Table of Contents

Paṭisambhidāmagga-aṭṭhakathā

Edit
832

2. Sīlamayañāṇaniddesavaṇṇanā

2. Commentary on the Exposition of Knowledge Born of Morality

2. Giải thích về Trí Tuệ Giới (Sīlamayañāṇaniddesavaṇṇanā)

833
37. Sīlamayañāṇaniddese pañcāti gaṇanaparicchedo.
37. In the exposition of knowledge born of morality (sīlamayañāṇa), five (pañca) is a numerical definition.
Trong phần giải thích về tuệ phát sinh từ giới (sīlamayañāṇa), năm là sự phân định về số lượng.
Sīlānīti paricchinnadhammanidassanaṃ.
Moralities (sīlāni) is an indication of the defined qualities.
Các giới là sự chỉ rõ các pháp đã được phân định.
Pariyantapārisuddhisīlantiādi pañcannaṃ sarūpato dassanaṃ.
Morality of purity with limits (pariyantapārisuddhisīla), etc., is a presentation of the intrinsic nature of the five.
Giới thanh tịnh có giới hạn v.v. là sự trình bày năm loại giới theo bản chất của chúng.
Pariyantapārisuddhītiādīsu yathā nīlavaṇṇayogato vatthampi nīlamassa atthīti nīlanti vuccati, evaṃ gaṇanavasena pariyanto paricchedo assā atthīti pariyantā, upasampannasīle patto anupasampannasīlassa avasānasabbhāvato vā pariyanto avasānaṃ assā atthīti pariyantā.
In "purity with limits" (pariyantapārisuddhi), etc., just as a cloth is called "blue" because it has a blue color, so too, this (purity) is "with limits" (pariyantā) because it has a limit or definition in terms of enumeration, or it is "with limits" because it has an end (avasāna) when the sīla of the unordained reaches the sīla of the ordained.
Trong các từ như "Pariyantapārisuddhi" (thanh tịnh có giới hạn), giống như một tấm vải được gọi là màu xanh vì nó có màu xanh, thì ở đây, do có sự phân định theo số lượng, nên nó có giới hạn (pariyantā), hoặc do giới của người đã thọ Cụ túc giới đạt đến sự kết thúc của giới của người chưa thọ Cụ túc giới, nên nó có giới hạn (pariyantā).
Sapariyantāti vā vattabbe sakāralopo katoti veditabbo ‘‘dakaṃ dakāsayā pavisantī’’ti (saṃ. ni. 3.78; a. ni. 4.33) ettha ukāralopo viya.
It should be understood that the letter 'sa' has been dropped, as in "dakaṃ dakāsayā pavisantī" where the letter 'u' is dropped, when it should be "sapariyantā."
Hoặc nên hiểu rằng chữ "sa" đã bị lược bỏ, đáng lẽ phải là "sapariyantā", giống như chữ "u" bị lược bỏ trong câu "dakaṃ dakāsayā pavisantī" (Tương Ưng Bộ 3.78; Tăng Chi Bộ 4.33).
Parisuddhabhāvo pārisuddhi, pariyantā ca sā pārisuddhi cāti pariyantapārisuddhi, pariyantapārisuddhisaṅkhātaṃ sīlaṃ pariyantapārisuddhisīlaṃ.
The state of being pure is purity (pārisuddhi). That which is limited and that which is purity is "pariyantapārisuddhi." The morality that is called "pariyantapārisuddhi" is "pariyantapārisuddhisīla."
Trạng thái thanh tịnh là pārisuddhi (thanh tịnh). Vừa có giới hạn (pariyantā) vừa thanh tịnh (pārisuddhi) là pariyantapārisuddhi (thanh tịnh có giới hạn). Giới được gọi là pariyantapārisuddhi (thanh tịnh có giới hạn) là pariyantapārisuddhisīla (giới thanh tịnh có giới hạn).
Vuttapaṭipakkhena na pariyantāti apariyantā, natthi etissā pariyantotipi apariyantā, vuddho etissā pariyantotipi apariyantā.
In contrast to what has been stated, it is unlimited (apariyantā) because it has no limit, or it is unlimited because its limit is not increased.
Ngược lại với điều đã nói, không có giới hạn (apariyantā) là không có giới hạn cho nó, hoặc không có giới hạn tăng trưởng cho nó.
Samādānato pabhuti akhaṇḍitattā khaṇḍitāpi katapaṭikammattā cittuppādamattakenāpi malena virahitattā ca parisuddhajātimaṇi viya sudhantasuparikammakatasuvaṇṇaṃ viya ca parisuddhattā ariyamaggassa padaṭṭhānabhūtā anūnaṭṭhena paripūṇṇā.
From the moment of undertaking, it is complete (paripūṇṇā) in the sense of being unblemished, due to being unbroken; even if broken, it is complete due to having been restored; and due to being free from defilement even by a mere thought, it is pure like a pure gem or like well-cleansed and well-wrought gold, thus forming the basis for the Noble Path.
Do không bị sứt mẻ kể từ khi thọ trì, dù có bị sứt mẻ nhưng đã được sửa chữa, và do không có một chút ô nhiễm nào dù chỉ là một ý niệm khởi lên, nên giới này hoàn hảo (paripuṇṇā) theo nghĩa không thiếu sót, giống như viên ngọc quý thanh tịnh và vàng đã được tinh luyện kỹ càng, là nền tảng cho con đường Thánh.
Diṭṭhiyā pahīnattā diṭṭhiparāmāsena aggahitattā aparāmaṭṭhā.Ayaṃ te sīle dosoti kenaci codakena parāmasituṃ asakkuṇeyyattā vā aparāmaṭṭhā.
It is unclung to (aparāmaṭṭhā) because it is abandoned by wrong view and not grasped by the clinging of wrong view. Or it is unclung to because no accuser can grasp it by saying, "This is a fault in your sīla."
Do tà kiến đã bị đoạn trừ, không bị chấp thủ bởi sự chấp thủ tà kiến, nên giới này không bị vướng mắc (aparāmaṭṭhā). Hoặc không bị vướng mắc vì không một ai có thể chỉ trích rằng “Giới này của ông có lỗi”.
Arahattaphalakkhaṇe sabbadarathapaṭippassaddhiyāpaṭippassaddhi.
It is appeasement (paṭippassaddhi) by the appeasement of all anguish at the moment of the fruit of Arahantship.
Do sự lắng dịu hoàn toàn mọi phiền não vào thời điểm chứng quả A-la-hán, nên giới này là sự lắng dịu (paṭippassaddhi).
Anupasampannānanti anavasesasamādānavasena sīlasampadāya bhusaṃ sampannāti upasampannā, na upasampannā anupasampannā.
Anupasampannānaṃ means those who are not upasampannā. Upasampannā are those who are exceedingly accomplished in virtue (sīla-sampadā) by undertaking it completely without remainder. Those who are not upasampannā are anupasampannā.
Anupasampannānaṃ (của những người chưa thọ Cụ túc giới) – Upasampannā (người đã thọ Cụ túc giới) là người đã hoàn toàn thành tựu giới hạnh một cách đầy đủ. Anupasampannā (người chưa thọ Cụ túc giới) là người không phải upasampannā.
Tesaṃ anupasampannānaṃ.
For those anupasampannā.
Của những người chưa thọ Cụ túc giới đó.
834
Pariyantasikkhāpadānanti ettha sikkhitabbaṭṭhena sikkhā, koṭṭhāsaṭṭhena padāni, sikkhitabbakoṭṭhāsānīti attho.
In the term Pariyantasikkhāpadānaṃ, sikkhā means that which should be trained in, and padāni means parts. The meaning is "parts to be trained in."
Trong Pariyantasikkhāpadānaṃ (của các học giới có giới hạn), "sikkhā" là sự học hỏi theo nghĩa cần phải học, "padāni" là các phần theo nghĩa các phần, tức là các phần cần phải học.
Apica sīle patiṭṭhitena uparipattabbattā sabbe kusalā dhammā sikkhā, sīlāni tāsaṃ sikkhānaṃ patiṭṭhaṭṭhena padānīti sikkhānaṃ padattā sikkhāpadāni, pariyantāni sikkhāpadāni etesanti pariyantasikkhāpadā.
Moreover, all wholesome states (kusalā dhammā) are sikkhā because they are to be attained by one established in virtue; and the virtues (sīlāni) are the bases (padāni) for these sikkhā. Thus, because they are the bases of sikkhā, they are sikkhāpadāni. Those for whom these sikkhāpadāni are limited are pariyantasikkhāpadā.
Hơn nữa, tất cả các pháp thiện đều là sikkhā (sự học hỏi) vì người đã an trú trong giới cần phải đạt được chúng ở cấp độ cao hơn. Các giới là padāni (nền tảng) của những sikkhā đó theo nghĩa là nền tảng của chúng. Do là nền tảng của các sikkhā nên chúng là sikkhāpadāni (học giới). Những học giới có giới hạn là pariyantasikkhāpadā (các học giới có giới hạn).
Tesaṃ pariyantasikkhāpadānaṃ.
For those pariyantasikkhāpadā.
Của những học giới có giới hạn đó.
Ettha ca dve pariyantā sikkhāpadapariyanto ca kālapariyanto ca.
Here, there are two limits: the limit of sikkhāpada and the limit of time.
Ở đây, có hai loại giới hạn: giới hạn về học giới (sikkhāpadapariyanta) và giới hạn về thời gian (kālapariyanta).
Katamo sikkhāpadapariyanto?
What is the limit of sikkhāpada?
Giới hạn về học giới là gì?
Upāsakopāsikānaṃ yathāsamādānavasena ekaṃ vā dve vā tīṇi vā cattāri vā pañca vā aṭṭha vā dasa vā sikkhāpadāni honti, sikkhamānasāmaṇerasāmaṇerīnaṃ dasa sikkhāpadāni.
For male and female lay followers (upāsaka-upāsikā), there are one, two, three, four, five, eight, or ten sikkhāpadāni, according to what they undertake. For trainees (sikkhamānā), novice monks (sāmaṇera), and novice nuns (sāmaṇerī), there are ten sikkhāpadāni.
Đối với cận sự nam và cận sự nữ, tùy theo sự thọ trì, có thể có một, hai, ba, bốn, năm, tám, hoặc mười học giới. Đối với các Sa-di tập sự (sikkhamāna), Sa-di và Sa-di-ni, có mười học giới.
Ayaṃ sikkhāpadapariyanto.
This is the limit of sikkhāpada.
Đây là giới hạn về học giới.
Katamo kālapariyanto?
What is the limit of time?
Giới hạn về thời gian là gì?
Upāsakopāsikā dānaṃ dadamānā parivesanapariyantaṃ sīlaṃ samādiyanti, vihāragatā vihārapariyantaṃ sīlaṃ samādiyanti, ekaṃ vā dve vā tayo vā bhiyyo vā rattindivāni paricchedaṃ katvā sīlaṃ samādiyanti.
Male and female lay followers, when giving alms, undertake virtue until the end of the distribution; when they go to a monastery, they undertake virtue until the end of their stay in the monastery. They undertake virtue by setting a limit of one, two, three, or more days and nights.
Cận sự nam và cận sự nữ, khi bố thí, thọ trì giới cho đến khi việc cúng dường kết thúc; khi đến chùa, thọ trì giới cho đến khi rời chùa; hoặc thọ trì giới bằng cách đặt ra giới hạn một, hai, ba hoặc nhiều ngày đêm.
Ayaṃ kālapariyanto.
This is the limit of time.
Đây là giới hạn về thời gian.
Imesu dvīsu pariyantesu sikkhāpadaṃ pariyantaṃ katvā samādinnaṃ sīlaṃ vītikkamanena vā maraṇena vā paṭippassambhati, kālaṃ pariyantaṃ katvā samādinnaṃ taṃtaṃkālātikkamena paṭippassambhati.
Among these two limits, virtue undertaken with sikkhāpada as the limit ceases by transgression or by death. Virtue undertaken with time as the limit ceases by the passing of that specific time.
Trong hai loại giới hạn này, giới được thọ trì với giới hạn về học giới sẽ chấm dứt khi bị vi phạm hoặc khi chết. Giới được thọ trì với giới hạn về thời gian sẽ chấm dứt khi thời gian đó trôi qua.
835
Apariyantasikkhāpadānanti –
Apariyantasikkhāpadānaṃ means –
Apariyantasikkhāpadānaṃ (của các học giới không có giới hạn) –
836
‘‘Nava koṭisahassāni, asīti satakoṭiyo;
“Nine thousand crores, eighty hundred crores;
“Chín ngàn vạn,
837
Paññāsa satasahassāni, chattiṃsa ca punāpare.
Fifty hundred thousand, and thirty-six more.
Một trăm tám mươi vạn,
838
‘‘Ete saṃvaravinayā, sambuddhena pakāsitā;
“These rules of restraint (saṃvara-vinaya) were proclaimed by the Perfectly Awakened One;
Năm mươi vạn,
839
Peyyālamukhena niddiṭṭhā, sikkhā vinayasaṃvare’’ti–
They were indicated by way of abbreviation (peyyāla) as sikkhā in the restraint of the Vinaya,” –
Và ba mươi sáu vạn khác nữa.
840
Evaṃ gaṇanavasena pariyantānampi sikkhāpadānaṃ anavasesasamādānabhāvavasena lābhayasañātiaṅgajīvitahetu adiṭṭhapariyantabhāvavasena upari rakkhitabbasīlaparicchedābhāvavasena ca natthi etesaṃ pariyantoti apariyantāni.
Thus, even for sikkhāpadāni that are limited by enumeration, they are apariyantā (unlimited) because of the complete undertaking without remainder, because of the state of having an unseen limit due to gain, fame, relatives, limbs, and life, and because of the absence of a defined limit for the virtue to be observed further.
Những giới luật phòng hộ này, được Đức Phật Toàn Giác thuyết giảng; các học giới đã được chỉ rõ trong giới luật phòng hộ theo cách tóm tắt (peyyāla). Mặc dù các học giới có giới hạn theo số lượng như vậy, nhưng chúng là không có giới hạn (apariyantāni) theo nghĩa là sự thọ trì không còn sót lại, không có giới hạn được nhìn thấy do lợi lộc, danh tiếng, thân quyến, các chi phần thân thể, và sinh mạng, và không có sự phân định giới cần phải giữ gìn ở cấp độ cao hơn. Những học giới không có giới hạn đó.
Apariyantāni sikkhāpadāni etesanti apariyantasikkhāpadā.
They are apariyantasikkhāpadā because for them there are unlimited sikkhāpadāni.
Những học giới không có giới hạn là apariyantasikkhāpadā.
Tesaṃ apariyantasikkhāpadānaṃ, vuddhapariyantasikkhāpadānanti vā attho.
The meaning is "for those with unlimited sikkhāpadāni" or "for those with developed sikkhāpadāni."
Của những học giới không có giới hạn đó, hoặc có nghĩa là của những học giới có giới hạn đã tăng trưởng.
841
Puthujjanakalyāṇakānantiādīsu –
In Puthujjanakalyāṇakānaṃ and so on –
Trong Puthujjanakalyāṇakānaṃ (của những phàm nhân thiện lành) v.v. –
842
‘‘Puthūnaṃ jananādīhi, kāraṇehi puthujjano;
“A puthujjana is one who generates various defilements, etc.;
“Phàm nhân là người tạo ra vô số (puthūnaṃ) phiền não v.v. do các nguyên nhân.
843
Puthujjanantogadhattā, puthuvāyaṃ jano iti’’–
Or this person is separate, being encompassed by puthujjana,” –
Do bao gồm trong phàm nhân, hoặc do chúng sinh này chỉ khác biệt với các bậc Thánh, nên được gọi là phàm nhân.”
844
Vuttaputhujjanalakkhaṇānatikkamepi –
Even without transgressing the definition of puthujjana as stated –
Dù không vượt qua đặc tính phàm nhân đã nói –
845
‘‘Duve puthujjanā vuttā, buddhenādiccabandhunā;
“Two types of puthujjana were stated by the Buddha, the Kinsman of the Sun;
“Đức Phật, Thân quyến của mặt trời, đã nói có hai loại phàm nhân:
846
Andho puthujjano eko, kalyāṇeko puthujjano’’ti–
One is the blind puthujjana, the other is the virtuous puthujjana,” –
Một là phàm nhân mù quáng, một là phàm nhân thiện lành.”
847
Vuttaputhujjanadvaye kalyāṇadhammasamāgamena andhaputhujjanabhāvaṃ atikkamma kalyāṇaputhujjanabhāve ṭhitānaṃ puthujjanakalyāṇakānaṃ kalyāṇaputhujjanānanti vuttaṃ hoti.
In the two types of puthujjana thus stated, by the association with wholesome qualities (kalyāṇadhamma), having transcended the state of a blind puthujjana and being established in the state of a virtuous puthujjana, it is said to be "for the virtuous puthujjanas (puthujjanakalyāṇakānaṃ)." Or, it means "for those who are virtuous among puthujjanas."
Trong hai loại phàm nhân đã nói, do sự hội tụ của các pháp thiện, vượt qua trạng thái phàm nhân mù quáng, những người an trú trong trạng thái phàm nhân thiện lành được gọi là puthujjanakalyāṇaka (phàm nhân thiện lành).
Puthujjanesu vā kalyāṇakānaṃ puthujjanakalyāṇakānaṃ.
Or, for those who are virtuous among puthujjanas, for puthujjanakalyāṇakānaṃ.
Hoặc là những người thiện lành trong số các phàm nhân, tức là puthujjanakalyāṇakānaṃ.
848
Kusaladhamme yuttānanti ettha kusalasaddo tāva ārogyānavajjachekasukhavipākesu dissati.
In Kusaladhamme yuttānaṃ, the word kusala is seen in the meanings of health, blamelessness, skill, and pleasant result.
Trong Kusaladhamme yuttānaṃ (của những người tinh cần trong các pháp thiện), từ kusala được thấy trong các nghĩa khỏe mạnh, không lỗi, khéo léo, và quả an lạc.
Ayañhi ‘‘kacci nu bhoto kusalaṃ, kacci bhoto anāmaya’’ntiādīsu (jā. 1.15.146; 2.20.129) ārogye dissati.
Indeed, it is seen in the meaning of health in phrases like “Are you well, sir? Are you free from illness, sir?”
Từ này được thấy trong nghĩa khỏe mạnh trong các câu như “Kacci nu bhoto kusalaṃ, kacci bhoto anāmaya” (Jātaka 1.15.146; 2.20.129).
‘‘Katamo pana, bhante, kāyasamācāro kusalo?
“Which bodily conduct, Venerable Sir, is wholesome (kusala)?”
“Bạch Thế Tôn, thế nào là thân hành thiện lành?
Yo kho, mahārāja, kāyasamācāro anavajjo’’ti (ma. ni. 2.361) ca ‘‘puna caparaṃ, bhante, etadānuttariyaṃ yathā bhagavā dhammaṃ deseti kusalesu dhammesū’’ti ca (dī. ni. 3.145) evamādīsu anavajje.
“That bodily conduct, great king, which is blameless,” and “Furthermore, Venerable Sir, this is the unsurpassed way in which the Blessed One teaches the Dhamma concerning wholesome states (kusala dhammā),” and so on, it is seen in the meaning of blamelessness.
Thưa Đại vương, thân hành nào không có lỗi” (Trung Bộ 2.361) và “Bạch Thế Tôn, hơn nữa, đây là sự vô thượng mà Đức Thế Tôn thuyết giảng pháp về các pháp thiện lành” (Trường Bộ 3.145) v.v., trong các trường hợp này, nó có nghĩa là không lỗi.
‘‘Kusalo tvaṃ rathassa aṅgapaccaṅgānaṃ (ma. ni. 2.87), kusalā naccagītassa sikkhitā cāturitthiyo’’tiādīsu (jā. 2.22.94) cheke.
In phrases like “You are skilled (kusala) in the parts of a chariot,” and “The four types of women trained in dancing and singing are skilled (kusalā),” it is seen in the meaning of skill.
Trong các câu như “Ngươi khéo léo trong các bộ phận của xe” (Trung Bộ 2.87), “Bốn người phụ nữ khéo léo đã được học múa hát” (Jātaka 2.22.94) v.v., nó có nghĩa là khéo léo.
‘‘Kusalānaṃ, bhikkhave, dhammānaṃ samādānahetu (dī. ni. 3.80).
“Because of undertaking wholesome (kusala) states, bhikkhus.”
“Do nguyên nhân thọ trì các pháp thiện lành, này các Tỳ-khưu” (Trường Bộ 3.80).
Kusalassa kammassa katattā upacitattā’’tiādīsu (dha. sa. 431) sukhavipāke.
“Because of having done and accumulated wholesome (kusala) kamma,” and so on, it is seen in the meaning of pleasant result.
“Do đã làm và tích lũy nghiệp thiện lành” (Pháp Tụ 431) v.v., trong các trường hợp này, nó có nghĩa là quả an lạc.
Svāyamidha ārogyepi anavajjepi sukhavipākepi vaṭṭati.
Here, this word kusala is applicable to health, blamelessness, and pleasant result.
Từ này ở đây có thể được áp dụng cho cả khỏe mạnh, không lỗi và quả an lạc.
849
Vacanattho panettha kucchite pāpake dhamme salayanti calayanti kampenti viddhaṃsentīti kusalā.
Here, the meaning of the word is: they shake, stir, agitate, and destroy vile, evil states, therefore they are kusalā.
Ý nghĩa của từ ở đây là: Chúng là kusala (thiện lành) vì chúng làm rung chuyển, lay động, làm cho các pháp ác xấu xa bị hủy diệt.
Kucchitena vā ākārena sayanti pavattantīti kusā, te kuse lunanti chindantīti kusalā.
Or, they exist, they proceed in a vile manner, therefore they are kusā; they cut, they sever these kusā, therefore they are kusalā.
Hoặc chúng là kusā vì chúng hoạt động theo cách xấu xa, và chúng là kusala vì chúng cắt đứt (lunanti) những kusā đó.
Kucchitānaṃ vā sānato tanukaraṇato kusaṃ ñāṇaṃ.
Or, knowledge is kusa because it thins out vile things.
Hoặc trí tuệ làm giảm thiểu các điều xấu xa được gọi là kusa.
Tena kusena lātabbā gahetabbā pavattetabbāti kusalā, yathā vā kusā ubhayabhāgagataṃ hatthappadesaṃ lunanti, evamimepi uppannānuppannabhāvena ubhayabhāgagataṃ saṃkilesapakkhaṃ lunanti, tasmā kusā viya lunantīti kusalā.
They are to be attained, to be grasped, to be brought about by that kusa (knowledge), therefore they are kusalā. Or, just as kusa grass cuts the part of the hand that is on both sides, so too do these (wholesome states) cut the side of defilements that exists in both arisen and unarisen states. Therefore, because they cut like kusa, they are kusalā.
Chúng là kusala vì chúng được đạt đến (lātabbā), được nắm giữ (gahetabbā), được thực hành (pavattetabbā) bằng kusa đó. Hoặc giống như cỏ kusa cắt đứt phần tay ở hai bên, thì các pháp này cũng cắt đứt phe phiền não ở hai bên, dù đã sinh hay chưa sinh. Do đó, chúng là kusala vì chúng cắt đứt như cỏ kusa.
Apica ārogyaṭṭhena anavajjaṭṭhena kosallasambhūtaṭṭhena vā kusalā.
Furthermore, they are kusalā in the sense of being healthy, blameless, or originating from skillfulness.
Hơn nữa, chúng là kusala theo nghĩa khỏe mạnh, không lỗi, hoặc phát sinh từ sự khéo léo.
Idha pana yasmā vipassanākusalameva adhippetaṃ, tasmā sese vihāya tasseva dassanatthaṃ ‘‘kusaladhamme’’ti ekavacanaṃ katanti veditabbaṃ.
Here, however, since only vipassanā-kusala is intended, it should be understood that the singular form "kusaladhamme" is used to indicate it, having discarded the others.
Tuy nhiên, ở đây, vì chỉ nhắm đến tuệ quán (vipassanākusala), nên cần hiểu rằng từ "kusaladhamme" được dùng ở số ít để chỉ riêng tuệ quán, bỏ qua các điều khác.
Vipassanākusaladhamme sātaccakiriyatāya sakkaccakāritāya ca yuttānanti attho.
The meaning is: those who are diligent and respectful in the practice of vipassanā-kusala states.
Có nghĩa là những người tinh cần trong pháp tuệ quán do thực hành liên tục và thực hành một cách cẩn trọng.
850
Sekkhapariyante paripūrakārīnanti ettha tīsu sikkhāsu jātātipi sekkhā, sattannaṃ sekkhānaṃ etetipi sekkhā, sayameva sikkhantītipi sekkhā.
In sekkhapariyante paripūrakārīnaṃ, they are sekkhā (learners) because they have arisen in the three trainings; or these are the possessions of the seven sekkhā; or they train themselves, therefore they are sekkhā.
Ở đây, trong cụm từ Sekkhapariyante paripūrakārīnaṃ, (họ) cũng được gọi là sekkhā (hữu học) vì sinh khởi trong ba học pháp; cũng được gọi là sekkhā vì đây là (tài sản) của bảy bậc hữu học; cũng được gọi là sekkhā vì chính họ đang tu học.
Sotāpattimaggaphalasakadāgāmimaggaphalaanāgāmimaggaphalaarahattamaggadhammā.
These are the states of Stream-entry path and fruition, Once-return path and fruition, Non-return path and fruition, and Arahantship path.
Các pháp là đạo và quả Tu-đà-hoàn, đạo và quả Tư-đà-hàm, đạo và quả A-na-hàm, và đạo A-la-hán.
Te sekkhā dhammā pariyante avasāne etassa, te vā sekkhā dhammā pariyanto paricchedo etassāti sekkhapariyanto.
These sekkhā states are at the end of this (practice), or these sekkhā states are the boundary of this (practice), hence sekkhapariyanta.
Các pháp hữu học ấy là điểm kết thúc, là chung cuộc của vị ấy, hoặc các pháp hữu học ấy là giới hạn, là sự phân định của vị ấy, nên gọi là sekkhapariyanto (giới hạn của hữu học).
Tasmiṃ sekkhapariyante dhammeti sambandho.
The connection is dhamme (states) in that sekkhapariyanta.
Sự liên kết là "trong pháp ở giới hạn hữu học ấy".
Paripūraṃ paripuṇṇataṃ karontīti paripūrakārino, paripūrakāro paripūrakiriyā etesaṃ atthīti vā paripūrakārino.
They bring about completeness, fullness, therefore they are paripūrakārino; or they have the act of completing, the action of completing, therefore they are paripūrakārino.
Họ làm cho viên mãn, làm cho trọn vẹn nên là những người làm cho viên mãn (paripūrakārino), hoặc họ có sự làm cho viên mãn, có hành động làm cho viên mãn nên là những người làm cho viên mãn.
Tesaṃ sotāpattimaggassa pubbabhāgabhūte sekkhapariyante paṭipadādhamme vipassanāpāripūriyā paripūrakārīnaṃ.
For those who complete the path-states of practice, which are the preceding part of the Stream-entry path and are at the boundary of the sekkhā, through the perfection of vipassanā.
Đối với những vị làm cho viên mãn bằng sự viên mãn của tuệ quán trong pháp hành, vốn là phần đầu của đạo Tu-đà-hoàn, ở giới hạn của hữu học.
Kāye ca jīvite ca anapekkhānanti ettha kāyeti sarīre.
In kāye ca jīvite ca anapekkhānaṃ, kāye means in the body.
Ở đây, trong cụm từ Kāye ca jīvite ca anapekkhānaṃ, kāye có nghĩa là trong thân thể.
Sarīrañhi asucisañcayato kucchitānañca kesādīnaṃ cakkhurogādīnañca rogasatānaṃ āyabhūtattā kāyoti vuccati.
The body is called kāya because it is a heap of impurities and the source of vile things like hair, etc., and hundreds of diseases like eye diseases, etc.
Thật vậy, thân thể được gọi là kāya vì là nơi tích tụ những thứ bất tịnh và là nơi phát sinh của hàng trăm bệnh tật như tóc tai đáng ghê tởm, bệnh về mắt, v.v.
Jīviteti jīvitindriye.
Jīvite means in the life faculty.
Jīvite có nghĩa là trong mạng quyền.
Tañhi jīvanti tenāti jīvitanti vuccati.
It is called jīvita (life) because one lives by it.
Thật vậy, nó được gọi là jīvita (sự sống) vì chúng sinh sống nhờ vào nó.
Natthi etesaṃ apekkhāti anapekkhā, nissinehāti attho.
They have no longing, therefore they are anapekkhā; the meaning is, they are without affection.
Họ không có sự luyến tiếc nên gọi là những người không luyến tiếc (anapekkhā), nghĩa là không còn quyến luyến.
Tesaṃ tasmiṃ kāye ca jīvite ca anapekkhānaṃ.
For those who are without longing for that body and life.
Đối với những vị không luyến tiếc thân và mạng ấy.
851
Idāni tesaṃ tesu anapekkhattassa kāraṇaṃ dassento pariccattajīvitānanti āha.
Now, showing the reason for their being without longing for these, he says pariccattajīvitānaṃ (those who have given up life).
Bây giờ, để chỉ ra nguyên nhân của việc họ không luyến tiếc những thứ ấy, ngài nói pariccattajīvitānaṃ (những người đã từ bỏ mạng sống).
Bhagavato ācariyassa vā sakajīvitapariccāgeneva hi te kilamamānepi kāye vinassamānepi jīvite anapekkhā hontīti.
For it is by the giving up of their own life for the Buddha or their teacher that they become unconcerned about their body even when it is afflicted, and about their life even when it is perishing.
Bởi vì, chính nhờ sự từ bỏ mạng sống của mình vì Đức Thế Tôn hoặc vì bậc đạo sư mà họ không còn luyến tiếc ngay cả khi thân thể mỏi mệt và mạng sống đang bị hủy hoại.
Sattannaṃ sekkhānanti sikkhantīti sekkhāti laddhanāmānaṃ sotāpattimaggaṭṭhādīnaṃ sattannaṃ ariyapuggalānaṃ.
Sattannaṃ sekkhānaṃ means for the seven noble individuals, such as those established in the Stream-entry path, who are called sekkhā because they are still training.
Sattannaṃ sekkhānaṃ (của bảy bậc hữu học) có nghĩa là của bảy bậc Thánh nhân, từ bậc Dự lưu đạo trở đi, những vị được gọi là sekkhā (hữu học) vì đang tu học.
Tathāgatasāvakānanti tathāgatassa sāvakānaṃ.
Tathāgatasāvakānaṃ means for the disciples of the Tathāgata.
Tathāgatasāvakānaṃ (của các vị Thinh văn của Như Lai) có nghĩa là của các vị Thinh văn của Như Lai.
Aṭṭhapi hi ariyapuggalā savanante ariyāya jātiyā jātattā bhagavato desanaṃ anusiṭṭhiṃ aveccappasādayogena sakkaccaṃ suṇantīti sāvakā.
Indeed, all eight noble individuals are sāvakā (disciples) because they are born of the noble birth at the end of hearing, and they listen respectfully to the Buddha's teaching and instruction with unwavering faith.
Thật vậy, cả tám bậc Thánh nhân đều là Thinh văn (sāvakā) vì sau khi nghe (pháp), họ được sinh ra bằng dòng dõi Thánh, và họ lắng nghe giáo pháp, lời huấn thị của Đức Thế Tôn một cách cung kính, với niềm tin bất động.
Tesupi arahattaphalaṭṭheyeva visesetvā dassento khīṇāsavānanti āha, arahattamaggañāṇena parikkhīṇasabbāsavānanti attho.
Among them, he specifically indicates those established in the fruition of Arahantship by saying khīṇāsavānaṃ, meaning those whose defilements are completely destroyed by the knowledge of the Arahant path.
Trong số đó, để chỉ riêng bậc A-la-hán quả, ngài nói khīṇāsavānaṃ (của các bậc Lậu tận), nghĩa là những vị đã đoạn trừ hoàn toàn mọi lậu hoặc bằng trí tuệ A-la-hán đạo.
Paccekabuddhānanti taṃ taṃ kāraṇaṃ paṭicca ekova anācariyako catusaccaṃ bujjhitavāti paccekabuddho.
Paccekabuddhānaṃ means for the Paccekabuddhas, who, depending on various causes, realize the Four Noble Truths alone, without a teacher.
Paccekabuddhānaṃ (của các vị Độc Giác Phật): Vị nào do duyên với một nhân duyên nào đó, một mình, không thầy chỉ dạy, tự mình giác ngộ Tứ đế, vị ấy là Độc Giác Phật (paccekabuddho).
Tādisānaṃ paccekabuddhānaṃ.
For such Paccekabuddhas.
Của các vị Độc Giác Phật như vậy.
852
Tathāgatānanti ettha aṭṭhahi kāraṇehi bhagavā tathāgato – tathā āgatoti tathāgato, tathā gatoti tathāgato, tathalakkhaṇaṃ āgatoti tathāgato, tathadhamme yāthāvato abhisambuddhoti tathāgato, tathadassitāya tathāgato, tathavāditāya tathāgato, tathā kāritāya tathāgato, abhibhavanaṭṭhena tathāgato.
In Tathāgatānaṃ, the Blessed One is Tathāgata for eight reasons: He has come in such a way, therefore Tathāgata; He has gone in such a way, therefore Tathāgata; He has attained the true characteristics, therefore Tathāgata; He has fully awakened to the true nature of phenomena, therefore Tathāgata; He is Tathāgata by seeing truly; He is Tathāgata by speaking truly; He is Tathāgata by acting truly; He is Tathāgata in the sense of overcoming.
Tathāgatānaṃ (của các bậc Như Lai): Ở đây, Đức Thế Tôn là Như Lai (Tathāgato) vì tám lý do: Ngài đến như vậy (tathā āgato), Ngài đi như vậy (tathā gato), Ngài đến với tướng chân thật (tathalakkhaṇaṃ āgato), Ngài đã giác ngộ các pháp chân thật đúng như thật (tathadhamme yāthāvato abhisambuddho), Ngài thấy đúng như thật (tathadassitāya), Ngài nói đúng như thật (tathavāditāya), Ngài làm đúng như thật (tathā kāritāya), và Ngài chinh phục (abhibhavanaṭṭhena).
853
Kathaṃ bhagavā tathā āgatoti tathāgato?
How is the Blessed One Tathāgata by having come in such a way?
Thế nào là Đức Thế Tôn đến như vậy nên là Như Lai?
Yathā sabbalokahitāya ussukkamāpannā purimakā sammāsambuddhā āgatā.
Just as the former Sammāsambuddhas came, striving for the welfare of all beings.
Như cách các bậc Chánh Đẳng Giác trong quá khứ đã đến, những vị đã nỗ lực vì lợi ích của toàn thể thế gian.
Kiṃ vuttaṃ hoti?
What is meant by this?
Điều này có nghĩa là gì?
Yenābhinīhārena purimakā bhagavanto āgatā, teneva amhākampi bhagavā āgato.
Our Blessed One also came with the same aspiration by which the former Blessed Ones came.
Các Đức Thế Tôn trong quá khứ đã đến với tâm nguyện nào, Đức Thế Tôn của chúng ta cũng đến với tâm nguyện ấy.
Atha vā yathā purimakā bhagavanto dānasīlanekkhammapaññāvīriyakhantisaccādhiṭṭhānamettupekkhāsaṅkhātā dasa pāramiyo, dasa upapāramiyo, dasa paramatthapāramiyoti samatiṃsa pāramiyo pūretvā aṅgapariccāgaṃ nayanadhanarajjaputtadārapariccāganti ime pañca mahāpariccāge pariccajitvā, pubbayogapubbacariyadhammakkhānañātatthacariyādayo pūretvā buddhicariyāya koṭiṃ patvā āgatā, tathā amhākampi bhagavā āgato.
Or, just as the former Blessed Ones, having fulfilled the thirty Pāramīs, namely, the ten Pāramīs, ten Upapāramīs, and ten Paramatthapāramīs, consisting of generosity, morality, renunciation, wisdom, energy, patience, truthfulness, determination, loving-kindness, and equanimity; having made these five great sacrifices: the sacrifice of limbs, eyes, wealth, kingdom, children, and wife; having fulfilled the former practices, former observances, teaching of the Dhamma, and acting for the welfare of relatives, etc., attained the pinnacle of the Bodhisattva's conduct and came; so too has our Blessed One come.
Hoặc là, như cách các Đức Thế Tôn trong quá khứ đã đến, sau khi hoàn thiện ba mươi ba-la-mật, gồm mười ba-la-mật là bố thí, trì giới, xuất gia, trí tuệ, tinh tấn, kham nhẫn, chân thật, quyết định, tâm từ, tâm xả; mười thượng ba-la-mật; và mười thắng nghĩa ba-la-mật; sau khi thực hiện năm đại thí xả là thí xả thân thể, thí xả mắt, tài sản, vương quốc, con cái và vợ; sau khi hoàn thiện các hạnh nguyện như nỗ lực trong quá khứ, hạnh nguyện trong quá khứ, thuyết pháp, hành vì lợi ích quyến thuộc, v.v., và đạt đến đỉnh cao của hạnh trí tuệ; Đức Thế Tôn của chúng ta cũng đã đến như vậy.
Yathā ca purimakā bhagavanto cattāro satipaṭṭhāne cattāro sammappadhāne cattāro iddhipāde pañcindriyāni pañca balāni satta bojjhaṅge ariyaṃ aṭṭhaṅgikaṃ maggaṃ bhāvetvā brūhetvā āgatā, tathā amhākampi bhagavā āgatoti tathāgato.
And just as the former Blessed Ones, having developed and cultivated the four foundations of mindfulness, the four right efforts, the four bases of psychic power, the five faculties, the five powers, the seven factors of enlightenment, and the Noble Eightfold Path, came; so too has our Blessed One come. Thus, he is a Tathāgata.
Và như cách các Đức Thế Tôn trong quá khứ đã đến, sau khi tu tập và phát triển bốn niệm xứ, bốn chánh cần, bốn như ý túc, năm căn, năm lực, bảy giác chi, và Thánh đạo tám ngành, Đức Thế Tôn của chúng ta cũng đã đến như vậy, nên gọi là Như Lai.
854
‘‘Yatheva dīpaṅkarabuddhaādayo, sabbaññubhāvaṃ munayo idhāgatā;
“Just as the sages, beginning with Dīpaṅkara Buddha, attained omniscience and came here;
"Như các bậc Phật Nhiên Đăng v.v., các bậc Mâu-ni đã đến đây đạt toàn giác quả;
855
Tathā ayaṃ sakyamunīpi āgato, tathāgato vuccati tena cakkhumā’’ti.
So too has this Sakyamuni come, therefore the Seer is called Tathāgata.”
Bậc Thích Ca Mâu-ni này cũng đến như vậy, vì thế bậc Mắt Tuệ được gọi là Như Lai."
856
Kathaṃ tathā gatoti tathāgato? Yathā sampatijātā purimakā bhagavanto gatā.
How is he Tathāgata because he has thus gone? Just as the former Blessed Ones, immediately upon birth, went.
Thế nào là đi như vậy nên là Như Lai? Như cách các Đức Thế Tôn trong quá khứ đã đi khi vừa mới đản sinh.
Kathañca te gatā?
And how did they go?
Và các Ngài đã đi như thế nào?
Te hi sampatijātā samehi pādehi pathaviyaṃ patiṭṭhāya uttarenamukhā sattapadavītihārena gatā.
Indeed, immediately upon birth, they stood on the earth with even feet, faced north, and went seven steps.
Khi vừa mới đản sinh, các Ngài đứng trên mặt đất bằng đôi chân vững chãi, hướng mặt về phía Bắc và đi bảy bước.
Yathāha ‘‘sampatijāto, ānanda, bodhisatto samehi pādehi pathaviyaṃ patiṭṭhahitvā uttarābhimukho sattapadavītihārena gacchati setamhi chatte anudhārayamāne, sabbā ca disā anuviloketi, āsabhiñca vācaṃ bhāsati ‘aggohamasmi lokassa, jeṭṭhohamasmi lokassa, seṭṭhohamasmi lokassa, ayamantimā jāti, natthi dāni punabbhavo’’’ti (ma. ni. 3.207; dī. ni. 2.31).
As it is said: “Immediately upon birth, Ānanda, the Bodhisatta stands on the earth with even feet, goes seven steps facing north, with a white parasol held over him, surveys all directions, and utters the noble speech: ‘I am chief in the world, I am eldest in the world, I am foremost in the world; this is my last birth, there is no more rebirth.’”
Như có lời dạy: "Này Ānanda, khi vừa mới đản sinh, vị Bồ-tát đứng trên mặt đất bằng đôi chân vững chãi, hướng mặt về phía Bắc và đi bảy bước, trong khi một chiếc lọng trắng được che trên đầu, Ngài nhìn khắp các phương, và thốt lên lời nói oai hùng: 'Ta là bậc tối thượng trong đời, Ta là bậc tối tôn trong đời, Ta là bậc cao cả nhất trong đời, đây là kiếp cuối cùng, không còn tái sinh nữa'."
Tañcassa gamanaṃ tathaṃ ahosi avitathaṃ anekesaṃ visesādhigamānaṃ pubbanimittabhāvena.
And that going of his was true and unfailing, being a premonition of many special attainments.
Và việc đi ấy của Ngài là chân thật, không sai khác, vì là điềm báo trước cho việc chứng đắc nhiều pháp đặc biệt.
Yañhi so sampatijāto samehi pādehi patiṭṭhahi, idamassa caturiddhipādapaṭilābhassa pubbanimittaṃ, uttaramukhabhāvo panassa sabbalokuttarabhāvassa pubbanimittaṃ, sattapadavītihāro sattabojjhaṅgaratanapaṭilābhassa pubbanimittaṃ, ‘‘suvaṇṇadaṇḍā vītipatanti cāmarā’’ti (su. ni. 693) ettha vuttacāmarukkhepo pana sabbatitthiyanimmathanassa pubbanimittaṃ, setacchattadhāraṇaṃ arahattaphalavimuttivaravimalasetacchattapaṭilābhassa pubbanimittaṃ, sabbādisānuvilokanaṃ sabbaññutānāvaraṇañāṇapaṭilābhassa pubbanimittaṃ, āsabhivācābhāsanaṃ pana appaṭivattiyavaradhammacakkappavattanassa pubbanimittaṃ.
For that he, immediately upon birth, stood with even feet, this was a premonition of his attainment of the four bases of psychic power; his facing north was a premonition of his being supreme in all worlds; his going seven steps was a premonition of his attainment of the seven jewels of enlightenment factors; the waving of the yak-tail whisks mentioned in “golden-handled yak-tail whisks wave” was a premonition of his crushing all other doctrines; the holding of the white parasol was a premonition of his attainment of the noble, stainless, white parasol of Arahattaphala-vimutti; his surveying all directions was a premonition of his attainment of the unobstructed knowledge of omniscience; and his uttering the noble speech was a premonition of his setting in motion the irreversible, supreme Wheel of Dhamma.
Việc Ngài vừa mới đản sinh đã đứng vững bằng đôi chân là điềm báo trước cho việc chứng đắc bốn như ý túc; việc hướng mặt về phía Bắc là điềm báo trước cho việc trở thành bậc siêu việt thế gian; việc đi bảy bước là điềm báo trước cho việc chứng đắc bảy báu giác chi; việc phất quạt hầu như được nói trong câu "những chiếc phất trần cán vàng được phất qua lại" là điềm báo trước cho việc chinh phục tất cả các tà thuyết ngoại đạo; việc được che lọng trắng là điềm báo trước cho việc chứng đắc chiếc lọng trắng thanh tịnh, cao quý của sự giải thoát A-la-hán quả; việc nhìn khắp các phương là điềm báo trước cho việc chứng đắc trí tuệ vô ngại của bậc Toàn giác; và việc thốt lên lời nói oai hùng là điềm báo trước cho việc chuyển bánh xe pháp cao thượng, không thể đảo ngược.
Tathāyaṃ bhagavāpi gato.
Thus, this Blessed One also went.
Đức Thế Tôn này cũng đã đi như vậy.
Tañcassa gamanaṃ tathaṃ ahosi avitathaṃ tesaṃyeva visesādhigamānaṃ pubbanimittabhāvena.
And that going of his was true and unfailing, being a premonition of those very special attainments.
Và việc đi ấy của Ngài là chân thật, không sai khác, vì là điềm báo trước cho việc chứng đắc chính những pháp đặc biệt ấy.
Tenāhu porāṇā –
Therefore, the ancients said:
Do đó, các bậc cổ nhân đã nói:
857
‘‘Muhuttajātova gavaṃpatī yathā, samehi pādehi phusī vasundharaṃ;
“Just as the lord of cattle, immediately upon birth, touched the earth with even feet;
"Vừa mới sinh ra, như con bò đầu đàn, Ngài đã chạm đất bằng đôi chân vững chãi;
858
So vikkamī satta padāni gotamo, setañca chattaṃ anudhārayuṃ marū.
So Gotama took seven steps, and the deities held a white parasol over him.
Vị Gotama ấy đã bước đi bảy bước, và chư thiên che một chiếc lọng trắng.
859
‘‘Gantvāna so satta padāni gotamo, disā vilokesi samā samantato;
Having gone seven steps, Gotama surveyed the directions all around equally;
"Sau khi đi bảy bước, vị Gotama ấy đã nhìn khắp các phương một cách đồng đều;
860
Aṭṭhaṅgupetaṃ giramabbhudīrayi, sīho yathā pabbatamuddhaniṭṭhito’’ti.
He uttered a speech endowed with eight qualities, like a lion standing on a mountain peak.”
Ngài thốt lên lời nói gồm tám thành phần, như sư tử đứng trên đỉnh núi."
861
Evaṃ tathā gatoti tathāgato.
Thus, he is Tathāgata because he has thus gone.
Như vậy, Ngài đi như vậy nên là Như Lai.
862
Atha vā yathā purimakā bhagavanto, ayampi bhagavā tatheva nekkhammena kāmacchandaṃ…pe… paṭhamajjhānena nīvaraṇe…pe… aniccānupassanāya niccasaññaṃ…pe… arahattamaggena sabbakilese pahāya gato.
Or, just as the former Blessed Ones, so too this Blessed One, having abandoned sensual desire through renunciation… and the hindrances through the first jhāna… and the perception of permanence through the contemplation of impermanence… and all defilements through the Arahantship Path, has gone.
Hoặc là, như các Đức Thế Tôn trong quá khứ, Đức Thế Tôn này cũng đã đi như vậy, sau khi từ bỏ dục tham bằng sự xuất gia... cho đến... từ bỏ các triền cái bằng thiền thứ nhất... cho đến... từ bỏ thường tưởng bằng quán vô thường... cho đến... từ bỏ tất cả phiền não bằng đạo A-la-hán.
Evampi tathā gatoti tathāgato.
Thus too, he is Tathāgata because he has thus gone.
Cũng như vậy, Ngài đi như vậy nên là Như Lai.
863
Kathaṃ tathalakkhaṇaṃ āgatoti tathāgato? Pathavīdhātuyā kakkhaḷattalakkhaṇaṃ tathaṃ avitathaṃ, āpodhātuyā paggharaṇalakkhaṇaṃ, tejodhātuyā uṇhattalakkhaṇaṃ, vāyodhātuyā vitthambhanalakkhaṇaṃ, ākāsadhātuyā asamphuṭṭhalakkhaṇaṃ, viññāṇadhātuyā vijānanalakkhaṇaṃ.
How is he Tathāgata because he has attained the true characteristic? The characteristic of hardness of the earth element is true and unfailing; the characteristic of flowing of the water element; the characteristic of heat of the fire element; the characteristic of distension of the air element; the characteristic of unimpingement of the space element; the characteristic of cognizing of the consciousness element.
Thế nào là Tathāgata vì đã đến với đặc tính như thật? Đối với địa đại, đặc tính cứng chắc là như thật, không sai khác; đối với thủy đại là đặc tính tuôn chảy; đối với hỏa đại là đặc tính nóng; đối với phong đại là đặc tính chống đỡ; đối với không đại là đặc tính không tiếp xúc; đối với thức đại là đặc tính nhận biết.
864
Rūpassa ruppanalakkhaṇaṃ, vedanāya vedayitalakkhaṇaṃ, saññāya sañjānanalakkhaṇaṃ, saṅkhārānaṃ abhisaṅkharaṇalakkhaṇaṃ, viññāṇassa vijānanalakkhaṇaṃ.
The characteristic of rūpa is being afflicted; of vedanā is feeling; of saññā is perceiving; of saṅkhāras is volitionally forming; of viññāṇa is cognizing.
Đối với sắc là đặc tính biến hoại; đối với thọ là đặc tính cảm nhận; đối với tưởng là đặc tính ghi nhận; đối với các hành là đặc tính tạo tác; đối với thức là đặc tính nhận biết.
865
Vitakkassa abhiniropanalakkhaṇaṃ, vicārassa anumajjanalakkhaṇaṃ, pītiyā pharaṇalakkhaṇaṃ, sukhassa sātalakkhaṇaṃ, cittekaggatāya avikkhepalakkhaṇaṃ, phassassa phusanalakkhaṇaṃ.
The characteristic of vitakka is directing towards the object; of vicāra is sustained application to the object; of pīti is pervading; of sukha is pleasantness; of citta-ekaggatā is non-distraction; of phassa is contact.
Đối với tầm là đặc tính hướng đến; đối với tứ là đặc tính thẩm sát; đối với hỷ là đặc tính lan tỏa; đối với lạc là đặc tính dễ chịu; đối với nhất tâm là đặc tính không phân tán; đối với xúc là đặc tính tiếp xúc.
866
Saddhindriyassa adhimokkhalakkhaṇaṃ, vīriyindriyassa paggahalakkhaṇaṃ, satindriyassa upaṭṭhānalakkhaṇaṃ, samādhindriyassa avikkhepalakkhaṇaṃ, paññindriyassa pajānanalakkhaṇaṃ.
The characteristic of the faculty of faith (saddhindriya) is conviction; of the faculty of energy (vīriyindriya) is exertion; of the faculty of mindfulness (satindriya) is presence; of the faculty of concentration (samādhindriya) is non-distraction; of the faculty of wisdom (paññindriya) is discerning.
Đối với tín quyền là đặc tính quyết đoán; đối với tấn quyền là đặc tính nâng đỡ; đối với niệm quyền là đặc tính hiện khởi; đối với định quyền là đặc tính không phân tán; đối với tuệ quyền là đặc tính biết rõ.
867
Saddhābalassa assaddhiye akampiyalakkhaṇaṃ, vīriyabalassa kosajje, satibalassa muṭṭhassacce, samādhibalassa uddhacce, paññābalassa avijjāya akampiyalakkhaṇaṃ.
The characteristic of the power of faith (saddhābala) is unshakeability by lack of faith; of the power of energy (vīriyabala) is unshakeability by laziness; of the power of mindfulness (satibala) is unshakeability by heedlessness; of the power of concentration (samādhibala) is unshakeability by restlessness; of the power of wisdom (paññābala) is unshakeability by ignorance.
Đối với tín lực là đặc tính không lay chuyển bởi sự thiếu niềm tin; đối với tấn lực là bởi sự lười biếng; đối với niệm lực là bởi sự thất niệm; đối với định lực là bởi sự trạo cử; đối với tuệ lực là đặc tính không lay chuyển bởi vô minh.
868
Satisambojjhaṅgassa upaṭṭhānalakkhaṇaṃ, dhammavicayasambojjhaṅgassa pavicayalakkhaṇaṃ, vīriyasambojjhaṅgassa paggahalakkhaṇaṃ, pītisambojjhaṅgassa pharaṇalakkhaṇaṃ, passaddhisambojjhaṅgassa upasamalakkhaṇaṃ, samādhisambojjhaṅgassa avikkhepalakkhaṇaṃ, upekkhāsambojjhaṅgassa paṭisaṅkhānalakkhaṇaṃ.
The characteristic of the enlightenment factor of mindfulness (satisambojjhaṅga) is presence; of the enlightenment factor of investigation of phenomena (dhammavicayasambojjhaṅga) is investigation; of the enlightenment factor of energy (vīriyasambojjhaṅga) is exertion; of the enlightenment factor of rapture (pītisambojjhaṅga) is pervading; of the enlightenment factor of tranquility (passaddhisambojjhaṅga) is calming; of the enlightenment factor of concentration (samādhisambojjhaṅga) is non-distraction; of the enlightenment factor of equanimity (upekkhāsambojjhaṅga) is contemplation.
Đối với niệm giác chi là đặc tính hiện khởi; đối với trạch pháp giác chi là đặc tính thẩm sát; đối với tấn giác chi là đặc tính nâng đỡ; đối với hỷ giác chi là đặc tính lan tỏa; đối với khinh an giác chi là đặc tính an tịnh; đối với định giác chi là đặc tính không phân tán; đối với xả giác chi là đặc tính quán xét.
869
Sammādiṭṭhiyā dassanalakkhaṇaṃ, sammāsaṅkappassa abhiniropanalakkhaṇaṃ, sammāvācāya pariggahalakkhaṇaṃ, sammākammantassa samuṭṭhānalakkhaṇaṃ, sammāājīvassa vodānalakkhaṇaṃ, sammāvāyāmassa paggahalakkhaṇaṃ, sammāsatiyā upaṭṭhānalakkhaṇaṃ, sammāsamādhissa avikkhepalakkhaṇaṃ.
The characteristic of right view (sammādiṭṭhi) is seeing; of right intention (sammāsaṅkappa) is directing towards the object; of right speech (sammāvācā) is restraint; of right action (sammākammanta) is arising; of right livelihood (sammāājīva) is purification; of right effort (sammāvāyāma) is exertion; of right mindfulness (sammāsati) is presence; of right concentration (sammāsamādhi) is non-distraction.
Đối với chánh kiến là đặc tính thấy; đối với chánh tư duy là đặc tính hướng đến; đối với chánh ngữ là đặc tính thu nhiếp; đối với chánh nghiệp là đặc tính khởi lên; đối với chánh mạng là đặc tính trong sạch; đối với chánh tinh tấn là đặc tính nâng đỡ; đối với chánh niệm là đặc tính hiện khởi; đối với chánh định là đặc tính không phân tán.
870
Avijjāya aññāṇalakkhaṇaṃ, saṅkhārānaṃ cetanālakkhaṇaṃ, viññāṇassa vijānanalakkhaṇaṃ, nāmassa namanalakkhaṇaṃ, rūpassa ruppanalakkhaṇaṃ, saḷāyatanassa āyatanalakkhaṇaṃ, phassassa phusanalakkhaṇaṃ, vedanāya vedayitalakkhaṇaṃ, taṇhāya hetulakkhaṇaṃ, upādānassa gahaṇalakkhaṇaṃ, bhavassa āyūhanalakkhaṇaṃ, jātiyā nibbattilakkhaṇaṃ, jarāya jīraṇalakkhaṇaṃ, maraṇassa cutilakkhaṇaṃ.
The characteristic of avijjā is unknowing; of saṅkhāras is volitional formation; of viññāṇa is cognizing; of nāma is bending; of rūpa is being afflicted; of saḷāyatana is basis; of phassa is contact; of vedanā is feeling; of taṇhā is cause; of upādāna is clinging; of bhava is striving; of jāti is birth; of jarā is aging; of maraṇa is passing away.
Đối với vô minh là đặc tính không biết; đối với các hành là đặc tính có chủ ý; đối với thức là đặc tính nhận biết; đối với danh là đặc tính hướng đến; đối với sắc là đặc tính biến hoại; đối với sáu xứ là đặc tính của xứ; đối với xúc là đặc tính tiếp xúc; đối với thọ là đặc tính cảm nhận; đối với ái là đặc tính của nhân; đối với thủ là đặc tính nắm giữ; đối với hữu là đặc tính nỗ lực; đối với sanh là đặc tính sinh khởi; đối với già là đặc tính chín muồi; đối với chết là đặc tính diệt đi.
871
Dhātūnaṃ suññatālakkhaṇaṃ, āyatanānaṃ āyatanalakkhaṇaṃ, satipaṭṭhānānaṃ upaṭṭhānalakkhaṇaṃ, sammappadhānānaṃ padahanalakkhaṇaṃ, iddhipādānaṃ ijjhanalakkhaṇaṃ, indriyānaṃ adhipatilakkhaṇaṃ, balānaṃ akampiyalakkhaṇaṃ, bojjhaṅgānaṃ niyyānalakkhaṇaṃ, maggassa hetulakkhaṇaṃ.
The characteristic of dhātus is emptiness; of āyatanas is basis; of satipaṭṭhānas is presence; of sammappadhānas is exertion; of iddhipādas is accomplishment; of indriyas is dominance; of balas is unshakeability; of bojjhaṅgas is leading to liberation; of the Magga is cause.
Đối với các giới là đặc tính trống không; đối với các xứ là đặc tính của xứ; đối với các niệm xứ là đặc tính hiện khởi; đối với các chánh cần là đặc tính nỗ lực; đối với các như ý túc là đặc tính thành tựu; đối với các quyền là đặc tính làm chủ; đối với các lực là đặc tính không lay chuyển; đối với các giác chi là đặc tính xuất ly; đối với đạo là đặc tính của nhân.
872
Saccānaṃ tathalakkhaṇaṃ, samathassa avikkhepalakkhaṇaṃ, vipassanāya anupassanālakkhaṇaṃ, samathavipassanānaṃ ekarasalakkhaṇaṃ, yuganaddhānaṃ anativattanalakkhaṇaṃ.
The characteristic of the Sacca (truths) is reality; of samatha is non-distraction; of vipassanā is continuous contemplation; of samatha and vipassanā is having a single essence; of their yuganaddha (conjoined pair) is non-transgression of each other.
Đối với các đế là đặc tính như thật; đối với chỉ là đặc tính không phân tán; đối với quán là đặc tính tùy quán; đối với chỉ và quán là đặc tính có cùng một tác dụng; đối với sự hợp nhất là đặc tính không vượt qua nhau.
873
Sīlavisuddhiyā saṃvaralakkhaṇaṃ, cittavisuddhiyā avikkhepalakkhaṇaṃ, diṭṭhivisuddhiyā dassanalakkhaṇaṃ.
The characteristic of purification of sīla is restraint; of purification of citta is non-distraction; of purification of diṭṭhi is seeing.
Đối với giới thanh tịnh là đặc tính phòng hộ; đối với tâm thanh tịnh là đặc tính không phân tán; đối với kiến thanh tịnh là đặc tính thấy.
874
Khaye ñāṇassa samucchedalakkhaṇaṃ, anuppāde ñāṇassa passaddhilakkhaṇaṃ.
The characteristic of the knowledge of destruction (khaye ñāṇa) is cutting off; of the knowledge of non-arising (anuppāde ñāṇa) is tranquility.
Đối với trí trong sự đoạn tận là đặc tính cắt đứt; đối với trí trong sự vô sanh là đặc tính an tịnh.
875
Chandassa mūlalakkhaṇaṃ, manasikārassa samuṭṭhānalakkhaṇaṃ, phassassa samodhānalakkhaṇaṃ, vedanāya samosaraṇalakkhaṇaṃ, samādhissa pamukhalakkhaṇaṃ, satiyā ādhipateyyalakkhaṇaṃ, paññāya tatuttarilakkhaṇaṃ, vimuttiyā sāralakkhaṇaṃ, amatogadhassa nibbānassa pariyosānalakkhaṇaṃ tathaṃ avitathaṃ.
The characteristic of taṇhā is the root of saṃsāra; of manasikāra is proper arising; of phassa is conjunction; of vedanā is convergence; of samādhi is prominence; of sati is mastery; of paññā is superiority to that (samādhi); of vimutti is essence; and of Nibbāna, which has the Deathless as its basis, is the end of saṃsāra, which is true, not otherwise.
Đối với dục là đặc tính của gốc rễ; đối với tác ý là đặc tính khởi lên; đối với xúc là đặc tính hợp lại; đối với thọ là đặc tính tụ hội; đối với định là đặc tính đứng đầu; đối với niệm là đặc tính làm chủ; đối với tuệ là đặc tính vượt trội hơn; đối với giải thoát là đặc tính cốt tủy; đối với Nibbāna, nơi đi vào bất tử, là đặc tính của sự chấm dứt, đó là như thật, không sai khác.
Etaṃ tathalakkhaṇaṃ ñāṇagatiyā āgato avirajjhitvā patto anuppattoti tathāgato.
He is called a Tathāgata because he has come to this true characteristic by the course of knowledge, having reached it without error, having attained it in succession.
Ngài đã đến, không sai lầm, đã đạt được, đã chứng đắc đặc tính như thật ấy bằng con đường trí tuệ, nên gọi là Tathāgata.
Evaṃ tathalakkhaṇaṃ āgatoti tathāgato.
Thus, he is called a Tathāgata because he has come to the true characteristic.
Như vậy, Ngài được gọi là Tathāgata vì đã đến với đặc tính như thật.
876
Kathaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato? Tathadhammā nāma cattāri ariyasaccāni.
How is he called a Tathāgata because he has fully awakened to the true nature of phenomena as they really are? The true phenomena are the Four Noble Truths.
Thế nào là Tathāgata vì đã giác ngộ các pháp như thật một cách chân chánh? Các pháp như thật tức là bốn Thánh đế.
Yathāha – ‘‘cattārimāni, bhikkhave, tathāni avitathāni anaññathāni.
As it is said: “These four, bhikkhus, are true, not otherwise, not different.
Như đã nói: “Này các Tỳ khưu, có bốn điều này là như thật, không sai khác, không khác đi.”
Katamāni cattāri?
Which four?
Bốn điều ấy là gì?
‘Idaṃ dukkha’nti, bhikkhave, tathametaṃ avitathametaṃ anaññathameta’’nti (saṃ. ni. 5.1090) vitthāro.
‘This is suffering,’ bhikkhus, this is true, this is not otherwise, this is not different” – and so on, in detail.
“‘Đây là khổ’, này các Tỳ khưu, điều này là như thật, không sai khác, không khác đi.” (Phần chi tiết).
Tāni ca bhagavā abhisambuddhoti tathānaṃ abhisambuddhattā tathāgatoti vuccati.
And the Blessed One has fully awakened to these true phenomena; therefore, because of his full awakening to the true phenomena, he is called a Tathāgata.
Và Đức Thế Tôn đã giác ngộ những điều ấy, nên Ngài được gọi là Tathāgata vì đã giác ngộ những điều như thật.
Abhisambodhattho hi ettha gatasaddo.
Indeed, in this word Tathāgato, the word gata has the meaning of 'thorough comprehension'.
Ở đây, từ “gata” có nghĩa là giác ngộ.
877
Apica jarāmaraṇassa jātipaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe… saṅkhārānaṃ avijjāpaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho.
Moreover, the meaning of old age and death arising and coming into being due to birth as a condition is true, not false, not otherwise… and the meaning of formations arising and coming into being due to ignorance as a condition is true, not false, not otherwise.
Hơn nữa, ý nghĩa rằng già và chết sinh khởi, hiện hữu do duyên sanh là như thật, không sai khác, không khác đi... cho đến... ý nghĩa rằng các hành sinh khởi, hiện hữu do duyên vô minh là như thật, không sai khác, không khác đi.
Tathā avijjāya saṅkhārānaṃ paccayaṭṭho tatho avitatho anaññatho…pe… jātiyā jarāmaraṇassa paccayaṭṭho tatho avitatho anaññatho.
Likewise, the meaning of ignorance being a condition for formations is true, not false, not otherwise… and the meaning of birth being a condition for old age and death is true, not false, not otherwise.
Tương tự, ý nghĩa rằng vô minh là duyên cho các hành là như thật, không sai khác, không khác đi... cho đến... ý nghĩa rằng sanh là duyên cho già và chết là như thật, không sai khác, không khác đi.
Taṃ sabbaṃ bhagavā abhisambuddho.
All that the Blessed One has thoroughly comprehended.
Tất cả những điều đó, Đức Thế Tôn đã giác ngộ.
Tasmāpi tathānaṃ abhisambuddhattā tathāgato.
Therefore, because he has thoroughly comprehended these truths, he is Tathāgato.
Vì thế, Ngài cũng được gọi là Tathāgata vì đã giác ngộ những điều như thật.
Evaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato.
Thus, because he has thoroughly comprehended the true natures of phenomena as they are, he is Tathāgato.
Như vậy, Ngài được gọi là Tathāgata vì đã giác ngộ các pháp như thật một cách chân chánh.
878
Kathaṃ tathadassitāya tathāgato?
How is he Tathāgato by seeing things as they are?
Thế nào là Tathāgata vì đã thấy như thật?
Bhagavā yaṃ sadevake loke…pe… sadevamanussāya aparimāṇāsu lokadhātūsu aparimāṇānaṃ sattānaṃ cakkhudvāre āpāthaṃ āgacchantaṃ rūpārammaṇaṃ nāma atthi, taṃ sabbākārena jānāti passati.
Whatever visual object there is that comes into the range of sight of immeasurable beings in immeasurable world-systems, in the world with devas… and humans and devas, the Blessed One knows and sees it in every aspect.
Đối với bất kỳ sắc trần nào hiện khởi trong nhãn môn của vô lượng chúng sanh trong vô lượng thế giới, trong thế giới cùng với chư thiên... cho đến... cùng với chư thiên và nhân loại, Đức Thế Tôn biết và thấy điều đó bằng mọi phương diện.
Evaṃ jānatā passatā ca tena taṃ iṭṭhāniṭṭhādivasena vā diṭṭhasutamutaviññātesu labbhamānakapadavasena vā ‘‘katamaṃ taṃ rūpaṃ rūpāyatanaṃ?
When he knows and sees thus, that form, whether described as agreeable or disagreeable, or by terms found in what is seen, heard, sensed, or cognized, such as: “What is that form, that form-base?
Do biết và thấy như vậy, Ngài phân tích sắc trần ấy theo các phương diện như khả ái, không khả ái, hoặc theo các thuật ngữ có thể tìm thấy trong những gì được thấy, nghe, cảm nhận, nhận thức. “Sắc ấy, sắc xứ ấy là gì?
Yaṃ rūpaṃ catunnaṃ mahābhūtānaṃ upādāya vaṇṇanibhā sanidassanaṃ sappaṭighaṃ nīlaṃ pītaka’’ntiādinā (dha. sa. 616) nayena anekehi nāmehi terasahi vārehi dvipaññāsāya nayehi vibhajjamānaṃ tathameva hoti, vitathaṃ natthi.
That form which is derived from the four great elements, having color and appearance, with manifestation, with impingement, blue, yellow”—and so on, as expounded in the Dhammasaṅgaṇī, divided by numerous names, or by thirteen categories, or by fifty-two methods, is truly so; there is no falsehood.
Sắc nào y cứ vào bốn đại mà có màu sắc, hình tướng, có thể chỉ ra, có sự va chạm, màu xanh, màu vàng...” theo phương pháp này, được phân tích bằng nhiều tên gọi, mười ba cách, năm mươi hai phương pháp, thì sắc ấy vẫn là như thật, không có gì sai khác.
Esa nayo sotadvārādīsupi āpāthamāgacchantesu saddādīsu.
This method applies also to sounds and so forth that come into the range of the ear-door and other sense-doors.
Phương pháp này cũng áp dụng cho các âm thanh, v.v., hiện khởi trong nhĩ môn, v.v.
Vuttampi cetaṃ bhagavatā ‘‘yaṃ, bhikkhave, sadevakassa lokassa…pe… sadevamanussāya diṭṭhaṃ sutaṃ mutaṃ viññātaṃ pattaṃ pariyesitaṃ anuvicaritaṃ manasā, tamahaṃ jānāmi, tamahaṃ abbhaññāsiṃ, taṃ tathāgatassa viditaṃ, taṃ tathāgato na upaṭṭhāsī’’ti (a. ni. 4.24).
It was also said by the Blessed One: “Whatever, bhikkhus, is seen, heard, sensed, cognized, attained, sought, and pondered by the mind in the world with devas… and humans and devas, that I know, that I have thoroughly understood, that is known to the Tathāgato, that is not hidden from the Tathāgato.”
Điều này cũng đã được Đức Thế Tôn nói: “Này các Tỳ khưu, những gì trong thế giới cùng với chư thiên... cho đến... cùng với chư thiên và nhân loại, đã được thấy, nghe, cảm nhận, nhận thức, đạt được, tìm kiếm, tư duy bởi tâm, Ta biết điều đó, Ta đã liễu tri điều đó, điều đó đã được Như Lai biết rõ, nhưng Như Lai không bám chấp vào đó.”
Evaṃ tathadassitāya tathāgato.
Thus, by seeing things as they are, he is Tathāgato.
Như vậy, Ngài được gọi là Tathāgata vì đã thấy như thật.
Tattha tathadassīatthe tathāgatoti padasambhavo veditabbo.
Here, the derivation of the word Tathāgato in the sense of tathadassī (one who sees things as they are) should be understood.
Ở đây, cần hiểu rằng từ “Tathāgata” được hình thành với ý nghĩa là người thấy như thật.
879
Kathaṃ tathavāditāya tathāgato?
How is he Tathāgato by speaking as he is?
Thế nào là Tathāgata vì nói lời như thật?
Yaṃ rattiṃ bhagavā bodhimaṇḍe aparājitapallaṅke nisinno catunnaṃ mārānaṃ matthakaṃ madditvā anuttaraṃ sammāsambodhiṃ abhisambuddho, yañca rattiṃ yamakasālānamantare anupādisesāya nibbānadhātuyā parinibbāyi, etthantare pañcacattālīsavassaparimāṇe kāle paṭhamabodhiyāpi majjhimabodhiyāpi pacchimabodhiyāpi yaṃ bhagavatā bhāsitaṃ suttaṃ geyyaṃ…pe… vedallaṃ, taṃ sabbaṃ atthato ca byañjanato ca anavajjaṃ anupavajjaṃ anūnamanadhikaṃ sabbākāraparipuṇṇaṃ rāgamadanimmadanaṃ dosamohamadanimmadanaṃ, natthi tattha vālaggamattampi pakkhalitaṃ, sabbaṃ taṃ ekamuddikāya lañchitaṃ viya, ekanāḷikāya mitaṃ viya, ekatulāya tulitaṃ viya, ca tathameva hoti.
The Suttas, Geyyas… and Vedallas spoken by the Blessed One during the forty-five years between the night he thoroughly comprehended unsurpassed perfect self-awakening, seated on the unconquerable seat at the Bodhi-maṇḍa after crushing the heads of the four Māras, and the night he attained parinibbāna in the Nibbāna-dhātu without any remainder of clinging between the twin Sāla trees—all of that, in meaning and in expression, is faultless, blameless, neither deficient nor excessive, perfect in all aspects, subduing the intoxication of lust, subduing the intoxication of hatred and delusion. There is not even a hair's breadth of error in it; all of it is truly so, as if sealed with a single seal, as if measured with a single measure, as if weighed with a single scale.
Trong đêm mà Đức Thế Tôn, sau khi ngự trên pháp tòa bất bại tại Bồ-đề đoàn, đã chinh phục đỉnh cao của bốn loại ma và chứng ngộ Vô Thượng Chánh Đẳng Giác, và trong đêm mà Ngài nhập Vô Dư Y Niết-bàn giới giữa hai cây sala song đôi, trong khoảng thời gian bốn mươi lăm năm ấy, những gì Đức Thế Tôn đã thuyết giảng trong sơ kỳ giác ngộ, trung kỳ giác ngộ, và hậu kỳ giác ngộ, dù là sutta, geyya... cho đến vedalla, tất cả đều không có lỗi lầm, không thể chê trách, không thiếu không thừa, và hoàn bị về mọi phương diện, cả về ý nghĩa lẫn văn tự, có khả năng dẹp tan sự say đắm trong tham, sân, và si. Trong đó, không có một sai sót nào dù chỉ nhỏ bằng đầu sợi lông. Tất cả đều như được đóng cùng một con dấu, được đo bằng cùng một ống đong, được cân bằng cùng một chiếc cân, và đều như thật.
Yathāha ‘‘yañca, cunda, rattiṃ tathāgato anuttaraṃ sammāsambodhiṃ abhisambujjhati, yañca rattiṃ anupādisesāya nibbānadhātuyā parinibbāyati, yaṃ etasmiṃ antare bhāsati lapati niddisati, sabbaṃ taṃ tathameva hoti, no aññathā.
As it was said: “Whatever, Cunda, the Tathāgato speaks, utters, or declares between the night he thoroughly comprehends unsurpassed perfect self-awakening and the night he attains parinibbāna in the Nibbāna-dhātu without any remainder of clinging—all of that is truly so, not otherwise.
Như đã nói: “Này Cunda, trong đêm Như Lai chứng ngộ Vô Thượng Chánh Đẳng Giác, và trong đêm Như Lai nhập Vô Dư Y Niết-bàn giới, những gì Ngài nói, giảng, và chỉ dạy trong khoảng thời gian đó, tất cả đều như thật, không khác.
Tasmā ‘tathāgato’ti vuccatī’’ti (dī. ni. 3.188).
Therefore, he is called Tathāgato.”
Vì vậy, Ngài được gọi là ‘Tathāgata’”.
Gadaattho hi ettha gatasaddo.
Indeed, in this word, gata means 'speaking'.
Ở đây, từ gata có nghĩa là nói.
Evaṃ tathavāditāya tathāgato.
Thus, by speaking as he is, he is Tathāgato.
Như vậy, do nói lời như thật nên Ngài là Tathāgata.
880
Apica āgadanaṃ āgado, vacananti attho.
Moreover, āgadana means 'speaking', which is the meaning of vacana.
Hơn nữa, āgadanaṃāgado, có nghĩa là lời nói.
Tatho aviparīto āgado assāti dakārassa takāraṃ katvā tathāgatoti evametasmiṃ atthe padasiddhi veditabbā.
The formation of the word Tathāgato in this sense, by changing the letter da to ta, should be understood as meaning 'whose speech is true and not otherwise'.
Lời nói (āgado) của Ngài là chân thật (tatho), không sai lệch. Do đó, chuyển da thành ta, nên có danh hiệu Tathāgata. Cần hiểu sự hình thành của từ này theo ý nghĩa đó.
881
Kathaṃ tathākāritāya tathāgato?
How is he Tathāgato by acting as he speaks?
Thế nào là Tathāgata do hành động như thật?
Bhagavato hi vācāya kāyo anulometi, kāyassāpi vācā, tasmā yathāvādī tathākārī yathākārī tathāvādī ca hoti.
Indeed, the Blessed One's bodily action is in conformity with his speech, and his speech is also in conformity with his bodily action; therefore, as he speaks, so he acts; as he acts, so he speaks.
Thân của Đức Thế Tôn thuận theo lời nói, và lời nói của Ngài cũng thuận theo thân. Vì vậy, Ngài nói thế nào làm thế ấy, làm thế nào nói thế ấy.
Evaṃbhūtassa cassa yathā vācā, kāyopi tathā gato pavattoti attho.
And for such a one, as his speech is, so his body has proceeded (gato), meaning it has acted.
Đối với bậc như vậy, lời nói thế nào, thân cũng hành động (gato) như thế ấy.
Yathā ca kāyo, vācāpi tathā gatā pavattāti tathāgato.
And as his body is, so his speech has proceeded (gatā); therefore, he is Tathāgato.
Và thân hành động thế nào, lời nói cũng diễn đạt (gatā) như thế ấy, nên Ngài là Tathāgata.
Tenevāha – ‘‘yathāvādī, bhikkhave, tathāgato tathākārī, yathākārī tathāvādī.
That is why it was said: “As the Tathāgato speaks, bhikkhus, so he acts; as he acts, so he speaks.
Vì thế, Ngài đã dạy: “Này các Tỳ khưu, Như Lai nói thế nào, làm thế ấy; làm thế nào, nói thế ấy.
Iti yathāvādī tathākārī, yathākārī tathāvādī.
Thus, as he speaks, so he acts; as he acts, so he speaks.
Như vậy, nói thế nào làm thế ấy, làm thế nào nói thế ấy.
Tasmā ‘tathāgato’ti vuccatī’’ti.
Therefore, he is called Tathāgato.”
Vì vậy, Ngài được gọi là ‘Tathāgata’”.
Evaṃ tathākāritāya tathāgato.
Thus, because of acting in such a way, he is a Tathāgata.
Như vậy, do hành động như thật nên Ngài là Tathāgata.
882
Kathaṃ abhibhavanaṭṭhena tathāgato?
How is he a Tathāgata by way of overcoming?
Thế nào là Tathāgata theo nghĩa chinh phục?
Upari bhavaggaṃ heṭṭhā avīciṃ pariyantaṃ katvā tiriyaṃ aparimāṇāsu lokadhātūsu sabbasatte abhibhavati sīlena samādhinā paññāya vimuttiyā vimuttiñāṇadassanena, na tassa tulā vā pamāṇaṃ vā atthi, atulo appameyyo anuttaro rājādhirājā devānaṃ atidevo sakkānaṃ atisakko brahmānaṃ atibrahmā.
Having made the highest existence (bhavagga) above and Avīci below as boundaries, he overcomes all beings in countless world-systems horizontally by means of virtue, concentration, wisdom, liberation, and the knowledge and vision of liberation. There is no equal or measure for him. He is incomparable, immeasurable, unsurpassed, a king of kings, a god beyond gods, an Indra beyond Indras, a Brahmā beyond Brahmās.
Lấy cõi trời Hữu Đảnh làm giới hạn trên và địa ngục Vô Gián làm giới hạn dưới, trong vô lượng thế giới theo chiều ngang, Ngài chinh phục tất cả chúng sinh bằng giới, định, tuệ, giải thoát và giải thoát tri kiến. Không có gì có thể so sánh hay đo lường được với Ngài. Ngài là bậc vô song, không thể đo lường, vô thượng, là vua của các vị vua, là thiên chủ của các vị trời, là Sakka chúa của các vị Sakka, là Phạm thiên chúa của các vị Phạm thiên.
Tenāha – ‘‘sadevake, bhikkhave, loke…pe… sadevamanussāya tathāgato abhibhū anabhibhūto aññadatthu daso vasavattī.
Therefore, it is said: ‘‘In the world with its devas, bhikkhus…pe… the Tathāgata is the overcomer, unconquered, truly the seer, the master, in the world with its devas and humans.
Vì thế, Ngài đã dạy: “Này các Tỳ khưu, trong thế giới cùng với chư thiên... cho đến chúng sinh cùng với chư thiên và nhân loại, Như Lai là bậc chinh phục, không bị chinh phục, là bậc thấy rõ, là bậc tự tại.
Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23).
Therefore, he is called ‘Tathāgata’.’’
Vì vậy, Ngài được gọi là ‘Tathāgata’”.
883
Tatthevaṃ padasiddhi veditabbā – agado viya agado.
In this context, the etymology of the word should be understood thus: Agada is like agada.
Ở đây, cần hiểu sự hình thành của từ như sau: agado giống như thuốc thần.
Ko panesa?
But what is this?
Vậy thuốc thần này là gì?
Desanāvilāso ceva puññussayo ca.
It is the splendor of his teaching and the accumulation of merit.
Đó chính là sự vi diệu của giáo pháp và sự tích lũy công đức.
Tena hesa mahānubhāvo bhisakko dibbāgadena sappe viya sabbaparappavādino sadevakañca lokaṃ abhibhavati.
Therefore, this powerful physician, with his divine medicine, overcomes all other disputants and the world with its devas, just as one overcomes snakes.
Do đó, vị thầy thuốc đại thần thông này chinh phục tất cả những người theo tà thuyết và thế giới cùng với chư thiên, giống như người dùng thuốc thần chinh phục loài rắn.
Iti sabbalokābhibhavane tatho aviparīto desanāvilāsamayo ceva puññamayo ca agado assāti dakārassa takāraṃ katvā tathāgatoti veditabbo.
Thus, in overcoming all worlds, that unperverted medicine, consisting of the splendor of his teaching and merit, is his; therefore, by changing the ‘da’ to ‘ta’, he should be understood as Tathāgata.
Vì vậy, trong việc chinh phục tất cả thế gian, thuốc thần (agado) của Ngài, bao gồm sự vi diệu của giáo pháp và công đức, là chân thật (tatho), không sai lệch. Chuyển da thành ta, nên cần hiểu là Tathāgata.
Evaṃ abhibhavanaṭṭhena tathāgato.
Thus, he is a Tathāgata by way of overcoming.
Như vậy, theo nghĩa chinh phục nên Ngài là Tathāgata.
884
Apica tathāya gatotipi tathāgato, tathaṃ gatotipi tathāgatoti.
Furthermore, he is a Tathāgata because he has gone to the truth (tathāya gato), and he is a Tathāgata because he has gone to the truth (tathaṃ gato).
Hơn nữa, tathāya gato cũng là Tathāgata, tathaṃ gato cũng là Tathāgata.
Gatoti avagato atīto patto paṭipannoti attho.
Gato means understood, transcended, attained, or practiced.
Gato có nghĩa là đã hiểu rõ, đã vượt qua, đã đạt đến, đã thực hành.
Tattha sakalaṃ lokaṃ tīraṇapariññāya tathāya gato avagatoti tathāgato, lokasamudayaṃ pahānapariññāya tathāya gato atītoti tathāgato, lokanirodhaṃ sacchikiriyāya tathāya gato pattoti tathāgato, lokanirodhagāminipaṭipadaṃ tathaṃ gato paṭipannoti tathāgato.
Among these, he is a Tathāgata because he has truly understood the entire world through the full comprehension of discernment; he is a Tathāgata because he has truly transcended the origin of the world through the full comprehension of abandonment; he is a Tathāgata because he has truly attained the cessation of the world through the full comprehension of realization; he is a Tathāgata because he has truly practiced the path leading to the cessation of the world.
Trong đó, Ngài đã hiểu rõ (gato avagato) toàn bộ thế gian bằng trí tuệ liễu tri như thật (tathāya), nên là Tathāgata. Ngài đã vượt qua (gato atīto) tập khởi của thế gian bằng trí tuệ đoạn trừ như thật (tathāya), nên là Tathāgata. Ngài đã đạt đến (gato patto) sự diệt tận của thế gian bằng sự chứng ngộ như thật (tathāya), nên là Tathāgata. Ngài đã thực hành (gato paṭipanno) con đường đưa đến sự diệt tận của thế gian một cách như thật (tathaṃ), nên là Tathāgata.
Tena yaṃ vuttaṃ bhagavatā – ‘‘loko, bhikkhave, tathāgatena abhisambuddho, lokasmā tathāgato visaṃyutto.
Therefore, what was said by the Blessed One: ‘‘The world, bhikkhus, has been fully understood by the Tathāgata; the Tathāgata is disjoined from the world.
Do đó, Đức Thế Tôn đã dạy: “Này các Tỳ khưu, thế gian đã được Như Lai chứng ngộ, Như Lai đã thoát ly khỏi thế gian.
Lokasamudayo, bhikkhave, tathāgatena abhisambuddho, lokasamudayo tathāgatassa pahīno.
The origin of the world, bhikkhus, has been fully understood by the Tathāgata; the origin of the world has been abandoned by the Tathāgata.
Này các Tỳ khưu, tập khởi của thế gian đã được Như Lai chứng ngộ, tập khởi của thế gian đã được Như Lai đoạn trừ.
Lokanirodho, bhikkhave, tathāgatena abhisambuddho lokanirodho tathāgatassa sacchikato.
The cessation of the world, bhikkhus, has been fully understood by the Tathāgata; the cessation of the world has been realized by the Tathāgata.
Này các Tỳ khưu, sự diệt tận của thế gian đã được Như Lai chứng ngộ, sự diệt tận của thế gian đã được Như Lai chứng thực.
Lokanirodhagāminī paṭipadā, bhikkhave, tathāgatena abhisambuddhā, lokanirodhagāminīpaṭipadā tathāgatassa bhāvitā.
The path leading to the cessation of the world, bhikkhus, has been fully understood by the Tathāgata; the path leading to the cessation of the world has been developed by the Tathāgata.
Này các Tỳ khưu, con đường đưa đến sự diệt tận của thế gian đã được Như Lai chứng ngộ, con đường đưa đến sự diệt tận của thế gian đã được Như Lai tu tập.
Yaṃ, bhikkhave, sadevakassa lokassa…pe… anuvicaritaṃ manasā, sabbaṃ taṃ tathāgatena abhisambuddhaṃ.
Whatever, bhikkhus, in the world with its devas…pe… has been traversed by the mind, all that has been fully understood by the Tathāgata.
Này các Tỳ khưu, tất cả những gì trong thế giới cùng với chư thiên... được tâm suy xét, tất cả những điều đó đã được Như Lai chứng ngộ.
Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23).
Therefore, he is called ‘Tathāgata’.’’
Vì vậy, Ngài được gọi là ‘Tathāgata’”.
Tassa evampi attho veditabbo.
This meaning should also be understood in this way.
Cũng cần phải hiểu ý nghĩa của lời dạy ấy như vậy.
Idampi ca tathāgatassa tathāgatabhāvadīpane mukhamattameva.
And this is merely an introduction to the exposition of the Tathāgata’s state of being a Tathāgata.
Và điều này cũng chỉ là phần mở đầu trong việc giải thích về bản chất Tathāgata của một vị Như Lai.
Sabbākārena pana tathāgatova tathāgatassa tathāgatabhāvaṃ vaṇṇeyya.
However, only a Tathāgata could fully describe the Tathāgata’s state of being a Tathāgata in all aspects.
Chỉ có một vị Như Lai mới có thể mô tả bản chất Tathāgata của một vị Như Lai một cách toàn diện.
Yasmā pana sabbabuddhā tathāgataguṇenāpi samasamā, tasmā sabbesaṃ vasena tathāgatānanti āha.
But since all Buddhas are equal in the quality of being a Tathāgata, he says Tathāgatānaṃ (of the Tathāgatas) with reference to all of them.
Tuy nhiên, vì tất cả các vị Phật đều bình đẳng về đức hạnh Như Lai, nên ngài đã nói của các bậc Như Lai (Tathāgatānaṃ) theo ý nghĩa bao hàm tất cả các vị.
885
Arahantānanti kilesehi ārakattā, arīnaṃ arānañca hatattā, paccayādīnaṃ arahattā, pāpakaraṇe rahābhāvā tathāgato arahaṃ.
Arahantānaṃ (of the Arahants): The Tathāgata is an Arahant because he is far from defilements (kilesa), because he has killed enemies (ari) and the spokes (ara), because he is worthy of requisites and so forth, and because there is no secrecy in doing evil.
Của các bậc A-la-hán (Arahantānaṃ): Như Lai là bậc A-la-hán vì xa lìa các phiền não, vì đã diệt trừ các kẻ thù và các căm xe, vì xứng đáng nhận các vật dụng cúng dường, và vì không làm điều ác ở nơi kín đáo.
Ārakā hi so sabbakilesehi suvidūravidūre ṭhito maggena savāsanānaṃ kilesānaṃ pahīnattāti arahaṃ.
Indeed, he stands far, far away from all defilements, because the defilements, together with their latent tendencies (vāsanā), have been abandoned by the Path, hence he is an Arahant.
Ngài đã ở rất xa, vô cùng xa lìa tất cả phiền não, vì các phiền não cùng với tập khí đã được đoạn trừ bằng đạo lộ, nên Ngài là A-la-hán.
886
So tato ārakā nāma, yassa yenāsamaṅgitā;
He is called "far" from that with which he is not endowed;
Vị nào do duyên nào mà không còn phiền não,
887
Asamaṅgī ca dosehi, nātho tenārahaṃ mato.
And the Lord, not endowed with faults, is therefore considered an Arahant.
Bậc không còn cấu uế, vị Thiện Thệ ấy được gọi là A-la-hán.
888
Te cānena kilesārayo maggena hatāti arīnaṃ hatattāpi arahaṃ.
And because these enemies, the defilements, have been killed by him through the Path, he is also an Arahant because of having killed enemies.
Và những kẻ thù phiền não ấy đã được Ngài diệt trừ bằng đạo lộ, nên do diệt trừ các kẻ thù, Ngài cũng là A-la-hán.
889
Yasmā rāgādisaṅkhātā, sabbepi arayo hatā;
Since all enemies, called lust and so forth,
Bởi vì tất cả kẻ thù, được gọi là tham ái v.v.,
890
Paññāsatthena nāthena, tasmāpi arahaṃ mato.
Have been killed by the Lord with the sword of wisdom, therefore he is considered an Arahant.
Đã bị vị Thiện Thệ diệt trừ bằng gươm báu trí tuệ, nên Ngài được gọi là A-la-hán.
891
Yañcetaṃ avijjābhavataṇhāmayanābhipuññādiabhisaṅkhārānaṃ jarāmaraṇanemi āsavasamudayamayena akkhena vijjhitvā tibhavarathe samāyojitaṃ anādikālappavattaṃ saṃsāracakkaṃ, tassānena bodhimaṇḍe vīriyapādehi sīlapathaviyaṃ patiṭṭhāya saddhāhatthena kammakkhayakaraṃ ñāṇapharasuṃ gahetvā sabbe arā hatāti arānaṃ hatattāpi arahaṃ.
And that wheel of saṃsāra, which is composed of ignorance, becoming, and craving, with its spokes of meritorious and other formations, and its rim of old age and death, pierced by the axle of the origin of cankers (āsava), and yoked to the chariot of the three existences, revolving from time immemorial—its spokes have all been destroyed by him at the Bodhi-maṇḍa, standing firm on the ground of sīla with the feet of energy, and taking the axe of knowledge that destroys kamma with the hand of faith. Therefore, he is also an Arahant because of having destroyed the spokes.
Bánh xe luân hồi, vốn được vận hành từ vô thủy, có trục xe là vô minh, hữu và ái, có các căm xe là các hành như phước hành, được vành xe là già và chết, được xuyên qua bởi trục là nhân duyên của các lậu hoặc, và được gắn vào cỗ xe ba cõi. Tại Bồ-đề đoàn, đứng trên mặt đất giới hạnh bằng đôi chân tinh tấn, dùng bàn tay tín thành cầm lấy chiếc búa trí tuệ có khả năng hủy diệt nghiệp, Ngài đã chặt đứt tất cả các căm xe ấy. Do đó, vì đã chặt đứt các căm xe, Ngài cũng là A-la-hán.
892
Arā saṃsāracakkassa, hatā ñāṇāsinā yato;
Since the spokes of the wheel of saṃsāra were destroyed by the Lord of the World with the sword of knowledge,
Vì các căm xe của bánh xe luân hồi đã bị chặt đứt
893
Lokanāthena tenesa, arahanti pavuccati.
Therefore, he is called an Arahant.
bởi gươm báu trí tuệ của vị Thiện Thệ, nên Ngài được gọi là A-la-hán.
894
Aggadakkhiṇeyyattā ca cīvarādipaccaye arahati pūjāvisesañca.
And because he is the foremost recipient of offerings, he is worthy of robes and other requisites, and special veneration.
Và vì là bậc đáng cúng dường tối thượng, Ngài xứng đáng nhận các vật dụng như y phục và các sự cúng dường đặc biệt khác.
Teneva ca uppanne tathāgate ye keci mahesakkhā devamanussā, na te aññattha pūjaṃ karonti.
And because of that, when the Tathāgata has arisen, whatever greatly powerful devas and humans there are, they do not perform veneration anywhere else.
Chính vì vậy, khi một vị Như Lai xuất hiện, bất kỳ chư thiên hay nhân loại nào có đại thần lực cũng không cúng dường ở nơi nào khác.
Tathā hi brahmā sahampati sinerumattena ratanadāmena tathāgataṃ pūjesi, yathābalañca aññe devā manussā ca bimbisārakosalarājādayo.
Indeed, Brahma Sahampati venerated the Tathāgata with a garland of jewels the size of Sineru, and other devas and humans, such as King Bimbisāra and King Kosala, did so according to their power.
Thật vậy, Phạm thiên Sahampati đã cúng dường Như Lai bằng một tràng hoa báu lớn bằng núi Tu-di, và các vị trời khác cùng các vị vua như Bimbisāra và vua xứ Kosala cũng cúng dường tùy theo khả năng của mình.
Parinibbutampi ca bhagavantaṃ uddissa channavutikoṭidhanaṃ vissajjetvā asokamahārājā sakalajambudīpe caturāsīti vihārasahassāni patiṭṭhāpesi, ko pana vādo aññesaṃ pūjāvisesānanti paccayādīnaṃ arahattāpi arahaṃ.
And furthermore, King Asoka, dedicating 960 million (of wealth) to the Blessed One even after His Parinibbāna, established eighty-four thousand monasteries throughout the entire Jambudīpa. What need is there to speak of other special offerings? Thus, He is an Arahant even by being worthy of requisites and so forth.
Ngay cả sau khi Đức Thế Tôn đã nhập diệt, đại đế Asoka đã chi ra chín mươi sáu triệu đơn vị tiền vàng để xây dựng tám mươi bốn ngàn ngôi chùa trên khắp cõi Diêm-phù-đề. Huống hồ chi nói đến các sự cúng dường đặc biệt khác. Do đó, vì xứng đáng nhận các vật dụng cúng dường, Ngài cũng là A-la-hán.
895
Pūjāvisesaṃ saha paccayehi, yasmā ayaṃ arahati lokanātho;
Because this Lord of the World is worthy of special offerings together with requisites;
Bởi vì vị Thiện Thệ này xứng đáng nhận sự cúng dường đặc biệt cùng với các vật dụng,
896
Atthānurūpaṃ arahanti loke, tasmā jino arahati nāmametaṃ.
And because Arahants in the world are worthy according to their meaning, therefore the Conqueror is worthy of this name.
Trong thế gian, họ xứng đáng với những gì phù hợp với lợi ích, vì thế bậc Chinh Phục xứng đáng với danh hiệu này.
897
Yathā ca loke ye keci paṇḍitamānino bālā asilokabhayena raho pāpaṃ karonti, evamesa na kadāci karotīti pāpakaraṇe rahābhāvatopi arahaṃ.
Just as in the world, whatever foolish people who consider themselves wise commit evil in secret for fear of disgrace, so too, this one never does so. Thus, He is an Arahant also by the absence of secrecy in committing evil.
Và như trong thế gian, những kẻ ngu si tự cho mình là bậc trí, vì sợ tai tiếng mà lén lút làm điều ác, cũng vậy, vị này không bao giờ làm như thế; do đó, vì không có sự lén lút trong việc làm ác, Ngài là bậc A-la-hán.
898
Yasmā natthi raho nāma, pāpakammesu tādino;
Because for such a one, there is no secrecy in evil deeds;
Bởi vì đối với bậc như vậy, không có cái gọi là lén lút trong các ác nghiệp;
899
Rahābhāvena tenesa, arahaṃ iti vissuto.
Therefore, by the absence of secrecy, He is known as an Arahant.
Do không có sự lén lút ấy, vị này được biết đến là bậc A-la-hán.
900
Evaṃ sabbathāpi –
Thus, in every way:
Như vậy, về mọi phương diện –
901
Ārakattā hatattā ca, kilesārīna so muni;
That sage is called an Arahant because he is far removed from defilements,
Vị ẩn sĩ ấy, do xa lìa và đã diệt trừ các kẻ thù phiền não;
902
Hatasaṃsāracakkāro, paccayādīna cāraho;
Because the spokes of the wheel of saṃsāra are destroyed, and he is worthy of requisites and so forth,
Đã phá hủy bánh xe luân hồi, và xứng đáng nhận các vật dụng cúng dường;
903
Na raho karoti pāpāni, arahaṃ tena vuccatīti.
And because he does not commit evil in secret.
Không lén lút làm các điều ác, do đó được gọi là bậc A-la-hán.
904
Yasmā pana sabbabuddhā arahattaguṇenāpi samasamā, tasmā sabbesaṃ vasena ‘‘arahantāna’’nti āha.
Since all Buddhas are equal in the quality of Arahantship, therefore, He spoke of "Arahants" in reference to all of them.
Bởi vì tất cả các vị Phật đều ngang bằng nhau về đức hạnh A-la-hán, do đó, Ngài nói "của các bậc A-la-hán" là để chỉ tất cả các vị.
905
Sammāsambuddhānanti sammā sāmañca sabbadhammānaṃ buddhattā sammāsambuddho.
Sammāsambuddhāna (of the Perfectly Enlightened Ones): He is a Sammāsambuddha (Perfectly Enlightened One) because He has perfectly and by Himself awakened to all phenomena.
Của các bậc Chánh Đẳng Giác (Sammāsambuddhānaṃ): là bậc Chánh Đẳng Giác do đã giác ngộ một cách chân chánh và tự mình tất cả các pháp.
Tathā hesa sabbadhamme sammā sambuddho, abhiññeyye dhamme abhiññeyyato buddho, pariññeyye dhamme pariññeyyato, pahātabbe dhamme pahātabbato, sacchikātabbe dhamme sacchikātabbato, bhāvetabbe dhamme bhāvetabbato.
Indeed, He is perfectly enlightened to all phenomena: enlightened to phenomena to be fully understood as fully understood, to phenomena to be fully comprehended as fully comprehended, to phenomena to be abandoned as abandoned, to phenomena to be realized as realized, to phenomena to be developed as developed.
Thật vậy, vị này đã giác ngộ một cách chân chánh tất cả các pháp: đã giác ngộ các pháp cần được thắng tri theo phương diện thắng tri, các pháp cần được liễu tri theo phương diện liễu tri, các pháp cần được đoạn tận theo phương diện đoạn tận, các pháp cần được chứng ngộ theo phương diện chứng ngộ, các pháp cần được tu tập theo phương diện tu tập.
Tenevāha –
Therefore, He said:
Do đó, Ngài đã nói –
906
‘‘Abhiññeyyaṃ abhiññātaṃ, bhāvetabbañca bhāvitaṃ;
“What is to be fully understood has been fully understood, and what is to be developed has been developed;
"Pháp cần thắng tri, ta đã thắng tri, pháp cần tu tập, ta đã tu tập;
907
Pahātabbaṃ pahīnaṃ me, tasmā buddhosmi brāhmaṇā’’ti.(ma. ni. 2.399; su. ni. 563);
What is to be abandoned has been abandoned by me, therefore, I am a Buddha, brahmin.”
Pháp cần đoạn tận, ta đã đoạn tận, vì thế, hỡi Bà-la-môn, ta là Phật."
908
Atha vā cakkhu dukkhasaccaṃ, tassa mūlakāraṇabhāvena samuṭṭhāpikā purimataṇhā samudayasaccaṃ, ubhinnaṃ appavatti nirodhasaccaṃ, nirodhappajānanā paṭipadā maggasaccanti evaṃ ekekapaduddhārenāpi sabbadhamme sammā sāmañca buddho.
Alternatively, the eye is the Dukkha-sacca (Truth of Suffering); the previous craving, which is the root cause of the eye's arising, is the Samudaya-sacca (Truth of the Origin of Suffering); the non-occurrence of both is the Nirodha-sacca (Truth of Cessation); the path that leads to the realization of cessation is the Magga-sacca (Truth of the Path). In this way, by extracting each term, He is perfectly and by Himself enlightened to all phenomena.
Hoặc là, con mắt là khổ đế, ái luyến trước đây là nhân sanh khởi do là nguyên nhân gốc rễ của nó là tập đế, sự không sanh khởi của cả hai là diệt đế, con đường tuệ tri sự diệt là đạo đế; như vậy, bằng cách nêu ra từng yếu tố một, Ngài đã giác ngộ một cách chân chánh và tự mình tất cả các pháp.
Esa nayo sotaghānajivhākāyamanesu.
The same method applies to the ear, nose, tongue, body, and mind.
Phương pháp này cũng áp dụng cho tai, mũi, lưỡi, thân, và ý.
Eteneva nayena rūpādīni cha āyatanāni, cakkhuviññāṇādayo cha viññāṇakāyā, cakkhusamphassādayo cha phassā, cakkhusamphassajādayo cha vedanā, rūpasaññādayo cha saññā, rūpasañcetanādayo cha cetanā, rūpataṇhādayo cha taṇhākāyā, rūpavitakkādayo cha vitakkā, rūpavicārādayo cha vicārā, rūpakkhandhādayo pañcakkhandhā, dasa kasiṇāni, dasa anussatiyo, uddhumātakasaññādivasena dasa saññā, kesādayo dvattiṃsākārā, dvādasāyatanāni, aṭṭhārasa dhātuyo, kāmabhavādayo nava bhavā, paṭhamādīni cattāri jhānāni, mettābhāvanādayo catasso appamaññā, catasso arūpasamāpattiyo, paṭilomato jarāmaraṇādīni, anulomato avijjādīni paṭiccasamuppādaṅgāni ca yojetabbāni.
By this same method, the six sense bases beginning with form, the six consciousnesses beginning with eye-consciousness, the six contacts beginning with eye-contact, the six feelings arising from eye-contact and so forth, the six perceptions beginning with perception of form, the six volitions beginning with volition of form, the six cravings beginning with craving for form, the six thoughts beginning with thought of form, the six investigations beginning with investigation of form, the five aggregates beginning with the form aggregate, the ten kasiṇas, the ten recollections, the ten perceptions by way of the perception of a bloated corpse and so forth, the thirty-two bodily parts beginning with hair, the twelve sense bases, the eighteen elements, the nine existences beginning with the sense-sphere existence, the four jhānas beginning with the first, the four immeasurables beginning with the development of loving-kindness, the four immaterial attainments, the factors of dependent origination in reverse order beginning with old age and death, and in direct order beginning with ignorance, should be applied.
Theo phương pháp này, cần phải kết hợp: sáu xứ như sắc...; sáu thân thức như nhãn thức...; sáu xúc như nhãn xúc...; sáu thọ như thọ do nhãn xúc sanh...; sáu tưởng như sắc tưởng...; sáu tư như sắc tư...; sáu thân ái như sắc ái...; sáu tầm như sắc tầm...; sáu tứ như sắc tứ...; năm uẩn như sắc uẩn...; mười đề mục kasiṇa; mười pháp tùy niệm; mười tưởng theo cách tưởng tử thi sình trương...; ba mươi hai thể trược như tóc...; mười hai xứ; mười tám giới; chín hữu như cõi dục...; bốn thiền như thiền thứ nhất...; bốn vô lượng tâm như tu tập tâm từ...; bốn thiền vô sắc; và các chi phần duyên khởi theo thứ tự nghịch như già-chết... và theo thứ tự thuận như vô minh....
Tatrāyaṃ ekapadayojanā – jarāmaraṇaṃ dukkhasaccaṃ, jāti samudayasaccaṃ, ubhinnaṃ nissaraṇaṃ nirodhasaccaṃ, nirodhappajānanā paṭipadā maggasaccanti evaṃ ekekapaduddhārena sabbadhamme sammā sāmañca buddho anubuddho paṭividdho.
Herein, the application of each term is as follows: old age and death are the Dukkha-sacca; birth is the Samudaya-sacca; the escape from both is the Nirodha-sacca; the path leading to the realization of cessation is the Magga-sacca. In this way, by extracting each term, He is perfectly and by Himself enlightened, re-enlightened, and penetrated to all phenomena.
Trong đó, đây là cách kết hợp từng yếu tố: già-chết là khổ đế, sanh là tập đế, sự giải thoát khỏi cả hai là diệt đế, con đường tuệ tri sự diệt là đạo đế; như vậy, bằng cách nêu ra từng yếu tố một, Ngài đã giác ngộ, liễu ngộ, và thâm nhập một cách chân chánh và tự mình tất cả các pháp.
Yaṃ vā pana kiñci atthi neyyaṃ nāma, sabbassa sammā sambuddhattā vimokkhantikañāṇavasena sammāsambuddho.
Or, whatever there is to be known, He is a Sammāsambuddha by having perfectly and by Himself awakened to all of it, by means of the knowledge leading to liberation.
Hoặc là, bất cứ pháp nào được gọi là pháp cần biết, Ngài là bậc Chánh Đẳng Giác do đã giác ngộ một cách chân chánh tất cả các pháp ấy bằng tuệ giác toàn tri, là tuệ giác cuối cùng của sự giải thoát.
Tassa pana vibhāgo upari āvi bhavissatīti.
The detailed explanation of that will become evident later.
Sự phân tích về điều này sẽ được làm rõ ở phần sau.
Yasmā pana sabbabuddhā sammāsambuddhaguṇenāpi samasamā, tasmā sabbesaṃ vasena ‘‘sammāsambuddhāna’’nti āha.
Since all Buddhas are equal in the quality of Sammāsambuddha, therefore, He spoke of "Sammāsambuddhāna" in reference to all of them.
Bởi vì tất cả các vị Phật đều ngang bằng nhau về đức hạnh Chánh Đẳng Giác, do đó, Ngài nói "của các bậc Chánh Đẳng Giác" là để chỉ tất cả các vị.
909
38. Idāni pariyantapārisuddhiapariyantapārisuddhisīladvaye ekekameva sīlaṃ pañcadhā bhinditvā dassetuṃ atthi sīlaṃ pariyantaṃ, atthi sīlaṃ apariyantantiādimāha.
38. Now, to show each of the two types of sīla, namely, limited purity (pariyantapārisuddhi-sīla) and unlimited purity (apariyantapārisuddhi-sīla), divided into five aspects, He stated: “There is sīla that is limited, there is sīla that is unlimited,” and so forth.
38. Bây giờ, để trình bày mỗi loại giới trong hai loại giới thanh tịnh có giới hạn và giới thanh tịnh không có giới hạn bằng cách phân chia thành năm loại, Ngài nói bắt đầu bằng "có giới có giới hạn, có giới không có giới hạn".
Itaresu pana tīsu sīlesu tathāvidho bhedo natthīti.
However, in the other three types of sīla, there is no such division.
Còn trong ba loại giới kia, không có sự phân chia như vậy.
Tattha lābhapariyantanti lābhena pariyanto bhedo etassāti lābhapariyantaṃ.
Here, lābhapariyanta means that which has its limit or breakdown through gain (lābha).
Trong đó, giới hạn bởi lợi lộc (lābhapariyantaṃ) có nghĩa là giới này có giới hạn, có sự vi phạm bởi lợi lộc.
Evaṃ sesānipi.
Similarly, for the others.
Các trường hợp còn lại cũng tương tự.
Yasoti panettha parivāro.
Here, yaso means retinue.
Ở đây, danh tiếng (yaso) là đoàn tùy tùng.
Idhāti imasmiṃ loke.
Idha means in this world.
Ở đây (idha) là trong thế gian này.
Ekaccoti eko.
Ekacco means a certain person.
Một người (ekacco) là một người nào đó.
Lābhahetūti lābhoyeva hetu lābhahetu, tasmā lābhahetutoti vuttaṃ hoti.
Lābhahetu means gain itself is the cause; therefore, it is said to be due to gain.
Vì lý do lợi lộc (lābhahetu): lợi lộc chính là lý do, là nhân, nên được nói là "do nhân là lợi lộc".
Hetvatthe nissakkavacanaṃ.
It is the ablative case in the sense of cause.
Đây là cách nói ở chủ cách với ý nghĩa là nhân.
‘‘Lābhapaccayā lābhakāraṇā’’ti tasseva vevacanaṃ.
"Lābhapaccayā lābhakāraṇā" is a synonym for that very term.
"Do duyên lợi lộc, do nguyên nhân lợi lộc" là từ đồng nghĩa của nó.
Hetumeva hi paṭicca etaṃ phalametīti paccayoti ca, phaluppattiṃ kārayatīti kāraṇanti ca vuccati.
Indeed, because an effect arises dependent on a cause, it is called paccaya (condition), and because it brings about the arising of an effect, it is called kāraṇa (cause).
Thật vậy, quả này sanh khởi do duyên theo chính nhân ấy, nên được gọi là duyên (paccayo); và vì nó làm cho quả sanh khởi, nên được gọi là nguyên nhân (kāraṇa).
910
Yathāsamādinnanti yaṃ yaṃ samādinnaṃ gahitaṃ.
Yathāsamādinna means whatever has been undertaken or accepted.
Giới đã thọ trì (yathāsamādinnaṃ) là bất cứ giới nào đã được thọ trì, đã được tiếp nhận.
Vītikkamatīti ajjhācarati.
Vītikkamati means transgresses.
Vi phạm (vītikkamati) là phạm vào.
Evarūpānīti evaṃsabhāvāni, vuttappakārānīti adhippāyo.
Evarūpāni means of such a nature; the intention is "of the kind described."
Những giới như vậy (evarūpāni) có nghĩa là có bản chất như vậy, tức là các loại đã được nói đến.
Sīlānīti gahaṭṭhasīlāni vā hontu pabbajitasīlāni vā, yesaṃ ādimhi vā ante vā ekaṃ bhinnaṃ, tāni pariyante chinnasāṭako viya khaṇḍāni.
Sīlāni refers to either the sīla of householders or the sīla of renunciants; those of which one (precept) is broken at the beginning or at the end are khaṇḍāni (broken), like a cloth torn at the edge.
Các giới (sīlāni): dù là giới tại gia hay giới xuất gia, nếu một giới ở đầu hay ở cuối bị vi phạm, chúng được gọi là bị sứt mẻ (khaṇḍāni), giống như tấm vải bị rách ở mép.
Yesaṃ vemajjhe ekaṃ bhinnaṃ, tāni majjhe vinividdhasāṭako viya chiddāni.
Those of which one (precept) is broken in the middle are chiddāni (perforated), like a cloth pierced through the middle.
Nếu một giới ở giữa bị vi phạm, chúng được gọi là bị thủng (chiddāni), giống như tấm vải bị thủng ở giữa.
Yesaṃ paṭipāṭiyā dve vā tīṇi vā bhinnāni, tāni piṭṭhiyā vā kucchiyā vā uṭṭhitena dīghavaṭṭādisaṇṭhānena visabhāgavaṇṇena kāḷarattādīnaṃ aññatarasarīravaṇṇā gāvī viya sabalāni.
Those of which two or three (precepts) are broken in succession are sabalāni (spotted), like a cow with a body color different from black, red, etc., having a long, round, or similar shape of a different color rising from its back or belly.
Nếu hai hoặc ba giới bị vi phạm liên tiếp, chúng được gọi là bị lốm đốm (sabalāni), giống như con bò có màu da khác biệt với các đốm dài, tròn... nổi lên ở lưng hoặc bụng, khác với màu thân đen, đỏ...
Yesaṃ antarantarā ekekāni bhinnāni, tāni antarantarā visabhāgavaṇṇabinduvicitrā gāvī viya kammāsāni.
Those of which individual (precepts) are broken here and there are kammāsāni (speckled), like a cow variegated with different colored spots here and there.
Nếu các giới bị vi phạm cách quãng, chúng được gọi là bị lang lổ (kammāsāni), giống như con bò được trang điểm bằng những chấm màu khác nhau ở các khoảng cách.
Avisesena vā sabbānipi sattavidhena methunasaṃyogena kodhūpanāhādīhi ca pāpadhammehi upahatattā khaṇḍāni chiddāni sabalāni kammāsānīti.
Alternatively, all of them are khaṇḍāni, chiddāni, sabalāni, and kammāsāni due to being corrupted by the seven kinds of sexual misconduct and by evil defilements such as anger and resentment.
Hoặc nói chung, tất cả chúng đều bị sứt mẻ, thủng, lốm đốm, lang lổ do bị tổn hại bởi bảy loại giao hợp bất chánh và các pháp ác như sân hận, phẫn uất...
Tāniyeva taṇhādāsabyato mocetvā bhujissabhāvākaraṇena na bhujissāni.
Those (sīla) are na bhujissāni (not free) because they do not liberate one from the slavery of craving (taṇhā) and do not make one free.
Chính những giới ấy, do không giải thoát khỏi sự nô lệ cho ái dục, được gọi là không giải thoát (na bhujissāni).
Buddhādīhi viññūhi na pasatthattā na viññuppasatthāni.
They are na viññuppasatthāni (not praised by the wise) because they are not commended by the Buddhas and other wise ones.
Do không được các bậc hiền trí như chư Phật tán thán, chúng được gọi là không được bậc trí tán thán (na viññuppasatthāni).
Taṇhādiṭṭhīhi parāmaṭṭhattā, kenaci vā ‘‘ayaṃ te sīlesu doso’’ti parāmaṭṭhuṃ sakkuṇeyyatāya parāmaṭṭhāni.
They are parāmaṭṭhāni (grasped) because they are grasped by craving and wrong view, or because someone might be able to find fault with them by saying, "This is a flaw in your sīla."
Do bị ái và tà kiến chấp thủ, hoặc do có thể bị người khác chỉ trích rằng "đây là lỗi trong giới của ông", chúng được gọi là bị chấp thủ (parāmaṭṭhāni).
Upacārasamādhiṃ appanāsamādhiṃ vā, atha vā maggasamādhiṃ phalasamādhiṃ vā na saṃvattayantīti asamādhisaṃvattanikāni.
They are asamādhisaṃvattanikāni (not conducive to concentration) because they do not lead to access concentration (upacārasamādhi) or absorption concentration (appanāsamādhi), or to path concentration (maggasamādhi) or fruition concentration (phalasamādhi).
Do không đưa đến cận hành định hay an chỉ định, hoặc không đưa đến đạo định hay quả định, chúng được gọi là không đưa đến định (asamādhisaṃvattanikāni).
Na samādhisaṃvattanikānītipi pāṭho.
"Na samādhisaṃvattanikāni" is also a reading.
Cũng có bản đọc là "na samādhisaṃvattanikāni".
911
Keci pana ‘‘khaṇḍānīti kusalānaṃ dhammānaṃ appatiṭṭhābhūtattā, chiddānītipi evaṃ.
Some, however, explain the meaning thus: "Khaṇḍāni because they are not a foundation for wholesome states; chiddāni, similarly.
Một số vị lại giải thích ý nghĩa như sau: "bị sứt mẻ (khaṇḍāni) là do không phải là nền tảng cho các pháp thiện; bị thủng (chiddāni) cũng vậy.
Sabalānīti vivaṇṇakaraṇattā, kammāsānītipi evaṃ.
Sabalāni because they cause disrepute; kammāsāni, similarly.
Bị lốm đốm (sabalāni) là do làm cho biến sắc; bị lang lổ (kammāsāni) cũng vậy.
Na bhujissānīti taṇhādāsabyaṃ gatattā.
Na bhujissāni because they have fallen into the slavery of craving.
Không giải thoát (na bhujissāni) là do đã trở thành nô lệ cho ái dục.
Na viññuppasatthānīti kusalehi garahitattā.
Na viññuppasatthāni because they are blamed by the wholesome.
Không được bậc trí tán thán (na viññuppasatthāni) là do bị các bậc thiện trí chê trách.
Parāmaṭṭhānīti taṇhāya gahitattā.
Parāmaṭṭhāni because they are grasped by craving.
Bị chấp thủ (parāmaṭṭhāni) là do bị ái dục nắm giữ.
Asamādhisaṃvattanikānīti vippaṭisāravatthubhūtattā’’ti evamatthaṃ vaṇṇayanti.
Asamādhisaṃvattanikāni because they are a cause for remorse."
Không đưa đến định (asamādhisaṃvattanikāni) là do trở thành đối tượng của sự hối hận".
912
Na avippaṭisāravatthukānīti vippaṭisārāvahattā avippaṭisārassa patiṭṭhā na hontīti attho.
Na avippaṭisāravatthukāni means that, since they lead to remorse, they are not a basis for freedom from remorse.
Không phải là đối tượng của sự không hối hận (na avippaṭisāravatthukāni) có nghĩa là: do mang lại sự hối hận, chúng không phải là nền tảng cho sự không hối hận.
Na pāmojjavatthukānīti avippaṭisārajāya dubbalapītiyā na vatthubhūtāni tassā anāvahattā.
Na pāmojjavatthukāni means that they are not a basis for the weak joy that arises from freedom from remorse, as they do not bring it about.
Không phải là đối tượng của hân hoan (na pāmojjavatthukāni) có nghĩa là: chúng không phải là đối tượng cho hỷ yếu ớt sanh từ sự không hối hận, vì chúng không mang lại hỷ ấy.
Evaṃ sesesupi yojanā kātabbā.
Similarly, the connection should be made for the remaining terms.
Cách kết hợp này cũng nên được áp dụng cho các trường hợp còn lại.
Na pītivatthukānīti dubbalapītijāya balavapītiyā na vatthubhūtāni.
Na pītivatthukāni means they are not a basis for strong joy that arises from weak joy.
Không phải là đối tượng của hỷ (na pītivatthukāni) có nghĩa là: chúng không phải là đối tượng cho hỷ mạnh mẽ sanh từ hỷ yếu ớt.
Na passaddhivatthukānīti balavapītijāya kāyacittapassaddhiyā na vatthubhūtāni.
Na passaddhivatthukāni means they are not a basis for bodily and mental tranquility that arises from strong joy.
Không phải là đối tượng của khinh an (na passaddhivatthukāni) có nghĩa là: chúng không phải là đối tượng cho thân và tâm khinh an sanh từ hỷ mạnh mẽ.
Na sukhavatthukānīti passaddhijassa kāyikacetasikasukhassa na vatthubhūtāni.
Na sukhavatthukāni means they are not a basis for bodily and mental happiness that arises from tranquility.
Không phải là đối tượng của lạc (na sukhavatthukāni) có nghĩa là: chúng không phải là đối tượng cho lạc về thân và tâm sanh từ khinh an.
Na samādhivatthukānīti sukhajassa samādhissa na vatthubhūtāni.
Na samādhivatthukāni means they are not a basis for concentration that arises from happiness.
Không phải là đối tượng của định (na samādhivatthukāni) có nghĩa là: chúng không phải là đối tượng cho định sanh từ lạc.
Na yathābhūtañāṇadassanavatthukānīti samādhipadaṭṭhānassa yathābhūtañāṇadassanassa na vatthubhūtāni.
Na yathābhūtañāṇadassanavatthukāni means they are not a basis for knowledge and vision of things as they really are, which has concentration as its proximate cause.
Không phải là nền tảng của tuệ tri và kiến giải đúng như thật có nghĩa là không phải là nền tảng của tuệ tri và kiến giải đúng như thật có thiền định làm cận nhân.
913
Na ekantanibbidāyātiādīsu na-kārameva āharitvā ‘‘na virāgāyā’’tiādinā nayena sesapadehipi yojetabbaṃ.
In phrases like na ekantanibbidāyā and so on, the negative particle na should be carried over and connected to the other terms, such as "na virāgāyā" and so forth.
Trong các cụm từ như không vì sự chán ghét hoàn toàn, chỉ nên lấy chữ na (không) và kết hợp với các từ còn lại theo cách như “không vì sự ly tham”.
Na virāgāyātiādīsu sanakāro vā pāṭho.
"Na virāgāyā" and so on is also a reading, with the particle "sa".
Trong các cụm từ như không vì sự ly tham, cũng có cách đọc là có chữ 'na'.
Tattha ekantanibbidāyāti ekantena vaṭṭe nibbindanatthāya na saṃvattantīti sambandho.
Here, ekantanibbidāyā means "not conducive to utter disenchantment with saṃsāra" – this is the connection.
Trong đó, vì sự chán ghét hoàn toàn có liên hệ là không đưa đến sự chán ghét hoàn toàn đối với vòng luân hồi.
Evaṃ sesesupi yojetabbaṃ.
Similarly, the connection should be made for the remaining terms.
Cũng vậy, nên kết hợp với các từ còn lại.
Virāgāyāti vaṭṭe virajjanatthāya.
Virāgāyā means for dispassion towards saṃsāra.
Vì sự ly tham có nghĩa là vì sự ly tham đối với vòng luân hồi.
Nirodhāyāti vaṭṭassa nirodhanatthāya.
Nirodhāyā means for the cessation of saṃsāra.
Vì sự đoạn diệt có nghĩa là vì sự đoạn diệt của vòng luân hồi.
Upasamāyāti nirodhitassa puna anuppattivasena vaṭṭassa upasamanatthāya.
Upasamāyā means for the appeasement of saṃsāra, in the sense of its non-arising again once it has ceased.
Vì sự an tịnh có nghĩa là vì sự an tịnh của vòng luân hồi, theo cách không tái sinh sau khi đã đoạn diệt.
Abhiññāyāti vaṭṭassa abhijānanatthāya.
For direct knowledge means for directly knowing the cycle of existence (vaṭṭa).
Vì sự thắng tri có nghĩa là vì sự thắng tri vòng luân hồi.
Sambodhāyāti kilesaniddāvigamena vaṭṭato pabujjhanatthāya.
For full awakening means for awakening from the cycle of existence (vaṭṭa) by shedding the slumber of defilements (kilesa).
Vì sự giác ngộ tối thượng có nghĩa là vì sự thức tỉnh khỏi vòng luân hồi do sự chấm dứt giấc ngủ phiền não.
Nibbānāyāti amatanibbānatthāya.
For Nibbāna means for the deathless Nibbāna.
Vì Niết Bàn có nghĩa là vì Niết Bàn bất tử.
914
Yathāsamādinnaṃ sikkhāpadaṃ vītikkamāyāti yathāsamādinnassa sikkhāpadassa vītikkamanatthāya.
For transgressing the precept as undertaken means for transgressing the precept as it was undertaken.
Vì sự vi phạm giới luật đã thọ trì có nghĩa là vì sự vi phạm giới luật đã thọ trì.
Vibhattivipallāsavasena panettha upayogavacanaṃ kataṃ.
Here, the accusative case (upayogavacana) is used due to a change in inflection (vibhattivipallāsa).
Ở đây, từ upayoga (dụng cách) được dùng do sự thay đổi biến cách.
Cittampi na uppādetīti cittuppādasuddhiyā sīlassa ativisuddhabhāvadassanatthaṃ vuttaṃ, na pana cittuppādamattena sīlaṃ bhijjati.
Does not even generate a thought is stated to show the extremely pure state of sīla through the purity of thought generation, for sīla is not broken merely by the generation of a thought.
Cũng không khởi tâm được nói để chỉ sự thanh tịnh tột bậc của giới do sự thanh tịnh của tâm khởi, chứ không phải giới bị phá hoại chỉ bởi sự khởi tâm.
Kiṃ so vītikkamissatīti kimatthaṃ vītikkamaṃ karissati, neva vītikkamaṃ karissatīti attho.
How will he transgress? means for what purpose will he transgress? The meaning is that he will not transgress at all.
Người ấy sẽ vi phạm điều gì? có nghĩa là vì mục đích gì mà người ấy sẽ vi phạm? Người ấy sẽ không vi phạm, đó là ý nghĩa.
Akhaṇḍānītiādīni heṭṭhā vuttapaṭipakkhanayena veditabbāni.
Unbroken and so on should be understood in the opposite way to what was stated below.
Các từ như không bị sứt mẻ v.v. nên được hiểu theo cách đối nghịch đã nói ở trên.
Na khaṇḍānītipi pāṭho.
"Not broken" is also a reading.
Cũng có cách đọc là na khaṇḍāni (không sứt mẻ).
‘‘Ekantanibbidāyā’’tiādīsu ekantena vaṭṭe nibbindanatthāyātiādinā nayena yojetabbaṃ.
In phrases like ‘‘for complete disenchantment’’ and so on, it should be connected in the manner of ‘‘for becoming completely disenchanted with the cycle of existence’’ and so forth.
Trong các cụm từ như “vì sự chán ghét hoàn toàn”, nên kết hợp theo cách như “vì sự chán ghét hoàn toàn đối với vòng luân hồi”.
Ettha pana nibbidāyāti vipassanā.
Here, for disenchantment is vipassanā.
Ở đây, vì sự chán ghét là vipassanā (thiền quán).
Virāgāyāti maggo.
For dispassion is the path (magga).
Vì sự ly tham là đạo.
Nirodhāya upasamāyāti nibbānaṃ.
For cessation, for tranquillity is Nibbāna.
Vì sự đoạn diệt, vì sự an tịnh là Niết Bàn.
Abhiññāya sambodhāyāti maggo.
For direct knowledge, for full awakening is the path (magga).
Vì sự thắng tri, vì sự giác ngộ tối thượng là đạo.
Nibbānāyāti nibbānameva.
For Nibbāna is Nibbāna itself.
Vì Niết Bàn chính là Niết Bàn.
Ekasmiṃ ṭhāne vipassanā, dvīsu maggo, tīsu nibbānaṃ vuttanti evaṃ avatthānakathā veditabbā.
Thus, the explanation of states should be understood: vipassanā is stated in one place, the path in two, and Nibbāna in three.
Nên hiểu sự phân loại này như thế này: vipassanā được nói ở một chỗ, đạo ở hai chỗ, và Niết Bàn ở ba chỗ.
Pariyāyena pana sabbānipetāni maggavevacanānipi nibbānavevacanānipi hontiyeva.
However, by way of पर्याय (pariyāya), all these terms are indeed synonyms for the path and synonyms for Nibbāna.
Tuy nhiên, theo cách gián tiếp, tất cả những từ này đều có thể là đồng nghĩa của đạo hoặc đồng nghĩa của Niết Bàn.
915
39. Idāni pariyantāpariyantavasena vijjamānapabhedaṃ dassetvā puna dhammavasena jātivasena paccayavasena sampayuttavasena sīlassa pabhedaṃ dassetuṃ kiṃ sīlantiādimāha.
39. Now, after showing the existing distinctions of sīla in terms of limited and unlimited, the Elder, the General of the Dhamma, begins by saying What is sīla? and so on, to further show the distinctions of sīla in terms of dhammas, origins, conditions, and concomitants.
39. Giờ đây, sau khi đã chỉ ra sự phân loại hiện có theo giới hạn và không giới hạn, để chỉ ra sự phân loại của giới theo pháp, theo loại, theo duyên và theo sự tương ưng, Ngài nói giới là gì v.v.
Tattha samuṭṭhāti etenāti samuṭṭhānaṃ.
There, that by which something arises is its origin (samuṭṭhāna).
Trong đó, samuṭṭhāna là cái mà từ đó khởi lên.
Paccayassetaṃ nāmaṃ.
This is a name for a condition.
Đây là tên của nhân duyên.
Kiṃ samuṭṭhānamassāti kiṃsamuṭṭhānaṃ.
What is its origin? means what is its origin?
Kiṃ samuṭṭhānaṃ (từ đâu khởi lên) có nghĩa là cái gì là sự khởi lên của nó?
Katinaṃ dhammānaṃ samodhānaṃ samavāyo assāti katidhammasamodhānaṃ.
What is the combination of dhammas? means what is the combination or concurrence of dhammas for it?
Katidhammasamodhānaṃ (sự kết hợp của bao nhiêu pháp) có nghĩa là sự kết hợp, sự hòa hợp của bao nhiêu pháp là của nó?
916
Cetanā sīlanti pāṇātipātādīhi viramantassa, vattapaṭipattiṃ vā pūrentassa cetanā.
Volitional sīla is the volition of one who abstains from killing and so forth, or who fulfills the practices of duty.
Tâm sở là giới là ý muốn của người kiêng cữ sát sinh v.v., hoặc của người hoàn thành sự thực hành phận sự.
Cetasikaṃ sīlanti pāṇātipātādīhi viramantassa virati.
Mental sīla is the abstinence of one who abstains from killing and so forth.
Giới tâm sở là sự kiêng cữ của người kiêng cữ sát sinh v.v.
Apica cetanā sīlaṃ nāma pāṇātipātādīni pajahantassa sattakammapathacetanā.
Furthermore, volitional sīla is the seven kamma-path volitions of one who abandons killing and so forth.
Hơn nữa, giới là tâm sở có nghĩa là tâm sở của bảy nghiệp đạo của người từ bỏ sát sinh v.v.
Cetasikaṃ sīlaṃ nāma ‘‘abhijjhaṃ loke pahāya vigatābhijjhena cetasā viharatī’’tiādinā (dī. ni. 1.217) nayena vuttā anabhijjhāabyāpādasammādiṭṭhidhammā.
Mental sīla refers to the dhammas of non-covetousness, non-ill-will, and right view, as stated in the manner of ‘‘abandoning covetousness in the world, one dwells with a mind free from covetousness’’ and so forth.
Giới tâm sở có nghĩa là các pháp không tham, không sân, chánh kiến được nói theo cách như “từ bỏ tham ái trong thế gian, sống với tâm không tham ái” v.v.
Saṃvaro sīlanti ettha pañcavidho saṃvaro veditabbo – pātimokkhasaṃvaro, satisaṃvaro, ñāṇasaṃvaro, khantisaṃvaro, vīriyasaṃvaroti.
Here, in restraint is sīla, five kinds of restraint should be understood: Pātimokkha restraint, mindfulness restraint, knowledge restraint, patience restraint, and energy restraint.
Trong sự phòng hộ là giới, nên hiểu có năm loại phòng hộ: phòng hộ ba-la-đề-mộc-xoa (pātimokkha-saṃvara), phòng hộ niệm (sati-saṃvara), phòng hộ tuệ (ñāṇa-saṃvara), phòng hộ nhẫn (khanti-saṃvara), phòng hộ tinh tấn (vīriya-saṃvara).
Tattha ‘‘iminā pātimokkhasaṃvarena upeto hoti samupeto’’ti (vibha. 511) ayaṃ pātimokkhasaṃvaro.
Among these, Pātimokkha restraint is that which states: ‘‘One is endowed with, fully endowed with, this Pātimokkha restraint.’’
Trong đó, “vị ấy được trang bị, hoàn toàn trang bị với sự phòng hộ ba-la-đề-mộc-xoa này” thì đây là phòng hộ ba-la-đề-mộc-xoa.
‘‘Rakkhati cakkhundriyaṃ, cakkhundriye saṃvaraṃ āpajjatī’’ti (dī. ni. 1.213; ma. ni. 1.295; saṃ. ni. 4.239; a. ni. 3.16) ayaṃ satisaṃvaro.
Mindfulness restraint is that which states: ‘‘One guards the eye-faculty, one undertakes restraint in the eye-faculty.’’
“Vị ấy bảo vệ nhãn căn, thực hành sự phòng hộ đối với nhãn căn” thì đây là phòng hộ niệm.
917
‘‘Yāni sotāni lokasmiṃ, (ajitāti bhagavā;)
‘‘Whatever streams there are in the world,
“Này Ajita, những dòng chảy nào trong thế gian,
918
Sati tesaṃ nivāraṇaṃ;
Mindfulness is their obstruction;
Niệm là sự ngăn chặn chúng;
919
Sotānaṃ saṃvaraṃ brūmi, paññāyete pidhīyare’’ti.(su. ni. 1041) –
I declare the restraint of streams; they are closed by wisdom.’’
Ta nói sự phòng hộ của các dòng chảy, chúng được đóng lại bằng trí tuệ.” –
920
Ayaṃ ñāṇasaṃvaro.
This is knowledge restraint.
Đây là phòng hộ tuệ.
Paccayapaṭisevanampi ettheva samodhānaṃ gacchati.
The proper use of requisites also falls under this category.
Sự thọ dụng vật dụng cũng được bao gồm ở đây.
Yo panāyaṃ ‘‘khamo hoti sītassa uṇhassā’’tiādinā (ma. ni. 1.24; a. ni. 4.114; 6.58) nayena āgato, ayaṃ khantisaṃvaro nāma.
That which is stated in the manner of ‘‘one is patient with cold, with heat’’ and so forth, is called patience restraint.
Sự phòng hộ được đề cập theo cách như “vị ấy chịu đựng được lạnh và nóng” v.v. thì đây gọi là phòng hộ nhẫn.
Yo cāyaṃ ‘‘uppannaṃ kāmavitakkaṃ nādhivāsetī’’tiādinā (ma. ni. 1.26; a. ni. 4.114; 6.58) nayena āgato, ayaṃ vīriyasaṃvaro nāma.
And that which is stated in the manner of ‘‘one does not tolerate a arisen thought of sensual desire’’ and so forth, is called energy restraint.
Sự phòng hộ được đề cập theo cách như “vị ấy không dung thứ những dục tầm đã khởi lên” v.v. thì đây gọi là phòng hộ tinh tấn.
Ājīvapārisuddhipi ettheva samodhānaṃ gacchati.
Purity of livelihood also falls under this category.
Sự thanh tịnh về phương tiện sinh sống cũng được bao gồm ở đây.
Iti ayaṃ pañcavidhopi saṃvaro, yā ca pāpabhīrukānaṃ kulaputtānaṃ sampattavatthuto virati, sabbametaṃ saṃvarasīlanti veditabbaṃ.
Thus, all five kinds of restraint, and the abstinence of virtuous young men from objects that have come into contact, should be understood as restraint-sīla.
Như vậy, tất cả năm loại phòng hộ này, và sự kiêng cữ khỏi các đối tượng hiện hữu của các thiện nam tử sợ ác, tất cả đều nên được hiểu là giới phòng hộ.
Avītikkamo sīlanti samādinnasīlassa kāyikavācasiko avītikkamo.
Non-transgression is sīla means the bodily and verbal non-transgression of the undertaken sīla.
Sự không vi phạm là giới là sự không vi phạm về thân và lời nói của giới đã thọ trì.
Idaṃ tāva kiṃ sīlanti pañhassa vissajjanaṃ.
This is, first of all, the answer to the question What is sīla?
Đây là lời giải đáp cho câu hỏi giới là gì.
921
Kati sīlānīti pañhassa vissajjane kusalasīlaṃ akusalasīlaṃ abyākatasīlanti ettha yasmā loke tesaṃ tesaṃ sattānaṃ pakati sīlanti vuccati, yaṃ sandhāya ‘‘ayaṃ sukhasīlo, ayaṃ dukkhasīlo, ayaṃ kalahasīlo, ayaṃ maṇḍanasīlo’’ti bhaṇanti.
In the answer to the question "How many sīlas?", in the words "wholesome sīla, unwholesome sīla, indeterminate sīla", because in the world the nature or habit of various beings is called sīla, referring to which they say, "This one has a pleasant nature, this one has a suffering nature, this one has a quarrelsome nature, this one has an adorning nature."
Trong lời giải đáp cho câu hỏi có bao nhiêu loại giới, ở đây, trong giới thiện, giới bất thiện, giới vô ký, vì trong thế gian, bản chất của từng chúng sinh được gọi là giới, mà theo đó người ta nói “người này có bản chất hạnh phúc, người này có bản chất đau khổ, người này có bản chất tranh cãi, người này có bản chất trang điểm”.
Tasmā tena pariyāyena atthuddhāravasena akusalasīlamapi sīlanti vuttaṃ.
Therefore, in that sense, by way of extracting the meaning, even unwholesome sīla is called sīla.
Vì vậy, theo cách gián tiếp đó, giới bất thiện cũng được gọi là giới theo cách rút ra ý nghĩa.
Taṃ pana ‘‘sutvāna saṃvare paññā’’ti (paṭi. ma. 1.37) vacanato idhādhippetasīlaṃ na hotīti.
However, that is not the sīla intended here, according to the saying "Wisdom is restraint after hearing."
Tuy nhiên, giới đó không phải là giới được đề cập ở đây, theo câu nói “trí tuệ trong sự phòng hộ sau khi nghe”.
922
Yasmā pana cetanādibhedassa sīlassa sampayuttacittaṃ samuṭṭhānaṃ, tasmā kusalacittasamuṭṭhānaṃ kusalasīlantiādimāha.
Since the associated consciousness is the origin of sīla, which is differentiated by volition and so forth, therefore it is said, "Wholesome sīla is that which originates from wholesome consciousness," and so on.
Vì tâm tương ưng là sự khởi lên của giới có sự phân loại như ý muốn v.v., nên Ngài nói giới thiện khởi lên từ tâm thiện v.v.
923
Saṃvarasamodhānaṃ sīlanti saṃvarasampayuttakhandhā.
"Sīla as the combination of restraint" refers to the aggregates associated with restraint.
Giới hòa hợp với sự phòng hộ là các uẩn tương ưng với sự phòng hộ.
Te hi saṃvarena samāgatā missībhūtāti saṃvarasamodhānanti vuttā.
For these are combined and mingled with restraint, hence they are called "combination of restraint."
Chúng được gọi là hòa hợp với sự phòng hộ vì chúng đã kết hợp và hòa lẫn với sự phòng hộ.
Evaṃ avītikkamasamodhānaṃ sīlampi veditabbaṃ.
Similarly, sīla as the combination of non-transgression should also be understood.
Cũng vậy, giới hòa hợp với sự không vi phạm cũng nên được hiểu.
Tathābhāve jātacetanā samodhānaṃ sīlanti saṃvarabhāve avītikkamabhāve jātacetanāsampayuttā khandhā.
"Sīla as the combination of volition arisen in such a state" refers to the aggregates associated with volition arisen in the state of restraint or the state of non-transgression.
Giới hòa hợp với tâm sở đã khởi lên trong trạng thái đó là các uẩn tương ưng với tâm sở đã khởi lên trong trạng thái phòng hộ và trạng thái không vi phạm.
Yasmā ca tīsupi cetesu taṃsampayuttā dhammā adhippetā, tasmā cetanāsamodhānena cetasikānampi saṅgahitattā cetasikasamodhānasīlaṃ visuṃ na niddiṭṭhanti veditabbaṃ.
And since in all three cases, the dhammas associated with them are intended, therefore, because mental factors are also included by the combination of volition, it should be understood that sīla as the combination of mental factors is not stated separately.
Và vì các pháp tương ưng với các tâm sở đó được đề cập trong cả ba trường hợp, nên nên hiểu rằng giới tâm sở không được chỉ ra riêng biệt vì các giới tâm sở cũng được bao gồm bởi giới hòa hợp với tâm sở.
Heṭṭhā cetanādayo dhammā ‘‘sīla’’nti vuttā.
Below, volition and other dhammas were called "sīla."
Ở trên, các pháp như tâm sở v.v. được gọi là “giới”.
Na kevalaṃ te eva sīlaṃ, taṃsampayuttā dhammāpi sīlamevāti dassanatthaṃ ayaṃ tiko vuttoti veditabbo.
It should be understood that this triad was stated to show that not only those are sīla, but also the dhammas associated with them are sīla.
Không chỉ riêng chúng là giới, mà các pháp tương ưng với chúng cũng là giới, để chỉ ra điều này, bộ ba này được nói.
924
40. Idāni yasmā cetanācetasikā saṃvarāvītikkamāyeva honti na visuṃ, tasmā saṃvarāvītikkameyeva yāva arahattamaggā sādhāraṇakkamena yojento pāṇātipātaṃ saṃvaraṭṭhena sīlaṃ, avītikkamaṭṭhena sīlantiādimāha.
Now, since volition and mental factors are precisely restraint and non-transgression, and not separate from them, therefore, applying them in a common sequence within restraint and non-transgression up to the path of Arahantship, it is said, "Refraining from killing is sīla by way of restraint, sīla by way of non-transgression," and so on.
40. Giờ đây, vì tâm sở và các pháp tâm sở chỉ là sự phòng hộ và không vi phạm chứ không phải là riêng biệt, nên để kết hợp chúng theo thứ tự chung trong sự phòng hộ và không vi phạm cho đến đạo A-la-hán, Ngài nói kiêng cữ sát sinh là giới theo ý nghĩa phòng hộ, là giới theo ý nghĩa không vi phạm v.v.
Pāṇātipātā veramaṇiādayo hi yasmā attano attano paccanīkaṃ saṃvaranti, taṃ na vītikkamanti ca, tasmā saṃvaraṇato avītikkamanato ca saṃvaraṭṭhena sīlaṃ avītikkamaṭṭhena sīlaṃ nāma hoti.
For abstentions from killing and so forth, since they restrain their respective opponents and do not transgress them, therefore, by reason of restraining and by reason of not transgressing, they are called sīla by way of restraint and sīla by way of non-transgression.
Vì sự kiêng cữ sát sinh v.v. ngăn chặn đối tượng đối nghịch của chính nó và không vi phạm nó, nên nó được gọi là giới theo ý nghĩa phòng hộ và giới theo ý nghĩa không vi phạm do sự ngăn chặn và không vi phạm.
Tattha pāṇātipātaṃ saṃvaraṭṭhenāti pāṇātipātassa pidahanaṭṭhena sīlaṃ.
Among these, "killing is sīla by way of restraint" means sīla by way of blocking killing.
Trong đó, kiêng cữ sát sinh là giới theo ý nghĩa phòng hộ có nghĩa là giới theo ý nghĩa ngăn chặn sự sát sinh.
Kiṃ taṃ?
What is that?
Nó là gì?
Pāṇātipātā veramaṇī.
Abstention from killing.
Đó là sự kiêng cữ sát sinh.
Sā ca taṃ saṃvarantīyeva taṃ na vītikkamatīti avītikkamaṭṭhena sīlaṃ.
And since that abstention, while restraining it, does not transgress it, it is sīla "by way of non-transgression."
Và giới (sīla) đó, vì nó ngăn giữ (saṃvarantī) điều đó (tức là sự vi phạm) và không vượt qua (na vītikkamati) điều đó, nên được gọi là giới theo ý nghĩa không vượt qua (avītikkamaṭṭhena).
Evameva adinnādānā veramaṇiādayo anabhijjhāabyāpādasammādiṭṭhiyo yojetabbā.
In the same way, abstention from taking what is not given and so forth, as well as non-covetousness, non-ill-will, and right view, should be applied.
Tương tự như vậy, các sự từ bỏ trộm cắp (adinnādānā veramaṇī) và các điều khác, cùng với vô tham (anabhijjhā), vô sân (abyāpāda) và chánh kiến (sammādiṭṭhi) cũng nên được áp dụng.
925
Pāṇātipātantiādīsu pana dasasu akusalakammapathesu pāṇassa atipāto pāṇātipāto.
Among the ten unwholesome courses of action, such as "killing" and so forth, the destruction of life is killing (pāṇātipāta).
Trong mười ác nghiệp đạo (akusalakammapatha) như sát sinh (pāṇātipāta), sự hủy hoại sinh mạng (pāṇa) chính là sát sinh (pāṇātipāta).
Pāṇavadho pāṇaghātoti vuttaṃ hoti.
It means the slaying of life, the killing of life.
Điều đó có nghĩa là giết hại sinh mạng, làm tổn hại sinh mạng.
Pāṇoti cettha vohārato satto, paramatthato jīvitindriyaṃ.
Here, life (pāṇa) conventionally refers to a being, ultimately to the faculty of life (jīvitindriya).
Ở đây, sinh mạng (pāṇa) theo cách nói thông thường là chúng sinh (satto), theo nghĩa tối hậu (paramattha) là sinh mạng căn (jīvitindriyaṃ).
Tasmiṃ pana pāṇe pāṇasaññino jīvitindriyupacchedakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā vadhakacetanā pāṇātipāto.
And in the case of that life, when there is the perception of a living being, the volition to kill, which initiates an effort to cut off the faculty of life, arising through one of the two doors, bodily or verbal, is killing.
Trong trường hợp đó, sát sinh (pāṇātipāta) là ý muốn giết hại (vadhakacetanā) được phát sinh từ một trong hai cửa thân (kāya) hoặc khẩu (vacī), do sự cố gắng (upakkama) hủy hoại sinh mạng căn (jīvitindriya) của một người có nhận thức (saññī) về sinh mạng đó.
So guṇavirahitesu tiracchānagatādīsu pāṇesu khuddake pāṇe appasāvajjo, mahāsarīre mahāsāvajjo.
This killing is of less fault when directed towards small beings such as animals devoid of virtues, but of great fault when directed towards large-bodied beings.
Sự sát sinh đó, đối với các chúng sinh thiếu đức (guṇavirahita) như loài súc sinh (tiracchānagata) và các loài khác, nếu là chúng sinh nhỏ thì tội nhẹ (appasāvajja), nếu là thân lớn thì tội nặng (mahāsāvajja).
Kasmā?
Why?
Vì sao?
Payogamahantatāya.
Due to the magnitude of the effort.
Vì sự lớn lao của hành động (payogamahantatāya).
Payogasamattepi vatthumahantatāya.
Even with equal effort, due to the magnitude of the object.
Ngay cả khi hành động tương đương, tội vẫn nặng hơn do sự lớn lao của đối tượng (vatthumahantatāya).
Guṇavantesu manussādīsu appaguṇe pāṇe appasāvajjo, mahāguṇe mahāsāvajjo.
When directed towards virtuous beings such as humans, it is of less fault when the being has few virtues, but of great fault when the being has many virtues.
Đối với các chúng sinh có đức (guṇavanta) như loài người (manussa) và các loài khác, nếu là chúng sinh ít đức thì tội nhẹ, nếu là chúng sinh nhiều đức thì tội nặng.
Sarīraguṇānaṃ pana samabhāve sati kilesānaṃ upakkamānañca mudutāya appasāvajjo, tibbatāya mahāsāvajjoti veditabbo.
And when the bodily virtues are equal, it should be understood that it is of less fault due to the mildness of defilements and efforts, but of great fault due to their intensity.
Và cần biết rằng, khi đức của thân (sarīraguṇa) ngang bằng, nếu phiền não (kilesa) và hành động (upakkama) nhẹ nhàng thì tội nhẹ, nếu mãnh liệt thì tội nặng.
Tassa pañca sambhārā – pāṇo, pāṇasaññitā, vadhakacittaṃ, upakkamo, tena maraṇanti.
Its five components are: a living being, the perception of a living being, the intention to kill, the effort, and death by that effort.
Có năm yếu tố (sambhārā) của sát sinh: sinh mạng (pāṇa), nhận thức về sinh mạng (pāṇasaññitā), ý muốn giết hại (vadhakacittaṃ), hành động (upakkamo), và cái chết do đó (tena maraṇaṃ).
926
Adinnassa ādānaṃ adinnādānaṃ, parasaṃharaṇaṃ, theyyaṃ, corikāti vuttaṃ hoti.
The taking of what is not given is taking what is not given (adinnādānaṃ), which means taking another's property, theft, or stealing.
Sự lấy của không cho là trộm cắp (adinnādānaṃ), có nghĩa là chiếm đoạt của người khác (parasaṃharaṇaṃ), ăn trộm (theyyaṃ), hoặc hành vi trộm cắp (corikā).
Tattha adinnanti parapariggahitaṃ, yattha paro yathākāmakāritaṃ āpajjanto adaṇḍāraho anupavajjo ca hoti, tasmiṃ parapariggahite parapariggahitasaññino tadādāyakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā theyyacetanā adinnādānaṃ.
Here, "what is not given" refers to what is owned by another, concerning which the owner, acting as he wishes, is not liable to punishment and is not to be blamed; when there is the perception of another's owned property in that owned property, the volition to steal, which initiates an effort to take it, arising through one of the two doors, bodily or verbal, is taking what is not given.
Ở đây, của không cho (adinnaṃ) là vật sở hữu của người khác (parapariggahitaṃ), mà người chủ có quyền tự do sử dụng mà không bị trừng phạt (adaṇḍāraha) hay chỉ trích (anupavajja). Trộm cắp (adinnādānaṃ) là ý muốn trộm cắp (theyyacetanā) được phát sinh từ một trong hai cửa thân (kāya) hoặc khẩu (vacī), do sự cố gắng lấy đi vật đó của một người có nhận thức (saññī) về vật sở hữu của người khác.
Taṃ hīne parasantake appasāvajjaṃ, paṇīte mahāsāvajjaṃ.
This is of less fault with regard to another's inferior property, but of great fault with regard to another's excellent property.
Sự trộm cắp đó, đối với vật của người khác thấp kém thì tội nhẹ, đối với vật quý giá thì tội nặng.
Kasmā?
Why?
Vì sao?
Vatthupaṇītatāya.
Due to the excellence of the object.
Vì sự quý giá của vật (vatthupaṇītatāya).
Vatthusamatte sati guṇādhikānaṃ santake vatthusmiṃ mahāsāvajjaṃ, taṃ taṃ guṇādhikaṃ upādāya tato tato hīnaguṇassa santake vatthusmiṃ appasāvajjaṃ.
When the object is equal (in value), it is a great offense regarding an object belonging to those superior in virtue; considering those superior in virtue, it is a minor offense regarding an object belonging to one inferior in virtue compared to those superior ones.
Khi vật ngang bằng, đối với vật của người có nhiều đức thì tội nặng, đối với vật của người có ít đức hơn thì tội nhẹ, tùy thuộc vào phẩm chất của người đó.
Tassa pañca sambhārā – parapariggahitaṃ, parapariggahitasaññitā theyyacittaṃ, upakkamo, tena haraṇanti.
Its five constituents are: an object owned by another, the perception that it is owned by another, the intention to steal, the effort, and the taking by that (effort).
Có năm yếu tố của trộm cắp: vật sở hữu của người khác (parapariggahitaṃ), nhận thức về vật sở hữu của người khác (parapariggahitasaññitā), ý muốn trộm cắp (theyyacittaṃ), hành động (upakkamo), và sự lấy đi do đó (tena haraṇaṃ).
927
Kāmesūti methunasamācāresu.
"In sensual pleasures" means in sexual conduct.
Trong các dục (kāmesu) có nghĩa là trong các hành vi giao hợp (methunasamācāresu).
Micchācāroti ekantanindito lāmakācāro.
"Wrong conduct" means utterly blameworthy, base conduct.
Tà hạnh (micchācāro) là hành vi xấu xa, bị lên án tuyệt đối.
Lakkhaṇato pana asaddhammādhippāyena kāyadvārappavattā agamanīyaṭṭhānavītikkamacetanā kāmesu micchācāro.
However, by definition, kāmesu micchācāro is the volition that arises through the bodily door with the intention of unwholesome conduct, transgressing places not to be gone to.
Tuy nhiên, theo đặc tính, tà hạnh trong các dục (kāmesu micchācāro) là ý muốn vi phạm (vītikkamacetanā) ở những nơi không nên đến (agamanīyaṭṭhāna) được phát sinh qua cửa thân (kāyadvāra), với ý định làm điều bất thiện (asaddhamma).
928
Tattha agamanīyaṭṭhānaṃ nāma purisānaṃ tāva māturakkhitā, piturakkhitā, mātāpiturakkhitā, bhāturakkhitā, bhaginirakkhitā, ñātirakkhitā, gottarakkhitā, dhammarakkhitā, sārakkhā, saparidaṇḍāti māturakkhitādayo dasa, dhanakkītā, chandavāsinī, bhogavāsinī, paṭavāsinī, odapattakinī, obhatacumbaṭā, dāsī ca, bhariyā ca, kammakārī ca bhariyā ca, dhajāhaṭā muhuttikāti dhanakkītādayo dasāti vīsati itthiyo.
Among these, "places not to be gone to" for men are twenty types of women: the ten such as a woman protected by her mother, protected by her father, protected by both mother and father, protected by her brother, protected by her sister, protected by relatives, protected by clan, protected by Dhamma, a protected woman, and a woman subject to penalty; and the ten such as a woman bought with wealth, a woman who lives by mutual consent, a woman who lives by receiving provisions, a woman who lives by receiving clothes, a woman who joins hands in a water-pot, a woman whose head-pad has been removed, a slave who is also a wife, a worker who is also a wife, a captive woman, and a temporary wife.
Ở đây, nơi không nên đến (agamanīyaṭṭhānaṃ) đối với đàn ông là hai mươi loại phụ nữ: mười loại như người được mẹ bảo vệ (māturakkhitā), được cha bảo vệ (piturakkhitā), được cha mẹ bảo vệ (mātāpiturakkhitā), được anh em bảo vệ (bhāturakkhitā), được chị em bảo vệ (bhaginirakkhitā), được bà con bảo vệ (ñātirakkhitā), được dòng họ bảo vệ (gottarakkhitā), được pháp bảo vệ (dhammarakkhitā), người có chồng (sārakkhā), và người bị pháp luật trừng phạt (saparidaṇḍā); và mười loại như người được mua bằng tiền (dhanakkītā), người sống theo ý muốn (chandavāsinī), người sống bằng tài sản (bhogavāsinī), người sống bằng y phục (paṭavāsinī), người đổ nước vào chén (odapattakinī), người bỏ gánh (obhatacumbaṭā), người tớ gái kiêm vợ (dāsī ca, bhariyā ca), người làm công kiêm vợ (kammakārī ca bhariyā ca), người bị bắt làm vợ trong chiến tranh (dhajāhaṭā), và người làm vợ tạm thời (muhuttikā).
Itthīsu pana dvinnaṃ sārakkhasaparidaṇḍānaṃ dasannañca dhanakkītādīnanti dvādasannaṃ itthīnaṃ aññe purisā, idaṃ agamanīyaṭṭhānaṃ nāma.
For women, however, other men are "places not to be gone to" for the two protected and penalty-subject women, and for the ten women such as those bought with wealth, making twelve types of women.
Đối với phụ nữ, nơi không nên đến là mười hai loại đàn ông khác, bao gồm hai loại có chồng và bị pháp luật trừng phạt, và mười loại như người được mua bằng tiền v.v.
929
So panesa micchācāro sīlādiguṇarahite agamanīyaṭṭhāne appasāvajjo, sīlādiguṇasampanne mahāsāvajjo.
This wrong conduct is a minor offense in a forbidden place devoid of virtues such as sīla, but a great offense in one endowed with virtues such as sīla.
Tà hạnh này, đối với nơi không nên đến mà thiếu các đức như giới (sīla) thì tội nhẹ, đối với nơi có đầy đủ các đức như giới thì tội nặng.
Tassa cattāro sambhārā – agamanīyavatthu, tasmiṃ sevanacittaṃ, sevanapayogo, maggenamaggapaṭipattiadhivāsananti.
Its four constituents are: a forbidden object, the intention to engage in it, the effort to engage in it, and the acquiescence to the practice of intercourse.
Có bốn yếu tố của tà hạnh: đối tượng không nên đến (agamanīyavatthu), ý muốn hành dâm với đối tượng đó (tasmiṃ sevanacittaṃ), hành động hành dâm (sevanapayogo), và sự chấp nhận hành vi sai trái (maggenamaggapaṭipattiadhivāsanaṃ).
930
Musāti visaṃvādanapurekkhārassa atthabhañjako vacīpayogo, kāyapayogo vā.
"Falsehood" is a verbal or bodily effort that destroys the welfare of a person with the intention to deceive.
Nói dối (musā) là hành động lời nói (vacīpayogo) hoặc hành động thân thể (kāyapayogo) làm tổn hại lợi ích của người khác, với ý định lừa dối (visaṃvādanapurekkhārassa).
Visaṃvādanādhippāyena panassa paravisaṃvādakakāyavacīpayogasamuṭṭhāpikā cetanā musāvādo.
However, musāvāda is the volition that gives rise to bodily or verbal effort to deceive another, with the intention to deceive.
Tuy nhiên, nói dối (musāvādo) là ý muốn (cetanā) phát sinh từ hành động thân thể hoặc lời nói nhằm lừa dối người khác, với ý định lừa dối.
Aparo nayo – musāti abhūtaṃ atacchaṃ vatthu.
Another explanation: "Falsehood" is an untrue, incorrect matter.
Một cách giải thích khác: Nói dối (musā) là một sự việc không có thật (abhūtaṃ), không đúng (atacchaṃ).
Vādoti tassa bhūtato tacchato viññāpanaṃ.
"Speech" is making that matter known as true and correct.
Lời nói (vādo) là sự làm cho người khác hiểu điều đó là có thật, là đúng.
Lakkhaṇato pana atathaṃ vatthuṃ tathato paraṃ viññāpetukāmassa tathāviññattisamuṭṭhāpikā cetanā musāvādo.
However, by definition, musāvāda is the volition that gives rise to such a declaration, by one who wishes to make another know an untrue matter as true.
Tuy nhiên, theo đặc tính, nói dối (musāvādo) là ý muốn (cetanā) phát sinh ra lời nói hoặc hành động làm người khác hiểu một sự việc không đúng là đúng, của một người muốn làm cho người khác hiểu sự việc không đúng là đúng.
So yamatthaṃ bhañjati, tassa appatāya appasāvajjo, mahantatāya mahāsāvajjo.
This falsehood is a minor offense if the welfare it destroys is small, and a great offense if it is great.
Lời nói dối đó, nếu làm tổn hại lợi ích nhỏ thì tội nhẹ, nếu làm tổn hại lợi ích lớn thì tội nặng.
Apica gahaṭṭhānaṃ attano santakaṃ adātukāmatāya natthītiādinayappavatto appasāvajjo, sakkhinā hutvā atthabhañjanatthaṃ vutto mahāsāvajjo.
Furthermore, for householders, it is a minor offense to say "there is none" or similar with the intention of not giving one's own property; it is a great offense if spoken as a witness to destroy someone's welfare.
Hơn nữa, đối với gia chủ, lời nói dối phát sinh theo kiểu "không có" vì không muốn cho của mình thì tội nhẹ, nhưng lời nói dối được nói ra để phá hoại lợi ích khi làm chứng thì tội nặng.
Pabbajitānaṃ appakampi telaṃ vā sappiṃ vā labhitvā hasādhippāyena ‘‘ajja gāme telaṃ nadī maññe sandatī’’ti pūraṇakathānayena pavatto appasāvajjo, adiṭṭhaṃyeva pana diṭṭhantiādinā nayena vadantānaṃ mahāsāvajjo.
For monastics, it is a minor offense if, having received a little oil or ghee from the village, one playfully says, "Today, in the village, oil flows like a river," in a manner of exaggeration; but it is a great offense for those who say, "I have seen what I have not seen," and so on.
Đối với chư Tỳ-khưu, lời nói dối phát sinh theo kiểu phóng đại, như khi nhận được một ít dầu hoặc bơ từ làng, nói đùa rằng "Hôm nay, dầu trong làng chảy như sông vậy", thì tội nhẹ; nhưng lời nói dối của những người nói điều chưa thấy là đã thấy thì tội nặng.
Tassa cattāro sambhārā – atathaṃ vatthu, visaṃvādanacittaṃ, tajjo vāyāmo, parassa tadatthavijānananti.
Its four constituents are: an untrue matter, the intention to deceive, the corresponding effort, and the other person's understanding of that meaning.
Có bốn yếu tố của nói dối: sự việc không đúng (atathaṃ vatthu), ý muốn lừa dối (visaṃvādanacittaṃ), sự cố gắng tương ứng (tajjo vāyāmo), và sự hiểu biết của người khác về ý nghĩa đó (parassa tadatthavijānanaṃ).
931
Yāya vācāya yassa taṃ vācaṃ bhāsati, tassa hadaye attano piyabhāvaṃ, parassa ca suññabhāvaṃ karoti, sā pisuṇā vācā.
The speech by which one speaks to someone, creating in that person's heart a sense of affection for oneself and a sense of alienation for another, is slanderous speech.
Lời nói mà khi nói với người nào đó, nó làm cho người đó có cảm tình với mình và làm cho người khác (người bị nói xấu) mất đi sự tin tưởng, đó là lời nói đâm thọc (pisuṇā vācā).
Yāya pana attānampi parampi pharusaṃ karoti, yā vācā sayampi pharusā neva kaṇṇasukhā na hadayasukhā vā, ayaṃ pharusā vācā.
But the speech by which one makes oneself and others harsh, or which is itself harsh, not pleasant to the ear, and not pleasant to the heart, this is harsh speech.
Lời nói mà qua đó người ta làm cho mình và người khác trở nên thô lỗ, lời nói đó tự thân nó thô lỗ, không dễ nghe, không dễ chịu, đó là lời nói thô ác (pharusā vācā).
Yena samphaṃ palapati niratthakaṃ, so samphappalāpo.
That by which one speaks nonsense, uselessly, is frivolous talk.
Lời nói vô ích, trống rỗng mà người ta nói ra, đó là lời nói vô ích (samphappalāpo).
Tesaṃ mūlabhūtā cetanāpi pisuṇāvācādināmameva labhati.
The volition that is the root of these also takes the names of slanderous speech and so on.
Ý muốn (cetanā) làm nền tảng cho những lời nói đó cũng mang tên là lời nói đâm thọc, v.v.
Sā eva ca idha adhippetāti.
And it is this volition that is intended here.
Và chính ý muốn đó được đề cập ở đây.
932
Tattha saṃkiliṭṭhacittassa paresaṃ vā bhedāya attano piyakamyatāya vā kāyavacīpayogasamuṭṭhāpikā cetanā pisuṇā vācā.
Among these, pisuṇā vācā is the volition that gives rise to bodily or verbal effort, with a defiled mind, either to cause division among others or out of a desire for one's own popularity.
Ở đây, lời nói đâm thọc (pisuṇā vācā) là ý muốn (cetanā) phát sinh từ hành động thân thể hoặc lời nói, với tâm ô nhiễm (saṃkiliṭṭhacitta) nhằm chia rẽ người khác (paresaṃ bhedāya) hoặc vì muốn được yêu mến (attano piyakamyatāya).
Sā yassa bhedaṃ karoti, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
If it causes division for a person of few virtues, it is a minor offense; if for a person of great virtues, it is a great offense.
Lời nói đó, nếu chia rẽ người ít đức thì tội nhẹ, nếu chia rẽ người nhiều đức thì tội nặng.
Tassā cattāro sambhārā – bhinditabbo paro, ‘‘iti ime nānā bhavissantī’’ti bhedapurekkhāratā vā ‘‘iti ahaṃ piyo bhavissāmi vissāsiko’’ti piyakamyatā vā, tajjo vāyāmo, tassa tadatthavijānananti.
Its four constituents are: the other person to be divided, the intention to divide (thinking, "these will become separate") or the desire for popularity (thinking, "I will become beloved and trusted"), the corresponding effort, and the other person's understanding of that meaning.
Có bốn yếu tố của lời nói đâm thọc: người cần bị chia rẽ (bhinditabbo paro), ý định chia rẽ ("Họ sẽ trở nên xa cách") hoặc ý muốn được yêu mến ("Tôi sẽ được yêu mến, được tin cậy"), sự cố gắng tương ứng (tajjo vāyāmo), và sự hiểu biết của người đó về ý nghĩa đó (tassa tadatthavijānananti).
Pare pana abhinne kammapathabhedo natthi, bhinneyeva hoti.
However, among others who are not divided, there is no division of the path of action; it occurs only among those who are divided.
Tuy nhiên, khi người khác chưa bị chia rẽ thì không có sự chia rẽ nghiệp đạo (kammapathabhedo), chỉ khi họ đã bị chia rẽ thì mới có.
933
Parassa mammacchedakakāyavacīpayogasamuṭṭhāpikā ekantapharusacetanā pharusā vācā.
Pharusā vācā is the utterly harsh volition that gives rise to bodily or verbal effort cutting to the core of another.
Lời nói thô ác (pharusā vācā) là ý muốn thô ác tuyệt đối (ekantapharusacetanā) phát sinh từ hành động thân thể hoặc lời nói làm tổn thương lòng tự trọng của người khác (parassa mammacchedaka).
Mammacchedakopi pana payogo cittasaṇhatāya pharusā vācā na hoti.
But even a speech that cuts off affection, when the mind is gentle, is not harsh speech.
Tuy nhiên, ngay cả hành động làm tổn thương lòng tự trọng cũng không phải là lời nói thô ác nếu tâm ý dịu dàng (cittasaṇhatāya).
Mātāpitaro hi kadāci puttake evampi vadanti ‘‘corā vo khaṇḍākhaṇḍikaṃ karontū’’ti.
For parents sometimes say to their children, "May thieves cut you into pieces!"
Thật vậy, cha mẹ đôi khi nói với con cái rằng: "Cầu cho bọn cướp xé xác các con ra từng mảnh!".
Uppalapattampi ca nesaṃ upari patantaṃ na icchanti.
Yet they do not wish even a lotus leaf to fall upon them.
Nhưng họ không muốn ngay cả một cánh sen rơi trên người con.
Ācariyupajjhāyā ca kadāci nissitake evaṃ vadanti ‘‘kiṃ ime ahirikā anottappino, niddhamatha ne’’ti.
And teachers and preceptors sometimes say to their pupils, "Why are these shameless and reckless? Drive them out!"
Các vị thầy và giới sư đôi khi nói với các đệ tử của mình rằng: "Những kẻ vô liêm sỉ, không biết xấu hổ này là gì? Hãy đuổi chúng đi!".
Atha ca nesaṃ āgamādhigamasampattiṃ icchanti.
Yet they wish for their pupils' attainment in learning and realization.
Tuy nhiên, họ lại mong muốn sự thành tựu trong học vấn và chứng đắc của các đệ tử.
Yathā ca cittasaṇhatāya pharusā vācā na hoti, evaṃ vacanasaṇhatāya apharusā vācāpi na hoti.
Just as harsh speech is not harsh when the mind is gentle, so too, non-harsh speech is not non-harsh when the words are gentle.
Cũng như lời nói thô ác không phải là lời nói thô ác nếu tâm ý dịu dàng, thì lời nói không thô ác cũng không phải là lời nói không thô ác nếu lời nói dịu dàng.
Na hi mārāpetukāmassa ‘‘imaṃ sukhaṃ sayāpethā’’ti vacanaṃ apharusā vācā hoti, cittapharusatāya panesā pharusā vācāva.
For the words, "Let this person sleep peacefully," spoken by one who intends to kill, are not non-harsh speech; rather, due to the harshness of the mind, it is indeed harsh speech.
Thật vậy, lời nói "Hãy cho người này ngủ yên" của một người muốn giết người không phải là lời nói không thô ác, mà chính là lời nói thô ác do tâm ý thô ác.
Sā yaṃ sandhāya pavattitā, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
Depending on whom it is directed, it is a minor offense if that person has few virtues, and a major offense if they have great virtues.
Lời nói đó, nếu hướng đến người ít đức thì tội nhẹ, nếu hướng đến người nhiều đức thì tội nặng.
Tassā tayo sambhārā – akkositabbo paro, kupitacittaṃ, akkosanāti.
Its three components are: the person to be abused, an angry mind, and the act of abusing.
Có ba yếu tố của lời nói thô ác: người bị chửi mắng (akkositabbo paro), tâm giận dữ (kupitacittaṃ), và hành động chửi mắng (akkosanāti).
934
Anatthaviññāpikā kāyavacīpayogasamuṭṭhāpikā akusalacetanā samphappalāpo.
Frivolous talk (samphappalāpa) is an unwholesome volition that makes known what is unbeneficial, arising from bodily and verbal effort.
Tư bất thiện làm cho biết điều vô ích, phát sanh từ sự tác động của thân và lời, là samphappalāpo (lời nói vô ích).
So āsevanamandatāya appasāvajjo, āsevanamahantatāya mahāsāvajjo.
It is a minor offense when practiced infrequently, and a major offense when practiced extensively.
Lời nói vô ích ấy, khi thực hành ít thì có lỗi ít, khi thực hành nhiều thì có lỗi nhiều.
Tassa dve sambhārā – bhāratayuddhasītāharaṇādiniratthakakathāpurekkhāratā, tathārūpikathākathanañcāti.
Its two components are: preoccupation with pointless stories such as the Mahabharata war and the abduction of Sītā, and the telling of such stories.
Nó có hai thành phần: việc hướng đến những câu chuyện vô ích như chiến tranh Bhārata, chuyện bắt cóc Sītā, v.v., và việc nói những câu chuyện như vậy.
Pare pana taṃ kathaṃ agaṇhante kammapathabhedo natthi, parena samphappalāpe gahiteyeva hoti.
However, if others do not take up that talk, there is no breaking of the path of action; it only occurs when the frivolous talk is taken up by another.
Tuy nhiên, khi người khác không nghe câu chuyện đó thì không có sự vi phạm nghiệp đạo; chỉ khi người khác nghe lời nói vô ích thì mới có sự vi phạm.
935
Abhijjhāyatīti abhijjhā, parabhaṇḍābhimukhī hutvā tanninnatāya pavattatīti attho.
It covets, thus it is covetousness (abhijjhā); meaning, it proceeds by turning towards another's property and inclining towards it.
Nó thèm muốn nên gọi là abhijjhā (tham lam), nghĩa là nó hướng đến tài sản của người khác và diễn tiến theo xu hướng đó.
Sā ‘‘aho vata idaṃ mamassā’’ti evaṃ parabhaṇḍābhijjhāyanalakkhaṇā, adinnādānaṃ viya appasāvajjā mahāsāvajjā ca.
It is characterized by coveting another's property, thinking, "Oh, if only this were mine!" It is a minor or major offense, like taking what is not given.
Nó có đặc tính thèm muốn tài sản của người khác như: "Ôi, mong sao cái này là của ta!". Giống như trộm cắp, nó có thể có lỗi ít hoặc có lỗi nhiều.
Tassa dve sambhārā – parabhaṇḍaṃ, attano pariṇāmanañcāti.
Its two components are: another's property, and the act of appropriating it as one's own.
Nó có hai thành phần: tài sản của người khác và việc hướng nó về cho mình.
Parabhaṇḍavatthuke hi lobhe uppannepi na tāva kammapathabhedo hoti, yāva ‘‘aho vata idaṃ mamassā’’ti attano na pariṇāmeti.
For even if greed arises regarding another's property, the path of action is not broken until one appropriates it as one's own, thinking, "Oh, if only this were mine!"
Bởi vì, dù lòng tham khởi lên đối với tài sản của người khác, vẫn chưa có sự vi phạm nghiệp đạo cho đến khi người ấy hướng nó về cho mình rằng: "Ôi, mong sao cái này là của ta!".
936
Hitasukhaṃ byāpādayatīti byāpādo.
It destroys welfare and happiness, thus it is ill-will (byāpādo).
Nó hủy hoại lợi ích và hạnh phúc nên gọi là byāpādo (sân hận).
So paravināsāya manopadosalakkhaṇo, pharusā vācā viya appasāvajjo mahāsāvajjo ca.
It is characterized by mental defilement for the destruction of another, and is a minor or major offense, like harsh speech.
Nó có đặc tính làm tâm ô nhiễm để hủy hoại người khác; giống như lời nói thô ác, nó có thể có lỗi ít hoặc có lỗi nhiều.
Tassa dve sambhārā – parasatto ca, tassa ca vināsacintāti.
Its two components are: another being, and the thought of that being's destruction.
Nó có hai thành phần: chúng sanh khác và ý nghĩ hủy hoại chúng sanh ấy.
Parasattavatthuke hi kodhe uppannepi na tāva kammapathabhedo hoti, yāva ‘‘aho vatāyaṃ ucchijjeyya vinasseyyā’’ti tassa vināsaṃ na cinteti.
For even if anger arises regarding another being, the path of action is not broken until one thinks of that being's destruction, "Oh, if only this one would perish and be destroyed!"
Bởi vì, dù sân hận khởi lên đối với chúng sanh khác, vẫn chưa có sự vi phạm nghiệp đạo cho đến khi người ấy nghĩ đến sự hủy hoại của chúng sanh đó rằng: "Ôi, mong sao kẻ này bị tiêu diệt, bị hủy hoại!".
937
Yathābhuccagahaṇābhāvena micchā passatīti micchādiṭṭhi.
It sees wrongly due to the absence of grasping things as they truly are, thus it is wrong view (micchādiṭṭhi).
Do không nắm bắt đúng như thật nên nó thấy một cách sai lầm, gọi là micchādiṭṭhi (tà kiến).
Sā ‘‘natthi dinna’’ntiādinā nayena viparītadassanalakkhaṇā, samphappalāpo viya appasāvajjā, mahāsāvajjā ca.
It is characterized by seeing things in a distorted way, such as "there is no giving," and is a minor or major offense, like frivolous talk.
Nó có đặc tính thấy sai lệch theo cách "Không có quả của việc bố thí", v.v.; giống như lời nói vô ích, nó có thể có lỗi ít hoặc có lỗi nhiều.
Apica aniyatā appasāvajjā, niyatā mahāsāvajjā.
Furthermore, an undetermined wrong view is a minor offense, and a determined wrong view is a major offense.
Hơn nữa, tà kiến bất định thì có lỗi ít, tà kiến nhất định thì có lỗi nhiều.
Tassā dve sambhārā – vatthuno ca gahitākāraviparītatā, yathā ca taṃ gaṇhāti, tathābhāvena tassūpaṭṭhānanti.
Its two components are: the object being contrary to the grasped aspect, and its presentation in the way it is grasped.
Nó có hai thành phần: sự sai lệch trong cách nắm bắt đối tượng, và sự biểu hiện của đối tượng đúng theo cách đã nắm bắt ấy.
Tattha natthikāhetukaakiriyadiṭṭhīhi eva kammapathabhedo hoti, na aññadiṭṭhīhi.
Among these, the path of action is broken only by nihilistic, causeless, and non-action views, not by other views.
Trong số các tà kiến, chỉ có đoạn kiến, vô nhân kiến và vô hành kiến mới có sự vi phạm nghiệp đạo, các tà kiến khác thì không.
938
Imesaṃ pana dasannaṃ akusalakammapathānaṃ dhammato, koṭṭhāsato, ārammaṇato, vedanāto, mūlatoti pañcahākārehi vinicchayo veditabbo.
The determination of these ten unwholesome paths of action should be understood in five ways: by way of their nature, by way of their parts, by way of their object, by way of feeling, and by way of their root.
Cần phải hiểu rõ sự phân tích mười bất thiện nghiệp đạo này theo năm phương diện: về pháp, về thành phần, về đối tượng, về thọ, và về căn.
939
Tattha dhammatoti etesu hi satta paṭipāṭiyā cetanādhammāva honti, abhijjhādayo tayo cetanāsampayuttā.
Among these, by way of their nature, the first seven in order are volitional phenomena (cetanā-dhamma), while the three, covetousness and so forth, are associated with volition.
Trong đó, về pháp, bảy pháp đầu tiên theo thứ tự chỉ là các pháp tư, ba pháp sau là các pháp tương ưng với tư.
940
Koṭṭhāsatoti paṭipāṭiyā satta, micchādiṭṭhi cāti ime aṭṭha kammapathā eva honti, no mūlāni.
By way of their parts, the first seven in order, and wrong view, these eight are paths of action, but not roots.
Về thành phần, bảy pháp đầu tiên theo thứ tự và tà kiến, tám pháp này chỉ là nghiệp đạo, không phải là căn.
Abhijjhābyāpādā kammapathā ceva mūlāni ca.
Covetousness and ill-will are both paths of action and roots.
Tham lam và sân hận vừa là nghiệp đạo vừa là căn.
Abhijjhā hi mūlaṃ patvā lobho akusalamūlaṃ hoti, byāpādo doso akusalamūlaṃ.
For covetousness, when it reaches the stage of a root, becomes the unwholesome root of greed; ill-will becomes the unwholesome root of hatred.
Bởi vì, tham lam khi đạt đến địa vị căn thì trở thành tham bất thiện căn, sân hận trở thành sân bất thiện căn.
941
Ārammaṇatoti pāṇātipāto jīvitindriyārammaṇato saṅkhārārammaṇo.
By way of their object: Taking of life (pāṇātipāta) has existence-faculty (jīvitindriya) as its object, thus it is a conditioned object (saṅkhārārammaṇa).
Về đối tượng, sát sanh có đối tượng là hành, do lấy mạng quyền làm đối tượng.
Adinnādānaṃ sattārammaṇaṃ vā saṅkhārārammaṇaṃ vā.
Taking what is not given (adinnādāna) has either a being as its object or a conditioned object.
Trộm cắp có đối tượng là chúng sanh hoặc đối tượng là hành.
Micchācāro phoṭṭhabbavasena saṅkhārārammaṇo, sattārammaṇotipi eke.
Sexual misconduct (micchācāra) has a conditioned object by way of tangibles; some say it also has a being as its object.
Tà dâm có đối tượng là hành, do lấy xúc làm đối tượng; một số vị cho rằng cũng có đối tượng là chúng sanh.
Musāvādo sattārammaṇo vā saṅkhārārammaṇo vā.
False speech (musāvāda) has either a being as its object or a conditioned object.
Nói dối có đối tượng là chúng sanh hoặc đối tượng là hành.
Tathā pisuṇā vācā.
Similarly, slanderous speech (pisuṇā vācā).
Lời nói đâm thọc cũng vậy.
Pharusā vācā sattārammaṇāva samphappalāpo diṭṭhasutamutaviññātavasena sattārammaṇo vā saṅkhārārammaṇo vā.
Harsh speech (pharusā vācā) always has a being as its object. Frivolous talk (samphappalāpa) has either a being as its object or a conditioned object, by way of what is seen, heard, sensed, or known.
Lời nói thô ác chỉ có đối tượng là chúng sanh. Lời nói vô ích, do lấy những gì đã thấy, nghe, cảm nhận, biết làm đối tượng, nên có đối tượng là chúng sanh hoặc đối tượng là hành.
Tathā abhijjhā.
Similarly, covetousness (abhijjhā).
Tham lam cũng vậy.
Byāpādo sattārammaṇova.
Ill-will (byāpādo) always has a being as its object.
Sân hận chỉ có đối tượng là chúng sanh.
Micchādiṭṭhi tebhūmakadhammavasena saṅkhārārammaṇāva.
Wrong view (micchādiṭṭhi) has formations (saṅkhārā) as its object, by way of the phenomena of the three realms.
Tà kiến chỉ có đối tượng là hành, do lấy các pháp ba cõi làm đối tượng.
942
Vedanātoti pāṇātipāto dukkhavedano hoti.
As for feeling (vedanā), the killing of living beings (pāṇātipāta) is accompanied by painful feeling.
Về thọ, sát sanh có khổ thọ.
Kiñcāpi hi rājāno coraṃ disvā hasamānāpi ‘‘gacchatha bhaṇe, māretha na’’nti vadanti, sanniṭṭhāpakacetanā pana nesaṃ dukkhasampayuttāva hoti.
Indeed, even if kings, having seen a thief, say while laughing, "Go, sirs, kill that thief," their volitional determination (sanniṭṭhāpakacetanā) is nevertheless accompanied by painful feeling.
Mặc dù các vị vua khi thấy tên trộm, dù đang cười cũng ra lệnh: "Này các khanh, hãy đi giết nó đi!", nhưng tư quyết định của họ chỉ tương ưng với khổ.
Adinnādānaṃ tivedanaṃ.
Taking what is not given (adinnādāna) has three kinds of feeling.
Trộm cắp có ba loại thọ.
Tañhi parabhaṇḍaṃ disvā haṭṭhatuṭṭhassa gaṇhato sukhavedanaṃ hoti, bhītatasitassa gaṇhato dukkhavedanaṃ, tathā vipākanissandaphalāni paccavekkhantassa.
For when one takes another's property, having seen it with a joyful and delighted mind, it is accompanied by pleasant feeling; when one takes it out of fear and terror, it is accompanied by painful feeling; and similarly, when one reflects on the resultant and consequential effects.
Bởi vì, đối với người hoan hỷ vui mừng khi thấy tài sản của người khác rồi lấy, nó có lạc thọ; đối với người sợ hãi run rẩy khi lấy, nó có khổ thọ; cũng vậy đối với người quán xét về quả dị thục và quả đẳng lưu.
Gahaṇakāle majjhattabhāve ṭhitassa pana gaṇhato adukkhamasukhavedanaṃ hoti.
However, when one takes it while remaining in a neutral state at the time of taking, it is accompanied by neither painful nor pleasant feeling.
Còn đối với người giữ tâm trung dung trong lúc lấy, nó có bất khổ bất lạc thọ.
Micchācāro sukhamajjhattavasena dvivedano, sanniṭṭhāpakacitte pana majjhattavedano na hoti.
Sexual misconduct (micchācāra) has two kinds of feeling, pleasant and neutral; but in the volitional determination, it is not accompanied by neutral feeling.
Tà dâm có hai loại thọ là lạc và xả, nhưng trong tâm quyết định thì không có xả thọ.
Musāvādo adinnādāne vuttanayeneva tivedano, tathā pisuṇā vācā.
False speech (musāvāda) has three kinds of feeling, in the manner stated for taking what is not given, and so too is slanderous speech (pisuṇā vācā).
Nói dối có ba loại thọ theo cách đã nói trong phần trộm cắp; lời nói đâm thọc cũng vậy.
Pharusā vācā dukkhavedanā.
Harsh speech (pharusā vācā) is accompanied by painful feeling.
Lời nói thô ác có khổ thọ.
Samphappalāpo tivedano.
Frivolous talk (samphappalāpa) has three kinds of feeling.
Lời nói vô ích có ba loại thọ.
Paresu hi sādhukāraṃ dentesu celādīni ukkhipantesu haṭṭhatuṭṭhassa sītāharaṇabhāratayuddhādīni kathanakāle so sukhavedano hoti, paṭhamaṃ dinnavetanena ekena pacchā āgantvā ‘‘ādito paṭṭhāya kathehī’’ti vutte ‘‘niravasesaṃ yathānusandhikaṃ pakiṇṇakakathaṃ kathessāmi nu kho, no’’ti domanassitassa kathanakāle dukkhavedano hoti, majjhattassa kathayato adukkhamasukhavedano hoti.
For when others give applause and toss up clothes, etc., and one recounts tales of Sītā's abduction, the Mahābhārata war, etc., with a joyful and delighted mind, it is accompanied by pleasant feeling; when one is told by someone who arrived later, having received payment earlier, "Recount it from the beginning without omission, in sequence," and one becomes dejected, thinking, "Should I recount the miscellaneous story completely and in sequence, or not?", then it is accompanied by painful feeling; and when one recounts it with a neutral mind, it is accompanied by neither painful nor pleasant feeling.
Bởi vì, khi người khác tán dương, ném y phục lên, v.v., thì lúc kể chuyện bắt cóc Sītā, chiến tranh Bhārata, v.v., người hoan hỷ vui mừng có lạc thọ; khi một người đã trả tiền trước, sau đó quay lại nói "Hãy kể lại từ đầu", người ấy ưu phiền "Ta có nên kể lại toàn bộ câu chuyện tản mạn theo đúng trình tự hay không?", thì lúc kể có khổ thọ; khi người giữ tâm trung dung kể, thì có bất khổ bất lạc thọ.
Abhijjhā sukhamajjhattavasena dvivedanā, tathā micchādiṭṭhi.
Covetousness (abhijjhā) has two kinds of feeling, pleasant and neutral, and so too is wrong view (micchādiṭṭhi).
Tham lam có hai loại thọ là lạc và xả; tà kiến cũng vậy.
Byāpādo dukkhavedano.
Ill-will (byāpāda) is accompanied by painful feeling.
Sân hận có khổ thọ.
943
Mūlatoti pāṇātipāto dosamohavasena dvimūlako hoti, adinnādānaṃ dosamohavasena vā lobhamohavasena vā, micchācāro lobhamohavasena, musāvādo dosamohavasena vā lobhamohavasena vā.
As for roots (mūlato), the killing of living beings (pāṇātipāta) has two roots, by way of hatred (dosa) and delusion (moha). Taking what is not given (adinnādāna) has two roots, by way of hatred and delusion, or by way of greed (lobha) and delusion. Sexual misconduct (micchācāra) has two roots, by way of greed and delusion. False speech (musāvāda) has two roots, by way of hatred and delusion, or by way of greed and delusion.
Về căn, sát sanh có hai căn là sân và si; trộm cắp có hai căn là sân và si, hoặc tham và si; tà dâm có hai căn là tham và si; nói dối có hai căn là sân và si, hoặc tham và si.
Tathā pisuṇā vācā samphappalāpo ca.
Similarly, slanderous speech (pisuṇā vācā) and frivolous talk (samphappalāpa) also have two roots, by way of hatred and delusion, or by way of greed and delusion.
Lời nói đâm thọc và lời nói vô ích cũng vậy.
Pharusā vācā dosamohavasena, abhijjhā mohavasena ekamūlā, tathā byāpādo.
Harsh speech (pharusā vācā) has one root, by way of hatred and delusion, and similarly, ill-will (byāpāda) has one root.
Lời nói thô ác có hai căn là sân và si; tham lam có một căn là si; sân hận cũng vậy.
Micchādiṭṭhi lobhamohavasena dvimūlāti.
Wrong view (micchādiṭṭhi) has two roots, by way of greed and delusion.
Tà kiến có hai căn là tham và si.
944
Akusalakammapathakathā niṭṭhitā.
The discourse on unwholesome courses of action is concluded.
Phần luận về bất thiện nghiệp đạo đã kết thúc.
945
Pāṇātipātādīhi pana viratiyo, anabhijjhāabyāpādasammādiṭṭhiyo cāti ime dasa kusalakammapathā nāma.
Now, abstentions (viratiyo) from killing living beings (pāṇātipāta) and so forth, and non-covetousness (anabhijjhā), non-ill-will (abyāpāda), and right view (sammādiṭṭhi)—these ten are called wholesome courses of action (kusalakammapathā).
Sự từ bỏ sát sanh, v.v., cùng với vô tham, vô sân và chánh kiến, mười pháp này được gọi là thiện nghiệp đạo.
Pāṇātipātādīhi etāya viramanti, sayaṃ vā viramati, viramaṇamattameva vā etanti virati.
One abstains from killing living beings and so forth by means of this (virati), or one abstains oneself, or it is merely the act of abstaining—thus it is called abstention (virati).
Nhờ pháp này mà họ từ bỏ sát sanh, v.v., hoặc tự mình từ bỏ, hoặc chỉ là sự từ bỏ, nên gọi là virati (sự từ bỏ).
Yā pāṇātipātādīhi viramantassa kusalacittasampayuttā virati, sā pabhedato tividhā hoti sampattavirati samādānavirati samucchedaviratīti.
The abstention that is conjoined with wholesome consciousness for one who abstains from killing living beings and so forth is threefold in its classification: abstention by occasion (sampattavirati), abstention by undertaking (samādānavirati), and abstention by eradication (samucchedavirati).
Sự từ bỏ tương ưng với thiện tâm của người từ bỏ sát sanh, v.v., được phân thành ba loại: sampattavirati (từ bỏ do hoàn cảnh), samādānavirati (từ bỏ do thọ trì) và samucchedavirati (từ bỏ do đoạn tận).
Tattha asamādinnasikkhāpadānaṃ attano jātivayabāhusaccādīni paccavekkhitvā ‘‘ayuttaṃ amhākaṃ evarūpaṃ pāpaṃ kātu’’nti sampattavatthuṃ avītikkamantānaṃ uppajjamānā virati sampattavirati nāma.
Among these, the abstention that arises in those who have not undertaken precepts, who, having reflected on their birth, age, extensive learning, etc., think, "It is not proper for us to commit such evil," and who do not transgress the occasion, is called abstention by occasion (sampattavirati).
Trong đó, sự từ bỏ khởi lên nơi những người không thọ trì học giới, sau khi quán xét về dòng dõi, tuổi tác, học vấn, v.v., của mình và nghĩ rằng "Chúng ta không nên làm điều ác như vậy", rồi không vi phạm đối tượng đã gặp, được gọi là sampattavirati.
Samādinnasikkhāpadānaṃ pana sikkhāpadasamādāne ca tatuttari ca attano jīvitampi pariccajitvā vatthuṃ avītikkamantānaṃ uppajjamānā virati samādānavirati nāma.
However, the abstention that arises in those who have undertaken precepts, who, even sacrificing their own lives, do not transgress the object during the undertaking of the precept and beyond, is called abstention by undertaking (samādānavirati).
Còn sự từ bỏ khởi lên nơi những người đã thọ trì học giới, khi thọ trì học giới và sau đó, dù phải hy sinh cả mạng sống cũng không vi phạm đối tượng, được gọi là samādānavirati.
Ariyamaggasampayuttā pana virati samucchedavirati nāma, yassā uppattito pabhuti ariyapuggalānaṃ ‘‘pāṇaṃ ghātessāmā’’tiādicittampi na uppajjatīti.
But the abstention that is conjoined with the noble path (ariyamagga) is called abstention by eradication (samucchedavirati), from the arising of which even the thought "I will kill a living being" and so forth does not arise in noble individuals (ariyapuggalā).
Còn sự từ bỏ tương ưng với Thánh đạo, được gọi là samucchedavirati, mà kể từ khi nó khởi lên, ngay cả ý nghĩ "Ta sẽ giết chúng sanh" cũng không khởi lên nơi các bậc Thánh nhân.
946
Idāni akusalakammapathānaṃ viya imesaṃ kusalakammapathānaṃ dhammato, koṭṭhāsato, ārammaṇato, vedanāto, mūlatoti pañcahākārehi vinicchayo veditabbo.
Now, the determination of these wholesome courses of action should be understood in five ways, just like that of the unwholesome courses of action: by way of phenomenon (dhammato), by way of component (koṭṭhāsato), by way of object (ārammaṇato), by way of feeling (vedanāto), and by way of root (mūlato).
Bây giờ, cần phải hiểu rõ sự phân tích các thiện nghiệp đạo này theo năm phương diện: về pháp, về thành phần, về đối tượng, về thọ, và về căn, giống như đối với các bất thiện nghiệp đạo.
947
Tattha dhammatoti etesupi paṭipāṭiyā satta cetanāpi vaṭṭanti viratiyopi, ante tayo cetanāsampayuttāva.
Among these, as for phenomenon (dhammato), in these (wholesome courses of action), in sequence, the seven volitions (cetanā) are also included, as are the abstentions (viratiyo); the last three are only those conjoined with volition.
Trong đó, về pháp, trong các pháp này, bảy pháp đầu tiên theo thứ tự có thể là tư hoặc sự từ bỏ, ba pháp cuối cùng chỉ là các pháp tương ưng với tư.
948
Koṭṭhāsatoti paṭipāṭiyā satta kammapathā eva, no mūlāni, ante tayo kammapathā ceva mūlāni ca.
As for component (koṭṭhāsato), in sequence, the first seven are only courses of action, not roots; the last three are both courses of action and roots.
Về thành phần, bảy pháp đầu tiên theo thứ tự chỉ là nghiệp đạo, không phải là căn; ba pháp cuối cùng vừa là nghiệp đạo vừa là căn.
Anabhijjhā hi mūlaṃ patvā alobho kusalamūlaṃ hoti, abyāpādo adoso kusalamūlaṃ, sammādiṭṭhi amoho kusalamūlaṃ.
For when non-covetousness (anabhijjhā) reaches the state of a root, it becomes the wholesome root of non-greed (alobha); non-ill-will (abyāpāda) becomes the wholesome root of non-hatred (adosa); and right view (sammādiṭṭhi) becomes the wholesome root of non-delusion (amoho).
Quả vậy, không tham ái, sau khi đạt đến chỗ căn bản, chính là vô tham, là thiện căn; không sân hận chính là vô sân, là thiện căn; chánh kiến chính là vô si, là thiện căn.
949
Ārammaṇatoti pāṇātipātādīnaṃ ārammaṇāneva etesaṃ ārammaṇāni.
As for object (ārammaṇato), the objects of killing living beings and so forth are indeed the objects of these.
Về đối tượng nghĩa là chính các đối tượng của sát sanh v.v... là đối tượng của những pháp này.
Vītikkamitabbatoyeva hi veramaṇī nāma hoti.
For abstention (veramaṇī) is indeed the very thing that should be transgressed.
Quả thật, sự kiêng cữ được gọi tên là do chính đối tượng cần phải vượt qua.
Yathā pana nibbānārammaṇo ariyamaggo kilese pajahati, evaṃ jīvitindriyādiārammaṇāpete kammapathā pāṇātipātādīni dussīlyāni pajahantīti.
Just as the Noble Path, having Nibbāna as its object, abandons defilements, so too these courses of action, having the life faculty (jīvitindriya) and so on as their objects, abandon immoralities such as the taking of life.
Tuy nhiên, giống như Thánh đạo lấy Niết-bàn làm đối tượng để từ bỏ các phiền não, cũng vậy, những nghiệp đạo này, với mạng quyền v.v... làm đối tượng, từ bỏ các ác giới như sát sanh v.v...
950
Vedanātoti sabbe sukhavedanā vā honti majjhattavedanā vā.
By way of feeling: All wholesome courses of action are accompanied by pleasant feeling or neutral feeling.
Về thọ nghĩa là tất cả đều là lạc thọ hoặc xả thọ.
Kusalaṃ patvā hi dukkhā vedanā nāma natthi.
Indeed, having attained the sphere of the wholesome, there is no such thing as painful feeling.
Bởi vì, khi đã đạt đến thiện pháp, thì không có cái gọi là khổ thọ.
951
Mūlatoti paṭipāṭiyā satta ñāṇasampayuttacittena viramantassa alobhaadosaamohavasena timūlā honti.
By way of root: For one who abstains with consciousness associated with knowledge (ñāṇasampayutta citta), there are three roots: non-greed (alobha), non-hatred (adosa), and non-delusion (amoha), in sequence.
Về căn nghĩa là, theo thứ tự, đối với người đang kiêng cữ bằng tâm tương ưng trí, các pháp này có ba căn do bởi vô tham, vô sân, vô si.
Ñāṇavippayuttacittena viramantassa alobhādosavasena dvimūlā.
For one who abstains with consciousness dissociated from knowledge (ñāṇavippayutta citta), there are two roots: non-greed and non-hatred.
Đối với người đang kiêng cữ bằng tâm bất tương ưng trí, chúng có hai căn do bởi vô tham và vô sân.
Anabhijjhā ñāṇasampayuttacittena viramantassa adosaamohavasena dvimūlā.
For one who abstains from covetousness (anabhijjhā) with consciousness associated with knowledge, there are two roots: non-hatred and non-delusion.
Sự không tham ái, đối với người đang kiêng cữ bằng tâm tương ưng trí, có hai căn do bởi vô sân và vô si.
Ñāṇavippayuttacittena viramantassa adosavasena ekamūlā.
For one who abstains with consciousness dissociated from knowledge, there is one root: non-hatred.
Đối với người đang kiêng cữ bằng tâm bất tương ưng trí, nó có một căn do bởi vô sân.
Alobho pana attanāva attano mūlaṃ na hoti.
Non-greed, however, is not its own root by itself.
Tuy nhiên, vô tham tự nó không phải là căn của chính nó.
Abyāpādepi eseva nayo.
The same method applies to non-ill-will (abyāpāda).
Đối với không sân hận cũng theo phương pháp này.
Sammādiṭṭhi alobhādosavasena dvimūlāvāti.
Right view (sammādiṭṭhi) always has two roots: non-greed and non-hatred.
Chánh kiến có hai căn do bởi vô tham và vô sân.
952
Kusalakammapathakathā niṭṭhitā.
The discourse on wholesome courses of action is concluded.
Phần luận về thiện nghiệp đạo đã chấm dứt.
953
41.
41.
41.
954
Evaṃ dasakusalakammapathavasena sīlaṃ dassetvā idāni nekkhammādīnaṃ arahattamaggapariyosānānaṃ sattatiṃsadhammānaṃ vasena dassetuṃ nekkhammena kāmacchandaṃ saṃvaraṭṭhena sīlaṃ, avītikkamaṭṭhena sīlantiādimāha.
Having thus shown sīla by way of the ten wholesome courses of action, now, to show it by way of the thirty-seven qualities culminating in the Arahantship Path, it is said: “ Renunciation (nekkhamma) is sīla by way of restraining sensual desire (kāmacchanda), sīla by way of non-transgression,” and so on.
Sau khi đã trình bày giới theo mười thiện nghiệp đạo như vậy, bây giờ để trình bày theo ba mươi bảy pháp, bắt đầu từ xuất ly và kết thúc ở A-la-hán đạo, ngài nói bằng sự xuất ly, giới là sự phòng hộ khỏi dục tham, giới là sự không vi phạm v.v...
Tattha yasmā nekkhammena kāmacchandaṃ saṃvarati na vītikkamati, tasmā nekkhammaṃ sīlanti adhippāyo.
Here, the intention is that since one restrains sensual desire through renunciation and does not transgress, renunciation is sīla.
Ở đây, ý nghĩa là: vì nhờ xuất ly mà phòng hộ, không vi phạm dục tham, cho nên xuất ly là giới.
Paccattatthe vā karaṇavacanaṃ, nekkhammanti attho.
Alternatively, the instrumental case is used in the sense of the nominative; it means renunciation.
Hoặc, đây là cách dùng công cụ cách trong ý nghĩa của chủ cách, nghĩa là: xuất ly là giới.
Esa nayo sesesu.
The same method applies to the rest.
Phương pháp này cũng áp dụng cho các phần còn lại.
Pāḷiyaṃ pana nekkhammaabyāpāde dassetvā heṭṭhā vuttanayattā sesaṃ saṅkhipitvā ante arahattamaggoyeva dassito.
In the Pāḷi, however, after showing renunciation and non-ill-will, the rest is summarized in the manner stated previously, and only the Arahantship Path is shown at the end.
Tuy nhiên, trong Chánh tạng, sau khi đã trình bày xuất ly và không sân hận, phần còn lại được tóm lược vì đã theo phương pháp đã nói ở dưới, và ở cuối chỉ có A-la-hán đạo được trình bày.
955
Evaṃ saṃvaraavītikkamavasena sīlaṃ dassetvā idāni tesaṃyeva dvinnaṃ pabhedadassanatthaṃ pañca sīlāni pāṇātipātassa pahānaṃ sīlantiādimāha.
Having thus shown sīla by way of restraint (saṃvara) and non-transgression (avītikkama), now, to show the distinctions of these two, it is said: “ The five sīlas: abandoning the taking of life is sīla,” and so on.
Sau khi đã trình bày giới theo phương diện phòng hộ và không vi phạm như vậy, bây giờ để trình bày sự phân loại của chính hai phương diện ấy, ngài nói năm loại giới: sự từ bỏ sát sanh là giới v.v...
Ettha ca pāṇātipātassa pahānaṃ sīlaṃ, pāṇātipātā veramaṇī sīlaṃ, pāṇātipātassa paṭipakkhacetanā sīlaṃ, pāṇātipātassa saṃvaro sīlaṃ, pāṇātipātassa avītikkamo sīlanti yojanā kātabbā.
Here, the construction should be: abandoning the taking of life is sīla; abstaining from the taking of life is sīla; the opposing volition to the taking of life is sīla; the restraint from the taking of life is sīla; non-transgression of the taking of life is sīla.
Và ở đây, nên hiểu cách kết hợp như sau: sự từ bỏ sát sanh là giới, sự kiêng cữ sát sanh là giới, tư đối nghịch với sát sanh là giới, sự phòng hộ khỏi sát sanh là giới, sự không vi phạm sát sanh là giới.
Pahānanti ca koci dhammo nāma natthi aññatra vuttappakārānaṃ pāṇātipātādīnaṃ anuppādamattato.
Abandoning (pahāna) is not a specific phenomenon (dhamma) apart from the mere non-arising of the aforementioned acts such as the taking of life.
sự từ bỏ không phải là một pháp nào đó, ngoài việc chỉ là sự không sanh khởi của sát sanh v.v... theo các cách đã nói.
Yasmā pana taṃ taṃ pahānaṃ tassa tassa kusalassa dhammassa patiṭṭhānaṭṭhena upadhāraṇaṃ hoti, vippakiṇṇasabhāvākaraṇena ca samodhānaṃ, tasmā pubbe vutteneva upadhāraṇasamodhānasaṅkhātena sīlanaṭṭhena sīlanti vuttaṃ.
However, since each act of abandoning serves as a foundation (patiṭṭhāna) for that particular wholesome quality (dhamma) and as a unification (samodhāna) by preventing a scattered state, it is called sīla by way of the meaning of sīlana, which is described as foundation and unification, as stated previously.
Tuy nhiên, vì sự từ bỏ này hay sự từ bỏ kia là nền tảng theo ý nghĩa làm nơi nương tựa cho pháp thiện này hay pháp thiện kia, và là sự hợp nhất do không làm cho các trạng thái bị phân tán, cho nên nó được gọi là giới theo ý nghĩa của giới hạnh, tức là sự nương tựa và sự hợp nhất đã được nói trước đây.
Itare cattāro dhammā tato tato veramaṇivasena tassa tassa saṃvaravasena tadubhayasampayuttacetanāvasena taṃ taṃ avītikkamantassa avītikkamavasena ca cetaso pavattisabhāvaṃ sandhāya vuttā.
The other four qualities are stated with reference to the nature of the mind's activity: by way of abstaining from each particular act, by way of restraining each particular act, by way of the volition associated with both, and by way of non-transgression for one who does not transgress each particular act.
Bốn pháp còn lại được nói đến liên quan đến bản chất của sự vận hành của tâm, theo phương diện kiêng cữ khỏi điều này hay điều kia, theo phương diện phòng hộ khỏi điều này hay điều kia, theo phương diện tư tương ưng với cả hai điều đó, và theo phương diện không vi phạm đối với người không vi phạm điều này hay điều kia.
956
Atha vā pahānampi dhammato atthiyeva.
Alternatively, abandoning (pahāna) also exists as a phenomenon (dhamma).
Hoặc là, sự từ bỏ cũng thực sự tồn tại về phương diện pháp.
Kathaṃ?
How?
Như thế nào?
Pahīyate anena pāṇātipātādipaṭipakkho, pajahati vā taṃ paṭipakkhanti pahānaṃ.
It is called abandoning because the opposing principle to the taking of life, etc., is abandoned by it, or it abandons that opposing principle.
Pháp đối nghịch với sát sanh v.v... bị từ bỏ bởi pháp này, hoặc pháp này từ bỏ pháp đối nghịch ấy, nên gọi là sự từ bỏ.
Kiṃ taṃ?
What is that?
Pháp đó là gì?
Sabbepi kusalā khandhā.
All wholesome aggregates (kusalā khandhā).
Tất cả các thiện uẩn.
Aññe pana ācariyā ‘‘nekkhammādīsupi ‘veramaṇī sīla’nti vacanamattaṃ gahetvā sabbakusalesupi niyatayevāpanakabhūtā virati nāma atthī’’ti vadanti, na tathā idhāti.
Other teachers, however, say that "by taking only the expression 'abstinence is sīla' even in renunciation and so on, there is indeed an abstinence that is a definite concomitant mental factor (niyatayevāpanakabhūtā virati) in all wholesome states," but it is not so here.
Tuy nhiên, các vị Luận sư khác, chỉ dựa vào câu "kiêng cữ là giới" trong các pháp như xuất ly v.v..., nói rằng: "Ngay cả trong tất cả các pháp thiện, cũng có một sự kiêng cữ nhất định, là một tâm sở bất định", nhưng ở đây thì không phải như vậy.
Evamimehi pahānādīhi pañcahi padehi visesetvā pariyantāpariyantasīladvaye apariyantasīlameva vuttaṃ.
Thus, by specifying with these five terms—abandoning and so on—only the unlimited sīla (apariyantasīla) is stated among the two types of sīla (limited and unlimited).
Như vậy, bằng cách phân biệt với năm từ này là từ bỏ v.v..., trong hai loại giới là giới hữu hạn và giới vô hạn, chỉ có giới vô hạn được nói đến.
Tasmā eva hi evarūpāni sīlāni cittassa avippaṭisārāya saṃvattanti…pe… sacchikātabbaṃ sacchikaronto sikkhatīti vuttaṃ.
Therefore, it is said: " Such sīlas lead to freedom from remorse (avippaṭisāra)…pe… one trains oneself, realizing what is to be realized."
Chính vì lý do đó mà có câu: Những giới như vậy đưa đến sự không hối tiếc... cho đến... người ấy tu học trong khi chứng ngộ điều cần chứng ngộ.
957
Tattha avippaṭisārāya saṃvattantīti ‘‘saṃvaro avippaṭisāratthāyā’’ti (pari. 366) ca ‘‘avippaṭisāratthāni kho, ānanda, kusalāni sīlāni avippaṭisārānisaṃsānī’’ti (a. ni. 10.1; 11.1) ca vacanato avippaṭisāratthāya saṃvattanti.
Here, lead to freedom from remorse means they lead to freedom from remorse, as stated in "restraint is for freedom from remorse" and "wholesome sīlas, Ānanda, are for freedom from remorse; they have freedom from remorse as their benefit." Lead to joy (pāmojja), as stated in "freedom from remorse is for joy" and "joy arises in one who attends wisely."
Trong đó, đưa đến sự không hối tiếc có nghĩa là chúng đưa đến sự không hối tiếc, theo câu "sự phòng hộ là vì mục đích không hối tiếc" và "này Ānanda, các thiện giới có mục đích là không hối tiếc, có quả báu là không hối tiếc".
‘‘Avippaṭisāro pāmojjatthāyā’’ti (pari. 366) ca ‘‘yoniso manasikaroto pāmojjaṃ jāyatī’’ti (paṭi. ma. 1.74) ca vacanato pāmojjāya saṃvattanti.
Joy leads to rapture (pīti), as stated in "joy is for rapture" and "rapture arises in one who is joyful." Rapture leads to tranquility (passaddhi), as stated in "rapture is for tranquility" and "the body of one whose mind is rapturous becomes tranquil." Tranquility leads to happiness (sukha), as stated in "tranquility is for happiness" and "one whose body is tranquil experiences happiness." Happiness leads to concentration (samādhi), as stated in "the mind of one who is happy becomes concentrated." Concentration leads to knowledge and vision of things as they are (yathābhūtañāṇadassana), as stated in "concentration is for knowledge and vision of things as they are." Knowledge and vision of things as they are lead to disenchantment (nibbidā), as stated in "knowledge and vision of things as they are are for disenchantment." Disenchantment leads to dispassion (virāga), as stated in "disenchantment is for dispassion." Dispassion leads to liberation (vimutti), as stated in "dispassion is for liberation." Liberation leads to knowledge and vision of liberation (vimuttiñāṇadassana), as stated in "liberation is for knowledge and vision of liberation."
Đưa đến hân hoan, theo câu "sự không hối tiếc là vì mục đích hân hoan" và "hân hoan sanh khởi nơi người tác ý như lý".
‘‘Pāmojjaṃ pītatthāyā’’ti (pari. 366) ca ‘‘pamuditassa pīti jāyatī’’ti (a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato pītiyā saṃvattanti.
Because it is said, ‘‘Joy is for rapture,’’ and ‘‘For one who is joyful, rapture arises,’’ they lead to rapture.
Đưa đến hỷ, theo câu "hân hoan là vì mục đích hỷ" và "hỷ sanh khởi nơi người có tâm hoan hỷ".
‘‘Pīti passaddhatthāyā’’ti (pari. 366) ca ‘‘pītimanassa kāyo passambhatī’’ti (a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato passaddhiyā saṃvattanti.
Because it is said, ‘‘Rapture is for tranquility,’’ and ‘‘For one whose mind is rapturous, the body becomes tranquil,’’ they lead to tranquility.
Đưa đến khinh an, theo câu "hỷ là vì mục đích khinh an" và "thân của người có tâm hỷ được khinh an".
‘‘Passaddhi sukhatthāyā’’ti (pari. 366) ca ‘‘passaddhakāyo sukhaṃ vedetī’’ti (a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato somanassāya saṃvattanti.
Because it is said, ‘‘Tranquility is for happiness,’’ and ‘‘One whose body is tranquil experiences happiness,’’ they lead to joy.
Đưa đến hỷ lạc, theo câu "khinh an là vì mục đích lạc" và "người có thân khinh an cảm thọ lạc".
Cetasikaṃ sukhañhi somanassanti vuccati.
For mental happiness is called joy (somanassa).
Quả vậy, lạc thuộc về tâm được gọi là hỷ lạc.
Āsevanāyāti bhusā sevanā āsevanā.
By cultivation (āsevanāya) means intense cultivation.
Vì sự thực hành nghĩa là sự thực hành nhiều lần là āsevanā.
Kassa āsevanā?
Cultivation of what?
Thực hành cái gì?
Anantaraṃ somanassavacanena sukhassa vuttattā sukhaṃ siddhaṃ.
Since happiness was mentioned immediately before with the word ‘joy’ (somanassa), happiness is established.
Vì lạc đã được nói đến ngay sau từ hỷ lạc, nên lạc đã được xác lập.
‘‘Sukhino cittaṃ samādhiyatī’’ti (a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato tena sukhena samādhi siddho hoti.
And because it is said, ‘‘For one who is happy, the mind becomes concentrated,’’ concentration is established by that happiness.
Và theo câu "tâm của người có lạc được định tĩnh", do lạc ấy mà định được thành tựu.
Evaṃ siddhassa samādhissa āsevanā.
It is the cultivation of such established concentration.
Như vậy, đó là sự thực hành định đã được thành tựu.
Tassa samādhissa āsevanāya saṃvattanti, paguṇabalavabhāvāya saṃvattantīti attho.
The meaning is that they lead to the cultivation (āsevanāya) of that concentration, they lead to its proficiency and strength.
Chúng đưa đến sự thực hành định ấy, nghĩa là chúng đưa đến trạng thái thuần thục và mạnh mẽ.
Bhāvanāyāti tasseva samādhissa vuddhiyā.
By development (bhāvanāya) means by the growth of that same concentration.
Vì sự tu tập nghĩa là vì sự tăng trưởng của chính định ấy.
Bahulīkammāyāti tasseva samādhissa punappunaṃ kiriyāya.
By making much of it (bahulīkammāya) means by repeatedly performing that same concentration.
Vì sự làm cho thuần thục nghĩa là vì sự thực hiện lặp đi lặp lại chính định ấy.
Avippaṭisārādipavattiyā mūlakāraṇaṃ hutvā samādhissa saddhindriyādialaṅkārasādhanena alaṅkārāya saṃvattanti.
Becoming the root cause of the arising of non-regret and so on, and by achieving the adornment of concentration through faculties like faith, they lead to adornment.
Trở thành nguyên nhân căn bản cho sự phát sinh của không hối tiếc v.v..., chúng đưa đến sự trang hoàng bằng cách hoàn thiện sự trang hoàng cho định với tín quyền v.v...
Avippaṭisārādikassa samādhisambhārassa sādhanena parikkhārāya saṃvattanti.
By achieving the requisites of concentration such as non-regret, they lead to requisites.
Bằng cách hoàn thiện các yếu tố hỗ trợ định như không hối tiếc v.v..., chúng đưa đến sự hỗ trợ.
‘‘Ye ca kho ime pabbajitena jīvitaparikkhārā samudānetabbā’’tiādīsu (ma. ni. 1.192) viya hi ettha sambhārattho parikkhārasaddo.
Indeed, in phrases like ‘‘whatever requisites for life are to be accumulated by a renunciant,’’ the word ‘requisite’ (parikkhāra) here means 'equipment' or 'provision'.
Quả vậy, ở đây, từ parikkhāra có nghĩa là yếu tố hỗ trợ, giống như trong các câu như "những vật dụng sinh hoạt này cần được người xuất gia chuẩn bị".
‘‘Ratho sīlaparikkhāro, jhānakkho cakkavīriyo’’tiādīsu (saṃ. ni. 3.54) pana alaṅkārattho.
But in phrases like ‘‘The chariot is adorned with virtue, its axle is jhāna, its wheels are energy,’’ it means 'adornment'.
Còn trong các câu như "cỗ xe có giới làm vật trang hoàng, có thiền làm trục, có tinh tấn làm bánh xe", nó có nghĩa là vật trang hoàng.
‘‘Sattahi nagaraparikkhārehi suparikkhataṃ hotī’’tiādīsu (a. ni. 7.67) parivārattho.
In phrases like ‘‘It is well-guarded by seven city-requisites,’’ it means 'retinue'.
Trong các câu như "được bảo vệ kỹ càng bởi bảy vật tùy tùng của thành phố", nó có nghĩa là vật tùy tùng.
Idha pana alaṅkāraparivārānaṃ visuṃ āgatattā sambhāratthoti vuttaṃ.
Here, however, since adornment and retinue are mentioned separately, it is said to mean 'equipment'.
Tuy nhiên, ở đây, vì các từ trang hoàng và tùy tùng đã được đề cập riêng, nên nó được nói là có nghĩa là yếu tố hỗ trợ.
Sambhārattho ca paccayatthoti.
And the meaning of 'equipment' is 'cause'.
Và ý nghĩa của yếu tố hỗ trợ chính là ý nghĩa của duyên.
Mūlakāraṇabhāveneva samādhisampayuttaphassādidhammasampattisādhanena parivārāya saṃvattanti.
Merely by being the root cause, and by achieving the perfection of mental factors like contact associated with concentration, they lead to retinue.
Chính do bản chất là nguyên nhân căn bản, bằng cách hoàn thiện sự thành tựu của các pháp như xúc v.v... tương ưng với định, chúng đưa đến sự tùy tùng.
Samādhissa vipassanāya ca padaṭṭhānabhāvapāpanena vasībhāvapāpanena ca paripuṇṇabhāvasādhanato pāripūriyā saṃvattanti.
By bringing concentration and insight to the state of a proximate cause, and by bringing them to the state of mastery, and by achieving their complete state, they lead to completion.
Bằng cách đưa định đến trạng thái làm nền tảng cho tuệ quán và bằng cách đưa đến trạng thái thuần thục, do hoàn thiện trạng thái viên mãn, chúng đưa đến sự viên mãn.
958
Evaṃ sīlūpanissayena sabbākāraparipūraṃ samādhiṃ dassetvā idāni ‘‘samāhite citte yathābhūtaṃ jānāti passati, yathābhūtaṃ jānaṃ passaṃ nibbindati, nibbindaṃ virajjati, virāgā vimuccatī’’ti (paṭi. ma. 1.73; dī. ni. 3.359) vacanato sīlamūlakāni samādhipadaṭṭhānāni yathābhūtañāṇadassanādīni dassento ekantanibbidāyātiādimāha.
Having thus shown concentration, complete in all aspects, as conditioned by virtue, the Dhammasenāpati now, wishing to show that the virtue is the training in higher virtue (adhisīla-sikkhā) and that the trainings in higher mind (adhicitta-sikkhā) and higher wisdom (adhipaññā-sikkhā) are rooted in it, according to the saying, ‘‘With a concentrated mind, one knows and sees things as they truly are; knowing and seeing things as they truly are, one becomes disenchanted; being disenchanted, one becomes dispassionate; through dispassion, one is liberated,’’ begins with to utter disenchantment (ekantanibbidāya).
Sau khi đã chỉ rõ định đã viên mãn về mọi phương diện do duyên cận y là giới như vậy, bây giờ, để chỉ rõ các pháp như tri kiến như thật v.v... có giới làm gốc rễ và định làm nền tảng, do lời dạy rằng: “Khi tâm được định tĩnh, vị ấy biết và thấy như thật. Do biết và thấy như thật, vị ấy nhàm chán. Do nhàm chán, vị ấy ly tham. Do ly tham, vị ấy giải thoát”, ngài đã nói câu bắt đầu bằng ekantanibbidāya (để nhất hướng nhàm chán).
Nibbidāya hi dassitāya tassā padaṭṭhānabhūtaṃ yathābhūtañāṇadassanaṃ dassitameva hoti.
For, when disenchantment is shown, the knowledge and vision of things as they truly are, which is its proximate cause, is also shown.
Bởi vì khi sự nhàm chán (nibbidā) được chỉ rõ thì tri kiến như thật (yathābhūtañāṇadassana), vốn là nền tảng của nó, cũng được xem như đã chỉ rõ.
Tasmiñhi asiddhe nibbidā na sijjhatīti.
For if that is not established, disenchantment is not established.
Vì nếu điều ấy không thành tựu thì sự nhàm chán cũng không thành tựu.
Tāni pana vuttatthāneva.
But those terms have already been explained.
Tuy nhiên, các thuật ngữ ấy đã được giải thích ý nghĩa.
Yathābhūtañāṇadassanaṃ panettha sappaccayanāmarūpapariggaho.
Here, the knowledge and vision of things as they truly are is the comprehension of mind-and-matter with their conditions.
Ở đây, tri kiến như thật chính là sự liễu tri danh sắc cùng với các duyên của chúng.
959
Evaṃ amatamahānibbānapariyosānaṃ sīlappayojanaṃ dassetvā idāni tassa sīlassa adhisīlasikkhābhāvaṃ tammūlakā ca adhicittaadhipaññāsikkhā dassetukāmo evarūpānaṃ sīlānaṃ saṃvarapārisuddhi adhisīlantiādimāha.
Having thus shown the purpose of virtue, culminating in the deathless great Nibbāna, the Elder, now wishing to show that this virtue is the training in higher virtue, and that the trainings in higher mind and higher wisdom are rooted in it, begins with ‘‘The purity of restraint of such virtues is higher virtue’’ and so on.
Sau khi đã chỉ rõ lợi ích của giới có Đại Niết-bàn bất tử làm đích cuối cùng như vậy, bây giờ, vì muốn chỉ rõ rằng giới ấy là tăng thượng giới học (adhisīlasikkhā), và tăng thượng tâm học (adhicittasikkhā) cùng tăng thượng tuệ học (adhipaññāsikkhā) lấy giới ấy làm gốc rễ, ngài đã nói câu bắt đầu bằng evarūpānaṃ sīlānaṃ saṃvarapārisuddhi adhisīla (sự thanh tịnh trong thu thúc của các giới như vậy là tăng thượng giới).
Tattha saṃvaroyeva pārisuddhi saṃvarapārisuddhi.
Therein, restraint itself is purity; hence, purity of restraint.
Trong đó, sự thu thúc chính là sự thanh tịnh, nên gọi là saṃvarapārisuddhi (sự thanh tịnh trong thu thúc).
Evarūpānaṃ apariyantabhūtānaṃ vivaṭṭanissitānaṃ sīlānaṃ saṃvarapārisuddhi vivaṭṭanissitattā sesasīlato adhikaṃ sīlanti adhisīlanti vuccati.
The purity of restraint of such boundless virtues, which are connected with the turning away (from saṃsāra), is called higher virtue (adhisīla) because, being connected with the turning away, it is superior to other virtues.
Sự thanh tịnh trong thu thúc của các giới như vậy, vốn vô hạn và hướng đến giải thoát (vivaṭṭanissita), được gọi là adhisīla (tăng thượng giới), vì là giới cao tột hơn các giới khác do có đặc tính hướng đến giải thoát.
Saṃvarapārisuddhiyā ṭhitaṃ cittanti edisāya sīlasaṃvarapārisuddhiyā patiṭṭhitaṃ cittaṃ suṭṭhu avippaṭisārādīnaṃ āvahanato na vikkhepaṃ gacchati, samādhismiṃ patiṭṭhātīti attho.
A mind established in the purity of restraint means that a mind established in such purity of virtuous restraint does not wander, due to its bringing forth non-regret and so on, but becomes established in concentration.
Saṃvarapārisuddhiyā ṭhitaṃ cittaṃ (tâm an trú trong sự thanh tịnh của thu thúc) có nghĩa là: tâm được thiết lập trong sự thanh tịnh của thu thúc giới như thế, do mang lại sự không hối hận v.v... một cách tốt đẹp, nên không đi đến tán loạn, tức là được an lập trong định.
Avikkhepoyeva pārisuddhi avikkhepapārisuddhi.
Non-distraction itself is purity; hence, purity of non-distraction.
Sự không tán loạn chính là sự thanh tịnh, nên gọi là avikkhepapārisuddhi (sự thanh tịnh trong không tán loạn).
So sabbamalavirahito nibbedhabhāgiyo samādhi sesasamādhito adhikattā adhicittanti vuccati.
That samādhi, being free from all defilements and conducive to disenchantment, is called adhicitta because it is superior to other samādhis.
Định ấy, do không còn mọi cấu uế, thuộc về phần thể nhập, và cao tột hơn các định khác, nên được gọi là adhicitta (tăng thượng tâm).
Cittasīsena hettha samādhi niddiṭṭho.
Here, samādhi is indicated by citta as the foremost.
Ở đây, định được chỉ định bằng thuật ngữ chính là tâm.
Saṃvarapārisuddhiṃ sammā passatīti parisuddhaṃ sīlasaṃvaraṃ ñātapariññāvasena tīraṇapariññāvasena ca sammā passati, evameva avikkhepapārisuddhisaṅkhātaṃ parisuddhaṃ samādhiṃ sammā passati.
The phrase "one rightly discerns purity of restraint" means one rightly discerns pure moral restraint, by way of ñāta-pariññā and by way of tīraṇa-pariññā. In the same way, one rightly discerns pure samādhi, which is called purity of non-distraction.
Saṃvarapārisuddhiṃ sammā passati (thấy rõ sự thanh tịnh trong thu thúc) có nghĩa là vị ấy thấy rõ sự thu thúc giới thanh tịnh bằng liễu tri trí (ñātapariññā) và thẩm sát trí (tīraṇapariññā); cũng như vậy, vị ấy thấy rõ định thanh tịnh được gọi là sự thanh tịnh trong không tán loạn.
Evaṃ passato cassa dassanasaṅkhātā pārisuddhi dassanapārisuddhi.
For one who discerns thus, the purity, which is called discernment, is dassanapārisuddhi (purity of discernment).
Đối với vị ấy đang thấy như vậy, sự thanh tịnh được gọi là sự thấy (dassana) chính là dassanapārisuddhi (sự thanh tịnh trong thấy).
Sāyeva sesapaññāya adhikattā adhipaññāti vuccati.
That same purity is called adhipaññā because it is superior to other wisdoms.
Chính nó, do cao tột hơn các tuệ khác, nên được gọi là adhipaññā (tăng thượng tuệ).
Yo tatthāti yo tattha saṃvaraavikkhepadassanesu.
"Yo tatthā" means "that which is in those" (restraint, non-distraction, and discernment).
Yo tatthā (bất cứ điều gì ở đó) nghĩa là, trong sự thu thúc, sự không tán loạn, và sự thấy.
Saṃvaraṭṭhoti saṃvarabhāvo.
"Saṃvaraṭṭho" means the state of restraint.
Saṃvaraṭṭho (trạng thái thu thúc) là bản chất của sự thu thúc.
Evameva avikkhepaṭṭhadassanaṭṭhā ca veditabbā.
In the same way, the states of non-distraction and discernment should be understood.
Cũng như vậy, cần hiểu về trạng thái không tán loạn và trạng thái thấy.
Adhisīlameva sikkhā adhisīlasikkhā.
The training that is superior virtue itself is adhisīlasikkhā.
Tăng thượng giới chính là học pháp, nên gọi là adhisīlasikkhā (tăng thượng giới học).
Evaṃ itarāpi veditabbā.
The others should also be understood in the same way.
Cũng cần hiểu các học pháp khác theo cách như vậy.
960
Evaṃ tisso sikkhāyo dassetvā idāni tāsaṃ pāripūrikkamaṃ dassetuṃ imā tisso sikkhāyo āvajjanto sikkhatītiādimāha.
Having thus shown the three trainings, now, to show the sequence of their fulfillment, the Elder said, "āvajjanto sikkhatī" and so on.
Sau khi đã chỉ rõ ba học pháp như vậy, bây giờ để chỉ rõ trình tự viên mãn của chúng, ngài nói câu bắt đầu bằng imā tisso sikkhāyo āvajjanto sikkhatī (vị ấy học tập trong khi hướng tâm đến ba học pháp này).
Tassattho – paccekaṃ paripūretuṃ āvajjantopi sikkhati nāma, āvajjetvā ‘‘ayaṃ nāma sikkhā’’ti jānantopi sikkhati nāma, jānitvā punappunaṃ passantopi sikkhati nāma, passitvā yathādiṭṭhaṃ paccavekkhantopi sikkhati nāma, paccavekkhitvā tattheva cittaṃ acalaṃ katvā patiṭṭhapentopi sikkhati nāma, taṃtaṃsikkhāsampayuttasaddhāvīriyasatisamādhipaññāhi sakasakakiccaṃ karontopi sikkhati nāma, abhiññeyyābhijānanādikālepi taṃ taṃ kiccaṃ karonto tissopi sikkhāyo sikkhati nāmāti.
Its meaning is: one who reflects to fulfill each individually is said to be training; one who, having reflected, knows "this is such and such a training" is said to be training; one who, having known, repeatedly discerns is said to be training; one who, having discerned, reviews as seen is said to be training; one who, having reviewed, establishes the mind immovably right there is said to be training; one who performs their respective duties with faith, energy, mindfulness, concentration, and wisdom associated with those respective trainings is said to be training; even at the time of fully knowing what is to be known, etc., one who performs those respective duties is said to be training in all three trainings.
Ý nghĩa của câu ấy là: Vị ấy được gọi là đang học tập cả khi hướng tâm để hoàn thiện từng học pháp; được gọi là đang học tập cả khi biết “đây là học pháp” sau khi đã hướng tâm; được gọi là đang học tập cả khi thấy đi thấy lại sau khi đã biết; được gọi là đang học tập cả khi quán xét lại những gì đã thấy; được gọi là đang học tập cả khi làm cho tâm bất động và an lập ngay tại đó sau khi đã quán xét; được gọi là đang học tập cả khi thực hiện phận sự của mình bằng tín, tấn, niệm, định, tuệ tương ưng với từng học pháp; và cả trong thời điểm liễu tri các pháp cần liễu tri v.v..., vị ấy được gọi là đang học tập cả ba học pháp khi thực hiện từng phận sự ấy.
Puna pañca sīlānītiādīni vuttatthāneva.
Again, the phrases "pañca sīlāni" and so on have the same meaning as before.
Một lần nữa, các câu bắt đầu bằng pañca sīlāni (năm giới) có ý nghĩa như đã được giải thích.
Arahattamaggena sabbakilesānantiādīsu pana arahantānaṃ suṭṭhu vippaṭisārādiabhāvato āsevanādibhāvato ca tāni padāni yujjanteva.
However, in phrases such as "arahattamaggena sabbakilesānaṃ" (by the path of Arahantship, of all defilements), those terms are appropriate for Arahants due to the complete absence of remorse and so on, and due to the presence of cultivation and so on.
Tuy nhiên, trong các câu như arahattamaggena sabbakilesānaṃ (bằng A-la-hán đạo, đối với tất cả phiền não), các thuật ngữ ấy vẫn phù hợp, vì các bậc A-la-hán hoàn toàn không có sự hối hận v.v... và vì có sự thực hành v.v...
Ekantanibbidāyātiādīni pana satipaṭṭhānasammappadhānāni viya maggakkhaṇeyeva yojetabbāni.
But phrases such as "ekantanibbidāya" (for complete disenchantment) should be applied only at the moment of the path, like the foundations of mindfulness and right efforts.
Còn các câu bắt đầu bằng ekantanibbidāya (để nhất hướng nhàm chán) nên được áp dụng chỉ trong sát-na đạo, giống như niệm xứ và chánh cần.
961
42.
42.
42.
962
Saṃvarapārisuddhiṃ sammā passati, avikkhepapārisuddhiṃ sammā passatīti idaṃ pana vacanadvayaṃ phalasamāpattatthāya vipassanāvasena yojetabbaṃ, dutiyavacanaṃ pana nirodhasamāpattatthāya vipassanāvasenāpi yujjati.
However, these two statements, "one rightly discerns purity of restraint, one rightly discerns purity of non-distraction," should be applied by way of insight for the attainment of fruition, and the second statement can also be applied by way of insight for the attainment of cessation.
Tuy nhiên, hai câu Saṃvarapārisuddhiṃ sammā passati, avikkhepapārisuddhiṃ sammā passati (thấy rõ sự thanh tịnh trong thu thúc, thấy rõ sự thanh tịnh trong không tán loạn) nên được áp dụng theo phương diện minh sát để chứng nhập quả thiền; còn câu thứ hai cũng phù hợp theo phương diện minh sát để chứng nhập diệt thọ tưởng định.
Āvajjanto sikkhatītiādīsu pañcasu vacanesu arahato sikkhitabbābhāvepi asekkhasīlakkhandhādisabhāvato ‘‘sikkhatī’’ti vuttanti veditabbaṃ.
In the five statements beginning with "āvajjanto sikkhatī" (one who reflects trains), it should be understood that even though an Arahant has nothing further to train in, the word "trains" is used because of the nature of their asekha (beyond training) aggregates of morality, and so on.
Trong năm câu bắt đầu bằng āvajjanto sikkhati (học tập trong khi hướng tâm), cần hiểu rằng mặc dù bậc A-la-hán không còn gì để học, nhưng vẫn được nói là “học tập” do bản chất của vô học giới uẩn v.v...
Saddhāya adhimuccanto sikkhatītiādīni pana maggakkhaṇaññeva sandhāya vuttāni.
But phrases such as "saddhāya adhimuccanto sikkhatī" (one who resolves with faith trains) are stated with reference only to the moment of the path.
Còn các câu bắt đầu bằng saddhāya adhimuccanto sikkhati (học tập trong khi quyết tín bằng đức tin) được nói ra nhắm đến chính sát-na đạo.
Aññānipi upacārappanāvipassanāmaggavasena vuttāni vacanāni yathāyogaṃ yojetabbānīti.
Other statements made by way of access concentration, absorption, insight, and path should also be applied appropriately.
Các câu khác được nói theo phương diện cận hành, an chỉ, minh sát và đạo cũng nên được áp dụng một cách thích hợp.
963
Sīlamayañāṇaniddesavaṇṇanā niṭṭhitā.
The commentary on the exposition of knowledge consisting of morality is concluded.
Phần Chú Giải về Trình Bày Trí Tuệ Do Giới Sanh Đã Hoàn Tất.
964

3. Samādhibhāvanāmayañāṇaniddesavaṇṇanā

3. Commentary on the Exposition of Knowledge Consisting of the Development of Concentration

3. Phần Chú Giải về Trình Bày Trí Tuệ Do Tu Tập Định Sanh

965
43. Samādhibhāvanāmayañāṇaniddese ādito tāva ekakato paṭṭhāya yāva dasakā samādhippabhedaṃ dassento eko samādhītiādimāha.
43. In the exposition of knowledge consisting of the development of concentration, to show the classification of samādhi from the single category up to the ten categories, he first said, "eko samādhī" (one concentration) and so on.
43. Trong phần trình bày trí tuệ do tu tập định sanh, trước hết, để chỉ rõ sự phân loại định từ pháp một cho đến pháp mười, ngài nói câu bắt đầu bằng eko samādhi (một loại định).
Tattha cittassa ekaggatāti nānārammaṇavikkhepābhāvato ekaṃ ārammaṇaṃ aggaṃ uttamaṃ assāti ekaggo, ekaggassa bhāvo ekaggatā.
Therein, "cittassa ekaggatā" means that the mind has a single, supreme object due to the absence of distraction by various objects; thus, it is ekagga (one-pointed), and the state of being one-pointed is ekaggatā (one-pointedness).
Trong đó, cittassa ekaggatā (sự nhất tâm) có nghĩa là: do không có sự tán loạn trên nhiều đối tượng khác nhau, tâm có một đối tượng duy nhất là tối thượng, nên gọi là ekagga (nhất tâm); trạng thái của nhất tâm là ekaggatā (sự nhất tâm).
Sā pana ekaggatā cittassa, na sattassāti dassanatthaṃ ‘‘cittassā’’ti vuttaṃ.
The word " cittassā" is used to show that this one-pointedness belongs to the mind, not to a being.
Sự nhất tâm ấy là của tâm, không phải của chúng sanh; để chỉ rõ ý nghĩa này, ngài đã nói “cittassa” (của tâm).
Duke lokiyoti loko vuccati lujjanapalujjanaṭṭhena vaṭṭaṃ, tasmiṃ pariyāpannabhāvena loke niyuttoti lokiyo.
In the pair, "lokiyo" (mundane) refers to vaṭṭa (the cycle of existence) which is called loka (world) because it is subject to decay and dissolution; thus, it is lokiyo because it is involved in that world.
Trong pháp hai, lokiyo (thuộc về thế gian) có nghĩa là: thế gian (loko) được gọi là luân hồi (vaṭṭa) theo nghĩa hoại diệt và tan rã; do thuộc về luân hồi ấy, nên được gọi là lokiyo.
Lokuttaroti uttiṇṇoti uttaro, loke apariyāpannabhāvena lokato uttaroti lokuttaro.
"Lokuttaro" (supramundane) means "transcended" (uttara) because it has gone beyond; it is lokuttaro because it transcends the world by not being comprised within the world.
Lokuttaro (siêu thế) có nghĩa là: đã vượt qua nên là uttaro (cao hơn); do không thuộc về thế gian nên cao hơn thế gian, vì vậy gọi là lokuttaro.
Tike savitakko ca so savicāro cāti savitakkasavicāro.
In the triad, that which is accompanied by vitakka and accompanied by vicāra is savitakkasavicāro.
Trong pháp ba, có tầm và có tứ nên là savitakkasavicāro (có tầm có tứ).
Evaṃ avitakkaavicāro.
Similarly, avitakkaavicāro.
Tương tự, avitakkaavicāro (không tầm không tứ).
Vitakkavicāresu vicārova mattā pamāṇaṃ etassāti vicāramatto, vicārato utthari vitakkena saddhiṃ sampayogaṃ na gacchatīti attho.
Vicāramatto means that among vitakka and vicāra, vicāra alone is its measure or extent; the meaning is that it does not go beyond vicāra to be associated with vitakka.
Vicāramatto (chỉ có tứ) có nghĩa là trong tầm và tứ, chỉ có tứ là mức độ của nó; nghĩa là nó không đi đến sự tương ưng với tầm vượt ngoài tứ.
Avitakko ca so vicāramatto cāti avitakkavicāramatto.
That which is without vitakka and is only vicāra is avitakkavicāramatto.
Không có tầm và chỉ có tứ nên là avitakkavicāramatto (không tầm chỉ có tứ).
Tīsupi vicchedaṃ katvāpi paṭhanti.
Some also read these three by making a separation (in the compound).
Trong cả ba, người ta cũng đọc bằng cách tách rời.
Catukkapañcakā vuttatthā.
The fourfold and fivefold categories have been explained.
Pháp bốn và pháp năm có ý nghĩa như đã được giải thích.
Chakke punappunaṃ uppajjanato satiyeva anussati, pavattitabbaṭṭhānamhiyeva vā pavattattā saddhāpabbajitassa kulaputtassa anurūpā satītipi anussati, buddhaṃ ārabbha uppannā anussati ba uddhānussati.
In the group of six, because mindfulness arises repeatedly, it is indeed recollection (anussati). Or, because it occurs only in the appropriate place where it should occur, it is recollection (anussati) as it is suitable mindfulness for a young man of good family who has gone forth out of faith. Recollection that arises with the Buddha as its object is Buddhanussati.
Trong pháp sáu, do sanh khởi lặp đi lặp lại nên chính niệm là tùy niệm (anussati); hoặc do chỉ sanh khởi ở nơi cần sanh khởi nên niệm phù hợp với thiện gia nam tử đã xuất gia với đức tin cũng là tùy niệm; tùy niệm sanh khởi do hướng đến Đức Phật là buddhānussati (niệm Phật).
Arahatādibuddhaguṇārammaṇāya satiyā etaṃ adhivacanaṃ.
This is a designation for mindfulness that has the qualities of the Buddha, such as Arahantship, as its object.
Đây là tên gọi của niệm có đối tượng là các đức tính của Đức Phật như A-la-hán v.v...
Tassā buddhānussatiyā vasena cittassa ekaggatāyeva uddhaccasaṅkhātassa vikkhepassa paṭipakkhabhāvato na vikkhepoti avikkhepo.
Due to that Buddhanussati, the one-pointedness of mind itself, being the opposite of distraction, which is called restlessness (uddhacca), is therefore non-distraction (avikkhepa).
Do niệm Phật ấy, sự nhất tâm chính là avikkhepo (không tán loạn) vì nó là đối nghịch của sự tán loạn được gọi là trạo cử.
Dhammaṃ ārabbha uppannā anussati dhammānussati.
Recollection that arises with the Dhamma as its object is Dhammanussati.
Tùy niệm sanh khởi do hướng đến Pháp là dhammānussati (niệm Pháp).
Svākkhātatādidhammaguṇārammaṇāya satiyā etaṃ adhivacanaṃ.
This is a designation for mindfulness that has the qualities of the Dhamma, such as being well-proclaimed, as its object.
Đây là tên gọi của niệm có đối tượng là các đức tính của Pháp như được khéo thuyết giảng v.v...
Saṅghaṃ ārabbha uppannā anussati saṅghānussati.
Recollection that arises with the Sangha as its object is Sanghanussati.
Tùy niệm sanh khởi do hướng đến Tăng là saṅghānussati (niệm Tăng).
Suppaṭipannatādisaṅghaguṇārammaṇāya satiyā etaṃ adhivacanaṃ.
This is a designation for mindfulness that has the qualities of the Sangha, such as being well-practiced, as its object.
Đây là tên gọi của niệm có đối tượng là các đức tính của Tăng như diệu hạnh v.v...
Sīlaṃ ārabbha uppannā anussati sīlānussati.
Recollection that arises with sīla as its object is Sīlanussati.
Tùy niệm sanh khởi do hướng đến giới là sīlānussati (niệm giới).
Attano akhaṇḍatādisīlaguṇārammaṇāya satiyā etaṃ adhivacanaṃ.
This is a designation for mindfulness that has one's own qualities of sīla, such as being unbroken, as its object.
Đây là tên gọi của niệm có đối tượng là các đức tính của giới của chính mình như không bị sứt mẻ v.v...
Cāgaṃ ārabbha uppannā anussati cāgānussati.
Recollection that arises with cāga as its object is Cāgānussati.
Tùy niệm sanh khởi do hướng đến sự xả ly là cāgānussati (niệm thí).
Attano muttacāgatādicāgaguṇārammaṇāya satiyā etaṃ adhivacanaṃ.
This is a designation for mindfulness that has one's own qualities of cāga, such as open generosity, as its object.
Đây là tên gọi của niệm có đối tượng là các đức tính của sự xả ly của chính mình như đã xả ly hoàn toàn v.v...
Devatā ārabbha uppannā anussati devatānussati.
Recollection that arises with devatās as its object is Devatānussati.
Tùy niệm sanh khởi do hướng đến chư thiên là devatānussati (niệm thiên).
Devatā sakkhiṭṭhāne ṭhapetvā attano saddhādiguṇārammaṇāya satiyā etaṃ adhivacanaṃ.
This is a designation for mindfulness that has one's own qualities, such as faith, as its object, taking devatās as witnesses.
Đây là tên gọi của niệm, sau khi đặt chư thiên ở vị trí chứng nhân, lấy các đức tính như tín, v.v., của chính mình làm đối tượng.
966
Sattake samādhikusalatāti ekavidhādibhedena anekabhede samādhimhi ‘‘ayamevaṃvidho samādhi, ayamevaṃvidho samādhī’’ti chekabhāvo.
In the group of seven, skill in samādhi means being adept in samādhi, which has many distinctions, such as being of one kind, knowing "this samādhi is of this nature, this samādhi is of that nature."
Trong pháp bảy, sự thiện xảo về định là trạng thái thiện xảo trong định có nhiều loại được phân chia như một loại, v.v., rằng: “định này có loại như vầy, định này có loại như vầy.”
Samādhiparicchedakapaññāyetaṃ adhivacanaṃ.
This is a designation for the wisdom that discerns samādhi.
Đây là tên gọi của trí tuệ phân định về định.
Samādhiuppādanavidhānepi chekabhāvo samādhikusalatā.
Skill in samādhi is also adeptness in the method of producing samādhi.
Sự thiện xảo trong phương pháp làm phát sinh định cũng là sự thiện xảo về định.
967
Samādhissa samāpattikusalatāti uppāditassa samādhissa samāpajjane chekabhāvo.
Skill in attaining samādhi means adeptness in attaining the samādhi that has been produced.
Sự thiện xảo trong việc nhập định là sự thiện xảo trong việc nhập vào định đã được làm cho phát sinh.
Etena samāpajjanavasitā vuttā hoti.
By this, mastery in attainment is stated.
Qua đây, năng lực nhập định (samāpajjanavasitā) được nói đến.
968
Samādhissa ṭhitikusalatāti samāpannassa samādhissa santativasena yathāruci ṭhapane chekabhāvo.
Skill in the abiding of samādhi means adeptness in sustaining the attained samādhi for as long as one wishes, by way of its continuity.
Sự thiện xảo trong việc duy trì định là sự thiện xảo trong việc duy trì định đã nhập theo ý muốn bằng dòng tương tục.
Etena adhiṭṭhānavasitā vuttā hoti.
By this, mastery in resolution is stated.
Qua đây, năng lực quyết định (adhiṭṭhānavasitā) được nói đến.
Atha vā nimittaggahaṇena cassa puna te ākāre sampādayato appanāmattameva ijjhati, na ciraṭṭhānaṃ.
Alternatively, for one who, by grasping the sign, reproduces those modes, only the attainment of absorption (appanā) succeeds, not its long duration.
Hoặc là, đối với vị ấy, dù đã nắm bắt tướng và nỗ lực tạo ra các trạng thái đó trở lại, chỉ có sự an chỉ là thành tựu, chứ không duy trì được lâu dài.
Ciraṭṭhānaṃ pana samādhiparipanthānaṃ dhammānaṃ suvisodhitattā hoti.
Long duration, however, comes about through the thorough purification of the factors obstructive to samādhi.
Việc duy trì lâu dài là do đã thanh lọc kỹ càng các pháp đối nghịch với định.
Yo hi bhikkhu kāmādīnavapaccavekkhaṇādīhi kāmacchandaṃ na suṭṭhu vikkhambhetvā, kāyapassaddhivasena kāyaduṭṭhullaṃ na suppaṭippassaddhaṃ katvā, ārambhadhātumanasikārādivasena thinamiddhaṃ na suṭṭhu paṭivinodetvā, samathanimittamanasikārādivasena uddhaccakukkuccaṃ na suṭṭhu samūhataṃ katvā, aññepi samādhiparipanthe dhamme na suṭṭhu visodhetvā jhānaṃ samāpajjati, so avisodhitaṃ āsayaṃ paviṭṭhabhamaro viya, asuddhaṃ uyyānaṃ paviṭṭharājā viya ca khippameva nikkhamati.
For if a bhikkhu attains jhāna without thoroughly suppressing sensual desire (kāmacchanda) by reflecting on the danger of sensual pleasures and so forth, without thoroughly calming the bodily disturbance (kāyaduṭṭhulla) by means of bodily tranquility, without thoroughly dispelling sloth and torpor (thīnamiddha) by means of focusing on the element of exertion and so forth, without thoroughly uprooting restlessness and remorse (uddhaccakukkucca) by means of focusing on the sign of tranquility and so forth, and without thoroughly purifying other factors obstructive to samādhi, then he quickly emerges, like a bee entering an unpurified hollow or a king entering an unclean park.
Thật vậy, vị Tỳ khưu nào nhập thiền mà không chế ngự tốt dục tham bằng cách quán xét sự nguy hại trong các dục, v.v., không làm cho sự thô trược của thân hoàn toàn lắng dịu nhờ thân khinh an, không loại trừ tốt hôn trầm thụy miên nhờ tác ý về giới cần tinh tấn, v.v., không dẹp tan tốt trạo cử hối quá nhờ tác ý về tướng tịnh chỉ, v.v., và không thanh lọc tốt các pháp khác đối nghịch với định, vị ấy sẽ nhanh chóng xuất ra, giống như con ong chui vào một nơi trú ẩn chưa được dọn dẹp, hay như vị vua đi vào một khu vườn không sạch sẽ.
Yo pana samādhiparipanthe dhamme suṭṭhu visodhetvā jhānaṃ samāpajjati, so suvisodhitaṃ āsayaṃ paviṭṭhabhamaro viya, suparisuddhaṃ uyyānaṃ paviṭṭharājā viya ca sakalampi divasabhāgaṃ antosamāpattiyaṃyeva hoti.
But if one thoroughly purifies the factors obstructive to samādhi and attains jhāna, one remains in absorption (samāpatti) for the entire day, like a bee entering a well-purified hollow or a king entering a perfectly clean park.
Còn vị nào nhập thiền sau khi đã thanh lọc tốt các pháp đối nghịch với định, vị ấy sẽ ở trong định suốt cả ngày, giống như con ong chui vào một nơi trú ẩn đã được dọn dẹp kỹ càng, hay như vị vua đi vào một khu vườn đã được làm cho hoàn toàn trong sạch.
Tenāhu porāṇā –
Therefore, the ancients said:
Do đó, các vị cổ sư đã nói:
969
‘‘Kāmesu chandaṃ paṭighaṃ vinodaye, uddhaccathīnaṃ vicikicchapañcamaṃ;
“One should dispel desire for sensual pleasures, aversion, restlessness, sloth, and the fifth, doubt;
“Hãy loại bỏ tham muốn trong các dục và sân hận, cùng trạo cử, hôn trầm, và hoài nghi là thứ năm;
970
Vivekapāmojjakarena cetasā, rājāva suddhantagato tahiṃ rame’’ti .
With a mind that brings joy of seclusion, one should delight there like a king who has entered his inner sanctum.”
Với tâm tạo ra hỷ lạc từ sự viễn ly, hãy an hưởng trong đó, như vua vào nơi cung cấm thanh tịnh.”
971
Tasmā ‘‘ciraṭṭhitikāmena pāripanthikadhamme sodhetvā jhānaṃ samāpajjitabba’’nti vuttattā taṃ vidhiṃ sampādetvā samādhissa ciraṭṭhitikaraṇe chekabhāvoti vuttaṃ hoti.
Therefore, it is stated that "one who desires long duration should purify the obstructive factors and attain jhāna," meaning that adeptness in sustaining samādhi for a long time is achieved by completing that method.
Vì vậy, đã được nói rằng: “Người muốn duy trì lâu dài nên nhập thiền sau khi đã thanh lọc các pháp đối nghịch,” do đó, điều được nói ở đây là sự thiện xảo trong việc làm cho định duy trì lâu dài sau khi đã hoàn thành phương pháp đó.
972
Samādhissa vuṭṭhānakusalatāti santativasena yathāruci pavattassa samādhissa yathāparicchinnakāleyeva vuṭṭhānena samādhissa vuṭṭhāne chekabhāvo.
Skill in emerging from samādhi means adeptness in emerging from samādhi at the precisely determined time, when the samādhi has proceeded as one wished by way of its continuity.
Sự thiện xảo trong việc xuất định là sự thiện xảo trong việc xuất khỏi định, tức là việc xuất ra đúng vào thời điểm đã được xác định trước, đối với định đã diễn tiến theo ý muốn bằng dòng tương tục.
‘‘Yassa hi dhammaṃ puriso vijaññā’’tiādīsu (jā. 1.10.152) viya nissakkatthe vā sāmivacanaṃ katanti veditabbanti.
It should be understood that the genitive case is used here in the sense of the ablative, as in "The Dhamma that a person might know" and so forth.
Hoặc nên hiểu rằng, sở hữu cách được dùng với ý nghĩa xuất xứ, giống như trong các câu như “Yassa hi dhammaṃ puriso vijaññā” (Do pháp nào mà người ta có thể biết được).
Etena vuṭṭhānavasitā vuttā hoti.
By this, mastery in emerging is stated.
Qua đây, năng lực xuất định (vuṭṭhānavasitā) được nói đến.
973
Samādhissa kallatākusalatāti agilānabhāvo arogabhāvo kallatā.
Skill in the adaptability of samādhi means being free from illness, being free from disease, which is adaptability.
Sự thiện xảo về sự lành mạnh của định: Sự lành mạnh (kallatā) là trạng thái không bệnh tật, không ốm đau.
Gilāno hi akallakoti vuccati.
For an ill person is called unadaptable.
Thật vậy, người bệnh được gọi là người không lành mạnh (akallako).
Vinayepi vuttaṃ ‘‘nāhaṃ, bhante, akallako’’ti (pārā. 151).
In the Vinaya it is said, "Venerable sir, I am not unfit."
Trong Luật cũng có nói: “Bạch ngài, con không phải là người không lành mạnh (akallako).”
Anaṅgaṇasuttavatthasuttesu (ma. ni. 1.57 ādayo, 70 ādayo) vuttānaṃ jhānapaṭilābhapaccanīkānaṃ pāpakānaṃ icchāvacarānaṃ abhāvena ca abhijjhādīnaṃ cittassa upakkilesānaṃ vigamena ca samādhissa agilānabhāvakaraṇe chekabhāvo samādhissa kallatākusalatā, kilesagelaññarahitabhāve kusalatāti vuttaṃ hoti.
And by the absence of evil desires, which are obstacles to the attainment of jhāna, as stated in the Anaṅgaṇa Sutta and Vatthūpama Sutta, and by the removal of mental defilements such as covetousness, the skillfulness of samādhi is the cleverness in making samādhi free from affliction, or it is said to be the skillfulness in being free from the sickness of defilements.
Sự thiện xảo về sự lành mạnh của định là sự thiện xảo trong việc làm cho định không bệnh tật, nhờ không có những ác ý xấu xa cản trở việc chứng đắc thiền đã được nói trong kinh Anaṅgaṇasutta và Vatthasutta, và nhờ sự từ bỏ các tùy phiền não của tâm như tham lam, v.v.; điều này có nghĩa là sự thiện xảo trong việc làm cho định thoát khỏi bệnh tật của phiền não.
Atha vā kallatāti kammaññatā kammaññatāpariyāyattā kallavacanassa.
Or, kallatā means suitability, because the word kalla is a synonym for suitability.
Hoặc là, sự lành mạnh (kallatā) là sự dễ sử dụng (kammaññatā), vì từ "kalla" là một từ đồng nghĩa với "kammaññatā".
‘‘Yā cittassa akallatā akammaññatā’’ti (dha. sa. 1162) hi vuttaṃ ‘‘kallacittaṃ muducittaṃ vinīvaraṇacitta’’nti (dī. ni. 1.298; ma. ni. 2.395; mahāva. 26) ca.
Indeed, it is said, "That unsuitability, unworkability of the mind," and "a suitable mind, a pliant mind, a mind free from hindrances."
Thật vậy, có nói rằng: “Sự không lành mạnh, không dễ sử dụng của tâm” và “tâm lành mạnh, tâm nhu nhuyến, tâm không còn triền cái”.
Ettha kallasaddo kammaññattho.
Here, the word kalla means suitability.
Ở đây, từ "kalla" có nghĩa là dễ sử dụng.
Tasmā kasiṇānulomato kasiṇapaṭilomato kasiṇānulomapaṭilomato jhānānulomato jhānapaṭilomato jhānānulomapaṭilomato jhānukkantikato kasiṇukkantikato jhānakasiṇukkantikato aṅgasaṅkantito ārammaṇasaṅkantito aṅgārammaṇasaṅkantito aṅgavavatthānato ārammaṇavavatthānatoti imehi cuddasahi ākārehi, aṅgārammaṇavavatthānatoti iminā saha pañcadasahi vā ākārehi cittaparidamanena samādhissa kammaññabhāvakaraṇe kusalabhāvoti vuttaṃ hoti.
Therefore, it is said to be skillfulness in making samādhi workable by disciplining the mind in these fourteen ways: by kasiṇa in forward order, by kasiṇa in reverse order, by kasiṇa in forward and reverse order, by jhāna in forward order, by jhāna in reverse order, by jhāna in forward and reverse order, by leaping into jhāna, by leaping into kasiṇa, by leaping into jhāna and kasiṇa, by shifting factors, by shifting objects, by shifting factors and objects, by determining factors, by determining objects; or by fifteen ways including determining factors and objects.
Do đó, điều được nói ở đây là sự thiện xảo trong việc làm cho định trở nên dễ sử dụng bằng cách rèn luyện tâm theo mười bốn phương cách sau: thuận theo kasiṇa, nghịch theo kasiṇa, thuận nghịch theo kasiṇa, thuận theo thiền, nghịch theo thiền, thuận nghịch theo thiền, vượt bậc thiền, vượt bậc kasiṇa, vượt bậc thiền và kasiṇa, chuyển đổi chi thiền, chuyển đổi đối tượng, chuyển đổi chi thiền và đối tượng, xác định chi thiền, và xác định đối tượng; hoặc theo mười lăm phương cách khi tính cả việc xác định chi thiền và đối tượng.
974
Samādhissa gocarakusalatāti samādhissa gocaresu kasiṇādīsu ārammaṇesu taṃ taṃ jhānaṃ samāpajjitukāmatāya yathāruci āvajjanakaraṇavasena tesu ārammaṇesu chekabhāvo.
Skillfulness in the range of samādhi means cleverness in those objects such as kasiṇa, by directing the mind as one wishes, with the desire to enter that particular jhāna.
Sự thiện xảo về hành xứ của định là sự thiện xảo đối với các đối tượng là hành xứ của định như kasiṇa, v.v., bằng cách hướng tâm theo ý muốn khi muốn nhập vào thiền này hay thiền khác.
Etena kasiṇāvajjanavasena āvajjanavasitā vuttā hoti.
By this, the mastery of directing the mind by directing the kasiṇa is stated.
Qua đây, năng lực hướng tâm (āvajjanavasitā) thông qua việc hướng đến kasiṇa được nói đến.
Atha vā tasmiṃ tasmiṃ disābhāge kasiṇapharaṇavasena evaṃ phuṭṭhassa kasiṇassa ciraṭṭhānavasena ca samādhissa gocaresu chekabhāvo.
Or, it is cleverness in the objects of samādhi by spreading the kasiṇa in each direction, and by the long endurance of the kasiṇa thus pervaded.
Hoặc là, sự thiện xảo về hành xứ của định là nhờ khả năng biến mãn kasiṇa đến các phương hướng khác nhau và nhờ khả năng duy trì lâu dài kasiṇa đã được biến mãn như vậy.
975
Samādhissa abhinīhārakusalatāti ekattanayena heṭṭhāheṭṭhāsamādhiṃ uparūparisamādhibhāvūpanayanena abhinīharaṇe abhininnāmane chekabhāvo.
Skillfulness in guiding samādhi means cleverness in guiding or inclining the lower samādhi towards the state of a higher samādhi, in a unified manner.
Sự thiện xảo trong việc hướng đến của định là sự thiện xảo trong việc hướng đến, trong việc dẫn dắt định thấp hơn lên trạng thái của định cao hơn theo phương pháp nhất quán.
Upacārajjhānañhi vasippattaṃ paṭhamajjhānatthāya vipassanatthāya vā abhinīharati, evaṃ paṭhamajjhānādīni dutiyajjhānādiatthāya vipassanatthāya vā, catutthajjhānaṃ arūpasamāpattatthāya abhiññatthāya vipassanatthāya vā, ākāsānañcāyatanādayo viññāṇañcāyatanādiatthāya vipassanatthāya vā abhinīharatīti evaṃ samādhissa tattha tattha abhinīhārakusalatā.
For indeed, the access jhāna, having attained mastery, guides towards the first jhāna or towards insight. Similarly, the first jhāna and so on guide towards the second jhāna and so on, or towards insight. The fourth jhāna guides towards the immaterial attainments, towards supernormal powers, or towards insight. The sphere of infinite space and so on guide towards the sphere of infinite consciousness and so on, or towards insight. Thus, this is the skillfulness in guiding samādhi in various ways.
Thật vậy, cận hành thiền khi đã thuần thục sẽ được hướng đến sơ thiền hoặc đến vipassanā; tương tự, sơ thiền, v.v., được hướng đến nhị thiền, v.v., hoặc đến vipassanā; tứ thiền được hướng đến các tầng thiền vô sắc, đến các thắng trí hoặc đến vipassanā; Không Vô Biên Xứ, v.v., được hướng đến Thức Vô Biên Xứ, v.v., hoặc đến vipassanā. Như vậy, đó là sự thiện xảo trong việc hướng đến của định ở mỗi cấp độ.
Yasmā pana kusalatā nāma paññā, sā samādhi na hoti, tasmā samādhipariṇāyakapaññāvasena sattavidho samādhi vuttoti veditabbo.
However, since skillfulness (kusalatā) is wisdom (paññā), and that is not samādhi, it should be understood that the sevenfold samādhi is spoken of in terms of the wisdom that leads samādhi.
Tuy nhiên, vì sự thiện xảo (kusalatā) chính là trí tuệ, mà trí tuệ thì không phải là định, nên cần hiểu rằng bảy loại định này được nói đến dưới phương diện trí tuệ điều khiển định.
976
Keci pana ācariyā ‘‘samādhikusalatāti yena manasikārena cittaṃ na vikkhipati, tattha kusalatā.
Some teachers, however, explain the meaning of these terms as follows: "Skillfulness in samādhi means skillfulness in that attention (manasikāra) by which the mind does not become distracted.
Một số vị thầy lại giải thích rằng: “Sự thiện xảo về định là sự thiện xảo trong việc tác ý mà nhờ đó tâm không bị phân tán.
Samāpattikusalatāti yena manasikārena samāpajjantassa jhānaṅgāni pātubhavanti, tattha kusalatā.
Skillfulness in attainment means skillfulness in that attention by which the jhāna factors appear to one who is attaining jhāna.
Sự thiện xảo trong việc nhập định là sự thiện xảo trong việc tác ý mà nhờ đó các thiền chi hiện khởi cho người đang nhập định.
Ṭhitikusalatāti yena manasikārena appito samādhi na vikkhipati, tattha kusalatā.
Skillfulness in abiding means skillfulness in that attention by which the attained samādhi does not become distracted.
Sự thiện xảo trong việc duy trì định là sự thiện xảo trong việc tác ý mà nhờ đó định đã an chỉ không bị phân tán.
Vuṭṭhānakusalatāti nīvaraṇavuṭṭhānaṃ jānāti paṭhamajjhāne, aṅgavuṭṭhānaṃ jānāti tīsu jhānesu, ārammaṇavuṭṭhānaṃ jānāti arūpasamāpattīsu, vikkhepavuṭṭhānaṃ jānāti visayādhimattesu, sacchandavuṭṭhānaṃ jānāti pariyantakāle ca avasānakaraṇīyakāle ca.
Skillfulness in emerging means knowing the emergence from hindrances in the first jhāna, knowing the emergence from factors in the three jhānas, knowing the emergence from objects in the immaterial attainments, knowing the emergence from distraction in excessive objects, and knowing the emergence at will at the boundary time and at the time for completing the task.
Sự thiện xảo trong việc xuất định là biết cách xuất khỏi triền cái trong sơ thiền, biết cách xuất khỏi chi thiền trong ba tầng thiền (cao hơn), biết cách xuất khỏi đối tượng trong các tầng thiền vô sắc, biết cách xuất khỏi sự phân tán trong các đối tượng quá mức, và biết cách xuất định theo ý muốn vào thời điểm đã định trước và khi cần kết thúc.
Kallatākusalatāti cittaphāsutāya sarīraphāsutāya āhāraphāsutāya senāsanaphāsutāya puggalaphāsutāya ca samādhissa kallatā hotīti jānāti.
Skillfulness in suitability means knowing that samādhi becomes suitable due to the suitability of mind, suitability of body, suitability of food, suitability of dwelling, and suitability of persons.
Sự thiện xảo về sự lành mạnh của định là biết rằng sự lành mạnh của định có được là nhờ sự an lạc của tâm, sự an lạc của thân, sự an lạc của thực phẩm, sự an lạc của trú xứ, và sự an lạc của cá nhân.
Gocarakusalatāti ārammaṇassa paricchedaṃ kātuṃ jānāti, disāpharaṇaṃ kātuṃ jānāti, vaḍḍhetuṃ jānāti.
Skillfulness in the range means knowing how to define the object, knowing how to pervade the directions, knowing how to expand it.
Sự thiện xảo về hành xứ của định là biết cách phân định đối tượng, biết cách biến mãn khắp các phương hướng, biết cách mở rộng (đối tượng).
Abhinīhārakusalatāti tattha tattha sammā manasikārena cittaṃ abhinīharati abhininnāmeti, upacāre vasippatte paṭhamajjhāne abhinīharati, evaṃ uparūparijhānesu abhiññāsu arūpasamāpattīsu vipassanāsu ca abhinīharati.
Skillfulness in guiding means guiding and inclining the mind correctly in each instance of attention; when access jhāna has attained mastery, one guides it to the first jhāna; similarly, one guides the mind to higher jhānas, supernormal powers, immaterial attainments, and insights.
Về Abhinīhārakusalatā (sự khéo léo trong việc hướng tâm), ở nơi này nơi kia, vị ấy hướng tâm, hướng xuôi tâm bằng sự tác ý chân chánh; khi đã đạt được sự thuần thục trong cận định, vị ấy hướng tâm vào sơ thiền; tương tự như vậy, vị ấy hướng tâm vào các tầng thiền cao hơn, các thắng trí, các thiền vô sắc và các pháp quán.
Evaṃ tattha tattha abhinīhārakusalatā’’ti evametesaṃ padānaṃ atthaṃ vaṇṇayanti.
In this way, they explain the meaning of these terms as "skill in applying the mind in various ways."
Như vậy, sự khéo léo trong việc hướng tâm ở nơi này nơi kia là như thế — các vị ấy giải thích ý nghĩa của những thuật ngữ này như vậy.
977
Aṭṭhakaṃ vuttatthameva.
The section on the eight is as already stated.
Phần tám pháp có ý nghĩa như đã trình bày.
Navake rūpāvacaroti ‘‘katame dhammā rūpāvacarā?
In the section on the nine, rūpāvacara means "What are the rūpāvacara phenomena?
Trong phần chín pháp, rūpāvacaro (thuộc sắc giới) có nghĩa là: “Những pháp nào là pháp thuộc sắc giới?
Heṭṭhato brahmapārisajjaṃ pariyantaṃ karitvā uparito akaniṭṭhe deve antokaritvā’’tiādinā (dha. sa. 1289) nayena vuttesu rūpāvacaradhammesu pariyāpanno.
Those included among the rūpāvacara phenomena, which are described as 'starting from the Brahmapārisajja assembly below and encompassing the Akanittha devas above'."
Lấy cõi Phạm Chúng Thiên làm giới hạn dưới, và bao gồm các vị trời ở cõi Sắc Cứu Cánh làm giới hạn trên” — pháp nào thuộc vào các pháp sắc giới đã được trình bày theo phương pháp này.
Tatrāyaṃ vacanattho – rūpakkhandhasaṅkhātaṃ rūpaṃ ettha avacarati, na kāmoti rūpāvacaro.
Here is the literal meaning of the term: rūpa, which is the rūpakkhandha, moves about here, not kāma; hence, it is rūpāvacara.
Ở đây, ý nghĩa của từ này là: sắc, tức sắc uẩn, hành hoạt ở đây, chứ không phải dục, nên gọi là rūpāvacaro (hành hoạt trong cõi sắc).
Rūpakkhandhopi hi rūpanti vuccati ‘‘rūpakkhandho rūpa’’ntiādīsu (yama. 1.khandhayamaka.2) viya.
Indeed, the rūpakkhandha is also called rūpa, as in phrases like "the rūpakkhandha is rūpa."
Bởi vì sắc uẩn cũng được gọi là “sắc”, như trong các câu “sắc uẩn là sắc” v.v...
So pana brahmapārisajjabrahmapurohitamahābrahmānaṃ parittābhaappamāṇābhaābhassarānaṃ parittasubhaappamāṇasubhasubhakiṇhānaṃ asaññasattavehapphalānaṃ avihātappasudassasudassīakaniṭṭhānañca vasena soḷasavidho padeso.
This realm is sixteenfold, comprising the Brahmapārisajja, Brahmapurohita, Mahābrahmā, Parittābha, Appamāṇābha, Ābhassara, Parittasubha, Appamāṇasubha, Subhakiṇha, Asaññasatta, Vehapphala, Aviha, Atappa, Sudassa, Sudassī, and Akanittha devas.
Và cảnh giới đó có mười sáu loại, tùy theo các cõi Phạm Chúng Thiên, Phạm Phụ Thiên, Đại Phạm Thiên; Thiểu Quang Thiên, Vô Lượng Quang Thiên, Quang Âm Thiên; Thiểu Tịnh Thiên, Vô Lượng Tịnh Thiên, Biến Tịnh Thiên; Vô Tưởng Thiên, Quảng Quả Thiên; và Vô Phiền Thiên, Vô Nhiệt Thiên, Thiện Kiến Thiên, Thiện Hiện Thiên, Sắc Cứu Cánh Thiên.
So rūpāvacarasaṅkhāto padeso uttarapadalopaṃ katvā ‘‘rūpa’’nti vuccati, tasmiṃ rūpe avacaratīti rūpāvacaro.
This realm, called rūpāvacara, is referred to as "rūpa" by omitting the latter part of the compound, and because it moves about in that rūpa, it is rūpāvacara.
Cảnh giới được gọi là rūpāvacara (sắc giới) đó, sau khi lược bỏ hậu tố, được gọi là “rūpa” (sắc); vì hành hoạt trong cảnh giới sắc đó, nên gọi là rūpāvacaro.
Rūpabhavo vā rūpaṃ, tasmiṃ avacaratīti rūpāvacaraṃ.
Or, rūpabhava is rūpa, and because it moves about in that, it is rūpāvacara.
Hoặc, sắc hữu là sắc, vì hành hoạt trong đó, nên gọi là rūpāvacaraṃ.
Kiñcāpi hi eso samādhi kāmabhavepi avacarati, yathā pana saṅgāme avacaraṇato saṅgāmāvacaroti laddhanāmo nāgo nagare carantopi saṅgāmāvacaroti vuccati, thalacarā jalacarā ca pāṇino athale ajale ca ṭhitāpi thalacarā jalacarāti vuccanti, evamayaṃ aññattha avacarantopi rūpāvacaroti vutto.
Although this samādhi also moves about in the kāma-bhava, just as an elephant, known as "saṅgāmāvacara" because it moves about in battle, is still called "saṅgāmāvacara" even when moving in a city, and land-dwelling and water-dwelling creatures are called such even when standing on dry land or out of water, so too is this samādhi called rūpāvacara even when it moves about elsewhere.
Mặc dù định này cũng hành hoạt trong cõi dục, nhưng cũng giống như con voi được gọi là saṅgāmāvacaro (hành hoạt trong chiến trận) vì nó hành hoạt trong chiến trận, dù đang đi trong thành phố vẫn được gọi là saṅgāmāvacaro; và các loài vật sống trên cạn và sống dưới nước, dù đang ở nơi không phải cạn hay không phải nước, vẫn được gọi là loài sống trên cạn và loài sống dưới nước; tương tự như vậy, pháp này dù hành hoạt ở nơi khác vẫn được gọi là rūpāvacaro.
Apica rūpabhavasaṅkhāte rūpe paṭisandhiṃ avacāretītipi rūpāvacaro.
Moreover, it is rūpāvacara because it causes rebirth (paṭisandhi) to take place in the rūpa, which is the rūpabhava.
Hơn nữa, pháp này cũng được gọi là rūpāvacaro vì nó dẫn dắt sự tái sanh vào cõi sắc, tức sắc hữu.
Hīnoti lāmako.
Hīna means inferior.
Hīno có nghĩa là thấp kém.
Hīnuttamānaṃ majjhe bhavo majjho.
That which is between the inferior and the excellent is majjha (middle).
Pháp nào ở giữa pháp thấp và pháp cao thì là majjho (trung bình).
Majjhimotipi pāṭho, soyevattho.
There is also the reading majjhima, which has the same meaning.
Cũng có bản đọc là majjhimo, ý nghĩa vẫn như vậy.
Padhānabhāvaṃ nīto paṇīto, uttamoti attho.
That which has been brought to a state of excellence is paṇīta, meaning supreme.
Pháp được đưa đến trạng thái ưu thắng là paṇīto, có nghĩa là cao thượng.
Ete pana āyūhanavasena veditabbā.
These, however, should be understood in terms of their cultivation.
Những pháp này nên được hiểu theo phương diện nỗ lực tạo tác.
Yassa hi āyūhanakkhaṇe chando vā hīno hoti vīriyaṃ vā cittaṃ vā vīmaṃsā vā, so hīno nāma.
For if, at the moment of cultivation, one's desire (chanda), or energy (vīriya), or mind (citta), or investigation (vīmaṃsā) is inferior, then it is called inferior.
Bởi vì, vào lúc nỗ lực tạo tác, nếu dục, hoặc tinh tấn, hoặc tâm, hoặc thẩm sát của người nào thấp kém, thì pháp đó được gọi là thấp kém.
Yassa te dhammā majjhimā, so majjhimo.
If these qualities are middling, it is middling.
Nếu những pháp đó của người nào ở mức trung bình, thì pháp đó là trung bình.
Yassa paṇītā, so paṇīto.
If they are excellent, it is excellent.
Nếu những pháp đó của người nào cao thượng, thì pháp đó là cao thượng.
Uppāditamatto vā hīno, nātisubhāvito majjhimo, atisubhāvito vasippatto paṇīto.
Alternatively, merely arisen is inferior; not fully developed is middling; fully developed and having attained mastery is excellent.
Hoặc, pháp vừa mới được tạo ra là thấp kém; pháp chưa được tu tập kỹ lưỡng là trung bình; pháp đã được tu tập kỹ lưỡng, đã đạt đến sự thuần thục là cao thượng.
Arūpāvacaro rūpāvacare vuttanayānusārena veditabbo.
Arūpāvacara should be understood according to the method stated for rūpāvacara.
Arūpāvacaro (thuộc vô sắc giới) nên được hiểu theo phương pháp đã trình bày trong phần rūpāvacaro.
978
Suññato samādhītiādīsu ‘‘sabbe saṅkhārā aniccā dukkhā anattā’’ti vipassanāpaṭipāṭiyā vipassantassa anattānupassanāya maggavuṭṭhāne jāte yasmā sā vipassanā attavirahitesu saṅkhāresu suññato pavattā, tasmā suññatā nāma hoti.
In suññato samādhi and so on: When the arising of the path occurs for one who contemplates with insight, in the sequence of insight, that "all formations are impermanent, suffering, and non-self," because that insight (vipassanā) proceeds as emptiness (suññata) with respect to formations devoid of self, it is called suññatā.
Trong các câu như suññato samādhi (không định), đối với người đang tu tập quán theo trình tự của pháp quán rằng “tất cả các pháp hữu vi là vô thường, khổ, vô ngã”, khi sự xuất khởi khỏi đạo lộ xảy ra nhờ vào vô ngã tùy quán, vì pháp quán đó diễn tiến trong các pháp hữu vi không có tự ngã theo phương diện “không”, nên nó được gọi là suññatā (không).
Tāya siddho ariyamaggasamādhi suññato samādhi nāma hoti, suññatavasena pavattasamādhīti attho.
The noble path concentration (ariyamaggasamādhi) accomplished by that is called suññato samādhi, meaning concentration that proceeds by way of emptiness.
Thánh đạo định được thành tựu nhờ pháp quán đó được gọi là suññato samādhi (không định); ý nghĩa là định diễn tiến theo phương diện không.
Vipassanāya pavattākārena hi so pavattati.
Indeed, it proceeds in the manner of insight.
Bởi vì nó diễn tiến theo cách thức diễn tiến của pháp quán.
Aniccānupassanāya maggavuṭṭhāne jāte yasmā sā vipassanā niccanimittapaṭipakkhavasena pavattā, tasmā animittā nāma hoti.
When the arising of the path occurs through the contemplation of impermanence (aniccanupassanā), because that insight proceeds in opposition to the sign of permanence, it is called animittā.
Khi sự xuất khởi khỏi đạo lộ xảy ra nhờ vào vô thường tùy quán, vì pháp quán đó diễn tiến theo phương diện đối nghịch với tướng thường, nên nó được gọi là animittā (vô tướng).
Tāya siddho ariyamaggasamādhi animitto samādhi nāma hoti, niccanimittavirahito samādhīti attho.
The noble path concentration accomplished by that is called animitto samādhi, meaning concentration devoid of the sign of permanence.
Thánh đạo định được thành tựu nhờ pháp quán đó được gọi là animitto samādhi (vô tướng định); ý nghĩa là định không có tướng thường.
Vipassanāya pavattākārena hi so pavattati.
Indeed, it proceeds in the manner of insight.
Bởi vì nó diễn tiến theo cách thức diễn tiến của pháp quán.
Dukkhānupassanāya maggavuṭṭhāne jāte yasmā sā vipassanā paṇidhipaṭipakkhavasena pavattā, tasmā appaṇihitā nāma hoti.
When the arising of the path occurs through the contemplation of suffering (dukkhānupassanā), because that insight proceeds in opposition to aspiration (paṇidhi), it is called appaṇihitā.
Khi sự xuất khởi khỏi đạo lộ xảy ra nhờ vào khổ tùy quán, vì pháp quán đó diễn tiến theo phương diện đối nghịch với sự ước nguyện, nên nó được gọi là appaṇihitā (vô nguyện).
Tāya siddho ariyamaggasamādhi appaṇihito samādhi nāma hoti, paṇidhivirahito samādhīti attho.
The noble path concentration accomplished by that is called appaṇihito samādhi, meaning concentration devoid of aspiration.
Thánh đạo định được thành tựu nhờ pháp quán đó được gọi là appaṇihito samādhi (vô nguyện định); ý nghĩa là định không có sự ước nguyện.
Vipassanāya pavattākārena hi so pavattati.
Indeed, it proceeds in the manner of insight.
Bởi vì nó diễn tiến theo cách thức diễn tiến của pháp quán.
Tādisā eva tayo phalasamādhayopi etehiyeva tīhi samādhīhi gahitā hontīti veditabbā.
It should be understood that the three fruit concentrations (phalasamādhi) are also included by these same three concentrations.
Nên hiểu rằng ba loại quả định tương tự cũng được bao gồm bởi ba loại định này.
Lokuttarasamādhīnaṃ pana paṇītattā hīnādibhedo na uddhaṭo.
However, the distinction of inferior and so on is not mentioned for the supramundane concentrations (lokuttarasamādhi) because of their excellence.
Tuy nhiên, vì các định siêu thế là cao thượng, nên sự phân biệt thấp kém v.v... không được nêu ra.
979
Dasake uddhumātakasaññāvasenātiādīsu bhastā viya vāyunā uddhaṃ jīvitapariyādānā yathānukkamaṃ samuggatena sūnabhāvena uddhumātattā uddhumātaṃ, uddhumātameva uddhumātakaṃ, paṭikūlattā vā kucchitaṃ uddhumātanti uddhumātakaṃ.
In the section on the ten, uddhumātakasaññāvasena and so on: "Uddhumāta" means swollen, being inflated upwards by wind like a bellows, or due to the gradual swelling that arises after the cessation of life. "Uddhumātaka" is just uddhumāta, or it is uddhumāta that is repulsive due to its loathsomeness.
Trong phần mười pháp, đối với các câu như uddhumātakasaññāvasena (theo phương diện tưởng về tử thi sình trương), một tử thi được gọi là uddhumātaṃ (sình trương) vì nó sình lên do trạng thái trương phồng, lần lượt dâng lên sau khi mạng sống chấm dứt, giống như một cái ống bễ được thổi phồng bằng gió; uddhumātaṃ chính là uddhumātakaṃ; hoặc, vì tính chất ghê tởm, tử thi sình trương đáng chê bai nên gọi là uddhumātakaṃ.
Tathārūpassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for such a corpse.
Đây là tên gọi của một tử thi có trạng thái như vậy.
Vinīlaṃ vuccati viparibhinnavaṇṇaṃ, vinīlameva vinīlakaṃ, paṭikūlattā vā kucchitaṃ vinīlanti vinīlakaṃ.
“Vinīla” means a corpse with its color deteriorated in various ways. Vinīlaka is simply vinīla, or it is called vinīlaka because it is a disgusting vinīla due to its repulsiveness.
Vinīlaṃ (xanh bầm) được gọi là tử thi có màu sắc biến đổi; vinīlaṃ chính là vinīlakaṃ; hoặc, vì tính chất ghê tởm, tử thi xanh bầm đáng chê bai nên gọi là vinīlakaṃ.
Maṃsussadaṭṭhānesu rattavaṇṇassa, pubbasannicayaṭṭhānesu setavaṇṇassa, yebhuyyena ca nīlavaṇṇassa nīlaṭṭhāne nīlasāṭakapārutasseva chavasarīrassetaṃ adhivacanaṃ.
This is a designation for a corpse that is red in places with much flesh, white in places where pus has accumulated, and mostly dark-colored in dark areas, like a body wrapped in a dark blue cloth.
Đây là tên gọi của một tử thi có màu đỏ ở những chỗ nhiều thịt, màu trắng ở những chỗ tụ mủ, và phần lớn có màu xanh, giống như một người được quấn trong tấm vải xanh ở những chỗ có màu xanh.
Paribhinnaṭṭhānesu vissandamānapubbaṃ vipubbaṃ, vipubbameva vipubbakaṃ, paṭikūlattā vā kucchitaṃ vipubbanti vipubbakaṃ.
“Vipubba” means a corpse with pus oozing from its cracked parts. Vipubbaka is simply vipubba, or it is called vipubbaka because it is a disgusting vipubba due to its repulsiveness.
Vipubbaṃ (chảy mủ) là tử thi có mủ chảy ra ở những chỗ nứt vỡ; vipubbaṃ chính là vipubbakaṃ; hoặc, vì tính chất ghê tởm, tử thi chảy mủ đáng chê bai nên gọi là vipubbakaṃ.
Tathārūpassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for such a corpse with oozing pus.
Đây là tên gọi của một tử thi có trạng thái như vậy.
Vicchiddaṃ vuccati dvidhā chindanena apadhāritaṃ, vicchiddameva vicchiddakaṃ, paṭikūlattā vā kucchitaṃ vicchiddanti vicchiddakaṃ.
“Vicchidda” means a corpse that has been separated by being cut in two. Vicchiddaka is simply vicchidda, or it is called vicchiddaka because it is a disgusting vicchidda due to its repulsiveness.
Vicchiddaṃ (đứt đoạn) được gọi là tử thi bị chia cắt làm hai phần; vicchiddaṃ chính là vicchiddakaṃ; hoặc, vì tính chất ghê tởm, tử thi bị đứt đoạn đáng chê bai nên gọi là vicchiddakaṃ.
Vemajjhe chinnassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for a corpse cut in the middle.
Đây là tên gọi của một tử thi bị cắt ngang ở giữa.
Ito ca etto ca vividhākārena soṇasiṅgālādīhi khāyitanti vikkhāyitaṃ, vikhāyitanti vattabbe vikkhāyitanti vuttaṃ.
“Vikkhāyita” means a corpse eaten in various ways by dogs, jackals, and so on, from this side and that; vikkhāyita is said instead of vikhāyita.
Vikkhāyitaṃ (bị ăn dở) là tử thi bị chó, chó rừng v.v... ăn theo nhiều cách khác nhau từ bên này và bên kia; đáng lẽ phải nói là vikhāyitaṃ, nhưng lại được nói là vikkhāyitaṃ.
Vikkhāyitameva vikkhāyitakaṃ, paṭikūlattā vā kucchitaṃ vikkhāyitanti vikkhāyitakaṃ.
Vikkhāyitaka is simply vikkhāyita, or it is called vikkhāyitaka because it is a disgusting vikkhāyita due to its repulsiveness.
Vikkhāyitaṃ chính là vikkhāyitakaṃ; hoặc, vì tính chất ghê tởm, tử thi bị ăn dở đáng chê bai nên gọi là vikkhāyitakaṃ.
Tathārūpassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for such a corpse that has been eaten.
Đây là tên gọi của một tử thi có trạng thái như vậy.
Vividhaṃ khittaṃ vikkhittaṃ, vikkhittameva vikkhittakaṃ, paṭikūlattā vā kucchitaṃ vikkhittanti vikkhittakaṃ.
“Vikkhitta” means scattered in various ways. Vikkhittaka is simply vikkhitta, or it is called vikkhittaka because it is a disgusting vikkhitta due to its repulsiveness.
Vikkhittaṃ (vương vãi) là tử thi bị vứt vương vãi theo nhiều cách; vikkhittaṃ chính là vikkhittakaṃ; hoặc, vì tính chất ghê tởm, tử thi bị vứt vương vãi đáng chê bai nên gọi là vikkhittakaṃ.
Aññena hatthaṃ aññena pādaṃ aññena sīsanti evaṃ tato tato khittassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for a corpse whose hand is in one place, its foot in another, and its head in another, thus scattered here and there.
Đây là tên gọi của một tử thi có tay một nơi, chân một nẻo, đầu một ngả, bị vứt vương vãi khắp nơi như vậy.
Hatañca taṃ purimanayeneva vikkhittakañcāti hatavikkhittakaṃ.
“Hatavikkhittaka” means both struck and scattered in the aforementioned manner.
Hatavikkhittakaṃ (bị chặt và vứt vương vãi) là tử thi vừa bị chặt, vừa bị vứt vương vãi theo cách đã nói ở trên.
Kākapadākārena aṅgapaccaṅgesu satthena hanitvā vuttanayena vikkhittassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for a corpse that has been struck with a knife in its limbs and minor parts, forming a crow's footprint pattern, and then scattered as described.
Đây là tên gọi của một tử thi bị chặt bằng vũ khí vào các chi phần theo hình dấu chân quạ và bị vứt vương vãi theo cách đã nói.
Lohitaṃ kirati vikkhipati ito cito ca paggharatīti lohitakaṃ.
“Lohitaka” means blood flows, scattering here and there, oozing from this side and that.
Lohitakaṃ (đẫm máu) là tử thi có máu vương vãi, tung tóe, chảy ra từ nơi này nơi kia.
Paggharitalohitamakkhitassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for a corpse smeared with oozing blood.
Đây là tên gọi của một tử thi bị vấy bẩn bởi máu chảy ra.
Puḷavā vuccanti kimayo, puḷave kiratīti puḷavakaṃ.
“Puḷavā” are called worms. “Puḷavaka” means teeming with worms.
Puḷavā được gọi là giòi; puḷavakaṃ là tử thi có giòi bọ vương vãi.
Kimiparipuṇṇassa chavasarīrassetaṃ adhivacanaṃ.
This is a designation for a corpse full of worms.
Đây là tên gọi của một tử thi đầy giòi bọ.
Aṭṭhiyeva aṭṭhikaṃ, paṭikūlattā vā kucchitaṃ aṭṭhīti aṭṭhikaṃ.
Aṭṭhika is simply a bone (aṭṭhi), or it is called aṭṭhika because it is a disgusting bone due to its repulsiveness.
Aṭṭhi (xương) chính là aṭṭhikaṃ; hoặc, vì tính chất ghê tởm, xương đáng chê bai nên gọi là aṭṭhikaṃ.
Aṭṭhisaṅkhalikāyapi ekaṭṭhikassapi etaṃ adhivacanaṃ.
This is a designation for a skeleton or even a single bone.
Đây cũng là tên gọi của một bộ xương hoặc một khúc xương.
Imāni ca pana uddhumātakādīni nissāya uppannanimittānampi nimittesu paṭiladdhajjhānānampi etāneva nāmāni.
Moreover, the names uddhumaṭaka, etc., are also given to the nimittas (meditation signs) that arise based on these stages, and to the jhānas attained through these nimittas.
Và những tên gọi này cũng là tên của các tướng phát sinh nhờ vào các tử thi sình trương v.v..., và cũng là tên của các tầng thiền đã đắc được trong các tướng đó.
Idha pana uddhumātakanimitte paṭikūlākāragāhikā appanāvasena uppannā saññā uddhumātakasaññā, tassā uddhumātakasaññāya vasena uddhumātakasaññāvasena.
Here, uddhumaṭakasaññā is the perception that arises in the uddhumaṭaka-nimitta, grasping the aspect of repulsiveness through the mode of appanā (absorption). “Uddhumaṭakasaññāvasena” means by way of this uddhumaṭakasaññā.
Ở đây, trong tướng thây sình, tưởng phát sinh do sự an chỉ (appanā) nắm giữ tướng ghê tởm được gọi là uddhumātaka-saññā (tưởng về thây sình). Do uddhumātaka-saññā đó mà có uddhumātakasaññāvasena (theo cách của tưởng thây sình).
Sesesupi eseva nayo.
The same method applies to the remaining terms.
Trong các trường hợp còn lại cũng theo cách này.
Pañcapaññāsa samādhīti ekakādivasena vuttā.
“Fifty-five kinds of concentration” are stated according to the one-by-one method.
Năm mươi lăm loại định được nói theo cách bắt đầu từ một.
980
44. Evaṃ ekakādivasena samādhippabhedaṃ dassetvā idāni aññenapi pariyāyena samādhiṃ dassetukāmo apicāti aññaṃ pariyāyārambhaṃ dassetvā pañcavīsatītiādimāha.
44. Having thus shown the divisions of concentration according to the one-by-one method, now, desiring to show concentration by another method, he states “apicā” to indicate the beginning of another method, and then says “pañcavīsati” and so on.
44. Sau khi trình bày các loại định theo cách bắt đầu từ một như vậy, bây giờ, Đức Phật muốn trình bày định theo một cách khác, nên đã nói apicā (hơn nữa) để chỉ sự bắt đầu của một phương pháp khác, và nói pañcavīsatī (hai mươi lăm) v.v.
Tattha samādhissa samādhiṭṭhāti samādhissa samādhibhāve sabhāvā, yehi sabhāvehi so samādhi hoti, te tasmiṃ atthā nāma.
Therein, “samādhissa samādhiṭṭhā” means the inherent natures of concentration in its state of concentration, the natures by which it becomes concentration; these are called the atthā (meanings/aspects) in it.
Trong đó, samādhissa samādhiṭṭhā (các khía cạnh của định) là những bản chất mà nhờ đó định trở thành định; những bản chất đó được gọi là các khía cạnh của định.
Pariggahaṭṭhena samādhīti saddhādīhi indriyehi pariggahitattā tasmā pariggahitasabhāvena samādhi.
“Concentration by way of grasping” means concentration due to being grasped by faculties such as faith (saddhā), hence by the nature of being grasped.
Định theo nghĩa được nắm giữ là định vì được các căn như tín (saddhā) v.v. nắm giữ, do đó là định theo bản chất được nắm giữ.
Tāneva ca indriyāni aññamaññaparivārāni honti, bhāvanāpāripūriyā paripuṇṇāni ca honti.
And these very faculties are mutually supportive and become perfected through the full development of meditation.
Những căn đó là những thứ hỗ trợ lẫn nhau và trở nên viên mãn nhờ sự hoàn thiện của sự tu tập.
Tasmā parivāraṭṭhena paripūraṭṭhena samādhi.
Therefore, “concentration by way of retinue and by way of perfection.”
Do đó, định theo nghĩa hỗ trợ và theo nghĩa viên mãn.
Tesaṃyeva samādhivasena ekārammaṇamapekkhitvā ekaggaṭṭhena, nānārammaṇavikkhepābhāvamapekkhitvā avikkhepaṭṭhena, lokuttarasseva mahatā vīriyabalapaggahena pattabbattā lokuttaramaggasseva ca parihānivasena visārābhāvato heṭṭhā gahitapaggahaṭṭhaavisāraṭṭhā idha na gahitāti veditabbā.
Considering their concentration as having a single object, it is “by way of one-pointedness.” Considering the absence of distraction by various objects, it is “by way of non-distraction.” It should be understood that the aspects of support (paggaṭṭha) and non-wavering (avisāraṭṭha) mentioned earlier are not included here, as supramundane concentration is to be attained by a great force of energy, and the supramundane path is not subject to decline, hence it is not repulsive.
Chỉ xét đến một đối tượng duy nhất theo nghĩa định của chúng, nên là theo nghĩa nhất tâm; xét đến sự không phân tán đối với nhiều đối tượng, nên là theo nghĩa không phân tán; cần phải hiểu rằng các khía cạnh đã được đề cập trước đó như "theo nghĩa được nâng đỡ" và "theo nghĩa không dao động" không được đề cập ở đây, vì định siêu thế chỉ có thể đạt được nhờ sức mạnh tinh tấn vĩ đại, và vì đạo siêu thế không có sự suy yếu.
Kilesakālussiyassābhāvena anāvilaṭṭhena samādhi.
“Concentration by way of untroubledness” due to the absence of defilement's turbidity.
Vì không có sự xáo trộn của các phiền não, nên là định theo nghĩa không vẩn đục.
Avikampattā aniñjanaṭṭhena samādhi.
“Concentration by way of immobility” due to being unshaken.
Vì không dao động, nên là định theo nghĩa bất động.
Vikkhambhanavasena samucchedavasena vā kilesehi vimuttattā ārammaṇe ca adhimuttattā vimuttaṭṭhena samādhi.
“Concentration by way of liberation” due to being freed from defilements by way of suppression or by way of eradication, and due to being devoted to the object.
Vì được giải thoát khỏi các phiền não bằng cách trấn áp hoặc đoạn trừ, và vì được giải thoát đối với đối tượng, nên là định theo nghĩa giải thoát.
981
Ekattupaṭṭhānavasena cittassa ṭhitattāti samādhiyogeneva ekārammaṇe bhusaṃ patiṭṭhānavasena cittassa ārammaṇe niccalabhāvena patiṭṭhitattā.
Because the mind is established in a state of unification, that is, because the mind is firmly established in a single object through the mode of being intensely established in that single object, by means of its unwavering state, only when conjoined with samādhi.
Do tâm an trú theo nghĩa hiện hữu nhất thể có nghĩa là do tâm an trú vững chắc trên đối tượng duy nhất, nhờ sự an trú mạnh mẽ trên một đối tượng duy nhất trong trạng thái định, và do tâm kiên cố trên đối tượng.
Aṭṭhasu yugalesu esati nesati, ādiyati nādiyati, paṭipajjati na paṭipajjatīti imāni tīṇi yugalāni appanāvīthito pubbabhāge upacārassa mudumajjhādhimattatāvasena vuttānīti veditabbāni, jhāyati jhāpetīti idaṃ appanāvīthiyaṃ upacāravasena veditabbaṃ.
Among the eight pairs, the three pairs, "seeks, does not seek; takes, does not take; engages, does not engage," should be understood as stated in the preliminary stage of appanā-vīthi (absorption path), according to the gentle, medium, and intense degrees of access concentration. The pair "burns, causes to burn" should be understood as pertaining to the absorption path by way of access concentration.
Cần phải hiểu rằng ba cặp từ này—esati nesati (tìm kiếm và không tìm kiếm), ādiyati nādiyati (nắm giữ và không nắm giữ), paṭipajjati nappaṭipajjati (thực hành và không thực hành)—được nói trong giai đoạn trước appanā-vīthi (lộ trình an chỉ), theo các mức độ mềm, trung bình và mạnh của cận định; còn cặp từ jhāyati jhāpetī (thiền định và làm cho thiền định) cần được hiểu theo nghĩa cận định trong appanā-vīthi.
Esitattā nesitattā, ādinnattā anādinnattā, paṭipannattā nappaṭipannattā, jhātattā na jhāpitattāti imāni cattāri yugalāni appanāvasena vuttānīti veditabbāni.
The four pairs, "because it is sought, because it is not sought; because it is taken, because it is not taken; because it is engaged, because it is not engaged; because it is burned, because it is not caused to burn," should be understood as stated by way of absorption.
Cần phải hiểu rằng bốn cặp từ này—esitattā nesitattā (do đã tìm kiếm và do đã không tìm kiếm), ādinnattā anādinnattā (do đã nắm giữ và do đã không nắm giữ), paṭipannattā nappaṭipannattā (do đã thực hành và do đã không thực hành), jhātattā na jhāpitattā (do đã thiền định và do đã không làm cho thiền định)—được nói theo nghĩa an chỉ (appanā).
982
Tattha samaṃ esatīti samādhītiādīsu samanti appanaṃ.
Among these, in phrases like " samaṃ esatīti samādhīti" (it seeks equanimity, therefore it is samādhi), "samaṃ" refers to appanā.
Trong các câu như samaṃ esatīti samādhī (tìm kiếm sự bình đẳng nên gọi là định) v.v., samaṃ có nghĩa là an chỉ (appanā).
Sā hi paccanīkadhamme sameti nāsetīti samā, paccanīkavisamābhāvato vā samabhūtāti samā.
For it (appanā) equalizes and destroys opposing phenomena, hence it is called samā (equal); or it is samā (equal) because it is free from the unevenness of opposing phenomena.
Vì nó làm cho các pháp đối nghịch trở nên bình đẳng (sameti), tức là tiêu diệt chúng, nên nó là samā (bình đẳng); hoặc vì nó trở thành bình đẳng do không có sự bất bình đẳng của các pháp đối nghịch, nên nó là samā.
Taṃ samaṃ esati ajjhāsayavasena gavesati.
It seeks that samā by way of inclination.
Nó tìm kiếm sự bình đẳng đó theo ý định.
Itisaddo kāraṇattho, yasmā samaṃ esati, tasmā samādhīti attho.
The word " iti" signifies cause; the meaning is: because it seeks samā, therefore it is samādhi.
Từ iti có nghĩa là nguyên nhân; có nghĩa là vì nó tìm kiếm sự bình đẳng, nên nó là định.
Visamaṃ nesatīti taṃ taṃ jhānapaccanīkasaṅkhātaṃ visamaṃ na esati.
" Visamaṃ nesatīti" means it does not seek that which is uneven, which refers to the opposing phenomena of jhāna.
Visamaṃ nesatī (không tìm kiếm sự bất bình đẳng) nghĩa là nó không tìm kiếm sự bất bình đẳng, tức là các pháp đối nghịch với thiền.
Mudubhūto hi pubbabhāgasamādhi ādibhūtattā samaṃ esati, visamaṃ nesati nāma.
The soft preliminary samādhi, being the initial stage, is called " samaṃ esati, visamaṃ nesati" (it seeks equanimity, it does not seek unevenness).
Định sơ khởi (pubbabhāga-samādhi) ở cấp độ mềm, vì là khởi đầu, nên được gọi là samaṃ esati, visamaṃ nesati (tìm kiếm sự bình đẳng, không tìm kiếm sự bất bình đẳng).
Majjhimabhūto thirabhūtattā samaṃ ādiyati, visamaṃ nādiyati nāma.
The medium stage, being firm, is called " samaṃ ādiyati, visamaṃ nādiyati" (it takes equanimity, it does not take unevenness).
Định ở cấp độ trung bình, vì đã trở nên kiên cố, nên được gọi là samaṃ ādiyati, visamaṃ nādiyati (nắm giữ sự bình đẳng, không nắm giữ sự bất bình đẳng).
Adhimattabhūto appanāvīthiyā āsannabhūtattā samaṃ paṭipajjati, visamaṃ nappaṭipajjati nāma.
The intense stage, being close to the appanā-vīthi, is called " samaṃ paṭipajjati, visamaṃ nappaṭipajjati" (it engages in equanimity, it does not engage in unevenness).
Định ở cấp độ tối thượng, vì gần với lộ trình an chỉ (appanā-vīthi), nên được gọi là samaṃ paṭipajjati, visamaṃ nappaṭipajjati (thực hành sự bình đẳng, không thực hành sự bất bình đẳng).
Samaṃ jhāyatīti bhāvanapuṃsakavacanaṃ, samaṃ hutvā jhāyati, samena vā ākārena jhāyatīti attho.
" Samaṃ jhāyatīti" is a neuter verbal noun of bhāvanā; the meaning is: it burns being equal, or it burns in an equal manner.
Samaṃ jhāyatī (thiền định một cách bình đẳng) là một danh từ trung tính chỉ sự tu tập; có nghĩa là thiền định trong trạng thái bình đẳng, hoặc thiền định theo một cách bình đẳng.
Appanāvīthiyañhi samādhi paccanīkadhammavigamena santattā, santāya appanāya anukūlabhāvena ca ṭhitattā samenākārena pavattati.
For samādhi in the appanā-vīthi, being tranquil due to the absence of opposing phenomena and being established in a state conducive to tranquil absorption, proceeds in an equal manner.
Trong lộ trình an chỉ (appanā-vīthi), định vận hành theo một cách bình đẳng, vì nó đã trở nên thanh tịnh do sự biến mất của các pháp đối nghịch, và vì nó an trú trong trạng thái thuận lợi cho sự an chỉ thanh tịnh.
Jhāyatīti ca pajjalatīti attho ‘‘ete maṇḍalamāḷe dīpā jhāyanti (dī. ni. 1.159) sabbarattiṃ, sabbarattiyo ca telappadīpo jhāyati, telappadīpo cettha jhāyeyyā’’tiādīsu (saṃ. ni. 4.255-256) viya.
" Jhāyatīti" also means it blazes, as in "these lamps blaze in the circular hall all night long," and "the oil lamp blazes all night long, and the oil lamp should blaze here."
jhāyatī có nghĩa là chiếu sáng, như trong các câu ‘‘những ngọn đèn này chiếu sáng suốt đêm trong các đại sảnh đường tròn (Dī. Ni. 1.159), và đèn dầu chiếu sáng suốt đêm, và đèn dầu này sẽ chiếu sáng ở đây’’ v.v. (Saṃ. Ni. 4.255-256).
Samaṃ jāyatītipi pāṭho, samenākārena uppajjatīti attho.
"Samaṃ jāyatīti" is also a reading, meaning it arises in an equal manner.
Cũng có bản đọc là samaṃ jāyatī (phát sinh một cách bình đẳng), có nghĩa là phát sinh theo một cách bình đẳng.
Jhāyati jhāpetīti yugalattā pana purimapāṭhova sundarataro.
However, due to the pair "jhāyati jhāpetīti," the former reading is more appropriate.
Tuy nhiên, vì có cặp từ jhāyati jhāpetī, bản đọc trước đó là tốt hơn.
Jhāpetīti ca dahatīti attho.
" Jhāpetīti" also means it burns.
jhāpetī có nghĩa là đốt cháy.
So hi samādhipaccanīkadhamme dūratarakaraṇena dahati nāma.
For that samādhi is said to burn opposing phenomena by keeping them far away.
Định này được gọi là đốt cháy các pháp đối nghịch với định bằng cách làm cho chúng ở rất xa.
Esanānesanādīnaṃ pana appanāya siddhattā ‘‘esitattā nesitattā’’tiādīhi appanāsamādhi vutto.
However, since seeking and not seeking, etc., are accomplished by absorption, appanā-samādhi is described by phrases like "because it is sought, because it is not sought."
esanā (tìm kiếm), nesanā (không tìm kiếm) v.v. được hoàn thành bởi an chỉ (appanā), nên định an chỉ (appanā-samādhi) được nói đến bằng các từ như esitattā nesitattā v.v.
Samaṃ jhātattāti samaṃ jalitattā.
" Samaṃ jhātattāti" means because it blazes equally.
Samaṃ jhātattā (do đã thiền định một cách bình đẳng) có nghĩa là do đã chiếu sáng một cách bình đẳng.
Samaṃ jātattātipi pāṭho.
"Samaṃ jātattātipi" is also a reading.
Cũng có bản đọc là samaṃ jātattā.
Iti imesaṃ aṭṭhannaṃ yugalānaṃ vasena soḷasa, purimā ca navāti ime pañcavīsati samādhissa samādhiṭṭhā.
Thus, these sixteen by way of these eight pairs, and the previous nine, make these twenty-five definitions of samādhi.
Như vậy, mười sáu khía cạnh theo tám cặp này, cộng với chín khía cạnh trước đó, tạo thành hai mươi lăm khía cạnh của định.
983
Samo ca hito ca sukho cāti samādhīti idaṃ pana pañcavīsatiyā ākārehi sādhitassa samādhissa atthasādhanatthaṃ vuttaṃ.
However, the statement " Samo ca hito ca sukho cāti samādhīti" (It is equal, beneficial, and pleasant, therefore it is samādhi) is made to establish the meaning of samādhi, which has been demonstrated in twenty-five ways.
Tuy nhiên, câu Samo ca hito ca sukho cāti samādhī (Bình đẳng, lợi ích và an lạc nên gọi là định) này được nói để xác định ý nghĩa của định đã được chứng minh bằng hai mươi lăm khía cạnh.
Tattha samoti samasaddassa, saṃsaddassa vā attho.
There, " samo" is the meaning of the word "sama" or the word "saṃ".
Trong đó, samo là ý nghĩa của từ sama hoặc saṃ.
So hi paccanīkakkhobhavisamavirahitattā samo.
For it (samādhi) is equal because it is free from the agitation and unevenness of opposing phenomena.
Định này là samo (bình đẳng) vì nó không có sự xáo trộn và bất bình đẳng của các pháp đối nghịch.
Hitoti ādhisaddassa attho, ārammaṇe āhito niccalabhāvakaraṇena patiṭṭhāpitoti adhippāyo.
" Hito" is the meaning of the word "ādhi"; the intention is that it is placed in the object, established by creating an unwavering state.
Hito là ý nghĩa của từ āhita (được đặt vào); ý nghĩa là được đặt và an trú vững chắc trên đối tượng bằng cách làm cho nó bất động.
Ubhayena samo ca āhito cāti samādhīti vuttaṃ hoti.
It means that it is both equal and placed.
Có nghĩa là định được gọi là samādhi vì nó vừa bình đẳng vừa được đặt vào.
Sukhoti santaṭṭhena sukho.
" Sukho" means pleasant in the sense of being tranquil.
Sukho (an lạc) là an lạc theo nghĩa thanh tịnh.
‘‘Yāyaṃ, bhante, adukkhamasukhā vedanā, santasmiṃ esā paṇīte sukhe vuttā bhagavatā’’ti (ma. ni. 2.88) ca ‘‘upekkhā pana santattā, sukhamicceva bhāsitā’’ti ca vuttattā tena santatthena sukhasaddena upekkhāsahagatasamādhipi gahito hoti.
And because it is said, "Bhante, this feeling that is neither painful nor pleasant is called pleasant by the Blessed One, as it is tranquil," and "Upekkhā, being tranquil, is indeed spoken of as pleasant," therefore, by that word "sukha" (pleasant) in the sense of tranquil, samādhi accompanied by upekkhā is also included.
Vì đã nói rằng ‘‘Bạch Thế Tôn, cảm thọ không khổ không lạc này đã được Thế Tôn nói là an lạc thanh tịnh và vi diệu’’ (Ma. Ni. 2.88) và ‘‘xả thọ thì thanh tịnh, nên chỉ được nói là an lạc’’, do đó, bằng từ an lạc theo nghĩa thanh tịnh, định đồng hành với xả thọ cũng được bao hàm.
Aniyāmena hi sabbasamādhayo idha vuccanti.
For here, all samādhis are spoken of without restriction.
Ở đây, tất cả các loại định được nói một cách không giới hạn.
Tena ca sukhasaddena āhitabhāvassa kāraṇaṃ vuttaṃ hoti.
And by that word "sukha," the cause of its being placed is stated.
Và bằng từ an lạc đó, nguyên nhân của trạng thái được đặt vào đã được nói đến.
Yasmā santo, tasmā ekārammaṇe āhitoti adhippāyo veditabboti.
The intention should be understood as: because it is tranquil, therefore it is placed in a single object.
Cần phải hiểu rằng ý nghĩa là vì nó thanh tịnh, nên nó được đặt vào một đối tượng duy nhất.
984
Samādhibhāvanāmayañāṇaniddesavaṇṇanā niṭṭhitā.
The explanation of the knowledge consisting of the development of concentration is concluded.
Phần giải thích về tri kiến phát sinh từ sự tu tập định đã hoàn tất.
985

4. Dhammaṭṭhitiñāṇaniddesavaṇṇanā

4. Explanation of the Knowledge of the Stability of Phenomena

4. Giải thích về Tri kiến An trú Pháp

986
45. Dhammaṭṭhitiñāṇaniddese avijjāsaṅkhārānaṃ uppādaṭṭhitītiādīsu tiṭṭhanti etāya saṅkhārāti ṭhiti.
In the section on the knowledge of the stability of phenomena, in phrases like " the arising and stability of ignorance and volitional formations," "ṭhiti" (stability) means that by which volitional formations stand.
45. Trong phần giải thích về Tri kiến An trú Pháp, trong các câu như avijjāsaṅkhārānaṃ uppādaṭṭhitī (sự an trú phát sinh của các hành do vô minh) v.v., ṭhiti (an trú) là cái mà nhờ đó các hành an trú.
Kā sā?
What is that?
Cái đó là gì?
Avijjā.
Ignorance.
Vô minh (avijjā).
Sā hi saṅkhārānaṃ uppādāya nibbattiyā ṭhiti kāraṇanti uppādaṭṭhiti.
That (ignorance) is indeed the cause for the arising and generation of saṅkhāras, therefore it is called uppādaṭṭhiti (stability of arising).
Vì nó là nguyên nhân của sự phát sinh, tức là sự xuất hiện của các hành, nên nó là uppādaṭṭhiti (sự an trú phát sinh).
Uppannānaṃ pavattiyāpi kāraṇanti pavattaṭṭhiti.
It is also the cause for the continuation of those that have arisen, therefore it is called pavattaṭṭhiti (stability of continuation).
Và vì nó cũng là nguyên nhân của sự tiếp diễn của những gì đã phát sinh, nên nó là pavattaṭṭhiti (sự an trú tiếp diễn).
Kiñcāpi hi janakapaccayassa jananakkhaṇeyeva kiccānubhāvo hoti, tena pana janitānaṃyeva pavattattā sakakkhaṇe pavattiyāpi kāraṇaṃ nāma hoti, santativasena vā pavattiyā kāraṇanti attho.
Although the generative condition (janakapaccaya) has its active power only at the moment of generation, yet, because it is through it that the generated things continue, it is also called a cause for their continuation in their own moment, or it is a cause for continuation in the sense of continuity.
Mặc dù năng lực của nhân sinh khởi chỉ có hiệu lực vào khoảnh khắc sinh khởi, nhưng vì những gì được sinh ra bởi nó vẫn tiếp diễn, nên nó cũng là nguyên nhân của sự tiếp diễn trong khoảnh khắc riêng của chúng, hoặc có nghĩa là nguyên nhân của sự tiếp diễn theo dòng tương tục.
Pavattanti ca napuṃsake bhāvavacanametaṃ, tasmā pavattaṃ pavattīti atthato ekaṃ.
The word pavatta is a verbal noun in the neuter gender; therefore, pavatta and pavatti are one in meaning.
pavattaṃ là một danh từ chỉ trạng thái ở thể trung tính; do đó, pavattaṃpavatti có cùng một ý nghĩa.
Pavattisaddassa pana pākaṭattā tena yojetvā attho vutto.
However, because the word pavatti is more common, the meaning has been stated by combining it with that word.
Tuy nhiên, vì từ pavatti phổ biến hơn, nên ý nghĩa được giải thích bằng cách kết hợp với nó.
Bhāvepi ṭhitisaddassa sijjhanato na idha bhāve ṭhitisaddo, kāraṇe ṭhitisaddoti dassanattaṃ nimittaṭṭhitīti vuttaṃ, nimittabhūtā ṭhitīti attho, kāraṇabhūtāti vuttaṃ hoti.
Although the word ṭhiti can also be formed in the sense of action (bhāva), here the word ṭhiti is not in the sense of action, but in the sense of cause, to show this, it is called nimittaṭṭhiti (stability as a sign); the meaning is "stability that is a sign," which means "stability that is a cause."
Mặc dù từ ṭhiti có thể được hình thành ở nghĩa trạng thái, nhưng ở đây từ ṭhiti không ở nghĩa trạng thái, mà để chỉ rằng từ ṭhiti ở nghĩa nguyên nhân, nên đã nói nimittaṭṭhitī (sự an trú là dấu hiệu), có nghĩa là sự an trú là nguyên nhân, tức là đã nói là nguyên nhân.
Na kevalaṃ nimittamattaṃ hoti, atha kho saṅkhārajanane sabyāpārā viya hutvā āyūhati vāyamatīti paccayasamatthataṃ dassento āyūhanaṭṭhitīti āha, āyūhanabhūtā ṭhitīti attho.
It is not merely a sign; rather, it acts as if it is actively engaged in generating saṅkhāras, striving and exerting itself. Thus, to show the efficacy of the condition, it is called āyūhanaṭṭhiti (stability of exertion); the meaning is "stability that is exertion."
Không chỉ đơn thuần là một nhân duyên, mà còn nỗ lực, cố gắng như thể có sự vận hành trong việc tạo ra các hành, do đó, để chỉ rõ khả năng làm duyên, ngài nói āyūhanaṭṭhiti, nghĩa là trạng thái nỗ lực.
Yasmā avijjā saṅkhāre uppādayamānā uppāde saṃyojeti nāma, ghaṭetīti attho.
Because avijjā, while giving rise to saṅkhāras, connects them to their arising, meaning it joins them.
Bởi vì vô minh, khi đang tạo ra các hành, được gọi là liên kết trong sự sanh khởi, nghĩa là kết hợp.
Saṅkhāre pavattayamānā pavattiyaṃ palibundhati nāma, bandhatīti attho.
While causing saṅkhāras to continue, it binds them to their continuation, meaning it ties them up.
Khi đang làm cho các hành diễn tiến, được gọi là trói buộc trong sự diễn tiến, nghĩa là ràng buộc.
Tasmā saññogaṭṭhiti palibodhaṭṭhitīti vuttā.
Therefore, it is called saññogaṭṭhiti (stability of connection) and palibodhaṭṭhiti (stability of impediment).
Do đó, được gọi là saññogaṭṭhiti palibodhaṭṭhiti.
Saññogabhūtā ṭhiti, palibodhabhūtā ṭhitīti attho.
The meaning is "stability that is connection" and "stability that is impediment."
Nghĩa là, trạng thái là sự liên kết, trạng thái là sự trói buộc.
Yasmā avijjāva saṅkhāre uppādayamānā uppādāya pavattiyā ca mūlakāraṇaṭṭhena samudayo nāma, samudayabhūtā ṭhitīti samudayaṭṭhiti, mūlakāraṇabhūtā ṭhitīti attho.
Because avijjā itself, while giving rise to saṅkhāras, is called samudaya (origin) in the sense of being the root cause for their arising and continuation, it is samudayaṭṭhiti (stability of origin), meaning "stability that is the root cause."
Bởi vì chính vô minh, khi đang tạo ra các hành, được gọi là tập khởi do ý nghĩa là nguyên nhân gốc rễ cho sự sanh khởi và sự diễn tiến, nên samudayaṭṭhiti là trạng thái là sự tập khởi, nghĩa là trạng thái là nguyên nhân gốc rễ.
Avijjāva saṅkhārānaṃ uppāde janakapaccayattā, pavattiyaṃ upatthambhakapaccayattā hetuṭṭhiti paccayaṭṭhitīti vuttā, hetubhūtā ṭhiti, paccayabhūtā ṭhitīti attho.
Avijjā itself, being the generative condition (janakapaccaya) for the arising of saṅkhāras and the supportive condition (upatthambhakapaccaya) for their continuation, is called hetuṭṭhiti (stability as a root cause) and paccayaṭṭhiti (stability as a condition), meaning "stability that is a root cause" and "stability that is a condition."
Chính vô minh được gọi là hetuṭṭhiti paccayaṭṭhiti vì là duyên sanh khởi trong sự sanh của các hành, và là duyên bảo trợ trong sự diễn tiến của chúng, nghĩa là trạng thái là nhân, trạng thái là duyên.
Janakapaccayo hi hetūti, upatthambhako paccayoti vuccati.
Indeed, the generative condition is called hetu, and the supportive condition is called paccaya.
Thật vậy, duyên sanh khởi được gọi là nhân, duyên bảo trợ được gọi là duyên.
Evaṃ sesesupi yojetabbaṃ.
In this way, it should be applied to the remaining terms as well.
Cũng nên áp dụng tương tự trong các trường hợp còn lại.
987
Bhavo jātiyā, jāti jarāmaraṇassāti ettha pana uppādaṭṭhiti saññogaṭṭhiti hetuṭṭhitīti uppādavasena yojitāni padāni jātijarāmaraṇavantānaṃ khandhānaṃ vasena pariyāyena vuttānīti veditabbāni.
However, in the phrase " existence is the condition for birth, birth is the condition for old age and death," the terms uppādaṭṭhiti, saññogaṭṭhiti, and hetuṭṭhiti, which are connected in the sense of arising, should be understood as being stated figuratively in relation to the aggregates (khandhas) that are subject to birth, old age, and death.
Hữu đối với sanh, sanh đối với già-chết, ở đây, cần hiểu rằng các thuật ngữ uppādaṭṭhiti, saññogaṭṭhiti, hetuṭṭhiti, được áp dụng theo phương diện sanh khởi, đã được nói đến một cách gián tiếp theo phương diện các uẩn có sanh, già và chết.
Keci pana ‘‘uppādāya ṭhiti uppādaṭṭhitī’’ti evamādinā nayenettha atthaṃ vaṇṇayanti.
Some, however, explain the meaning here in this manner: "stability for arising is uppādaṭṭhiti," and so on.
Tuy nhiên, một số vị giải thích ý nghĩa ở đây theo cách như: “Uppādaṭṭhiti là trạng thái cho sự sanh khởi” v.v...
Avijjā paccayoti avijjāya saṅkhārānaṃ paccayabhāvaṃ apekkhitvā vuttaṃ.
" Ignorance is the condition" is stated with reference to ignorance being a condition for saṅkhāras.
Vô minh là duyên được nói đến khi xem xét việc vô minh là duyên của các hành.
Avijjāyapi paccayasambhūtattā tassā api paccayapariggahaṇadassanatthaṃ ubhopete dhammā paccayasamuppannāti paccayapariggahe paññāti vuttaṃ.
And to show the comprehension of conditions even for ignorance, since it too arises from conditions, it is stated: " Both these phenomena, being dependently arisen, are wisdom in the comprehension of conditions."
Để chỉ ra việc nắm bắt duyên của cả vô minh, vì vô minh cũng do duyên sanh, nên đã nói: Cả hai pháp này đều do duyên sanh khởi, như vậy là trí tuệ trong việc nắm bắt duyên.
Evaṃ sesesupi yojetabbaṃ.
In this way, it should be applied to the remaining terms as well.
Cũng nên áp dụng tương tự trong các trường hợp còn lại.
Jāti paccayo, jarāmaraṇaṃ paccayasamuppannanti pana pariyāyena vuttaṃ.
However, " birth is the condition, old age and death are dependently arisen" is stated figuratively.
Còn sanh là duyên, già-chết là do duyên sanh khởi thì được nói một cách gián tiếp.
Atītampi addhānanti atikkantampi kālaṃ.
" Even the past period" means "even the time that has passed."
Thời quá khứ là thời gian đã trôi qua.
Anāgatampi addhānanti appattampi kālaṃ.
" Even the future period" means "even the time that has not yet arrived."
Thời vị lai là thời gian chưa đến.
Ubhayatthāpi accantasaṃyogatthe upayogavacanaṃ.
In both cases, the accusative case is used in the sense of continuous connection.
Trong cả hai trường hợp, đây là cách dùng đối cách trong ý nghĩa liên tục không gián đoạn.
988
46. Idāni navākāravārānantaraṃ te navākāre vihāya hetupaṭiccapaccayapadeheva yojetvā avijjā hetu, saṅkhārā hetusamuppannātiādayo tayo vārā niddiṭṭhā.
46. Now, after the section of nine modes, abandoning those nine modes and combining only with the terms hetu, paṭicca, and paccaya, the three sections beginning with " ignorance is the root cause, saṅkhāras are arisen from the root cause" have been explained.
46. Bây giờ, sau phần về chín phương diện, ba phần vô minh là nhân, các hành là do nhân sanh khởi v.v... được trình bày bằng cách bỏ qua chín phương diện đó và chỉ kết hợp với các thuật ngữ nhân, duyên và duyên khởi.
Navākāravāre janakaupatthambhakavasena paccayo vutto.
In the section of nine modes, conditionality (paccaya) was explained in terms of generative and supportive aspects.
Trong phần về chín phương diện, duyên được nói theo phương diện sanh khởi và bảo trợ.
Idha pana hetuvārassa paccayavārassa ca visuṃ āgatattā hetūti janakapaccayattaṃ, paccayoti upatthambhakapaccayattaṃ veditabbaṃ ekekassāpi avijjādikassa paccayassa ubhayathā sambhavato.
Here, however, since the hetu section and the paccaya section appear separately, hetu should be understood as the generative condition (janakapaccaya), and paccaya as the supportive condition (upatthambhakapaccaya), because each condition, such as ignorance, can function in both ways.
Nhưng ở đây, vì phần về nhân và phần về duyên được trình bày riêng biệt, nên cần hiểu nhân là duyên sanh khởi, và duyên là duyên bảo trợ, vì mỗi một duyên như vô minh v.v... có thể có cả hai phương diện.
Paṭiccavāre avijjā paṭiccāti attano uppāde saṅkhārānaṃ avijjāpekkhattā saṅkhārehi avijjā paṭimukhaṃ etabbā gantabbāti paṭiccā.
In the paṭicca section, " ignorance is dependent" (avijjā paṭiccā) means that because saṅkhāras depend on ignorance for their arising, ignorance must be faced or approached by saṅkhāras.
Trong phần duyên khởi, do duyên vô minh, vì trong sự sanh khởi của mình, các hành phụ thuộc vào vô minh, nên các hành phải hướng đến, đi đến đối diện với vô minh, do đó là paṭiccā (duyên).
Etena avijjāya saṅkhāruppādanasamatthatā vuttā hoti.
By this, the ability of ignorance to produce saṅkhāras is stated.
Qua đó, khả năng tạo ra các hành của vô minh được nói đến.
Saṅkhārā paṭiccasamuppannāti saṅkhārā avijjaṃ paṭicca tadabhimukhaṃ pavattanato paṭimukhaṃ katvā na vihāya samaṃ uppannā.
" Saṅkhāras are dependently arisen" (saṅkhārā paṭiccasamuppannā) means that saṅkhāras, proceeding towards that ignorance, having made it their object, arise together without abandoning it.
Các hành là do duyên sanh khởi, nghĩa là các hành, do duyên vô minh, diễn tiến hướng về vô minh đó, nên chúng sanh khởi cùng nhau, đối diện, không rời bỏ.
Evaṃ sesesupi liṅgānurūpena yojetabbaṃ.
In this way, it should be applied to the remaining terms according to their gender.
Cũng nên áp dụng tương tự trong các trường hợp còn lại, tùy theo cách biến đổi từ ngữ.
Avijjā paṭiccāti ussukkavasena vā pāṭho, attho panettha avijjā attano paccaye paṭicca pavattāti pāṭhasesavasena yojetabbo.
The reading "Avijjā paṭicca" (ignorance dependent on) is either in the sense of a prior action, or its meaning here should be construed by supplementing the text as "ignorance arises dependent on its own conditions."
Hoặc, văn bản là avijjā paṭiccā theo nghĩa của một bất biến từ chỉ hành động đã xảy ra trước, và ý nghĩa ở đây nên được áp dụng theo phần văn bản được hiểu ngầm là: vô minh diễn tiến do duyên với các duyên của nó.
Evaṃ sesesupi.
So too in the remaining cases.
Cũng nên áp dụng tương tự trong các trường hợp còn lại.
Catūsupi ca etesu vāresu dvādasannaṃ paṭiccasamuppādaṅgānaṃ paccayasseva vasena dhammaṭṭhitiñāṇassa niddisitabbattā avijjādīnaṃ ekādasannaṃyeva aṅgānaṃ vasena dhammaṭṭhitiñāṇaṃ niddiṭṭhaṃ, jarāmaraṇassa pana ante ṭhitattā tassa vasena na niddiṭṭhaṃ.
And in all these four modes, because the knowledge of the stability of phenomena (dhammaṭṭhitiñāṇa) is to be expounded only in terms of the conditions of the twelve factors of dependent origination, the dhammaṭṭhitiñāṇa is expounded in terms of the eleven factors beginning with ignorance, but it is not expounded in terms of old age and death (jarāmaraṇa) because it stands at the end.
Và trong cả bốn phần này, vì dhammaṭṭhitiñāṇa (trí về sự an trú của pháp) phải được trình bày theo phương diện duyên của mười hai chi phần duyên khởi, nên dhammaṭṭhitiñāṇa chỉ được trình bày theo phương diện của mười một chi phần, bắt đầu từ vô minh, còn theo phương diện của già-chết thì không được trình bày vì nó nằm ở cuối.
Jarāmaraṇassāpi sokaparidevadukkhadomanassupāyāsānaṃ paccayattā jarāmaraṇaṃ tesaṃ paccayaṃ katvā upaparikkhamānassa tassāpi jarāmaraṇassa vasena dhammaṭṭhitiñāṇaṃ yujjateva.
However, since old age and death are also conditions for sorrow, lamentation, pain, displeasure, and despair, the dhammaṭṭhitiñāṇa is indeed appropriate when one investigates old age and death by making them a condition for these*.
Tuy nhiên, vì già-chết cũng là duyên của sầu, bi, khổ, ưu, não, nên khi một người xem xét già-chết như là duyên của chúng, thì dhammaṭṭhitiñāṇa theo phương diện của già-chết đó cũng hoàn toàn hợp lý.
989
47. Idāni tāneva dvādasa paṭiccasamuppādaṅgāni vīsatiākāravasena vibhajitvā catusaṅkhepatiyaddhatisandhiyo dassetvā dhammaṭṭhitiñāṇaṃ niddisitukāmo purimakammabhavasmintiādimāha.
47. Now, wishing to expound the dhammaṭṭhitiñāṇa by dividing those very twelve factors of dependent origination into twenty aspects and showing the four sections, three periods, and three connections, he said, " In the previous kammabhava," and so on.
47. Bây giờ, muốn trình bày dhammaṭṭhitiñāṇa bằng cách phân chia mười hai chi phần duyên khởi đó theo hai mươi phương diện, và chỉ ra bốn tầng, ba thời, và ba mối nối, ngài nói trong kammabhava quá khứ v.v...
Tattha purimakammabhavasminti purime kammabhave, atītajātiyaṃ kammabhave kariyamāneti attho.
Therein, " In the previous kammabhava" means in the previous existence of kamma, that is, when kamma was being performed in a past birth.
Trong đó, trong kammabhava quá khứ nghĩa là trong kammabhava trước đây, khi kammabhava trong kiếp quá khứ đang được tạo ra.
Moho avijjāti yo tadā dukkhādīsu moho, yena mūḷho kammaṃ karoti, sā avijjā.
" Delusion is ignorance" means that delusion concerning suffering, etc., at that time, by which one, deluded, performs kamma, that is ignorance.
Si là vô minh nghĩa là sự si mê về khổ v.v... vào lúc đó, do si mê đó mà người ta tạo nghiệp, đó là vô minh.
Āyūhanā saṅkhārāti taṃ kammaṃ karontassa purimacetanāyo, yathā ‘‘dānaṃ dassāmī’’ti cittaṃ uppādetvā māsampi saṃvaccharampi dānūpakaraṇāni sajjentassa uppannā purimacetanāyo.
" Accumulation is formations" refers to the prior volitions of one performing that kamma, just as the prior volitions arise for one who, having conceived the thought "I will give a gift," prepares the requisites for the gift for a month or even a year.
Sự nỗ lực là các hành nghĩa là các tư tâm trước của người đang tạo nghiệp đó, ví như các tư tâm đã sanh khởi của người, sau khi khởi tâm "ta sẽ bố thí", đã chuẩn bị các vật dụng cúng dường trong một tháng hay một năm.
Paṭiggāhakānaṃ pana hatthe dakkhiṇaṃ patiṭṭhāpayato cetanā bhavoti vuccati.
However, the volition of one placing the offering in the hands of the recipients is called bhava.
Còn tư tâm của người đang đặt vật cúng dường vào tay người nhận thì được gọi là hữu.
Ekāvajjanesu vā chasu javanesu cetanā āyūhanā saṅkhārā nāma, sattamajavane cetanā bhavo.
Or, the volitions in the six javanas, each with one āvajjana, are called āyūhanā saṅkhārā, while the volition in the seventh javana is bhava.
Hoặc, tư tâm trong sáu sát-na tâm javana của một lộ trình tâm được gọi là sự nỗ lực, các hành; tư tâm trong sát-na tâm javana thứ bảy là hữu.
Yā kāci vā pana cetanā bhavo, taṃsampayuttā āyūhanā saṅkhārā nāma.
Or, any volition is bhava, and those associated with it are called āyūhanā saṅkhārā.
Hoặc, bất kỳ tư tâm nào cũng là hữu, và sự nỗ lực tương ưng với nó được gọi là các hành.
990
Nikanti taṇhāti yā kammaṃ karontassa tassa phale upapattibhave nikāmanā patthanā, sā taṇhā nāma.
" Longing is craving" means the desire or aspiration for the result of the kamma, for the rebirth-existence (upapattibhava), that arises in one performing kamma; that is called taṇhā.
Sự ưa thích là ái nghĩa là sự mong muốn, ước nguyện về upapattibhava (kiếp sống tái sanh) là quả của nghiệp đó khi đang tạo nghiệp, đó được gọi là ái.
Upagamanaṃ upādānanti yaṃ kammabhavassa paccayabhūtaṃ ‘‘imasmiṃ nāma kamme kate kāmā sampajjantī’’ti vā ‘‘idaṃ katvā asukasmiṃ nāma ṭhāne kāme sevissāmī’’ti vā ‘‘attā ucchinno suucchinno hotī’’ti vā ‘‘sukhī hotiṃ vigatapariḷāho’’ti vā ‘‘sīlabbataṃ sukhena paripūratī’’ti vā pavattaṃ upagamanaṃ daḷhagahaṇaṃ, idaṃ upādānaṃ nāma.
" Approaching is clinging" means the firm grasping, the approaching, which serves as a condition for the kamma-existence, arising with the thought "When this kamma is done, sensual pleasures will be attained," or "Having done this, I will enjoy sensual pleasures in such and such a place," or "The self is completely annihilated," or "I am happy, free from fever," or "The moral practices are easily perfected"; this is called upādāna.
Sự tiếp cận là thủ nghĩa là sự tiếp cận, sự nắm giữ chắc chắn, là duyên của kammabhava, diễn tiến với suy nghĩ rằng "khi nghiệp này được làm, các dục sẽ thành tựu", hoặc "sau khi làm điều này, ta sẽ hưởng thụ các dục ở nơi kia", hoặc "ngã bị đoạn diệt, hoàn toàn đoạn diệt", hoặc "ta sẽ được an lạc, không còn phiền não", hoặc "giới cấm được viên mãn một cách dễ dàng", đây được gọi là thủ.
Cetanā bhavoti āyūhanāvasāne vuttā cetanā bhavo nāma.
" Volition is existence" means the volition mentioned at the end of accumulation is called bhava.
Tư tâm là hữu nghĩa là tư tâm được nói ở cuối phần nỗ lực được gọi là hữu.
Purimakammabhavasminti atītajātiyā kammabhave kariyamāne pavattā.
" In the previous kamma-existence" means those that arose when kamma was being performed in a past birth.
Trong kammabhava quá khứ nghĩa là đã diễn tiến khi kammabhava trong kiếp quá khứ đang được tạo ra.
Idha paṭisandhiyā paccayāti paccuppannapaṭisandhiyā paccayabhūtā.
" Conditions for rebirth here" means they are conditions for the present rebirth-linking (paṭisandhi).
Là duyên cho sự tái sanh ở đây nghĩa là là duyên cho sự tái sanh trong hiện tại.
991
Idha paṭisandhi viññāṇanti yaṃ paccuppannabhavassa bhavantarapaṭisandhānavasena uppannattā paṭisandhīti vuccati, taṃ viññāṇaṃ.
" Rebirth-linking consciousness here" refers to the consciousness that is called paṭisandhi because it arises in the present existence by linking one existence to another.
Sự tái sanh ở đây là thức nghĩa là thức được gọi là sự tái sanh vì nó sanh khởi với vai trò nối liền các kiếp sống của kiếp hiện tại.
Okkanti nāmarūpanti yā gabbhe rūpārūpadhammānaṃ okkanti āgantvā pavisanaṃ viya, idaṃ nāmarūpaṃ.
" Descent is mentality-materiality" refers to the descent of mental and material phenomena in the womb, as if entering; this is nāmarūpa.
Sự nhập vào là danh-sắc nghĩa là sự nhập vào, sự đi vào như thể đi vào của các pháp sắc và phi sắc trong bụng mẹ, đây là danh-sắc.
Pasādo āyatananti yo pasannabhāvo, idaṃ āyatanaṃ.
" Clarity is sense-base" refers to the clear state; this is āyatana.
Sự trong sáng là xứ nghĩa là trạng thái trong sáng, đây là xứ.
Jātiggahaṇena ekavacanaṃ kataṃ.
The singular form is used by taking the class.
Số ít được dùng để chỉ chung một loại.
Etena cakkhādīni pañcāyatanāni vuttāni.
By this, the five sense-bases, such as the eye, are mentioned.
Qua đó, năm xứ như nhãn xứ v.v... đã được nói đến.
‘‘Pabhassaramidaṃ, bhikkhave, cittaṃ, tañca kho āgantukehi upakkilesehi upakkiliṭṭha’’nti (a. ni. 1.49) ettha bhavaṅgacittaṃ adhippetanti vacanato idhāpi manāyatanassa vipākabhūtattā, tassa ca kilesakālussiyābhāvena pasannattā pasādavacanena manāyatanampi vuttanti veditabbaṃ.
It should be understood that in the passage "This mind, monks, is luminous, but it is defiled by adventitious defilements," the bhavaṅga-citta is intended, and here too, because the mind-base is a result (vipāka) and is clear due to the absence of agitation by defilements, the mind-base is also referred to by the word "clarity."
Cần hiểu rằng, ý xứ cũng được nói đến bằng từ "sự trong sáng", vì trong câu "Này các Tỳ-khưu, tâm này sáng chói, nhưng nó bị ô nhiễm bởi các phiền não ngoại lai", tâm bhavaṅga được ám chỉ, và ở đây cũng vậy, vì ý xứ là quả, và nó trong sáng do không có sự vẩn đục của phiền não.
Phuṭṭho phassoti yo ārammaṇaṃ phuṭṭho phusanto uppanno, ayaṃ phasso.
" Contact is touched" refers to the contact that arises, having touched or come into contact with the object; this is phassa.
Sự xúc chạm là xúc nghĩa là pháp sanh khởi khi xúc chạm, tiếp xúc với đối tượng, đây là xúc.
Vedayitaṃ vedanāti yaṃ paṭisandhiviññāṇena vā saḷāyatanapaccayena vā phassena saha uppannaṃ vipākavedayitaṃ, ayaṃ vedanā.
" Feeling is felt" refers to the resultant feeling (vipākavedayita) that arises together with rebirth-linking consciousness or with contact conditioned by the six sense-bases; this is vedanā.
Cảm thọ là vedanā có nghĩa là: Bất cứ cảm thọ quả nào sanh khởi cùng với thức tái sanh, hoặc với xúc do sáu xứ làm duyên, đó là vedanā.
Idhupapattibhavasmiṃ purekatassa kammassa paccayāti paccuppanne vipākabhave atītajātiyaṃ katassa kammassa paccayena pavattantīti attho.
" In this existence of arising, due to kamma previously done" means that these arise in the present resultant existence due to kamma done in a past birth.
Do duyên của nghiệp đã làm trước đây trong kiếp hiện hữu này có nghĩa là: (năm pháp này) diễn tiến do duyên của nghiệp đã làm trong kiếp quá khứ, trong kiếp quả hiện tại.
992
Idha paripakkattā āyatanānanti paripakkāyatanassa kammakaraṇakāle mohādayo dassitā.
Here, due to the maturity of the sense bases refers to delusion and so forth being shown at the time of performing kamma for a person with mature sense bases.
Do các xứ đã chín muồi ở đây: si, v.v... được chỉ ra vào lúc làm nghiệp đối với người có các xứ đã chín muồi.
Āyatiṃ paṭisandhiyāti anāgate paṭisandhiyā.
In the future, for rebirth means for rebirth in a future existence.
Trong sự tái sanh vị lai: của sự tái sanh trong tương lai.
Āyatiṃ paṭisandhi viññāṇantiādīni vuttatthāni.
The words beginning with rebirth consciousness in the future have been explained.
Các từ thức, v.v... trong sự tái sanh vị lai đã được giải thích ý nghĩa.
993
Kathaṃ pana dvādasahi paṭiccasamuppādaṅgehi ime vīsati ākārā gahitā hontīti?
How then are these twenty aspects included by the twelve factors of Dependent Origination?
Vậy, làm thế nào mà hai mươi phương diện này được bao gồm bởi mười hai chi phần của Duyên khởi?
Avijjā saṅkhārāti ime dve atītahetuyo sarūpato vuttā.
Ignorance and formations—these two past causes are stated in their own nature.
Vô minh và hành, hai nhân quá khứ này, được nói theo tự thân của chúng.
Yasmā pana avidvā paritassati, paritassito upādiyati, tassupādānapaccayā bhavo, tasmā tehi dvīhi gahitehi taṇhupādānabhavāpi gahitāva honti.
But since an ignorant person craves, and one who craves grasps, and from that grasping arises existence, therefore, by including those two, craving, grasping, and existence are also included.
Tuy nhiên, vì người vô trí khao khát, do khao khát nên chấp thủ, do duyên chấp thủ của người ấy mà có hữu, do đó, khi hai chi phần ấy được bao gồm thì ái, thủ, và hữu cũng được bao gồm.
Paccuppanne viññāṇanāmarūpasaḷāyatanaphassavedanā sarūpato vuttāyeva.
In the present, consciousness, mentality-materiality, six sense bases, contact, and feeling are stated in their own nature.
Trong hiện tại, thức, danh sắc, sáu xứ, xúc, và thọ đã được nói theo tự thân của chúng.
Taṇhupādānabhavā paccuppannahetuyo sarūpato vuttā.
Craving, grasping, and existence are stated in their own nature as present causes.
Ái, thủ, và hữu là các nhân hiện tại được nói theo tự thân của chúng.
Bhave pana gahite tassa pubbabhāgā taṃsampayuttā vā saṅkhārā gahitāva honti, taṇhupādānaggahaṇena ca taṃsampayuttā.
However, when existence is included, its prior parts or formations associated with it are also included, and by including craving and grasping, those associated with them are included.
Tuy nhiên, khi hữu được bao gồm, các hành thuộc phần trước của nó hoặc tương ưng với nó cũng được bao gồm, và do việc bao gồm ái và thủ, (vô minh) tương ưng với chúng cũng được bao gồm.
Yāya vā mūḷho kammaṃ karoti, sā avijjā gahitāva hoti.
Or, the ignorance by which a deluded person performs kamma is also included.
Hoặc, vô minh mà nhờ đó người si mê làm nghiệp cũng được bao gồm.
Anāgate jāti jarāmaraṇanti dve sarūpena vuttāni, jātijarāmaraṇaggahaṇeneva pana viññāṇādīni pañca anāgataphalāni gahitāneva honti.
In the future, birth and aging-and-death are stated in their own nature, but by including birth and aging-and-death, the five future results, beginning with consciousness, are also included.
Trong tương lai, hai chi phần sanh và lão tử được nói theo tự thân của chúng, nhưng chính nhờ việc bao gồm sanh và lão tử mà năm quả vị lai là thức, v.v... cũng được bao gồm.
Tesaṃyeva hi jātijarāmaraṇānīti evaṃ dvādasahi aṅgehi vīsati ākārā gahitā honti.
For these same birth and aging-and-death are thus the twenty aspects included by the twelve factors.
Vì sanh và lão tử chính là của chúng. Như vậy, hai mươi phương diện được bao gồm bởi mười hai chi phần.
994
‘‘Atīte hetavo pañca, idāni phalapañcakaṃ;
“Five causes in the past, five results in the present;
"Năm nhân trong quá khứ, năm quả trong hiện tại;
995
Idāni hetavo pañca, āyatiṃ phalapañcaka’’nti–
Five causes in the present, five results in the future”—
Năm nhân trong hiện tại, năm quả trong tương lai."
996
Gāthāya ayamevattho vutto.
This very meaning is stated in the verse.
Chính ý nghĩa này đã được nói trong bài kệ.
Itimeti iti ime.
Itime means iti ime.
Itime là iti ime.
Iti imeti vā pāṭho.
Or the reading is iti ime.
Hoặc bản văn là iti ime.
997
Catusaṅkhepeti caturo rāsī.
In four groups means four aggregates.
Trong bốn tóm lược: bốn nhóm.
Atīte pañca hetudhammā eko hetusaṅkhepo, paccuppanne pañca phaladhammā eko phalasaṅkhepo, paccuppanne pañca hetudhammā eko hetusaṅkhepo, anāgate pañca phaladhammā eko phalasaṅkhepo.
The five causal phenomena in the past are one causal group, the five resultant phenomena in the present are one resultant group, the five causal phenomena in the present are one causal group, and the five resultant phenomena in the future are one resultant group.
Năm pháp nhân trong quá khứ là một tóm lược nhân, năm pháp quả trong hiện tại là một tóm lược quả, năm pháp nhân trong hiện tại là một tóm lược nhân, năm pháp quả trong tương lai là một tóm lược quả.
998
Tayo addheti tayo kāle.
Three times means three periods.
Ba thời: ba thời kỳ.
Paṭhamapañcakavasena atītakālo, dutiyatatiyapañcakavasena paccuppannakālo, catutthapañcakavasena anāgatakālo veditabbo.
The past time should be understood by means of the first pentad, the present time by means of the second and third pentads, and the future time by means of the fourth pentad.
Nên hiểu thời quá khứ qua nhóm năm đầu tiên, thời hiện tại qua nhóm năm thứ hai và thứ ba, thời tương lai qua nhóm năm thứ tư.
999
Tisandhinti tayo sandhayo assāti tisandhi, taṃ tisandhiṃ.
Three connections means that it has three connections, that is, the three connections.
Ba mối nối: có ba mối nối nên gọi là ba mối nối, (biết) ba mối nối ấy.
Atītahetupaccuppannaphalānamantarā eko hetuphalasandhi, paccuppannaphalaanāgatahetūnamantarā eko phalahetusandhi, paccuppannahetuanāgataphalānamantarā eko hetuphalasandhi.
Between the past causes and present results is one cause-result connection; between the present results and future causes is one result-cause connection; between the present causes and future results is one cause-result connection.
Giữa nhân quá khứ và quả hiện tại có một mối nối nhân-quả, giữa quả hiện tại và nhân tương lai có một mối nối quả-nhân, giữa nhân hiện tại và quả tương lai có một mối nối nhân-quả.
1000
Paṭiccasamuppādapāḷiyaṃ sarūpato āgatavasena pana avijjāsaṅkhārā eko saṅkhepo, viññāṇanāmarūpasaḷāyatanaphassavedanā dutiyo, taṇhupādānabhavā tatiyo, jātijarāmaraṇaṃ catuttho.
However, according to what is stated in its own nature in the Paṭiccasamuppāda Pāḷi, ignorance and formations are one group; consciousness, mentality-materiality, six sense bases, contact, and feeling are the second; craving, grasping, and existence are the third; and birth and aging-and-death are the fourth.
Tuy nhiên, theo cách trình bày trong bản văn Duyên khởi, vô minh và hành là một tóm lược; thức, danh sắc, sáu xứ, xúc, và thọ là tóm lược thứ hai; ái, thủ, và hữu là tóm lược thứ ba; sanh và lão tử là tóm lược thứ tư.
Avijjāsaṅkhārāti dve aṅgāni atītakālāni, viññāṇādīni bhavāvasānāni aṭṭha paccuppannakālāni, jātijarāmaraṇanti dve anāgatakālāni.
Ignorance and formations—these two factors are past; the eight, beginning with consciousness and ending with existence, are present; and birth and aging-and-death—these two are future.
Hai chi phần là vô minh và hành thuộc thời quá khứ; tám chi phần bắt đầu từ thức và kết thúc ở hữu thuộc thời hiện tại; hai chi phần là sanh và lão tử thuộc thời tương lai.
Saṅkhāraviññāṇānaṃ antarā eko hetuphalasandhi, vedanātaṇhānamantarā eko phalahetusandhi, bhavajātīnamantarā eko hetuphalasandhi.
Between formations and consciousness is one cause-result connection; between feeling and craving is one result-cause connection; between existence and birth is one cause-result connection.
Giữa hành và thức có một mối nối nhân-quả, giữa thọ và ái có một mối nối quả-nhân, giữa hữu và sanh có một mối nối nhân-quả.
1001
Vīsatiyā ākārehīti vīsatiyā koṭṭhāsehi.
By twenty aspects means by twenty divisions.
Bởi hai mươi phương diện: bởi hai mươi phần.
Catusaṅkhepe ca tayo addhe ca tisandhiṃ paṭiccasamuppādañca vīsatiyā ākārehi jānātīti sambandho.
The connection is that one knows the four groups, the three times, and the three connections of Dependent Origination by twenty aspects.
Mối liên hệ là: biết bốn tóm lược, ba thời, ba mối nối, và Duyên khởi bởi hai mươi phương diện.
1002
Jānātīti sutānusārena bhāvanārambhañāṇena jānāti.
Knows means knows through the knowledge that initiates development, following what has been heard.
Biết: biết bằng trí tuệ khởi đầu của sự tu tập theo những gì đã nghe.
Passatīti ñātameva cakkhunā diṭṭhaṃ viya hatthatale āmalakaṃ viya ca phuṭaṃ katvā ñāṇeneva passati.
Sees means sees by knowledge itself, making what is known manifest, as if seen by the eye or like an amalaka fruit in the palm of the hand.
Thấy: thấy bằng chính trí tuệ, làm cho điều đã biết trở nên rõ ràng như được thấy bằng mắt, như quả amla trong lòng bàn tay.
Aññātīti diṭṭhamariyādeneva āsevanaṃ karonto ñāṇeneva jānāti.
Understands means, by practicing according to what has been seen, one knows by knowledge itself.
Hiểu rõ: biết bằng chính trí tuệ trong khi thực hành theo giới hạn đã thấy.
Mariyādattho hi ettha ākāro.
Indeed, here ākāra means "mode" or "aspect."
Vì ở đây, từ ākāra có nghĩa là giới hạn.
Paṭivijjhatīti bhāvanāpāripūriyā niṭṭhaṃ pāpento ñāṇeneva paṭivedhaṃ karoti.
Penetrates means, bringing it to completion through the perfection of development, one achieves penetration by knowledge itself.
Thâm nhập: thực hiện sự thâm nhập bằng chính trí tuệ, đưa sự tu tập đến chỗ hoàn mãn, đến chỗ kết thúc.
Salakkhaṇavasena vā jānāti, sarasavasena passati, paccupaṭṭhānavasena aññāti, padaṭṭhānavasena paṭivijjhati.
Or, one knows by way of its specific characteristic, sees by way of its function, understands by way of its manifestation, and penetrates by way of its proximate cause.
Hoặc, biết theo phương diện tự tướng, thấy theo phương diện phận sự, hiểu rõ theo phương diện trạng thái hiện khởi, thâm nhập theo phương diện nhân gần.
1003
Tattha paṭiccasamuppādoti paccayadhammā veditabbā.
Therein, Dependent Origination refers to the causal phenomena that should be known.
Trong đó, Duyên khởi nên được hiểu là các pháp duyên.
Paṭiccasamuppannā dhammāti tehi tehi paccayehi nibbattadhammā.
Dependently originated phenomena refers to the phenomena that arise from those various causes.
Các pháp do duyên sanh là các pháp được tạo ra bởi các duyên ấy.
Kathamidaṃ jānitabbanti ce?
If it is asked, "How should this be known?"
Nếu hỏi: "Làm thế nào để biết điều này?"
Bhagavato vacanena.
By the word of the Blessed One.
Bởi lời dạy của Đức Thế Tôn.
Bhagavatā hi paṭiccasamuppādapaṭiccasamuppannadhammadesanāsutte –
For the Blessed One, in the discourse on the teaching of Dependent Origination and Dependently Originated Phenomena—
Vì Đức Thế Tôn, trong kinh thuyết về Duyên khởi và các pháp do duyên sanh, đã nói –
1004
‘‘Katamo ca, bhikkhave, paṭiccasamuppādo, jātipaccayā, bhikkhave, jarāmaraṇaṃ, uppādā vā tathāgatānaṃ anuppādā vā tathāgatānaṃ ṭhitāva sā dhātu dhammaṭṭhitatā dhammaniyāmatā idappaccayatā, taṃ tathāgato abhisambujjhati abhisameti, abhisambujjhitvā abhisametvā ācikkhati deseti paññāpeti paṭṭhapeti vivarati vibhajati uttānīkaroti ‘passathā’ti cāha.
“And what, bhikkhus, is dependent origination? Conditioned by birth, bhikkhus, is aging-and-death. Whether Tathāgatas arise or do not arise, that element, the stability of the Dhamma, the fixedness of the Dhamma, the specific conditionality, remains. This the Tathāgata fully comprehends and penetrates. Having fully comprehended and penetrated it, he declares it, teaches it, makes it known, establishes it, reveals it, analyzes it, clarifies it, and says: ‘Behold!’
"Này các Tỳ khưu, thế nào là Duyên khởi? Này các Tỳ khưu, do duyên sanh có lão tử. Dù các Như Lai có xuất hiện hay không xuất hiện, yếu tố ấy vẫn tồn tại, đó là pháp trụ tánh, pháp định tánh, y duyên tánh. Như Lai giác ngộ, chứng đạt điều đó. Sau khi giác ngộ, chứng đạt, Ngài tuyên bố, giảng dạy, trình bày, thiết lập, khai mở, phân tích, làm cho rõ ràng và nói rằng: 'Hãy xem!'
Jātipaccayā, bhikkhave, jarāmaraṇaṃ, bhavapaccayā, bhikkhave, jāti…pe… avijjāpaccayā, bhikkhave, saṅkhārā.
Conditioned by birth, bhikkhus, is aging-and-death. Conditioned by existence, bhikkhus, is birth… and so on… Conditioned by ignorance, bhikkhus, are volitional formations.
Này các Tỳ khưu, do duyên sanh có lão tử. Này các Tỳ khưu, do duyên hữu có sanh... ... Này các Tỳ khưu, do duyên vô minh có các hành.
Uppādā vā tathāgatānaṃ…pe… uttānīkaroti ‘passathā’ti cāha.
Whether Tathāgatas arise or do not arise… and so on… he clarifies it, and says: ‘Behold!’
Dù các Như Lai có xuất hiện... ... làm cho rõ ràng và nói rằng: 'Hãy xem!'
Avijjāpaccayā, bhikkhave, saṅkhārā.
Conditioned by ignorance, bhikkhus, are volitional formations.
Này các Tỳ khưu, do duyên vô minh có các hành.
Iti kho, bhikkhave, yā tatrata thatā avitathatā anaññathatā idappaccayatā.
Thus, bhikkhus, that which is reality, unerroneousness, unalterability, specific conditionality therein—
Như vậy, này các Tỳ khưu, cái gì ở đó là như tánh, bất ly tánh, bất dị tánh, y duyên tánh.
Ayaṃ vuccati, bhikkhave, paṭiccasamuppādo’’ti (saṃ. ni. 2.20) –
this, bhikkhus, is called dependent origination.”
Này các Tỳ khưu, đây được gọi là Duyên khởi."
1005
Evaṃ paṭiccasamuppādaṃ desentena tathatādīhi vevacanehi paccayadhammāva paṭiccasamuppādoti vuttā.
Thus, by the Blessed One, in teaching dependent origination with synonyms such as tathatā, it was stated that dependent origination consists only of the conditioned phenomena.
Như vậy, khi thuyết giảng về Duyên khởi, Ngài đã nói rằng chính các pháp duyên là Duyên khởi, bằng các từ đồng nghĩa như như tánh, v.v...
Tasmā jarāmaraṇādīnaṃ paccayalakkhaṇo paṭiccasamuppādo, dukkhānubandhanaraso kummaggapaccupaṭṭhāno, ayampi sapaccayattā attano visesapaccayapadaṭṭhāno.
Therefore, dependent origination has the characteristic of being the condition for aging-and-death and so forth, its function is to bind suffering, and its manifestation is a wrong path. This also, due to its conditionality, has its own specific condition as its proximate cause.
Do đó, Duyên khởi của lão tử, v.v... có đặc tính là duyên, có phận sự là nối kết với khổ, có trạng thái hiện khởi là con đường sai lầm, và pháp này cũng có nhân gần là duyên đặc biệt của chính nó vì nó có duyên.
1006
Uppādā vā anuppādā vāti uppāde vā anuppāde vā, tathāgatesu uppannesupi anuppannesupīti attho.
Whether they arise or do not arise: means whether Tathāgatas have arisen or have not arisen.
Dù có xuất hiện hay không xuất hiện có nghĩa là, dù có xuất hiện hay không xuất hiện, tức là dù các Như Lai có xuất hiện hay không xuất hiện.
Ṭhitāva sā dhātūti ṭhitova so paccayasabhāvo, na kadāci jātijarāmaraṇassa paccayo na hotīti attho.
That element remains: means that causal nature remains; it is never the case that birth is not a condition for aging-and-death.
Yếu tố ấy vẫn tồn tại có nghĩa là, bản chất duyên ấy vẫn tồn tại. Ý nghĩa là, không bao giờ sanh không phải là duyên của lão tử.
Dhammaṭṭhitatā dhammaniyāmatā idappaccayatāti jātipaccayoyeva.
The stability of the Dhamma, the fixedness of the Dhamma, the specific conditionality: is indeed birth as a condition.
Pháp trụ tánh, pháp định tánh, y duyên tánh: chính là duyên sanh.
Jātipaccayena hi jarāmaraṇasaṅkhāto paccayasamuppannadhammo tadāyattatāya tiṭṭhati, jātipaccayova jarāmaraṇadhammaṃ niyameti, tasmā jāti ‘‘dhammaṭṭhitatā dhammaniyāmatā’’ti vuccati.
For, conditioned by birth, the dependently originated phenomenon called aging-and-death stands in dependence on that; birth as a condition regulates the phenomenon of aging-and-death. Therefore, birth is called “the stability of the Dhamma, the fixedness of the Dhamma.”
Vì do duyên sanh, pháp do duyên sanh được gọi là lão tử tồn tại do phụ thuộc vào nó; chính duyên sanh quy định pháp lão tử, do đó sanh được gọi là "pháp trụ tánh, pháp định tánh".
Jātiyeva imassa jarāmaraṇassa paccayoti idappaccayo, idappaccayova idappaccayatā.
Birth itself is the condition for this aging-and-death, hence idappaccaya; idappaccaya itself is idappaccayatā.
Chính sanh là duyên của lão tử này, nên gọi là y duyên; chính y duyên là y duyên tánh.
Tanti taṃ paccayaṃ.
That: refers to that condition.
Điều đó: duyên đó.
Abhisambujjhatīti ñāṇena abhisambujjhati.
Fully comprehends: fully comprehends with knowledge.
Giác ngộ: giác ngộ bằng trí tuệ.
Abhisametīti ñāṇena abhisamāgacchati.
Penetrates: fully attains with knowledge.
Chứng đạt: đạt đến bằng trí tuệ.
Ācikkhatīti katheti.
Declares: states.
Tuyên bố: nói.
Desetīti dasseti.
Teaches: shows.
Giảng dạy: chỉ ra.
Paññāpetīti jānāpeti.
Makes it known: causes to know.
Trình bày: làm cho biết.
Paṭṭhapetīti ñāṇamukhe ṭhapeti.
Establishes it: establishes it at the forefront of knowledge.
Thiết lập: đặt ở cửa ngõ của trí tuệ.
Vivaratīti vivaritvā dasseti.
Reveals it: reveals by opening it up.
Khai mở: mở ra và chỉ ra.
Vibhajatīti vibhāgato dasseti.
Analyzes it: shows it by division.
Phân tích: chỉ ra theo từng phần.
Uttānīkarotīti pākaṭaṃ karoti.
Clarifies it: makes it manifest.
Làm cho rõ ràng: làm cho hiển nhiên.
Iti khoti evaṃ kho.
Thus indeed: in this way indeed.
Iti kho (như vậy thì) có nghĩa là như vậy.
Yā tatrāti yā tesu ‘‘jātipaccayā jarāmaraṇa’’ntiādīsu.
That which is therein: refers to that which is in "conditioned by birth is aging-and-death" and so forth.
Yā tatrā (cái nào trong đó) có nghĩa là cái nào trong các câu ‘‘do sinh mà có già chết’’ v.v.
So panāyaṃ paṭiccasamuppādo tehi tehi paccayehi anūnādhikeheva tassa tassa dhammassa sambhavato tathatāti, sāmaggiṃ upagatesu paccayesu muhuttampi tato nibbattanadhammānaṃ asambhavābhāvato avitathatāti, aññadhammapaccayehi aññadhammānuppattito anaññathatāti, yathāvuttānaṃ etesaṃ jarāmaraṇādīnaṃ paccayato vā paccayasamūhato vā idappaccayatāti vutto.
Moreover, this dependent origination is called tathatā (reality) because of the arising of each phenomenon from those conditions, neither more nor less; avitathatā (unerroneousness) because there is no non-arising of phenomena to be produced from them even for a moment when the conditions are complete; anaññathatā (unalterability) because different phenomena do not arise from the conditions of other phenomena; and idappaccayatā (specific conditionality) because it is the condition or the aggregate of conditions for these aging-and-death and so forth, as stated.
Và duyên khởi này được gọi là tathatā (chân như) vì sự sinh khởi của mỗi pháp đó (như già, chết, v.v.) chỉ do các duyên đó, không thêm không bớt; được gọi là avitathatā (không hư vọng) vì khi các duyên hội đủ, dù chỉ một khoảnh khắc, cũng không thể không phát sinh các pháp được tạo ra từ đó; được gọi là anaññathatā (không khác biệt) vì các pháp khác không sinh khởi từ các duyên của các pháp khác; và được gọi là idappaccayatā (duyên này sinh) vì là duyên hoặc tập hợp duyên của các pháp già, chết, v.v., đã được nói đến.
Tatrāyaṃ vacanattho – imesaṃ paccayā idappaccayā, idappaccayā eva idappaccayatā, idappaccayānaṃ vā samūho idappaccayatā.
Herein, the meaning of the word is: idappaccayā are the conditions for these; idappaccayā itself is idappaccayatā, or idappaccayatā is the aggregate of idappaccayā.
Ở đây, ý nghĩa của từ là: các duyên của những điều này là idappaccayā (những duyên này), chính idappaccayāidappaccayatā (tính duyên này sinh), hoặc tập hợp của idappaccayāidappaccayatā.
Lakkhaṇaṃ panettha saddasatthato veditabbanti.
The characteristic here should be understood from grammar.
Đặc điểm của từ này cần được hiểu từ ngữ pháp học.
1007
Dhammaṭṭhitiñāṇaniddesavaṇṇanā niṭṭhitā.
The explanation of the knowledge of the stability of the Dhamma is concluded.
Phần giải thích về Dhammaṭṭhitiñāṇa đã kết thúc.
1008

5. Sammasanañāṇaniddesavaṇṇanā

5. The Explanation of the Knowledge of Comprehension

5. Giải thích về Sammasanañāṇa

1009
48. Sammasanañāṇaniddese yaṃ kiñcīti anavasesapariyādānaṃ.
In the explanation of the knowledge of comprehension, whatever is a complete inclusion without remainder.
Trong phần giải thích về Sammasanañāṇa, từ yaṃ kiñcī (bất cứ điều gì) có nghĩa là bao trùm tất cả, không sót lại.
Rūpanti atippasaṅganiyamanaṃ.
Form is the restriction of excessive generalization.
Từ rūpaṃ (sắc) có nghĩa là giới hạn sự lan rộng quá mức.
Evaṃ padadvayenāpi rūpassa asesapariggaho kato hoti.
Thus, by these two terms, a complete comprehension of form is made.
Như vậy, với hai từ này, tất cả sắc đều được bao gồm hoàn toàn.
Athassa atītādinā vibhāgaṃ ārabhati.
Then, it begins the division of it into past and so forth.
Sau đó, bắt đầu phân loại sắc theo quá khứ, v.v.
Tañhi kiñci atītaṃ kiñci anāgatādibhedanti.
For some of it is past, some is future, and so on.
Thật vậy, một số là quá khứ, một số là vị lai, v.v.
Esa nayo vedanādīsupi.
The same method applies to feeling and so forth.
Nguyên tắc này cũng áp dụng cho thọ, v.v.
Tattha rūpaṃ tāva addhāsantatisamayakhaṇavasena catudhā atītaṃ nāma hoti, tathā anāgatapaccuppannaṃ.
Among these, form is called past in four ways: by way of duration, continuity, occasion, and moment; likewise, future and present.
Trong đó, sắc có thể là quá khứ theo bốn cách: theo thời gian (addhā), theo dòng chảy (santati), theo giai đoạn (samaya), và theo sát-na (khaṇa); tương tự với vị lai và hiện tại.
Tattha addhāvasena tāva ekassa ekasmiṃ bhave paṭisandhito pubbe atītaṃ, cutito uddhaṃ anāgataṃ, ubhinnamantare paccuppannaṃ.
Among these, by way of duration, first, for a single being in a single existence, that which is before rebirth is past; that which is after death is future; that which is between the two is present.
Trong đó, theo thời gian (addhā), sắc là quá khứ trước khi tái sinh trong một kiếp sống của một chúng sinh, là vị lai sau khi chết, và là hiện tại ở giữa hai điều đó.
Santativasena sabhāgaekautusamuṭṭhānaṃ ekāhārasamuṭṭhānañca pubbāpariyabhāvena vattamānampi paccuppannaṃ, tato pubbe visabhāgautuāhārasamuṭṭhānaṃ atītaṃ, pacchā anāgataṃ.
By way of continuity, matter arisen from one homogeneous season and matter arisen from one food, even though existing by way of prior and posterior states, is present. Matter arisen from heterogeneous season and food before that is past. Matter arisen from heterogeneous season and food after that is future.
Theo dòng chảy (santati), sắc được sinh ra từ nhiệt độ đồng loại và cùng một nguồn thực phẩm, hoặc từ cùng một nguồn thực phẩm, dù đang hiện hữu theo thứ tự trước sau, cũng là hiện tại; sắc được sinh ra từ nhiệt độ và thực phẩm dị loại trước đó là quá khứ; và sắc sau đó là vị lai.
Cittajaṃ ekavīthiekajavanaekasamāpattisamuṭṭhānaṃ paccuppannaṃ, tato pubbe atītaṃ, pacchā anāgataṃ, kammasamuṭṭhānassa pāṭiyekkaṃ santativasena atītādibhedo natthi, tesaññeva pana utuāhāracittasamuṭṭhānānaṃ upatthambhanavasena tassa atītādibhāvo veditabbo.
Matter arisen from mind, which arises in one vīthi, one javana, and one samāpatti, is present. That which is before it is past, and that which is after it is future. For matter arisen from kamma, there is no distinct division into past, etc., by way of continuity. However, its state of being past, etc., should be understood by way of supporting matter arisen from season, food, and mind.
Sắc do tâm sinh (cittaja) phát sinh trong cùng một lộ trình (vīthi), cùng một sát-na tốc hành (javana), cùng một sự nhập định (samāpatti) là hiện tại; sắc trước đó là quá khứ; sắc sau đó là vị lai. Đối với sắc do nghiệp sinh (kammaja), không có sự phân biệt quá khứ, v.v., theo dòng chảy riêng biệt; nhưng trạng thái quá khứ, v.v., của nó cần được hiểu theo cách nó hỗ trợ các sắc do nhiệt độ, thực phẩm và tâm sinh.
Samayavasena ekamuhuttapubbaṇhasāyanharattindivādīsu samayesu santānavasena pavattamānaṃ taṃ taṃ samayaṃ paccuppannaṃ nāma, tato pubbe atītaṃ, pacchā anāgataṃ.
By way of time, whatever matter occurs continuously in times such as one muhutta, forenoon, evening, day, and night, that matter existing at that particular time is called present. That which is before it is past, and that which is after it is future.
Theo giai đoạn (samaya), sắc đang hiện hữu theo dòng chảy trong các giai đoạn như một khoảnh khắc, buổi sáng, buổi tối, ngày và đêm, v.v., được gọi là hiện tại trong giai đoạn đó; sắc trước đó là quá khứ; sắc sau đó là vị lai.
Khaṇavasena uppādādikhaṇattayapariyāpannaṃ paccuppannaṃ, tato pubbe anāgataṃ, pacchā atītaṃ.
By way of moment, that which is included in the three moments of arising, etc., is present. That which is before it is future, and that which is after it is past.
Theo sát-na (khaṇa), sắc thuộc ba sát-na sinh, trụ, diệt là hiện tại; sắc trước đó là vị lai; sắc sau đó là quá khứ.
Apica atikkantahetupaccayakiccaṃ atītaṃ, niṭṭhitahetukiccamaniṭṭhitapaccayakiccaṃ paccuppannaṃ, ubhayakiccamasampattaṃ anāgataṃ.
Furthermore, that which has completed the function of its generative causes and conditions is past. That which has completed the function of its generative causes but has not completed the function of its supportive conditions is present. That which has not yet reached both functions is future.
Hơn nữa, sắc mà chức năng của nhân duyên đã qua là quá khứ; sắc mà chức năng của nhân duyên đã hoàn tất nhưng chức năng của duyên chưa hoàn tất là hiện tại; sắc mà cả hai chức năng đều chưa đạt được là vị lai.
Sakiccakkhaṇe vā paccuppannaṃ, tato pubbe anāgataṃ, pacchā atītaṃ.
Or, that which is in the moment of its own function is present. That which is before it is future, and that which is after it is past.
Hoặc, sắc là hiện tại trong sát-na thực hiện chức năng của nó; sắc trước đó là vị lai; sắc sau đó là quá khứ.
Ettha ca khaṇādikathāva nippariyāyā sesā sapariyāyā.
Among these, the discourse on moments, etc., is direct, while the rest are indirect.
Ở đây, lời giải thích về sát-na, v.v., là trực tiếp, còn các lời giải thích khác là gián tiếp.
1010
Ajjhattanti pañcasupi khandhesu idha niyakajjhattaṃ adhippetaṃ, tasmā attano santāne pavattaṃ pāṭipuggalikaṃ rūpaṃ ajjhattanti veditabbaṃ.
Internal refers to one's own internal rūpa among all five aggregates. Therefore, rūpa that occurs in one's own continuum, belonging to an individual, should be understood as internal.
Nội phần (ajjhatta): Trong năm uẩn, ở đây, nội phần của chính mình được đề cập. Do đó, sắc phát sinh trong dòng tương tục của chính mình, sắc cá nhân, cần được hiểu là nội phần.
Tato bahibhūtaṃ pana indriyabaddhaṃ vā anindriyabaddhaṃ vā rūpaṃ bahiddhā nāma.
However, rūpa that is external to that, whether connected to a sense faculty or not connected to a sense faculty, is called external.
Sắc nằm ngoài điều đó, dù liên quan đến căn hay không liên quan đến căn, được gọi là ngoại phần (bahiddhā).
Oḷārikanti cakkhusotaghānajivhākāyarūpasaddagandharasaphoṭṭhabbasaṅkhātā pathavītejovāyo cāti dvādasavidhaṃ rūpaṃ ghaṭṭanavasena gahetabbato oḷārikaṃ.
Gross refers to the twelve kinds of rūpa—eye, ear, nose, tongue, body, visible form, sound, smell, taste, tangible object (earth, fire, air)—which are considered gross because they are to be apprehended by way of impingement.
Thô (oḷārikaṃ): Mười hai loại sắc bao gồm sắc mắt, tai, mũi, lưỡi, thân, âm thanh, mùi, vị, xúc (đất, lửa, gió) được gọi là thô vì chúng có thể được nắm bắt thông qua sự va chạm.
Sesaṃ pana āpodhātu itthindriyaṃ purisindriyaṃ jīvitindriyaṃ hadayavatthu ojā ākāsadhātu kāyaviññatti vacīviññatti rūpassa lahutā mudutā kammaññatā upacayo santati jaratā aniccatāti soḷasavidhaṃ rūpaṃ ghaṭṭanavasena agahetabbato sukhumaṃ.
The remaining sixteen kinds of rūpa—water element, femininity, masculinity, life faculty, heart-base, nutriment, space element, bodily intimation, verbal intimation, lightness of rūpa, pliancy, adaptability, accumulation, continuity, decay, impermanence—are subtle because they are not to be apprehended by way of impingement.
Mười sáu loại sắc còn lại, bao gồm thủy đại, nữ căn, nam căn, mạng căn, ý vật, chất dinh dưỡng, không đại, thân biểu tri, ngữ biểu tri, tính nhẹ nhàng của sắc, tính mềm mại, tính thích nghi, sự tích lũy, sự liên tục, sự già nua, sự vô thường, được gọi là vi tế (sukhumaṃ) vì chúng không thể được nắm bắt thông qua sự va chạm.
Hīnaṃ vā paṇītaṃ vāti ettha hīnapaṇītabhāvo pariyāyato nippariyāyato ca.
Regarding inferior or excellent, the state of being inferior or excellent is both indirect and direct.
Trong cụm từ hạ liệt (hīnaṃ) hay thù thắng (paṇītaṃ), trạng thái hạ liệt và thù thắng có thể là gián tiếp hoặc trực tiếp.
Tattha akaniṭṭhānaṃ rūpato sudassīnaṃ rūpaṃ hīnaṃ, tadeva sudassānaṃ rūpato paṇītaṃ.
Among these, the rūpa of the Sudassī devas is inferior compared to the rūpa of the Akaniṭṭha devas. That very rūpa of the Sudassī devas is excellent compared to the rūpa of the Sudassa devas.
Trong đó, sắc của chư thiên Sudassī là hạ liệt so với sắc của chư thiên Akaniṭṭha; chính sắc của chư thiên Sudassī lại là thù thắng so với sắc của chư thiên Sudassa.
Evaṃ yāva narakasattānaṃ rūpaṃ, tāva pariyāyato hīnapaṇītatā veditabbā.
In this way, the inferiority and excellence by way of indirect meaning should be understood up to the rūpa of beings in hell.
Tương tự, trạng thái hạ liệt và thù thắng gián tiếp cần được hiểu cho đến sắc của chúng sinh địa ngục.
Nippariyāyato pana yattha akusalavipākaṃ uppajjati, taṃ hīnaṃ.
However, by direct meaning, where unwholesome vipāka arises, that is inferior.
Tuy nhiên, nói một cách trực tiếp, nơi nào quả bất thiện nghiệp sinh khởi, đó là hạ liệt.
Yattha kusalavipākaṃ, taṃ paṇītaṃ.
Where wholesome vipāka arises, that is excellent.
Nơi nào quả thiện nghiệp sinh khởi, đó là thù thắng.
Yaṃ dūre santike vāti ettha yaṃ sukhumaṃ, tadeva duppaṭivijjhasabhāvattā dūre.
Regarding that which is far or near, that which is subtle is far because its nature is difficult to penetrate.
Trong cụm từ xa (dūre) hay gần (santike), sắc nào vi tế thì chính nó là xa vì bản chất khó thấu hiểu.
Yaṃ oḷārikaṃ, tadeva suppaṭivijjhasabhāvattā santike.
That which is gross is near because its nature is easy to penetrate.
Sắc nào thô thì chính nó là gần vì bản chất dễ thấu hiểu.
1011
Sabbaṃ rūpaṃ aniccato vavattheti ekaṃ sammasanaṃ, dukkhato vavattheti ekaṃ sammasanaṃ, anattato vavattheti ekaṃ sammasananti ettha ayaṃ bhikkhu ‘‘yaṃ kiñci rūpa’’nti evaṃ aniyamaniddiṭṭhaṃ sabbampi rūpaṃ atītattikena ceva catūhi ajjhattādidukehi cāti ekādasahi okāsehi paricchinditvā sabbaṃ rūpaṃ aniccato vavattheti aniccanti sammasati.
In this phrase: He comprehends all rūpa as impermanent, this is one comprehension; he comprehends it as suffering, this is one comprehension; he comprehends it as not-self, this is one comprehension, this bhikkhu, having delimited all rūpa—which is indicated without restriction as "whatever rūpa"—by the past triad and the four dyads of internal, etc., in eleven ways, comprehends all rūpa as impermanent, that is, he contemplates it as impermanent.
Trong cụm từ "quán sát tất cả sắc là vô thường là một sự quán sát, quán sát là khổ là một sự quán sát, quán sát là vô ngã là một sự quán sát", vị tỳ-khưu này phân loại tất cả sắc, đã được xác định không giới hạn bằng cách nói "bất cứ sắc nào", thành mười một trường hợp: ba thời (quá khứ, vị lai, hiện tại) và bốn cặp nội phần/ngoại phần, thô/vi tế, hạ liệt/thù thắng, xa/gần, và quán sát tất cả sắc là vô thường, tức là quán sát là vô thường.
Kathaṃ?
How?
Bằng cách nào?
Parato vuttanayena.
In the manner stated later.
Theo phương pháp đã nói ở sau.
Vuttañhetaṃ – ‘‘rūpaṃ atītānāgatapaccuppannaṃ aniccaṃ khayaṭṭhenā’’ti (paṭi. ma. 1.48).
For it has been said: "Past, future, and present rūpa is impermanent in the sense of perishing."
Điều này đã được nói: "Sắc quá khứ, vị lai, hiện tại là vô thường theo nghĩa hoại diệt."
Tasmā esa yaṃ atītaṃ rūpaṃ, taṃ yasmā atīteyeva khīṇaṃ, nayimaṃ bhavaṃ sampattanti aniccaṃ khayaṭṭhena, yaṃ anāgataṃ rūpaṃ anantarabhave nibbattissati, tampi tattheva khīyissati, na tato paraṃ bhavaṃ gamissatīti aniccaṃ khayaṭṭhena, yaṃ paccuppannaṃ rūpaṃ, taṃ idheva khīyati, na ito gacchatīti aniccaṃ khayaṭṭhena, yaṃ ajjhattaṃ rūpaṃ, tampi ajjhattameva khīyati, na bahiddhābhāvaṃ gacchatīti aniccaṃ khayaṭṭhena, yaṃ bahiddhā oḷārikaṃ sukhumaṃ hīnaṃ paṇītaṃ dūre santike, tampi ettheva khīyati, na dūrabhāvaṃ gacchatīti aniccaṃ khayaṭṭhenāti sammasati.
Therefore, this bhikkhu reflects: "Whatever past form there is, since that form ceased in the past and did not reach this existence, it is impermanent in the sense of destruction. Whatever future form will arise in the next existence, that too will cease right there and will not go to any existence beyond that; thus it is impermanent in the sense of destruction. Whatever present form there is, that ceases right here and does not go from here; thus it is impermanent in the sense of destruction. Whatever internal form there is, that too ceases right within and does not go to an external state; thus it is impermanent in the sense of destruction. Whatever external, gross, subtle, inferior, excellent, far, or near form there is, that too ceases right here and does not go to a distant state; thus it is impermanent in the sense of destruction."
Do đó, vị ấy quán sát rằng: sắc quá khứ, vì nó đã hoại diệt trong quá khứ và không đến kiếp này, nên là vô thường theo nghĩa hoại diệt; sắc vị lai, sẽ sinh khởi trong kiếp kế tiếp, cũng sẽ hoại diệt ở đó và không đi đến kiếp sau, nên là vô thường theo nghĩa hoại diệt; sắc hiện tại, vì nó hoại diệt ngay tại đây và không đi đâu khác, nên là vô thường theo nghĩa hoại diệt; sắc nội phần, vì nó hoại diệt ngay trong nội phần và không đi đến trạng thái ngoại phần, nên là vô thường theo nghĩa hoại diệt; sắc ngoại phần, thô, vi tế, hạ liệt, thù thắng, xa, gần, vì nó hoại diệt ngay tại đây và không đi đến trạng thái xa, nên là vô thường theo nghĩa hoại diệt.
Idaṃ sabbampi ‘‘aniccaṃ khayaṭṭhenā’’ti etassa vasena ekaṃ sammasanaṃ, pabhedato pana ekādasavidhaṃ hoti.
All of this, in terms of "impermanent in the sense of destruction," constitutes one reflection, but in terms of its divisions, it is elevenfold.
Tất cả những điều này là một sự quán sát theo nghĩa "vô thường theo nghĩa hoại diệt", nhưng theo phân loại thì có mười một loại.
1012
Sabbameva cetaṃ dukkhaṃ bhayaṭṭhenāti sammasati.
And all of this is suffering in the sense of fear, thus he reflects.
Và vị ấy quán sát tất cả những điều này là khổ theo nghĩa đáng sợ.
Bhayaṭṭhenāti sappaṭibhayatāya.
"In the sense of fear" means due to being fraught with danger.
Theo nghĩa đáng sợ (bhayaṭṭhenā): vì có sự đáng sợ.
Yañhi aniccaṃ, taṃ bhayāvahaṃ hoti sīhopamasutte (a. ni. 4.33; saṃ. ni. 3.78) devānaṃ viya.
For that which is impermanent is fearful, like for the devas in the Lion Simile Sutta.
Thật vậy, cái gì vô thường thì đáng sợ, như đối với chư thiên trong kinh Sīhopama.
Iti idampi ‘‘dukkhaṃ bhayaṭṭhenā’’ti etassa vasena ekaṃ sammasanaṃ, pabhedato pana ekādasavidhaṃ hoti.
Thus, this too, in terms of "suffering in the sense of fear," constitutes one reflection, but in terms of its divisions, it is elevenfold.
Như vậy, điều này cũng là một sự quán sát theo nghĩa "khổ theo nghĩa đáng sợ", nhưng theo phân loại thì có mười một loại.
1013
Yathā ca dukkhaṃ, evaṃ sabbampi taṃ anattā asārakaṭṭhenāti sammasati.
And just as it is suffering, so too all of it is non-self in the sense of being essenceless, thus he reflects.
Và cũng như khổ, vị ấy quán sát tất cả những điều đó là vô ngã theo nghĩa không có cốt lõi.
Asārakaṭṭhenāti ‘‘attā nivāsī kārako vedako sayaṃvasī’’ti evaṃ parikappitassa attasārassa abhāvena.
"In the sense of being essenceless" means due to the absence of a self-essence conceived as "the self dwells, acts, experiences, and is self-governing."
Theo nghĩa không có cốt lõi (asārakaṭṭhenā): vì không có cái cốt lõi là ngã, được tưởng tượng là "ngã là người cư ngụ, người tạo tác, người cảm nhận, người tự chủ".
Yañhi aniccaṃ dukkhaṃ, attanopi aniccataṃ vā udayabbayapīḷanaṃ vā vāretuṃ na sakkoti, kuto tassa kārakādibhāvo.
For that which is impermanent and suffering cannot prevent its own impermanence or the oppression of its arising and passing away; how could it be an agent or the like?
Thật vậy, cái gì vô thường và khổ thì không thể ngăn cản sự vô thường hay sự bức bách của sinh diệt ngay cả đối với chính nó; làm sao nó có thể là người tạo tác, v.v.?
Tenāha – ‘‘rūpañca hidaṃ, bhikkhave, attā abhavissa, nayidaṃ rūpaṃ ābādhāya saṃvatteyyā’’tiādi (saṃ. ni. 3.59).
Therefore, it is said: "If, bhikkhus, this form were self, then this form would not lead to affliction," and so on.
Vì thế, Ngài đã nói: "Này các Tỳ-khưu, nếu sắc này là ngã, thì sắc này sẽ không dẫn đến bệnh tật", v.v.
Iti idaṃ ‘‘anattā asārakaṭṭhenā’’ti etassa vasena ekaṃ sammasanaṃ, pabhedato pana ekādasavidhaṃ hoti.
Thus, this "non-self in the sense of being essenceless" constitutes one reflection, but in terms of its divisions, it is elevenfold.
Như vậy, đây là một sự thẩm sát (sammasana) theo nghĩa “vô ngã vì không có cốt lõi”, còn về mặt phân loại thì có mười một loại.
Eseva nayo vedanādīsu.
The same method applies to feeling and the other aggregates.
Phương pháp này cũng tương tự đối với thọ v.v...
Iti ekekasmiṃ khandhe ekādasa ekādasa katvā pañcasu khandhesu pañcapaññāsa sammasanāni honti, aniccato pañcapaññāsa, dukkhato pañcapaññāsa, anattato pañcapaññāsāti tividhānupassanāvasena sabbāni pañcasaṭṭhisatasammasanāni honti.
Thus, making eleven reflections for each aggregate, there are fifty-five reflections in the five aggregates; fifty-five from the perspective of impermanence, fifty-five from the perspective of suffering, and fifty-five from the perspective of non-self, making a total of one hundred sixty-five reflections by way of the three contemplations.
Như vậy, tính mười một thẩm sát trong mỗi uẩn, thì trong năm uẩn có năm mươi lăm thẩm sát. Về phương diện vô thường có năm mươi lăm, về phương diện khổ có năm mươi lăm, về phương diện vô ngã có năm mươi lăm, như vậy theo ba loại tùy quán thì có tất cả một trăm sáu mươi lăm thẩm sát.
1014
Keci pana ‘‘sabbaṃ rūpaṃ, sabbaṃ vedanaṃ, sabbaṃ saññaṃ, sabbe saṅkhāre, sabbaṃ viññāṇanti padampi pakkhipitvā ekekasmiṃ khandhe dvādasa dvādasa katvā pañcasu saṭṭhi, anupassanāto asītisatasammasanānī’’ti vadanti.
Some, however, say that by adding the phrases "all form, all feeling, all perception, all mental formations, all consciousness," and making twelve for each aggregate, there are sixty in the five aggregates, and one hundred eighty reflections by way of contemplation.
Tuy nhiên, một số vị nói rằng: “Thêm vào các từ ‘tất cả sắc, tất cả thọ, tất cả tưởng, tất cả hành, tất cả thức’, tính mười hai thẩm sát trong mỗi uẩn, thì trong năm uẩn có sáu mươi, và theo tùy quán thì có một trăm tám mươi thẩm sát.”
1015
Atītādivibhāge panettha santativasena khaṇādivasena ca vedanāya atītānāgatapaccuppannabhāvo veditabbo.
In this division of past, etc., the past, future, and present nature of feeling should be understood in terms of continuity and in terms of moments, etc.
Ở đây, trong sự phân chia quá khứ v.v..., nên hiểu trạng thái quá khứ, vị lai và hiện tại của thọ theo phương diện dòng tương tục và theo phương diện sát-na v.v...
Tattha santativasena ekavīthiekajavanaekasamāpattipariyāpannā ekavidhavisayasamāyogappavattā ca paccuppannā, tato pubbe atītā, pacchā anāgatā.
Among these, in terms of continuity, feeling that falls within one thought-process, one javana, one attainment, and arises through the conjunction of a single type of object, is present; that which was before it is past, and that which will be after it is future.
Trong đó, theo phương diện dòng tương tục, thọ thuộc về một lộ trình tâm, một tốc hành tâm, một định, và thọ diễn tiến do sự kết hợp với một loại đối tượng duy nhất là hiện tại; trước đó là quá khứ, sau đó là vị lai.
Khaṇādivasena khaṇattayapariyāpannā pubbantāparantamajjhagatā sakiccañca kurumānā vedanā paccuppannā, tato pubbe atītā, pacchā anāgatā.
In terms of moments, etc., feeling that falls within the three moments (arising, existing, ceasing), that is at the beginning, end, or middle, and is performing its function, is present; that which was before it is past, and that which will be after it is future.
Theo phương diện sát-na v.v..., thọ bao gồm trong ba sát-na, nằm ở điểm đầu, điểm cuối và ở giữa, và đang thực hiện chức năng của mình là hiện tại; trước đó là quá khứ, sau đó là vị lai.
Ajjhattabahiddhābhedo niyakajjhattavaseneva veditabbo.
The distinction between internal and external should be understood solely in terms of one's own internal (experience).
Sự phân biệt nội và ngoại nên được hiểu chỉ theo phương diện nội phần của chính mình.
1016
Oḷārikasukhumabhāvo ‘‘akusalā vedanā oḷārikā, kusalābyākatā vedanā sukhumā’’tiādinā (vibha. 4) nayena vibhaṅge vuttena jātisabhāvapuggalalokiyalokuttaravasena veditabbo.
The state of being gross or subtle should be understood according to the method stated in the Vibhaṅga, such as "unwholesome feelings are gross, wholesome and indeterminate feelings are subtle," and so on, by way of genus, nature, person, mundane, and supramundane.
Trạng thái thô và tế nên được hiểu theo các phương diện chủng loại, bản chất, cá nhân, thế gian và siêu thế, theo phương pháp đã được nói trong bộ Phân Tích (Vibhaṅga) bằng cách thức như: “Thọ bất thiện là thô, thọ thiện và vô ký là tế” v.v...
Jātivasena tāva akusalā vedanā sāvajjakiriyahetuto, kilesasantāpabhāvato ca avūpasantavuttīti kusalavedanāya oḷārikā, sabyāpārato saussāhato savipākato kilesasantāpabhāvato sāvajjato ca vipākābyākatāya oḷārikā, savipākato kilesasantāpabhāvato sabyābajjhato sāvajjato ca kiriyābyākatāya oḷārikā.
First, by way of genus: unwholesome feeling is grosser than wholesome feeling because it is the cause of blameworthy actions and due to its nature of tormenting defilements, its activity is unsettled. It is grosser than resultant indeterminate feeling due to its being accompanied by exertion, effort, and result, due to its nature of tormenting defilements, and due to its blameworthiness. It is grosser than functional indeterminate feeling due to its being accompanied by result, due to its nature of tormenting defilements, due to its being accompanied by affliction, and due to its blameworthiness.
Trước hết, theo phương diện chủng loại, thọ bất thiện là thô hơn thọ thiện vì là nguyên nhân của hành vi có tội lỗi và vì có sự thiêu đốt của phiền não, nên có sự vận hành không an tịnh. Nó thô hơn thọ quả vô ký vì có sự nỗ lực, có sự cố gắng, có quả báo, có sự thiêu đốt của phiền não và có tội lỗi. Nó thô hơn thọ duy tác vô ký vì có quả báo, có sự thiêu đốt của phiền não, có sự khổ não và có tội lỗi.
Kusalābyākatā pana vuttavipariyāyato akusalāya vedanāya sukhumā.
Wholesome and indeterminate feelings, however, are subtle compared to unwholesome feeling, by reason of the opposite of what has been stated.
Còn thọ thiện và vô ký thì tế hơn thọ bất thiện do ngược lại với những gì đã nói.
Dvepi kusalākusalā vedanā sabyāpārato saussāhato savipākato ca yathāyogaṃ duvidhāyapi abyākatāya oḷārikā, vuttavipariyāyena duvidhāpi abyākatā tāhi sukhumā.
Both wholesome and unwholesome feelings are, appropriately, gross compared to the two kinds of indeterminate (abyākatā) feelings due to being accompanied by exertion, effort, and having results; and conversely, both kinds of indeterminate feelings are subtle compared to those*.
Cả hai thọ thiện và bất thiện, do có sự nỗ lực, có sự cố gắng và có quả báo, tùy theo trường hợp, đều thô hơn cả hai loại thọ vô ký. Ngược lại, cả hai loại thọ vô ký đều tế hơn chúng.
Evaṃ tāva jātivasena oḷārikasukhumatā veditabbā.
Thus, first of all, grossness and subtlety should be understood by way of origin.
Như vậy, trước hết, nên hiểu tính thô và tế theo phương diện chủng loại.
1017
Sabhāvavasena pana dukkhā vedanā nirassādato savipphārato khobhakaraṇato ubbejanīyato abhibhavanato ca itarāhi dvīhi oḷārikā, itarā pana dve sātato santato paṇītato manāpato majjhattato ca yathāyogaṃ dukkhāya sukhumā.
However, by way of characteristic, painful feeling is gross compared to the other two* due to being without enjoyment, accompanied by agitation, causing disturbance, being vexing, and overwhelming; while the other two*, pleasant and neutral, are appropriately subtle compared to painful feeling due to being pleasant, tranquil, refined, agreeable, and indifferent.
Theo phương diện bản chất, khổ thọ, do không có vị ngọt, có sự dao động, gây ra sự xáo trộn, khó chịu đựng và có tính áp đảo, nên thô hơn hai thọ còn lại. Còn hai thọ kia, do có sự dễ chịu, an tịnh, cao thượng, khả ái và trung tính, tùy theo trường hợp, nên tế hơn khổ thọ.
Ubho pana sukhadukkhā savipphārato ubbejanīyato khobhakaraṇato pākaṭato ca adukkhamasukhāya oḷārikā, sā vuttavipariyāyena tadubhayato sukhumā.
But both pleasant and painful feelings are gross compared to neither-painful-nor-pleasant feeling due to being accompanied by agitation, being vexing, causing disturbance, and being manifest; that* is subtle compared to both of those, by way of the converse of what was stated.
Cả lạc thọ và khổ thọ, do có sự dao động, khó chịu đựng, gây ra sự xáo trộn và rõ ràng, nên thô hơn thọ không khổ không lạc. Thọ ấy, do ngược lại với những gì đã nói, nên tế hơn cả hai thọ kia.
Evaṃ sabhāvavasena oḷārikasukhumatā veditabbā.
Thus, grossness and subtlety should be understood by way of characteristic.
Như vậy, nên hiểu tính thô và tế theo phương diện bản chất.
1018
Puggalavasena pana asamāpannassa vedanā nānārammaṇe vikkhittabhāvato samāpannassa vedanāya oḷārikā, vipariyāyena itarā sukhumā.
However, by way of individual, the feeling of one who has not attained jhāna is gross compared to the feeling of one who has attained jhāna, due to being scattered among various objects; conversely, the other* is subtle.
Theo phương diện cá nhân, thọ của người không nhập định, do có sự phân tán trong các đối tượng khác nhau, nên thô hơn thọ của người nhập định. Ngược lại, thọ kia là tế.
Evaṃ puggalavasena oḷārikasukhumatā veditabbā.
Thus, grossness and subtlety should be understood by way of individual.
Như vậy, nên hiểu tính thô và tế theo phương diện cá nhân.
1019
Lokiyalokuttaravasena pana sāsavā vedanā lokiyā, sā āsavuppattihetuto oghaniyato yoganiyato ganthaniyato nīvaraṇiyato upādāniyato saṃkilesikato puthujjanasādhāraṇato ca anāsavāya oḷārikā, anāsavā ca vipariyāyena sāsavāya sukhumā.
However, by way of mundane and supramundane, feeling accompanied by taints (sāsavā vedanā) is mundane (lokiyā); that* is gross compared to untainted (anāsavā) feeling due to being a cause for the arising of taints, being bound by the floods (ogha), bound by the yokes (yoga), bound by the ties (gantha), bound by the hindrances (nīvaraṇa), subject to clinging (upādāna), defiling (saṃkilesika), and common to ordinary people (puthujjana); and untainted feeling is, conversely, subtle compared to tainted feeling.
Theo phương diện thế gian và siêu thế, thọ hữu lậu là thuộc thế gian. Thọ ấy, do là nguyên nhân phát sinh các lậu hoặc, là đối tượng của bộc lưu, của ách phược, của triền phược, của triền cái, của thủ, có tính ô nhiễm và chung cho phàm phu, nên thô hơn thọ vô lậu. Còn thọ vô lậu, do ngược lại, nên tế hơn thọ hữu lậu.
Evaṃ lokiyalokuttaravasena oḷārikasukhumatā veditabbā.
Thus, grossness and subtlety should be understood by way of mundane and supramundane.
Như vậy, nên hiểu tính thô và tế theo phương diện thế gian và siêu thế.
1020
Tattha jātiādivasena sambhedo pariharitabbo.
Here, the intermingling by way of origin and so on should be avoided.
Trong đó, cần tránh sự pha trộn theo các phương diện chủng loại v.v...
Akusalavipākakāyaviññāṇasampayuttā hi vedanā jātivasena abyākatattā sukhumāpi samānā sabhāvādivasena oḷārikā hoti.
For a feeling associated with unwholesome resultant body-consciousness, although subtle by way of origin due to being indeterminate, is gross by way of characteristic and so on.
Vì thọ tương ưng với thân thức quả bất thiện, mặc dù tế theo phương diện chủng loại vì là vô ký, nhưng lại là thô theo phương diện bản chất v.v...
Vuttañhetaṃ –
For it has been said:
Điều này đã được nói:
1021
‘‘Abyākatā vedanā sukhumā, dukkhā vedanā oḷārikā.
“Indeterminate feeling is subtle; painful feeling is gross.
“Thọ vô ký là tế, khổ thọ là thô.
Samāpannassa vedanā sukhumā, asamāpannassa vedanā oḷārikā.
The feeling of one who has attained jhāna is subtle; the feeling of one who has not attained jhāna is gross.
Thọ của người nhập định là tế, thọ của người không nhập định là thô.
Anāsavā vedanā sukhumā, sāsavā vedanā oḷārikā’’ti (vibha. 11).
Untainted feeling is subtle; tainted feeling is gross.”
Thọ vô lậu là tế, thọ hữu lậu là thô”.
1022
Yathā ca dukkhā vedanā, evaṃ sukhādayopi.
And just as with painful feeling, so too with pleasant feeling and so on.
Và như khổ thọ, các thọ khác như lạc thọ v.v... cũng vậy.
Tāpi hi jātivasena oḷārikā, sabhāvādivasena sukhumā honti.
For these too are gross by way of origin, but subtle by way of characteristic and so on.
Bởi vì chúng cũng thô theo phương diện chủng loại, nhưng lại tế theo phương diện bản chất v.v...
Tasmā yathā jātiādivasena sambhedo na hoti, tathā vedanānaṃ oḷārikasukhumatā veditabbā.
Therefore, the grossness and subtlety of feelings should be understood so that there is no intermingling by way of origin and so on.
Vì vậy, nên hiểu tính thô và tế của các thọ theo cách mà không có sự pha trộn theo các phương diện chủng loại v.v...
Seyyathidaṃ, abyākatā jātivasena kusalākusalāhi sukhumā.
For example, indeterminate feeling is subtle compared to wholesome and unwholesome feelings by way of origin.
Ví dụ như sau: thọ vô ký, theo phương diện chủng loại, thì tế hơn thọ thiện và bất thiện.
Tattha katamā abyākatā?
Among these, which is indeterminate?
Trong đó, thọ vô ký nào?
Kiṃ dukkhā?
Is it painful?
Là khổ thọ chăng?
Kiṃ sukhā?
Is it pleasant?
Là lạc thọ chăng?
Kiṃ samāpannassa?
Is it of one who has attained jhāna?
Là của người nhập định chăng?
Kiṃ asamāpannassa?
Is it of one who has not attained jhāna?
Là của người không nhập định chăng?
Kiṃ sāsavā?
Is it tainted?
Là hữu lậu chăng?
Kiṃ anāsavāti?
Is it untainted?
Là vô lậu chăng?
Evaṃ sabhāvādibhedo na parāmasitabbo.
Thus, the distinction by way of characteristic and so on should not be considered.
Không nên xem xét sự phân biệt theo bản chất v.v... như vậy.
Esa nayo sabbattha.
This method applies everywhere.
Phương pháp này áp dụng cho tất cả các trường hợp.
1023
Apica ‘‘taṃ taṃ vā pana vedanaṃ upādāyupādāya vedanā oḷārikā sukhumā daṭṭhabbā’’ti vacanato akusalādīsupi lobhasahagatāya dosasahagatā vedanā aggi viya nissayadahanato oḷārikā, lobhasahagatā sukhumā.
Furthermore, according to the statement, “feelings should be seen as gross or subtle depending on each particular feeling,” even among unwholesome feelings and so on, feeling associated with hatred (dosa) is gross compared to feeling associated with greed (lobha), like fire, due to burning its support; feeling associated with greed is subtle.
Hơn nữa, theo lời dạy: “Hoặc nên thấy thọ là thô hay tế tùy thuộc vào từng thọ tương ứng”, ngay cả trong các thọ bất thiện v.v..., thọ đi kèm với sân thô hơn thọ đi kèm với tham, vì nó thiêu đốt nơi nương tựa như lửa; thọ đi kèm với tham thì tế hơn.
Dosasahagatāpi niyatā oḷārikā, aniyatā sukhumā.
Feeling associated with hatred, if determinate, is gross; if indeterminate, it is subtle.
Ngay cả thọ đi kèm với sân, thọ nhất định (niyata) thì thô, thọ không nhất định (aniyata) thì tế.
Niyatāpi kappaṭṭhitikā oḷārikā, itarā sukhumā.
If determinate, and lasting for an eon, it is gross; otherwise, it is subtle.
Ngay cả thọ nhất định, thọ kéo dài một kiếp thì thô, thọ còn lại thì tế.
Kappaṭṭhitikāsupi asaṅkhārikā oḷārikā, itarā sukhumā.
Even among those lasting for an eon, if unprompted, it is gross; otherwise, it is subtle.
Ngay cả trong các thọ kéo dài một kiếp, thọ không cần xúi giục (asaṅkhārika) thì thô, thọ còn lại thì tế.
Lobhasahagatā pana diṭṭhisampayuttā oḷārikā, itarā sukhumā.
However, feeling associated with greed, if accompanied by wrong view, is gross; otherwise, it is subtle.
Còn thọ đi kèm với tham, thọ tương ưng với tà kiến thì thô, thọ còn lại thì tế.
Sāpi niyatā kappaṭṭhitikā asaṅkhārikā oḷārikā, itarā sukhumā.
That too, if determinate, lasting for an eon, and unprompted, is gross; otherwise, it is subtle.
Thọ ấy cũng vậy, nếu là nhất định, kéo dài một kiếp, không cần xúi giục thì thô, thọ còn lại thì tế.
Avisesena ca akusalā bahuvipākā oḷārikā, appavipākā sukhumā.
And generally, unwholesome feelings with many results are gross; those with few results are subtle.
Nói chung, thọ bất thiện có nhiều quả báo thì thô, ít quả báo thì tế.
Kusalā pana appavipākā oḷārikā, bahuvipākā sukhumā.
However, wholesome feelings with few results are gross; those with many results are subtle.
Còn thọ thiện, ít quả báo thì thô, nhiều quả báo thì tế.
1024
Apica kāmāvacarakusalā oḷārikā, rūpāvacarā sukhumā, tato arūpāvacarā, tato lokuttarā.
Furthermore, wholesome feelings of the sense-sphere are gross; those of the fine-material sphere are subtle; more subtle than those are those of the immaterial sphere; more subtle than those are the supramundane.
Hơn nữa, thọ thiện cõi Dục là thô, thọ cõi Sắc là tế; thọ cõi Vô sắc tế hơn, thọ siêu thế tế hơn nữa.
Kāmāvacarā ca dānamayā oḷārikā, sīlamayā sukhumā.
And among sense-sphere wholesome feelings, those consisting of giving are gross; those consisting of morality are subtle.
Trong cõi Dục, thọ do bố thí sanh là thô, thọ do trì giới sanh là tế.
Sīlamayāpi oḷārikā, tato bhāvanāmayā sukhumā.
Even those consisting of morality are gross; more subtle than those are those consisting of development (bhāvanā).
Thọ do trì giới sanh cũng là thô, thọ do tu thiền sanh tế hơn.
Bhāvanāmayāpi duhetukā oḷārikā, tihetukā sukhumā.
Even those consisting of development, if with two roots, are gross; if with three roots, they are subtle.
Thọ do tu thiền sanh, nếu là nhị nhân thì thô, tam nhân thì tế.
Tihetukāpi sasaṅkhārikā oḷārikā, asaṅkhārikā sukhumā.
Even those with three roots, if prompted, are gross; if unprompted, they are subtle.
Thọ tam nhân, nếu có sự xúi giục (sasaṅkhārika) thì thô, không có sự xúi giục (asaṅkhārika) thì tế.
Rūpāvacarā ca paṭhamajjhānikā oḷārikā…pe… pañcamajjhānikā sukhumāva.
And among fine-material sphere feelings, those of the first jhāna are gross...pe... those of the fifth jhāna are subtle.
Thọ cõi Sắc, thọ thuộc sơ thiền là thô... cho đến... thọ thuộc ngũ thiền thì thật tế.
Arūpāvacarā ca ākāsānañcāyatanasampayuttā oḷārikā…pe… nevasaññānāsaññāyatanasampayuttā sukhumāva.
And among immaterial sphere feelings, those associated with the sphere of infinite space are gross...pe... those associated with the sphere of neither perception nor non-perception are subtle.
Thọ cõi Vô sắc, thọ tương ưng với Không Vô Biên Xứ là thô... cho đến... thọ tương ưng với Phi Tưởng Phi Phi Tưởng Xứ thì thật tế.
Lokuttarā ca sotāpattimaggasampayuttā oḷārikā…pe… arahattamaggasampayuttā sukhumāva.
And among supramundane feelings, those associated with the path of stream-entry are gross...pe... those associated with the path of arahantship are subtle.
Thọ siêu thế, thọ tương ưng với đạo Tu-đà-hoàn là thô... cho đến... thọ tương ưng với đạo A-la-hán thì thật tế.
Esa nayo taṃtaṃbhūmivipākakiriyāvedanāsu dukkhādiasamāpannādisāsavādivasena vuttavedanāsu ca.
This method also applies to feelings of vipāka and kriya in their respective realms, and to feelings mentioned by way of dukkha, asamāpanna, sāsava, and so on.
Phương pháp này cũng áp dụng cho các thọ quả và duy tác ở các cõi tương ứng, và cho các thọ đã được nói theo phương diện khổ v.v..., không nhập định v.v..., hữu lậu v.v...
Okāsavasena vāpi niraye dukkhā oḷārikā, tiracchānayoniyaṃ sukhumā…pe… paranimmitavasavattīsu sukhumāva.
Or, by way of location, painful feeling in hell is coarse; in the animal realm, it is subtle… and in the Paranimmita-vasavattī realm, it is indeed subtle.
Hoặc theo phương diện nơi chốn, khổ thọ ở địa ngục là thô, ở loài súc sinh là tế... cho đến... ở cõi Tha Hóa Tự Tại thì thật tế.
Yathā ca dukkhā, evaṃ sukhāpi sabbattha yathānurūpaṃ yojetabbā.
And just as with painful feeling, so too should pleasurable feeling be applied everywhere appropriately.
Và như khổ thọ, lạc thọ cũng nên được áp dụng tương tự ở mọi nơi một cách thích hợp.
Vatthuvasena cāpi hīnavatthukā yā kāci vedanā oḷārikā, paṇītavatthukā sukhumā.
And also by way of basis, any feeling associated with a base of inferior kamma is coarse; any feeling associated with a refined base is subtle.
Và theo phương diện vật, bất kỳ thọ nào có vật nương hạ liệt đều là thô, có vật nương cao thượng là tế.
Hīnapaṇītabhede yā oḷārikā, sā hīnā.
In the distinction of inferior and refined, that which is coarse is inferior.
Trong sự phân biệt hạ liệt và cao thượng, thọ nào thô thì được xem là hạ liệt.
Yā ca sukhumā, sā paṇītāti daṭṭhabbā.
And that which is subtle is refined; thus it should be understood.
Và thọ nào tế thì được xem là cao thượng.
1025
Dūrasantikapade pana ‘‘akusalā vedanā kusalābyākatāhi vedanāhi dūre, akusalā vedanā akusalāya vedanāya santike’’tiādinā (vibha. 13) nayena vibhaṅge vibhattā.
In the section on distance and proximity, it is explained in the Vibhaṅga by the method, “Unwholesome feeling is distant from wholesome and indeterminate feelings; unwholesome feeling is proximate to unwholesome feeling,” and so on.
Vả lại, trong mục từ về xa và gần, đã được phân tích trong bộ Phân Tích theo phương pháp: “Thọ bất thiện thì xa với các thọ thiện và vô ký, thọ bất thiện thì gần với thọ bất thiện” v.v...
Tasmā akusalā vedanā visabhāgato asaṃsaṭṭhato asarikkhato ca kusalābyākatāhi dūre, tathā kusalābyākatā akusalāya.
Therefore, unwholesome feeling is distant from wholesome and indeterminate feelings due to being dissimilar, unmixed, and unlike; and similarly, wholesome and indeterminate feelings are distant from unwholesome feeling.
Vì vậy, thọ bất thiện do khác biệt về bản chất, do không pha trộn, và do không tương đồng nên xa với các thọ thiện và vô ký; tương tự, các thọ thiện và vô ký cũng xa với thọ bất thiện.
Esa nayo sabbavāresu.
This method applies in all cases.
Phương pháp này áp dụng cho tất cả các đoạn.
Akusalā pana vedanā sabhāgato saṃsaṭṭhato sarikkhato ca akusalāya santiketi idaṃ vedanāya atītādivibhāge vitthārakathāmukhaṃ.
However, unwholesome feeling is proximate to unwholesome feeling due to being similar, mixed, and alike. This is an introduction to the detailed explanation of feeling in terms of past, etc.
Còn thọ bất thiện do đồng nhất về bản chất, do có pha trộn, và do tương đồng nên gần với thọ bất thiện. Đây là phần mở đầu cho bài giảng chi tiết về sự phân chia thọ theo quá khứ v.v...
Taṃtaṃvedanāsampayuttānaṃ pana saññādīnampi etaṃ evameva veditabbaṃ.
And this same principle should be understood for saññā and other aggregates associated with those respective feelings.
Đối với tưởng v.v... tương ưng với từng loại thọ, cũng cần được hiểu theo cách tương tự.
1026
Ye panettha vedanādīsu cakkhu…pe… jarāmaraṇanti peyyālena saṃkhittesu ca dhammesu lokuttaradhammā āgatā, te asammasanūpagattā imasmiṃ adhikāre na gahetabbā.
Here, among the feelings and so on, and among the phenomena abbreviated by the ellipsis of eye… old age-and-death, those supramundane phenomena that are mentioned should not be taken in this context, as they are not subject to contemplation.
Ở đây, trong số các pháp như thọ v.v... và các pháp được tóm lược bằng dấu lược trong câu “mắt… cho đến… già-chết”, những pháp siêu thế nào đã được đề cập thì không nên được nắm bắt trong chủ đề này, vì chúng không thuộc đối tượng của tuệ quán sát.
Te pana kevalaṃ tena tena padena saṅgahitadhammadassanavasena ca abhiññeyyaniddese āgatanayena ca vuttā.
They are merely stated to show the phenomena encompassed by those respective terms and according to the method given in the Abhiññeyyaniddesa.
Tuy nhiên, chúng được đề cập chỉ nhằm mục đích trình bày các pháp được bao hàm bởi từng mục từ đó, và theo phương pháp đã nêu trong phần giải về các pháp cần được thắng tri.
Yepi ca sammasanūpagā, tesu ye yassa pākaṭā honti, sukhena pariggahaṃ gacchanti, tesu tena sammasanaṃ ārabhitabbaṃ.
And among those that are subject to contemplation, one should begin contemplation with those that are evident to a person and are easily grasped by them.
Ngay cả đối với những pháp thuộc đối tượng của tuệ quán sát, hành giả nên bắt đầu quán sát những pháp nào rõ ràng đối với mình và dễ dàng nắm bắt.
Jātijarāmaraṇavasena visuṃ sammasanābhāvepi jātijarāmaraṇavantesuyeva pana sammasitesu tānipi sammasitāni hontīti pariyāyena tesampi vasena sammasanaṃ vuttanti veditabbaṃ.
Even if there is no separate contemplation by way of birth, old age, and death, it should be understood that when the aggregates possessing birth, old age, and death are contemplated, these also become contemplated, and thus contemplation is said to be by way of these indirectly.
Cần phải hiểu rằng, mặc dù không có sự quán sát riêng biệt về sanh, già, chết, nhưng khi các pháp hữu sanh, hữu già, hữu tử được quán sát, thì sanh, già, chết cũng đã được quán sát. Do đó, một cách gián tiếp, sự quán sát về chúng cũng đã được nói đến.
Atītānāgatapaccuppannaṃ aniccato vavatthetītiādinā nayena atītattikasseva ca vasena sammasanassa vuttattā ajjhattādibhedaṃ anāmasitvāpi atītattikasseva vasena paricchinditvāpi aniccādito sammasanaṃ kātabbameva.
And since contemplation is stated by way of the past triad in the manner of “one determines the past, future, and present as impermanent,” etc., contemplation as impermanent, etc., must be performed by delimiting by way of the past triad alone, even without touching upon the divisions of internal, etc.
Và vì sự quán sát đã được nói đến chỉ theo bộ ba quá khứ, theo phương pháp “xác định pháp quá khứ, vị lai, hiện tại là vô thường” v.v..., nên ngay cả khi không đề cập đến sự phân chia nội phần v.v..., và ngay cả khi chỉ phân định theo bộ ba quá khứ, thì sự quán sát về vô thường v.v... vẫn phải được thực hiện.
1027
Yaṃ pana aniccaṃ, taṃ yasmā niyamato saṅkhatādibhedaṃ hoti, tenassa pariyāyadassanatthaṃ, nānākārehi vā manasikārappavattidassanatthaṃ rūpaṃ atītānāgatapaccuppannaṃ aniccaṃ saṅkhatantiādimāha.
But because that which is impermanent is necessarily of the nature of conditioned, etc., to show its various aspects, or to show the occurrence of attention in various ways, it is said: “Form, past, future, and present, is impermanent, conditioned,” etc.
Vả lại, cái gì vô thường thì nhất định có sự phân chia thành hữu vi v.v... Do đó, để trình bày các từ đồng nghĩa của nó, hoặc để trình bày sự vận hành của tác ý theo nhiều cách khác nhau, nên đã nói: “Sắc quá khứ, vị lai, hiện tại là vô thường, là hữu vi” v.v...
Tañhi hutvā abhāvaṭṭhena aniccaṃ, aniccantikatāya ādiantavantatāya vā aniccaṃ.
For it is impermanent in the sense of having come into being and then ceasing to exist, or impermanent due to not lasting for a moment, or due to having a beginning and an end.
Thật vậy, nó là vô thường theo nghĩa là không còn tồn tại sau khi đã có mặt, hoặc là vô thường do có khởi đầu và kết thúc bởi tính chất không bền vững.
Paccayehi samāgantvā katattā saṅkhataṃ.
It is conditioned because it comes together by causes.
Nó là hữu vi vì được tạo tác do các duyên hợp lại.
Paccaye paṭicca nissāya samaṃ, saha vā uppannattā paṭiccasamuppannaṃ.
It is dependently arisen because it arises equally or together by depending on and relying on causes.
Nó là duyên sinh vì nương vào, y cứ vào các duyên mà đồng thời sinh khởi, hoặc cùng sinh khởi.
Etena paccayehi katepi paccayānaṃ abyāpārataṃ dasseti.
By this, it shows the non-exertion of causes, even when things are made by them.
Qua đó, cho thấy rằng dù được các duyên tạo tác, các duyên ấy vẫn không có sự tác động chủ động.
Khayadhammanti khīyanadhammaṃ khīyanapakatikaṃ.
Subject to decay means having the nature of decaying, having the characteristic of decaying.
Có tính chất hủy hoại nghĩa là có pháp bị hủy hoại, có bản chất bị hủy hoại.
Vayadhammanti nassanadhammaṃ.
Subject to vanishing means having the nature of perishing.
Có tính chất biến hoại nghĩa là có pháp bị tiêu mất.
Nayidaṃ mandībhāvakkhayavasena khayadhammaṃ, kevalaṃ vigamanapakatikaṃ.
This is not subject to decay in the sense of diminishing, but merely having the nature of disappearing.
Pháp này không phải là có tính chất hủy hoại theo nghĩa suy yếu dần rồi hủy hoại, mà chỉ đơn thuần có bản chất tan rã.
Pahūtassa mandībhāvopi hi loke khayoti vuccati.
For in the world, the diminishing of abundance is also called decay.
Vì trong đời, sự suy yếu của cái dồi dào cũng được gọi là hủy hoại.
Virāgadhammanti nayidaṃ kuhiñci gamanavasena vayadhammaṃ, kevalaṃ sabhāvātikkamanapakatikaṃ.
Subject to dispassion means this is not subject to vanishing in the sense of going somewhere, but merely having the nature of transcending its own nature.
Có tính chất ly tham nghĩa là pháp này không phải có tính chất biến hoại theo nghĩa đi đến một nơi nào đó, mà chỉ đơn thuần có bản chất vượt qua tự tánh của nó.
‘‘Virāgo nāma jigucchanaṃ vā samatikkamo vā’’ti hi vuttaṃ.
Indeed, it is said, “Dispassion is disgust or transcendence.”
Vì đã có lời dạy rằng: “Ly tham có nghĩa là nhàm chán hoặc vượt qua”.
Nirodhadhammanti nayidaṃ sabhāvātikkamena punarāvattidhammaṃ, kevalaṃ apunarāvattinirodhena nirujjhanapakatikanti purimapurimapadassa atthavivaraṇavasena pacchimapacchimapadaṃ vuttanti veditabbaṃ.
Subject to cessation means this is not subject to returning again after transcending its nature, but merely having the nature of ceasing with a non-returning cessation. Thus, it should be understood that each succeeding term is stated as an explanation of the meaning of the preceding term.
Có tính chất đoạn diệt nghĩa là pháp này không phải là pháp quay trở lại sau khi đã vượt qua tự tánh, mà chỉ đơn thuần có bản chất bị diệt bởi sự đoạn diệt không quay trở lại. Cần phải hiểu rằng, các mục từ sau được nói đến để giải thích ý nghĩa của các mục từ trước đó.
1028
Atha vā ekabhavapariyāpannarūpabhaṅgavasena khayadhammaṃ, ekasantatipariyāpannarūpakkhayavasena vayadhammaṃ, rūpassa khaṇabhaṅgavasena virāgadhammaṃ, tiṇṇampi apunappavattivasena nirodhadhammantipi yojetabbaṃ.
Alternatively, it should be applied as: subject to decay by way of the dissolution of form belonging to one existence; subject to vanishing by way of the exhaustion of form belonging to one continuum; subject to dispassion by way of the momentary dissolution of form; and subject to cessation by way of the non-recurrence of all three.
Hoặc cũng có thể kết hợp như sau: có tính chất hủy hoại theo nghĩa là sự tan rã của sắc trong một kiếp sống; có tính chất biến hoại theo nghĩa là sự hủy hoại của sắc trong một dòng tương tục; có tính chất ly tham theo nghĩa là sự tan rã trong từng sát-na của sắc; và có tính chất đoạn diệt theo nghĩa là sự không tái diễn của cả ba loại trên.
1029
Jarāmaraṇaṃ aniccantiādīsu jarāmaraṇaṃ na aniccaṃ, aniccasabhāvānaṃ pana khandhānaṃ jarāmaraṇattā aniccaṃ nāma jātaṃ.
In phrases like “old age-and-death is impermanent,” old age-and-death is not impermanent in itself, but it is called impermanent because old age-and-death belong to the aggregates which are impermanent by nature.
Trong các câu như “Già-chết là vô thường”, già-chết tự nó không phải là vô thường, nhưng vì nó là sự già và chết của các uẩn có bản chất vô thường, nên nó được gọi là vô thường.
Saṅkhatādīsupi eseva nayo.
The same method applies to conditioned phenomena and so forth.
Đối với các pháp hữu vi v.v... cũng theo phương pháp này.
Antarapeyyāle jātiyāpi aniccāditāya eseva nayo.
In the intermediate abridged passage, the same method applies to birth (jāti) as impermanent and so forth.
Trong phần dấu lược ở giữa, tính chất vô thường v.v... của sanh cũng theo phương pháp này.
1030
Jātipaccayā jarāmaraṇantiādi na vipassanāvasena vuttaṃ, kevalaṃ paṭiccasamuppādassa ekekaaṅgavasena saṅkhipitvā vavatthānato sammasanañāṇaṃ nāma hotīti pariyāyena vuttaṃ.
The phrase ‘With birth as condition, there is old age and death’ and so forth, is not stated in terms of vipassanā. It is merely stated by way of analogy that the discernment of individual factors of dependent origination, when summarized and analyzed, is called sammasanañāṇa.
Câu “Do sanh làm duyên, có già-chết” v.v... không được nói theo khía cạnh của tuệ quán, mà chỉ được nói một cách gián tiếp rằng, do sự xác định bằng cách tóm lược theo từng chi phần của lý duyên khởi, nên được gọi là tuệ quán sát.
Na panetaṃ kalāpasammasanañāṇaṃ dhammaṭṭhitiñāṇameva taṃ hotīti.
However, this is not kalāpasammasanañāṇa; it is indeed dhammaṭṭhitiñāṇa.
Nhưng đây không phải là tuệ quán sát theo nhóm, mà nó chính là tuệ biết rõ trạng thái của các pháp.
Asati jātiyāti liṅgavipallāso kato, asatiyā jātiyāti vuttaṃ hoti.
In ‘asati jātiyā’, a gender inversion has been made; it means ‘asatiyā jātiyā’ (when birth is not).
Trong câu “Asati jātiyā”, có sự thay đổi về giới tính của từ, ý muốn nói là “asatiyā jātiyā”.
Asati saṅkhāresūti vacanavipallāso kato, asantesu saṅkhāresūti vuttaṃ hoti.
In ‘asati saṅkhāresu’, a number inversion has been made; it means ‘asantesu saṅkhāresu’ (when volitional formations are not).
Trong câu “Asati saṅkhāresu”, có sự thay đổi về số của từ, ý muốn nói là “asantesu saṅkhāresu”.
Bhavapaccayā jāti, asatītiādi ‘‘bhavapaccayā jāti, asati bhave natthi jātī’’tiādinā nayena yojetabbaṃ.
‘With existence as condition, there is birth; when there is no existence’ and so forth, should be connected in the manner of ‘‘bhavapaccayā jāti, asati bhave natthi jātī’’ (with existence as condition, there is birth; when there is no existence, there is no birth).
Câu “Do hữu làm duyên, có sanh; khi không có...” v.v... cần được kết hợp theo phương pháp: “Do hữu làm duyên, có sanh; khi không có hữu, không có sanh” v.v...
1031
Sammasanañāṇaniddesavaṇṇanā niṭṭhitā.
The explanation of the Exposition on Sammasanañāṇa is concluded.
Phần Chú giải về Trình bày Tuệ Quán sát đã hoàn tất.
1032

6. Udayabbayañāṇaniddesavaṇṇanā

6. Exposition on Udayabbayañāṇa

6. Chú giải về Trình bày Tuệ Sanh Diệt

1033
49. Idāni anantaraṃ vuttassa sammasanañāṇassa nānānayehi bhāvanāthirakaraṇena pāraṃ gantvā ṭhitena aniccādito diṭṭhe saṅkhāre udayabbayena paricchinditvā aniccādito vipassanatthaṃ vuttassa udayabbayānupassanāñāṇassa niddese jātaṃ rūpantiādīsu santativasena yathāsakaṃ paccayehi nibbattaṃ rūpaṃ.
49. Now, in the exposition of udayabbayānupassanāñāṇa, which is stated for the purpose of discerning conditioned phenomena, seen as impermanent and so forth, by perceiving their arising and passing away, after having gone beyond (to the other shore) and firmly established the previously mentioned sammasanañāṇa through various methods, in phrases like ‘jātaṃ rūpaṃ’ (arisen matter), ‘rūpaṃ’ (matter) means matter that has arisen through its respective conditions in terms of continuity.
49. Bây giờ, trong phần trình bày về tuệ tùy quán sanh diệt, được nói đến để quán chiếu vô thường v.v... sau khi đã phân định các pháp hành đã được thấy là vô thường v.v... bằng tuệ sanh diệt, bởi người đã đạt đến bờ kia qua việc tu tập và củng cố tuệ quán sát đã được nói đến ngay trước đó theo nhiều phương pháp, trong các câu như “sắc đã sanh” v.v..., sắc được tạo ra bởi các duyên tương ứng của nó theo dòng tương tục.
Tassa jātassa rūpassa nibbattilakkhaṇaṃ jātiṃ uppādaṃ abhinavākāraṃ udayoti, vipariṇāmalakkhaṇaṃ khayaṃ bhaṅgaṃ vayoti, anupassanā punappunaṃ nisāmanā, udayabbaya anupassanāñāṇanti attho.
Udaya (arising) refers to the characteristic of origination of that arisen matter, its birth, its moment of arising, its new appearance. Vaya (passing away) refers to the characteristic of change, its perishing, its dissolution. Anupassanā means repeated observation. This is the meaning of udayabbayānupassanāñāṇa.
Trạng thái phát sinh, tức là sự sanh, sự khởi lên, hình thái mới mẻ của sắc đã sanh ấy, được gọi là sanh; trạng thái biến đổi, tức là sự hủy hoại, sự tan rã, được gọi là diệt; tùy quán là sự quán sát lặp đi lặp lại; ý nghĩa là tuệ tùy quán sanh diệt.
Vedanādīsupi eseva nayo.
The same method applies to feeling (vedanā) and so forth.
Đối với thọ v.v... cũng theo phương pháp này.
Jātijarāmaraṇavantānaṃyeva udayabbayassa pariggahetabbattā jātijarāmaraṇānaṃ udayabbayābhāvato jātijarāmaraṇaṃ anāmasitvā jātaṃ cakkhu…pe… jāto bhavoti peyyālaṃ kataṃ.
Since the arising and passing away of only those phenomena that possess birth, old age, and death are to be comprehended, and since birth, old age, and death themselves do not have arising and passing away, the abridged passage ‘jātaṃ cakkhu…pe… jāto bhavo’ (the eye has arisen…etc…existence has arisen) has been made without touching upon birth, old age, and death.
Vì chỉ có sự sanh diệt của các pháp hữu sanh, hữu già, hữu tử mới cần được nắm bắt, và vì sanh, già, chết không có sanh diệt, nên đã không đề cập đến sanh, già, chết mà dùng dấu lược: “mắt đã sanh… cho đến… hữu đã sanh”.
So evaṃ pañcannaṃ khandhānaṃ udayabbayaṃ passanto evaṃ jānāti ‘‘imesaṃ khandhānaṃ uppattito pubbe anuppannānaṃ rāsi vā nicayo vā natthi, uppajjamānānampi rāsito vā nicayato vā āgamanaṃ nāma natthi, nirujjhamānānampi disāvidisāgamanaṃ nāma natthi, niruddhānampi ekasmiṃ ṭhāne rāsito nicayato nidhānato avaṭṭhānaṃ nāma natthi.
One who thus perceives the arising and passing away of the five aggregates understands as follows: “Before the arising of these aggregates, there is no accumulation or collection of unarisen aggregates. There is no coming from an accumulation or collection for those that are arising. There is no going to directions or intermediate directions for those that are ceasing. There is no standing in one place as an accumulation, collection, or store for those that have ceased.
Người ấy, khi thấy sự sanh diệt của năm uẩn như vậy, biết rằng: “Trước khi các uẩn này sinh khởi, không có một khối hay một tập hợp nào của chúng chưa sinh; khi chúng đang sinh, cũng không có sự đến từ một khối hay một tập hợp nào; khi chúng đang diệt, cũng không có sự đi đến phương này hay phương khác; và sau khi đã diệt, cũng không có sự tồn tại ở một nơi nào đó dưới dạng một khối, một tập hợp hay một kho chứa.
Yathā pana vīṇāya vādiyamānāya uppannassa saddassa neva uppattito pubbe sannicayo atthi, na uppajjamāno sannicayato āgato, na nirujjhamānassa disāvidisāgamanaṃ atthi, na niruddho katthaci sannicito tiṭṭhati, atha kho vīṇañca upavīṇañca purisassa ca tajjaṃ vāyāmaṃ paṭicca ahutvā sambhoti, hutvā paṭiveti, evaṃ sabbepi rūpārūpino dhammā ahutvā sambhonti, hutvā paṭiventī’’ti.
Just as, when a lute is being played, there is no prior accumulation of the sound that arises, nor does the arising sound come from an accumulation, nor does the ceasing sound go to any direction or intermediate direction, nor does the ceased sound remain accumulated anywhere; rather, dependent on the lute, the plectrum (or fingers), and the corresponding effort of the person, it comes into being without having been, and having been, it ceases. In the same way, all phenomena, both material and immaterial, come into being without having been, and having been, they cease.”
Giống như khi đàn vīṇā được gảy, âm thanh phát ra không hề có một sự tích tụ nào trước khi sinh khởi, khi đang sinh cũng không đến từ một sự tích tụ nào, khi đang diệt cũng không đi đến phương này hay phương khác, và sau khi đã diệt cũng không tồn tại ở đâu dưới dạng tích tụ; mà là do duyên vào đàn vīṇā, que gảy và sự cố gắng tương ứng của người gảy, nó từ không mà có, sau khi có lại hoại diệt. Cũng vậy, tất cả các pháp sắc và phi sắc đều từ không mà có, sau khi có lại hoại diệt.”
1034
50. Evaṃ saṅkhepato udayabbayadassanaṃ dassetvā idāni vitthārato dassetuṃ pañcannaṃ khandhānaṃ udayaṃ passanto kati lakkhaṇāni passatītiādīhi rāsito gaṇanaṃ pucchitvā, pañcannaṃ khandhānaṃ udayaṃ passanto pañcavīsati lakkhaṇāni passatītiādīhi rāsitova gaṇanaṃ vissajjetvā, puna rūpakkhandhassa udayaṃ passanto kati lakkhaṇāni passatītiādīhi vibhāgato gaṇanaṃ pucchitvā rūpakkhandhassa udayaṃ passanto pañca lakkhaṇāni passatītiādīhi vibhāgato gaṇanaṃ vissajjetvā, puna rūpakkhandhassa udayaṃ passanto katamāni pañca lakkhaṇāni passatītiādīhi lakkhaṇavibhāgaṃ pucchitvā vissajjanaṃ kataṃ.
50. Having thus briefly shown the perception of arising and passing away, the exposition then proceeds to show it in detail by asking about the number of characteristics perceived by one who sees the arising of the five aggregates, with phrases like ‘pañcannaṃ khandhānaṃ udayaṃ passanto kati lakkhaṇāni passatī’ (How many characteristics does one who perceives the arising of the five aggregates perceive?), and answering with phrases like ‘pañcavīsati lakkhaṇāni passatī’ (one perceives twenty-five characteristics), referring to the number in terms of aggregates. Then, it asks about the number in terms of division with phrases like ‘rūpakkhandhassa udayaṃ passanto kati lakkhaṇāni passatī’ (How many characteristics does one who perceives the arising of the matter aggregate perceive?), and answers with phrases like ‘rūpakkhandhassa udayaṃ passanto pañca lakkhaṇāni passatī’ (one perceives five characteristics for the matter aggregate), referring to the number in terms of division. Finally, it asks about the division of characteristics with phrases like ‘rūpakkhandhassa udayaṃ passanto katamāni pañca lakkhaṇāni passatī’ (Which five characteristics does one who perceives the arising of the matter aggregate perceive?), and provides the answer.
50. Sau khi đã trình bày tuệ thấy sự sanh diệt một cách tóm tắt như vậy, bây giờ để trình bày một cách chi tiết, câu trả lời đã được thực hiện sau khi đã hỏi về số lượng theo cách tổng hợp bằng các câu như “Khi thấy sự sanh khởi của năm uẩn, vị ấy thấy bao nhiêu đặc tướng?”, rồi trả lời về số lượng theo cách tổng hợp bằng các câu như “Khi thấy sự sanh khởi của năm uẩn, vị ấy thấy hai mươi lăm đặc tướng”, lại hỏi về số lượng theo cách phân tích bằng các câu như “Khi thấy sự sanh khởi của sắc uẩn, vị ấy thấy bao nhiêu đặc tướng?”, rồi trả lời về số lượng theo cách phân tích bằng các câu như “Khi thấy sự sanh khởi của sắc uẩn, vị ấy thấy năm đặc tướng”, lại hỏi về sự phân tích đặc tướng bằng các câu như “Khi thấy sự sanh khởi của sắc uẩn, năm đặc tướng mà vị ấy thấy là những gì?”.
1035
Tattha avijjāsamudayā rūpasamudayoti ‘‘purimakammabhavasmiṃ moho avijjā’’ti vuttāya avijjāya sati imasmiṃ bhave rūpassa uppādo hotīti attho.
Here, avijjāsamudayā rūpasamudayo (with the arising of ignorance, there is the arising of matter) means that when there is ignorance, which is stated as 'delusion in the previous kamma-existence,' the arising of matter occurs in this present existence.
Trong đó, do vô minh sanh khởi nên sắc sanh khởi có nghĩa là: khi có vô minh, vốn được gọi là “si mê trong nghiệp hữu quá khứ”, thì sự sanh khởi của sắc trong đời này xảy ra.
Paccayasamudayaṭṭhenāti paccayassa uppannabhāvenāti attho.
Paccayasamudayaṭṭhena (in the sense of the arising of condition) means by virtue of the condition (ignorance and craving) having arisen.
Theo nghĩa duyên sanh khởi có nghĩa là: do trạng thái sanh khởi của duyên.
Avijjātaṇhākammāni cettha idha paṭisandhihetubhūtā atītapaccayā.
Here, ignorance, craving, and kamma are the past conditions that are the causes of rebirth in this existence.
Và ở đây, vô minh, ái, và nghiệp là các duyên quá khứ đã trở thành nhân cho sự tái sanh ở đây.
Imesu ca tīsu gahitesu saṅkhārupādānāni gahitāneva honti.
And when these three are taken, volitional formations (saṅkhāra) and clinging (upādāna) are also taken.
Và khi ba pháp này được nắm giữ, thì hành và thủ cũng đã được nắm giữ.
Āhārasamudayāti pavattipaccayesu kabaḷīkārāhārassa balavattā soyeva gahito.
From the origination of nutriment: Among the conditions for continuity, gross nutriment is taken because of its strength.
Do vật thực sanh khởi: trong các duyên của đời sống, vì đoàn thực có sức mạnh, nên chỉ nó được đề cập đến.
Tasmiṃ pana gahite pavattihetubhūtāni utucittānipi gahitāneva honti.
However, when that* is taken, temperature and consciousness, which are causes for continuity, are also taken.
Tuy nhiên, khi nó được đề cập đến, thì thời tiết và tâm, vốn là nhân của đời sống, cũng đã được đề cập đến.
Nibbattilakkhaṇanti addhāsantatikhaṇavasena rūpassa uppādaṃ, uppādoyeva saṅkhatalakkhaṇattā lakkhaṇanti ca vutto.
The characteristic of arising means the arising of matter in terms of duration, continuity, and moment; and arising itself is called a characteristic because it is a characteristic of conditioned phenomena.
Đặc tướng sanh thành: là sự sanh khởi của sắc theo phương diện thời gian, dòng tương tục, và sát-na; và chính sự sanh khởi được gọi là đặc tướng vì là đặc tướng của pháp hữu vi.
Pañca lakkhaṇānīti avijjā taṇhā kammāhārā nibbatti cāti imāni pañca lakkhaṇāni.
Five characteristics are these five characteristics: ignorance, craving, kamma, nutriment, and arising.
Năm đặc tướng: là năm đặc tướng này, tức là vô minh, ái, nghiệp, vật thực, và sự sanh thành.
Avijjādayopi hi rūpassa udayo lakkhīyati etehīti lakkhaṇāni.
For ignorance and the others are indeed characteristics because the origination of matter is marked by them.
Bởi vì sự sanh khởi của sắc được ghi nhận bởi vô minh v.v., nên chúng là các đặc tướng.
Nibbatti pana saṅkhatalakkhaṇameva, tampi saṅkhatanti lakkhīyati etenāti lakkhaṇaṃ.
But arising is itself a characteristic of conditioned phenomena, and that too is a characteristic because it is marked as conditioned by it.
Còn sự sanh thành chính là đặc tướng của pháp hữu vi; nó cũng được gọi là đặc tướng vì pháp hữu vi được ghi nhận bởi nó.
1036
Avijjānirodhā rūpanirodhoti anāgatabhavassa paccayabhūtāya imasmiṃ bhave avijjāya arahattamaggañāṇena nirodhe kate paccayābhāvā anāgatassa rūpassa anuppādo nirodho hotīti attho.
From the cessation of ignorance comes the cessation of matter: This means that when ignorance, which is a condition for future existence in this life, is ceased by the knowledge of the Arahantship path, due to the absence of the condition, the non-arising of future matter is its cessation.
Do vô minh diệt nên sắc diệt có nghĩa là: khi vô minh trong đời này, vốn là duyên cho đời vị lai, được diệt trừ bởi tuệ A-la-hán đạo, do không còn duyên nên sự không sanh khởi của sắc vị lai chính là sự diệt.
Paccayanirodhaṭṭhenāti paccayassa niruddhabhāvenāti attho.
In the sense of the cessation of the condition means "by the ceased state of the condition."
Theo nghĩa duyên diệt có nghĩa là: do trạng thái đã diệt của duyên.
Nirodho cettha anāgatapaṭisandhipaccayānaṃ idha avijjātaṇhākammānaṃyeva nirodho.
Here, cessation refers to the cessation of ignorance, craving, and kamma in this life, which are the conditions for future rebirth-linking.
Và ở đây, sự diệt chính là sự diệt của vô minh, ái và nghiệp ở đây, vốn là các duyên cho sự tái sanh trong vị lai.
Āhāranirodhā rūpanirodhoti pavattipaccayassa kabaḷīkārāhārassa abhāve taṃsamuṭṭhānarūpābhāvo hoti.
From the cessation of nutriment comes the cessation of matter: In the absence of gross nutriment, which is a condition for continuity, there is an absence of matter produced by it.
Do vật thực diệt nên sắc diệt: khi không có đoàn thực, vốn là duyên của đời sống, thì không có sắc do nó sanh ra.
Vipariṇāmalakkhaṇanti addhāsantatikhaṇavasena rūpassa bhaṅgaṃ, bhaṅgoyeva saṅkhatalakkhaṇattā lakkhaṇanti vutto.
The characteristic of change means the dissolution of matter in terms of duration, continuity, and moment; and dissolution itself is called a characteristic because it is a characteristic of conditioned phenomena.
Đặc tướng biến hoại: là sự hoại diệt của sắc theo phương diện thời gian, dòng tương tục, và sát-na; và chính sự hoại diệt được gọi là đặc tướng vì là đặc tướng của pháp hữu vi.
Idha pañca lakkhaṇānīti avijjātaṇhākammāhārānaṃ abhāvanirodhā cattāri, vipariṇāmo ekanti pañca.
Here, five characteristics means four from the non-existence and cessation of ignorance, craving, kamma, and nutriment, and one from change, making five.
Ở đây, năm đặc tướng là: bốn pháp do sự không có mặt và diệt của vô minh, ái, nghiệp, vật thực, và một pháp là sự biến hoại, thành ra năm.
Esa nayo vedanākkhanthādīsu.
The same method applies to the feeling aggregate and the others.
Phương pháp này cũng áp dụng cho thọ uẩn v.v.
Ayaṃ pana viseso – arūpakkhandhānaṃ udayabbayadassanaṃ addhāsantativasena, na khaṇavasena.
But this is the distinction: the seeing of the origination and dissolution of the immaterial aggregates is in terms of duration and continuity, not in terms of moment.
Tuy nhiên, đây là điểm khác biệt: tuệ thấy sự sanh diệt của các danh uẩn là theo phương diện thời gian và dòng tương tục, không theo phương diện sát-na.
Phasso vedanāsaññāsaṅkhārakkhandhānaṃ pavattipaccayo, taṃnirodhā ca tesaṃ nirodho.
Contact is a condition for the continuity of the feeling, perception, and mental formations aggregates; and from its cessation comes their cessation.
Xúc là duyên của đời sống cho thọ, tưởng, và hành uẩn, và do sự diệt của nó mà chúng diệt.
Nāmarūpaṃ viññāṇakkhandhassa pavattipaccayo, taṃnirodhā ca tassa nirodhoti.
Name-and-form is a condition for the continuity of the consciousness aggregate; and from its cessation comes its cessation.
Danh-sắc là duyên của đời sống cho thức uẩn, và do sự diệt của nó mà thức uẩn diệt.
1037
Keci panāhu – ‘‘catudhā paccayato udayabbayadassane atītādivibhāgaṃ anāmasitvāva sabbasāmaññavasena avijjādīhi udetīti uppajjamānabhāvamattaṃ gaṇhāti, na uppādaṃ.
Some, however, say: "In the seeing of origination and dissolution from conditions in four ways, without touching upon distinctions such as past, it takes merely the state of arising, saying 'it arises from ignorance and the others,' not the moment of arising.
Tuy nhiên, một số người nói: “Trong tuệ thấy sự sanh diệt theo bốn loại duyên, không cần xem xét sự phân chia quá khứ v.v., vị ấy chỉ nắm bắt trạng thái đang sanh khởi nói chung là ‘nó sanh khởi do vô minh v.v.’, chứ không nắm bắt sự sanh khởi (sát-na sanh).
Avijjādinirodhā nirujjatīti anuppajjamānabhāvamattaṃ gaṇhāti, na bhaṅgaṃ.
It takes merely the state of non-arising, saying 'it ceases from the cessation of ignorance and the others,' not the moment of dissolution.
‘Nó diệt do sự diệt của vô minh v.v.’, vị ấy chỉ nắm bắt trạng thái đang không sanh khởi, chứ không nắm bắt sự hoại diệt (sát-na diệt).
Khaṇato udayabbayadassane paccuppannānaṃ uppādaṃ bhaṅgaṃ gaṇhātī’’ti.
In the seeing of origination and dissolution from moments, it takes the arising and dissolution of present phenomena."
Trong tuệ thấy sự sanh diệt theo sát-na, vị ấy nắm bắt sự sanh khởi và hoại diệt của các pháp hiện tại.”
1038
Vipassamāno pana vipassako paṭhamaṃ paccayato udayabbayaṃ manasikaritvā vipassanākāle avijjādike caturo dhamme vissajjetvā udayabbayavanteyeva khandhe gahetvā tesaṃ udayabbayaṃ passati, evañca tassa vipassakassa ‘‘evaṃ rūpādīnaṃ udayo, evaṃ vayo, evaṃ rūpādayo udenti, evaṃ ventī’’ti paccayato ca khaṇato ca vitthārena udayabbayaṃ passato ‘‘iti kira ime dhammā ahutvā sambhonti, hutvā paṭiventī’’ti ñāṇaṃ visadataraṃ hoti, saccapaṭiccasamuppādanayalakkhaṇabhedā pākaṭā honti.
But the meditator, when meditating, first attends to origination and dissolution from conditions, and at the time of insight, having discarded the four phenomena such as ignorance, takes only the aggregates that have origination and dissolution, and sees their origination and dissolution. And thus, for that meditator, as he extensively sees the origination and dissolution of matter and the others, "in this way matter and the others originate, in this way they dissolve, in this way matter and the others arise, in this way they pass away," both from conditions and from moments, his knowledge becomes clearer, and the distinctions of characteristics in the way of the Truths and Dependent Origination become manifest.
Tuy nhiên, hành giả tu tập minh sát, sau khi tác ý về sự sanh diệt theo duyên trước tiên, vào lúc tu tập minh sát, vị ấy gác lại bốn pháp như vô minh v.v., chỉ nắm lấy các uẩn có sanh diệt và thấy sự sanh diệt của chúng. Và như vậy, đối với hành giả minh sát đó, khi thấy sự sanh diệt một cách chi tiết theo duyên và theo sát-na rằng “sự sanh của sắc v.v. là như vầy, sự diệt là như vầy; sắc v.v. sanh lên như vầy, diệt đi như vầy”, thì trí tuệ “quả thực, các pháp này từ không có mà có, sau khi có lại diệt đi” trở nên trong sáng hơn, và các sự khác biệt về phương pháp của Tứ đế và Duyên khởi trở nên rõ ràng.
Yañhi so avijjādisamudayā khandhānaṃ samudayaṃ avijjādinirodhā ca khandhānaṃ nirodhaṃ passati, idamassa paccayato udayabbayadassanaṃ.
For when he sees the origination of the aggregates from the origination of ignorance and the others, and the cessation of the aggregates from the cessation of ignorance and the others, this is his seeing of origination and dissolution from conditions.
Việc vị ấy thấy sự sanh khởi của các uẩn do sự sanh khởi của vô minh v.v., và sự diệt của các uẩn do sự diệt của vô minh v.v., đây là tuệ thấy sự sanh diệt của vị ấy theo duyên.
Yaṃ pana nibbattilakkhaṇavipariṇāmalakkhaṇāni passanto khandhānaṃ udayabbayaṃ passati, idamassa khaṇato udayabbayadassanaṃ.
But when he sees the origination and dissolution of the aggregates by seeing the characteristic of arising and the characteristic of change, this is his seeing of origination and dissolution from moments.
Việc vị ấy thấy sự sanh diệt của các uẩn khi thấy các đặc tướng sanh thành và biến hoại, đây là tuệ thấy sự sanh diệt của vị ấy theo sát-na.
Uppattikkhaṇeyeva hi nibbattilakkhaṇaṃ, bhaṅgakkhaṇe ca vipariṇāmalakkhaṇaṃ.
For the characteristic of arising is at the moment of production, and the characteristic of change is at the moment of dissolution.
Bởi vì đặc tướng sanh thành chỉ có trong sát-na sanh, và đặc tướng biến hoại chỉ có trong sát-na diệt.
1039
Iccassevaṃ paccayato ceva khaṇato ca dvedhā udayabbayaṃ passato paccayato udayadassanena samudayasaccaṃ pākaṭaṃ hoti janakāvabodhato.
Thus, for him who sees origination and dissolution in two ways, both from conditions and from moments, the truth of origination becomes manifest through seeing origination from conditions, by understanding the generative cause.
Như vậy, đối với vị ấy, khi thấy sự sanh diệt theo hai cách là theo duyên và theo sát-na, thì do thấy sự sanh theo duyên, Tập đế trở nên rõ ràng, vì thấu hiểu được nhân sanh.
Khaṇato udayadassanena dukkhasaccaṃ pākaṭaṃ hoti jātidukkhāvabodhato.
The truth of suffering becomes manifest through seeing origination from moments, by understanding the suffering of birth.
Do thấy sự sanh theo sát-na, Khổ đế trở nên rõ ràng, vì thấu hiểu được khổ sanh.
Paccayato vayadassanena nirodhasaccaṃ pākaṭaṃ hoti paccayānuppādena paccayavataṃ anuppādāvabodhato.
The truth of cessation becomes manifest through seeing dissolution from conditions, by understanding the non-arising of that which has conditions due to the non-arising of conditions.
Do thấy sự diệt theo duyên, Diệt đế trở nên rõ ràng, vì thấu hiểu được sự không sanh của các pháp hữu duyên do duyên không sanh.
Khaṇato vayadassanena dukkhasaccameva pākaṭaṃ hoti maraṇadukkhāvabodhato.
The truth of suffering itself becomes manifest through seeing dissolution from moments, by understanding the suffering of death.
Do thấy sự diệt theo sát-na, chính Khổ đế trở nên rõ ràng, vì thấu hiểu được khổ chết.
Yañcassa udayabbayadassanaṃ, maggovāyaṃ lokikoti maggasaccaṃ pākaṭaṃ hoti tatra sammohavighātato.
And his seeing of origination and dissolution is itself a mundane path, so the truth of the path becomes manifest by the elimination of delusion therein.
Và tuệ thấy sự sanh diệt của vị ấy, chính là Đạo đế ở bậc thế gian, nên Đạo đế trở nên rõ ràng, vì đã phá tan si mê ở đó.
1040
Paccayato cassa udayadassanena anulomo paṭiccasamuppādo pākaṭo hoti ‘‘imasmiṃ sati idaṃ hotī’’ti (ma. ni. 1.404; saṃ. ni. 2.21; udā. 1) avabodhato.
And to that yogi, the forward-going Paṭiccasamuppāda becomes evident through the perception of arising due to conditions, by understanding 'When this exists, that comes to be.'
Và đối với vị ấy, do thấy sự sanh theo duyên, Duyên khởi chiều thuận trở nên rõ ràng, vì thấu hiểu rằng “khi cái này có, cái kia có”.
Paccayato vayadassanena paṭilomo paṭiccasamuppādo pākaṭo hoti ‘‘imassa nirodhā idaṃ nirujjhatī’’ti (ma. ni. 1.406; saṃ. ni. 2.21; udā. 2) avabodhato.
The reverse-going Paṭiccasamuppāda becomes evident through the perception of passing away due to conditions, by understanding 'With the cessation of this, that ceases.'
Do thấy sự diệt theo duyên, Duyên khởi chiều nghịch trở nên rõ ràng, vì thấu hiểu rằng “do cái này diệt, cái kia diệt”.
Khaṇato pana udayabbayadassanena paṭiccasamuppannā dhammā pākaṭā honti saṅkhatalakkhaṇāvabodhato.
However, the phenomena arisen from conditions become evident through the perception of arising and passing away moment by moment, by understanding the characteristic of conditioned things.
Còn do thấy sự sanh diệt theo sát-na, các pháp duyên sanh trở nên rõ ràng, vì thấu hiểu được đặc tướng hữu vi.
Udayabbayavanto hi saṅkhatā, te ca paṭiccasamuppannāti.
For conditioned things are subject to arising and passing away, and they arise dependently.
Bởi vì các pháp có sanh diệt là pháp hữu vi, và chúng là pháp duyên sanh.
1041
Paccayato cassa udayadassanena ekattanayo pākaṭo hoti hetuphalasambandhena santānassa anupacchedāvabodhato.
And to that yogi, the mode of oneness becomes evident through the perception of arising due to conditions, by understanding the uninterrupted continuity of the stream of existence through the connection of cause and effect.
Và đối với vị ấy, do thấy sự sanh theo duyên, phương pháp nhất thể trở nên rõ ràng, vì thấu hiểu được sự không gián đoạn của dòng tương tục qua mối liên hệ nhân quả.
Atha suṭṭhutaraṃ ucchedadiṭṭhiṃ pajahati.
Then one thoroughly abandons the annihilationist view (ucchedadiṭṭhi).
Khi đó, vị ấy từ bỏ đoạn kiến một cách triệt để hơn.
Khaṇato udayadassanena nānattanayo pākaṭo hoti navanavānaṃ uppādāvabodhato.
The mode of diversity becomes evident through the perception of arising moment by moment, by understanding the arising of new and new phenomena.
Do thấy sự sanh theo sát-na, phương pháp dị thể trở nên rõ ràng, vì thấu hiểu được sự sanh khởi của các pháp mới luôn luôn.
Atha suṭṭhutaraṃ sassatadiṭṭhiṃ pajahati.
Then one thoroughly abandons the eternalist view (sassatadiṭṭhi).
Khi đó, vị ấy từ bỏ thường kiến một cách triệt để hơn.
Paccayato cassa udayabbayadassanena abyāpāranayo pākaṭo hoti dhammānaṃ avasavattibhāvāvabodhato.
And to that yogi, the mode of non-agency (abyāpāranaya) becomes evident through the perception of arising and passing away due to conditions, by understanding the non-subservience of phenomena.
Và đối với vị ấy, do thấy sự sanh diệt theo duyên, phương pháp vô tác trở nên rõ ràng, vì thấu hiểu được trạng thái không chịu sự chi phối của các pháp.
Atha suṭṭhutaraṃ attadiṭṭhiṃ pajahati.
Then one thoroughly abandons the self-view (attadiṭṭhi).
Khi đó, vị ấy từ bỏ ngã kiến một cách triệt để hơn.
Paccayato pana udayadassanena evaṃdhammatānayo pākaṭo hoti paccayānurūpena phalassuppādāvabodhato.
Furthermore, the mode of 'suchness' (evaṃdhammatānaya) becomes evident through the perception of arising due to conditions, by understanding the arising of results in accordance with their conditions.
Còn do thấy sự sanh theo duyên, phương pháp y pháp tánh trở nên rõ ràng, vì thấu hiểu được sự sanh khởi của quả tương ứng với duyên.
Atha suṭṭhutaraṃ akiriyadiṭṭhiṃ pajahati.
Then one thoroughly abandons the view of non-action (akiriyadiṭṭhi).
Khi đó, vị ấy từ bỏ vô hành kiến một cách triệt để hơn.
1042
Paccayato cassa udayadassanena anattalakkhaṇaṃ pākaṭaṃ hoti dhammānaṃ nirīhakattapaccayapaṭibaddhavuttitāvabodhato.
And to that yogi, the characteristic of not-self (anattalakkhaṇa) becomes evident through the perception of arising due to conditions, by understanding that phenomena are without effort and dependent on conditions for their occurrence.
Và đối với vị ấy, do thấy sự sanh khởi theo phương diện duyên, đặc tướng vô ngã trở nên rõ ràng, vì liễu tri được rằng các pháp không có sự nỗ lực và sự vận hành của chúng bị ràng buộc bởi duyên.
Khaṇato udayabbayadassanena aniccalakkhaṇaṃ pākaṭaṃ hoti hutvā abhāvāvabodhato, pubbantāparantavivekāvabodhato ca.
The characteristic of impermanence (aniccalakkhaṇa) becomes evident through the perception of arising and passing away moment by moment, by understanding that having come into being, they cease to be, and by understanding the separation of the past and the future.
Do thấy sự sanh và diệt theo phương diện sát-na, đặc tướng vô thường trở nên rõ ràng, vì liễu tri được sự không hiện hữu sau khi đã hiện hữu, và vì liễu tri được sự phân biệt giữa tiền kiếp và hậu kiếp.
Dukkhalakkhaṇampi pākaṭaṃ hoti udayabbayehi paṭipīḷanāvabodhato.
The characteristic of suffering (dukkhalakkhaṇa) also becomes evident through the understanding of being oppressed by arising and passing away.
Đặc tướng khổ cũng trở nên rõ ràng, vì liễu tri được sự bức bách bởi sanh và diệt.
Sabhāvalakkhaṇampi pākaṭaṃ hoti udayabbayaparicchinnāvabodhato.
The characteristic of inherent nature (sabhāvalakkhaṇa) also becomes evident through the understanding of being delimited by arising and passing away.
Đặc tướng tự tánh cũng trở nên rõ ràng, vì liễu tri được sự phân định bởi sanh và diệt.
Sabhāvalakkhaṇe saṅkhatalakkhaṇassa tāvakālikattampi pākaṭaṃ hoti, udayakkhaṇe vayassa, vayakkhaṇe ca udayassa abhāvāvabodhatoti.
And the momentary nature of the characteristic of conditioned things in their inherent nature also becomes evident, by understanding the non-existence of passing away at the moment of arising, and the non-existence of arising at the moment of passing away.
Trong đặc tướng tự tánh, tính chất nhất thời của đặc tướng pháp hữu vi cũng trở nên rõ ràng, vì liễu tri được sự không có của diệt trong sát-na sanh, và sự không có của sanh trong sát-na diệt.
1043
Tassevaṃ pākaṭībhūtasaccapaṭiccasamuppādanayalakkhaṇabhedassa ‘‘evaṃ kira nāmime dhammā anuppannapubbā uppajjanti, uppannā nirujjhantī’’ti niccanavāva hutvā saṅkhārā upaṭṭhahanti.
For such a yogi, to whom the distinctions of the truths, dependent origination, modes, and characteristics have become evident, the saṅkhāras appear as constantly new, with the understanding that "these phenomena, never having arisen before, now arise, and having arisen, they cease."
Đối với vị ấy, người có sự phân biệt về phương pháp của các sự thật, duyên khởi và đặc tướng đã trở nên rõ ràng như vậy, các pháp hành hiện khởi như thể luôn luôn mới mẻ, rằng: "Quả thật, các pháp này, trước đây chưa từng sanh, nay lại sanh khởi; sau khi sanh khởi, chúng lại diệt đi".
Na kevalañca niccanavāva, sūriyuggamane ussāvabindu viya udakapubbuḷo viya udake daṇḍarāji viya āragge sāsapo viya vijjuppādo viya ca parittaṭṭhāyino māyāmarīcisupinantaalātacakkagandhabbanagarapheṇakadaliādayo viya asārā nissārāti cāpi upaṭṭhahanti.
Not only do they appear as constantly new, but they also appear as fleeting, like dewdrops at sunrise, like water bubbles, like lines drawn on water with a stick, like a mustard seed on the tip of an awl, like a flash of lightning; and as insubstantial and without essence, like illusions, mirages, dream-objects, fire-wheels, Gandhabba cities, foam, and banana trees.
Không chỉ luôn luôn mới mẻ, chúng còn hiện khởi như là tồn tại trong chốc lát, giống như giọt sương khi mặt trời mọc, như bọt nước, như vệt gậy vẽ trên mặt nước, như hạt cải trên đầu mũi dùi, như tia chớp; và chúng cũng hiện khởi như là vô lõi, không có thực chất, giống như ảo ảnh, ảo giác, giấc mơ, vòng lửa, thành Càn-thát-bà, bọt biển, thân cây chuối, v.v.
Ettāvatā tena ‘‘vayadhammameva uppajjati, uppannañca vayaṃ upetī’’ti iminā ākārena samapaññāsa lakkhaṇāni paṭivijjhitvā ṭhitaṃ udayabbayānupassanā nāma paṭhamaṃ taruṇavipassanāñāṇaṃ adhigataṃ hoti, yassādhigamā ‘‘āraddhavipassako’’ti saṅkhaṃ gacchati.
At this point, by comprehending fifty characteristics in the manner of "only that which is subject to decay arises, and what has arisen goes to decay," the first tender insight-knowledge called knowledge of the contemplation of arising and passing away (udayabbayānupassanā) is attained, by the attainment of which one is called "a meditator who has commenced vipassanā."
Đến đây, vị ấy, bằng cách thấu triệt năm mươi đặc tướng theo phương thức "chỉ có pháp có tánh diệt mới sanh khởi, và cái đã sanh thì đi đến hoại diệt", đã chứng đắc được tuệ minh sát non trẻ đầu tiên gọi là tuệ quán sanh diệt (udayabbayānupassanā), và do sự chứng đắc này, vị ấy được gọi là "người đã bắt đầu minh sát".
Imasmiṃ ñāṇe ṭhitassa obhāsādayo dasa vipassanūpakkilesā uppajjanti, yesaṃ uppattiyā akusalo yogāvacaro tesu maggañāṇasaññī hutvā amaggameva ‘‘maggo’’ti gaṇhāti, upakkilesajaṭājaṭito ca hoti.
For one who stands in this knowledge, the ten imperfections of insight (vipassanūpakkilesā) such as effulgence (obhāsa) arise; and due to their arising, an unskillful meditator, perceiving them as path-knowledge, takes what is not the path as "the path," and becomes entangled in the thicket of imperfections.
Khi đang an trú trong tuệ này, mười phiền não của minh sát (vipassanūpakkilesā) như ánh sáng (obhāsa), v.v. sanh khởi. Do sự sanh khởi của chúng, vị hành giả không thiện xảo, có tưởng về tuệ đạo đối với chúng, liền chấp thủ cái không phải là đạo rằng "đây là đạo", và bị vướng vào mớ bòng bong của phiền não.
Kusalo pana yogāvacaro tesu vipassanaṃ āropento upakkilesajaṭaṃ vijaṭetvā ‘‘ete dhammā na maggo, upakkilesavimuttaṃ pana vīthipaṭipannaṃ vipassanāñāṇaṃ maggo’’ti maggañca amaggañca vavatthapeti.
But a skillful meditator, applying insight to them, disentangles the thicket of imperfections and discerns the path from the non-path, understanding: "These phenomena are not the path; rather, insight-knowledge that is free from imperfections and has entered the proper course is the path."
Còn vị hành giả thiện xảo, bằng cách áp dụng minh sát vào chúng, gỡ rối mớ bòng bong phiền não và xác định đạo và phi đạo rằng: "Các pháp này không phải là đạo, nhưng tuệ minh sát đã đi vào lộ trình, thoát khỏi phiền não, mới là đạo".
Tassevaṃ maggañca amaggañca ñatvā ṭhitaṃ ñāṇaṃ maggāmaggañāṇadassanavisuddhi nāma.
The knowledge of such a person, who has thus known the path and the non-path, is called the Purification of Knowledge and Vision of the Path and Not-Path (maggāmaggañāṇadassanavisuddhi).
Tuệ của vị ấy, người đã biết và an trú trong đạo và phi đạo như vậy, được gọi là Đạo phi đạo tri kiến thanh tịnh (maggāmaggañāṇadassanavisuddhi).
1044
Ettāvatā ca pana tena catunnaṃ saccānaṃ vavatthānaṃ kataṃ hoti.
And by this much, the yogi has made a determination of the four truths.
Đến đây, vị ấy đã thực hiện việc xác định bốn sự thật.
Kathaṃ?
How?
Như thế nào?
Nāmarūpapariggahe sati paccayapariggahasambhavato dhammaṭṭhitiñāṇavacaneneva vuttena diṭṭhivisuddhisaṅkhātena nāmarūpavavatthāpanena dukkhasaccassa vavatthānaṃ kataṃ hoti, kaṅkhāvitaraṇavisuddhisaṅkhātena paccayapariggahaṇena samudayasaccassa vavatthānaṃ, udayabbayānupassanena ca khaṇato udayabbayadassanena dukkhasaccassa vavatthānaṃ kataṃ, paccayato udayadassanena samudayasaccassa vavatthānaṃ, paccayato vayadassanena nirodhasaccassa vavatthānaṃ, yañcassa udayabbayadassanaṃ, maggovāyaṃ lokikoti tatra sammohavighātato imissañca maggāmaggañāṇadassanavisuddhiyaṃ vipassato sammā maggassa avadhāraṇena maggasaccassa vavatthānaṃ kataṃ.
When there is comprehension of mind-and-matter, because of the possibility of comprehending causal conditions, by the very statement of Dhammaṭṭhitiñāṇa, by the discernment of mind-and-matter, which is called purity of view, the discernment of the truth of suffering is accomplished. By the comprehension of causal conditions, which is called purity by overcoming doubt, the discernment of the truth of origin is accomplished. And by observing rise and fall, by seeing rise and fall moment by moment, the discernment of the truth of suffering is accomplished. By seeing rise through causes, the discernment of the truth of origin is accomplished. By seeing fall through causes, the discernment of the truth of cessation is accomplished. And as for his seeing of rise and fall, this is a mundane path, and by overcoming delusion in that, and by rightly ascertaining the path for one who sees in this purity of knowledge and vision of what is path and what is not path, the discernment of the truth of the path is accomplished.
Khi có sự liễu tri danh sắc, sự liễu tri các duyên trở nên khả dĩ. Do đó, bằng việc xác định danh sắc, được gọi là Kiến thanh tịnh (diṭṭhivisuddhi), cũng được gọi bằng thuật ngữ tuệ về sự an trú của pháp (dhammaṭṭhitiñāṇa), sự xác định khổ đế đã được thực hiện. Bằng việc liễu tri các duyên, được gọi là Độ nghi thanh tịnh (kaṅkhāvitaraṇavisuddhi), sự xác định tập đế đã được thực hiện. Và bằng tuệ quán sanh diệt, do thấy sự sanh và diệt theo phương diện sát-na, sự xác định khổ đế đã được thực hiện; do thấy sự sanh theo phương diện duyên, sự xác định tập đế đã được thực hiện; do thấy sự diệt theo phương diện duyên, sự xác định diệt đế đã được thực hiện. Và tuệ thấy sanh diệt của vị ấy, chính là đạo thế gian, do đó, nhờ việc phá tan si mê ở đó và nhờ việc xác định chánh đạo trong khi quán chiếu trong Đạo phi đạo tri kiến thanh tịnh này, sự xác định đạo đế đã được thực hiện.
Evaṃ lokiyena tāva ñāṇena catunnaṃ saccānaṃ vavatthānaṃ kataṃ hotīti.
Thus, by mundane knowledge, the discernment of the four truths is accomplished.
Như vậy, việc xác định bốn sự thật đã được thực hiện trước hết bằng tuệ thế gian.
1045
Udayabbayañāṇaniddesavaṇṇanā niṭṭhitā.
The explanation of the knowledge of rise and fall is concluded.
Phần giải thích về chỉ dẫn tuệ sanh diệt đã hoàn tất.
1046

7. Bhaṅgānupassanāñāṇaniddesavaṇṇanā

7. Explanation of the Knowledge of Contemplation of Dissolution

7. Phần giải thích về chỉ dẫn tuệ quán sự hoại diệt

1047
51. So udayabbayānupassanāyaṃ ṭhito yogāvacaro maggāmaggavavatthāpanena upakkilesavimuttaṃ vīthipaṭipannaṃ udayabbayānupassanāñāṇaṃ ‘‘maggo’’ti ñatvā tilakkhaṇasallakkhaṇena tasseva maggassa suvisadakaraṇatthaṃ puna udayabbayānupassanaṃ ārabhitvā udayabbayena paricchinne saṅkhāre aniccādito vipassati.
51. That yogi, standing in the contemplation of rise and fall, having known the knowledge of rise and fall, which is free from defilements and has entered the path, as “the path” through the discernment of what is path and what is not path, again begins the contemplation of rise and fall to make that very path very clear by observing the three characteristics. He discerns the formations, delimited by rise and fall, as impermanent and so forth.
51. Vị hành giả ấy, đang an trú trong tuệ quán sanh diệt, sau khi nhận biết tuệ quán sanh diệt đã đi vào lộ trình, thoát khỏi phiền não nhờ việc xác định đạo và phi đạo, là "đạo", liền bắt đầu lại tuệ quán sanh diệt để làm cho chính đạo ấy trở nên thật trong sáng bằng cách ghi nhận ba tướng, và quán chiếu các pháp hành, vốn đã được phân định bởi sanh và diệt, theo phương diện vô thường, v.v.
Evaṃ tassa taṃ ñāṇaṃ tikkhaṃ hutvā vahati, saṅkhārā lahuṃ upaṭṭhahanti, ñāṇe tikkhe vahante saṅkhāresu lahuṃ upaṭṭhahantesu uppādaṃ atikkamitvā bhaṅge eva sati santiṭṭhati.
Thus, that knowledge of his becomes sharp and flows, and formations manifest quickly. When his knowledge flows sharply and formations manifest quickly, his mindfulness transcends origination and settles on dissolution alone.
Như vậy, tuệ ấy của vị ấy trở nên sắc bén và vận hành; các pháp hành hiện khởi nhanh chóng. Khi tuệ vận hành sắc bén và các pháp hành hiện khởi nhanh chóng, tâm vượt qua sự sanh và chỉ an trú vào sự hoại diệt.
Nirodhādhimuttattā vā udayaṃ pahāya bhaṅgeyeva satiṃ upaṭṭhapeti.
Or, being intent on cessation, he abandons origination and establishes mindfulness on dissolution alone.
Hoặc do có khuynh hướng hướng về sự diệt, vị ấy từ bỏ sự sanh và thiết lập niệm chỉ trên sự hoại diệt.
Etasmiṃ ṭhāne bhaṅgānupassanāñāṇaṃ uppajjati.
At this stage, the knowledge of contemplation of dissolution arises.
Tại thời điểm này, tuệ quán sự hoại diệt (bhaṅgānupassanāñāṇa) sanh khởi.
Idāni tassa ñāṇassa niddese rūpārammaṇatā cittaṃ uppajjitvā bhijjatīti rūpārammaṇaṃ cittaṃ uppajjitvā bhijjati.
Now, in the explanation of that knowledge, “the mind arises and dissolves with a visible object as its object” means that the mind with a visible object as its object arises and dissolves.
Bây giờ, trong phần chỉ dẫn về tuệ ấy, câu tâm có sắc làm đối tượng sanh lên rồi hoại diệt có nghĩa là tâm có sắc làm đối tượng sanh lên rồi hoại diệt.
Atha vā rūpārammaṇabhāve cittaṃ uppajjitvā bhijjatīti attho.
Alternatively, it means that the mind arises and dissolves in the state of having a visible object as its object.
Hoặc có nghĩa là: trong trạng thái có sắc làm đối tượng, tâm sanh lên rồi hoại diệt.
Taṃ ārammaṇaṃ paṭisaṅkhāti taṃ rūpārammaṇaṃ paṭisaṅkhāya jānitvā, khayato vayato disvāti attho.
“Having reflected on that object” means having known that visible object by reflecting on it, i.e., having seen it as perishing and vanishing.
Vị ấy thẩm xét đối tượng ấy có nghĩa là, sau khi biết đối tượng sắc ấy bằng cách thẩm xét, tức là sau khi thấy nó theo phương diện tận diệt, hoại diệt.
Tassa cittassa bhaṅgaṃ anupassatīti yena cittena taṃ rūpārammaṇaṃ khayato vayato diṭṭhaṃ, tassa cittassa aparena cittena bhaṅgaṃ anupassatīti attho.
“He contemplates the dissolution of that mind” means that he contemplates the dissolution of that mind by which that visible object was seen as perishing and vanishing, with a subsequent mind.
Vị ấy quán sự hoại diệt của tâm ấy có nghĩa là, vị ấy quán sự hoại diệt của tâm mà nhờ đó đối tượng sắc đã được thấy theo phương diện tận diệt, hoại diệt, bằng một tâm khác (theo sau).
Tenāhu porāṇā – ‘‘ñātañca ñāṇañca ubho vipassatī’’ti.
Therefore, the ancients said: “He discerns both what is known and the knowledge itself.”
Do đó, các vị cổ sư đã nói: "Vị ấy quán cả cái được biết và tuệ".
Cittanti cettha sasampayuttacittaṃ adhippetaṃ.
Here, “mind” refers to the mind together with its associated mental factors.
Và ở đây, tâm được hiểu là tâm cùng với các pháp tương ưng.
1048
Anupassatīti anu anu passati, anekehi ākārehi punappunaṃ passatīti attho.
“Contemplates” means contemplates again and again, i.e., sees repeatedly in various ways.
Quán (anupassati) có nghĩa là thấy đi thấy lại, thấy lặp đi lặp lại bằng nhiều cách.
Tenāha anupassatīti kathaṃ anupassati, aniccato anupassatītiādi.
Therefore, it is said, “How does he contemplate? He contemplates as impermanent,” and so on.
Do đó, Ngài nói "Quán" là quán như thế nào? Quán theo phương diện vô thường, v.v.
Tattha yasmā bhaṅgo nāma aniccatāya paramā koṭi, tasmā bhaṅgānupassako yogāvacaro sabbaṃ rūpagataṃ aniccato anupassati, no niccato.
Here, since dissolution is the ultimate stage of impermanence, the yogi who contemplates dissolution contemplates all rūpa as impermanent, not as permanent.
Trong đó, vì sự hoại diệt là đỉnh cao của sự vô thường, cho nên vị hành giả quán sự hoại diệt quán chiếu tất cả những gì thuộc về sắc theo phương diện vô thường, chứ không phải thường còn.
Tato aniccassa dukkhattā, dukkhassa ca anattattā, tadeva dukkhato anupassati, no sukhato.
Because what is impermanent is suffering, and what is suffering is non-self, he contemplates that very thing as suffering, not as pleasure.
Sau đó, vì cái vô thường là khổ, và cái khổ là vô ngã, vị ấy quán chính cái đó theo phương diện khổ, chứ không phải lạc.
Anattato anupassati, no attato.
He contemplates it as non-self, not as self.
Quán theo phương diện vô ngã, chứ không phải ngã.
Yasmā pana yaṃ aniccaṃ dukkhamanattā, na taṃ abhinanditabbaṃ.
Since what is impermanent, suffering, and non-self should not be delighted in.
Hơn nữa, vì cái gì vô thường, khổ, vô ngã, thì không nên hoan hỷ.
Yañca na abhinanditabbaṃ, na tattha rajjitabbaṃ.
And what should not be delighted in, one should not be attached to.
Và cái gì không nên hoan hỷ, thì không nên tham đắm.
Tasmā esa tasmiṃ bhaṅgānupassanānusārena ‘‘aniccaṃ dukkhamanattā’’ti diṭṭhe rūpagate nibbindati, no nandati.
Therefore, in accordance with the contemplation of dissolution, when he sees rūpa as “impermanent, suffering, non-self,” he becomes disenchanted, not delighted.
Do đó, vị này, đối với những gì thuộc về sắc đã được thấy là "vô thường, khổ, vô ngã" theo tuệ quán sự hoại diệt, liền nhàm chán, không hoan hỷ.
Virajjati, no rajjati.
He becomes dispassionate, not attached.
Ly tham, không tham đắm.
So evaṃ virajjanto lokikeneva tāva ñāṇena rāgaṃ nirodheti, no samudeti, samudayaṃ na karotīti attho.
Thus, becoming dispassionate, he first eradicates craving with mundane knowledge, he does not originate it, meaning he does not cause its arising.
Vị ấy, khi ly tham như vậy, trước hết bằng tuệ thế gian, diệt trừ tham, không làm cho nó sanh khởi, nghĩa là không tạo ra sự sanh khởi.
Atha vā so evaṃ viratto yathā diṭṭhaṃ rūpagataṃ, tathā adiṭṭhampi anvayañāṇavasena nirodheti, no samudeti.
Alternatively, being thus dispassionate, he eradicates both the rūpa he has seen and the rūpa he has not seen, by way of inferential knowledge; he does not originate it.
Hoặc, vị ấy, sau khi ly tham như vậy, diệt trừ cả những gì thuộc về sắc chưa được thấy, cũng như những gì đã được thấy, bằng sức mạnh của tuệ suy luận, không làm cho nó sanh khởi.
Nirodhatova manasi karoti, nirodhamevassa passati, no samudayanti attho.
He attends only to cessation; he sees only its cessation, not its origination. This is the meaning.
Vị ấy chỉ tác ý đến sự diệt, chỉ thấy sự diệt của nó, chứ không phải sự sanh khởi, đó là ý nghĩa.
So evaṃ paṭipanno paṭinissajjati, no ādiyati.
Thus practicing, he relinquishes, he does not grasp.
Vị ấy, khi thực hành như vậy, liền từ bỏ, không chấp thủ.
Kiṃ vuttaṃ hoti?
What is meant?
Điều gì đã được nói?
Ayampi hi aniccādianupassanā tadaṅgavasena saddhiṃ khandhābhisaṅkhārehi kilesānaṃ pariccajanato, saṅkhatadosadassanena ca tabbiparīte nibbāne tanninnatāya pakkhandanato pariccāgapaṭinissaggo ceva pakkhandanapaṭinissaggo cāti vuccati.
Indeed, this contemplation of impermanence (aniccānupassanā), etc., is called both relinquishment by abandonment (pariccāgapaṭinissagga) and relinquishment by plunging (pakkhandanapaṭinissagga), because by means of its constituent factors, it abandons defilements together with the aggregates and volitional formations, and by seeing the fault in conditioned things, it plunges into Nibbāna, which is contrary to them, with a tendency towards it.
Bởi vì sự quán vô thường, v.v. này, do từ bỏ các phiền não cùng với các hành của uẩn theo phương diện đoạn trừ từng phần, và do hướng đến Niết-bàn, đối nghịch với các pháp hữu vi, nhờ thấy lỗi của pháp hữu vi, nên được gọi là sự từ bỏ bằng cách xả ly (pariccāgapaṭinissagga) và sự từ bỏ bằng cách lao vào (pakkhandanapaṭinissagga).
Tasmā tāya samannāgato bhikkhu yathāvuttena nayena kilese ca pariccajati, nibbāne ca pakkhandati.
Therefore, a bhikkhu endowed with that (contemplation) abandons defilements and plunges into Nibbāna in the manner stated.
Do đó, vị tỳ-khưu có được tuệ quán ấy, theo phương pháp đã nói, vừa từ bỏ các phiền não, vừa lao vào Niết-bàn.
Nāpi nibbattanavasena kilese ādiyati, na adosadassitāvasena saṅkhatārammaṇaṃ.
He does not grasp defilements by way of their arising, nor does he grasp conditioned objects by not seeing their fault.
Vị ấy không chấp thủ các phiền não theo cách làm cho chúng phát sanh, cũng không chấp thủ đối tượng hữu vi theo cách không thấy lỗi lầm của nó.
Tena vuccati paṭinissajjati, no ādiyatīti.
Therefore, it is said: ‘He relinquishes, he does not grasp.’
Vì thế, người ta nói: "từ bỏ, không chấp thủ".
1049
52. Idānissa tehi ñāṇehi yesaṃ dhammānaṃ pahānaṃ hoti, taṃ dassetuṃ aniccato anupassanto niccasaññaṃ pajahatītiādi vuttaṃ.
To show which phenomena are abandoned by these knowledges for him, it is now stated: “Contemplating as impermanent, he abandons the perception of permanence,” and so on.
52. Bây giờ, để trình bày các pháp được đoạn trừ bằng các tuệ ấy, Đức Phật đã nói “ quán sát là vô thường thì đoạn trừ tưởng thường hằng (niccasaññaṃ pajahati)” v.v...
Tattha nandinti sappītikaṃ taṇhaṃ.
Here, nandi means craving accompanied by delight.
Trong đó, nandi là tham ái (taṇhā) đi kèm với hỷ.
Rāganti sesaṃ taṇhaṃ.
Rāga means the remaining craving.
Rāga là phần tham ái còn lại.
Samudayanti rāgassa uppattiṃ.
Samudaya means the arising of rāga.
Samudaya là sự khởi lên của tham ái.
Atha vā rūpagatassa udayaṃ.
Alternatively, the arising of the rūpa-aggregate.
Hoặc là sự khởi lên của sắc uẩn.
Ādānanti nibbattanavasena kilesānaṃ ādānaṃ.
Ādāna means the grasping of defilements by way of their arising.
Ādāna là sự chấp thủ các phiền não theo cách tái sinh.
Vedanārammaṇatātiādīni idha ca heṭṭhā ca vuttanayeneva veditabbāni.
“Being an object of feeling,” and so on, should be understood here and below in the stated manner.
Các từ “vedanārammaṇatā” v.v... ở đây và ở dưới cần được hiểu theo cách đã nói.
1050
Gāthāsu pana vatthusaṅkamanāti rūpādīsu ekekassa bhaṅgaṃ disvā puna yena cittena bhaṅgo diṭṭho, tassāpi bhaṅgadassanavasena purimavatthuto aññavatthusaṅkamanā.
However, in the verses, vatthusaṅkamanā means seeing the dissolution of each of the rūpa-aggregates, etc., and then the transition from the former object to another object by way of seeing the dissolution of the mind with which that dissolution was seen.
Trong các bài kệ, vatthusaṅkamanā (sự chuyển đổi đối tượng) là sau khi thấy sự hoại diệt của từng sắc uẩn v.v..., rồi lại thấy sự hoại diệt của tâm đã thấy sự hoại diệt ấy, theo cách đó là sự chuyển đổi từ đối tượng trước sang đối tượng khác.
Paññāya ca vivaṭṭanāti udayaṃ pahāya vaye santiṭṭhanā.
Paññāya ca vivaṭṭanā means the wisdom that, having abandoned arising, stands in dissolution.
Paññāya ca vivaṭṭanā (và sự xoay chuyển của tuệ) là tuệ trú trong sự hoại diệt sau khi từ bỏ sự sinh khởi.
Āvajjanā balañcevāti rūpādīsu ekekassa bhaṅgaṃ disvā puna bhaṅgārammaṇassa cittassa bhaṅgadassanatthaṃ anantarameva āvajjanasamatthatā.
Āvajjanā balañcevā means the ability to immediately advert (to the mind’s dissolution) after seeing the dissolution of each of the rūpa-aggregates, etc., in order to see the dissolution of the mind whose object is that dissolution.
Āvajjanā balañcevā (sự chú ý và năng lực) là khả năng chú ý ngay lập tức để thấy sự hoại diệt của tâm lấy sự hoại diệt làm đối tượng, sau khi thấy sự hoại diệt của từng sắc uẩn v.v...
Paṭisaṅkhā vipassanāti esā ārammaṇapaṭisaṅkhā bhaṅgānupassanā nāma.
Paṭisaṅkhā vipassanā means this reflection on the object is called contemplation of dissolution (bhaṅgānupassanā).
Paṭisaṅkhā vipassanā (tuệ quán phân tích) – sự phân tích đối tượng này được gọi là quán sát sự hoại diệt (bhaṅgānupassanā).
Ārammaṇaanvayena ubho ekavavatthanāti paccakkhato diṭṭhassa ārammaṇassa anvayena anugamanena yathā idaṃ, tathā atītepi saṅkhāragataṃ bhijji, anāgatepi bhijjissatīti evaṃ ubhinnaṃ ekasabhāveneva vavatthāpananti attho.
Ārammaṇaanvayena ubho ekavavatthanā means, by following the object seen directly, establishing both (past and future aggregates) as having the same nature, just as this (present aggregate) dissolves, so too did the saṅkhāra-aggregate dissolve in the past, and it will dissolve in the future; this is the meaning.
Ārammaṇaanvayena ubho ekavavatthanā (cả hai được xác định là một theo đối tượng) nghĩa là theo sự liên tục của đối tượng đã thấy một cách trực tiếp, rằng giống như pháp này, các hành trong quá khứ cũng đã hoại diệt, và trong tương lai cũng sẽ hoại diệt, như vậy là xác định cả hai có cùng bản chất.
Vuttampi cetaṃ porāṇehi –
And it has been said by the ancients:
Các bậc cổ đức cũng đã nói điều này:
1051
‘‘Saṃvijjamānamhi visuddhadassano, tadanvayaṃ neti atītanāgate;
“One with pure vision in what exists, extends that analogy to the past and future;
“Người thấy rõ ràng trong hiện tại, sẽ suy luận về quá khứ và vị lai;
1052
Sabbepi saṅkhāragatā palokino, ussāvabindū sūriyeva uggate’’ti.
All saṅkhāra-formations are perishable, like dewdrops when the sun has risen.”
Tất cả các hành đều hoại diệt, như giọt sương tan khi mặt trời mọc.”
1053
Nirodhe adhimuttatāti evaṃ ubhinnaṃ bhaṅgavasena ekavavatthānaṃ katvā tasmiṃyeva bhaṅgasaṅkhāte nirodhe adhimuttatā taggarutā tanninnatā tappoṇatā tappabbhāratāti attho.
Nirodhe adhimuttatā means, having thus established both (past and future aggregates) by way of dissolution, being intent on that very dissolution, that is, nirodha, being devoted to it, inclined towards it, leaning towards it, tending towards it; this is the meaning.
Nirodhe adhimuttatā (sự hướng tâm đến sự diệt trừ) nghĩa là sau khi xác định cả hai (quá khứ và vị lai) là một theo cách hoại diệt, thì sự hướng tâm, sự chú trọng, sự nghiêng về, sự hướng tới, sự thiên về chính sự diệt trừ (nirodha) được gọi là sự hoại diệt ấy.
Vayalakkhaṇavipassanāti esā vayalakkhaṇavipassanā nāmāti vuttaṃ hoti.
Vayalakkhaṇavipassanā means this is called contemplation of the characteristic of dissolution.
Điều này được gọi là tuệ quán về đặc tính hoại diệt (vayalakkhaṇavipassanā).
Ārammaṇañca paṭisaṅkhāti purimañca rūpādiārammaṇaṃ jānitvā.
Ārammaṇañca paṭisaṅkhā means knowing the former object of rūpa, etc.
Ārammaṇañca paṭisaṅkhā (và phân tích đối tượng) là sau khi biết đối tượng sắc uẩn v.v... trước đó.
Bhaṅgañca anupassatīti tassārammaṇassa bhaṅgaṃ disvā tadārammaṇassa cittassa ca bhaṅgaṃ anupassati.
Bhaṅgañca anupassatīti means seeing the dissolution of that object and then contemplating the dissolution of the mind whose object is that (dissolution).
Bhaṅgañca anupassatī (và quán sát sự hoại diệt) là sau khi thấy sự hoại diệt của đối tượng ấy, thì quán sát sự hoại diệt của tâm lấy đối tượng ấy làm đối tượng.
Suññato ca upaṭṭhānanti tassevaṃ bhaṅgamanupassato ‘‘saṅkhārāva bhijjanti, tesaṃ bhedo maraṇaṃ, na añño koci atthī’’ti suññato upaṭṭhānaṃ ijjhati.
Suññato ca upaṭṭhāna means for one who thus contemplates dissolution, the manifestation as emptiness arises: “Only saṅkhāras dissolve; their breaking is death; there is no other.”
Suññato ca upaṭṭhāna (và sự hiện hữu của tánh không) là khi quán sát sự hoại diệt như vậy, đối với người ấy, sự hiện hữu của tánh không được thành tựu, rằng “chỉ có các hành hoại diệt, sự hoại diệt của chúng là cái chết, không có gì khác.”
Tenāhu porāṇā –
Therefore, the ancients said:
Vì thế các bậc cổ đức đã nói:
1054
‘‘Khandhā nirujjhanti na catthi añño, khandhāna bhedo maraṇanti vuccati;
“The aggregates dissolve, and there is no other; the breaking of the aggregates is called death;
“Các uẩn diệt đi mà không có gì khác, sự hoại diệt của các uẩn được gọi là cái chết;
1055
Tesaṃ khayaṃ passati appamatto, maṇiṃva vijjhaṃ vajirena yoniso’’ti.
The diligent one sees their destruction, piercing a gem with a diamond appropriately.”
Người không phóng dật thấy sự tiêu diệt của chúng, như người thợ kim hoàn khéo léo đục xuyên ngọc bằng kim cương.”
1056
Adhipaññā vipassanāti yā ca ārammaṇapaṭisaṅkhā, yā ca bhaṅgānupassanā, yañca suññato upaṭṭhānaṃ, ayaṃ adhipaññā vipassanā nāmāti vuttaṃ hoti.
Adhipaññā vipassanā means that reflection on the object, that contemplation of dissolution, and that manifestation as emptiness—this is called higher wisdom vipassanā.
Adhipaññā vipassanā (tuệ quán siêu việt) là sự phân tích đối tượng, sự quán sát sự hoại diệt, và sự hiện hữu của tánh không – tất cả những điều này được gọi là tuệ quán siêu việt.
Kusalo tīsu anupassanāsūti aniccānupassanādīsu tīsu cheko bhikkhu.
Kusalo tīsu anupassanāsūti means a bhikkhu who is skilled in the three contemplations, such as contemplation of impermanence (aniccānupassanā), etc.
Kusalo tīsu anupassanāsū (người khéo léo trong ba pháp quán sát) là Tỳ-khưu thiện xảo trong ba pháp quán sát vô thường v.v...
Catasso ca vipassanāsūti nibbidādīsu ca catūsu vipassanāsu.
Catasso ca vipassanāsūti and in the four vipassanās, such as disenchantment (nibbidā), etc.
Bốn tuệ quán (vipassanā) là bốn tuệ quán như chán ghét (nibbidā) v.v.
Tayo upaṭṭhāne kusalatāti khayato vayato suññatoti imasmiñca tividhe upaṭṭhāne kusalatāya.
Tayo upaṭṭhāne kusalatāti and in skill in these three kinds of manifestation: as destruction, as dissolution, and as emptiness.
Khéo léo trong ba sự an trú là sự khéo léo trong ba cách an trú này: theo khía cạnh hoại diệt (khayato), theo khía cạnh biến mất (vayato), và theo khía cạnh tánh không (suññato).
Nānādiṭṭhīsu na kampatīti sassatadiṭṭhiādīsu nānappakārāsu diṭṭhīsu na vedhati.
Nānādiṭṭhīsu na kampatīti means he does not waver amidst various wrong views, such as the eternalist view (sassatadiṭṭhi), etc.
Không dao động trước các tà kiến khác nhau là không chao động trước các tà kiến đa dạng như thường kiến (sassatadiṭṭhi) v.v.
So evaṃ avedhamāno ‘‘aniruddhameva nirujjhati, abhinnameva bhijjatī’’ti pavattamanasikāro dubbalabhājanassa viya bhijjamānassa, sukhumarajasseva vippakiriyamānassa, tilānaṃ viya bhajjiyamānānaṃ sabbasaṅkhārānaṃ uppādaṭṭhitipavattanimittaṃ vissajjetvā bhedameva passati.
Thus, being unshaken by wrong views, that yogi, whose attention is directed to ‘what has not yet ceased, ceases; what has not yet broken, breaks,’ abandons the signs of arising, standing, and continuity of all saṅkhāras, and sees only their breaking, just as one sees the breaking of a fragile pot, or the scattering of fine dust, or the perishing of sesame seeds being roasted.
Vị ấy, không chao động như vậy, với tác ý rằng “cái chưa diệt thì diệt, cái chưa tan thì tan”, từ bỏ dấu hiệu của sự sinh, trụ, và diễn tiến của tất cả các pháp hữu vi, như một cái bình yếu ớt đang vỡ, như bụi mịn đang tan tác, như hạt mè đang rang, chỉ thấy sự hoại diệt.
So yathā nāma cakkhumā puriso pokkharaṇītīre vā nadītīre vā ṭhito thūlaphusitake deve vassante udakapiṭṭhe mahantamahantāni udakapubbuḷāni uppajjitvā uppajjitvā sīghaṃ sīghaṃ bhijjamānāni passeyya, evameva sabbe saṅkhārā bhijjanti bhijjantīti passati.
Just as a man with sight, standing on the bank of a pond or a river, might see large water-bubbles arising and swiftly breaking on the surface of the water when a heavy rain falls, even so, that yogi sees all saṅkhāras breaking, breaking.
Như một người có mắt đứng bên bờ ao hay bờ sông, khi trời mưa hạt lớn, thấy những bong bóng nước rất lớn nổi lên trên mặt nước, rồi vỡ tan rất nhanh chóng, cũng vậy, hành giả thấy rằng tất cả các hành (saṅkhārā) đều đang hoại diệt, đang hoại diệt.
Evarūpañhi yogāvacaraṃ sandhāya vuttaṃ bhagavatā –
It was with reference to such a yogi that the Blessed One said:
Chính vì hành giả như vậy mà Thế Tôn đã nói:
1057
‘‘Yathā pubbuḷakaṃ passe, yathā passe marīcikaṃ;
“As one would look upon a bubble, as one would look upon a mirage;
“Hãy nhìn bong bóng nước, hãy nhìn ảo ảnh;
1058
Evaṃ lokaṃ avekkhantaṃ, maccurājā na passatī’’ti.(dha. pa. 170);
The King of Death does not see one who thus looks upon the world.”
Kẻ nào nhìn thế gian như vậy, Vua chúa của sự chết không thấy kẻ ấy.”
1059
Tassevaṃ ‘‘sabbe saṅkhārā bhijjanti bhijjantī’’ti abhiṇhaṃ passato aṭṭhānisaṃsaparivāraṃ bhaṅgānupassanāñāṇaṃ balappattaṃ hoti.
When he thus constantly sees “all saṅkhāras break, break,” his knowledge of the contemplation of dissolution (bhaṅgānupassanāñāṇa) becomes strong, accompanied by eight benefits.
Khi hành giả thường xuyên thấy rằng “tất cả các hành đều đang hoại diệt, đang hoại diệt” như vậy, thì trí tuệ quán hoại diệt (bhaṅgānupassanāñāṇa) được bao quanh bởi tám lợi ích sẽ trở nên mạnh mẽ.
Tatrime aṭṭhānisaṃsā – bhavadiṭṭhippahānaṃ, jīvitanikantipariccāgo, sadāyuttapayuttatā, visuddhājīvitā, ussukkappahānaṃ, vigatabhayatā, khantisoraccapaṭilābho, aratiratisahanatāti.
These are the eight benefits: the abandonment of bhava-view, the renunciation of attachment to life, constant diligence, purified livelihood, the abandonment of zealous striving, freedom from fear, the attainment of patience and gentleness, and endurance of discontent and contentment.
Trong đó, đây là tám lợi ích: từ bỏ tà kiến về hữu (bhavadiṭṭhippahāna), từ bỏ sự ham thích vào sự sống (jīvitanikantipariccāgo), luôn tinh cần (sadāyuttapayuttatā), đời sống trong sạch (visuddhājīvitā), từ bỏ sự lo lắng (ussukkappahānaṃ), không còn sợ hãi (vigatabhayatā), đạt được sự nhẫn nại và ôn hòa (khantisoraccapaṭilābho), và chịu đựng được sự bất lạc và lạc (aratiratisahanatā).
Tenāhu porāṇā –
Therefore, the ancients said:
Vì vậy, các bậc cổ nhân đã nói:
1060
‘‘Imāni aṭṭhagguṇamuttamāni, disvā tahiṃ sammasatī punappunaṃ;
“Seeing these eight supreme qualities,
“Sau khi thấy tám đức tính tối thượng này, vị ẩn sĩ quán hoại diệt (bhaṅgānupassī) để đạt được bất tử (amata), giống như người có khăn vải hay đầu đang cháy, quán xét lại nhiều lần.”
1061
Ādittacelassirasūpamo muni, bhaṅgānupassī amatassa pattiyā’’ti.
The sage, contemplating dissolution, strives again and again for the attainment of the Deathless, like one whose head or clothes are aflame.”
Bậc hiền giả (muni) ví như người đầu và khăn bị cháy, quán sát sự hoại diệt để đạt đến bất tử (amatassa pattiyā).”
1062
Bhaṅgānupassanāñāṇaniddesavaṇṇanā niṭṭhitā.
The description of the knowledge of the contemplation of dissolution is concluded.
Phần giải thích về trí tuệ quán hoại diệt (Bhaṅgānupassanāñāṇa) đã hoàn tất.
1063

8. Ādīnavañāṇaniddesavaṇṇanā

8. Description of the Knowledge of Adversity (Ādīnavañāṇa)

8. Giải thích về trí tuệ quán sự nguy hiểm (Ādīnavañāṇa)

1064
53. Ādīnavañāṇaniddese uppādoti purimakammapaccayā idha uppatti.
In the description of the knowledge of adversity, arising (uppāda) means arising here due to past kamma.
53. Trong phần giải thích về trí tuệ quán sự nguy hiểm (ādīnavañāṇa), sự sinh khởi (uppādo) là sự sinh khởi ở đây do nghiệp quá khứ làm nhân.
Pavattanti tathāuppannassa pavatti.
Continuity (pavatta) means the continuity of what has thus arisen.
Sự tiếp diễn (pavattaṃ) là sự tiếp diễn của cái đã sinh khởi như vậy.
Nimittanti sabbampi saṅkhāranimittaṃ.
Sign (nimitta) means all saṅkhāra-signs.
Tướng (nimittaṃ) là tất cả các tướng của hành (saṅkhāra).
Āyūhanāti āyatiṃ paṭisandhihetubhūtaṃ kammaṃ.
Accumulation (āyūhanā) means kamma that is the cause of future rebirth.
Sự tích lũy (āyūhanā) là nghiệp làm nhân cho sự tái tục (paṭisandhi) trong tương lai.
Paṭisandhīti āyatiṃ uppatti.
Rebirth (paṭisandhi) means future arising.
Tái tục (paṭisandhī) là sự sinh khởi trong tương lai.
Gatīti yāya gatiyā sā paṭisandhi hoti.
Destination (gati) means the destination in which that rebirth occurs.
Cảnh giới (gatī) là cảnh giới mà sự tái tục đó xảy ra.
Nibbattīti khandhānaṃ nibbattanaṃ.
Generation (nibbattī) means the generation of the aggregates.
Sự sinh ra (nibbattī) là sự sinh ra của các uẩn (khandha).
Upapattīti ‘‘samāpannassa vā upapannassa vā’’ti (dha. sa. 1289) evaṃ vuttā vipākappavatti.
Existence (upapattī) means the continuity of vipāka, as stated in phrases like “of one who has attained or one who has come into existence.”
Sự tái sinh (upapattī) là sự tiếp diễn của quả (vipāka) được nói đến như: “của người nhập định hay của người tái sinh” (Dhamma. Sa. 1289).
Jātīti jarādīnaṃ paccayabhūtā bhavapaccayā jāti.
Birth (jāti) means birth conditioned by existence, which is a cause for old age and so on.
Sự sinh (jātī) là sự sinh do hữu làm nhân, là nhân của già (jarā) và các khổ khác.
Nippariyāyato tattha tattha nibbattamānānaṃ sattānaṃ ye ye khandhā pātubhavanti, tesaṃ paṭhamapātubhāvo jāti.
In a non-figurative sense, birth is the first manifestation of the aggregates that appear in beings generated in various existences.
Không theo cách gián tiếp, sự sinh là sự xuất hiện đầu tiên của các uẩn của chúng sinh được sinh ra ở từng nơi.
Jarāti khaṇḍiccādisammato santatiyaṃ ekabhavapariyāpannakhandhasantānassa purāṇabhāvo.
Old age (jarā) means the aging of the continuum of aggregates belonging to a single existence, as understood by tooth decay and so on.
Sự già (jarā) là trạng thái cũ kỹ của dòng uẩn thuộc một đời sống trong sự liên tục (santati), được chấp nhận là sự sứt mẻ, rụng rời, v.v.
Sokoti ñātibyasanādīhi phuṭṭhassa cittasantāpo.
Sorrow (soko) means mental affliction of one afflicted by the loss of relatives and so on.
Sự sầu (soko) là sự đau buồn trong tâm của người bị chạm đến bởi sự mất mát người thân, v.v.
Paridevoti ñātibyasanādīhi phuṭṭhassa vacīpalāpo.
Lamentation (paridevo) means vocal lamentation of one afflicted by the loss of relatives and so on.
Than vãn (paridevo) là lời than vãn của người bị chạm đến bởi sự mất mát người thân, v.v.
Upāyāsoti bhuso āyāso, ñātibyasanādīhi phuṭṭhassa adhimattacetodukkhappabhāvito dosoyeva.
Despair (upāyāso) means extreme affliction; it is simply excessive hatred arising from mental suffering of one afflicted by the loss of relatives and so on.
Sự tuyệt vọng (upāyāso) là sự đau khổ tột cùng, chính là sân (dosa) được biểu hiện qua sự đau khổ tâm lý quá mức của người bị chạm đến bởi sự mất mát người thân, v.v.
Ettha ca uppādādayo pañceva ādīnavañāṇassa vatthuvasena vuttā, sesā tesaṃ vevacanavasena.
Here, the five terms, arising and so on, are stated as the basis for the knowledge of adversity, while the others are synonyms for them.
Trong đây, năm điều: sự sinh khởi (uppāda), v.v., được nói đến theo nghĩa là đối tượng của trí tuệ quán sự nguy hiểm (ādīnavañāṇa), còn các điều khác được nói đến theo nghĩa là từ đồng nghĩa của chúng.
‘‘Nibbatti jātī’’ti idañhi dvayaṃ uppādassa ceva paṭisandhiyā ca vevacanaṃ, ‘‘gati upapattī’’ti idaṃ dvayaṃ pavattassa, jarādayo nimittassāti.
Indeed, the pair “generation, birth” are synonyms for arising and rebirth; the pair “destination, existence” are synonyms for continuity; and old age and so on are synonyms for sign.
Hai điều “sự sinh ra (nibbatti) và sự sinh (jāti)” này là từ đồng nghĩa của sự sinh khởi (uppāda) và tái tục (paṭisandhi); hai điều “cảnh giới (gati) và tái sinh (upapatti)” này là của sự tiếp diễn (pavatta); còn già (jarā), v.v., là của tướng (nimitta).
Tenāha –
Therefore, it is said:
Vì vậy, đã nói:
1065
‘‘Uppādañca pavattañca, nimittaṃ dukkhanti passati;
“One sees arising and continuity, and sign as suffering;
“Thấy sự sinh khởi, sự tiếp diễn, tướng là khổ;
1066
Āyūhanaṃ paṭisandhiṃ, ñāṇaṃ ādīnave ida’’nti.
Accumulation and rebirth—this is the knowledge of adversity.”
Sự tích lũy, tái tục, đây là trí tuệ quán sự nguy hiểm.”
ca
And:
1067
‘‘Idaṃ ādīnave ñāṇaṃ, pañcaṭhānesu jāyatī’’ti.
“This knowledge of adversity arises in five ways.”
“Trí tuệ quán sự nguy hiểm này sinh khởi ở năm nơi.”
ca
And:
1068
Sabbapadesu ca bhayanti iccetassa vacanassa bhayaṃ itīti padacchedo.
In all passages, the word bhayaṃ should be parsed as bhayaṃ iti.
Ở tất cả các đoạn văn, từ bhayaṃ có nghĩa là sợ hãi, và iti là sự giải thích nguyên nhân của sự hiện diện của nỗi sợ hãi. (phân tách từ: bhayaṃ iti)
Bhayanti pīḷāyogato sappaṭibhayatāya bhayaṃ.
Fear (bhayaṃ) is fear due to its connection with oppression and its perilous nature.
Sợ hãi (bhayaṃ) là sự sợ hãi do liên quan đến sự đau khổ, do có mối đe dọa.
Itīti bhayatupaṭṭhānassa kāraṇaniddeso.
Iti is the indication of the cause for the manifestation of fear.
Iti là sự chỉ rõ nguyên nhân của sự hiện diện của nỗi sợ hãi.
1069
Anuppādo khemanti santipade ñāṇantiādi pana ādīnavañāṇassa paṭipakkhañāṇadassanatthaṃ vuttaṃ.
However, the phrase “ knowledge in the peaceful state of non-arising, security” and so on, is stated to show the opposing knowledge to the knowledge of adversity.
Tuy nhiên, câu nói “Không sinh khởi là an ổn, trí tuệ trong cảnh giới tịch tịnh” v.v., được nói ra để chỉ ra trí tuệ đối nghịch với trí tuệ về sự nguy hiểm (ādīnavañāṇa).
Bhayatupaṭṭhānena vā ādīnavaṃ disvā ubbiggahadayānaṃ abhayampi atthi khemaṃ nirādīnavanti assāsajananatthampi etaṃ vuttaṃ.
Or, it is stated to generate reassurance in those whose hearts are agitated, having seen the adversity through the manifestation of fear, that there is also a state of fearlessness, security, and freedom from adversity.
Hoặc, câu này cũng được nói ra để tạo sự an ủi cho những ai có tâm hồn bàng hoàng, sau khi đã thấy sự nguy hiểm (ādīnava) qua sự hiện diện của nỗi sợ hãi (bhayatupaṭṭhāna), rằng cũng có sự vô úy, an ổn và không có sự nguy hiểm.
Yasmā vā yassa uppādādayo bhayato sūpaṭṭhitā honti, tassa tappaṭipakkhaninnaṃ cittaṃ hoti, tasmā bhayatupaṭṭhānavasena siddhassa ādīnavañāṇassa ānisaṃsadassanatthampetaṃ vuttanti veditabbaṃ.
Or, because for whom the arising and so forth appear as fearful, for that person, the mind inclines towards the opposite of those (arising and so forth), therefore, it should be understood that this (statement) was made to show the benefit of the knowledge of danger (ādīnavañāṇa) that has been perfected by means of the apprehension of fear (bhayatupaṭṭhāna).
Hoặc, cần phải hiểu rằng câu này cũng được nói ra để chỉ ra lợi ích của trí tuệ về sự nguy hiểm (ādīnavañāṇa) đã thành tựu nhờ sự hiện diện của nỗi sợ hãi, bởi vì khi sự sinh khởi v.v. hiện ra rõ ràng như một mối nguy hiểm đối với một người, thì tâm của người ấy sẽ hướng về điều đối nghịch với chúng.
Anuppādo appavattantiādi nibbānameva.
The statement beginning with " non-arising, non-occurrence" refers to Nibbāna itself.
“Không sinh khởi, không vận hành” v.v. chính là Nibbāna.
Santipadeti santikoṭṭhāse, nibbāneti attho.
" In the state of peace" means in the realm of peace, i.e., Nibbāna.
“Trong cảnh giới tịch tịnh” (santipade) có nghĩa là trong phần tịch tịnh, tức là trong Nibbāna.
Anussavavasenāpi hi santipadanti nāmamattaṃ gahetvā uppannaṃ ñāṇampi ‘‘santipade ñāṇa’’nti vuttaṃ.
Indeed, even knowledge that has arisen merely by grasping the name "state of peace" through hearsay is called "knowledge in the state of peace."
Ngay cả trí tuệ phát sinh chỉ bằng cách tiếp thu danh từ “cảnh giới tịch tịnh” (santipada) qua truyền thống cũng được gọi là “trí tuệ trong cảnh giới tịch tịnh”.
1070
Uppādo bhayaṃ, anuppādo khemantiādi vipakkhapaṭipakkhavasena ubhayaṃ samāsetvā uppajjamānaṃ ñāṇaṃ gahetvā vuttaṃ.
The statement beginning with " arising is fear, non-arising is security" was made by taking the knowledge that arises by encompassing both (arising and non-arising) in terms of opponent and counter-opponent.
“Sinh khởi là sợ hãi, không sinh khởi là an ổn” v.v. được nói ra khi gộp cả hai, theo cách đối lập và không đối lập, và tiếp nhận trí tuệ đang phát sinh.
Ettha ca yaṃ bhayaṃ, taṃ yasmā niyamato dukkhaṃ.
And here, that which is fear is necessarily suffering.
Ở đây, điều gì là sợ hãi thì nhất định là khổ.
Yañca dukkhaṃ, taṃ vaṭṭāmisalokāmisakilesāmisehi avippamuttattā sāmisameva.
And that which is suffering is always accompanied by bait (sāmisa) because it is not free from the bait of saṃsāra, worldly bait, and defilement bait.
Và điều gì là khổ thì chắc chắn là có vị (sāmisa), vì nó không thoát khỏi sự vị ái của vòng luân hồi, vị ái của thế gian và vị ái của phiền não.
Yañca sāmisaṃ, taṃ saṅkhāramattameva.
And that which is accompanied by bait is merely a conditioned phenomenon (saṅkhāra).
Và điều gì có vị thì chỉ là các hành (saṅkhāra).
Tasmā uppādo dukkhanti bhayatupaṭṭhāne paññā ādīnave ñāṇantiādi vuttaṃ.
Therefore, the statement beginning with " arising is suffering, wisdom in the apprehension of fear is knowledge of danger" was made.
Vì vậy, câu “Sinh khởi là khổ, tuệ trong sự hiện diện của nỗi sợ hãi là trí tuệ về sự nguy hiểm” v.v. đã được nói ra.
Evaṃ santepi bhayākārena dukkhākārena sāmisākārena saṅkhārākārenāti evaṃ ākāranānattato pavattivasenettha nānattaṃ veditabbaṃ.
Even so, the difference here should be understood as a difference in mode of occurrence due to the diversity of aspects: as an aspect of fear, as an aspect of suffering, as an aspect of bait, and as an aspect of conditioned phenomena.
Mặc dù là như vậy, nhưng sự khác biệt ở đây cần được hiểu là do sự khác biệt về phương diện hiện hữu, tức là theo phương diện sợ hãi, phương diện khổ, phương diện có vị và phương diện các hành.
Uppādo bhayaṃ, dukkhaṃ, sāmisaṃ, saṅkhārā cāti uppādādiliṅgamanapekkhitvā ‘‘netaṃ kho saraṇaṃ khemaṃ, netaṃ saraṇamuttama’’ntiādīsu (dha. pa. 189) viya attano liṅgāpekkhameva vuttaṃ.
"Arising is fear, suffering, bait, and conditioned phenomena" was stated with regard to its own gender, without considering the gender of "arising" and so forth, just as in phrases like "This refuge is not secure, this refuge is not supreme."
“Sinh khởi là sợ hãi, khổ, có vị, và các hành” đã được nói ra mà không cần quan tâm đến giống của từ ‘sinh khởi’ v.v., mà chỉ quan tâm đến giống của chính nó, giống như trong các câu “Đây không phải là nơi nương tựa an ổn, đây không phải là nơi nương tựa tối thượng” v.v.
Saṅkhārāti ca ekattamanapekkhitvā ‘‘appaccayā dhammā, asaṅkhatā dhammā’’tiādīsu (dha. sa. dukamātikā 7-8) viya bahuvacanaṃ kataṃ, uppādādīnaṃ vā saṅkhārekadesattā ‘‘uttare pañcālā, dakkhiṇe pañcālā’’tiādīsu viya bahunnaṃ ekadesepi bahuvacanaṃ katanti veditabbaṃ.
And the plural form "conditioned phenomena" was used without considering the singular nature (of saṅkhāra), just as in phrases like "phenomena without conditions, unconditioned phenomena," or it should be understood that the plural was used for a part of many, like "northern Pañcālas, southern Pañcālas," because arising and so forth are parts of conditioned phenomena.
Và từ “các hành” (saṅkhārā) được dùng ở số nhiều mà không quan tâm đến tính đơn nhất, giống như trong các câu “Các pháp không duyên, các pháp vô vi” v.v. Hoặc, vì các pháp sinh khởi v.v. là một phần của các hành, nên số nhiều được dùng cho một phần của nhiều điều, giống như trong các câu “Pañcālā phía bắc, Pañcālā phía nam” v.v.
Khemaṃ sukhaṃ nirāmisaṃ nibbānanti nibbānameva vuttākārānaṃ paṭipakkhavasena catudhā vuttaṃ.
" Security, happiness, unbaited, Nibbāna" refers to Nibbāna itself, described in four ways in opposition to the aforementioned aspects.
“An ổn, lạc, vô vị, Nibbāna” – Nibbāna được nói ra theo bốn cách đối nghịch với các phương diện đã nói.
Dasa ñāṇe pajānātīti ādīnave ñāṇaṃ pajānanto uppādādivatthukāni pañca, anuppādādivatthukāni pañcāti dasa ñāṇe pajānāti paṭivijjhati sacchikaroti.
" He understands ten knowledges" means that one who understands the knowledge of danger understands, penetrates, and realizes ten knowledges: five based on arising and so forth, and five based on non-arising and so forth.
“Biết mười trí tuệ”: Người biết trí tuệ về sự nguy hiểm, biết mười trí tuệ—năm trí tuệ có đối tượng là sự sinh khởi v.v., và năm trí tuệ có đối tượng là sự không sinh khởi v.v.—thấu hiểu và chứng ngộ chúng.
Dvinnaṃ ñāṇānaṃ kusalatāti ādīnavañāṇassa ceva santipadañāṇassa cāti imesaṃ dvinnaṃ ñāṇānaṃ kusalatāya.
" Skill in two knowledges" refers to skill in these two knowledges: the knowledge of danger and the knowledge of the state of peace.
“Sự thiện xảo trong hai trí tuệ” có nghĩa là sự thiện xảo trong hai trí tuệ này, tức là trí tuệ về sự nguy hiểm và trí tuệ về cảnh giới tịch tịnh.
Nānādiṭṭhīsu na kampatīti paramadiṭṭhadhammanibbānādivasena pavattāsu diṭṭhīsu na vedhatīti.
" He does not waver in various views" means he is not shaken by views that arise concerning Nibbāna, the highest seen Dhamma, and so forth.
“Không dao động giữa các tà kiến khác nhau” có nghĩa là không bị lung lay bởi các tà kiến phát sinh liên quan đến Nibbāna, là pháp được thấy tối thượng, v.v.
1071
Ādīnavañāṇaniddesavaṇṇanā niṭṭhitā.
The commentary on the exposition of the Knowledge of Danger is concluded.
Phần giải thích về trí tuệ về sự nguy hiểm đã hoàn tất.
1072
9. Saṅkhārupekkhāñāṇaniddesavaṇṇanā
9. Commentary on the Exposition of Knowledge of Equanimity Regarding Formations (Saṅkhārupekkhāñāṇa)
9. Giải thích về trí tuệ xả bỏ các hành (Saṅkhārupekkhāñāṇa)
1073
54. Saṅkhārupekkhāñāṇaniddese uppādādīni vuttatthāneva.
In the exposition of Saṅkhārupekkhāñāṇa, words like " arising" have the same meaning as before.
54. Trong phần giải thích về trí tuệ xả bỏ các hành, các từ “sinh khởi” (uppādā) v.v. có ý nghĩa như đã nói.
Dukkhanti bhayanti sāmisanti saṅkhārāti uppādādimuñcanañāṇassa kāraṇavacanāni.
" Suffering," " fear," " with bait," and " conditioned phenomena" are words indicating the cause for the knowledge that releases from arising and so forth.
Các từ “khổ”, “sợ hãi”, “có vị”, “các hành” là những từ chỉ nguyên nhân của trí tuệ giải thoát khỏi sự sinh khởi v.v.
Evañca lakkhaṇato saṅkhārupekkhaṃ dassetvā idāni atthato dassetuṃ uppādo saṅkhārā, te saṅkhāre ajjhupekkhatīti saṅkhārupekkhātiādimāha.
Having thus shown saṅkhārupekkhā by its characteristic, now to show it by its meaning, the text states, " Arising is conditioned phenomena, and equanimity regarding those conditioned phenomena is saṅkhārupekkhā," and so forth.
Sau khi đã chỉ ra Saṅkhārupekkhā theo đặc tính như vậy, giờ đây để chỉ ra theo ý nghĩa, Ngài nói “Sự sinh khởi là các hành, xả bỏ các hành ấy gọi là Saṅkhārupekkhā” v.v.
Tattha saṅkhāre ajjhupekkhatīti tassa āraddhavipassakassa vipassanāñāṇena lakkhaṇattayassa diṭṭhattā lakkhaṇavicinane pahīnabyāpārassa āditte viya tayo bhave passato saṅkhāraggahaṇe majjhattassa taṃ vipassanāñāṇaṃ te saṅkhāre visesena ca ikkhati, gahaṇena vajjitañca hutvā ikkhati oloketīti saṅkhārupekkhā nāmāti attho.
Here, " is equanimity regarding conditioned phenomena" means that for the meditator who has commenced practice, due to having seen the three characteristics with vipassanā knowledge, and whose activity of investigating characteristics has ceased, viewing the three existences as if they were ablaze, that vipassanā knowledge is neutral in grasping conditioned phenomena. It particularly observes those conditioned phenomena and observes them free from grasping, hence it is called saṅkhārupekkhā.
Ở đó, “xả bỏ các hành” (saṅkhāre ajjhupekkhati) có nghĩa là: đối với hành giả đã tinh tấn tu tập thiền quán, vì đã thấy ba đặc tính (vô thường, khổ, vô ngã) bằng tuệ quán, nên hành giả ấy đã từ bỏ việc phân tích các đặc tính, và giống như nhìn thấy ba ngôi nhà đang cháy, hành giả ấy trở nên thờ ơ với việc chấp thủ các hành. Tuệ quán ấy đặc biệt quán sát các hành ấy, và quán sát mà không chấp thủ. Do đó, nó được gọi là Saṅkhārupekkhā.
Yathā loke visesena jayanto adhijayatīti, annena vajjito vasanto upavasatīti vuccati.
Just as in the world, one who conquers exceptionally is said to "overcome," and one who dwells abstaining from food is said to "fast."
Giống như trong đời thường, người chiến thắng một cách đặc biệt được gọi là “chiến thắng vượt trội” (adhijayati), và người sống mà không ăn được gọi là “giữ giới” (upavasati).
Puna saṅkhāre aniccādito vipassitvā gahaṇe majjhattabhāvasaṇṭhitaṃ saṅkhārupekkhampi aniccādito vipassitvā tassāpi saṅkhārupekkhāya gahaṇe majjhattākārasaṇṭhitāya saṅkhārupekkhāya sabbhāvato ye ca saṅkhārā yā ca upekkhātiādi vuttaṃ.
Furthermore, having discerned conditioned phenomena as impermanent and so forth, and due to the existence of saṅkhārupekkhā that is established in a state of neutrality regarding grasping, and again, having discerned even that saṅkhārupekkhā as impermanent and so forth, and due to the existence of saṅkhārupekkhā that is established in a state of neutrality regarding the grasping of that very saṅkhārupekkhā, the statement " both conditioned phenomena and equanimity" and so forth was made.
Hơn nữa, sau khi quán sát các hành (saṅkhāra) theo vô thường v.v., và trí tuệ xả bỏ các hành (saṅkhārupekkhā) đã an trú trong trạng thái thờ ơ đối với sự chấp thủ, trí tuệ xả bỏ các hành ấy cũng được quán sát theo vô thường v.v. Vì vậy, do sự tồn tại của trí tuệ xả bỏ các hành đã an trú trong trạng thái thờ ơ đối với sự chấp thủ của chính trí tuệ xả bỏ các hành ấy, nên câu “những gì là các hành và những gì là xả bỏ” v.v. đã được nói ra.
1074
55. Idāni saṅkhārupekkhāya cittābhinīhārabhedaṃ dassetuṃ katihākārehītiādimāha.
Now, to show the distinction of the mind's inclination in saṅkhārupekkhā, the text begins with " in how many ways."
55. Bây giờ, để chỉ ra sự khác biệt trong việc hướng tâm đến Saṅkhārupekkhā, Ngài nói “Bằng bao nhiêu phương diện?” v.v.
Tattha saṅkhārupekkhāyāti bhummavacanaṃ.
Here, " in saṅkhārupekkhā" is in the locative case.
Ở đó, “Saṅkhārupekkhāya” là ở cách định sở.
Cittassa abhinīhāroti saṅkhārupekkhālābhino tato aññassa cittassa saṅkhārupekkhābhimukhaṃ katvā bhusaṃ haraṇaṃ.
Cittassa abhinīhāro means the strong directing of the mind, by one who has attained equanimity regarding formations (saṅkhārupekkhā), turning another mind towards equanimity regarding formations.
“Sự hướng tâm” (cittassa abhinīhāro) là sự dẫn dắt mạnh mẽ tâm của người đã đạt được Saṅkhārupekkhā hướng đến Saṅkhārupekkhā khác.
Abhimukhattho hi ettha abhisaddo, bhusattho saddo.
Here, the word abhi means "towards," and the word means "strongly."
Ở đây, tiền tố “abhi” có nghĩa là hướng về, và tiền tố “nī” có nghĩa là mạnh mẽ.
Katihākārehīti pucchitaṃ pucchaṃ aṭṭhahākārehīti vissajjetvā dutiyapucchāvissajjaneneva te aṭṭhākāre dassetukāmo te adassetvāva puthujjanassa katihākārehītiādi pucchaṃ akāsi.
Having answered the question "In how many ways?" with "In eight ways," the Elder, wishing to show these eight ways only through the answer to the second question, asked the question "In how many ways for a puthujjana?" and so on, without yet showing those*.
Sau khi hỏi “Bằng bao nhiêu phương diện?” và trả lời “Bằng tám phương diện”, Ngài muốn chỉ ra tám phương diện ấy bằng cách trả lời câu hỏi thứ hai, nhưng thay vì chỉ ra chúng, Ngài lại hỏi “Đối với phàm nhân, bằng bao nhiêu phương diện?” v.v.
Puthujjanassāti ettha pana –
Regarding Puthujjanassa, there are—
Ở đây, trong từ “Puthujjanassa” (của phàm nhân) thì –
1075
Duve puthujjanā vuttā, buddhenādiccabandhunā;
Two types of ordinary people (puthujjana) were spoken of
Hai loại phàm nhân đã được Đức Phật, bậc Thân quyến của mặt trời, nói đến:
1076
Andho puthujjano eko, kalyāṇeko puthujjanoti.
by the Buddha, the Kinsman of the Sun: one is the blind puthujjana, the other is the virtuous puthujjana.
Một là phàm nhân mù quáng, một là phàm nhân thiện lành.
1077
Tattha yassa khandhadhātuāyatanādīsu uggahaparipucchāsavanadhāraṇapaccavekkhaṇādīni natthi, ayaṃ andhaputhujjano.
Among these, the one who has no comprehension, inquiry, listening, retention, or reflection concerning aggregates, elements, sense-bases, and so on, is the blind puthujjana.
Trong số đó, người nào không có sự học hỏi, tìm hiểu, lắng nghe, ghi nhớ, quán xét v.v. về các uẩn, giới, xứ v.v., thì người ấy là phàm nhân mù quáng.
Yassa tāni atthi, so kalyāṇaputhujjano.
The one who has these is the virtuous puthujjana.
Người nào có những điều ấy thì là phàm nhân thiện lành.
Duvidhopi panesa –
Both types of these* are—
Cả hai loại này đều là –
1078
Puthūnaṃ jananādīhi, kāraṇehi puthujjano;
A puthujjana due to causes such as giving rise to many*;
Phàm nhân là do các nguyên nhân như sinh ra nhiều (kilesa);
1079
Puthujjanantogadhattā, puthuvāyaṃ jano iti.
Or this person is a puthujjana because he is included among ordinary people, or because he is separate.
Hoặc do thuộc về hạng phàm nhân, hoặc do là người riêng biệt.
1080
So hi puthūnaṃ nānappakārānaṃ kilesādīnaṃ jananādīhi kāraṇehi puthujjano.
Indeed, he is a puthujjana due to causes such as giving rise to many diverse defilements and so on.
Người ấy là phàm nhân (puthujjano) do các nguyên nhân như sinh ra nhiều loại phiền não khác nhau v.v.
Yathāha – ‘‘puthu kilese janentīti puthujjanā, puthu avihatasakkāyadiṭṭhikāti puthujjanā, puthu satthārānaṃ mukhullokikāti puthujjanā, puthu sabbagatīhi avuṭṭhitāti puthujjanā, puthu nānābhisaṅkhāre abhisaṅkharontīti puthujjanā, puthu nānāoghehi vuyhantīti puthujjanā, puthu nānāsantāpehi santappentīti puthujjanā, puthu nānāpariḷāhehi pariḍayhantīti puthujjanā, puthu pañcasu kāmaguṇesu rattā giddhā gadhitā mucchitā ajjhosannā laggā laggitā palibuddhāti puthujjanā, puthu pañcahi nīvaraṇehi āvutā nivutā ovutā pihitā paṭicchannā paṭikujjitāti puthujjanā’’ti (mahāni. 94).
As it is said: ‘‘They are puthujjanas because they give rise to many defilements; they are puthujjanas because they have not eradicated sakkāya-diṭṭhi; they are puthujjanas because they look to the faces of many teachers; they are puthujjanas because they have not risen from all destinies; they are puthujjanas because they perform many diverse formations; they are puthujjanas because they are carried away by many diverse floods; they are puthujjanas because they are tormented by many diverse torments; they are puthujjanas because they are burned by many diverse fevers; they are puthujjanas because they are attached, greedy, infatuated, deluded, immersed, stuck, clinging, and entangled in the five sense-pleasures; they are puthujjanas because they are obstructed, hindered, covered, blocked, concealed, and overturned by the five hindrances’’.
Như đã nói: “Họ sinh ra nhiều phiền não, nên là phàm nhân; họ có tà kiến thân kiến chưa được đoạn trừ, nên là phàm nhân; họ ngước nhìn nhiều vị đạo sư, nên là phàm nhân; họ chưa thoát khỏi mọi nẻo luân hồi, nên là phàm nhân; họ tạo ra nhiều loại hành khác nhau, nên là phàm nhân; họ bị cuốn trôi bởi nhiều dòng nước lũ khác nhau, nên là phàm nhân; họ bị nung đốt bởi nhiều nỗi khổ khác nhau, nên là phàm nhân; họ bị thiêu đốt bởi nhiều sự nóng bức khác nhau, nên là phàm nhân; họ say mê, tham đắm, dính mắc, mê muội, chìm đắm, bám víu, bị trói buộc vào năm dục lạc, nên là phàm nhân; họ bị che lấp, bị ngăn che, bị bao phủ, bị che giấu, bị che khuất, bị lật úp bởi năm triền cái, nên là phàm nhân” (Mahāniddesa 94).
Puthūnaṃ vā gaṇanapathātītānaṃ ariyadhammaparammukhānaṃ nīcadhammasamācārānaṃ janānaṃ antogadhattāpi puthujjanā, puthu vā ayaṃ visuṃyeva saṅkhaṃ gato, visaṃsaṭṭho sīlasutādiguṇayuttehi ariyehi janotipi puthujjano.
Or they are puthujjanas because they are included among people who are countless, averse to the Noble Dhamma, and whose conduct is ignoble; or this person is a puthujjana because he is counted as distinctly separate, a person unmixed with Noble Ones endowed with virtues such as morality and learning.
Hoặc, họ là phàm nhân vì thuộc về hạng người đông đảo, vô số, quay lưng lại với Pháp bậc thánh, và có hành vi thấp kém. Hoặc, người này là phàm nhân vì được tính là riêng biệt, không hòa lẫn với các bậc thánh có các đức tính như giới, tuệ v.v.
Tesu kalyāṇaputhujjano idhādhippeto itarassa bhāvanāya eva abhāvā.
Among these, the virtuous puthujjana is intended here, due to the absence of cultivation for the other.
Trong số đó, phàm nhân thiện lành được đề cập ở đây, vì phàm nhân còn lại không có sự tu tập.
1081
Sekkhassāti ettha satta sekkhā sotāpattimaggaphalasakadāgāmimaggaphalaanāgāmimaggaphalaarahattamaggaṭṭhā.
Regarding Sekkhassa, there are seven Sekkhas: those on the path and fruition of stream-entry, once-returning, non-returning, and those on the path to Arahantship.
Trong từ “Sekkhassa” (của bậc Hữu học), có bảy bậc Hữu học: người đang trên đạo Tu-đà-hoàn, quả Tu-đà-hoàn, người đang trên đạo Tư-đà-hàm, quả Tư-đà-hàm, người đang trên đạo A-na-hàm, quả A-na-hàm, và người đang trên đạo A-la-hán.
Te hi tisso sikkhā sikkhantīti sekkhā.
Indeed, these are Sekkhas because they are still training in the three trainings.
Họ là những bậc Hữu học (sekkhā) vì họ đang tu tập ba học pháp (giới, định, tuệ).
Tesu sotāpattisakadāgāmianāgāmiphalaṭṭhā tayo idhādhippetā maggaṭṭhānaṃ saṅkhārupekkhāya cittābhinīhārābhāvā.
Among these, the three who have attained the fruition of stream-entry, once-returning, and non-returning are intended here, because those on the path do not direct their minds to equanimity regarding formations.
Trong số ấy, ba vị trú trong quả Tu-đà-hoàn, Tư-đà-hàm, A-na-hàm được ngụ ý ở đây, vì các vị trú trong đạo không có sự hướng tâm đến saṅkhārupekkhā.
1082
Vītarāgassāti ettha samucchedavigamena vigato rāgo assāti vītarāgo.
Regarding Vītarāgassa, it means one whose passion has departed through complete eradication.
Của bậc ly tham: Ở đây, vītarāga (bậc ly tham) là người có tham ái đã được đoạn trừ bằng sự đoạn tận.
Arahato etaṃ adhivacanaṃ.
This is an appellation for an Arahant.
Đây là danh xưng của bậc A-la-hán.
Tīsupi padesu jātiggahaṇena ekavacanaṃ kataṃ.
In all three instances, the singular number is used by taking the class*.
Trong cả ba trường hợp, số ít được dùng để chỉ chung cho cả loại.
1083
Saṅkhārupekkhaṃ abhinandatīti tasmiṃ upekkhāvihāre phāsuvihārasaññaṃ paṭilabhitvā phāsuvihāranikantiyā saṅkhārupekkhābhimukho hutvā nandati, sappītikaṃ taṇhaṃ uppādetīti attho.
Saṅkhārupekkhaṃ abhinandatī means that, having gained the perception of a comfortable abiding in that abiding of equanimity regarding formations, he rejoices, turning towards equanimity regarding formations with delight in that comfortable abiding, meaning he generates craving accompanied by joy.
Hoan hỷ trong hành xả: nghĩa là, sau khi nhận thức được sự an trú thoải mái trong trạng thái trú xả ấy, vị ấy hoan hỷ, hướng đến saṅkhārupekkhā với sự ưa thích an trú thoải mái, tức là làm phát sinh ái đi kèm với hỷ.
Vipassatīti sotāpattimaggapaṭilābhatthaṃ aniccādivasena vividhā passati, sekkho uparimaggatthaṃ, vītarāgo diṭṭhadhammasukhavihāratthaṃ vipassati.
Vipassatī means that the puthujjana discerns in various ways, such as impermanence, for the attainment of the path of stream-entry; the sekkha discerns for the higher paths; the vītarāga discerns for a comfortable abiding in this very life.
Quán chiếu: quán chiếu theo nhiều cách khác nhau như vô thường v.v... để chứng đắc Tu-đà-hoàn đạo; bậc hữu học quán chiếu để chứng đắc đạo cao hơn; bậc ly tham quán chiếu để được hiện tại lạc trú.
Paṭisaṅkhāyāti aniccādivaseneva upaparikkhitvā.
Paṭisaṅkhāyā means having thoroughly examined in terms of impermanence and so on.
Sau khi thẩm xét: tức là sau khi xem xét theo cách vô thường v.v...
Yasmā pana sotāpannādayo ariyā sakaṃ sakaṃ phalasamāpattiṃ samāpajjamānā udayabbayañāṇādīhi navahi vipassanāñāṇehi avipassitvā samāpajjituṃ na sakkonti, tasmā paṭisaṅkhāya vā phalasamāpattiṃ samāpajjatīti vuttaṃ.
However, since the Noble Ones such as stream-enterers cannot enter into their respective fruition attainments without discerning with the nine vipassanā-ñāṇas such as the knowledge of rise and fall, it is said, "or by reflecting, one enters into fruition attainment."
Và vì các bậc Thánh như Tu-đà-hoàn v.v... khi nhập thánh quả định của mình, không thể nhập nếu không quán chiếu bằng chín tuệ quán, bắt đầu từ tuệ sanh diệt, nên có câu nói hoặc sau khi thẩm xét, vị ấy nhập thánh quả định.
1084
Phalasamāpattiyā pavattidassanatthaṃ pana tesaṃ idaṃ pañhakammaṃ – kā phalasamāpatti?
To show the occurrence of fruition attainment, this set of questions for them is: What is fruition attainment?
Và để cho thấy sự diễn tiến của thánh quả định, đây là những câu hỏi liên quan đến các vị ấy: Thánh quả định là gì?
Ke taṃ samāpajjanti?
Who attains it?
Ai nhập định ấy?
Ke na samāpajjanti?
Who does not attain it?
Ai không nhập định ấy?
Kasmā samāpajjanti?
Why do they attain it?
Tại sao lại nhập định ấy?
Kathañcassā samāpajjanaṃ hoti?
How does its attainment occur?
Việc nhập định ấy diễn ra như thế nào?
Kathaṃ ṭhānaṃ?
How does its abiding occur?
Việc an trú diễn ra như thế nào?
Kathaṃ vuṭṭhānaṃ?
How does its emergence occur?
Việc xuất định diễn ra như thế nào?
Kiṃ phalassa anantaraṃ?
What immediately precedes the fruition?
Cái gì theo sau quả?
Kassa ca phalaṃ anantaranti?
And what immediately precedes whose fruition?
Và quả theo sau cái gì?
1085
Tattha kā phalasamāpattīti?
Among these, "What is fruition attainment?"
Trong đó, Thánh quả định là gì?
Yā ariyaphalassa nirodhe appanā.
It is the absorption (appanā) into the cessation of the Noble Fruition.
Đó là sự an chỉ của thánh quả trong đối tượng Niết-bàn.
1086
Ke taṃ samāpajjanti?
Who attain it?
Ai nhập định ấy?
Ke na samāpajjantīti?
Who do not attain it?
Ai không nhập định ấy?
Sabbepi puthujjanā na samāpajjanti.
All ordinary people do not attain it.
Tất cả phàm phu đều không nhập định ấy.
Kasmā?
Why?
Tại sao?
Anadhigatattā.
Because it has not been realized.
Vì chưa chứng đắc.
Ariyā pana sabbepi samāpajjanti.
But all noble ones attain it.
Còn các bậc Thánh thì tất cả đều nhập định ấy.
Kasmā?
Why?
Tại sao?
Adhigatattā.
Because it has been realized.
Vì đã chứng đắc.
Uparimā pana heṭṭhimaṃ na samāpajjanti puggalantarabhāvūpagamanena paṭippassaddhattā, heṭṭhimā ca uparimaṃ anadhigatattā.
However, those of higher stages do not attain the lower stages, as the lower stages have been appeased by their attainment of a different individual state; and those of lower stages do not attain the higher stages, as they have not yet realized them.
Tuy nhiên, các bậc cao hơn không nhập quả thấp hơn, vì quả thấp hơn đã lắng dịu do đã đạt đến một cấp độ cá nhân khác; còn các bậc thấp hơn không nhập quả cao hơn vì chưa chứng đắc.
Attano attanoyeva pana phalaṃ sabbepi samāpajjantīti idamettha sanniṭṭhānaṃ.
Herein, the conclusion is that all noble ones attain their own respective fruit.
Kết luận ở đây là tất cả các vị đều nhập chính quả của mình.
1087
Keci pana ‘‘sotāpannasakadāgāminopi na samāpajjanti, uparimā dveyeva samāpajjantī’’ti vadanti.
Some say, however, that even stream-enterers and once-returners do not attain it; only the two higher ones attain it.
Tuy nhiên, một số vị nói rằng: “Cả bậc Tu-đà-hoàn và Tư-đà-hàm cũng không nhập định ấy, chỉ có hai bậc cao hơn mới nhập.”
Idañca nesaṃ kāraṇaṃ – ete hi samādhismiṃ paripūrakārinoti.
And this is their reason: for these are fully accomplished in samādhi.
Và đây là lý do của họ: “Vì các vị này là những người thực hành viên mãn trong định.”
Taṃ puthujjanassāpi attanā paṭiladdhaṃ lokiyasamādhiṃ samāpajjanato akāraṇameva.
That is indeed no reason, for even an ordinary person attains the mundane samādhi that he has gained.
Điều đó không phải là lý do, vì ngay cả phàm phu cũng có thể nhập định thế gian mà mình đã chứng đắc.
Kiñcettha kāraṇākāraṇacintāya.
What is the point of considering reasons and non-reasons here?
Hơn nữa, cần gì phải suy xét về lý do và phi lý do ở đây.
Nanu idheva pāḷiyaṃ ‘‘katame dasa saṅkhārupekkhā vipassanāvasena uppajjanti, katame dasa gotrabhudhammā vipassanāvasena uppajjantī’’ti (paṭi. ma. 1.60) imesaṃ pañhānaṃ vissajjane ‘‘sotāpattiphalasamāpattatthāya sakadāgāmiphalasamāpattatthāyā’’ti (paṭi. ma. 1.60) visuṃ visuṃ vuttā.
Are not the questions, “Which ten saṅkhārupekkhā arise by way of vipassanā, which ten gotrabhū-dhamma arise by way of vipassanā?” answered right here in the Pāḷi by stating separately “for the attainment of stream-entry fruit-attainment, for the attainment of once-returner fruit-attainment”?
Chẳng phải chính trong kinh văn này, khi giải đáp các câu hỏi “Mười saṅkhārupekkhā nào sanh khởi do tuệ quán, mười gotrabhudhammā nào sanh khởi do tuệ quán?”, đã nói riêng rẽ rằng: “để nhập Tu-đà-hoàn quả định, để nhập Tư-đà-hàm quả định” hay sao?
Tasmā sabbepi ariyā attano attano phalaṃ samāpajjantīti niṭṭhamettha gantabbaṃ.
Therefore, it should be concluded here that all noble ones attain their own respective fruit.
Do đó, cần phải đi đến kết luận rằng tất cả các bậc Thánh đều nhập quả của chính mình.
1088
Kasmā samāpajjantīti?
Why do they attain it?
Tại sao lại nhập định ấy?
Diṭṭhadhammasukhavihāratthaṃ.
For a happy abiding in this very life.
Để được hiện tại lạc trú.
Yathā hi rājāno rajjasukhaṃ, devatā dibbasukhamanubhavanti, evaṃ ariyā ‘‘lokuttarasukhaṃ anubhavissāmā’’ti addhānaparicchedaṃ katvā icchiticchitakkhaṇe phalasamāpattiṃ samāpajjanti.
Just as kings experience the happiness of kingship, and devas experience divine happiness, so too, the noble ones, having determined a period of time, attain fruit-attainment at the desired moment, thinking, “We shall experience supramundane happiness.”
Giống như các vị vua hưởng thụ lạc thú của vương quyền, các vị trời hưởng thụ thiên lạc, các bậc Thánh cũng vậy, với ý nghĩ “chúng ta sẽ hưởng thụ lạc siêu thế”, sau khi xác định thời gian, các vị ấy nhập thánh quả định vào những khoảnh khắc mong muốn.
1089
Kathañcassā samāpajjanaṃ hoti, kathaṃ ṭhānaṃ, kathaṃ vuṭṭhānanti?
How does its attainment occur, how its abiding, and how its emergence?
Việc nhập định ấy diễn ra như thế nào, việc an trú diễn ra như thế nào, việc xuất định diễn ra như thế nào?
Dvīhi tāva ākārehi assā samāpajjanaṃ hoti nibbānato aññassa ārammaṇassa amanasikārā, nibbānassa ca manasikārā.
Its attainment occurs in two ways: by not attending to any other object than Nibbāna, and by attending to Nibbāna.
Việc nhập định ấy diễn ra theo hai cách: do không tác ý đến đối tượng nào khác ngoài Niết-bàn, và do tác ý đến Niết-bàn.
Yathāha – ‘‘dve kho, āvuso, paccayā animittāya cetovimuttiyā samāpattiyā sabbanimittānañca amanasikāro, animittāya ca dhātuyā manasikāro’’ti (ma. ni. 1.458).
As it is said: “There are, friends, two conditions for the attainment of the signless liberation of mind: not attending to all signs, and attending to the signless element.”
Như đã nói: “Này chư hiền, có hai duyên để nhập vô tướng tâm giải thoát: không tác ý đến tất cả các tướng, và tác ý đến vô tướng giới.”
Ayaṃ panettha samāpajjanakkamo – phalasamāpattatthikena hi ariyasāvakena rahogatena paṭisallīnena udayabbayādivasena saṅkhārā vipassitabbā.
Herein, this is the sequence of attainment: a noble disciple desirous of fruit-attainment, having gone to a secluded place and being withdrawn, should observe the formations (saṅkhārā) by way of their arising and passing away.
Đây là trình tự nhập định: vị Thánh đệ tử muốn nhập thánh quả định, ở nơi thanh vắng, độc cư, cần phải quán chiếu các hành theo cách sanh diệt v.v...
Tassa pavattānupubbavipassanassa saṅkhārārammaṇagotrabhuñāṇānantaraṃ phalasamāpattivasena nirodhe cittaṃ appeti.
For him, whose vipassanā proceeds in due order, immediately after the gotrabhū-ñāṇa with formations as its object, the mind inclines towards cessation by way of fruit-attainment.
Đối với vị ấy, người đang tuần tự tu tập tuệ quán, sau trí gotrabhu lấy các hành làm đối tượng, tâm an chỉ vào Niết-bàn bằng cách nhập thánh quả định.
Phalasamāpattininnatāya cettha sekkhassāpi phalameva uppajjati, na maggo.
And here, due to the inclination towards fruit-attainment, even for a learner (sekha), only the fruit arises, not the path.
Và ở đây, do tâm hướng về thánh quả định, ngay cả đối với bậc hữu học, chỉ có quả sanh khởi, chứ không phải đạo.
Ye pana vadanti ‘‘sotāpanno ‘phalasamāpattiṃ samāpajjissāmī’ti vipassanaṃ paṭṭhapetvā sakadāgāmī hoti, sakadāgāmī ca anāgāmī’’ti.
But those who say, “A stream-enterer, having initiated vipassanā with the intention of attaining fruit-attainment, becomes a once-returner; and a once-returner becomes a non-returner,”
Còn những người nói rằng: “Bậc Tu-đà-hoàn, với ý nghĩ ‘ta sẽ nhập thánh quả định’, sau khi thiết lập tuệ quán, trở thành bậc Tư-đà-hàm; và bậc Tư-đà-hàm trở thành bậc A-na-hàm.”
Te vattabbā ‘‘evaṃ sati anāgāmī arahā bhavissati, arahā paccekabuddho, paccekabuddho ca buddho’’ti.
should be told, “If that were so, a non-returner would become an Arahant, an Arahant a Paccekabuddha, and a Paccekabuddha a Buddha.”
Họ nên được trả lời rằng: “Nếu vậy, bậc A-na-hàm sẽ trở thành A-la-hán, bậc A-la-hán sẽ trở thành Độc Giác Phật, và Độc Giác Phật sẽ trở thành Phật.”
1090
Tasmā na kiñci etaṃ, pāḷivaseneva ca paṭikkhittantipi na gahetabbaṃ.
Therefore, this is nothing, and it should not be taken that it is rejected by the Pāḷi itself.
Do đó, điều đó hoàn toàn không đúng, và cũng không nên chấp nhận vì nó đã bị bác bỏ ngay trong kinh văn.
Idameva pana gahetabbaṃ.
Rather, this alone should be accepted:
Chỉ nên chấp nhận điều này.
Sekkhassāpi phalameva uppajjati, na maggo.
Even for a learner, only the fruit arises, not the path.
Ngay cả đối với bậc hữu học, chỉ có quả sanh khởi, chứ không phải đạo.
Phalañcassa sace anena paṭhamajjhāniko maggo adhigato hoti, paṭhamajjhānikameva uppajjati, sace dutiyādīsu aññatarajjhāniko, dutiyādīsu aññatarajjhānikamevāti evaṃ tāvassā samāpajjanaṃ hoti.
And if he has attained a path connected with the first jhāna, his fruit is also connected with the first jhāna; if it is connected with any of the second and so on jhānas, it is also connected with that particular jhāna. Thus, its attainment occurs in this way.
Và nếu vị ấy đã chứng đắc đạo thuộc sơ thiền, thì quả của vị ấy cũng thuộc sơ thiền sanh khởi; nếu đạo thuộc một trong các thiền từ nhị thiền trở lên, thì quả cũng thuộc một trong các thiền từ nhị thiền trở lên. Như vậy là việc nhập định của vị ấy.
1091
‘‘Tayo kho, āvuso, paccayā animittāya cetovimuttiyā ṭhitiyā sabbanimittānañca amanasikāro, animittāya ca dhātuyā manasikāro, pubbe ca abhisaṅkhāro’’ti (ma. ni. 1.458) vacanato panassā tīhākārehi ṭhānaṃ hoti.
But its abiding occurs in three ways, according to the statement: “There are, friends, three conditions for the abiding of the signless liberation of mind: not attending to all signs, attending to the signless element, and a prior determination.”
Và việc an trú của định ấy diễn ra theo ba cách, theo câu nói: “Này chư hiền, có ba duyên để an trú trong vô tướng tâm giải thoát: không tác ý đến tất cả các tướng, tác ý đến vô tướng giới, và sự chuẩn bị trước đó.”
Tattha pubbe ca abhisaṅkhāroti samāpattito pubbe kālaparicchedo.
Herein, “a prior determination” refers to the determination of time before the attainment.
Trong đó, sự chuẩn bị trước đó là việc xác định thời gian trước khi nhập định.
‘‘Asukasmiṃ nāma kāle vuṭṭhahissāmī’’ti paricchinnattā hissā yāva so kālo nāgacchati, tāva ṭhānaṃ hoti.
Because it is determined, “I shall emerge at such and such a time,” its abiding continues until that time arrives.
Vì đã xác định rằng “tôi sẽ xuất định vào một thời điểm nhất định”, nên định ấy an trú cho đến khi thời điểm đó đến.
Evamassa ṭhānaṃ hoti.
Thus, its abiding occurs.
Như vậy là việc an trú của định ấy.
1092
‘‘Dve kho, āvuso, paccayā animittāya cetovimuttiyā vuṭṭhānāya sabbanimittānañca manasikāro, animittāya ca dhātuyā amanasikāro’’ti (ma. ni. 1.458) vacanato panassā dvīhākārehi vuṭṭhānaṃ hoti.
Due to what was stated (in the Mahāvedalla Sutta): "Indeed, friends, there are two conditions for rising from the signless liberation of mind: attention to all signs, and non-attention to the signless element," its rising occurs in two ways.
Và việc xuất định của vị ấy diễn ra theo hai cách, theo câu nói: “Này chư hiền, có hai duyên để xuất khỏi vô tướng tâm giải thoát: tác ý đến tất cả các tướng, và không tác ý đến vô tướng giới.”
Tattha sabbanimittānanti rūpanimittavedanāsaññāsaṅkhāraviññāṇanimittānaṃ.
Here, all signs refers to the signs of rūpa, vedanā, saññā, saṅkhāra, and viññāṇa.
Trong đó, tất cả các tướng là tướng sắc, tướng thọ, tướng tưởng, tướng hành, và tướng thức.
Kāmañca na sabbānevetāni ekato manasi karoti, sabbasaṅgāhikavasena panetaṃ vuttaṃ.
Although one does not attend to all of these simultaneously, this is stated in the sense of encompassing all.
Mặc dù vị ấy không tác ý đến tất cả chúng cùng một lúc, nhưng điều này được nói theo cách bao quát tất cả.
Tasmā yaṃ bhavaṅgassa ārammaṇaṃ hoti, taṃ manasikaroto phalasamāpattito vuṭṭhānaṃ hotīti evamassā vuṭṭhānaṃ veditabbaṃ.
Therefore, its rising should be understood as occurring when one attends to the object of the bhavaṅga from the attainment of fruition.
Do đó, cần hiểu rằng việc xuất khỏi thánh quả định xảy ra khi vị ấy tác ý đến đối tượng của bhavaṅga. Như vậy là việc xuất định của vị ấy.
1093
Kiṃ phalassa anantaraṃ, kassa ca phalaṃ anantaranti?
What immediately precedes fruition, and what fruition immediately precedes?
Cái gì theo sau quả, và quả theo sau cái gì?
Phalassa tāva phalameva vā anantaraṃ hoti bhavaṅgaṃ vā.
As for fruition, either fruition itself immediately precedes it, or bhavaṅga immediately precedes it.
Sau quả, có thể là chính quả ấy hoặc là bhavaṅga.
Phalaṃ pana atthi maggānantaraṃ, atthi phalānantaraṃ, atthi gotrabhuanantaraṃ, atthi nevasaññānāsaññāyatanānantaranti.
Fruition, however, is sometimes immediately preceded by the path, sometimes immediately preceded by fruition, sometimes immediately preceded by gotrabhū, and sometimes immediately preceded by the sphere of neither-perception-nor-non-perception.
Còn quả thì có khi theo sau đạo, có khi theo sau quả, có khi theo sau gotrabhu, có khi theo sau phi tưởng phi phi tưởng xứ.
Tattha maggavīthiyaṃ maggānantaraṃ, purimassa purimassa pacchimaṃ pacchimaṃ phalānantaraṃ, phalasamāpattīsu purimaṃ purimaṃ gotrabhuanantaraṃ.
Among these, in the path-process, it is immediately preceded by the path; the latter fruition is immediately preceded by the former fruition; in fruition-attainments, the first fruition is immediately preceded by gotrabhū.
Trong đó, trong lộ trình đạo, nó theo sau đạo; quả sau theo sau quả trước; trong các thánh quả định, quả đầu tiên theo sau gotrabhu.
Gotrabhūti cettha anulomaṃ veditabbaṃ.
Here, gotrabhū should be understood as anuloma.
Và ở đây, gotrabhu cần được hiểu là anuloma (thuận thứ).
Vuttañhetaṃ paṭṭhāne ‘‘arahato anulomaṃ phalasamāpattiyā anantarapaccayena paccayo.
For it is said in the Paṭṭhāna: "Anuloma of an Arahant is a condition by way of immediate contiguity for fruition-attainment.
Điều này đã được nói trong bộ Paṭṭhāna: “Đối với bậc A-la-hán, anuloma là duyên cho thánh quả định bằng vô gián duyên.”
Sekkhānaṃ anulomaṃ phalasamāpattiyā anantarapaccayena paccayo’’ti (paṭṭhā. 1.1.417).
Anuloma of trainees is a condition by way of immediate contiguity for fruition-attainment."
anuloma (thuận thứ) đối với các bậc hữu học là duyên cho quả thiền chứng bằng vô gián duyên”.
Yena phalena nirodhā vuṭṭhānaṃ hoti, taṃ nevasaññānāsaññāyatanānantaranti.
The fruition from which one rises from cessation is immediately preceded by the sphere of neither-perception-nor-non-perception.
Do quả nào mà có sự xuất khỏi Diệt thọ tưởng định, quả ấy được gọi là (quả) kế ngay sau phi tưởng phi phi tưởng xứ.
Tattha ṭhapetvā maggavīthiyaṃ uppannaphalaṃ avasesaṃ sabbaṃ phalasamāpattivasena pavattaṃ nāma.
Among these, all fruition that occurs in the fruition-attainment, except for the fruition that arises in the path-process, is called pavatta.
Trong đó, ngoại trừ quả sanh khởi trong lộ trình đạo, tất cả quả còn lại được gọi là diễn tiến theo cách nhập quả thiền.
Evametaṃ maggavīthiyaṃ vā phalasamāpattiyaṃ vā uppajjanavasena –
Thus, this arises either in the path-process or in fruition-attainment—
Như vậy, do sự sanh khởi trong lộ trình đạo hoặc trong quả thiền chứng –
1094
‘‘Paṭippassaddhadarathaṃ, amatārammaṇaṃ subhaṃ;
“The excellent fruit of recluseship, which has suppressed vexation, has Nibbāna as its object, is beautiful,
“Sự phiền muộn đã được lắng dịu, có đối tượng là bất tử, tốt đẹp;
1095
Vantalokāmisaṃ santaṃ, sāmaññaphalamuttama’’nti.
has vomited the allurements of the world, and is tranquil.”
Đã từ bỏ vật chất thế gian, tịch tịnh, là quả sa-môn tối thượng.”
1096
Ayamettha phalasamāpattikathā.
This is the discourse on fruition-attainment here.
Đây là phần luận về quả thiền chứng.
1097
Tadajjhupekkhitvāti taṃ saṅkhārupekkhaṃ aññena tādiseneva vipassanāñāṇena ajjhupekkhitvā.
Having observed that means having observed that saṅkhārupekkhā with another vipassanā-knowledge of the same kind.
Sau khi xả bỏ điều đó: sau khi xả bỏ tuệ xả hành đó bằng một tuệ quán khác tương tự.
Suññatavihārena vātiādīsu phalasamāpattiṃ vinā vipassanāvihāreneva viharitukāmassa arahato attābhinivesaṃ bhayato disvā suññatādhimuttassa saṅkhārupekkhāya vayaṃ passantassa vipassanattayavihāro suññatavihāro nāma, saṅkhāranimittaṃ bhayato disvā animittādhimuttassa saṅkhārupekkhāya vayaṃ passantassa vipassanattayavihāro animittavihāro nāma, taṇhāpaṇidhiṃ bhayato disvā appaṇihitādhimuttassa saṅkhārupekkhāya vayaṃ passantassa vipassanattayavihāro appaṇihitavihāro nāma.
In the phrases or by the emptiness abiding, etc., for an Arahant who desires to abide only in vipassanā-abiding without fruition-attainment, who sees self-identification as fearful, who is intent on emptiness, and who sees the dissolution of saṅkhārupekkhā, the abiding of the three vipassanās is called emptiness abiding; for one who sees the sign of formations as fearful, who is intent on the signless, and who sees the dissolution of saṅkhārupekkhā, the abiding of the three vipassanās is called signless abiding; for one who sees the aspiration of craving as fearful, who is intent on the unaspired, and who sees the dissolution of saṅkhārupekkhā, the abiding of the three vipassanās is called unaspired abiding.
Hoặc bằng không tánh trú v.v...: Đối với bậc A-la-hán muốn an trú chỉ bằng tuệ quán mà không nhập quả thiền, sau khi thấy sự chấp thủ tự ngã là đáng sợ, có khuynh hướng về không tánh, thấy sự hoại diệt của tuệ xả hành, thì sự an trú bằng ba loại tuệ quán được gọi là không tánh trú. Sau khi thấy tướng của các hành là đáng sợ, có khuynh hướng về vô tướng, thấy sự hoại diệt của tuệ xả hành, thì sự an trú bằng ba loại tuệ quán được gọi là vô tướng trú. Sau khi thấy sự mong cầu của ái là đáng sợ, có khuynh hướng về vô nguyện, thấy sự hoại diệt của tuệ xả hành, thì sự an trú bằng ba loại tuệ quán được gọi là vô nguyện trú.
Tathā hi parato vuttaṃ –
For it is said later:
Bởi vậy, về sau có nói rằng –
1098
‘‘Abhinivesaṃ bhayato sampassamāno suññate adhimuttattā phussa phussa vayaṃ passati, suññato vihāro.
“Seeing self-identification as fearful, and being intent on emptiness, he sees dissolution again and again: this is emptiness abiding.
“Thấy rõ sự chấp thủ là đáng sợ, do có khuynh hướng về không tánh, vị ấy thấy sự hoại diệt mỗi khi tiếp xúc; đó là không tánh trú.
Nimittaṃ bhayato sampassamāno animitte adhimuttattā phussa phussa vayaṃ passati, animitto vihāro.
Seeing the sign as fearful, and being intent on the signless, he sees dissolution again and again: this is signless abiding.
Thấy rõ tướng là đáng sợ, do có khuynh hướng về vô tướng, vị ấy thấy sự hoại diệt mỗi khi tiếp xúc; đó là vô tướng trú.
Paṇidhiṃ bhayato sampassamāno appaṇihite adhimuttattā phussa phussa vayaṃ passati, appaṇihito vihāro’’ti (paṭi. ma. 1.78).
Seeing aspiration as fearful, and being intent on the unaspired, he sees dissolution again and again: this is unaspired abiding.”
Thấy rõ sự mong cầu là đáng sợ, do có khuynh hướng về vô nguyện, vị ấy thấy sự hoại diệt mỗi khi tiếp xúc; đó là vô nguyện trú.”
1099
Chaḷaṅgupekkhāsabbhāvena ca paṭikūle appaṭikūlasaññādivihārasabbhāvena ca arahatoyeva sabbākārena cittaṃ vase vattati, tato ayaṃ vipassanāvihāro arahatoyeva ijjhatīti vuttaṃ hoti.
Due to the presence of six-factored equanimity and the presence of abiding such as the perception of non-repulsiveness in the repulsive, the mind of an Arahant alone is completely under control. Thus, it is said that this vipassanā-abiding is successful only for an Arahant.
Và do sự hiện hữu của lục phần xả và sự hiện hữu của các pháp trú như tưởng không ghê tởm trong đối tượng ghê tởm, tâm của bậc A-la-hán hoàn toàn thuận theo ý muốn về mọi phương diện, do đó, pháp trú tuệ quán này chỉ thành tựu nơi bậc A-la-hán, được nói như vậy.
Vītarāgo saṅkhārupekkhaṃ vipassati vāti ettha pana tidhā ca bhayaṃ, tidhā ca adhimuttiṃ anāpajjitvā kevalaṃ vipassanāti veditabbā.
However, in the dispassionate one discerns saṅkhārupekkhā, it should be understood as mere vipassanā, without falling into the three kinds of fear and the three kinds of intent.
Hoặc bậc Vô tham quán tuệ xả hành: Ở đây, nên hiểu rằng đó chỉ là tuệ quán đơn thuần, không đi đến ba loại sợ hãi và ba loại khuynh hướng.
Evañhi sati pubbāparaviseso hoti.
Only then is there a distinction between the former and the latter.
Bởi vì như vậy mới có sự khác biệt giữa trước và sau.
1100
56. Idāni dvinnaṃ tiṇṇaṃ puggalānaṃ vasena saṅkhārupekkhāya ekattanānattabhedaṃ dassetukāmo kathaṃ puthujjanassa ca sekkhassa cātiādimāha.
56. Now, wishing to show the distinction of sameness and difference of saṅkhārupekkhā in terms of two or three types of individuals, he says, how for an ordinary person and for a trainee, and so on.
56. Bây giờ, muốn chỉ ra sự khác biệt về tính đơn nhất và đa dạng của tuệ xả hành theo phương diện của hai hoặc ba hạng người, ngài nói Thế nào đối với phàm phu và bậc hữu học v.v...
Tattha cittassa abhinīhāro ekattaṃ hotīti eko hoti, sakatthe bhāvavacananti veditabbaṃ.
Here, the mind's inclination is sameness means it is one; it should be understood as a bhāva-word in its own sense.
Trong đó, sự hướng tâm của tâm là đơn nhất có nghĩa là một, nên hiểu là một từ chỉ trạng thái trong ý nghĩa của chính nó.
Yathā idappaccayā eva idappaccayatāti vuttaṃ, tathā ekova ekattaṃ.
Just as it is said that idappaccayā is idappaccayatā, so too eka is ekatta.
Giống như idappaccayatā được nói từ idappaccayā eva, cũng vậy ekattaṃ từ ekova.
Abhinīhāroti sāmiatthe paccattavacanaṃ vā, abhinīhārassāti attho.
"Abhinīhāro" is a nominative case used in the sense of the genitive, meaning "of abhinīhāra."
Abhinīhāro là một từ ở chủ cách trong ý nghĩa sở hữu chủ, có nghĩa là "của sự hướng tâm".
‘‘So deso sammajjitvā’’tiādīsu (mahāva. 168) viya vibhattivipallāso katoti veditabbo.
It should be understood that a reversal of case ending has been made, as in phrases like "having swept that place."
Nên hiểu rằng sự biến đổi cách đã được thực hiện, giống như trong các câu “Sau khi quét dọn nơi đó” v.v...
Cittaṃ kilissatīti vipassanānikantisaṅkhātena lobhakilesena cittaṃ kilissati, tāpīyati bādhīyatīti attho.
"The mind becomes defiled" means that the mind is defiled, afflicted, or oppressed by the defilement of greed, which is attachment to vipassanā.
Tâm bị ô nhiễm: tâm bị ô nhiễm, bị thiêu đốt, bị bức bách bởi phiền não tham được gọi là sự ưa thích tuệ quán.
Bhāvanāya paripantho hotīti paṭiladdhāya vipassanābhāvanāya upaghāto hoti.
"It becomes an obstacle to development" means it becomes a hindrance to the vipassanā development that has been attained.
Là chướng ngại cho sự tu tập: là sự phá hoại đối với sự tu tập tuệ quán đã đạt được.
Paṭivedhassa antarāyo hotīti vipassanābhāvanāya paṭilabhitabbassa saccappaṭivedhassa paṭilābhantarāyo hoti.
"It becomes an impediment to penetration" means it becomes an impediment to the penetration of the truths to be attained through vipassanā development.
Là chướng ngại cho sự chứng ngộ: là chướng ngại cho việc đạt được sự chứng ngộ chân lý, điều có thể đạt được nhờ tu tập tuệ quán.
Āyatiṃ paṭisandhiyā paccayo hotīti saṅkhārupekkhāsampayuttakammassa balavattā teneva sugatipaṭisandhiyā dīyamānāya atinandanasaṅkhāto lobhakileso anāgate kāmāvacarasugatipaṭisandhiyā paccayo hoti.
"It becomes a condition for rebirth in the future" means that due to the strength of kamma associated with saṅkhārupekkhā, the defilement of greed, which is excessive delight, becomes a condition for rebirth in a happy sensual realm in the future, when that kamma itself gives rise to a happy rebirth.
Là duyên cho sự tái sanh trong tương lai: Do nghiệp hợp với tuệ xả hành có sức mạnh, khi nghiệp ấy tạo ra sự tái sanh vào cõi thiện, phiền não tham được gọi là sự hoan hỷ quá mức trở thành duyên cho sự tái sanh vào cõi thiện dục giới trong tương lai.
Yasmā kilesasahāyaṃ kammaṃ vipākaṃ janeti, tasmā kammaṃ janakapaccayo hoti, kileso upatthambhakapaccayo.
Since kamma, accompanied by defilements, produces results, kamma is the generative condition, and defilement is the supporting condition.
Bởi vì nghiệp có phiền não làm bạn đồng hành mới sinh ra quả, cho nên nghiệp là sanh duyên, phiền não là hỗ trợ duyên.
Sekkhassa pana uttaripaṭivedhassāti sakadāgāmimaggādivasena saccappaṭivedhassa.
For a Sekkha, "for further penetration" means for the penetration of the truths in the sense of the Sakadāgāmi-magga and so on.
Còn đối với bậc hữu học, đối với sự chứng ngộ cao hơn là sự chứng ngộ chân lý theo cách của đạo Nhất lai v.v...
Āyatiṃ paṭisandhiyā paccayo hotīti sekkhesu sotāpannasakadāgāmīnaṃ anadhigatajjhānānaṃ saṅkhārupekkhākammena dīyamānāya kāmāvacarasugatipaṭisandhiyā abhinandanakileso paccayo hoti, jhānalābhīnaṃ pana anāgāmissa ca brahmalokeyeva paṭisandhānato paccayo na hoti, anulomagotrabhūhi ca dīyamānāya paṭisandhiyā ayameva kileso paccayo hotīti veditabbo.
"It becomes a condition for rebirth in the future" means that for Sotāpannas and Sakadāgāmis among the Sekkhas who have not attained jhāna, the defilement of delight becomes a condition for rebirth in a happy sensual realm, when it is given by kamma associated with saṅkhārupekkhā. However, for those who have attained jhāna, and for an Anāgāmī, it is not a condition for rebirth, as rebirth occurs only in the Brahma-world. It should also be understood that this same defilement becomes a condition for rebirth when given by anuloma and gotrabhū knowledges.
Là duyên cho sự tái sanh trong tương lai: Trong số các bậc hữu học, đối với các vị Dự lưu và Nhất lai chưa đắc thiền, phiền não hoan hỷ trở thành duyên cho sự tái sanh vào cõi thiện dục giới do nghiệp tuệ xả hành tạo ra. Nhưng đối với các vị đã đắc thiền và vị Bất lai, vì tái sanh chỉ ở cõi Phạm thiên nên nó không thành duyên. Và nên hiểu rằng, chính phiền não này là duyên cho sự tái sanh do các tuệ thuận thứ và chuyển tộc tạo ra.
1101
Aniccatoti hutvā abhāvaṭṭhena aniccantikatāya ādiantavantatāya ca aniccato.
"Impermanence" (anicca) means impermanent in the sense of having existed and then ceased to exist, in the sense of not transcending the moment of dissolution, and in the sense of having a beginning and an end.
Theo phương diện vô thường: theo phương diện vô thường do ý nghĩa đã có rồi không có, do tính không vượt qua được và do có khởi đầu và kết thúc.
Dukkhatoti abhiṇhaṃ paṭipīḷanaṭṭhena uppādavayapaṭipīḷanatāya dukkhavatthutāya ca dukkhato.
"Suffering" (dukkha) means suffering in the sense of being constantly oppressed, in the sense of being oppressed by arising and ceasing, and in the sense of being the basis of suffering.
Theo phương diện khổ: theo phương diện khổ do ý nghĩa bức bách không ngừng, do sự bức bách của sanh và diệt, và do là nền tảng của khổ.
Anattatoti avasavattanaṭṭhena paccayāyattavuttitāya sāminivāsīkārakavedakābhāvena ca anattato.
"Non-self" (anattā) means non-self in the sense of not being subject to one's will, in the sense of existing dependently on conditions, and in the absence of a master, resident, doer, or experiencer.
Theo phương diện vô ngã: theo phương diện vô ngã do ý nghĩa không theo ý muốn, do sự vận hành phụ thuộc vào duyên, và do không có chủ sở hữu, người cư trú, người tạo tác, người cảm thọ.
Anupassanaṭṭhenāti anu anu aniccādito passanaṭṭhena.
"In the sense of contemplating" means contemplating repeatedly from the perspective of impermanence and so on.
Do ý nghĩa tùy quán: do ý nghĩa thấy đi thấy lại theo phương diện vô thường v.v...
Abhinīhāro nānattaṃ hotīti abhinīhāro nānā hotīti vā abhinīhārassa nānābhāvo hotīti vā veditabbaṃ.
"The aspiration becomes varied" should be understood either as "the aspiration becomes diverse" or "the diversity of the aspiration comes to be."
Sự hướng tâm trở nên đa dạng: nên hiểu là sự hướng tâm trở nên khác nhau, hoặc là có sự đa dạng của sự hướng tâm.
1102
Kusalāti ārogyaṭṭhena anavajjaṭṭhena kosallasambhūtaṭṭhena ca.
"Wholesome" (kusala) means in the sense of healthiness, blamelessness, and being born of skill.
Thiện: do ý nghĩa không bệnh, không lỗi lầm, và do được tạo ra bởi sự khéo léo.
Abyākatāti kusalākusalabhāvena na byākatā.
"Indeterminate" (abyākatā) means not declared as wholesome or unwholesome.
Vô ký: không được ghi nhận là thiện hay bất thiện.
Kiñcikāle suviditāti vipassanākāle suṭṭhu viditā.
"Well-known at some times" means well-known at the time of vipassanā.
Đôi khi được biết rõ: được biết rõ vào lúc tuệ quán.
Kiñcikāle na suviditāti abhinandanakāle na suṭṭhu viditā.
"Not well-known at some times" means not well-known at the time of delight.
Đôi khi không được biết rõ: không được biết rõ vào lúc hoan hỷ.
Accantaṃ suviditāti abhinandanāya pahīnattā ekantena suviditā.
"Completely well-known" means absolutely well-known due to the abandonment of delight.
Hoàn toàn được biết rõ: được biết rõ một cách tuyệt đối do sự hoan hỷ đã được đoạn trừ.
Viditaṭṭhena ca aviditaṭṭhena cāti ettha puthujjanasekkhānaṃ suviditaṭṭhopi vītarāgassa accantasuviditaṭṭhopi viditaṭṭhova hoti, dvinnampi na suviditaṭṭho aviditaṭṭhova.
Here, regarding "in the sense of being known and in the sense of being unknown," the state of being well-known for ordinary people and Sekkhas, and the state of being completely well-known for an Arahant, are both "known." The state of not being well-known for both (ordinary people and Sekkhas) is "unknown."
Do ý nghĩa đã biết và ý nghĩa chưa biết: Ở đây, ý nghĩa đã biết rõ của phàm phu và hữu học, cũng như ý nghĩa hoàn toàn biết rõ của bậc vô tham, đều là ý nghĩa đã biết. Ý nghĩa không biết rõ của cả hai đều là ý nghĩa chưa biết.
1103
Atittattāti vipassanāya karaṇīyassa apariyositattā appaṇītabhāvena.
"Because of not being satisfied" means due to the uncompleted nature of the task of vipassanā, in the sense of not having set a goal.
Do chưa mãn nguyện: do việc cần làm của tuệ quán chưa hoàn tất, do trạng thái chưa viên mãn.
Tabbiparītena tittattā.
"Because of being satisfied" is the opposite of that.
Ngược lại với điều đó là do đã mãn nguyện.
Tiṇṇaṃ saññojanānaṃ pahānāyāti sakkāyadiṭṭhivicikicchāsīlabbataparāmāsānaṃ pahānatthaṃ.
"For the abandonment of the three fetters" means for the abandonment of personality view (sakkāyadiṭṭhi), doubt (vicikicchā), and clinging to rites and rituals (sīlabbataparāmāsa).
Để đoạn trừ ba kiết sử: để đoạn trừ thân kiến, hoài nghi và giới cấm thủ.
Pacchimabhavikāpi bodhisattā ettheva saṅgahaṃ gacchanti.
Even Bodhisattas who are in their final existence are included here.
Các vị Bồ-tát trong kiếp chót cũng được bao gồm ở đây.
Apacchimabhavikā pana vipassanaṃ saṅkhārupekkhaṃ pāpetvā ṭhapenti.
However, Bodhisattas who are not in their final existence bring vipassanā up to saṅkhārupekkhā and then stop.
Còn các vị Bồ-tát không phải ở kiếp chót thì đưa tuệ quán đến tuệ xả hành rồi dừng lại.
Sotāpattimaggaṃ paṭilābhatthāyāti asamāsetvā paṭhanti, samāsetvā pāṭho sundarataro.
They recite "for the attainment of the Sotāpatti-magga" without compounding; the compounded reading is more appropriate.
Để chứng đắc đạo Dự lưu: họ đọc không ghép lại; cách đọc ghép lại thì hay hơn.
Sekkho tiṇṇaṃ saññojanānaṃ pahīnattāti sotāpannasakadāgāmianāgāmīnaṃ sāmaññena vuttaṃ.
"A Sekkha, due to the abandonment of the three fetters" is stated generally for Sotāpannas, Sakadāgāmis, and Anāgāmis.
Bậc hữu học do đã đoạn trừ ba kiết sử: được nói chung cho các vị Dự lưu, Nhất lai và Bất lai.
Sakadāgāmianāgāmīnampi hi tāni pahīnāneva.
Indeed, for Sakadāgāmis and Anāgāmis too, those fetters are abandoned.
Bởi vì đối với các vị Nhất lai và Bất lai, những kiết sử ấy cũng đã được đoạn trừ.
Uttaripaṭilābhatthāyāti uparūparimaggapaṭilābhatthaṃ.
"For further attainment" means for the attainment of higher and higher paths.
Để chứng đắc cao hơn: để chứng đắc các đạo cao hơn.
Diṭṭhadhammasukhavihāratthāyāti diṭṭheva dhamme paccakkhe attabhāve yo sukho vihāro, tadatthāya.
"For a pleasant abiding in this very life" means for the pleasant abiding that exists in this very life, in this present existence.
Để hiện tại lạc trú: để có sự an trú an lạc trong chính đời này, trong thân hiện tại.
Vihārasamāpattaṭṭhenāti sekkhassa phalasamāpattaṭṭhena, vītarāgassa vipassanāvihāraphalasamāpattaṭṭhena.
"In the sense of attaining abiding" means for a Sekkha, in the sense of attaining fruition-attainment, and for an Arahant, in the sense of attaining the fruition-attainment of vipassanā-abiding.
Do ý nghĩa trú và nhập định: đối với bậc hữu học là do ý nghĩa nhập quả thiền, đối với bậc vô tham là do ý nghĩa tuệ quán trú và nhập quả thiền.
1104
57. Idāni saṅkhārupekkhānaṃ gaṇanaparicchedaṃ dassetuṃ kati saṅkhārupekkhātiādimāha.
Now, to show the enumeration of saṅkhārupekkhā, it is said, "How many saṅkhārupekkhā are there?"
57. Bây giờ, để chỉ ra sự phân định số lượng của các tuệ xả hành, ngài nói Có bao nhiêu tuệ xả hành v.v...
Tattha samathavasenāti samādhivasena.
There, by means of samatha means by means of samādhi.
Ở đó, samathavasenā (theo năng lực của samatha) nghĩa là theo năng lực của samādhi (định).
Ayameva vā pāṭho.
Or this is the reading itself.
Hoặc đây chính là cách đọc.
Nīvaraṇe paṭisaṅkhāti pañca nīvaraṇāni pahātabbabhāvena pariggahetvā.
Having reflected on the hindrances means having understood the five hindrances as things to be abandoned.
Nīvaraṇe paṭisaṅkhā (suy xét các triền cái) nghĩa là sau khi đã nắm bắt năm triền cái với tính chất cần phải đoạn trừ.
Santiṭṭhanāti nīvaraṇānaṃ pahānābhimukhībhūtattā tesaṃ pahānepi abyāpārabhāvūpagamanena majjhattatāya santiṭṭhanā.
Santiṭṭhanā means the establishment of equanimity by becoming indifferent to the abandoning of the hindrances, due to their having become directed towards abandonment, and by not exerting effort in abandoning them.
Santiṭṭhanā (an trú) là sự an trú trong trạng thái trung lập bằng cách đạt đến trạng thái không cần nỗ lực, ngay cả trong việc đoạn trừ các triền cái, vì đã hướng đến việc đoạn trừ chúng.
Saṅkhārupekkhāsūti nīvaraṇappahāne byāpārākaraṇena nīvaraṇasaṅkhātānaṃ saṅkhārānaṃ upekkhanāsu.
In equanimity regarding formations (saṅkhārupekkhā) means in the equanimity regarding formations, which are called hindrances, by not exerting effort in abandoning the hindrances.
Saṅkhārupekkhāsu (trong các hành xả) là trong các sự xả đối với các hành được gọi là triền cái, bằng cách không nỗ lực trong việc đoạn trừ triền cái.
Esa nayo vitakkavicārādīsu ca.
The same method applies to vitakka, vicāra, and so on.
Phương pháp này cũng áp dụng cho tầm, tứ, v.v.
Samathe saṅkhārupekkhā nāma appanāvīthiyā āsannapubbabhāge balappattabhāvanāmayañāṇaṃ.
In samatha, saṅkhārupekkhā is the knowledge born of development that has gained strength in the proximate prior stage of the absorption path.
Trong samatha, hành xả là trí tuệ phát sinh từ sự tu tập đã đạt đến sức mạnh trong giai đoạn cận kề trước lộ trình tâm appanā.
Sotāpattimaggaṃ paṭilābhatthāyātiādīsu catūsu maggavāresu suññatānimittaappaṇihitamaggānaṃ aññataraññataro maggo labbhati.
In the four instances of paths, such as for the attainment of the Sotāpatti-magga, one or another of the paths—suññatā, animitta, or appaṇihita—is obtained.
Trong bốn trường hợp về đạo, như sotāpattimaggaṃ paṭilābhatthāya (để chứng đắc Tu-đà-hoàn đạo), v.v., một trong các đạo không tánh, vô tướng, hoặc vô nguyện sẽ được chứng đắc.
Sotāpattiphalasamāpattatthāyātiādīsu catūsu phalavāresu pana appaṇihitā phalasamāpatti veditabbā.
In the four instances of fruits, such as for the attainment of the Sotāpatti-phala-samāpatti, the appaṇihita fruit attainment should be understood.
Còn trong bốn trường hợp về quả, như sotāpattiphalasamāpattatthāya (để nhập Tu-đà-hoàn quả định), v.v., cần hiểu rằng đó là quả định vô nguyện.
Kasmā?
Why?
Tại sao?
‘‘Suññatavihārasamāpattatthāya animittavihārasamāpattatthāyā’’ti itarāsaṃ dvinnaṃ phalasamāpattīnaṃ visuṃ vuttattā.
Because the other two fruit attainments are stated separately as “for the attainment of the suññatā-vihāra-samāpatti, for the attainment of the animitta-vihāra-samāpatti.”
Vì hai quả định kia đã được nói riêng là: “để nhập không tánh trú định, để nhập vô tướng trú định”.
Aniccānupassanāvuṭṭhānavasena hi animittamaggo, tatheva phalasamāpattikāle animittaphalasamāpatti, dukkhānupassanāvuṭṭhānavasena appaṇihitamaggaphalasamāpattiyo, anattānupassanāvuṭṭhānavasena suññatamaggaphalasamāpattiyo suttantanayeneva veditabbā.
Indeed, the animitta-magga arises by way of the contemplation of impermanence; similarly, the animitta-phala-samāpatti at the time of fruit attainment. The appaṇihita-magga and appaṇihita-phala-samāpattis arise by way of the contemplation of suffering. The suññatā-magga and suññatā-phala-samāpattis arise by way of the contemplation of non-self. This should be understood according to the Suttanta method.
Cần phải hiểu theo phương pháp của Kinh tạng rằng: vô tướng đạo là do xuất khởi từ quán vô thường, và quả định vô tướng cũng tương tự vào lúc nhập quả định; đạo và quả định vô nguyện là do xuất khởi từ quán khổ; đạo và quả định không tánh là do xuất khởi từ quán vô ngã.
1105
Ettha ca catūsu maggavāresu uppādantiādīni pañca mūlapadāni, gatintiādīni dasa vevacanapadānīti pannarasa padāni vuttāni.
Here, in the four instances of paths, the five root terms, such as "arising" (uppāda), and the ten synonymous terms, such as "destination" (gati), making fifteen terms, have been stated.
Ở đây, trong bốn trường hợp về đạo, có năm từ gốc là uppāda (sanh khởi), v.v., và mười từ đồng nghĩa là gati (cảnh giới), v.v., tổng cộng là mười lăm từ đã được nêu.
Chasu pana phalasamāpattivāresu pañca mūlapadāneva vuttāni.
However, in the six instances of fruit attainment, only the five root terms have been stated.
Nhưng trong sáu trường hợp về quả định, chỉ có năm từ gốc được nêu.
Taṃ kasmā iti ce?
Why is that?
Nếu hỏi tại sao lại như vậy?
Saṅkhārupekkhāya tikkhabhāve sati kilesappahāne samatthassa maggassa sambhavato tassā tikkhabhāvadassanatthaṃ vevacanapadehi saha daḷhaṃ katvā mūlapadāni vuttāni.
Because the path, which is capable of abandoning defilements, arises when saṅkhārupekkhā is keen, the root terms were stated firmly together with synonymous terms to show its keenness.
Khi hành xả trở nên sắc bén, đạo có khả năng đoạn trừ phiền não mới có thể phát sinh. Do đó, để chỉ rõ sự sắc bén của nó, các từ gốc được nêu ra cùng với các từ đồng nghĩa để làm cho ý nghĩa vững chắc.
Phalassa nirussāhabhāvena santasabhāvattā maggāyattattā ca mandabhūtāpi saṅkhārupekkhā phalassa paccayo hotīti dassanatthaṃ mūlapadāneva vuttānīti veditabbāni.
It should be understood that even a weak saṅkhārupekkhā becomes a condition for the fruit, to show that the fruit is tranquil due to its lack of exertion and its dependence on the path, therefore only the root terms were stated.
Cần hiểu rằng, chỉ các từ gốc được nêu ra để chỉ rõ rằng ngay cả hành xả yếu ớt cũng có thể là duyên cho quả, vì quả có bản chất an tịnh, không cần nỗ lực và phụ thuộc vào đạo.
1106
58. Idāni jātivasena pucchitvā labbhamānavasena vissajjetuṃ kati saṅkhārupekkhā kusalātiādimāha.
58. Now, to answer by way of what is obtained, having asked by way of origin, he states "How many saṅkhārupekkhā are wholesome?" and so on.
Bây giờ, để hỏi theo phương diện chủng loại và trả lời theo phương diện có thể đạt được, Ngài nói: Kati saṅkhārupekkhā kusalā (Có bao nhiêu hành xả là thiện?), v.v.
Tattha pannarasa saṅkhārupekkhāti samathavasena aṭṭha, catunnaṃ maggānaṃ tiṇṇaṃ phalānaṃ vasena sattāti pannarasa.
There, fifteen saṅkhārupekkhā means eight by way of samatha, and seven by way of the four paths and three fruits, making fifteen.
Ở đó, pannarasa saṅkhārupekkhā (mười lăm hành xả) là: tám theo năng lực của samatha, và bảy theo năng lực của bốn đạo và ba quả, tổng cộng là mười lăm.
Samathavasena aṭṭha saṅkhārupekkhā arahato nīvaraṇapaṭisaṅkhāabhāvato, vitakkavicārādīnaṃ pahānabyāpāraṃ vinā sukhena pahānato ca saṅkhārupekkhānāmassa ananurūpāti katvā tāsaṃ abyākatatā na vuttāti veditabbā.
It should be understood that the eight saṅkhārupekkhā by way of samatha are not described as indeterminate (abyākatā) because for an Arahant there is no reflection on hindrances, and because the abandonment of vitakka, vicāra, etc., occurs easily without exertion, making the term saṅkhārupekkhā unsuitable for them.
Cần hiểu rằng, tám hành xả theo năng lực của samatha không được gọi là vô ký, vì đối với bậc A-la-hán, không có sự suy xét các triền cái, và vì các pháp như tầm, tứ, v.v. được đoạn trừ một cách dễ dàng mà không cần nỗ lực, nên chúng không phù hợp với tên gọi là hành xả.
Arahatā pana phalasamāpattiṃ samāpajjantena saṅkhārupekkhaṃ vinā samāpajjituṃ na sakkāti tisso saṅkhārupekkhā abyākatāti vuttā.
However, since an Arahant cannot enter into fruit attainment without saṅkhārupekkhā, the three saṅkhārupekkhā are stated as indeterminate.
Tuy nhiên, vì bậc A-la-hán khi nhập quả định không thể nhập nếu không có hành xả, nên ba hành xả được gọi là vô ký.
Appaṇihitasuññatānimittavasena hi arahato tisso saṅkhārupekkhā.
Indeed, for an Arahant, there are three saṅkhārupekkhā by way of appaṇihita, suññatā, and animitta.
Thật vậy, đối với bậc A-la-hán, có ba hành xả theo năng lực của vô nguyện, không tánh, và vô tướng.
1107
Idāni saṅkhārupekkhānaṃ saṃvaṇṇanāvasena vuttāsu tīsu gāthāsu paṭisaṅkhāsantiṭṭhanā paññāti saṅkhārupekkhā.
Now, among the three verses stated by way of describing saṅkhārupekkhā: "reflection, establishment, wisdom" (paṭisaṅkhā-santiṭṭhanā paññā) is saṅkhārupekkhā.
Bây giờ, trong ba bài kệ được nói để giải thích về các hành xả, paṭisaṅkhāsantiṭṭhanā paññā (trí tuệ an trú sau khi suy xét) chính là hành xả.
Aṭṭha cittassa gocarāti samathavasena vuttā aṭṭha saṅkhārupekkhā samādhissa visayā, bhūmiyoti attho.
"Eight are the objects of the mind" (aṭṭha cittassa gocarā) means the eight saṅkhārupekkhā stated by way of samatha are the objects of samādhi, or the grounds.
Aṭṭha cittassa gocarā (tám là đối tượng của tâm) nghĩa là tám hành xả được nói theo năng lực của samatha là đối tượng, là nền tảng của định.
‘‘Cittaṃ paññañca bhāvaya’’ntiādīsu (saṃ. ni. 1.23, 192) viya cittasīsena samādhi niddiṭṭho, ‘‘gocare, bhikkhave, caratha sake pettike visaye’’tiādīsu (saṃ. ni. 5.372) viya gocarasaddena visayo.
Samādhi is indicated by the term "citta" (mind), as in "Develop the mind and wisdom" (Saṃ. Ni. 1.23, 192), and the object (visaya) by the term "gocara" (range), as in "Monks, range in your own ancestral domain" (Saṃ. Ni. 5.372).
Định được chỉ định bằng thuật ngữ "tâm" như trong các câu “hãy tu tập tâm và tuệ”, v.v. Đối tượng được chỉ định bằng thuật ngữ "gocara" (hành xứ) như trong các câu “này các Tỳ-khưu, hãy đi trong hành xứ của mình, trong lãnh địa của tổ tiên”, v.v.
Yañhi yadāyattaṃ, tasseso visayoti vuccati.
For whatever is dependent on something, that is called its object.
Bởi vì cái gì phụ thuộc vào cái gì, thì cái đó được gọi là đối tượng của nó.
Puthujjanassa dveti samathavasena vipassanāvasena ca.
"Two for the ordinary person" (puthujjanassa dve) means by way of samatha and by way of vipassanā.
Puthujjanassa dve (hai đối với phàm phu) là theo năng lực của samatha và theo năng lực của vipassanā.
Tayo sekkhassāti samathavipassanāsamāpattivasena.
"Three for the trainee" (tayo sekkhassā) means by way of samatha, vipassanā, and attainment.
Tayo sekkhassa (ba đối với hữu học) là theo năng lực của samatha, vipassanā, và định.
Tayo ca vītarāgassāti appaṇihitasuññatānimittaphalasamāpattivasena.
"And three for the one without defilements" (tayo ca vītarāgassā) means by way of appaṇihita, suññatā, and animitta fruit attainments.
Tayo ca vītarāgassa (và ba đối với bậc ly tham) là theo năng lực của quả định vô nguyện, không tánh, và vô tướng.
‘‘Tisso’’ti vattabbe ‘‘tayo’’ti ca liṅgavipallāso kato.
The gender inversion of "tayo" instead of "tisso" is made.
Đáng lẽ phải nói là “tisso” (ba, giống cái), nhưng lại dùng “tayo” (ba, giống đực), đây là sự thay đổi về giống.
Tayo saṅkhārupekkhā dhammāti vā yojetabbaṃ.
Or it should be construed as "three saṅkhārupekkhā dhammas."
Hoặc nên hiểu là: có ba pháp hành xả.
Yehi cittaṃ vivaṭṭatīti yehi saṅkhārupekkhādhammehi vitakkavicārādito, uppādādito vā cittaṃ apagacchati.
By which the mind turns away means that by those saṅkhārupekkhā phenomena, the mind turns away from vitakka, vicāra, etc., or from arising, etc.
Yehi cittaṃ vivaṭṭatī (nhờ đó tâm xoay chuyển) nghĩa là nhờ những pháp hành xả đó mà tâm lìa khỏi tầm, tứ, v.v., hoặc lìa khỏi sanh khởi, v.v.
Vītarāgassāpi hi saṅkhārupekkhāsabbhāvato ca saṅkhārato cittaṃ vivaṭṭitvā nibbānaṃ pakkhandatīti vuttaṃ hoti.
Indeed, for one who is free from passion, due to the existence of saṅkhārupekkhā, the mind turns away from saṅkhāras and plunges into Nibbāna; thus it is said.
Điều này có nghĩa là, ngay cả đối với bậc ly tham, do sự hiện hữu của hành xả, tâm xoay chuyển khỏi các hành và đi vào Niết-bàn.
Aṭṭha samādhissa paccayāti samathavasena vuttā aṭṭha appanāsampāpakattā appanāsamādhissa paccayā.
Eight are the conditions for concentration means the eight saṅkhārupekkhā knowledges, spoken of in terms of samatha, are conditions for appanā-samādhi because they lead to appanā.
Aṭṭha samādhissa paccayā (tám là duyên của định) nghĩa là tám hành xả được nói theo năng lực của samatha là duyên cho appanāsamādhi (an chỉ định) vì chúng dẫn đến sự thành tựu appanā.
Dasa ñāṇassa gocarāti vipassanāvasena vuttā dasa maggañāṇassa phalañāṇassa ca bhūmiyo.
Ten are the domains of knowledge means the ten stages of path-knowledge and fruition-knowledge, spoken of in terms of vipassanā.
Dasa ñāṇassa gocarā (mười là đối tượng của trí) nghĩa là mười hành xả được nói theo năng lực của vipassanā là nền tảng cho đạo tuệ và quả tuệ.
Tiṇṇaṃ vimokkhāna paccayāti suññatānimittaappaṇihitavimokkhānaṃ upanissayapaccayā.
Conditions for the three liberations means the decisive supporting conditions for the empty, signless, and desireless liberations.
Tiṇṇaṃ vimokkhāna paccayā (là duyên của ba giải thoát) là duyên y chỉ cho giải thoát không tánh, vô tướng, và vô nguyện.
Nānādiṭṭhīsu na kampatīti bhaṅgaṃ avissajjitvāva saṅkhāre aniccādivasena vipassanto sassatadiṭṭhiādīsu nānappakārāsu diṭṭhīsu na vedhatīti.
Does not waver in various views means that one who contemplates saṅkhāras as impermanent, etc., without abandoning their dissolution, does not waver in various views such as the eternalist view, etc.
Nānādiṭṭhīsu na kampatī (không dao động giữa các tà kiến) nghĩa là, trong khi quán các hành theo phương diện vô thường, v.v., mà không từ bỏ sự hoại diệt, vị ấy không bị lay động bởi các loại tà kiến khác nhau như thường kiến, v.v.
1108
Saṅkhārupekkhāñāṇaniddesavaṇṇanā niṭṭhitā.
The commentary on the exposition of Saṅkhārupekkhā-ñāṇa is concluded.
Phần giải thích về Trí Hành Xả đã hoàn tất.
Next Page →