1. Idāni yathānikkhittena uddesena saṅgahite dhamme pabhedato dassetuṃ kathaṃ sotāvadhāne paññā sutamaye ñāṇantiādi niddesavāro āraddho.
Now, to show the phenomena encompassed by the summary in their distinctions as laid down, the section of elucidation beginning with "How is the wisdom in giving ear, the knowledge born of hearing?" has been commenced.
1. Bây giờ, để trình bày các pháp đã được tổng hợp trong phần tổng quát (uddesa) theo cách đã được sắp xếp, phần giải thích (niddesavāra) bắt đầu với câu hỏi kathaṃ sotāvadhāne paññā sutamaye ñāṇa (Trí tuệ trong sự lắng nghe, trí tuệ do nghe, là như thế nào?).
Tattha yaṃ vuttaṃ, ‘‘sotāvadhāne paññā sutamaye ñāṇa’’nti, taṃ kathaṃ hotīti?
Here, what was stated as, "the wisdom in giving ear, the knowledge born of hearing"—how does that come to be?
Ở đây, điều đã được nói là ‘‘sotāvadhāne paññā sutamaye ñāṇa’’, điều đó là như thế nào?
Ayaṃ kathetukamyatāpucchā.
This is a question arising from the desire to explain.
Đây là câu hỏi muốn được giải thích.
Pañcavidhā hi pucchā – adiṭṭhajotanāpucchā, diṭṭhasaṃsandanāpucchā, vimaticchedanāpucchā, anumatipucchā, kathetukamyatāpucchāti.
Indeed, there are five kinds of questions: the question for illuminating the unseen, the question for comparing the seen, the question for resolving doubt, the question for seeking approval, and the question arising from the desire to explain.
Thật vậy, có năm loại câu hỏi: câu hỏi làm sáng tỏ điều chưa thấy (adiṭṭhajotanāpucchā), câu hỏi đối chiếu điều đã thấy (diṭṭhasaṃsandanāpucchā), câu hỏi cắt đứt nghi ngờ (vimaticchedanāpucchā), câu hỏi xin phép (anumatipucchā), và câu hỏi muốn được giải thích (kathetukamyatāpucchā).
Tāsaṃ idaṃ nānattaṃ –
Their distinctions are as follows:
Sự khác biệt giữa chúng là:
Katamā anumatipucchā?
What is the question for seeking approval?
Thế nào là câu hỏi cầu sự đồng ý (anumati-pucchā)?
Bhagavā bhikkhūnaṃ anumatiyā pañhaṃ pucchati – ‘‘taṃ kiṃ maññatha, bhikkhave, rūpaṃ niccaṃ vā aniccaṃ vā’’ti?
The Blessed One asks a question with the bhikkhus' consent: "What do you think, bhikkhus, is form permanent or impermanent?"
Đức Thế Tôn hỏi các Tỳ-kheo để cầu sự đồng ý của họ: “Này các Tỳ-kheo, các ông nghĩ sao, sắc là thường hay vô thường?”.
‘‘Aniccaṃ, bhante’’.
"Impermanent, venerable sir."
“Bạch Thế Tôn, vô thường.”
‘‘Yaṃ panāniccaṃ, dukkhaṃ vā taṃ sukhaṃ vā’’ti?
"But that which is impermanent, is it suffering or happiness?"
“Mà cái gì vô thường, cái ấy là khổ hay lạc?”
‘‘Dukkhaṃ, bhante’’.
"Suffering, venerable sir."
“Bạch Thế Tôn, là khổ.”
‘‘Yaṃ panāniccaṃ dukkhaṃ vipariṇāmadhammaṃ, kallaṃ nu taṃ samanupassituṃ ‘etaṃ mama, esohamasmi, eso me attā’’ti?
"But that which is impermanent, suffering, subject to change, is it proper to regard it thus: 'This is mine, this I am, this is my self'?"
“Mà cái gì vô thường, khổ, có pháp biến hoại, có hợp lý chăng khi quán xét: ‘Cái này là của tôi, cái này là tôi, cái này là tự ngã của tôi’?”
‘‘No hetaṃ, bhante’’ti (mahāva. 21), ayaṃ anumatipucchā.
"No, venerable sir," this is the question for consent.
“Bạch Thế Tôn, không hợp lý chút nào.” Đây là câu hỏi cầu sự đồng ý (anumati-pucchā).
Idāni samātikuddesāya kathetukamyatāpucchāya ‘‘ime dhammā abhiññeyyāti sotāvadhānaṃ, taṃpajānanā paññā sutamaye ñāṇa’’ntiādayo soḷasa vissajjanuddesā.
Now, for the purpose of briefly stating the categories, there are sixteen detailed explanations of the answers to the question for teaching, such as "These phenomena are to be fully understood, and the wisdom that comprehends them is knowledge born of listening."
Bây giờ, mười sáu phần giải đáp (vissajjanuddesā) như “Những pháp này cần được thắng tri (abhiññeyya), sự chú tâm lắng nghe (sotāvadhāna), trí tuệ hiểu biết điều đó là tuệ do nghe (sutamaye ñāṇa)” v.v. là những giải đáp được trình bày theo câu hỏi muốn thuyết giảng (kathetukamyatā-pucchā) với phần tóm tắt (samātikuddesa).
Tattha ime dhammā abhiññeyyāti ‘‘desayantassā’’ti pāṭhaseso.
There, "These phenomena are to be fully understood" is a remaining part of the text, meaning "for one who teaches."
Trong đó, “Những pháp này cần được thắng tri (ime dhammā abhiññeyyā)” có phần còn lại của câu là “của người thuyết giảng”.
Ime dhammā abhijānitabbāti satthuno, aññatarassa vā garuṭṭhāniyassa sabrahmacārissa dhammaṃ desayantassa pubbe vuttanayena sotāvadhānaṃ sutaṃ sotāvadhānaṃ nāma.
"These phenomena are to be fully understood" means that the attention of the listener, as previously stated, when the Teacher or some other respected fellow monastic teaches the Dhamma, is called "sotāvadhāna" (attention of the ear), which is listening.
Sự chú tâm lắng nghe (sotāvadhāna) là sự nghe (sutaṃ) của Đức Bổn Sư hoặc của một vị đồng phạm hạnh có địa vị đáng tôn kính, khi vị ấy thuyết giảng pháp về những pháp này cần được thắng tri (abhijānitabbā) theo cách đã nói trước đây, được gọi là sotāvadhāna.
Taṃpajānanā paññā tassa sutassa pajānanā pariyāyaparicchindakapaññā sutamaye ñāṇaṃ nāmāti attho.
The wisdom that comprehends that (listening) is the wisdom that discerns the meaning of that which has been heard, and this is called knowledge born of listening (sutamaye ñāṇaṃ).
Trí tuệ hiểu biết điều đó (taṃpajānanā paññā) có nghĩa là trí tuệ phân biệt theo phương pháp, hiểu biết về điều đã nghe đó, được gọi là tuệ do nghe (sutamaye ñāṇa).
Tassa pajānanā taṃpajānanāti sāmivacanasamāso.
"Tampajānanā" is a possessive compound, meaning "comprehension of that."
“Taṃpajānanā” là một hợp từ sở thuộc (sāmivacanasamāso), có nghĩa là sự hiểu biết về điều đó.
Taṃ pajānanāti vibhattivipallāsavasena upayogavacanaṃ vā.
Or "taṃ pajānanā" is a dative case by way of a change in case ending.
Hoặc “taṃ pajānanā” là một từ ngữ chỉ sự ứng dụng (upayogavacanaṃ) do sự thay đổi biến cách.
Abhiññeyyāti ca sabhāvalakkhaṇāvabodhavasena sobhanenākārena jānitabbā.
And "abhiññeyyā" means to be known in an excellent manner, by way of comprehending their inherent characteristics.
Và “cần được thắng tri (abhiññeyyā)” có nghĩa là cần được biết một cách tốt đẹp qua sự thấu hiểu các đặc tính riêng biệt (sabhāvalakkhaṇa).
Pariññeyyāti sāmaññalakkhaṇāvabodhavasena kiccasamāpanavasena ca byāpitvā jānitabbā.
"Pariññeyyā" means to be known extensively, by way of comprehending their general characteristics and by accomplishing the task.
“Cần được liễu tri (pariññeyyā)” có nghĩa là cần được biết một cách rộng khắp qua sự thấu hiểu các đặc tính chung (sāmaññalakkhaṇa) và qua sự hoàn thành nhiệm vụ.
Bhāvetabbāti vaḍḍhetabbā.
"Bhāvetabbā" means to be developed.
“Cần được tu tập (bhāvetabbā)” có nghĩa là cần được tăng trưởng.
Sacchikātabbāti paccakkhaṃ kātabbā.
"Sacchikātabbā" means to be realized directly.
“Cần được chứng ngộ (sacchikātabbā)” có nghĩa là cần được thực hiện một cách trực tiếp.
Duvidhā hi sacchikiriyā paṭilābhasacchikiriyā ārammaṇasacchikiriyā ca.
For realization is twofold: realization by attainment and realization by object.
Quả thật, có hai loại chứng ngộ: chứng ngộ thành tựu (paṭilābhasacchikiriyā) và chứng ngộ đối tượng (ārammaṇasacchikiriyā).
Paccanīkasamudācāravasena parihāniyasaṅkhātaṃ hānaṃ bhajantīti hānabhāgiyā.
They tend towards decline, which is called loss, by way of the arising of opposing factors, hence "hānabhāgiyā" (tending to decline).
“Thuộc phần suy thoái (hānabhāgiyā)” là những pháp dẫn đến sự suy thoái, tức là sự mất mát (hāna) do sự phát sinh của các pháp đối nghịch.
Tadanudhammatāya satiyā saṇṭhānavasena ṭhānasaṅkhātaṃ ṭhitiṃ bhajantīti ṭhitibhāgiyā.
They tend towards stability, which is called remaining, by way of establishing mindfulness in accordance with that Dhamma, hence "ṭhitibhāgiyā" (tending to stability).
“Thuộc phần an trú (ṭhitibhāgiyā)” là những pháp dẫn đến sự an trú (ṭhiti), tức là sự ổn định (ṭhāna), do sự an trú của chánh niệm theo pháp tương ứng.
Uparivisesādhigamavasena visesaṃ bhajantīti visesabhāgiyā.
They tend towards distinction, by way of attaining higher distinctions, hence "visesabhāgiyā" (tending to distinction).
“Thuộc phần tăng trưởng (visesabhāgiyā)” là những pháp dẫn đến sự tăng trưởng (visesa) do sự thành tựu các cấp độ cao hơn.
Anibbiddhapubbaṃ appadālitapubbaṃ lobhakkhandhaṃ dosakkhandhaṃ mohakkhandhaṃ nibbijjhati padāletīti ariyamaggo nibbedho nāma, nibbidāsahagatānaṃ saññāmanasikārānaṃ samudācāravasena taṃ nibbedhaṃ bhajantīti nibbedhabhāgiyā.
The Noble Path is called "nibbedha" (penetration) because it penetrates and pierces the aggregates of greed, hatred, and delusion that have not been penetrated or pierced before; they tend towards that penetration by way of the arising of perceptions and attentions accompanied by disenchantment, hence "nibbedhabhāgiyā" (tending to penetration).
Con đường Thánh (ariyamagga) được gọi là sự thâm nhập (nibbedha) vì nó thâm nhập và phá vỡ khối tham (lobhakkhandha), khối sân (dosakkhandha), khối si (mohakkhandha) chưa từng bị xuyên thủng, chưa từng bị phá hủy trước đây; “thuộc phần thâm nhập (nibbedhabhāgiyā)” là những pháp dẫn đến sự thâm nhập (nibbedha) đó do sự phát sinh của các tưởng (saññā) và tác ý (manasikāra) đi kèm với sự nhàm chán (nibbidā).
Sabbe saṅkhārāti sabbe sappaccayā dhammā.
"All formations" means all phenomena with conditions.
“Tất cả các hành (sabbe saṅkhārā)” là tất cả các pháp hữu duyên (sappaccayā dhammā).
Te hi saṅkhatasaṅkhārā nāma.
Indeed, these are called conditioned formations (saṅkhatasaṅkhārā).
Chúng được gọi là các hành hữu vi (saṅkhatasaṅkhārā).
Paccayehi saṅgamma karīyantīti saṅkhārā, te eva paccayehi saṅgamma katattā saṅkhatāti visesetvā vuttā.
They are formed by coming together with conditions, hence "saṅkhārā"; they are specifically called "saṅkhatā" (conditioned) because they are made by coming together with conditions.
Chúng được tạo tác do sự kết hợp của các duyên, nên được gọi là các hành (saṅkhārā); và chúng được nói rõ hơn là hữu vi (saṅkhatā) vì đã được tạo tác do sự kết hợp của các duyên.
Kammanibbattā tebhūmakarūpārūpadhammā abhisaṅkhatasaṅkhārāti aṭṭhakathāsu (visuddhi. 2.587; vibha. aṭṭha. 226 saṅkhārapadaniddesa) vuttā.
In the commentaries, the resultant mental and physical phenomena of the three planes of existence, produced by kamma, are called "abhisaṅkhata saṅkhārā" (karma-formations).
Trong các bộ chú giải (aṭṭhakathā), các pháp sắc và vô sắc thuộc ba cõi được tạo tác bởi nghiệp được gọi là các hành sở tạo (abhisaṅkhatasaṅkhārā).
Tepi ‘‘aniccā va saṅkhārā’’tiādīsu (saṃ. ni. 1.186; 2.143; dī. ni. 2.221, 272) saṅkhatasaṅkhāresu saṅgahaṃ gacchanti.
These also fall under the category of conditioned formations in phrases like "Impermanent indeed are formations."
Những pháp đó cũng được bao gồm trong các hành hữu vi (saṅkhatasaṅkhārā) trong các câu như “Quả thật, các hành là vô thường (aniccā va saṅkhārā)” v.v.
‘‘Avijjāgato ayaṃ, bhikkhave, purisapuggalo puññañceva saṅkhāraṃ abhisaṅkharotī’’tiādīsu (saṃ. ni. 2.51) avijjāpaccayā saṅkhārāva āgatā tebhūmikakusalākusalacetanā abhisaṅkharaṇakasaṅkhārā nāma.
In phrases like "Bhikkhus, this individual, enveloped in ignorance, performs meritorious formations," the volitions of wholesome and unwholesome actions in the three planes of existence, which arise due to ignorance, are called "abhisaṅkharaṇakasaṅkhārā" (forming formations).
Trong các câu như “Này các Tỳ-kheo, người phàm phu này do vô minh mà tạo tác phước hành (puññañceva saṅkhāraṃ abhisaṅkharotī)” v.v., các pháp hành (saṅkhārā) phát sinh do vô minh, tức là các tư (cetanā) thiện và bất thiện thuộc ba cõi, được gọi là các hành tạo tác (abhisaṅkharaṇakasaṅkhārā).
‘‘Yāvatikā abhisaṅkhārassa gati, tāvatikaṃ gantvā akkhāhataṃ maññe aṭṭhāsī’’tiādīsu āgataṃ kāyikaṃ cetasikaṃ vīriyaṃ payogābhisaṅkhāro nāma.
The bodily and mental effort that appears in phrases like "Having gone as far as the movement of the formation, it stood firm as if fixed to an axle," is called "payogābhisaṅkhāro" (effort-formation).
Sự tinh tấn thân và tâm (kāyikaṃ cetasikaṃ vīriyaṃ) được đề cập trong các câu như “Đi xa chừng nào tùy theo sự vận hành của hành tạo tác, rồi đứng yên như thể bị trục giữ lại” được gọi là hành tạo tác do nỗ lực (payogābhisaṅkhāro).
‘‘Saññāvedayitanirodhaṃ samāpannassa kho, āvuso visākha, bhikkhuno paṭhamaṃ nirujjhati vacīsaṅkhāro, tato kāyasaṅkhāro, tato cittasaṅkhāro’’tiādīsu (ma. ni. 1.464) āgatā vitakkavicārā.
The thoughts and reflections that appear in phrases like "Friend Visākha, for a bhikkhu who has attained the cessation of perception and feeling, first the verbal formation ceases, then the bodily formation, then the mental formation."
Trong các câu như “Này Hiền giả Visākha, khi một Tỳ-kheo nhập Diệt thọ tưởng định, hành ngữ (vacīsaṅkhāro) diệt trước, sau đó là hành thân (kāyasaṅkhāro), sau đó là hành ý (cittasaṅkhāro)” v.v., các tầm (vitakka) và tứ (vicāra) được đề cập đến.
Vācaṃ saṅkharontīti vacīsaṅkhārā.
They form speech, hence "vacīsaṅkhārā" (verbal formations).
Tạo tác lời nói nên gọi là hành ngữ (vacīsaṅkhārā).
Assāsapassāsā kāyena saṅkharīyantīti kāyasaṅkhārā.
In-breaths and out-breaths are formed by the body, hence "kāyasaṅkhārā" (bodily formations).
Hơi thở vào và hơi thở ra được thân tạo tác nên gọi là hành thân (kāyasaṅkhārā).
Saññā ca vedanā ca cittena saṅkharīyantīti cittasaṅkhārā.
Perception and feeling are fashioned by the mind, therefore they are mental fabrications.
Tưởng và thọ được tâm tạo tác nên gọi là hành ý (cittasaṅkhārā).
Idha pana saṅkhatasaṅkhārā adhippetā.
But here, conditioned fabrications are intended.
Tuy nhiên, ở đây, các hành hữu vi (saṅkhatasaṅkhārā) được đề cập đến.
Aniccāti hutvā abhāvaṭṭhena.
Impermanent means existing and then ceasing to exist.
“Vô thường (aniccā)” là do đặc tính có rồi không có.
Dukkhāti pīḷanaṭṭhena.
Suffering means by way of oppression.
“Khổ (dukkhā)” là do đặc tính bức bách.
Sabbe dhammāti nibbānampi antokatvā vuttā.
All phenomena are spoken of including Nibbāna.
“Tất cả các pháp (sabbe dhammā)” được nói đến bao gồm cả Nibbāna.
Anattāti avasavattanaṭṭhena.
Non-self means by way of not being subject to one's will.
“Vô ngã (anattā)” là do đặc tính không thuộc quyền tự chủ.
Idaṃ dukkhaṃ ariyasaccantiādīsu ‘‘dukkhasamudayo dukkhanirodho’’ti vattabbe ‘‘dukkhasamudayaṃ dukkhanirodha’’nti liṅgavipallāso kato.
In phrases like "This is the noble truth of suffering", where it should be "the origin of suffering, the cessation of suffering," a gender inversion has been made to "the origin of suffering, the cessation of suffering."
Trong các câu như “Đây là Khổ Thánh đế (idaṃ dukkhaṃ ariyasaccaṃ)” v.v., lẽ ra phải nói “Khổ tập (dukkhasamudayo), Khổ diệt (dukkhanirodho)”, nhưng lại đổi giống thành “Khổ tập (dukkhasamudayaṃ), Khổ diệt (dukkhanirodhaṃ)”.
Yasmā pana buddhādayo ariyā paṭivijjhanti, tasmā ariyasaccānīti vuccanti.
However, because the Noble Ones, such as the Buddhas, penetrate these truths, they are called Noble Truths.
Tuy nhiên, vì chư Phật và các bậc Thánh khác đã thâm nhập các pháp này, nên chúng được gọi là các Thánh đế (ariyasaccāni).
Yathāha ‘‘cattārimāni, bhikkhave, ariyasaccāni…pe… imāni kho, bhikkhave, cattāri ariyasaccāni.
As it is said: "These four, bhikkhus, are Noble Truths…pe… These, bhikkhus, are the four Noble Truths.
Như đã nói: “Này các Tỳ-kheo, có bốn Thánh đế này… (pe) … Này các Tỳ-kheo, đây là bốn Thánh đế.
Ariyā imāni paṭivijjhanti, tasmā ariyasaccānīti vuccantī’’ti.
The Noble Ones penetrate them, therefore they are called Noble Truths."
Các bậc Thánh đã thâm nhập chúng, do đó chúng được gọi là các Thánh đế.”
Ariyassa saccānītipi ariyasaccāni.
They are also Noble Truths because they are the truths of the Noble One.
Các Thánh đế cũng là những sự thật của bậc Thánh (ariyassa saccāni).
Yathāha ‘‘sadevake loke…pe… sadevamanussāya tathāgato ariyo, tasmā ariyasaccānīti vuccantī’’ti (saṃ. ni. 5.1098).
As it is said: "In the world with devas…pe… the Tathāgata is noble among devas and humans, therefore they are called Noble Truths."
Như đã nói: “Trong thế gian cùng với chư thiên… (pe) … Đức Như Lai là bậc Thánh trong thế gian cùng với chư thiên và loài người, do đó chúng được gọi là các Thánh đế.”
Etesaṃ abhisambuddhattā ariyabhāvasiddhitopi ariyasaccāni.
They are also Noble Truths because the state of being noble is attained through their full comprehension.
Các Thánh đế cũng là Thánh đế do sự thành tựu phẩm vị Thánh (ariyabhāvasiddhi) từ sự giác ngộ chúng.
Yathāha ‘‘imesaṃ kho, bhikkhave, catunnaṃ ariyasaccānaṃ yathābhūtaṃ abhisambuddhattā tathāgato arahaṃ sammāsambuddho ariyoti vuccatī’’ti (saṃ. ni. 5.1093).
As it is said: "Because of the full comprehension of these four Noble Truths as they really are, bhikkhus, the Tathāgata, the Arahant, the Perfectly Self-Enlightened One, is called Noble."
Như đã nói: “Này các Tỳ-kheo, do đã giác ngộ đúng như thật bốn Thánh đế này, Đức Như Lai là bậc A-la-hán, Chánh Đẳng Giác, được gọi là bậc Thánh.”
Ariyāni saccānītipi ariyasaccāni.
They are also Noble Truths because they are noble truths.
Các Thánh đế cũng là các sự thật cao thượng (ariyāni saccāni).
Ariyānīti avitathāni, avisaṃvādakānīti attho.
Noble means they are unfailing and non-deceptive.
“Cao thượng (ariyānī)” có nghĩa là không sai lệch, không lừa dối.
Yathāha ‘‘imāni kho, bhikkhave, cattāri ariyasaccāni tathāni avitathāni anaññathāni, tasmā ariyasaccānīti vuccantī’’ti (saṃ. ni. 5.1097).
As it is said: "These four Noble Truths, bhikkhus, are true, unfailing, and not otherwise, therefore they are called Noble Truths."
Như đã nói: “Này các Tỳ-kheo, bốn Thánh đế này là chân thật, không sai lệch, không khác biệt, do đó chúng được gọi là các Thánh đế.”
Saccānīti ko saccaṭṭhoti ce?
If it is asked, "Truths"—what is the meaning of truth?
Nếu hỏi: “Sự thật (saccānī)” có nghĩa là gì?
Yo paññācakkhunā upaparikkhamānānaṃ māyāva viparīto, marīcīva visaṃvādako, titthiyānaṃ parikappitaattāva anupalabbhasabhāvo ca na hoti, atha kho bādhanapabhavasantiniyyānappakārena tacchāviparītabhūtabhāvena ariyañāṇassa gocaro hotiyeva.
That which, when examined by the eye of wisdom, is not like an illusion, not deceptive like a mirage, and not unfindable in nature like the self imagined by sectarians, but is indeed an object of noble knowledge by way of oppression, origin, cessation, and exit, being truly existent and not otherwise.
Đó là một bản chất không phải là ảo ảnh sai lệch như ảo thuật, không lừa dối như ánh nắng ban trưa, không phải là một tự ngã được các ngoại đạo tưởng tượng mà không thể tìm thấy, mà là một đối tượng của Thánh trí (ariyañāṇa) với bản chất chân thật, không sai lệch, hiện hữu qua các phương diện bức bách, phát sinh, an tịnh và xuất ly.
Esa aggilakkhaṇaṃ viya lokapakati viya ca tacchāviparītabhūtabhāvo saccaṭṭhoti veditabbo.
This truly existent and not otherwise nature, like the characteristic of fire or the nature of the world, should be understood as the meaning of truth.
Bản chất chân thật, không sai lệch, hiện hữu này cần được biết là ý nghĩa của sự thật (saccaṭṭha), giống như đặc tính của lửa hay bản chất của thế gian.
Yathāha ‘‘idaṃ dukkhanti, bhikkhave, tathametaṃ avitathametaṃ anaññathameta’’nti (saṃ. ni. 5.1090) vitthāro.
As it is said: "This is suffering, bhikkhus; this is true, this is unfailing, this is not otherwise," and so on in detail.
Như đã nói: “Này các Tỳ-kheo, đây là khổ, điều này là chân thật, điều này không sai lệch, điều này không khác biệt.” v.v. là phần giải thích chi tiết.
Apica –
Furthermore:
Hơn nữa –
So panāyaṃ saccasaddo anekesu atthesu dissati.
This word sacca (truth) is seen in many meanings.
Tuy nhiên, từ sacca này được thấy trong nhiều nghĩa khác nhau.
Seyyathidaṃ – ‘‘saccaṃ bhaṇe na kujjheyyā’’tiādīsu (dha. pa. 224) vācāsacce.
For example, in phrases like "Speak the truth, do not get angry," it refers to truthfulness in speech.
Chẳng hạn, trong các câu như: “Nói lời chân thật, chớ nổi giận” v.v... là nghĩa chân thật của lời nói (vācāsacca).
‘‘Sacce ṭhitā samaṇabrāhmaṇā cā’’tiādīsu (jā. 2.21.433) viratisacce.
In phrases like "Ascetics and brahmins established in truth," it refers to the truth of abstinence.
Trong các câu như: “Các Sa-môn, Bà-la-môn an trú trong chân lý” v.v... là nghĩa chân thật của sự chế ngự (viratisacca).
‘‘Kasmā nu saccāni vadanti nānā, pavādiyāse kusalāvadānā’’tiādīsu (su. ni. 891) diṭṭhisacce.
In phrases like "Why do debaters, skilled in argument, speak various truths?" it refers to the truth of views.
Trong các câu như: “Tại sao những người tranh luận, những người tự xưng là thiện xảo, lại nói những chân lý khác nhau?” v.v... là nghĩa chân thật của quan kiến (diṭṭhisacca).
‘‘Ekañhi saccaṃ na dutīyamatthi, yasmiṃ pajā no vivade pajāna’’ntiādīsu (su. ni. 890; mahāni. 119) paramatthasacce nibbāne ceva magge ca.
In phrases like "There is indeed one truth, there is no second, by which people, knowing, do not dispute," it refers to ultimate truth, Nibbāna and the Path.
Trong các câu như: “Chỉ có một chân lý, không có chân lý thứ hai, mà nhờ đó chúng sinh không tranh cãi khi hiểu biết” v.v... là nghĩa chân thật tối hậu (paramatthasacca) trong Nibbāna và Đạo.
‘‘Catunnaṃ saccānaṃ kati kusalā kati akusalā’’tiādīsu (vibha. 216) ariyasacce.
In phrases like "Among the four truths, how many are wholesome, how many unwholesome?" it refers to the Noble Truths.
Trong các câu như: “Trong bốn chân lý, có bao nhiêu là thiện, bao nhiêu là bất thiện?” v.v... là nghĩa Thánh đế (ariyasacca).
Svāyamidhāpi ariyasacce pavattatīti.
And here too, it refers to the Noble Truths.
Ở đây, từ này cũng được dùng trong nghĩa Thánh đế.
2. Idāni vissajjanuddesasaṅgahite dhamme pabhedato dassetuṃ kathaṃ ime dhammā abhiññeyyātiādi niddesavāro āraddho.
2. Now, to show the phenomena included in the Vissajjanuddesa by their classifications, the Niddesavāra beginning with "How are these phenomena to be fully understood?" has been commenced.
2. Bây giờ, để trình bày các pháp được bao gồm trong Uddesa trả lời một cách chi tiết, Niddesavāra bắt đầu với câu: “Những pháp này cần được thắng tri như thế nào?”
Tattha abhiññeyyaniddesādīsu pañcasu ādito ekakādivasena dasa dasa vissajjanāni dasuttarapariyāyena saṃsandetvā uddiṭṭhāni.
Therein, in the five sections beginning with the Abhiññeyyaniddesa, ten answers each are first enumerated by correlating them with the Dasuttara-pariyāya (the exposition of the "more than ten" groups).
Trong năm phần Abhiññeyyaniddesa v.v... ban đầu, mười câu trả lời theo từng nhóm một, hai, v.v... được trình bày bằng cách đối chiếu với phương pháp Dasuttara.
Tesu abhiññeyyaniddese tāva sabbe sattāti kāmabhavādīsu saññābhavādīsu ekavokārabhavādīsu ca sabbabhavesu sabbe sattā.
In these, in the designation of what is to be directly known, first, "all beings" means all beings in all existences, such as the sense-sphere existences, the perception-sphere existences, and the one-constituent existences.
Trong số đó, trước hết, trong Abhiññeyyaniddesa, câu “Tất cả chúng sinh” có nghĩa là tất cả chúng sinh trong các cõi dục (kāmabhava), các cõi sắc (rūpabhava), các cõi vô sắc (arūpabhava), các cõi có tưởng (saññābhava), các cõi vô tưởng (asaññābhava), các cõi phi tưởng phi phi tưởng (nevasaññānāsaññābhava), các cõi một uẩn (ekavokārabhava), các cõi bốn uẩn (catuvokārabhava), và các cõi năm uẩn (pañcavokārabhava) – tức là tất cả chúng sinh trong chín cõi tái sinh.
Āhāraṭṭhitikāti āhārato ṭhiti etesanti āhāraṭṭhitikā.
"Sustained by nutriment" means that their existence is due to nutriment, hence they are "sustained by nutriment."
“Dựa vào thức ăn để tồn tại” (āhāraṭṭhitikā) có nghĩa là sự tồn tại của chúng dựa vào thức ăn.
Ṭhitīti cettha sakakkhaṇe atthitā adhippetā.
Here, "existence" implies being present in one's own moment.
Ở đây, từ “tồn tại” (ṭhiti) có nghĩa là sự hiện hữu trong khoảnh khắc riêng của nó.
Iti sabbasattānaṃ ṭhitihetu āhāro nā eko dhammo adhikena ñāṇena jānitabbo.
Thus, nutriment, as the cause of existence for all beings, is one phenomenon to be known by higher knowledge.
Như vậy, thức ăn là một pháp duy nhất cần được biết bằng trí tuệ siêu việt như là nguyên nhân tồn tại của tất cả chúng sinh.
Paccaye hi abhiññāte paccayuppannāpi abhiññātā honti ubhinnampi aññamaññāpekkhattā.
For when the causes are directly known, the effects are also directly known, as both are interdependent.
Thật vậy, khi các duyên được thắng tri, thì các pháp do duyên sinh cũng được thắng tri, vì cả hai đều phụ thuộc lẫn nhau.
Etena ñātapariññā vuttā hoti.
By this, the comprehension of what is known (ñātapariññā) is stated.
Với điều này, sự hiểu biết toàn diện (ñātapariññā) đã được nói đến.
Nanu ca evaṃ sante yaṃ vuttaṃ ‘‘asaññasattā devā ahetukā anāhārā aphassakā’’tiādi (vibha. 1017), taṃ virujjhatīti.
"But then," one might object, "what was said, 'The non-percipient devas are without cause, without nutriment, without contact,' would be contradicted."
Chẳng phải điều đã nói: “Các chư thiên vô tưởng không có nhân, không có thức ăn, không có xúc” v.v... là mâu thuẫn sao?
Tañca na virujjhati.
That is not contradicted.
Điều đó không mâu thuẫn.
Tesañhi jhānaṃ āhāroti.
For them, jhāna is nutriment.
Thật vậy, đối với họ, thiền định là thức ăn.
Evaṃ santepi ‘‘cattārome, bhikkhave, āhārā bhūtānaṃ vā sattānaṃ ṭhitiyā, sambhavesīnaṃ vā anuggahāya.
"Even so, this would be contradicted: 'Monks, there are these four nutriments for the sustenance of beings that have come to be, or for the support of those seeking rebirth.
Nếu vậy, điều này: “Này các Tỳ-kheo, có bốn loại thức ăn này để duy trì sự sống của chúng sinh đã sinh, hoặc để hỗ trợ những chúng sinh sắp sinh.
Katame cattāro?
What are these four?
Bốn loại nào?
Kabaḷīkāro āhāro oḷāriko vā sukhumo vā, phasso dutiyo, manosañcetanā tatiyā, viññāṇaṃ catuttha’’nti (saṃ. ni. 2.11) idaṃ virujjhatīti.
Physical food, coarse or subtle; contact is the second; mental volition is the third; consciousness is the fourth.'"
Thức ăn vật chất, thô hay vi tế; xúc là thứ hai; tư tâm sở là thứ ba; thức là thứ tư” sẽ mâu thuẫn.
Idampi na virujjhati.
This too is not contradicted.
Điều này cũng không mâu thuẫn.
Etasmiñhi sutte nippariyāyena āhāralakkhaṇāva dhammā āhārāti vuttā.
For in that Sutta, phenomena with the characteristic of nutriment are stated as nutriments in the literal sense (nippariyāya).
Vì trong kinh này, các pháp có đặc tính của thức ăn được gọi là thức ăn theo nghĩa đen (nippariyāyena).
Idha pana pariyāyena paccayo āhāroti vutto.
Here, however, a condition is stated as nutriment in a figurative sense (pariyāya).
Ở đây, duyên được gọi là thức ăn theo nghĩa ẩn dụ (pariyāyena).
Sabbasaṅkhatadhammānañhi paccayo laddhuṃ vaṭṭati, so ca yaṃ yaṃ phalaṃ janeti, taṃ taṃ āharati nāma.
Indeed, a condition for all conditioned phenomena is to be found, and whatever result it generates, that it "brings forth" (āharati).
Thật vậy, đối với tất cả các pháp hữu vi, duyên có thể được tìm thấy, và duyên đó mang lại bất kỳ kết quả nào mà nó tạo ra.
Tasmā āhāroti vuccati.
Therefore, it is called nutriment.
Do đó, nó được gọi là thức ăn.
Tenevāha –
That is why it is said:
Chính vì thế mà Ngài đã nói:
‘‘Avijjampāhaṃ, bhikkhave, sāhāraṃ vadāmi, no anāhāraṃ.
"Monks, I declare even ignorance to have nutriment, not to be without nutriment.
“Này các Tỳ-kheo, Ta nói vô minh có thức ăn, không phải không có thức ăn.
Ko ca, bhikkhave, avijjāya āhāro?
And what, monks, is the nutriment for ignorance?
Này các Tỳ-kheo, thức ăn của vô minh là gì?
‘Pañca nīvaraṇā’tissa vacanīyaṃ.
'The five hindrances' should be said.
Phải nói là ‘năm triền cái’.
Pañca nīvaraṇepāhaṃ, bhikkhave, sāhāre vadāmi, no anāhāre.
And the five hindrances, monks, I declare to have nutriment, not to be without nutriment.
Này các Tỳ-kheo, Ta nói năm triền cái có thức ăn, không phải không có thức ăn.
Ko ca, bhikkhave, pañcannaṃ nīvaraṇānaṃ āhāro.
And what, monks, is the nutriment for the five hindrances?
Này các Tỳ-kheo, thức ăn của năm triền cái là gì?
‘Ayoniso manasikāro’tissa vacanīya’’ntiādi (a. ni. 10.61).
'Unwise attention' should be said."
Phải nói là ‘tác ý không như lý’ v.v...”
Ayaṃ idha adhippeto.
This is what is intended here.
Đây là ý nghĩa được đề cập ở đây.
Tattha asaññabhave paccayāhāro labbhati.
There, in the non-percipient existence (asaññabhava), nutriment as condition is found.
Trong cõi vô tưởng, thức ăn duyên được tìm thấy.
Anuppanne hi buddhe titthāyatane pabbajitvā vāyokasiṇe parikammaṃ katvā catutthajjhānaṃ nibbattetvā tato vuṭṭhāya ‘‘dhī cittaṃ, dhī cittaṃ, cittassa nāma abhāvoyeva sādhu.
For before the Buddha arose, some, having gone forth into the ascetic tradition, performed preliminary work on the air kasina, generated the fourth jhāna, and rising from it, thought, "Fie on consciousness! Fie on consciousness! It is good that consciousness does not exist.
Thật vậy, trước khi Đức Phật xuất hiện, có những người xuất gia theo ngoại đạo, thực hành biến xứ gió (vāyokasiṇa), chứng đắc Tứ thiền, rồi xuất thiền và suy nghĩ: “Tâm thật đáng ghê tởm! Tâm thật đáng ghê tởm! Không có tâm mới là tốt.
Cittañhi nissāya vadhabandhanādipaccayaṃ dukkhaṃ uppajjati, citte asati nattheta’’nti khantiṃ ruciṃ uppādetvā aparihīnajjhānā kālaṃkatvā asaññabhave nibbattanti.
For suffering, which has killing and binding as its cause, arises dependent on consciousness; when consciousness is absent, that suffering does not exist." Having thus generated patience and delight, and without their jhāna declining, they passed away and were reborn in the non-percipient existence.
Vì nương vào tâm mà khổ đau do giết chóc, trói buộc v.v... phát sinh; khi không có tâm, những điều đó không có.” Họ đã phát sinh lòng kiên nhẫn và sự yêu thích như vậy, rồi chết đi khi thiền định không bị suy giảm, và tái sinh vào cõi vô tưởng.
Yo yassa iriyāpatho manussaloke paṇihito ahosi, so tena iriyāpathena nibbattitvā pañca kappasatāni tiṭṭhati.
Whatever posture they had maintained in the human world, they are reborn in that posture and remain for five hundred kappas.
Tư thế oai nghi nào mà họ đã giữ ở cõi người, họ sẽ tái sinh với tư thế đó và tồn tại trong năm trăm đại kiếp.
Ettakaṃ addhānaṃ nipanno viya nisinno viya ṭhito viya hoti.
For that long a time, they are as if lying, as if sitting, as if standing.
Trong khoảng thời gian dài như vậy, họ giống như đang nằm, đang ngồi, hay đang đứng.
Evarūpānañca sattānaṃ paccayāhāro labbhati.
For such beings, nutriment as condition is found.
Đối với những chúng sinh như vậy, thức ăn duyên được tìm thấy.
Te hi yaṃ jhānaṃ bhāvetvā nibbattā, tade nesaṃ paccayo hoti.
For the jhāna they developed before being reborn is their condition.
Thật vậy, thiền định mà họ đã tu tập để tái sinh chính là duyên của họ.
Yathā jiyāvegena khittasaro yāva jiyāvego atthi, tāva gacchati, evaṃ yāva jhānapaccayo atthi, tāva tiṭṭhanti.
Just as an arrow shot by the force of a bowstring travels as long as the force of the bowstring exists, so too they remain as long as the jhāna-condition exists.
Giống như mũi tên được bắn đi bởi sức mạnh của dây cung sẽ bay xa chừng nào sức mạnh của dây cung còn đó, thì họ cũng tồn tại chừng nào duyên thiền định còn đó.
Tasmiṃ niṭṭhite khīṇavego saro viya patanti.
When that is exhausted, they fall like an arrow whose force is spent.
Khi duyên đó chấm dứt, họ rơi xuống như mũi tên đã hết lực.
Ye pana te nerayikā ‘‘nevuṭṭhānaphalūpajīvino na puññaphalūpajīvino’’ti vuttā, tesaṃ ko āhāroti?
But what is the nutriment for those beings in hell who are said to be "not living on the fruit of exertion, nor living on the fruit of merit"?
Còn những chúng sinh trong địa ngục, những người được nói là “không sống nhờ quả của sự nỗ lực, không sống nhờ quả của phước báu”, thức ăn của họ là gì?
Tesaṃ kammameva āhāroti.
For them, kamma itself is nutriment.
Đối với họ, chính nghiệp là thức ăn.
Kiṃ pañca āhārā atthīti?
Are there five nutriments?
Có năm loại thức ăn sao?
‘‘Pañca, na pañcā’’ti idaṃ na vattabbaṃ.
This should not be said: "Five, not five."
Không nên nói “năm, không phải năm”.
Nanu ‘‘paccayo āhāro’’ti vutto, tasmā yena kammena te niraye nibbattā, tadeva tesaṃ ṭhitipaccayattā āhāro.
Was it not said that "a condition is nutriment"? Therefore, the kamma by which they were reborn in hell, that itself is their nutriment, as it is the condition for their existence.
Chẳng phải đã nói “duyên là thức ăn” sao? Do đó, nghiệp mà họ đã tái sinh vào địa ngục chính là thức ăn của họ, vì nó là duyên cho sự tồn tại của họ.
Yaṃ sandhāya idaṃ vuttaṃ ‘‘na tāva kālaṃ karoti, yāva na taṃ pāpakammaṃ byantī hotī’’ti (a. ni. 3.36; ma. ni. 3.250).
It is with reference to this that it was said, "He does not die until that evil kamma is exhausted."
Điều này được nói đến trong câu: “Người đó sẽ không chết chừng nào ác nghiệp đó chưa chấm dứt.”
Tasmā āhāraṭṭhitikāti paccayaṭṭhitikāti attho.
Therefore, "sustained by nutriment" means "sustained by condition."
Do đó, āhāraṭṭhitikā có nghĩa là tồn tại nhờ duyên.
Kabaḷīkāraṃ āhāraṃ ārabbhāti cettha vivādo na kātabbo.
Here, no dispute should be made regarding physical food.
Không nên tranh cãi về việc này liên quan đến thức ăn vật chất (kabaḷīkāra).
Mukhe uppannakheḷopi hi tesaṃ āhārakiccaṃ sādheti.
For even the saliva produced in their mouths serves as nutriment for them.
Thật vậy, ngay cả nước bọt tiết ra trong miệng cũng thực hiện chức năng thức ăn cho họ.
Kheḷo hi niraye dukkhavedanīyo hutvā paccayo hoti, sagge sukhavedanīyo.
Indeed, saliva in hell becomes a condition that causes painful feeling, and in heaven, it causes pleasant feeling.
Nước bọt trong địa ngục là duyên gây ra cảm thọ khổ, còn ở cõi trời là duyên gây ra cảm thọ lạc.
Iti kāmabhave nippariyāyena cattāro āhārā, rūpārūpabhavesu ṭhapetvā asaññabhavaṃ sesānaṃ tayo, asaññānañceva avasesānañca paccayāhāroti iminā āhārena sabbe sattā āhāraṭṭhitikā.
Thus, in the kāma-bhava, there are four nutriments directly; in the rūpa and arūpa-bhavas, excluding the asañña-bhava, there are three for the remaining (beings); and for the asañña beings and the remaining (phenomena), there is nutriment as condition. By this nutriment, all beings (or conditioned phenomena) are sustained by nutriment.
Như vậy, trong cõi dục, có bốn loại thức ăn theo nghĩa đen; trong cõi sắc và vô sắc, trừ cõi vô tưởng, có ba loại (thức ăn) cho những chúng sinh còn lại; và đối với chúng sinh vô tưởng cùng những chúng sinh còn lại, có thức ăn duyên. Với các loại thức ăn này, tất cả chúng sinh đều tồn tại nhờ thức ăn.
Sabbe sattāti ca puggalādhiṭṭhānā dhammadesanā, sabbe saṅkhārāti adhippāyo.
And the phrase “ all beings” is a discourse on phenomena based on the individual; the intention is “all conditioned phenomena.”
Và câu “Tất cả chúng sinh” là một lời giảng pháp dựa trên giả định về cá nhân; ý nghĩa là tất cả các pháp hữu vi (saṅkhāra).
Bhagavatopi hi dhammapuggalānaṃ vasena catubbidhā desanā – dhammādhiṭṭhānā dhammadesanā, dhammādhiṭṭhānā puggaladesanā, puggalādhiṭṭhānā puggaladesanā, puggalādhiṭṭhānā dhammadesanāti.
Indeed, the Blessed One's discourse is fourfold, in terms of phenomena and individuals: a discourse on phenomena based on phenomena, a discourse on individuals based on phenomena, a discourse on individuals based on individuals, and a discourse on phenomena based on individuals.
Thật vậy, lời dạy của Đức Thế Tôn có bốn loại dựa trên pháp và cá nhân: lời dạy pháp dựa trên pháp, lời dạy về cá nhân dựa trên pháp, lời dạy về cá nhân dựa trên cá nhân, và lời dạy pháp dựa trên cá nhân.
‘‘Nāhaṃ, bhikkhave, aññaṃ ekadhammampi samanupassāmi, yaṃ evaṃ bhāvitaṃ kammaniyaṃ hoti, yathayidaṃ cittaṃ.
“Bhikkhus, I do not perceive any other single phenomenon that, when developed in this way, becomes workable, as is this mind.
“Này các Tỳ-kheo, Ta không thấy một pháp nào khác mà khi được tu tập như vậy lại có thể làm được việc, như tâm này.
Cittaṃ, bhikkhave, bhāvitaṃ kammaniyaṃ hotī’’ti (a. ni. 1.22) evarūpī dhammādhiṭṭhānā dhammadesanā.
Bhikkhus, the mind, when developed, becomes workable”—such is a discourse on phenomena based on phenomena.
Này các Tỳ-kheo, tâm được tu tập thì có thể làm được việc.” Lời dạy như vậy là lời dạy pháp dựa trên pháp.
‘‘Aṭṭhānametaṃ, bhikkhave, anavakāso yaṃ diṭṭhisampanno puggalo kañci saṅkhāraṃ niccato upagaccheyya, netaṃ ṭhānaṃ vijjatī’’ti (a. ni. 1.268) evarūpī dhammādhiṭṭhānā puggaladesanā.
“Bhikkhus, it is impossible, there is no opportunity, for a person endowed with right view to regard any conditioned phenomenon as permanent; such a situation does not exist”—such is a discourse on individuals based on phenomena.
“Này các Tỳ-kheo, không thể có chuyện, không có cơ hội, một người có chánh kiến lại xem bất kỳ pháp hữu vi nào là thường còn; điều đó không thể có.” Lời dạy như vậy là lời dạy về cá nhân dựa trên pháp.
‘‘Ekapuggalo, bhikkhave, loke uppajjamāno uppajjati bahujanahitāya bahujanasukhāya lokānukampāya atthāya hitāya sukhāya devamanussāna’’nti (a. ni. 1.170, 309), evarūpī puggalādhiṭṭhānā puggaladesanā.
“Bhikkhus, when one individual arises in the world, he arises for the welfare of many people, for the happiness of many people, out of compassion for the world, for the good, welfare, and happiness of devas and humans”—such is a discourse on individuals based on individuals.
‘‘Này các Tỳ-khưu, một người xuất hiện trên đời, xuất hiện vì lợi ích của nhiều người, vì hạnh phúc của nhiều người, vì lòng thương xót thế gian, vì mục đích, vì lợi ích, vì hạnh phúc của chư thiên và loài người.’’ – lời dạy như vậy là lời dạy về cá nhân dựa trên cá nhân (puggalādhiṭṭhānā puggaladesanā).
‘‘Ekapuggalassa bhikkhave, pātubhāvā mahato cakkhussa pātubhāvo hotī’’ti (a. ni. 1.175-186) evarūpī puggalādhiṭṭhānā dhammadesanā.
“Bhikkhus, with the appearance of one individual, the appearance of a great eye occurs”—such is a discourse on phenomena based on individuals.
‘‘Này các Tỳ-khưu, do sự xuất hiện của một người, sự xuất hiện của đại trí nhãn (mahato cakkhussa) xảy ra.’’ – lời dạy như vậy là lời dạy về Pháp dựa trên cá nhân (puggalādhiṭṭhānā dhammadesanā).
Tāsu idha puggalādhiṭṭhānā dhammadesanā.
Among these, here it is a discourse on phenomena based on individuals.
Trong số đó, ở đây là lời dạy về Pháp dựa trên cá nhân.
Upari yāva dasakā dhammānaṃyeva gahitattā sattaggahaṇena dhammaggahaṇaṃ katanti veditabbaṃ, visesena vā sattasantānapariyāpannadhammānaṃyeva adhikena ñāṇena sabhāvato upaparikkhitabbattā sattaggahaṇaṃ katanti veditabbaṃ, saṅkhāre upādāya sattoti paññattimattasambhavato vā phalopacārena saṅkhārā ‘‘sattā’’ti vuttāti veditabbaṃ.
It should be understood that, further on, up to the tens, since only phenomena are taken, the taking of "beings" implies the taking of phenomena. Or, it should be understood that "beings" is taken especially because the phenomena included in the continuum of beings are to be examined in their true nature with superior knowledge. Or, it should be understood that conditioned phenomena are called "beings" by way of the result, because the designation "being" arises merely by referring to conditioned phenomena.
Phải hiểu rằng, từ trên cho đến mười, vì chỉ nắm giữ các pháp (dhammā) nên việc nắm giữ chúng sanh (satta) được thực hiện bằng cách nắm giữ các pháp. Hoặc phải hiểu rằng, việc nắm giữ chúng sanh được thực hiện vì các pháp thuộc dòng tương tục của chúng sanh cần được quán sát bản chất bằng tuệ tri vượt trội. Hoặc phải hiểu rằng, do sự tồn tại của sự chế định chúng sanh (satta) dựa trên các hành (saṅkhāra), nên các hành được gọi là ‘‘chúng sanh’’ theo cách ví dụ về quả.
Na hi koci satto paccayaṭṭhitiko atthi aññatra saṅkhārehi, vohāravasena pana evaṃ vuccati.
Indeed, there is no being that is sustained by a condition apart from conditioned phenomena, but it is said this way by way of conventional usage.
Thật vậy, không có chúng sanh nào tồn tại dựa trên các duyên ngoài các hành. Tuy nhiên, theo cách nói thông thường, nó được nói như vậy.
Evametena ñātapariññā vuttā hoti.
Thus, by this, the knowledge of discernment (ñāta-pariññā) is explained.
Như vậy, với điều này, sự liễu tri bằng sự hiểu biết (ñātapariññā) đã được nói đến.
Tisso dhātuyoti kāmadhātu rūpadhātu arūpadhātu (vibha. 181-182).
Three elements means the kāma-dhātu, rūpa-dhātu, and arūpa-dhātu.
Ba giới (tisso dhātuyo) là Dục giới (kāmadhātu), Sắc giới (rūpadhātu), Vô sắc giới (arūpadhātu).
Tattha katamā kāmadhātu?
Among these, what is the kāma-dhātu?
Trong đó, Dục giới là gì?
Heṭṭhato avīcinirayaṃ pariyantaṃ karitvā uparito paranimmitavasavattī deve antokaritvā yaṃ etasmiṃ antare etthāvacarā ettha pariyāpannā khandhā dhātū āyatanā rūpā vedanā saññā saṅkhārā viññāṇaṃ.
It is the aggregates, elements, sense bases, matter, feeling, perception, mental formations, and consciousness that are within this interval, that belong to this realm, that are included herein, taking the Avīci hell as the lower limit and including the Paranimmitavasavattī devas as the upper limit.
Từ dưới lấy địa ngục Avīci làm giới hạn, từ trên lấy chư thiên Paranimmitavasavattī làm giới hạn, những uẩn, giới, xứ, sắc, thọ, tưởng, hành, thức nằm trong khoảng này, thuộc phạm vi này, bao gồm trong khoảng này.
Ayaṃ vuccati kāmadhātu (vibha. 182; dha. sa. 1287).
This is called the kāma-dhātu.
Đây được gọi là Dục giới.
Tattha katamā rūpadhātu?
Among these, what is the rūpa-dhātu?
Trong đó, Sắc giới là gì?
Heṭṭhato brahmalokaṃ pariyantaṃ karitvā uparito akaniṭṭhe deve antokaritvā yaṃ etasmiṃ antare etthāvacarā ettha pariyāpannā samāpannassa vā upapannassa vā diṭṭhadhammasukhavihārissa vā cittacetasikā dhammā.
It is the mental and concomitant phenomena of a person who has attained rūpāvacara jhāna, or has been reborn in the rūpāvacara realm, or dwells happily in this very life with rūpāvacara jhāna, that are within this interval, that belong to this realm, that are included herein, taking the Brahma world as the lower limit and including the Akaniṭṭha devas as the upper limit.
Từ dưới lấy cõi Phạm thiên làm giới hạn, từ trên lấy chư thiên Akanitṭha làm giới hạn, những pháp tâm và tâm sở của người nhập định, hoặc người tái sanh, hoặc người sống an lạc trong hiện tại, nằm trong khoảng này, thuộc phạm vi này, bao gồm trong khoảng này.
Ayaṃ vuccati rūpadhātu.
This is called the rūpa-dhātu.
Đây được gọi là Sắc giới.
Tattha katamā arūpadhātu?
Among these, what is the arūpa-dhātu?
Trong đó, Vô sắc giới là gì?
Heṭṭhato ākāsānañcāyatanūpage deve pariyantaṃ karitvā uparito nevasaññānāsaññāyatanūpage deve antokaritvā yaṃ etasmiṃ antare etthāvacarā ettha pariyāpannā samāpannassa vā upapannassa vā diṭṭhadhammasukhavihārissa vā cittacetasikā dhammā.
It is the mental and concomitant phenomena of a person who has attained arūpāvacara jhāna, or has been reborn in the arūpa realm, or dwells happily in this very life with arūpāvacara jhāna, that are within this interval, that belong to this realm, that are included herein, taking the devas who have attained the base of infinite space as the lower limit and including the devas who have attained the base of neither-perception-nor-non-perception as the upper limit.
Từ dưới lấy chư thiên sanh vào Không vô biên xứ làm giới hạn, từ trên lấy chư thiên sanh vào Phi tưởng phi phi tưởng xứ làm giới hạn, những pháp tâm và tâm sở của người nhập định, hoặc người tái sanh, hoặc người sống an lạc trong hiện tại, nằm trong khoảng này, thuộc phạm vi này, bao gồm trong khoảng này.
Ayaṃ vuccati arūpadhātu.
This is called the arūpa-dhātu.
Đây được gọi là Vô sắc giới.
Aṭṭhakathāyaṃ pana ‘‘kāmadhātūti kāmabhavo pañcakkhandhā labbhanti, rūpadhātūti rūpabhavo pañcakkhandhā labbhanti.
However, in the Commentary, it is said: “Kāma-dhātu means the kāma-bhava, where the five aggregates are found; rūpa-dhātu means the rūpa-bhava, where the five aggregates are found.
Trong Chú giải lại nói rằng: ‘‘Dục giới là cõi dục, năm uẩn được tìm thấy; Sắc giới là cõi sắc, năm uẩn được tìm thấy.
Arūpadhātūti arūpabhavo cattāro khandhā labbhantī’’ti vuttaṃ.
Arūpa-dhātu means the arūpa-bhava, where the four aggregates are found.”
Vô sắc giới là cõi vô sắc, bốn uẩn được tìm thấy.’’
Ayaṃ dasuttarapariyāyena yojanā.
This is an explanation according to the Dasuttara method.
Đây là cách giải thích theo phương pháp Dasuttara.
Saṅgītipariyāyena pana ‘‘tisso kusaladhātuyo – nekkhammadhātu abyāpādadhātu avihiṃsādhātu.
Moreover, according to the discourse of the Saṅgīti Sutta, 'three wholesome elements – the element of renunciation, the element of non-ill-will, the element of non-harming.'
Tuy nhiên, theo phương pháp Saṅgīti, các giới đã được nói đến như: ‘‘Ba thiện giới – giới xuất ly (nekkhammadhātu), giới vô sân (abyāpādadhātu), giới vô hại (avihiṃsādhātu).
Aparāpi tisso dhātuyo – rūpadhātu arūpadhātu nirodhadhātu.
Again, three elements – the element of form, the element of formlessness, the element of cessation.
Ba giới khác – Sắc giới (rūpadhātu), Vô sắc giới (arūpadhātu), Diệt giới (nirodhadhātu).
Aparāpi tisso dhātuyo – hīnā dhātu majjhimā dhātu paṇītā dhātū’’ti (dī. ni. 1.3.305) vuttā dhātuyopi ettha yujjanti (vibha. 181-182).
Again, three elements – the inferior element, the middling element, the sublime element' – these elements, as stated, are also applicable here.
Ba giới khác – giới hạ liệt (hīnā dhātu), giới trung bình (majjhimā dhātu), giới thù thắng (paṇītā dhātu)’’ cũng phù hợp ở đây.
Nekkhammapaṭisaṃyutto takko vitakko…pe… sammāsaṅkappo.
Thinking and pondering associated with renunciation… and right thought.
Tư duy (takka), tầm (vitakka)… và chánh tư duy (sammāsaṅkappa) liên quan đến xuất ly.
Ayaṃ vuccati nekkhammadhātu.
This is called the element of renunciation.
Đây được gọi là giới xuất ly.
Sabbepi kusalā dhammā nekkhammadhātu.
All wholesome phenomena are the element of renunciation.
Tất cả các pháp thiện đều là giới xuất ly.
Abyāpādapaṭisaṃyutto takko vitakko…pe… sammāsaṅkappo abyāpādadhātu.
Thinking and pondering associated with non-ill-will… and right thought is the element of non-ill-will.
Tư duy, tầm… và chánh tư duy liên quan đến vô sân là giới vô sân.
Yā sattesu metti mettāyanā mettāyitattaṃ mettācetovimutti.
That which is loving-kindness towards beings, the state of being loving-kindness, the state of having developed loving-kindness, the liberation of mind through loving-kindness.
Lòng từ (mettā), sự từ ái (mettāyanā), trạng thái từ ái (mettāyitattaṃ), tâm giải thoát bằng từ (mettācetovimutti) đối với chúng sanh.
Ayaṃ vuccati abyāpādadhātu.
This is called the element of non-ill-will.
Đây được gọi là giới vô sân.
Avihiṃsāpaṭisaṃyutto takko vitakko…pe… sammāsaṅkappo avihiṃsādhātu.
Thinking and pondering associated with non-harming… and right thought is the element of non-harming.
Tư duy, tầm… và chánh tư duy liên quan đến vô hại là giới vô hại.
Yā sattesu karuṇā karuṇāyanā karuṇāyitattaṃ karuṇācetovimutti.
That which is compassion towards beings, the state of being compassionate, the state of having developed compassion, the liberation of mind through compassion.
Lòng bi (karuṇā), sự bi mẫn (karuṇāyanā), trạng thái bi mẫn (karuṇāyitattaṃ), tâm giải thoát bằng bi (karuṇācetovimutti) đối với chúng sanh.
Ayaṃ vuccati avihiṃsādhātu (vibha. 182).
This is called the element of non-harming.
Đây được gọi là giới vô hại.
Rūpārūpadhātuyo vuttāyeva.
The elements of form and formlessness have already been stated.
Sắc giới và Vô sắc giới đã được nói đến rồi.
Nirodhadhātu nibbānaṃ.
The element of cessation is Nibbāna.
Diệt giới là Nibbāna.
Hīnā dhātu dvādasākusalacittuppādā, majjhimā dhātu avasesā tebhūmakadhammā.
The inferior element comprises the twelve unwholesome thought-arisings; the middling element comprises the remaining phenomena of the three planes.
Giới hạ liệt là mười hai tâm bất thiện sanh khởi; giới trung bình là các pháp thuộc tam giới còn lại.
Paṇītā dhātu nava lokuttaradhammā.
The sublime element comprises the nine supramundane phenomena.
Giới thù thắng là chín pháp siêu thế.
Sabbāpi ca nijjīvaṭṭhena dhātu.
And all phenomena are elements in the sense of being devoid of a living entity.
Tất cả đều là giới theo nghĩa không có linh hồn.
‘‘Puna caparaṃ, bhikkhave, bhikkhuno naheva kho satthā dhammaṃ deseti aññataro vā garuṭṭhāniyo sabrahmacārī, nāpi yathāsutaṃ yathāpariyattaṃ dhammaṃ vitthārena paresaṃ deseti, nāpi yathāsutaṃ yathāpariyattaṃ dhammaṃ vitthārena sajjhāyaṃ karoti, nāpi yathāsutaṃ yathāpariyattaṃ dhammaṃ cetasā anuvitakketi anuvicāreti manasānupekkhati, api ca khvassa aññataraṃ samādhinimittaṃ suggahitaṃ hoti sumanasikataṃ sūpadhāritaṃ suppaṭividdhaṃ paññāya, yathā yathā kho, bhikkhave, bhikkhuno aññataraṃ samādhinimittaṃ suggahitaṃ hoti sumanasikataṃ sūpadhāritaṃ suppaṭividdhaṃ paññāya tathā tathā so tasmiṃ dhamme atthapaṭisaṃvedī ca hoti dhammapaṭisaṃvedī ca.
‘‘Furthermore, bhikkhus, if a bhikkhu’s Teacher does not teach the Dhamma, nor does any respected fellow monastic teach it; nor does he teach the Dhamma to others extensively as he has heard and learned it; nor does he recite the Dhamma extensively as he has heard and learned it; nor does he ponder, reflect, and contemplate the Dhamma with his mind as he has heard and learned it. But rather, some sign of concentration is well-grasped by him, well-attended to, well-considered, and well-penetrated by wisdom. Bhikkhus, in whatever way some sign of concentration is well-grasped by that bhikkhu, well-attended to, well-considered, and well-penetrated by wisdom, in that way he experiences the meaning and experiences the Dhamma in that teaching.
“Lại nữa, này các Tỳ-khưu, vị Tỳ-khưu không được bậc Đạo Sư thuyết giảng Dhamma, cũng không được một vị đồng Phạm hạnh đáng tôn kính nào khác thuyết giảng Dhamma; vị ấy cũng không thuyết giảng Dhamma đã nghe, đã học rộng rãi cho người khác; vị ấy cũng không tụng đọc rộng rãi Dhamma đã nghe, đã học; vị ấy cũng không dùng tâm tư duy, quán xét, quán tưởng Dhamma đã nghe, đã học. Nhưng vị ấy có một Tịnh chỉ tướng (samādhinimitta) nào đó đã được nắm giữ vững chắc, đã được tác ý đúng đắn, đã được quán sát kỹ lưỡng, đã được trí tuệ thấu triệt. Này các Tỳ-khưu, tùy theo cách vị Tỳ-khưu có một Tịnh chỉ tướng nào đó đã được nắm giữ vững chắc, đã được tác ý đúng đắn, đã được quán sát kỹ lưỡng, đã được trí tuệ thấu triệt, thì vị ấy thấu hiểu ý nghĩa và thấu hiểu Dhamma trong pháp ấy.
Tassa atthapaṭisaṃvedino dhammapaṭisaṃvedino pāmojjaṃ jāyati, pamuditassa pīti jāyati, pītimanassa kāyo passambhati, passaddhakāyo sukhaṃ vedeti, sukhino cittaṃ samādhiyati.
As he experiences the meaning and experiences the Dhamma, joy arises in him; being joyful, delight arises; with a delighted mind, his body becomes tranquil; with a tranquil body, he feels happiness; with a happy mind, his mind becomes concentrated.
Khi thấu hiểu ý nghĩa và thấu hiểu Dhamma, vị ấy khởi lên sự hoan hỷ; khi hoan hỷ, hỷ khởi lên; khi tâm hoan hỷ, thân được an tịnh; khi thân an tịnh, vị ấy cảm thọ lạc; khi có lạc, tâm được định tĩnh.
Idaṃ pañcamaṃ vimuttāyatana’’nti (a. ni. 5.26; dī. ni. 3.322).
This, bhikkhus, is the fifth avenue to liberation.’’
Đây là giải thoát xứ thứ năm.”
‘‘Katamañca, bhikkhave, dassanānuttariyaṃ?
‘‘And what, bhikkhus, is the supreme vision?
“Và này các Tỳ-khưu, thế nào là vô thượng về thấy?
Idha, bhikkhave, ekacco hatthiratanampi dassanāya gacchati, assaratanampi dassanāya gacchati, maṇiratanampi dassanāya gacchati, uccāvacaṃ vā pana dassanāya gacchati, samaṇaṃ vā brāhmaṇaṃ vā micchādiṭṭhikaṃ micchāpaṭipannaṃ dassanāya gacchati.
Here, bhikkhus, some individual goes to see a king elephant, or to see a king horse, or to see a king gem, or he goes to see various other things, or he goes to see a recluse or brahmin of wrong view and wrong practice.
Ở đây, này các Tỳ-khưu, có người đi xem tượng voi báu, đi xem tượng ngựa báu, đi xem tượng ngọc báu, hoặc đi xem đủ thứ khác, hoặc đi xem các Sa-môn, Bà-la-môn có tà kiến, tà hạnh.
Atthetaṃ, bhikkhave, dassanaṃ, netaṃ natthīti vadāmi.
Bhikkhus, there is such seeing; I do not say that there is not.
Này các Tỳ-khưu, có sự thấy ấy, Ta không nói là không có.
Tañca kho etaṃ, bhikkhave, dassanaṃ hīnaṃ gammaṃ pothujjanikaṃ anariyaṃ anatthasaṃhitaṃ na nibbidāya na virāgāya na nirodhāya na upasamāya na abhiññāya na sambodhāya na nibbānāya saṃvattati.
But that seeing, bhikkhus, is inferior, vulgar, ordinary, ignoble, unbeneficial; it does not lead to disenchantment, dispassion, cessation, peace, direct knowledge, full enlightenment, or Nibbāna.
Tuy nhiên, này các Tỳ-khưu, sự thấy ấy là thấp kém, thuộc phàm tục, thuộc người phàm, không cao thượng, không liên hệ đến lợi ích, không đưa đến nhàm chán, không đưa đến ly tham, không đưa đến đoạn diệt, không đưa đến an tịnh, không đưa đến thắng trí, không đưa đến giác ngộ, không đưa đến Nibbāna.
Yo ca kho, bhikkhave, tathāgataṃ vā tathāgatasāvakaṃ vā dassanāya gacchati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
But, bhikkhus, when one goes to see the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached a definite conclusion, and with profound confidence,
Còn này các Tỳ-khưu, ai đi xem một vị Như Lai hoặc một vị Thanh văn của Như Lai, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Etadānuttariyaṃ, bhikkhave, dassanānaṃ sattānaṃ visuddhiyā sokaparidevānaṃ samatikkamāya dukkhadomanassānaṃ atthaṅgamāya ñāyassa adhigamāya nibbānassa sacchikiriyāya, yadidaṃ tathāgataṃ vā tathāgatasāvakaṃ vā dassanāya gacchati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
This, bhikkhus, is the supreme vision among visions, for the purification of beings, for the overcoming of sorrow and lamentation, for the disappearance of pain and displeasure, for the attainment of the path, for the realization of Nibbāna—namely, when one goes to see the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached a definite conclusion, and with profound confidence.
Này các Tỳ-khưu, đây là vô thượng trong các sự thấy, vì sự thanh tịnh của các chúng sanh, vì vượt qua sầu bi, vì diệt trừ khổ ưu, vì đạt đến Chánh Đạo, vì chứng ngộ Nibbāna, đó là việc đi xem một vị Như Lai hoặc một vị Thanh văn của Như Lai, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Idaṃ vuccati, bhikkhave, dassanānuttariyaṃ.
This, bhikkhus, is called the supreme vision.
Này các Tỳ-khưu, đây được gọi là vô thượng về thấy.
Iti dassanānuttariyaṃ.
Thus, the supreme vision.
Như vậy là vô thượng về thấy.
‘‘Savanānuttariyañca kathaṃ hoti?
‘‘And how does the supreme hearing come about?
“Và vô thượng về nghe thì như thế nào?
Idha, bhikkhave, ekacco bherisaddampi savanāya gacchati, vīṇāsaddampi savanāya gacchati, gītasaddampi savanāya gacchati, uccāvacaṃ vā pana savanāya gacchati, samaṇassa vā brāhmaṇassa vā micchādiṭṭhikassa micchāpaṭipannassa dhammassavanāya gacchati.
Here, bhikkhus, some individual goes to hear the sound of a drum, or to hear the sound of a lute, or to hear the sound of singing, or he goes to hear various other sounds, or he goes to hear the Dhamma from a recluse or brahmin of wrong view and wrong practice.
Ở đây, này các Tỳ-khưu, có người đi nghe tiếng trống, đi nghe tiếng đàn, đi nghe tiếng hát, hoặc đi nghe đủ thứ khác, hoặc đi nghe Dhamma từ các Sa-môn, Bà-la-môn có tà kiến, tà hạnh.
Atthetaṃ, bhikkhave, savanaṃ, netaṃ natthīti vadāmi.
Bhikkhus, there is such hearing; I do not say that there is not.
Này các Tỳ-khưu, có sự nghe ấy, Ta không nói là không có.
Tañca kho etaṃ, bhikkhave, savanaṃ hīnaṃ…pe… na nibbānāya saṃvattati.
But that hearing, bhikkhus, is inferior… it does not lead to Nibbāna.
Tuy nhiên, này các Tỳ-khưu, sự nghe ấy là thấp kém… không đưa đến Nibbāna.
Yo ca kho, bhikkhave, tathāgatassa vā tathāgatasāvakassa vā dhammassavanāya gacchati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
But, bhikkhus, when one goes to hear the Dhamma from the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached a definite conclusion, and with profound confidence,
Còn này các Tỳ-khưu, ai đi nghe Dhamma từ một vị Như Lai hoặc một vị Thanh văn của Như Lai, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Etadānuttariyaṃ, bhikkhave, savanānaṃ sattānaṃ visuddhiyā…pe… nibbānassa sacchikiriyāya, yadidaṃ tathāgatassa vā tathāgatasāvakassa vā dhammassavanāya gacchati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
This, bhikkhus, is the supreme hearing among hearings, for the purification of beings… for the realization of Nibbāna—namely, when one goes to hear the Dhamma from the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached a definite conclusion, and with profound confidence.
Này các Tỳ-khưu, đây là vô thượng trong các sự nghe, vì sự thanh tịnh của các chúng sanh… vì chứng ngộ Nibbāna, đó là việc đi nghe Dhamma từ một vị Như Lai hoặc một vị Thanh văn của Như Lai, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Idaṃ vuccati, bhikkhave, savanānuttariyaṃ.
This, bhikkhus, is called the supreme hearing.
Này các Tỳ-khưu, đây được gọi là vô thượng về nghe.
Iti dassanānuttariyaṃ, savanānuttariyaṃ.
Thus, the unsurpassed vision, the unsurpassed hearing.
Như vậy là vô thượng về thấy, vô thượng về nghe.
‘‘Lābhānuttariyañca kathaṃ hoti?
And how, bhikkhus, is the unsurpassed gain?
“Và vô thượng về lợi đắc thì như thế nào?
Idha, bhikkhave, ekacco puttalābhampi labhati, dāralābhampi labhati, dhanalābhampi labhati, uccāvacaṃ vā pana lābhampi labhati.
Here, bhikkhus, some individual obtains a gain of sons, a gain of wives, a gain of wealth, or various other gains.
Ở đây, này các Tỳ-khưu, có người được lợi đắc về con cái, được lợi đắc về vợ, được lợi đắc về tài sản, hoặc được lợi đắc đủ thứ khác.
Samaṇe vā brāhmaṇe vā micchādiṭṭhike micchāpaṭipanne saddhaṃ paṭilabhati.
He obtains faith in recluses or brahmins who hold wrong views and practice wrongly.
Có người được lòng tin nơi các Sa-môn, Bà-la-môn có tà kiến, tà hạnh.
Attheso, bhikkhave, lābho, neso natthīti vadāmi.
This gain, bhikkhus, exists; I do not say it does not exist.
Này các Tỳ-khưu, có sự lợi đắc ấy, Ta không nói là không có.
So ca kho eso, bhikkhave, lābho hīno…pe… na nibbānāya saṃvattati.
But that gain, bhikkhus, is inferior…pe… it does not lead to Nibbāna.
Tuy nhiên, này các Tỳ-khưu, sự lợi đắc ấy là thấp kém… không đưa đến Nibbāna.
Yo ca kho, bhikkhave, tathāgate vā tathāgatasāvake vā saddhaṃ paṭilabhati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
But, bhikkhus, when one obtains faith in the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached the ultimate, and with profound confidence,
Còn này các Tỳ-khưu, ai được lòng tin nơi một vị Như Lai hoặc một vị Thanh văn của Như Lai, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Etadānuttariyaṃ, bhikkhave, lābhānaṃ sattānaṃ visuddhiyā…pe… nibbānassa sacchikiriyāya, yadidaṃ tathāgate vā tathāgatasāvake vā saddhaṃ paṭilabhati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
this, bhikkhus, is the unsurpassed among gains for the purification of beings…pe… for the realization of Nibbāna, namely, when one obtains faith in the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached the ultimate, and with profound confidence.
Này các Tỳ-khưu, đây là vô thượng trong các sự lợi đắc, vì sự thanh tịnh của các chúng sanh… vì chứng ngộ Nibbāna, đó là việc được lòng tin nơi một vị Như Lai hoặc một vị Thanh văn của Như Lai, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Idaṃ vuccati, bhikkhave, lābhānuttariyaṃ.
This, bhikkhus, is called the unsurpassed gain.
Này các Tỳ-khưu, đây được gọi là vô thượng về lợi đắc.
Iti dassanānuttariyaṃ, savanānuttariyaṃ, lābhānuttariyaṃ.
Thus, the unsurpassed vision, the unsurpassed hearing, the unsurpassed gain.
Như vậy là vô thượng về thấy, vô thượng về nghe, vô thượng về lợi đắc.
‘‘Sikkhānuttariyañca kathaṃ hoti?
And how, bhikkhus, is the unsurpassed training?
“Và vô thượng về học tập thì như thế nào?
Idha, bhikkhave, ekacco hatthismimpi sikkhati, assasmimpi sikkhati, rathasmimpi sikkhati, dhanusmimpi sikkhati, tharusmimpi sikkhati, uccāvacaṃ vā pana sikkhati, samaṇassa vā brāhmaṇassa vā micchādiṭṭhikassa micchāpaṭipannassa sikkhati.
Here, bhikkhus, some individual trains in elephants, trains in horses, trains in chariots, trains in archery, trains in swordsmanship, or trains in various other skills; he trains with a recluse or brahmin who holds wrong views and practices wrongly.
Ở đây, này các Tỳ-khưu, có người học tập về voi, học tập về ngựa, học tập về xe, học tập về cung, học tập về kiếm, hoặc học tập đủ thứ khác, hoặc học tập từ các Sa-môn, Bà-la-môn có tà kiến, tà hạnh.
Atthesā, bhikkhave, sikkhā, nesā natthīti vadāmi.
This training, bhikkhus, exists; I do not say it does not exist.
Này các Tỳ-khưu, có sự học tập ấy, Ta không nói là không có.
Sā ca kho esā, bhikkhave, sikkhā hīnā…pe… na nibbānāya saṃvattati.
But that training, bhikkhus, is inferior…pe… it does not lead to Nibbāna.
Tuy nhiên, này các Tỳ-khưu, sự học tập ấy là thấp kém… không đưa đến Nibbāna.
Yo ca kho, bhikkhave, tathāgatappavedite dhammavinaye adhisīlampi sikkhati, adhicittampi sikkhati, adhipaññampi sikkhati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
But, bhikkhus, when one trains in higher morality (adhisīla), trains in higher consciousness (adhicitta), trains in higher wisdom (adhipaññā) in the Dhamma and Vinaya proclaimed by the Tathāgata, with established faith, established affection, having reached the ultimate, and with profound confidence,
Còn này các Tỳ-khưu, ai học tập về Giới tăng thượng (adhisīla), học tập về Tâm tăng thượng (adhicitta), học tập về Tuệ tăng thượng (adhipaññā) trong Dhamma-Vinaya do Như Lai thuyết giảng, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Etadānuttariyaṃ, bhikkhave, sikkhānaṃ sattānaṃ visuddhiyā…pe… nibbānassa sacchikiriyāya, yadidaṃ tathāgatappavedite dhammavinaye adhisīlampi sikkhati, adhicittampi sikkhati, adhipaññampi sikkhati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
this, bhikkhus, is the unsurpassed among trainings for the purification of beings…pe… for the realization of Nibbāna, namely, when one trains in higher morality, trains in higher consciousness, trains in higher wisdom in the Dhamma and Vinaya proclaimed by the Tathāgata, with established faith, established affection, having reached the ultimate, and with profound confidence.
Này các Tỳ-khưu, đây là vô thượng trong các sự học tập, vì sự thanh tịnh của các chúng sanh… vì chứng ngộ Nibbāna, đó là việc học tập về Giới tăng thượng, học tập về Tâm tăng thượng, học tập về Tuệ tăng thượng trong Dhamma-Vinaya do Như Lai thuyết giảng, với lòng tin kiên cố, với tình yêu kiên cố, đã đạt đến sự nhất định, với lòng tịnh tín tuyệt đối.
Idaṃ vuccati, bhikkhave, sikkhānuttariyaṃ.
This, bhikkhus, is called the unsurpassed training.
Này các Tỳ-khưu, đây được gọi là vô thượng về học tập.
Iti dassanānuttariyaṃ, savanānuttariyaṃ, lābhānuttariyaṃ, sikkhānuttariyaṃ.
Thus, the unsurpassed vision, the unsurpassed hearing, the unsurpassed gain, the unsurpassed training.
Như vậy là vô thượng về thấy, vô thượng về nghe, vô thượng về lợi đắc, vô thượng về học tập.
‘‘Pāricariyānuttariyañca kathaṃ hoti?
And how, bhikkhus, is the unsurpassed service?
“Và vô thượng về phụng sự thì như thế nào?
Idha, bhikkhave, ekacco khattiyampi paricarati, brāhmaṇampi paricarati, gahapatimpi paricarati, uccāvacaṃ vā pana paricarati, samaṇaṃ vā brāhmaṇaṃ vā micchādiṭṭhikaṃ micchāpaṭipannaṃ paricarati.
Here, bhikkhus, some individual serves a khattiya, serves a brahmin, serves a householder, or serves various others; he serves a recluse or brahmin who holds wrong views and practices wrongly.
Ở đây, này các Tỳ-khưu, có người phụng sự vua chúa, phụng sự Bà-la-môn, phụng sự gia chủ, hoặc phụng sự đủ thứ khác, hoặc phụng sự các Sa-môn, Bà-la-môn có tà kiến, tà hạnh.
Atthesā, bhikkhave, pāricariyā, nesā natthīti vadāmi.
This service, bhikkhus, exists; I do not say it does not exist.
Này các Tỳ-khưu, có sự phụng sự ấy, Ta không nói rằng không có sự phụng sự ấy.
Sā ca kho esā, bhikkhave, pāricariyā hīnā…pe… na nibbānāya saṃvattati.
But that service, bhikkhus, is inferior…pe… it does not lead to Nibbāna.
Này các Tỳ-khưu, sự phụng sự ấy là thấp kém…pe… không đưa đến Nibbāna.
Yo ca kho, bhikkhave, tathāgataṃ vā tathāgatasāvakaṃ vā paricarati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
But, bhikkhus, when one serves the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached the ultimate, and with profound confidence,
Này các Tỳ-khưu, người nào phụng sự Như Lai hoặc đệ tử của Như Lai với niềm tin kiên cố, tình yêu kiên cố, đã đạt đến sự tuyệt đối, với lòng tịnh tín tuyệt đối.
Etadānuttariyaṃ, bhikkhave, pāricariyānaṃ sattānaṃ visuddhiyā…pe… nibbānassa sacchikiriyāya, yadidaṃ tathāgataṃ vā tathāgatasāvakaṃ vā paricarati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
this, bhikkhus, is the unsurpassed among services for the purification of beings…pe… for the realization of Nibbāna, namely, when one serves the Tathāgata or a disciple of the Tathāgata, with established faith, established affection, having reached the ultimate, and with profound confidence.
Này các Tỳ-khưu, đây là sự phụng sự vô thượng trong các sự phụng sự, vì sự thanh tịnh của chúng sanh…pe… vì sự chứng ngộ Nibbāna, đó là sự phụng sự Như Lai hoặc đệ tử của Như Lai với niềm tin kiên cố, tình yêu kiên cố, đã đạt đến sự tuyệt đối, với lòng tịnh tín tuyệt đối.
Idaṃ vuccati, bhikkhave, pāricariyānuttariyaṃ.
This, bhikkhus, is called the unsurpassed service.
Này các Tỳ-khưu, đây được gọi là sự phụng sự vô thượng.
Iti dassanānuttariyaṃ, savanānuttariyaṃ, lābhānuttariyaṃ, sikkhānuttariyaṃ, pāricariyānuttariyaṃ.
Thus, the unsurpassed vision, the unsurpassed hearing, the unsurpassed gain, the unsurpassed training, the unsurpassed service.
Như vậy, có sự thấy vô thượng, sự nghe vô thượng, sự lợi đắc vô thượng, sự học hỏi vô thượng, sự phụng sự vô thượng.
‘‘Anussatānuttariyañca kathaṃ hoti?
And how, bhikkhus, is the unsurpassed recollection?
Sự tùy niệm vô thượng thì như thế nào?
Idha, bhikkhave, ekacco puttalābhampi anussarati, dāralābhampi anussarati, dhanalābhampi anussarati, uccāvacaṃ vā pana anussarati, samaṇaṃ vā brāhmaṇaṃ vā micchādiṭṭhikaṃ micchāpaṭipannaṃ anussarati.
Here, bhikkhus, some individual recollects a gain of sons, recollects a gain of wives, recollects a gain of wealth, or recollects various other gains; he recollects a recluse or brahmin who holds wrong views and practices wrongly.
Này các Tỳ-khưu, ở đây, có người tùy niệm sự lợi đắc con cái, tùy niệm sự lợi đắc vợ con, tùy niệm sự lợi đắc tài sản, hoặc tùy niệm những điều thấp kém, hoặc tùy niệm một Sa-môn hay Bà-la-môn có tà kiến, có tà hạnh.
Atthesā, bhikkhave, anussati, nesā natthīti vadāmi.
This recollection, bhikkhus, exists; I do not say it does not exist.
Này các Tỳ-khưu, có sự tùy niệm ấy, Ta không nói rằng không có sự tùy niệm ấy.
Sā ca kho esā, bhikkhave, anussati hīnā…pe… na nibbānāya saṃvattati.
But that recollection, bhikkhus, is inferior…pe… it does not lead to Nibbāna.
Này các Tỳ-khưu, sự tùy niệm ấy là thấp kém…pe… không đưa đến Nibbāna.
Yo ca kho, bhikkhave, tathāgataṃ vā tathāgatasāvakaṃ vā anussarati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
And truly, bhikkhus, whoever recollects the Tathāgata or a disciple of the Tathāgata, with firm faith, firm affection, absolutely devoted, and deeply confident.
Này các Tỳ-khưu, người nào tùy niệm Như Lai hoặc đệ tử của Như Lai với niềm tin kiên cố, tình yêu kiên cố, đã đạt đến sự tuyệt đối, với lòng tịnh tín tuyệt đối.
Etadānuttariyaṃ, bhikkhave, anussatīnaṃ sattānaṃ visuddhiyā…pe… nibbānassa sacchikiriyāya, yadidaṃ tathāgataṃ vā tathāgatasāvakaṃ vā anussarati niviṭṭhasaddho niviṭṭhapemo ekantagato abhippasanno.
This, bhikkhus, is the unsurpassed recollection among recollections for the purification of beings… for the realization of Nibbāna, namely, that one recollects the Tathāgata or a disciple of the Tathāgata, with firm faith, firm affection, absolutely devoted, and deeply confident.
Này các Tỳ-khưu, đây là sự tùy niệm vô thượng trong các sự tùy niệm, vì sự thanh tịnh của chúng sanh…pe… vì sự chứng ngộ Nibbāna, đó là sự tùy niệm Như Lai hoặc đệ tử của Như Lai với niềm tin kiên cố, tình yêu kiên cố, đã đạt đến sự tuyệt đối, với lòng tịnh tín tuyệt đối.
Idaṃ vuccati, bhikkhave, anussatānuttariyaṃ.
This, bhikkhus, is called the unsurpassed recollection.
Này các Tỳ-khưu, đây được gọi là sự tùy niệm vô thượng.
Imāni kho, bhikkhave, cha anuttariyānī’’ti (a. ni. 6.30).
These, bhikkhus, are the six unsurpassed things,” (A.N. 6.30).
Này các Tỳ-khưu, đây là sáu pháp vô thượng ấy (A.N. 6.30).
Satta niddasavatthūnīti ettha natthi etassa dasāti niddaso.
Seven Objects of Niddasa – Here, niddasa means that for such a one (an Arahant), there are no ten (years) again.
Trong câu “Bảy pháp Niddasavatthu”, Niddasa có nghĩa là không có mười năm cho vị ấy.
Niddasassa niddasabhāvassa vatthūni kāraṇāni niddasavatthūni.
Niddasavatthūni are the causes for the state of niddasa.
Niddasavatthu là những nguyên nhân, những yếu tố của trạng thái Niddasa.
Khīṇāsavo hi dasavassakāle parinibbuto puna paṭisandhiyā abhāvā puna dasavasso na hotīti niddasoti vuccati.
Indeed, an Arahant, having attained parinibbāna at the age of ten, does not become ten years old again due to the absence of rebirth; thus, he is called niddasa.
Một vị A-la-hán đã nhập Niết-bàn khi đã mười năm tuổi thì sẽ không còn mười năm tuổi nữa do không tái sanh, nên được gọi là Niddasa.
Na kevalañca dasavassova na hoti, navavassopi…pe… ekamuhuttikopi na hotiyeva.
Not only does he not become ten years old again, but he does not become nine years old either… nor even for a single moment.
Không chỉ không còn mười năm tuổi, mà cũng không còn chín năm…pe… hay một khoảnh khắc nào nữa.
Na kevalañca dasavassakāle parinibbuto, sattavassikakāle parinibbutopi nissatto niddaso nimuhutto hotiyeva.
And not only one who attained parinibbāna at the age of ten; even one who attained parinibbāna at the age of seven is indeed without a being, niddasa, without a moment.
Không chỉ vị A-la-hán đã nhập Niết-bàn khi mười năm tuổi, mà vị đã nhập Niết-bàn khi bảy năm tuổi cũng trở thành vô sanh, Niddasa, vô khoảnh khắc.
Titthiyasamaye uppannavohāraṃ pana sāsane khīṇāsavassa āropetvā tattha tādisassa abhāvaṃ, idha ca sabbhāvaṃ dassento bhagavā tādisasabhāvassa kāraṇāni ‘‘satta niddasavatthūnī’’ti āha.
However, the Blessed One, applying the term that arose in the time of the sectarians to the Arahant in the Dispensation, and showing the absence of such a state among them and its presence here, spoke of the causes of such a state as “seven objects of niddasa.”
Đức Thế Tôn, khi trình bày rằng thuật ngữ phát sinh trong thời của ngoại đạo được áp dụng cho vị A-la-hán trong giáo pháp, và rằng không có điều như vậy trong quan điểm của ngoại đạo nhưng lại có trong giáo pháp, đã nói “bảy pháp Niddasavatthu” như là những nguyên nhân của trạng thái như vậy.
Yathāha –
As it is said:
Như đã nói:
‘‘Sattimāni, bhikkhave, niddasavatthūni.
“Bhikkhus, there are these seven objects of niddasa.
“Này các Tỳ-khưu, có bảy pháp Niddasavatthu này.
Katamāni satta?
Which seven?
Bảy điều nào?
Idha, bhikkhave, bhikkhu sikkhāsamādāne tibbacchando hoti, āyatiñca sikkhāsamādāne avigatapemo.
Here, bhikkhus, a bhikkhu has keen desire for undertaking the training, and in the future, his affection for undertaking the training is not diminished.
Này các Tỳ-khưu, ở đây, một Tỳ-khưu có ý muốn mạnh mẽ trong việc thọ trì giới luật, và không mất đi tình yêu thương đối với việc thọ trì giới luật trong tương lai.
Dhammanisantiyā tibbacchando hoti, āyatiñca dhammanisantiyā avigatapemo.
He has keen desire for discerning the Dhamma, and in the future, his affection for discerning the Dhamma is not diminished.
Có ý muốn mạnh mẽ trong việc làm sắc bén Pháp, và không mất đi tình yêu thương đối với việc làm sắc bén Pháp trong tương lai.
Icchāvinaye tibbacchando hoti, āyatiñca icchāvinaye avigatapemo.
He has keen desire for the removal of desires, and in the future, his affection for the removal of desires is not diminished.
Có ý muốn mạnh mẽ trong việc chế ngự dục vọng, và không mất đi tình yêu thương đối với việc chế ngự dục vọng trong tương lai.
Paṭisallāne tibbacchando hoti, āyatiñca paṭisallāne avigatapemo.
He has keen desire for seclusion, and in the future, his affection for seclusion is not diminished.
Có ý muốn mạnh mẽ trong việc độc cư, và không mất đi tình yêu thương đối với việc độc cư trong tương lai.
Vīriyārambhe tibbacchando hoti, āyatiñca vīriyārambhe avigatapemo.
He has keen desire for the arousal of energy, and in the future, his affection for the arousal of energy is not diminished.
Có ý muốn mạnh mẽ trong việc tinh tấn khởi sự, và không mất đi tình yêu thương đối với việc tinh tấn khởi sự trong tương lai.
Satinepakke tibbacchando hoti, āyatiñca satinepakke avigatapemo.
He has keen desire for mindfulness and discernment, and in the future, his affection for mindfulness and discernment is not diminished.
Có ý muốn mạnh mẽ trong việc chánh niệm và trí tuệ, và không mất đi tình yêu thương đối với việc chánh niệm và trí tuệ trong tương lai.
Diṭṭhipaṭivedhe tibbacchando hoti, āyatiñca diṭṭhipaṭivedhe avigatapemo.
He has keen desire for the penetration of views, and in the future, his affection for the penetration of views is not diminished.
Có ý muốn mạnh mẽ trong việc thấu hiểu Chánh kiến, và không mất đi tình yêu thương đối với việc thấu hiểu Chánh kiến trong tương lai.
Imāni kho, bhikkhave, satta niddasavatthūnī’’ti (a. ni. 7.20).
These, bhikkhus, are the seven objects of niddasa,” (A.N. 7.20).
Này các Tỳ-khưu, đây là bảy pháp Niddasavatthu ấy (A.N. 7.20).”
‘‘Ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati nīlāni nīlavaṇṇāni nīlanidassanāni nīlanibhāsāni.
One, having the perception of non-form internally, sees external forms that are blue, blue in color, blue in appearance, blue in luster.
Một người không có tưởng về sắc bên trong, thấy các sắc bên ngoài màu xanh, có sắc xanh, có vẻ xanh, có ánh xanh.
Seyyathāpi nāma umāpupphaṃ nīlaṃ nīlavaṇṇaṃ nīlanidassanaṃ nīlanibhāsaṃ, seyyathāpi vā pana taṃ vatthaṃ bārāṇaseyyakaṃ ubhatobhāgavimaṭṭhaṃ nīlaṃ nīlavaṇṇaṃ nīlanidassanaṃ nīlanibhāsaṃ, evameva ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati nīlāni nīlavaṇṇāni nīlanidassanāni nīlanibhāsāni, ‘tāni abhibhuyya jānāmi passāmī’ti evaṃsaññī hoti.
Just as a flax flower is blue, blue in color, blue in appearance, blue in luster; or just as a Bārāṇasī cloth, smoothed on both sides, is blue, blue in color, blue in appearance, blue in luster; even so, one, having no perception of form within oneself, sees external forms that are blue, blue in color, blue in appearance, blue in luster, and perceives, ‘Having overcome them, I know, I see.’
Ví như hoa umā màu xanh, có sắc xanh, có vẻ xanh, có ánh xanh; hoặc như tấm vải Bārāṇasī được dệt mịn hai mặt, màu xanh, có sắc xanh, có vẻ xanh, có ánh xanh; cũng vậy, một người không có tưởng về sắc bên trong, thấy các sắc bên ngoài màu xanh, có sắc xanh, có vẻ xanh, có ánh xanh, và có tưởng rằng: ‘Sau khi chi phối chúng, tôi biết và thấy chúng.’
Idaṃ pañcamaṃ abhibhāyatanaṃ.
This is the fifth abhibhāyatana.
Đây là Abhibhāyatana thứ năm.
‘‘Ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati pītāni pītavaṇṇāni pītanidassanāni pītanibhāsāni.
One, having no perception of form within oneself, sees external forms that are yellow, yellow in color, yellow in appearance, yellow in luster.
Một người không có tưởng về sắc bên trong, thấy các sắc bên ngoài màu vàng, có sắc vàng, có vẻ vàng, có ánh vàng.
Seyyathāpi nāma kaṇikārapupphaṃ pītaṃ pītavaṇṇaṃ pītanidassanaṃ pītanibhāsaṃ, seyyathāpi vā pana taṃ vatthaṃ bārāṇaseyyakaṃ ubhatobhāgavimaṭṭhaṃ pītaṃ pītavaṇṇaṃ pītanidassanaṃ pītanibhāsaṃ, evameva ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati pītāni pītavaṇṇāni pītanidassanāni pītanibhāsāni, ‘tāni abhibhuyya jānāmi passāmī’ti evaṃsaññī hoti.
Just as a kaṇikāra flower is yellow, yellow in color, yellow in appearance, yellow in luster; or just as a Bārāṇasī cloth, smoothed on both sides, is yellow, yellow in color, yellow in appearance, yellow in luster; even so, one, having no perception of form within oneself, sees external forms that are yellow, yellow in color, yellow in appearance, yellow in luster, and perceives, ‘Having overcome them, I know, I see.’
Ví như hoa kaṇikāra màu vàng, có sắc vàng, có vẻ vàng, có ánh vàng; hoặc như tấm vải Bārāṇasī được dệt mịn hai mặt, màu vàng, có sắc vàng, có vẻ vàng, có ánh vàng; cũng vậy, một người không có tưởng về sắc bên trong, thấy các sắc bên ngoài màu vàng, có sắc vàng, có vẻ vàng, có ánh vàng, và có tưởng rằng: ‘Sau khi chi phối chúng, tôi biết và thấy chúng.’
Idaṃ chaṭṭhaṃ abhibhāyatanaṃ.
This is the sixth abhibhāyatana.
Đây là Abhibhāyatana thứ sáu.
‘‘Ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati lohitakāni lohitakavaṇṇāni lohitakanidassanāni lohitakanibhāsāni.
One, having no perception of form within oneself, sees external forms that are red, red in color, red in appearance, red in luster.
Một người không có tưởng về sắc bên trong, thấy các sắc bên ngoài màu đỏ, có sắc đỏ, có vẻ đỏ, có ánh đỏ.
Seyyathāpi nāma bandhujīvakapupphaṃ lohitakaṃ lohitakavaṇṇaṃ lohitakanidassanaṃ lohitakanibhāsaṃ, seyyathāpi vā pana taṃ vatthaṃ bārāṇaseyyakaṃ ubhatobhāgavimaṭṭhaṃ lohitakaṃ lohitakavaṇṇaṃ lohitakanidassanaṃ lohitakanibhāsaṃ, evameva ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati lohitakāni lohitakavaṇṇāni lohitakanidassanāni lohitakanibhāsāni, ‘tāni abhibhuyya jānāmi passāmī’ti evaṃsaññī hoti.
Just as a bandhujīvaka flower is red, red in color, red in appearance, red in luster; or just as a Bārāṇasī cloth, smoothed on both sides, is red, red in color, red in appearance, red in luster; even so, one, having no perception of form within oneself, sees external forms that are red, red in color, red in appearance, red in luster, and perceives, ‘Having overcome them, I know, I see.’
Ví như hoa bandhujīvaka có màu đỏ, sắc đỏ, vẻ đỏ, ánh đỏ; hoặc ví như tấm vải Bārāṇasī được dệt tinh xảo cả hai mặt, có màu đỏ, sắc đỏ, vẻ đỏ, ánh đỏ; cũng vậy, một người bên trong không có tưởng về sắc (arūpasaññī), bên ngoài nhìn thấy các sắc có màu đỏ, sắc đỏ, vẻ đỏ, ánh đỏ, rồi có tưởng rằng: ‘Ta chế ngự chúng và thấy chúng’.
Idaṃ sattamaṃ abhibhāyatanaṃ.
This is the seventh abhibhāyatana.
Đây là thắng xứ thứ bảy.
‘‘Ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati odātāni odātavaṇṇāni odātanidassanāni odātanibhāsāni.
One, having no perception of form within oneself, sees external forms that are white, white in color, white in appearance, white in luster.
“Một người bên trong không có tưởng về sắc (arūpasaññī), bên ngoài nhìn thấy các sắc có màu trắng, sắc trắng, vẻ trắng, ánh trắng.
Seyyathāpi nāma osadhitārakā odātā odātavaṇṇā odātanidassanā odātanibhāsā, seyyathāpi vā pana taṃ vatthaṃ bārāṇaseyyakaṃ ubhatobhāgavimaṭṭhaṃ odātaṃ odātavaṇṇaṃ odātanidassanaṃ odātanibhāsaṃ, evameva ajjhattaṃ arūpasaññī eko bahiddhā rūpāni passati odātāni odātavaṇṇāni odātanidassanāni odātanibhāsāni, ‘tāni abhibhuyya jānāmi passāmī’ti evaṃsaññī hoti.
Just as the morning star is white, white in color, white in appearance, white in luster; or just as a Bārāṇasī cloth, smoothed on both sides, is white, white in color, white in appearance, white in luster; even so, one, having no perception of form within oneself, sees external forms that are white, white in color, white in appearance, white in luster, and perceives, ‘Having overcome them, I know, I see.’
Ví như ngôi sao Osadhī có màu trắng, sắc trắng, vẻ trắng, ánh trắng; hoặc ví như tấm vải Bārāṇasī được dệt tinh xảo cả hai mặt, có màu trắng, sắc trắng, vẻ trắng, ánh trắng; cũng vậy, một người bên trong không có tưởng về sắc (arūpasaññī), bên ngoài nhìn thấy các sắc có màu trắng, sắc trắng, vẻ trắng, ánh trắng, rồi có tưởng rằng: ‘Ta chế ngự chúng và thấy chúng’.
Idaṃ aṭṭhamaṃ abhibhāyatanaṃ.
This is the eighth abhibhāyatana.
Đây là thắng xứ thứ tám.
Imāni aṭṭha abhibhāyatanāni (a. ni. 8.65; dī. ni. 3.358).
These are the eight abhibhāyatanas.
Đây là tám thắng xứ.
‘‘Katame nava?
‘‘Which nine?
“Thế nào là chín?
Idha, bhikkhave, bhikkhu vivicceva kāmehi vivicca akusalehi dhammehi savitakkaṃ savicāraṃ vivekajaṃ pītisukhaṃ paṭhamaṃ jhānaṃ upasampajja viharati.
Here, bhikkhus, a bhikkhu, quite secluded from sensual pleasures, secluded from unwholesome states, enters and dwells in the first jhāna, which is accompanied by initial application and sustained application, with rapture and pleasure born of seclusion.
Ở đây, này các Tỳ-khưu, vị Tỳ-khưu ly dục, ly các pháp bất thiện, chứng và an trú thiền thứ nhất, có tầm, có tứ, có hỷ lạc do viễn ly sinh.
Vitakkavicārānaṃ vūpasamā ajjhattaṃ sampasādanaṃ cetaso ekodibhāvaṃ avitakkaṃ avicāraṃ samādhijaṃ pītisukhaṃ dutiyaṃ jhānaṃ upasampajja viharati.
With the subsiding of initial and sustained application, by gaining inner tranquillity and unification of mind, he enters and dwells in the second jhāna, which is without initial and sustained application, with rapture and pleasure born of concentration.
Sau khi tầm và tứ lắng dịu, nội tâm thanh tịnh, tâm chuyên nhất, không tầm, không tứ, chứng và an trú thiền thứ hai, có hỷ lạc do định sinh.
Pītiyā ca virāgā upekkhako ca viharati sato sampajāno, sukhañca kāyena paṭisaṃvedeti, yaṃ taṃ ariyā ācikkhanti ‘upekkhako satimā sukhavihārī’ti, tatiyaṃ jhānaṃ upasampajja viharati.
With the fading away of rapture, he dwells in equanimity, mindful and clearly comprehending, and experiences pleasure with the body, of which the Noble Ones declare: ‘He dwells in pleasure with equanimity and mindfulness.’ He enters and dwells in the third jhāna.
Sau khi ly hỷ, vị ấy an trú xả, chánh niệm, tỉnh giác, và cảm nhận lạc trên thân, mà các bậc Thánh gọi là ‘người an trú xả, chánh niệm, có lạc’, chứng và an trú thiền thứ ba.
Sukhassa ca pahānā dukkhassa ca pahānā pubbeva somanassadomanassānaṃ atthaṅgamā adukkhamasukhaṃ upekkhāsatipārisuddhiṃ catutthaṃ jhānaṃ upasampajja viharati.
With the abandoning of pleasure and pain, and with the disappearance of former joy and sorrow, he enters and dwells in the fourth jhāna, which is neither painful nor pleasant, and is purified by equanimity and mindfulness.
Sau khi xả lạc, xả khổ, diệt trừ hỷ và ưu đã có trước, chứng và an trú thiền thứ tư, không khổ không lạc, với sự thanh tịnh của niệm do xả.
Sabbaso rūpasaññānaṃ samatikkamā paṭighasaññānaṃ atthaṅgamā nānattasaññānaṃ amanasikārā ‘ananto ākāso’ti ākāsānañcāyatanaṃ upasampajja viharati.
With the complete transcendence of perceptions of form, with the disappearance of perceptions of sensory impact, with non-attention to perceptions of diversity, thinking ‘Space is infinite,’ he enters and dwells in the base of infinite space.
Vượt lên hoàn toàn các tưởng về sắc (rūpasaññā), diệt trừ các tưởng về đối ngại (paṭighasaññā), không tác ý các tưởng về sai biệt (nānattasaññā), vị ấy chứng và an trú Không vô biên xứ (ākāsānañcāyatana), với niệm ‘không gian là vô biên’.
Sabbaso ākāsānañcāyatanaṃ samatikkamma ‘anantaṃ viññāṇa’nti viññāṇañcāyatanaṃ upasampajja viharati.
With the complete transcendence of the base of infinite space, thinking ‘Consciousness is infinite,’ he enters and dwells in the base of infinite consciousness.
Vượt lên hoàn toàn Không vô biên xứ, vị ấy chứng và an trú Thức vô biên xứ (viññāṇañcāyatana), với niệm ‘thức là vô biên’.
Sabbaso viññāṇañcāyatanaṃ samatikkamma ‘natthi kiñcī’ti ākiñcaññāyatanaṃ upasampajja viharati.
Having entirely surpassed the dimension of infinite consciousness, perceiving 'there is nothing', one attains and dwells in the dimension of nothingness.
Vượt lên hoàn toàn Thức vô biên xứ, vị ấy chứng và an trú Vô sở hữu xứ (ākiñcaññāyatana), với niệm ‘không có gì cả’.
Sabbaso ākiñcaññāyatanaṃ samatikkamma nevasaññānāsaññāyatanaṃ upasampajja viharati.
Having entirely surpassed the dimension of nothingness, one attains and dwells in the dimension of neither perception nor non-perception.
Vượt lên hoàn toàn Vô sở hữu xứ, vị ấy chứng và an trú Phi tưởng phi phi tưởng xứ (nevasaññānāsaññāyatana).
Sabbaso nevasaññānāsaññāyatanaṃ samatikkamma saññāvedayitanirodhaṃ upasampajja viharatī’’ti (a. ni. 9.33; dī. ni. 3.343, 359) vuttā nava anupubbavihārāva.
Having entirely surpassed the dimension of neither perception nor non-perception, one attains and dwells in the cessation of perception and feeling (saññāvedayitanirodha)''—these are the nine successive abodes (anupubbavihārā) that have been stated.
Vượt lên hoàn toàn Phi tưởng phi phi tưởng xứ, vị ấy chứng và an trú Diệt thọ tưởng định (saññāvedayitanirodha).” Như vậy, chín anupubbavihāra đã được nói đến.
3. Sabbaṃ, bhikkhave, abhiññeyyantiādi bhagavatā vuttaṃ idha āharitvā dassitanti veditabbaṃ.
3. It should be understood that the passage beginning with ''Bhikkhus, all is to be fully known'' was spoken by the Blessed One and is presented here by the Elder.
3. Sabbaṃ, bhikkhave, abhiññeyya (Này các Tỳ-khưu, tất cả cần phải được thắng tri) và các câu tương tự được Đức Thế Tôn thuyết giảng, cần phải hiểu là đã được đưa vào và trình bày ở đây.
Kiñca-iti ca-kāro padapūraṇamatte nipāto.
In the phrase Kiñca, the particle ca is merely a filler word.
Kiñca – chữ ca là một tiểu từ chỉ để bổ túc câu.
Cakkhādīni tiṃsa vissajjanāni chasu dvāresu ekekasmiṃ pañca pañca katvā dvārārammaṇapavattikkamena niddiṭṭhāni.
The thirty explanations, such as those concerning the eye, are extensively expounded by taking five for each of the six doors, in the sequence of the arising of doors and objects.
Ba mươi câu trả lời, bắt đầu bằng nhãn (cakkhu), được giải thích theo thứ tự phát sinh của các căn và cảnh, với mỗi căn trong sáu căn có năm câu trả lời.
Tattha duvidhaṃ cakkhu – maṃsacakkhu paññācakkhu ca.
Therein, the eye (cakkhu) is twofold: the physical eye (maṃsacakkhu) and the eye of wisdom (paññācakkhu).
Trong đó, nhãn (cakkhu) có hai loại: nhục nhãn (maṃsacakkhu) và tuệ nhãn (paññācakkhu).
Tesu buddhacakkhu samantacakkhu ñāṇacakkhu dibbacakkhu dhammacakkhūti pañcavidhaṃ paññācakkhu.
Among these, the paññācakkhu is fivefold: the Buddha-eye (buddhacakkhu), the all-seeing eye (samantacakkhu), the eye of knowledge (ñāṇacakkhu), the divine eye (dibbacakkhu), and the Dhamma-eye (dhammacakkhu).
Trong số đó, tuệ nhãn (paññācakkhu) có năm loại: Phật nhãn (buddhacakkhu), Toàn diện nhãn (samantacakkhu), Trí nhãn (ñāṇacakkhu), Thiên nhãn (dibbacakkhu) và Pháp nhãn (dhammacakkhu).
‘‘Addasaṃ kho ahaṃ, bhikkhave, buddhacakkhunā lokaṃ volokento’’ti (ma. ni. 1.283; 2.339; mahāva. 9) idaṃ buddhacakkhu nāma.
“Monks, I saw the world surveying it with the Buddha-eye” – this is called the Buddha-eye (buddhacakkhu).
"Này các Tỳ-khưu, khi Ta quán sát thế gian bằng Phật nhãn (buddhacakkhu), Ta đã thấy" – đây gọi là Phật nhãn.
‘‘Samantacakkhu vuccati sabbaññutaññāṇa’’nti (cūḷani. dhotakamāṇavapucchāniddesa 32; mogharājamāṇavapucchāniddesa 85) idaṃ samantacakkhu nāma.
“The all-seeing eye (samantacakkhu) is called omniscience” – this is called the all-seeing eye (samantacakkhu).
"Toàn tri trí (sabbaññutaññāṇa) được gọi là Toàn diện nhãn (samantacakkhu)" – đây gọi là Toàn diện nhãn.
‘‘Cakkhuṃ udapādi ñāṇaṃ udapādī’’ti (saṃ. ni. 5.1081; mahāva. 15) idaṃ ñāṇacakkhu nāma.
“The eye arose, knowledge arose” – this is called the eye of knowledge (ñāṇacakkhu).
"Nhãn phát sinh, trí phát sinh" – đây gọi là Trí nhãn (ñāṇacakkhu).
‘‘Addasaṃ kho ahaṃ, bhikkhave, dibbena cakkhunā visuddhenā’’ti (ma. ni. 1.285) idaṃ dibbacakkhu nāma.
“Monks, I saw with the purified divine eye” – this is called the divine eye (dibbacakkhu).
"Này các Tỳ-khưu, Ta đã thấy bằng thiên nhãn (dibbacakkhu) thanh tịnh" – đây gọi là Thiên nhãn.
‘‘Virajaṃ vītamalaṃ dhammacakkhuṃ udapādī’’ti (ma. ni. 2.395) idaṃ heṭṭhimamaggattayasaṅkhātaṃ ñāṇaṃ dhammacakkhu nāma.
“The dust-free, stainless Dhamma-eye arose” – this knowledge, which is the aggregate of the three lower paths, is called the Dhamma-eye (dhammacakkhu).
"Pháp nhãn (dhammacakkhu) không bụi bặm, không cấu uế phát sinh" – trí tuệ này, bao gồm ba đạo thấp hơn, được gọi là Pháp nhãn.
Maṃsacakkhupi sasambhāracakkhu, pasādacakkhūti duvidhaṃ hoti.
The physical eye (maṃsacakkhu) is also twofold: the eye with its constituents (sasambhāracakkhu) and the sensitive eye (pasādacakkhu).
Nhục nhãn (maṃsacakkhu) cũng có hai loại: nhãn có cấu tạo (sasambhāracakkhu) và nhãn tịnh sắc (pasādacakkhu).
Yvāyaṃ akkhikūpake patiṭṭhito heṭṭhā akkhikūpakaṭṭhikena upari bhamukaṭṭhikena ubhato akkhikūṭehi bahiddhā akkhipakhumehi paricchinno akkhikūpakamajjhā nikkhantena nhārusuttakena matthaluṅge ābaddho setakaṇhātikaṇhamaṇḍalavicitto maṃsapiṇḍo, idaṃ sasambhāracakkhu nāma.
That mass of flesh which is situated in the eye-socket, bounded below by the bone of the eye-socket, above by the eyebrow bone, on both sides by the eye-corners, externally by the eyelashes, connected to the brain by a nerve-cord emerging from the middle of the eye-socket, and adorned with white, black, and intensely black circles – this is called the eye with its constituents (sasambhāracakkhu).
Khối thịt này nằm trong hốc mắt, được giới hạn bên dưới bởi xương hốc mắt, bên trên bởi xương lông mày, hai bên bởi khóe mắt, và bên ngoài bởi lông mi; được nối với não bởi một sợi gân nhô ra từ giữa hốc mắt; và được trang trí bằng các vòng tròn trắng, đen và đen sẫm – đây gọi là nhãn có cấu tạo.
Yo pana ettha sito ettha paṭibaddho catunnaṃ mahābhūtānaṃ upādāya pasādo, idaṃ pasādacakkhu nāma.
But that sensitivity (pasāda), which is dependent on and connected to this, arising from the four great elements – this is called the sensitive eye (pasādacakkhu).
Còn tịnh sắc (pasāda) ở đây, được nương tựa và gắn liền với bốn đại chủng, thì đây gọi là nhãn tịnh sắc.
Idamidhādhippetaṃ.
This is what is intended here.
Đây là điều được đề cập ở đây.
Tadetaṃ tassa sasambhāracakkhuno setamaṇḍalaparikkhittassa kaṇhamaṇḍalassa majjhe abhimukhe ṭhitānaṃ sarīrasaṇṭhānuppattidese diṭṭhimaṇḍale sattasu picupaṭalesu āsittatelaṃ picupaṭalāni viya satta akkhipaṭalāni byāpetvā pamāṇato muggavidalamattaṃ cakkhuviññāṇādīnaṃ yathārahaṃ vatthudvārabhāvaṃ sādhayamānaṃ tiṭṭhati.
That sensitive eye, located in the visible disk, in the region where the bodily forms of those standing directly in front appear, in the middle of the black circle surrounded by the white circle of that eye with its constituents, pervades the seven eye-membranes like oil poured onto cotton wicks pervades the wicks, and, being the size of half a split pea, it functions as the appropriate basis and door for eye-consciousness and so forth.
Nhãn tịnh sắc này, nằm ở giữa vòng đen được bao quanh bởi vòng trắng của nhãn có cấu tạo đó, tại vị trí phát sinh hình dạng cơ thể của những người đứng đối diện, trong vòng tròn thị giác, lan tỏa qua bảy lớp màng mắt như dầu thấm qua các lớp bông gòn, có kích thước bằng một nửa hạt đậu xanh, và tùy theo trường hợp, đóng vai trò là căn và cửa cho nhãn thức và các thức khác.
Taṃ cakkhatīti cakkhu, rūpaṃ assādeti vibhāveti cāti attho.
It sees (cakkhati), therefore it is the eye (cakkhu); meaning, it experiences and manifests forms.
Vì nó thấy (cakkhati), nên gọi là nhãn (cakkhu); nghĩa là nó thưởng thức và hiển lộ sắc.
Rūpayantīti rūpā, vaṇṇavikāraṃ āpajjamānā hadayaṅgatabhāvaṃ pakāsentīti attho.
They manifest (rūpayanti), therefore they are forms (rūpā); meaning, by undergoing changes in color, they reveal their presence to the mind.
Vì chúng hiển lộ (rūpayanti), nên gọi là sắc (rūpā); nghĩa là chúng biểu hiện trạng thái đi vào tâm khi chúng biến đổi màu sắc.
Cakkhuto pavattaṃ viññāṇaṃ, cakkhussa vā viññāṇaṃ cakkhuviññāṇaṃ.
Consciousness arising from the eye, or consciousness of the eye, is eye-consciousness (cakkhuviññāṇaṃ).
Thức phát sinh từ nhãn, hoặc thức của nhãn, là nhãn thức (cakkhuviññāṇa).
Phusatīti phasso.
It touches (phusati), therefore it is contact (phasso).
Vì nó xúc chạm (phusati), nên là xúc (phassa).
Upasaggena padaṃ maṇḍetvā samphassoti vuttaṃ.
The word samphasso is used, adorning the term with a prefix.
Từ này được tô điểm bằng tiền tố (upa) để trở thành samphassa (xúc chạm).
Cakkhuto pavatto samphasso cakkhusamphasso.
Contact arising from the eye is eye-contact (cakkhusamphasso).
Xúc chạm phát sinh từ nhãn là nhãn xúc (cakkhusamphasso).
Cakkhusamphassapaccayāti cakkhuviññāṇasampayuttaphassapaccayā.
“Dependent on eye-contact” means dependent on contact associated with eye-consciousness.
Do nhãn xúc duyên (cakkhusamphassapaccayā) nghĩa là do duyên xúc đồng sanh với nhãn thức.
Vedayitanti vindanaṃ, vedanāti attho.
Feeling (vedayitaṃ) is experiencing; it means vedanā (sensation).
Cảm thọ (vedayitaṃ) là sự cảm nhận, nghĩa là thọ (vedanā).
Tadeva sukhayatīti sukhaṃ, yassuppajjati, taṃ sukhitaṃ karotīti attho.
That very feeling, because it makes one happy (sukhayati), is happiness (sukhaṃ); meaning, it makes the person in whom it arises happy.
Chính nó làm cho người ta sung sướng (sukhayati), nên là lạc (sukhaṃ); nghĩa là nó làm cho người nào phát sinh nó trở nên sung sướng.
Suṭṭhu vā khādati, khanati ca kāyacittābādhanti sukhaṃ.
Or, it thoroughly consumes or digs up bodily and mental afflictions, hence sukhaṃ.
Hoặc nó ăn mòn (khādati) và đào bới (khanati) các bệnh khổ thân và tâm, nên là lạc.
Dukkhayatīti dukkhaṃ, yassuppajjati, taṃ dukkhitaṃ karotīti attho.
It causes suffering (dukkhayati), therefore it is suffering (dukkhaṃ); meaning, it makes the person in whom it arises suffer.
Vì nó làm cho người ta đau khổ (dukkhayati), nên là khổ (dukkhaṃ); nghĩa là nó làm cho người nào phát sinh nó trở nên đau khổ.
Na dukkhaṃ na sukhanti adukkhamasukhaṃ.
That which is neither suffering nor happiness is neither-suffering-nor-happiness (adukkhamasukhaṃ).
Không khổ không lạc là phi khổ phi lạc (adukkhamasukhaṃ).
Ma-kāro padasandhivasena vutto.
The particle ma is used for euphonic conjunction.
Chữ ma được nói theo cách nối từ.
So pana cakkhusamphasso attanā sampayuttāya vedanāya sahajāta aññamaññanissaya vipākaāhārasampayuttaatthiavigatavasena aṭṭhadhā paccayo hoti, sampaṭicchanasampayuttāya anantarasamanantaraanantarūpanissayanatthivigatavasenapañcadhā, santīraṇādisampayuttānaṃ upanissayavaseneva paccayo hoti.
That eye-contact is a condition in eight ways for the feeling associated with itself, by way of co-nascence, mutuality, support, resultant, nutriment, association, presence, and non-disappearance; in five ways for the feeling associated with receiving-consciousness, by way of contiguity, immediate contiguity, immediate decisive support, absence, and disappearance; and it is a condition for the feelings associated with investigating-consciousness and so forth only by way of decisive support.
Nhãn xúc đó là duyên tám cách cho thọ đồng sanh với nó, theo các duyên đồng sanh (sahajāta), hỗ tương (aññamañña), y chỉ (nissaya), quả dị thục (vipāka), thực (āhāra), tương ưng (sampayutta), hiện hữu (atthi), bất ly (avigata); năm cách cho thọ đồng sanh với tiếp thọ, theo các duyên vô gián (anantara), đẳng vô gián (samanantara), cận y (anantarūpanissaya), bất hữu (natthi), ly (vigata); và chỉ là duyên theo cách cận y (upanissaya) cho các thọ đồng sanh với thẩm sát và các tâm khác.
Suṇātīti sotaṃ.
It hears (suṇāti), therefore it is the ear (sotaṃ).
Vì nó nghe (suṇāti), nên là nhĩ (sotaṃ).
Taṃ sasambhārasotabilassa anto tanutambalomācite aṅgulivedhakasaṇṭhāne padese sotaviññāṇādīnaṃ yathārahaṃ vatthudvārabhāvaṃ sādhayamānaṃ tiṭṭhati.
That ear is situated within the ear-cavity with its constituents, in a region shaped like a finger-ring, covered with fine reddish hairs, functioning as the appropriate basis and door for ear-consciousness and so forth.
Nhĩ này nằm bên trong hốc tai có cấu tạo (sasambhārasotabila), tại một vị trí có hình dạng như ngón tay đeo nhẫn, được bao phủ bởi những sợi lông mảnh màu đỏ, và tùy theo trường hợp, đóng vai trò là căn và cửa cho nhĩ thức và các thức khác.
Sappantīti saddā, udāharīyantīti attho.
They are uttered (sappanti), therefore they are sounds (saddā); meaning, they are spoken.
Vì chúng lan tỏa (sappanti), nên là thanh (saddā); nghĩa là chúng được phát ra.
Ghāyatīti ghānaṃ.
It smells (ghāyati), therefore it is the nose (ghānaṃ).
Vì nó ngửi (ghāyati), nên là tỷ (ghānaṃ).
Taṃ sasambhāraghānabilassa anto ajapadasaṇṭhāne padese ghānaviññāṇādīnaṃ yathārahaṃ vatthudvārabhāvaṃ sādhayamānaṃ tiṭṭhati.
That nose is situated within the nose-cavity with its constituents, in a region shaped like a goat's foot, functioning as the appropriate basis and door for nose-consciousness and so forth.
Tỷ này nằm bên trong hốc mũi có cấu tạo (sasambhāraghānabilassa), tại một vị trí có hình dạng như chân dê, và tùy theo trường hợp, đóng vai trò là căn và cửa cho tỷ thức và các thức khác.
Gandhayantīti gandhā, attano vatthuṃ sūcentīti attho.
They make known, hence odours (gandhā); the meaning is that they indicate their own basis.
Vì chúng tỏa hương (gandhayanti), nên là hương (gandhā); nghĩa là chúng biểu thị đối tượng của chính mình.
Jīvitamavhāyatīti jivhā, sāyanaṭṭhena vā jivhā.
It calls for life, hence tongue (jivhā); or, the tongue by way of licking.
Vì nó gọi sự sống (jīvitamavhāyati), nên là thiệt (jivhā); hoặc là thiệt theo nghĩa nếm.
Sā sasambhārajivhāya atiaggamūlapassāni vajjetvā uparimatalamajjhe bhinnauppaladalaggasaṇṭhāne padese jivhāviññāṇādīnaṃ yathārahaṃ vatthudvārabhāvaṃ sādhayamānā tiṭṭhati.
That tongue, avoiding the extreme tip, root, and sides of the tongue with its constituents, remains in the middle of the upper surface, in a place shaped like the tip of a broken lotus petal, serving as the appropriate basis and door for tongue-consciousness and so on.
Thiệt này nằm ở giữa mặt trên của lưỡi có cấu tạo (sasambhārajivhāya), tránh phần đầu, gốc và hai bên quá mức, tại một vị trí có hình dạng như đầu cánh sen bị tách ra, và tùy theo trường hợp, đóng vai trò là căn và cửa cho thiệt thức và các thức khác.
Rasanti te sattāti rasā, assādentīti attho.
Beings taste them, hence tastes (rasā); the meaning is that they enjoy them.
Vì chúng sinh vật nếm (rasanti) các đối tượng đó, nên là vị (rasā); nghĩa là chúng được nếm.
Kucchitānaṃ sāsavadhammānaṃ āyoti kāyo.
The origin of repulsive, defiled phenomena, hence body (kāyo).
Thân (kāyo) là nơi phát sinh (āyo) của các pháp hữu lậu (sāsavadhammāna) đáng ghê tởm (kucchitāna).
Āyoti uppattideso.
Origin means the place of arising.
Āyo nghĩa là nơi phát sinh.
So yāvatā imasmiṃ kāye upādiṇṇappavatti nāma atthi, tattha yebhuyyena kāyapasādo kāyaviññāṇādīnaṃ yathārahaṃ vatthudvārabhāvaṃ sādhayamāno tiṭṭhati.
As far as there is the arising of clung-to phenomena in this body, there, for the most part, the body-sensitivity remains, serving as the appropriate basis and door for body-consciousness and so on.
Thân tịnh sắc (kāyapasāda) này, trong chừng mực mà có sự phát sinh các sắc do nghiệp tạo (upādiṇṇappavatti) trong thân này, thì phần lớn nó đóng vai trò là căn và cửa cho thân thức (kāyaviññāṇa) và các thức khác, tùy theo trường hợp.
Phusīyantīti phoṭṭhabbā.
They are touched, hence tangibles (phoṭṭhabbā).
Vì chúng được xúc chạm (phusīyanti), nên là xúc (phoṭṭhabbā).
Munātīti mano, vijānātīti attho.
It knows, hence mind (mano); the meaning is that it cognizes.
Vì nó suy nghĩ (munāti), nên là ý (mano); nghĩa là nó hiểu biết.
Attano lakkhaṇaṃ dhārentīti dhammā.
They uphold their own characteristics, hence mental objects (dhammā).
Vì chúng giữ gìn đặc tính của chính mình, nên là pháp (dhammā).
Manoti sahāvajjanaṃ bhavaṅgaṃ.
Mind (mano) is the bhavanga-consciousness together with the advertence.
Ý (mano) là tâm cận tử (bhavaṅga) cùng với tâm khai ý môn (āvajjana).
Dhammāti dvādasapabhedā dhammārammaṇā dhammā.
Mental objects (dhammā) are the twelvefold mental objects.
Pháp (dhammā) là các pháp cảnh pháp (dhammārammaṇā) có mười hai loại.
Manoviññāṇanti javanamanoviññāṇaṃ.
Mind-consciousness (manoviññāṇaṃ) is the javana-mind-consciousness.
Ý thức (manoviññāṇa) là ý thức tốc hành (javanamanoviññāṇa).
Manosamphassoti taṃsampayutto phasso.
Mind-contact (manosamphasso) is the contact associated with it.
Ý xúc (manosamphasso) là xúc đồng sanh với ý thức đó.
So sampayuttāya vedanāya vipākapaccayavajjehi sesehi sattahi paccayo hoti, anantarāya teheva, sesānaṃ upanissayavaseneva paccayo hoti.
It is a condition for the associated feeling by seven conditions, excluding the vipāka condition; for the immediately preceding ones, by those same conditions; for the remaining ones, it is a condition only by way of decisive support (upanissaya).
Ý xúc đó là duyên bảy cách cho thọ đồng sanh với nó, ngoại trừ duyên quả dị thục; là duyên năm cách cho thọ kế tiếp, theo các duyên vô gián, đẳng vô gián, cận y, bất hữu, ly; và chỉ là duyên theo cách cận y cho các thọ đồng sanh với thẩm sát và các tâm khác.
Rūpādīni pañca vissajjanāni khandhavasena niddiṭṭhāni.
The five expositions, beginning with form (rūpa), are described in terms of the aggregates.
Năm câu trả lời, bắt đầu bằng sắc (rūpa), được giải thích theo khía cạnh các uẩn.
Sītādīhi ruppati pīḷīyatīti rūpaṃ.
It is afflicted and oppressed by cold and so on, hence form (rūpa).
Vì nó bị hoại diệt (ruppati) hoặc bị bức hại (pīḷīyati) bởi lạnh và các yếu tố khác, nên là sắc (rūpaṃ).
Vedayatīti vedanā.
It feels, hence feeling (vedanā).
Vì nó cảm nhận (vedayati), nên là thọ (vedanā).
Sañjānātīti saññā.
It perceives, hence perception (saññā).
Vì nó nhận biết (sañjānāti), nên là tưởng (saññā).
Saṅkharontīti saṅkhārā.
They construct, hence volitional formations (saṅkhārā).
Vì chúng tạo tác (saṅkharonti), nên là hành (saṅkhārā).
Vijānātīti viññāṇaṃ.
It cognizes, hence consciousness (viññāṇaṃ).
Vì nó hiểu biết (vijānāti), nên là thức (viññāṇaṃ).
Cakkhādīni dhammavicārapariyantāni dasa chakkavasena, saṭṭhi vissajjanāni piyarūpasātarūpavasena niddiṭṭhāni.
The ten, beginning with eye (cakkhu) and ending with investigation of phenomena (dhammavicāra), are described in terms of the sixfold sets; the sixty expositions are described in terms of what is dear and agreeable.
Mười câu trả lời từ nhãn (cakkhu) đến pháp quán (dhammavicāra), tức sáu mươi câu trả lời, được giải thích theo khía cạnh sáu nhóm (chakka), theo sắc đáng yêu và sắc đáng thích.
Cakkhusamphassajādikā vedanā taṃtaṃsampayuttāva.
Feeling born of eye-contact and so on is just that which is associated with each of them.
Thọ phát sinh từ nhãn xúc và các xúc khác là thọ đồng sanh với chính xúc đó.
Rūpesu saññā rūpasaññā. Sañcetayatīti sañcetanā, abhisandahatīti attho.
Perception of forms is perception of forms (rūpasaññā). It intends, hence intention (sañcetanā); the meaning is that it coordinates.
Tưởng về sắc là sắc tưởng (rūpasaññā). Vì nó tác ý (sañcetayati), nên là tư (sañcetanā); nghĩa là nó hướng đến.
Tasatīti taṇhā, pipāsatīti attho.
It trembles, hence craving (taṇhā); the meaning is that it thirsts.
Vì nó run sợ (tasati) hoặc khát khao (pipāsatī), nên là ái (taṇhā); nghĩa là nó khát khao.
Vitakketīti vitakko, vitakkanaṃ vā vitakko, ūhananti vuttaṃ hoti.
It applies thoughts, hence initial application (vitakko); or, initial application is vitakka; it is said to be directing.
Vì nó tầm cầu (vitakketi), nên là tầm (vitakko); hoặc tầm là sự tầm cầu, nghĩa là sự suy xét.
Ārammaṇe tena cittaṃ vicaratīti vicāro, vicaraṇaṃ vā vicāro, anusañcaraṇanti vuttaṃ hoti.
The mind wanders with it in the object, hence sustained application (vicāro); or, wandering is vicāra; it is said to be continuous movement.
Vì tâm chuyển động (vicarati) trên đối tượng với nó, nên là tứ (vicāro); hoặc tứ là sự chuyển động, nghĩa là sự tiếp tục chuyển động.
4. Pathavīdhātādīni cha vissajjanāni saṃkhittena nāmarūpavavatthānavasena niddiṭṭhāni.
The six expositions, beginning with earth element (pathavīdhātu), are described briefly in terms of the analysis of mind-and-matter.
4. Sáu câu trả lời, bắt đầu bằng địa giới (pathavīdhātu), được giải thích tóm tắt theo cách phân biệt danh và sắc.
Patthaṭattā pathavī.
Because it is spread out, it is earth (pathavī).
Vì nó trải rộng (patthaṭattā), nên là địa (pathavī).
Appeti, āpīyati, appāyatīti vā āpo.
It pervades, it is pervaded, or it expands, hence water (āpo).
Vì nó thấm nhập (appeti), hoặc được thấm nhập (āpīyati), hoặc lan tỏa (appāyati), nên là thủy (āpo).
Tejayatīti tejo.
It heats, hence fire (tejo).
Vì nó làm sáng (tejayati), nên là hỏa (tejo).
Vāyatīti vāyo.
It moves, hence wind (vāyo).
Vì nó thổi (vāyati), nên là phong (vāyo).
Na kassati na nikassati, kasituṃ chindituṃ bhindituṃ vā na sakkāti ākāso.
It cannot be cut, cannot be divided, cannot be broken, hence space (ākāso).
Vì nó không bị cày xới, không bị kéo ra, hoặc không thể cày xới, cắt đứt, hoặc phá vỡ, nên là không (ākāso).
Nissattaṭṭhena dhātu.
By the meaning of being without a living essence, it is element (dhātu).
Vì nó không phải là chúng sinh, nên là giới (dhātu).
Pathavīkasiṇādīni dasa vissajjanāni kasiṇabhāvanāvasena niddiṭṭhāni.
The ten expositions, beginning with earth kasiṇa (pathavīkasiṇa), are described in terms of kasiṇa meditation.
Mười câu trả lời, bắt đầu bằng địa biến xứ (pathavīkasiṇa), được giải thích theo cách tu tập biến xứ.
Kasiṇanti sakalapharaṇavasena kasiṇamaṇḍalampi tasmiṃ upaṭṭhitanimittampi tadārammaṇaṃ jhānampi vuccati.
Kasiṇa is also said to be the kasiṇa-disk by way of complete pervasion, the sign that has appeared in it, and the jhāna that has that as its object.
Kasiṇa: Do năng lực biến mãn khắp tất cả, vòng tròn kasiṇa cũng được gọi là kasiṇa, tướng hiện khởi trong đó cũng (được gọi là kasiṇa), và thiền có đối tượng ấy cũng được gọi là (kasiṇa).
Idha pana jhānaṃ adhippetaṃ.
Here, however, jhāna is intended.
Tuy nhiên, ở đây, thiền (jhāna) được chủ định.
Ādimhi cattāri mahābhūtakasiṇārammaṇāni jhānāni, tato parāni cattāri vaṇṇakasiṇārammaṇāni.
Initially, there are four jhānas whose objects are the great-element kasiṇas; thereafter, four jhānas whose objects are the colour kasiṇas.
Ban đầu là các thiền có đối tượng là bốn đại biến xứ (mahābhūtakasiṇa), sau đó là các thiền có đối tượng là bốn biến xứ màu sắc (vaṇṇakasiṇa).
Ākāsakasiṇanti paricchedākāso, tadārammaṇañca jhānaṃ, kasiṇugghāṭimākāso, tadārammaṇañca ākāsānañcāyatanaṃ.
Space kasiṇa (ākāsakasiṇa) refers to delimited space, and the jhāna that has it as its object, as well as the space released from the kasiṇa, and the sphere of infinite space (ākāsānañcāyatana) that has it as its object.
Ākāsakasiṇa (Không biến xứ) là hư không được phân định (paricchedākāso), và thiền có đối tượng ấy; là hư không được mở ra từ kasiṇa (kasiṇugghāṭimākāso), và Không Vô Biên Xứ (ākāsānañcāyatana) có đối tượng ấy.
Viññāṇakasiṇanti ākāsānañcāyatanaviññāṇaṃ, tadārammaṇañca viññāṇañcāyatanaṃ.
Consciousness kasiṇa (viññāṇakasiṇa) refers to the consciousness of the sphere of infinite space (ākāsānañcāyatana-viññāṇa), and the sphere of infinite consciousness (viññāṇañcāyatana) that has it as its object.
Viññāṇakasiṇa (Thức biến xứ) là thức của Không Vô Biên Xứ (ākāsānañcāyatanaviññāṇa), và Thức Vô Biên Xứ (viññāṇañcāyatana) có đối tượng ấy.
Pubbo khāṇukaṇṭakapaharaṇaggijālādīhi abhihate vā sarīrappadese abbhantaradhātukkhobhavasena vā uppannesu gaṇḍapīḷakādīsu paripakkalohitapariṇāmo.
Pus (pubbo) is the transformation of ripened blood that arises in boils, pustules, etc., in a part of the body either struck by a tree-stump, thorn, weapon with a sharp edge, flame, etc., or due to an internal disturbance of the elements.
Mủ: Là sự biến chất của máu đã chín, trong các mụn nhọt, v.v... phát sinh ở những vùng cơ thể bị cọc, gai đâm, vũ khí chém, lửa đốt, v.v... hoặc do sự xáo trộn của các giới bên trong.
Lohitaṃ yakanassa heṭṭhābhāgaṃ pūretvā hadayavakkapapphāsānaṃ upari thokaṃ thokaṃ paggharantaṃ vakkahadayayakanapapphāse temayamānaṃ ṭhitaṃ ekapatthapūramattaṃ sannicitalohitasaṅkhātañca, kesalomanakhadantānaṃ maṃsavinimuttaṭṭhānañceva thaddhasukkhacammañca ṭhapetvā dhamanijālānusārena sabbaṃ upādiṇṇasarīraṃ pharitvā ṭhitaṃ saṃsaraṇalohitasaṅkhātañcāti duvidhaṃ lohitaṃ.
Blood ( Lohita) is of two kinds: that which is called accumulated blood, filling the lower part of the liver, gradually flowing out and dripping above the heart, kidneys, and lungs, moistening the kidneys, heart, liver, and lungs, remaining to the extent of about one pattha full; and that which is called circulating blood, pervading the entire body grasped by craving and views, following the network of veins, excluding the places free from flesh, such as hair, body-hair, nails, and teeth, and hard, dry skin.
Máu: Có hai loại máu: loại gọi là máu tích tụ (sannicitalohita) có dung lượng khoảng một đấu, làm đầy phần dưới của gan, chảy rỉ ra một ít trên tim, thận và phổi, làm ẩm ướt thận, tim, gan và phổi; và loại gọi là máu lưu thông (saṃsaraṇalohita) chảy khắp toàn bộ cơ thể chấp thủ theo mạng lưới các mạch máu, trừ những nơi không có thịt như tóc, lông, móng, răng và lớp da khô cứng.
Cakkhāyatanādīni dvādasa vissajjanāni dvādasāyatanavasena niddiṭṭhāni.
The twelve spheres, such as the eye-sphere (cakkhāyatana), are designated as the twelve āyatanas.
Mười hai sự giải thích như xứ nhãn (Cakkhāyatana) v.v… được trình bày theo mười hai xứ.
Āyatanato, āyānaṃ tananato, āyatassa ca nayanato āyatanaṃ.
An āyatana is so called because it is a place of arising (āyatanato), because it expands the arisings (āyānaṃ tananato), and because it leads to the prolonged (āyatassa ca nayanato) suffering of saṃsāra.
Xứ (āyatana) là nơi phát sinh (āyatanato), là nơi làm tăng trưởng (āyānaṃ tananato), và là nơi dẫn dắt (āyatassa ca nayanato).
Cakkhurūpādīsu hi taṃtaṃdvārārammaṇā cittacetasikā dhammā sena sena anubhavanādinā kiccena āyatanti uṭṭhahanti ghaṭanti, vāyamantīti vuttaṃ hoti.
Indeed, in the eye, visible forms, and so on, the mind and mental factors associated with each respective door and object arise, strive, and exert themselves by their respective functions of experiencing and so on; this is what is meant.
Thật vậy, trong nhãn, sắc v.v…, các pháp tâm và tâm sở ở mỗi cửa và đối tượng tương ứng, phát sinh, khởi lên, nỗ lực, cố gắng với chức năng kinh nghiệm của riêng chúng; tức là chúng "phát sinh" (āyatanti).
Te ca pana āyabhūte dhamme etāni tanonti, vitthārentīti vuttaṃ hoti.
And these (spheres) expand and proliferate these phenomena that are arisings; this is what is meant.
Và những xứ này làm tăng trưởng, mở rộng các pháp đã phát sinh đó; tức là chúng "làm tăng trưởng" (tanonti).
Idañca anamatagge saṃsāre pavattaṃ atīva āyataṃ saṃsāradukkhaṃ yāva na nivattati, tāva nayanti, pavattayantīti vuttaṃ hoti.
And this extremely prolonged suffering of saṃsāra, which has no discernible beginning, continues to lead to and prolong it as long as it does not cease; this is what is meant.
Và chúng dẫn dắt, duy trì sự khổ luân hồi rất dài đã diễn ra trong luân hồi vô thủy này cho đến khi nó chưa chấm dứt; tức là chúng "dẫn dắt" (nayanti).
Apica nivāsaṭṭhānaṭṭhena ākaraṭṭhena samosaraṇaṭṭhānaṭṭhena sañjātidesaṭṭhena kāraṇaṭṭhena ca āyatanaṃ.
Furthermore, an āyatana is so called by way of being a dwelling place, a source, a place of convergence, a place of origin, and a cause.
Hơn nữa, xứ (āyatana) còn có nghĩa là nơi cư trú, nơi phát sinh, nơi hội tụ, nơi sản sinh, và nguyên nhân.
Tathā hi loke ‘‘issarāyatanaṃ vāsudevāyatana’’ntiādīsu nivāsaṭṭhānaṃ ‘‘āyatana’’nti vuccati.
Thus, in the world, a dwelling place is called an āyatana, as in "the āyatana of Issara", "the āyatana of Vāsudeva", and so on.
Thật vậy, trong đời, nơi cư trú được gọi là xứ, như trong các câu “xứ của chúa tể (issarāyatanaṃ), xứ của Vasudeva (vāsudevāyatanaṃ)” v.v….
‘‘Suvaṇṇāyatanaṃ rajatāyatana’’ntiādīsu ākaro.
A source is called an āyatana, as in "a source of gold", "a source of silver", and so on.
Nơi phát sinh (ākaro) như trong các câu “xứ vàng (suvaṇṇāyatanaṃ), xứ bạc (rajatāyatanaṃ)” v.v….
Sāsane pana ‘‘manorame āyatane, sevanti naṃ vihaṅgamā’’tiādīsu (a. ni. 5.38) samosaraṇaṭṭhānaṃ.
However, in the Dispensation, a place of convergence is called an āyatana, as in "In a delightful āyatana, the birds resort to it."
Còn trong giáo pháp, nơi hội tụ (samosaraṇaṭṭhānaṃ) như trong các câu “Trong xứ đẹp đẽ, các loài chim tụ tập” v.v….
‘‘Dakkhiṇāpatho gunnaṃ āyatana’’ntiādīsu sañjātideso.
A place of origin is called an āyatana, as in "The Southern Path is the āyatana of cattle," and so on.
Nơi sản sinh (sañjātideso) như trong các câu “Đakṣiṇāpatha là xứ của bò” v.v….
‘‘Tatra tatreva sakkhibhabbataṃ pāpuṇāti sati satiāyatane’’tiādīsu (a. ni. 3.102; 5.23) kāraṇaṃ.
A cause is called an āyatana, as in "One attains the capacity to bear witness in each and every āyatana where mindfulness is present," and so on.
Nguyên nhân (kāraṇaṃ) như trong các câu “Ở mỗi xứ có niệm, vị ấy đạt được khả năng làm chứng ở đó” v.v….
Cakkhuādīsu cāpi te te cittacetasikā dhammā nivasanti tadāyattavuttitāyāti cakkhādayo nesaṃ nivāsaṭṭhānaṃ, cakkhādīsu ca te ākiṇṇā tannissayattā tadārammaṇattā cāti cakkhādayo ca nesaṃ ākaro, tattha tattha vatthudvārārammaṇavasena samosaraṇato cakkhādayo ca nesaṃ samosaraṇaṭṭhānaṃ, taṃnissayārammaṇabhāvena tattheva uppattito cakkhādayo ca nesaṃ sañjātideso, cakkhādīnaṃ abhāve abhāvato cakkhādayo ca nesaṃ kāraṇanti yathāvuttenatthena cakkhu ca taṃ āyatanañcāti cakkhāyatanaṃ.
And in the eye and so on, those various mental factors dwell, because their existence is dependent on them; therefore, the eye and so on are their dwelling place. And in the eye and so on, those (mental factors) are abundant because they are dependent on them and have them as their object; therefore, the eye and so on are their source. And because they converge there by way of base, door, and object, the eye and so on are their place of convergence. And because they arise right there by way of being dependent on them and having them as their object, the eye and so on are their place of origin. And because they do not exist in the absence of the eye and so on, the eye and so on are their cause. Thus, by the meaning stated, the eye and that which is an āyatana is the eye-sphere (cakkhāyatana).
Và trong nhãn v.v…, các pháp tâm và tâm sở đó cư trú vì chúng có sự tồn tại phụ thuộc vào đó; do đó, nhãn v.v… là nơi cư trú của chúng. Và các pháp đó tràn ngập trong nhãn v.v… vì chúng nương tựa vào đó và lấy đó làm đối tượng; do đó, nhãn v.v… là nơi phát sinh của chúng. Và nhãn v.v… là nơi hội tụ của chúng vì chúng hội tụ ở đó theo căn, môn, và cảnh. Và nhãn v.v… là nơi sản sinh của chúng vì chúng chỉ phát sinh ở đó do bản chất nương tựa và lấy đó làm đối tượng. Và nhãn v.v… là nguyên nhân của chúng vì nếu không có nhãn v.v… thì chúng cũng không có; do đó, theo nghĩa đã nói, nhãn và xứ là nhãn xứ (cakkhāyatanaṃ).
Evaṃ sesānipi.
Thus also the remaining ones.
Các xứ còn lại cũng vậy.
Cakkhudhātādīni aṭṭhārasa vissajjanāni aṭṭhārasadhātuvasena niddiṭṭhāni.
The eighteen expositions beginning with cakkhudhātu (eye-element) are explained by way of the eighteen elements.
Mười tám sự giải thích như nhãn giới (Cakkhudhātu) v.v… được trình bày theo mười tám giới.
Cakkhādīsu ekeko dhammo yathāsambhavaṃ vidahati, dhīyate, vidhānaṃ vidhīyate, etāya, ettha vā dhīyatīti dhātu.
Among the eye and so forth, each phenomenon, as is possible, arranges, is borne, or is arranged by this, or is placed therein; thus it is called dhātu.
Trong nhãn v.v…, mỗi pháp tương ứng với khả năng của nó mà sắp đặt, được chứa đựng, sự sắp đặt được thực hiện bởi cái này, hoặc được chứa đựng ở đây; do đó gọi là giới (dhātu).
Lokiyā hi dhātuyo kāraṇabhāvena vavatthitā hutvā suvaṇṇarajatādidhātuyo viya suvaṇṇarajatādiṃ, anekappakāraṃ saṃsāradukkhaṃ vidahanti.
Indeed, worldly elements, being established as causes, arrange various kinds of saṃsāric suffering, just as elements like gold and silver ores produce gold, silver, and so forth.
Thật vậy, các giới thế gian, tồn tại như là nguyên nhân, sắp đặt sự khổ luân hồi đa dạng, giống như các khoáng chất vàng, bạc v.v… tạo ra vàng, bạc v.v….
Bhārahārehi ca bhāro viya sattehi dhīyante, dhārīyantīti attho.
And they are borne by beings, like a burden by burden-bearers; this is the meaning.
Và chúng được chúng sinh gánh vác, mang theo, giống như gánh nặng được người gánh vác; đó là ý nghĩa.
Dukkhavidhānamattameva cetā avasavattanato.
And since these are not subject to control, they merely arrange suffering.
Và chúng chỉ là sự sắp đặt của khổ, vì chúng không phục tùng ý muốn.
Etāhi ca karaṇabhūtāhi saṃsāradukkhaṃ sattehi anuvidhīyati.
And by these, which are causes, saṃsāric suffering is repeatedly arranged by beings.
Và sự khổ luân hồi được chúng sinh sắp đặt liên tục bởi chúng, là nguyên nhân.
Tathāvihitañcetaṃ etāsveva dhīyati, ṭhapīyatīti attho.
And this suffering, thus arranged, is placed or established in these very elements; this is the meaning.
Và sự khổ đã được sắp đặt như vậy được đặt, được chứa đựng trong chính chúng; đó là ý nghĩa.
Apica yathā titthiyānaṃ attā nāma sabhāvato natthi, na evametā.
Furthermore, just as the self (atta) of the sectarians does not exist by nature, these are not so.
Hơn nữa, không phải như các ngoại đạo nói rằng không có tự ngã theo bản chất, mà các giới này thì không như vậy.
Etā pana attano sabhāvaṃ dhārentīti dhātuyo.
But these (elements) uphold their own nature, hence they are dhātus.
Mà các giới này duy trì bản chất của chính chúng; do đó gọi là giới (dhātuyo).
Yathā ca loke vicittā haritālamanosilādayo selāvayavā dhātuyoti vuccanti, evametāpi dhātuyo viyāti dhātuyo.
And just as in the world, variegated parts of rocks like realgar and orpiment are called elements, so too are these called elements, as if they were elements.
Và giống như trong đời, các phần của đá như haritāla và manosilā đa sắc được gọi là khoáng chất (dhātuyo), thì các giới này cũng giống như khoáng chất; do đó gọi là giới (dhātuyo).
Vicittā hetā ñāṇaneyyāvayavāti.
For these are indeed variegated parts of what is to be known by wisdom.
Thật vậy, chúng là các phần đa dạng của đối tượng của trí tuệ.
Yathā vā sarīrasaṅkhātassa samudāyassa avayavabhūtesu rasasoṇitādīsu aññamaññavisabhāgalakkhaṇaparicchinnesu dhātusamaññā, evamevetesupi pañcakkhandhasaṅkhātassa attabhāvassa avayavesu dhātusamaññā veditabbā.
Or, just as the designation ‘element’ applies to the constituents of the aggregate called the body, such as lymph and blood, which are distinguished by mutually dissimilar characteristics, so too should the designation ‘element’ be understood for these constituents of existence, called the five aggregates.
Hoặc giống như trong các phần của tập hợp gọi là thân thể, như máu, huyết v.v…, được phân biệt bởi các đặc tính khác nhau, có danh xưng là giới; thì cũng vậy, trong các phần của sự tồn tại gọi là năm uẩn, cũng nên hiểu có danh xưng là giới.
Aññamaññavisabhāgalakkhaṇaparicchinnā hete cakkhādayoti.
For these, the eye and so forth, are distinguished by mutually dissimilar characteristics.
Thật vậy, các nhãn v.v… này được phân biệt bởi các đặc tính khác nhau.
Apica dhātūti nijjīvamattassetaṃ adhivacanaṃ.
Moreover, dhātu is merely a term for what is devoid of a living essence.
Hơn nữa, giới (dhātu) là tên gọi của bản chất vô sinh.
Tathā hi bhagavā ‘‘chadhāturo ayaṃ bhikkhu puriso’’tiādīsu (ma. ni. 3.343-344) jīvasaññāsamūhananatthaṃ dhātudesanaṃ akāsīti.
Thus, the Blessed One taught the elements in passages like "This person, bhikkhu, has six elements" to eradicate the notion of a living being.
Thật vậy, Đức Thế Tôn đã thuyết giảng về giới để loại bỏ quan niệm về chúng sinh, như trong các câu “Này Tỳ-kheo, người này có sáu giới” v.v….
Yathāvuttenatthena cakkhu ca taṃ dhātu cāti cakkhudhātu.
By the meaning stated above, the eye is also an element, and that is cakkhudhātu.
Theo nghĩa đã nói, nhãn và giới là nhãn giới (cakkhudhātu).
Evaṃ sesāpi.
Similarly for the rest.
Các giới còn lại cũng vậy.
Manodhātūti ca tisso manodhātuyo.
Manodhātu refers to the three mind-elements.
Ý giới (Manodhātu) là ba ý giới.
Dhammadhātūti vedanāsaññāsaṅkhārakkhandhā soḷasa sukhumarūpāni nibbānañca.
Dhammadhātu refers to the aggregates of feeling, perception, and mental formations, the sixteen subtle material phenomena, and Nibbāna.
Pháp giới (Dhammadhātu) là các uẩn thọ, tưởng, hành, mười sáu sắc vi tế, và Nibbāna.
Manoviññāṇadhātūti chasattati manoviññāṇadhātuyo.
Manoviññāṇadhātu refers to the seventy-six mind-consciousness elements.
Ý thức giới (Manoviññāṇadhātu) là bảy mươi sáu ý thức giới.
Cakkhundriyādīni bāvīsati vissajjanāni bāvīsatindriyavasena niddiṭṭhāni.
The twenty-two expositions beginning with cakkhundriya (eye-faculty) are explained by way of the twenty-two faculties.
Hai mươi hai sự giải thích như nhãn căn (Cakkhundriya) v.v… được trình bày theo hai mươi hai căn.
Cakkhumeva dassanalakkhaṇe indaṭṭhaṃ kāretīti cakkhundriyaṃ.
The eye itself produces the state of being a lord in the characteristic of seeing, hence it is cakkhundriyaṃ.
Chính nhãn làm chức năng chủ tể trong đặc tính thấy; do đó gọi là nhãn căn (cakkhundriyaṃ).
Sotameva savanalakkhaṇe indaṭṭhaṃ kāretīti sotindriyaṃ.
The ear itself produces the state of being a lord in the characteristic of hearing, hence it is sotindriyaṃ.
Chính nhĩ làm chức năng chủ tể trong đặc tính nghe; do đó gọi là nhĩ căn (sotindriyaṃ).
Ghānameva ghāyanalakkhaṇe indaṭṭhaṃ kāretīti ghānindriyaṃ.
The nose itself produces the state of being a lord in the characteristic of smelling, hence it is ghānindriyaṃ.
Chính tỷ làm chức năng chủ tể trong đặc tính ngửi; do đó gọi là tỷ căn (ghānindriyaṃ).
Jivhā eva sāyanalakkhaṇe indaṭṭhaṃ kāretīti jivhindriyaṃ.
The tongue itself produces the state of being a lord in the characteristic of tasting, hence it is jivhindriyaṃ.
Chính thiệt làm chức năng chủ tể trong đặc tính nếm; do đó gọi là thiệt căn (jivhindriyaṃ).
Kāyo eva phusanalakkhaṇe indaṭṭhaṃ kāretīti kāyindriyaṃ.
The body itself produces the state of being a lord in the characteristic of touching, hence it is kāyindriyaṃ.
Chính thân làm chức năng chủ tể trong đặc tính xúc chạm; do đó gọi là thân căn (kāyindriyaṃ).
Manate iti mano, vijānātīti attho.
It knows, hence it is mind (mano), meaning it cognizes.
Nó nhận biết (manate); do đó gọi là ý (mano). Tức là nó hiểu biết.
Aṭṭhakathācariyā panāhu – nāliyā minamāno viya mahātulāya dhārayamāno viya ca ārammaṇaṃ manati jānātīti mano, tadeva mananalakkhaṇe indaṭṭhaṃ kāretīti manindriyaṃ.
But the Aṭṭhakathā teachers say: It measures or knows the object, like one measuring with a measuring pot or weighing with a large scale, hence it is mind (mano); that very mind produces the state of being a lord in the characteristic of cognizing, hence it is manindriyaṃ.
Tuy nhiên, các bậc thầy Aṭṭhakathā nói rằng: ý (mano) là cái nhận biết (jānāti) đối tượng như người cân bằng naliya hoặc như người cân bằng bằng cân lớn; chính ý đó làm chức năng chủ tể trong đặc tính nhận biết; do đó gọi là ý căn (manindriyaṃ).
Aññātāvino catusaccesu niṭṭhitañāṇakiccassa khīṇāsavassa uppajjanato indriyaṭṭhasambhavato ca aññātāvindriyaṃ, aññātāvīnaṃ vā catūsu saccesu niṭṭhitakiccānaṃ cattāri saccāni paṭivijjhitvā ṭhitānaṃ dhammānaṃ abbhantare indaṭṭhasādhanena aññātāvindriyaṃ.
Because it arises in an Arahant, whose task of knowledge concerning the four Noble Truths is completed, and because of the possibility of its being an indriya, it is the aññātāvindriya. Or, it is the aññātāvindriya by establishing sovereignty among the dhammas of those who have completed their task concerning the four truths, who have penetrated the four truths, namely the Arahants who have known.
Vì nó phát sinh nơi vị A-la-hán đã đoạn trừ các lậu hoặc, người đã hoàn thành nhiệm vụ của tuệ trong Tứ Thánh đế đã được biết, và vì có sự hiện hữu của quyền năng của căn, nên nó là aññātāvindriya (cứu cánh tri căn); hoặc aññātāvindriya là sự thiết lập quyền năng của căn trong các pháp của những vị đã thành tựu sự biết, những vị đã hoàn thành nhiệm vụ trong Tứ Thánh đế, đã thâm nhập Tứ Thánh đế và an trú trong đó.
Arahattaphalañāṇassetaṃ nāmaṃ.
This is the name for the knowledge of the Arahatta-phala.
Đây là tên gọi của Tuệ Quả A-la-hán.
Sabbānipetāni yathāyogaṃ indaliṅgaṭṭhena indadesitaṭṭhena indadiṭṭhaṭṭhena indasiṭṭhaṭṭhena indajuṭṭhaṭṭhena ca indriyāni.
All these are indriyas, according to their respective suitability, by reason of being a sign of Indra, by reason of being taught by Indra, by reason of being seen by Indra, by reason of being ordained by Indra, and by reason of being used by Indra.
Tất cả những căn này, tùy theo sự thích hợp, đều là các căn theo nghĩa là dấu hiệu của Indra, được Indra thuyết giảng, được Indra thấy biết, được Indra sắp đặt, và được Indra thọ dụng.
Bhagavā hi sammāsambuddho paramissariyabhāvato indo, kusalākusalañca kammaṃ kammesu kassaci issariyābhāvato.
For the Blessed One, the Perfectly Self-Enlightened One, is Indra by virtue of His supreme sovereignty; and wholesome and unwholesome kamma is also Indra, because there is no sovereignty of anyone over kamma.
Đức Thế Tôn, bậc Chánh Đẳng Giác, là Indra (chúa tể) do có quyền năng tối thượng; và nghiệp thiện ác cũng là Indra trong các nghiệp, vì không có ai có quyền năng tối thượng trong các nghiệp.
Tenevettha kammajanitāni indriyāni kusalākusalakammaṃ ulliṅgenti, tena ca siṭṭhānīti indaliṅgaṭṭhena indasiṭṭhaṭṭhena ca indriyāni.
Therefore, the indriyas generated by kamma here indicate wholesome and unwholesome kamma, and they are ordained by it, thus they are indriyas by reason of being a sign of Indra and by reason of being ordained by Indra.
Chính vì thế, các căn do nghiệp sinh ra ở đây biểu thị nghiệp thiện ác, và chúng được nghiệp đó sắp đặt, nên chúng là các căn theo nghĩa là dấu hiệu của Indra và được Indra sắp đặt.
Sabbāneva panetāni bhagavatā munindena yathābhūtato pakāsitāni abhisambuddhāni cāti indadesitaṭṭhena indadiṭṭhaṭṭhena ca indriyāni.
Furthermore, all these indriyas were revealed as they truly are and fully comprehended by the Blessed One, the King of Sages, thus they are indriyas by reason of being taught by Indra and by reason of being seen by Indra.
Và tất cả những căn này đều được Đức Thế Tôn, bậc chúa tể các bậc hiền trí, tuyên bố đúng như thật và được Ngài tự chứng ngộ, nên chúng là các căn theo nghĩa được Indra thuyết giảng và được Indra thấy biết.
Teneva ca bhagavatā munindena kānici gocarāsevanāya, kānici bhāvanāsevanāya sevitānīti indajuṭṭhaṭṭhenapi indriyāni.
And by that same Blessed One, the King of Sages, some were cultivated by way of resorting to objects, and some by way of cultivating, thus they are indriyas also by reason of being used by Indra.
Và chính Đức Thế Tôn, bậc chúa tể các bậc hiền trí, đã thọ dụng một số căn bằng cách tu tập đối tượng, và một số căn bằng cách tu tập thiền định, nên chúng cũng là các căn theo nghĩa được Indra thọ dụng.
Api ca ādhipaccasaṅkhātena issariyaṭṭhenapi etāni indriyāni.
Moreover, these are faculties (indriyāni) in the sense of supremacy, that is, in the sense of mastery.
Hơn nữa, những căn này cũng là các căn theo nghĩa là quyền năng tối thượng được gọi là sự chủ tể.
Cakkhuviññāṇādipavattiyañhi cakkhādīnaṃ siddhamādhipaccaṃ tasmiṃ tikkhe tikkhattā mande ca mandattāti.
For indeed, the supremacy of the eye and so forth is established in the occurrence of eye-consciousness and so forth, because when the faculty is keen, the consciousness is keen, and when it is dull, the consciousness is dull.
Thật vậy, trong sự vận hành của nhãn thức, v.v., quyền năng tối thượng của nhãn căn, v.v., đã được thiết lập, vì khi nó sắc bén thì nhãn thức, v.v., cũng sắc bén, và khi nó yếu thì nhãn thức, v.v., cũng yếu.
6. Paṭhamajjhānādīni dvādasa vissajjanāni jhānasamāpattivasena niddiṭṭhāni.
6. The twelve explanations beginning with Paṭhamajjhāna are set forth in terms of jhāna-samāpatti.
6. Mười hai sự giải thích về paṭhamajjhāna (sơ thiền) v.v., được chỉ ra theo phương diện thiền định (jhānasamāpatti).
Jhānanti idha brahmavihāramattaṃ adhippetaṃ.
Here, Jhāna is intended to mean only the Brahmavihāras.
Ở đây, từ Jhāna (thiền) chỉ có ý nghĩa là Phạm trú (brahmavihāra).
Vitakkavicārapītisukhacittekaggatāsampayuttaṃ paṭhamaṃ jhānaṃ.
The first jhāna is accompanied by initial application (vitakka), sustained application (vicāra), rapture (pīti), happiness (sukha), and one-pointedness of mind (cittekaggatā).
Thiền định đi kèm với tầm (vitakka), tứ (vicāra), hỷ (pīti), lạc (sukha), và nhất tâm (cittekaggatā) là paṭhamaṃ jhānaṃ (sơ thiền).
Pītisukhacittekaggatāsampayuttaṃ dutiyaṃ jhānaṃ.
The second jhāna is accompanied by rapture (pīti), happiness (sukha), and one-pointedness of mind (cittekaggatā).
Thiền định đi kèm với hỷ (pīti), lạc (sukha), và nhất tâm (cittekaggatā) là dutiyaṃ jhānaṃ (nhị thiền).
Sukhacittekaggatāsampayuttaṃ tatiyaṃ jhānaṃ.
The third jhāna is accompanied by happiness (sukha) and one-pointedness of mind (cittekaggatā).
Thiền định đi kèm với lạc (sukha) và nhất tâm (cittekaggatā) là tatiyaṃ jhānaṃ (tam thiền).
Upekkhācittekaggatāsampayuttaṃ catutthaṃ jhānaṃ.
The fourth jhāna is accompanied by equanimity (upekkhā) and one-pointedness of mind (cittekaggatā).
Thiền định đi kèm với xả (upekkhā) và nhất tâm (cittekaggatā) là catutthaṃ jhānaṃ (tứ thiền).
Pharaṇavasena natthi etassa antoti ananto.
There is no end to it in terms of pervasion, thus it is ananta (infinite).
Vì không có giới hạn về mặt lan tỏa, nên nó là vô biên (ananta).
Ākāso ananto ākāsānanto, kasiṇugghāṭimākāso.
Space is infinite, ākāsānanta; this is the space obtained by removing the kasiṇa.
Không gian là vô biên (ākāso ananto), không gian vô biên (ākāsānanto) là không gian được loại bỏ khỏi kasiṇa.
Ākāsānantoyeva ākāsānañcaṃ, taṃ ākāsānañcaṃ adhiṭṭhānaṭṭhena āyatanamassa sasampayuttadhammassa jhānassa ‘‘devānaṃ devāyatanamivā’’ti ākāsānañcāyatanaṃ.
The infinity of space itself is ākāsānañca. That ākāsānañca is the basis (āyatana) for its associated jhāna, like the abode of the devas is the devāyatana, thus ākāsānañcāyatana.
Chính không gian vô biên đó là vô biên xứ không gian (ākāsānañcaṃ). Vô biên xứ không gian đó là không vô biên xứ (ākāsānañcāyatanaṃ) đối với thiền và các pháp đồng sanh của nó, theo nghĩa là nền tảng, như là “nơi ở của các chư thiên”.
Ākāsānañcāyatanameva samāpatti ākāsānañcāyatanasamāpatti.
The attainment (samāpatti) of ākāsānañcāyatana itself is ākāsānañcāyatanasamāpatti.
Chính thiền không vô biên xứ là định không vô biên xứ (ākāsānañcāyatanasamāpatti).
Pharaṇavasena ca natthi etassa antoti anantaṃ, taṃ ākāsārammaṇaṃ viññāṇaṃ.
And there is no end to it in terms of pervasion, thus it is ananta; that is the consciousness with space as its object.
Và vì không có giới hạn về mặt lan tỏa, nên nó là vô biên (anantaṃ), đó là thức có không gian làm đối tượng.
Anantameva ānañcaṃ, viññāṇaṃ ānañcaṃ ‘‘viññāṇānañca’’nti avatvā ‘‘viññāṇañca’’nti vuttaṃ.
Ananta itself is ānañca. Consciousness is ānañca. It is said "viññāṇañca" instead of "viññāṇānañca".
Chính cái vô biên là vô biên xứ (ānañcaṃ). Thức là vô biên xứ (viññāṇaṃ ānañcaṃ), nhưng không nói “viññāṇānañcaṃ” mà nói “viññāṇañcaṃ”.
Ayañhettha ruḷhisaddo.
This is a conventional term here.
Đây là một thuật ngữ thông dụng ở đây.
Taṃ viññāṇañcaṃ adhiṭṭhānaṭṭhena āyatanamassa sasampayuttadhammassa jhānassa ‘‘devānaṃ devāyatanamivā’’ti viññāṇañcāyatanaṃ.
That consciousness (viññāṇañca) is the basis (āyatana) for its associated jhāna, like the abode of the devas is the devāyatana, thus viññāṇañcāyatana.
Thức vô biên xứ đó là thức vô biên xứ (viññāṇañcāyatanaṃ) đối với thiền và các pháp đồng sanh của nó, theo nghĩa là nền tảng, như là “nơi ở của các chư thiên”.
Natthi etassa kiñcananti akiñcanaṃ, antamaso bhaṅgamattampi assa avasiṭṭhaṃ natthīti vuttaṃ hoti.
There is nothing whatsoever in it, thus it is akiñcana; it means that not even a trace of dissolution remains in it.
Không có bất cứ thứ gì của nó là vô sở hữu (akiñcanaṃ), nghĩa là không còn dù chỉ là một chút hủy diệt.
Akiñcanassa bhāvo ākiñcaññaṃ.
The state of having nothing is ākiñcañña.
Trạng thái vô sở hữu là vô sở hữu xứ (ākiñcaññaṃ).
Ākāsānañcāyatanaviññāṇābhāvassetaṃ adhivacanaṃ.
This is a designation for the non-existence of the consciousness of the base of infinite space.
Đây là tên gọi của sự không tồn tại của thức không vô biên xứ.
Taṃ ākiñcaññaṃ.
That is ākiñcañña.
Vô sở hữu xứ đó.
Adhiṭṭhānaṭṭhena āyatanamassa sasampayuttadhammassa jhānassa ‘‘devānaṃ devāyatanamivā’’ti ākiñcaññāyatanaṃ.
By way of being a basis, it is a base for that jhāna and its associated phenomena, just as "the abode of the devas" is a base for devas; thus it is the base of nothingness (ākiñcaññāyatana).
Nó là vô sở hữu xứ (ākiñcaññāyatanaṃ) đối với thiền và các pháp đồng sanh của nó, theo nghĩa là nền tảng, như là “nơi ở của các chư thiên”.
Oḷārikāya saññāya abhāvato, sukhumāya ca bhāvato nevassa sasampayuttadhammassa jhānassa saññā nāsaññāti nevasaññānāsaññaṃ.
Because gross perception is absent and subtle perception is present, the perception of that jhāna and its associated phenomena is neither perception nor non-perception; it is nevasaññānāsañña.
Vì không có tưởng thô và có tưởng vi tế, nên đối với thiền và các pháp đồng sanh của nó, tưởng không phải là tưởng và cũng không phải là phi tưởng, đó là phi tưởng phi phi tưởng (nevasaññānāsaññaṃ).
Nevasaññānāsaññañca taṃ manāyatanadhammāyatanapariyāpannattā āyatanañcāti nevasaññānāsaññāyatanaṃ.
And since that nevasaññānāsañña is included within the mind-base and the phenomenon-base, it is also a base; thus it is the base of neither perception nor non-perception (nevasaññānāsaññāyatana).
Và vì phi tưởng phi phi tưởng đó được bao gồm trong ý xứ và pháp xứ, nên nó là xứ, đó là phi tưởng phi phi tưởng xứ (nevasaññānāsaññāyatanaṃ).
Atha vā yāyamettha saññā sā paṭusaññākiccaṃ kātuṃ asamatthatāya nevasaññā, saṅkhārāvasesasukhumabhāvena vijjamānattā nāsaññāti nevasaññānāsaññā, nevasaññānāsaññā ca sā sesadhammānaṃ adhiṭṭhānaṭṭhena āyatanañcāti nevasaññānāsaññāyatanaṃ.
Alternatively, the perception here is neither perception because it is unable to perform the function of gross perception, and it is not non-perception because it exists as a subtle remainder of formations; thus it is nevasaññānāsañña. And because that nevasaññānāsañña is a base by way of being a foundation for the remaining phenomena, it is also a base; thus it is the nevasaññānāsaññāyatana.
Hoặc, tưởng ở đây, vì không có khả năng thực hiện chức năng của tưởng thô, nên là phi tưởng (nevasaññā), và vì tồn tại ở trạng thái vi tế còn lại của các hành (saṅkhāra), nên là phi phi tưởng (nāsaññā), do đó là phi tưởng phi phi tưởng (nevasaññānāsaññā). Và vì phi tưởng phi phi tưởng đó là xứ đối với các pháp còn lại theo nghĩa là nền tảng, nên là phi tưởng phi phi tưởng xứ (nevasaññānāsaññāyatanaṃ).
Ākiñcaññāyatanārammaṇāya samāpattiyā etaṃ adhivacanaṃ.
This is a designation for the attainment whose object is the base of nothingness.
Đây là tên gọi của sự thành tựu có vô sở hữu xứ làm đối tượng.
Na kevalaṃ ettha saññā edisī, atha kho vedanāpi nevavedanā nāvedanā.
Not only is perception of this nature here, but feeling is also neither feeling nor non-feeling.
Không chỉ tưởng ở đây là như vậy, mà thọ (vedanā) cũng không phải là thọ và cũng không phải là phi thọ.
Cittampi nevacittaṃ nācittaṃ.
Consciousness is also neither consciousness nor non-consciousness.
Tâm (citta) cũng không phải là tâm và cũng không phải là phi tâm.
Phassopi nevaphasso nāphasso.
Contact is also neither contact nor non-contact.
Xúc (phassa) cũng không phải là xúc và cũng không phải là phi xúc.
Esa nayo sesasampayuttadhammesu.
This method applies to the remaining associated phenomena.
Điều này cũng áp dụng cho các pháp đồng sanh còn lại.
Saññāsīsena panāyaṃ desanā katāti.
But this teaching is given with perception as the leading factor.
Tuy nhiên, bài giảng này được thực hiện với tưởng là chủ yếu.
Avijjādīni dvādasa vissajjanāni paṭiccasamuppādaṅgavasena niddiṭṭhāni.
The twelve explanations, beginning with ignorance (avijjā), are set forth in terms of the factors of dependent origination.
Mười hai lời giải thích từ vô minh (avijjā) v.v... được trình bày theo các chi phần của duyên khởi (paṭiccasamuppāda).
Pūretuṃ ayuttaṭṭhena kāyaduccaritādi avindiyaṃ nāma, aladdhabbanti attho.
That which is not fit to be fulfilled, such as bodily misconduct, is called avindiyaṃ, meaning that which cannot be obtained.
Những điều không nên đạt được, như ác hạnh thân v.v..., được gọi là avindiyaṃ, nghĩa là không thể đạt được.
Taṃ avindiyaṃ vindatīti avijjā.
It obtains that which is avindiyaṃ, therefore it is ignorance (avijjā).
Người đạt được điều không nên đạt được đó là vô minh (avijjā).
Tabbiparītato kāyasucaritādi vindiyaṃ nāma, taṃ vindiyaṃ na vindatīti avijjā.
Conversely, that which is fit to be obtained, such as bodily good conduct, is called vindiyaṃ, but it does not obtain that vindiyaṃ; therefore it is ignorance.
Ngược lại, thiện hạnh thân v.v... được gọi là vindiyaṃ (điều nên đạt được); người không đạt được điều nên đạt được đó là vô minh.
Khandhānaṃ rāsaṭṭhaṃ, āyatanānaṃ āyatanaṭṭhaṃ, dhātūnaṃ suññaṭṭhaṃ, indriyānaṃ adhipatiyaṭṭhaṃ, saccānaṃ tathaṭṭhaṃ aviditaṃ karotīti avijjā.
It makes unknown the nature of aggregates as heaps, the nature of sense bases as extensions, the nature of elements as empty, the nature of faculties as dominant, and the nature of truths as they are; therefore it is ignorance.
Vô minh là thứ làm cho không biết nghĩa của các uẩn (khandha) là sự tích tụ, nghĩa của các xứ (āyatana) là nơi phát sinh, nghĩa của các giới (dhātu) là trống rỗng, nghĩa của các quyền (indriya) là chủ tể, và nghĩa của các sự thật (sacca) là chân thật.
Dukkhādīnaṃ pīḷanādivasena vuttaṃ catubbidhaṃ catubbidhaṃ atthaṃ aviditaṃ karotītipi avijjā, antavirahite saṃsāre sabbayonigatibhavaviññāṇaṭṭhitisattāvāsesu satte javāpetīti avijjā, paramatthato avijjamānesu itthipurisādīsu javati, vijjamānesupi khandhādīsu na javatīti avijjā, api ca cakkhuviññāṇādīnaṃ vatthārammaṇānaṃ paṭiccasamuppādapaṭiccasamuppannānañca dhammānaṃ chādanatopi avijjā.
It also makes unknown the fourfold meaning of suffering, etc., as oppression, etc.; therefore it is ignorance. It causes beings to run through all wombs, destinies, existences, stations of consciousness, and abodes of beings in a beginningless saṃsāra; therefore it is ignorance. It runs in things that are ultimately non-existent, such as men and women, but does not run in things that are existent, such as aggregates; therefore it is ignorance. Furthermore, it is ignorance because it obscures the bases and objects of eye-consciousness, etc., and the phenomena that are dependently arisen through dependent origination.
Vô minh cũng là thứ làm cho không biết bốn loại ý nghĩa của khổ (dukkha) v.v... được nói đến theo cách áp bức v.v...; vô minh là thứ thúc đẩy chúng sanh trong luân hồi (saṃsāra) vô tận đến tất cả các loài, cảnh giới, hữu, thức trú và nơi ở của chúng sanh; vô minh là thứ thúc đẩy chúng sanh đến những điều không tồn tại trong ý nghĩa tối hậu như nam nữ v.v..., nhưng không thúc đẩy đến các uẩn v.v... đang tồn tại; và vô minh cũng là sự che đậy các đối tượng và căn của nhãn thức v.v..., cũng như các pháp duyên khởi và các pháp do duyên khởi sinh.
Saṅkhatamabhisaṅkharontīti saṅkhārā.
They fashion the conditioned; therefore they are formations (saṅkhārā).
Những thứ tạo tác các pháp hữu vi (saṅkhata) được gọi là các hành (saṅkhārā).
Vijānātīti viññāṇaṃ.
It cognizes; therefore it is consciousness (viññāṇaṃ).
Thức tri là thức (viññāṇaṃ).
Namatīti nāmaṃ, nāmayatīti vā nāmaṃ.
It inclines, or it causes to incline; therefore it is name (nāmaṃ).
Nó nghiêng về (namati) hoặc làm cho nghiêng về (nāmayati), đó là danh (nāmaṃ).
Ruppatīti rūpaṃ.
It is afflicted; therefore it is form (rūpaṃ).
Nó biến hoại (ruppati), đó là sắc (rūpaṃ).
Āye tanoti, āyatañca nayatīti āyatanaṃ.
It extends to the sphere, or it leads to the extended; therefore it is base (āyatanaṃ).
Nó mở rộng (tanoti) đến các căn (āya), và nó dẫn đến (nayati) sự mở rộng (āyata), đó là xứ (āyatanaṃ).
Phusatīti phasso.
It contacts; therefore it is contact (phasso).
Nó xúc chạm (phusati), đó là xúc (phasso).
Vedayatīti vedanā.
It feels; therefore it is feeling (vedanā).
Nó cảm thọ (vedayati), đó là thọ (vedanā).
Paritassatīti taṇhā.
It trembles greatly; therefore it is craving (taṇhā).
Nó khát khao (paritassati), đó là ái (taṇhā).
Upādiyati bhusaṃ gaṇhātīti upādānaṃ.
It grasps firmly; therefore it is clinging (upādānaṃ).
Nó bám víu mạnh mẽ (upādiyati bhusaṃ gaṇhāti), đó là thủ (upādānaṃ).
Bhavati, bhāvayatīti vā bhavo.
It exists, or it causes to exist; therefore it is existence (bhavo).
Nó tồn tại (bhavati) hoặc làm cho tồn tại (bhāvayati), đó là hữu (bhavo).
Jananaṃ jāti.
Generating is birth (jāti).
Sự sinh ra là sinh (jāti).
Jīraṇaṃ jarā.
Decaying is old age (jarā).
Sự già đi là già (jarā).
Maranti etenāti maraṇaṃ.
They die by this; therefore it is death (maraṇaṃ).
Người ta chết bởi nó, đó là chết (maraṇaṃ).
7. Dukkhādīni aṭṭhasatāni aṭṭha ca vissajjanāni catusaccayojanāvasena niddiṭṭhāni.
The eight hundred and eight explanations, beginning with suffering (dukkha), are set forth in terms of the fourfold conjunction of truths.
7. Tám trăm lẻ tám lời giải thích về khổ (dukkha) v.v... được trình bày theo cách kết hợp với bốn chân lý.
‘‘Dukkhaṃ abhiññeyya’’ntiādīsu hi channaṃ catukkānaṃ vasena catuvīsati vissajjanāni ‘‘cakkhu jarāmaraṇa’’nti peyyāle ‘‘cakkhu abhiññeyyaṃ sotaṃ abhiññeyya’’ntiādinā ‘‘jāti abhiññeyyā’’ti pariyosānena pañcanavutādhikena vissajjanasatena yojetvā vuttāni.
Indeed, in phrases like "Suffering is to be fully understood," twenty-four explanations are given by way of six tetrads, and by way of the peyyāla (summary) starting with "The eye is to be fully understood, the ear is to be fully understood," and concluding with "Birth is to be fully understood," one hundred and ninety-five explanations are given.
Trong các câu như “Khổ cần phải được thắng tri (abhiññeyya)” v.v..., hai mươi bốn lời giải thích theo sáu nhóm bốn được kết hợp với một trăm chín mươi lăm lời giải thích, bắt đầu từ “mắt cần phải được thắng tri, tai cần phải được thắng tri” v.v... trong phần “mắt, già, chết” và kết thúc bằng “sinh cần phải được thắng tri”.
Pañcanavutādhikaṃ catukkasataṃ hoti, tesaṃ catukkānaṃ vasena asītiadhikāni satta vissajjanasatāni.
This makes one hundred and ninety-five tetrads, and by way of these tetrads, there are seven hundred and eighty explanations.
Một trăm chín mươi lăm nhóm bốn; theo đó, bảy trăm tám mươi lời giải thích.
‘‘Jarāmaraṇaṃ abhiññeyya’’ntiādike catukke ‘‘cattāri vissajjanānī’’ti evaṃ sabbāni aṭṭha ca satāni aṭṭha ca vissajjanāni honti.
And in the tetrad beginning with "Old age-and-death is to be fully understood," there are "four explanations." In this way, there are altogether eight hundred and eight explanations.
Trong nhóm bốn như “già và chết cần phải được thắng tri” v.v..., có bốn lời giải thích, như vậy tổng cộng có tám trăm lẻ tám lời giải thích.
Ettha ca tassa tassa dhammassa padhānabhūto paccayo samudayoti veditabbo.
And here, the predominant condition for each phenomenon is to be understood as the origin (samudaya).
Ở đây, cần phải hiểu rằng nhân chính yếu của mỗi pháp đó là tập (samudaya).
Sabbasaṅkhārehi suññaṃ nibbānaṃ nirodhoti veditabbaṃ.
Nibbāna, which is empty of all formations, is to be understood as cessation (nirodha).
Niết bàn (nibbāna), trống rỗng khỏi tất cả các hành (saṅkhāra), cần phải được hiểu là diệt (nirodha).
Anaññātaññassāmītindriyādīnaṃ tiṇṇampi hi lokuttarindriyānaṃ ettha abhāvaṃ sandhāya anaññātaññassāmītindriyanirodhotiādi yujjati.
The phrase "cessation of the faculty of I-shall-know-the-unknown," etc., is appropriate here, referring to the absence of all three supramundane faculties, namely, anaññātaññassāmītindriya, aññindriya, and aññātāvīndriya.
Việc nói “sự diệt của quyền vị chưa biết sẽ biết” (anaññātaññassāmītindriyanirodha) v.v... là phù hợp, vì nó đề cập đến sự vắng mặt của ba quyền vị siêu thế (lokuttarindriya) ở đây.
Nirodhagāminipaṭipadāti ca sabbattha ariyamaggo eva.
And the path leading to cessation (nirodhagāminipaṭipadā) is always the Noble Path itself.
Và con đường dẫn đến diệt (nirodhagāminipaṭipadā) ở khắp mọi nơi chính là Bát Chánh Đạo (ariyamagga).
Evañhi vuccamāne phalepi maggavohārasambhavato aññindriyaaññātāvindriyānampi yujjati.
Indeed, if it is said thus, then even in the fruit (phala), due to the possibility of the designation 'path' (magga), it is applicable also for the faculties of aññindriya and aññātāvindriya.
Nếu nói như vậy, thì việc gọi quả (phala) là đạo (magga) cũng có thể xảy ra, và nó cũng phù hợp với các quyền vị như aññindriya và aññātāvindriya.
Puna dukkhādīnaṃ pariññaṭṭhādivasena aṭṭhasatāni aṭṭha ca vissajjanāni niddiṭṭhāni, puna dukkhādīnaṃ pariññāpaṭivedhaṭṭhādivasena aṭṭhasatāni aṭṭha ca vissajjanāni niddiṭṭhāni.
Again, eight hundred and eight explanations have been specified in terms of the full understanding (pariññāṭṭha) of suffering, etc. Again, eight hundred and eight explanations have been specified in terms of the full understanding and penetration (pariññāpaṭivedhaṭṭha) of suffering, etc.
Lại nữa, tám trăm lẻ tám lời giải thích về khổ v.v... được trình bày theo nghĩa cần được thắng tri (pariññāṭṭha) v.v..., và lại nữa, tám trăm lẻ tám lời giải thích về khổ v.v... được trình bày theo nghĩa cần được thắng tri và chứng ngộ (pariññāpaṭivedhaṭṭha) v.v...
Pariññā ca sā paṭivijjhitabbaṭṭhena paṭivedho cāti pariññāpaṭivedho.
And this full understanding (pariññā) is also penetration (paṭivedha) in the sense of being penetrable; thus, it is pariññāpaṭivedha.
Sự thắng tri (pariññā) đó, vì cần được chứng ngộ (paṭivijjhitabbaṭṭhena), nên cũng là sự chứng ngộ (paṭivedho), do đó là thắng tri và chứng ngộ (pariññāpaṭivedho).
Pariññāpaṭivedhova attho pariññāpaṭivedhaṭṭho.
The meaning of pariññāpaṭivedha itself is pariññāpaṭivedhaṭṭha.
Chính nghĩa của thắng tri và chứng ngộ là nghĩa của thắng tri và chứng ngộ (pariññāpaṭivedhaṭṭho).
8. Puna tāneva dukkhādīni jarāmaraṇapariyantāni dviadhikāni dve padasatāni samudayādīhi sattahi sattahi padehi yojetvā dviadhikānaṃ dvinnaṃ aṭṭhakasatānaṃ vasena sahassañca cha ca satāni soḷasa ca vissajjanāni niddiṭṭhāni.
8. Again, those same two hundred and two terms, from suffering up to aging-and-death, when combined with seven terms each, such as origination (samudaya), yield one thousand six hundred and sixteen explanations, in terms of two hundred and two octads.
8. Lại nữa, chính những pháp khổ v.v... đó, kết thúc bằng già và chết, tức là hai trăm lẻ hai từ, được kết hợp với bảy từ mỗi loại như tập (samudaya) v.v..., và một ngàn sáu trăm mười sáu lời giải thích được trình bày theo hai trăm lẻ hai nhóm tám.
Tattha padhānabhūto paccayo samudayo, tassa nirodho samudayanirodho.
Among these, the primary cause (paccaya) is origination (samudaya); its cessation is samudayanirodha (cessation of origination).
Trong đó, nhân chính yếu là tập (samudaya), sự diệt của nó là tập diệt (samudayanirodho).
Chando eva rāgo chandarāgo, dukkhe sukhasaññāya dukkhassa chandarāgo, tassa nirodho chandarāganirodho.
Desire (chanda) itself is passion (rāga), hence chandarāga. The chandarāga for suffering, which arises from the perception of pleasure in suffering, is dukkhassa chandarāga (desire-passion for suffering); its cessation is chandarāganirodha (cessation of desire-passion).
Chính dục (chanda) là tham (rāga), dục tham (chandarāgo). Dục tham của khổ là sự nhận thức lạc trong khổ; sự diệt của nó là dục tham diệt (chandarāganirodho).
Dukkhaṃ paṭicca uppajjamānaṃ sukhaṃ somanassaṃ dukkhassa assādo.
The pleasure (sukha) and joy (somanassa) that arise dependent on suffering is dukkhassa assādo (the gratification of suffering).
Lạc và hỷ sinh khởi nương vào khổ là vị ngọt của khổ (dukkhassa assādo).
Dukkhassa aniccatā dukkhassa vipariṇāmadhammatā dukkhassa ādīnavo.
The impermanence (aniccatā) of suffering, the nature of suffering to undergo change (vipariṇāmadhammatā), is dukkhassa ādīnavo (the danger of suffering).
Tính vô thường của khổ, tính biến hoại của khổ là sự nguy hiểm của khổ (dukkhassa ādīnavo).
Dukkhe chandarāgavinayo chandarāgappahānaṃ dukkhassa nissaraṇaṃ.
The removal of desire-passion (chandarāgavinayo) for suffering, the abandoning of desire-passion (chandarāgappahānaṃ), is dukkhassa nissaraṇaṃ (the escape from suffering).
Sự điều phục dục tham trong khổ, sự đoạn trừ dục tham là sự thoát ly khỏi khổ (dukkhassa nissaraṇaṃ).
‘‘Yaṃ kho pana kiñci bhūtaṃ saṅkhataṃ paṭiccasamuppannaṃ nirodho tassa nissaraṇa’’nti (paṭi. ma. 1.24) vacanato nibbānameva dukkhassa nissaraṇaṃ.
As it is said, "Whatever is existent, conditioned, dependently arisen, its cessation is the escape from it," Nibbāna itself is the escape from suffering.
“Bất cứ pháp nào là hữu thể, hữu vi, duyên sinh, sự diệt trừ của nó chính là sự giải thoát.” Theo lời dạy này, chỉ Nibbāna mới là sự giải thoát khỏi khổ.
‘‘Dukkhanirodho samudayanirodho chandarāganirodho dukkhassa nissaraṇa’’nti nānāsaṅkhatapaṭipakkhavasena nānāpariyāyavacanehi catūsu ṭhānesu nibbānameva vuttanti veditabbaṃ.
It should be understood that in these four instances—"cessation of suffering," "cessation of origination," "cessation of desire-passion," and "escape from suffering"—Nibbāna itself is spoken of through various synonymous terms, in opposition to various conditioned phenomena.
Cần phải hiểu rằng, trong bốn trường hợp, Nibbāna đã được nói đến bằng các từ đồng nghĩa khác nhau như ‘Dukkhanirodha’ (sự diệt khổ), ‘Samudayanirodha’ (sự diệt tập), ‘Chandarāganirodha’ (sự diệt tham ái), ‘Dukkhassa Nissaraṇa’ (sự giải thoát khỏi khổ), tùy theo sự đối lập với các pháp hữu vi khác nhau.
Keci pana ‘‘āhārasamudayā dukkhasamudayo āhāranirodhā dukkhanirodho sarasavasena samudayanirodho, atha vā udayabbayadassanena samudayanirodho saha vipassanāya maggo chandarāganirodho’’ti vadanti.
Some, however, say: "The origination of suffering is due to the origination of nutriment (āhāra); the cessation of suffering is due to the cessation of nutriment. The cessation of origination (samudayanirodha) is in terms of its own function (sarasavasena), or else, the cessation of origination is through the perception of rise and fall (udayabbayadassana). The path (magga) accompanied by insight (vipassanā) is the cessation of desire-passion (chandarāganirodha)."
Tuy nhiên, một số người nói rằng: “Sự tập khởi của khổ là do sự tập khởi của vật thực; sự diệt trừ của khổ là do sự diệt trừ của vật thực, tức là sự diệt trừ của tập khởi theo bản chất của nó. Hoặc, sự diệt trừ của tập khởi là do sự thấy sự sinh diệt, và con đường cùng với tuệ quán là sự diệt trừ của tham ái.”
Evañca vuccamāne lokuttarindriyānaṃ avipassanūpagattā na sabbasādhāraṇaṃ hotīti paṭhamaṃ vuttanayova gahetabbo.
If it is said thus, it would not be universally applicable, because the supramundane faculties (lokuttarindriya) do not involve insight; therefore, the method stated first should be adopted.
Nếu nói như vậy, thì nó sẽ không phổ biến cho tất cả các căn siêu thế, vì chúng không thuộc về tuệ quán. Do đó, cách nói đã được trình bày trước đó mới là điều cần được chấp nhận.
Lokuttarindriyesu hi chandarāgābhāvatoyeva chandarāganirodhoti yujjati.
Indeed, in the supramundane faculties, the cessation of desire-passion is applicable precisely because there is no desire-passion.
Thật vậy, trong các căn siêu thế, sự diệt trừ của tham ái là hợp lý chỉ vì không có tham ái.
Sarīre chandarāgeneva sarīrekadesesu kesādīsupi chandarāgo katova hoti, jarāmaraṇavantesu chandarāgeneva jarāmaraṇesupi chandarāgo katova hoti.
Just as there is desire-passion for the body, so too is desire-passion created for parts of the body such as hair, etc.; just as there is desire-passion for phenomena ending in aging-and-death, so too is desire-passion created for aging-and-death itself.
Khi có tham ái đối với thân, thì cũng có tham ái đối với các bộ phận của thân như tóc, v.v. Khi có tham ái đối với các pháp có già chết, thì cũng có tham ái đối với già chết.
Evaṃ assādādīnavāpi yojetabbā.
Similarly, gratification (assāda) and danger (ādīnava) should also be understood.
Tương tự, sự vị ngọt (assāda) và sự nguy hiểm (ādīnava) cũng nên được kết hợp.
Puna dukkhādīni jarāmaraṇapariyantāni dviadhikāni dve padasatāni samudayādīhi chahi chahi padehi yojetvā dviadhikānaṃ dvinnaṃ sattakasatānaṃ vasena nayasahassañca cattāri ca satāni cuddasa ca vissajjanāni niddiṭṭhāni.
Again, those two hundred and two terms, from suffering up to aging-and-death, when combined with six terms each, such as origination, yield one thousand four hundred and fourteen explanations, in terms of two hundred and two heptads.
Hơn nữa, hai trăm hai pháp từ khổ cho đến già chết, khi được kết hợp với sáu pháp từ tập khởi, v.v., đã được trình bày thành một ngàn bốn trăm mười bốn câu trả lời theo cách hai trăm bảy bộ.
9. Idāni rūpādīni jarāmaraṇapariyantāni ekādhikāni dve padasatāni sattahi anupassanāhi yojetvā niddisituṃ paṭhamaṃ tāva aniccānupassanādayo satta anupassanā niddiṭṭhā.
9. Now, to specify the two hundred and one terms, from form (rūpa) up to aging-and-death, when combined with the seven contemplations (anupassanā), first, the seven contemplations, such as contemplation of impermanence, are specified.
9. Bây giờ, để trình bày hai trăm mốt pháp từ sắc (rūpa) cho đến già chết khi được kết hợp với bảy phép quán chiếu (anupassanā), trước hết, bảy phép quán chiếu như vô thường quán (anicca-anupassanā) đã được trình bày.
Tāni sabbāni sattahi suddhikaanupassanāvissajjanehi saddhiṃ sahassañca cattāri ca satāni cuddasa ca vissajjanāni honti.
All of these, together with the seven pure contemplation explanations, amount to one thousand four hundred and fourteen explanations.
Tất cả những điều đó, cùng với một ngàn bốn trăm mười bốn câu trả lời của bảy phép quán chiếu thuần túy, sẽ là một ngàn bốn trăm mười bốn câu trả lời.
Aniccanti anupassanā aniccānupassanā.
The contemplation that it is impermanent is aniccānupassanā (contemplation of impermanence).
Sự quán chiếu rằng “vô thường” là vô thường quán (aniccānupassanā).
Sā niccasaññāpaṭipakkhā.
This is the opposite of the perception of permanence.
Nó đối lập với thường tưởng (niccasaññā).
Dukkhanti anupassanā dukkhānupassanā.
The contemplation that it is suffering is dukkhānupassanā (contemplation of suffering).
Sự quán chiếu rằng “khổ” là khổ quán (dukkhānupassanā).
Sā sukhasaññāpaṭipakkhā.
This is the opposite of the perception of pleasure.
Nó đối lập với lạc tưởng (sukhasaññā).
Anattāti anupassanā anattānupassanā.
The contemplation that it is non-self is anattānupassanā (contemplation of non-self).
Sự quán chiếu rằng “vô ngã” là vô ngã quán (anattānupassanā).
Sā attasaññāpaṭipakkhā.
This is the opposite of the perception of self.
Nó đối lập với ngã tưởng (attasaññā).
Tissannaṃ anupassanānaṃ paripūrattā nibbindatīti nibbidā, nibbidā ca sā anupassanā cāti nibbidānupassanā.
Due to the completion of the three contemplations, one becomes weary (nibbindati); this weariness is also contemplation, hence nibbidānupassanā (contemplation of weariness).
Do sự hoàn thiện của ba phép quán chiếu, người ta nhàm chán, nên gọi là sự nhàm chán (nibbidā). Sự nhàm chán đó và phép quán chiếu đó là nhàm chán quán (nibbidānupassanā).
Sā nandipaṭipakkhā.
This is the opposite of delight (nandi).
Nó đối lập với sự hoan hỷ (nandi).
Catassannaṃ anupassanānaṃ paripūrattā virajjatīti virāgo, virāgo ca so anupassanā cāti virāgānupassanā.
Due to the completion of the four contemplations, one becomes dispassionate (virajjati); this dispassion is also contemplation, hence virāgānupassanā (contemplation of dispassion).
Do sự hoàn thiện của bốn phép quán chiếu, người ta ly tham, nên gọi là sự ly tham (virāga). Sự ly tham đó và phép quán chiếu đó là ly tham quán (virāgānupassanā).
Sā rāgapaṭipakkhā.
This is the opposite of passion (rāga).
Nó đối lập với tham ái (rāga).
Pañcannaṃ anupassanānaṃ paripūrattā rāgaṃ nirodhetīti nirodho, nirodho ca so anupassanā cāti nirodhānupassanā.
Due to the completion of the five contemplations, one ceases passion (rāgaṃ nirodheti); this cessation is also contemplation, hence nirodhānupassanā (contemplation of cessation).
Do sự hoàn thiện của năm phép quán chiếu, người ta diệt trừ tham ái, nên gọi là sự diệt trừ (nirodha). Sự diệt trừ đó và phép quán chiếu đó là diệt trừ quán (nirodhānupassanā).
Sā samudayapaṭipakkhā.
This is the opposite of origination (samudaya).
Nó đối lập với sự tập khởi (samudaya).
Channaṃ anupassanānaṃ paripūrattā paṭinissajjatīti paṭinissaggo, paṭinissaggo ca so anupassanā cāti paṭinissaggānupassanā.
Due to the completion of the six contemplations, one relinquishes, therefore it is relinquishment (paṭinissagga). And that relinquishment is also contemplation, thus it is contemplation of relinquishment (paṭinissaggānupassanā).
Do sự hoàn thiện của sáu phép quán chiếu, người ta từ bỏ, nên gọi là sự từ bỏ (paṭinissagga). Sự từ bỏ đó và phép quán chiếu đó là từ bỏ quán (paṭinissaggānupassanā).
Sā ādānapaṭipakkhā.
That is the opposite of clinging.
Nó đối lập với sự chấp thủ (ādāna).
Lokuttarindriyānaṃ asatipi vipassanūpagatte ‘‘sabbe saṅkhārā aniccā, sabbe saṅkhārā dukkhā, sabbe dhammā anattā’’ti (dha. pa. 277-279; paṭi. ma. 1.31) vacanato tesampi aniccadukkhānattattā tattha niccasukhattasaññānaṃ nandiyā rāgassa ca abhāvā nirodhavantānīti anupassanato pariccāgapaṭinissaggapakkhandanapaṭinissaggasambhavato ca tehipi satta anupassanā yojitāti veditabbā.
Even though the supramundane faculties are not subject to vipassanā, it should be understood that the seven contemplations are also applied to them because, by the saying, “All conditioned phenomena are impermanent, all conditioned phenomena are suffering, all phenomena are non-self,” they too are impermanent, suffering, and non-self; and because there is no perception of permanence, happiness, or self, no delight, and no passion in them, they possess cessation, and because of the arising of relinquishment (pariccāga), abandoning (paṭinissagga), plunging (pakkhandana), and giving up (paṭinissagga) through contemplation.
Mặc dù các căn siêu thế không thuộc về tuệ quán, nhưng vì tất cả các hành là vô thường, tất cả các hành là khổ, tất cả các pháp là vô ngã, nên các căn siêu thế ấy cũng có tính vô thường, khổ, vô ngã. Do không có thường tưởng, lạc tưởng, ngã tưởng, hoan hỷ và tham ái ở đó, và do có sự diệt trừ (nirodha) và sự từ bỏ (pariccāga), sự buông bỏ (paṭinissagga), sự nhảy vào (pakkhandana), sự từ bỏ (paṭinissagga) phát sinh từ sự quán chiếu, nên cần phải hiểu rằng bảy phép quán chiếu này cũng được kết hợp với chúng.
Jarāmaraṇavantesu aniccādito diṭṭhesu jarāmaraṇampi aniccādito diṭṭhaṃ nāma hoti, jarāmaraṇavantesu nibbindanto virajjanto jarāmaraṇe nibbinno ca viratto ca hoti, jarāmaraṇavantesu nirodhato diṭṭhesu jarāmaraṇampi nirodhato diṭṭhaṃ nāma hoti, jarāmaraṇavantesu paṭinissajjanto jarāmaraṇaṃ paṭinissajjantova hotīti jarāmaraṇehi satta anupassanā yojitāti veditabbā.
When old age and death are seen as impermanent and so on in things that are subject to old age and death, old age and death are also seen as impermanent and so on. When one becomes dispassionate and disenchanted with things that are subject to old age and death, one is disenchanted and dispassionate with old age and death. When things subject to old age and death are seen as ceasing, old age and death are also seen as ceasing. When one relinquishes things subject to old age and death, one is indeed relinquishing old age and death. Thus, it should be understood that the seven contemplations are applied to old age and death.
Khi già chết và các pháp có già chết được quán chiếu là vô thường, v.v., thì già chết cũng được quán chiếu là vô thường, v.v. Khi nhàm chán và ly tham đối với các pháp có già chết, thì cũng nhàm chán và ly tham đối với già chết. Khi già chết và các pháp có già chết được quán chiếu là diệt trừ, thì già chết cũng được quán chiếu là diệt trừ. Khi từ bỏ các pháp có già chết, thì cũng là từ bỏ già chết. Do đó, cần phải hiểu rằng bảy phép quán chiếu được kết hợp với già chết.
10. Idāni ādīnavañāṇassa vatthubhūtānaṃ uppādādīnaṃ pañcannaṃ ārammaṇānaṃ vasena uppādādīni tesaṃ vevacanāni pañcadasa vissajjanāni niddiṭṭhāni, santipadañāṇassa tappaṭipakkhārammaṇavasena anuppādādīni pañcadasa vissajjanāni niddiṭṭhāni, puna tāneva uppādānuppādādīni padāni yugaḷakavasena yojetvā tiṃsa vissajjanāni niddiṭṭhāni.
10. Now, fifteen explanations, namely arising (uppāda) and so on, which are synonyms for the five objects of the knowledge of disadvantages (ādīnavañāṇa) — namely, arising and so on — have been designated. Fifteen explanations, namely non-arising (anuppāda) and so on, have been designated as objects opposite to the knowledge of the peaceful state (santipadañāṇa). Again, the same terms, arising and non-arising and so on, have been designated as thirty explanations by combining them in pairs.
10. Bây giờ, mười lăm câu trả lời về sự sinh khởi (uppāda) và các từ đồng nghĩa của chúng đã được trình bày theo năm đối tượng làm nền tảng cho trí tuệ về sự nguy hiểm (ādīnavañāṇa). Mười lăm câu trả lời về sự không sinh khởi (anuppāda) và các pháp tương tự đã được trình bày theo đối tượng đối lập của trí tuệ về sự an tịnh (santipadañāṇa). Hơn nữa, những từ này như sự sinh khởi và sự không sinh khởi, v.v., khi được kết hợp theo cặp, đã được trình bày thành ba mươi câu trả lời.
Evaṃ imasmiṃ nayeva saṭṭhi vissajjanāni honti.
Thus, in this method alone, there are sixty explanations.
Như vậy, chỉ trong phương pháp này đã có sáu mươi câu trả lời.
Tattha uppādoti purimakammapaccayā idha uppatti.
Among these, arising (uppāda) is the origination here due to past kamma as a condition.
Trong đó, sự sinh khởi (uppāda) là sự sinh ra ở đây do các nhân duyên của nghiệp quá khứ.
Pavattanti tathāuppannassa pavatti.
Continuance (pavatta) is the continuance of what has thus arisen.
Sự tiếp diễn (pavatta) là sự tiếp diễn của những gì đã sinh ra như vậy.
Nimittanti sabbampi saṅkhāranimittaṃ.
Sign (nimitta) is all conditioned phenomena as a sign.
Tướng (nimitta) là tất cả các tướng hữu vi.
Yogāvacarassa hi saṅkhārā sasaṇṭhānā viya upaṭṭhahanti, tasmā nimittanti vuccanti.
Indeed, for the yogi, conditioned phenomena appear as if they have their own forms; therefore, they are called signs.
Đối với hành giả thiền, các hành hữu vi hiện ra như có hình dạng riêng của chúng, do đó chúng được gọi là tướng.
Āyūhanāti āyatiṃ paṭisandhihetubhūtaṃ kammaṃ.
Accumulation (āyūhanā) is kamma that becomes a condition for rebirth in the future.
Sự tích tập (āyūhanā) là nghiệp làm nhân duyên cho sự tái sinh trong tương lai.
Tañhi abhisaṅkharaṇaṭṭhena āyūhanāti vuccati.
Indeed, it is called accumulation in the sense of preparation.
Thật vậy, nó được gọi là sự tích tập theo nghĩa là sự tạo tác.
Paṭisandhīti āyatiṃ uppatti.
Rebirth (paṭisandhī) is origination in the future.
Sự tái sinh (paṭisandhī) là sự sinh khởi trong tương lai.
Sā hi bhavantarapaṭisandhānato paṭisandhīti vuccati.
Indeed, it is called rebirth because it connects one existence to another.
Thật vậy, nó được gọi là sự tái sinh vì nó kết nối các kiếp sống khác nhau.
Gatīti yāya gatiyā sā paṭisandhi hoti.
Destination (gati) is the destination to which that rebirth occurs.
Cảnh giới (gati) là cảnh giới mà sự tái sinh đó xảy ra.
Sā hi gantabbato gatīti vuccati.
Indeed, it is called a destination because it is to be gone to.
Thật vậy, nó được gọi là cảnh giới vì nó là nơi phải đi đến.
Nibbattīti khandhānaṃ nibbattanaṃ.
Production (nibbattī) is the production of the aggregates.
Sự phát sinh (nibbattī) là sự phát sinh của các uẩn.
Upapattīti ‘‘samāpannassa vā upapannassa vā’’ti (paṭi. ma. 1.72) evaṃ vuttā vipākapavatti.
Occurrence (upapattī) is the continuance of results (vipāka-pavatti) as stated in “for one who has attained or one who has occurred.”
Sự hiện hữu (upapattī) là sự tiếp diễn của quả báo đã được nói đến như “của người nhập định hoặc của người đã hiện hữu”.
Jātīti jananaṃ.
Birth (jātī) is generating.
Sự sinh (jātī) là sự sinh ra.
Tattha tattha nibbattamānānaṃ sattānaṃ ye ye khandhā pātubhavanti, tesaṃ tesaṃ paṭhamaṃ pātubhāvo.
It is the first manifestation of whatever aggregates appear for beings being produced in various existences.
Đó là sự xuất hiện đầu tiên của các uẩn khác nhau của chúng sinh sinh ra ở các cảnh giới khác nhau.
Jarāti jīraṇaṃ.
Old age (jarā) is decaying.
Sự già (jarā) là sự lão hóa.
Sā duvidhā ṭhitaññathattalakkhaṇasaṅkhātaṃ saṅkhatalakkhaṇañca khaṇḍiccādisammato santatiyaṃ ekabhavapariyāpannakhandhānaṃ purāṇabhāvo ca.
It is twofold: the characteristic of conditioned phenomena, described as the characteristic of alteration in persistence, and the aging of the aggregates belonging to one existence in the continuum, designated as breaking of teeth and so on.
Nó có hai loại: tướng hữu vi được gọi là tướng biến đổi khi tồn tại, và sự cũ kỹ của các uẩn thuộc một kiếp sống trong dòng tương tục, được chấp nhận là sự sứt mẻ, v.v.
Sā idha adhippetā.
That is intended here.
Điều này được đề cập ở đây.
Byādhīti dhātukkhobhapaccayasamuṭṭhito pittasemhavātasannipātautuvipariṇāmavisamaparihāraupakkamakammavipākavasena aṭṭhavidho ābādho.
Sickness (byādhī) is an ailment of eight kinds, arising from the disturbance of elements as a cause, due to the combination of bile, phlegm, and wind, changes in seasons, improper care, external causes, and kamma-result.
Bệnh tật (byādhī) là tám loại bệnh phát sinh do sự rối loạn của các yếu tố, như mật, đàm, phong, sự kết hợp của mật-đàm-phong, sự thay đổi của thời tiết, sự chăm sóc không đúng cách, sự can thiệp và quả báo của nghiệp.
Vividhaṃ dukkhaṃ ādahati vidahatīti byādhi, byādhayati tāpeti, kampayatīti vā byādhi.
It is called sickness (byādhi) because it brings forth (ādahati) or spreads (vidahati) various sufferings, or because it afflicts (byādhayati), torments (tāpeti), or shakes (kampayati).
Nó được gọi là bệnh tật (byādhi) vì nó mang lại nhiều loại khổ đau, hoặc vì nó hành hạ, làm đau đớn, làm rung chuyển.
Maraṇanti maranti etenāti maraṇaṃ.
Death (maraṇa) is that by which one dies, hence death.
Sự chết (maraṇa) là sự chết qua đó.
Taṃ duvidhaṃ vayalakkhaṇasaṅkhātaṃ saṅkhatalakkhaṇañca ekabhavapariyāpannajīvitindriyappabandhavicchedo ca.
It is twofold: the characteristic of conditioned phenomena, described as the characteristic of dissolution, and the severance of the continuum of the life faculty belonging to one existence.
Nó có hai loại: tướng hữu vi được gọi là tướng hoại diệt, và sự đoạn tuyệt của dòng sinh mạng (jīvitindriya) thuộc một kiếp sống.
Taṃ idha adhippetaṃ.
That is intended here.
Điều này được đề cập ở đây.
Sokoti socanaṃ.
Sorrow (soko) is grieving.
Sự sầu (soko) là sự sầu não.
Ñātibhogarogasīladiṭṭhibyasanehi phuṭṭhassa cittasantāpo.
It is the mental affliction of one affected by the loss of relatives, wealth, health, virtue, or views.
Đó là sự đau khổ trong tâm của người bị ảnh hưởng bởi những tai họa liên quan đến thân quyến, tài sản, bệnh tật, giới hạnh và tà kiến.
Paridevoti paridevanaṃ.
Lamentation (paridevo) is wailing.
Sự than vãn (paridevo) là sự than khóc.
Ñātibyasanādīhiyeva phuṭṭhassa vacīpalāpo.
It is the verbal expression of grief by one affected by the loss of relatives and so on.
Đó là lời than vãn của người bị ảnh hưởng bởi những tai họa liên quan đến thân quyến, v.v.
Upāyāsoti bhuso āyāso.
Despair (upāyāso) is extreme distress.
Sự tuyệt vọng (upāyāso) là sự tuyệt vọng tột độ.
Ñātibyasanādīhiyeva phuṭṭhassa adhimattacetodukkhappabhāvito dosoyeva.
It is simply hatred (dosa) intensely produced by mental suffering in one affected by the loss of relatives and so on.
Đó chính là sân (dosa) phát sinh từ sự đau khổ tột độ trong tâm của người bị ảnh hưởng bởi những tai họa liên quan đến thân quyến, v.v.
Ettha ca uppādādayo pañceva ādīnavañāṇassa vatthuvasena vuttā, sesā tesaṃ vevacanavasena.
Here, the five terms, arising (uppāda) and so on, are stated as the basis for the knowledge of disadvantages, while the rest are their synonyms.
Ở đây, chỉ có năm pháp từ sự sinh khởi (uppāda) được nói đến như là đối tượng của trí tuệ về sự nguy hiểm (ādīnavañāṇa), còn lại là các từ đồng nghĩa của chúng.
‘‘Nibbattī’’ti hi uppādassa, ‘‘jātī’’ti paṭisandhiyā vevacanaṃ, ‘‘gati upapattī’’ti idaṃ dvayaṃ pavattassa, jarādayo nimittassāti.
Indeed, "nibbattī" is a synonym for "uppāda" (arising), "jāti" for "paṭisandhi" (relinking), this pair "gati upapatti" for "pavatti" (continuance), and "jarādayo" (aging, etc.) for "nimitta" (sign).
Thật vậy, ‘sự phát sinh (nibbattī)’ là từ đồng nghĩa của sự sinh khởi (uppāda), ‘sự sinh (jātī)’ là từ đồng nghĩa của sự tái sinh (paṭisandhī), hai điều này ‘cảnh giới (gati) và sự hiện hữu (upapattī)’ là của sự tiếp diễn (pavatta), và già (jarā) v.v. là của tướng (nimitta).
Anuppādādivacanehi pana nibbānameva vuttaṃ.
However, by expressions such as "anuppāda" (non-arising), Nibbāna alone is spoken of.
Tuy nhiên, với các từ ngữ như 'không sinh khởi' (anuppāda) và các từ khác, chỉ Niết Bàn được nói đến.
Puna tāneva uppādānuppādādīni saṭṭhi padāni dukkhasukhapadehi yojetvā saṭṭhi vissajjanāni, bhayakhemapadehi yojetvā saṭṭhi vissajjanāni, sāmisanirāmisapadehi yojetvā saṭṭhi vissajjanāni, saṅkhāranibbānapadehi yojetvā saṭṭhi vissajjanāni niddiṭṭhāni.
Again, these sixty terms such as "uppāda" (arising) and "anuppāda" (non-arising) are explained as sixty answers by combining them with the terms "dukkha" (suffering) and "sukha" (happiness), sixty answers by combining them with the terms "bhaya" (fear) and "khema" (security), sixty answers by combining them with the terms "sāmisa" (with relish) and "nirāmisa" (without relish), and sixty answers by combining them with the terms "saṅkhāra" (conditioned phenomena) and "Nibbāna".
Lại nữa, sáu mươi từ ngữ đó, như 'sinh khởi' (uppāda) và 'không sinh khởi' (anuppāda), được kết hợp với các từ 'khổ' (dukkha) và 'lạc' (sukha) để tạo thành sáu mươi câu trả lời; kết hợp với các từ 'sợ hãi' (bhaya) và 'an ổn' (khema) để tạo thành sáu mươi câu trả lời; kết hợp với các từ 'hữu lậu' (sāmisa) và 'vô lậu' (nirāmisa) để tạo thành sáu mươi câu trả lời; và kết hợp với các từ 'các hành' (saṅkhāra) và 'Niết Bàn' (nibbāna) để tạo thành sáu mươi câu trả lời.
Tattha dukkhanti aniccattā dukkhaṃ.
Among these, dukkha (suffering) means suffering due to impermanence.
Trong đó, khổ (dukkha) là khổ vì vô thường (aniccattā).
Dukkhapaṭipakkhato sukhaṃ.
Sukha (happiness) is the opposite of suffering.
Lạc (sukha) là đối nghịch với khổ.
Yaṃ dukkhaṃ, taṃ bhayaṃ.
That which is suffering is bhaya (fear).
Cái gì là khổ, cái đó là sợ hãi (bhaya).
Bhayapaṭipakkhato khemaṃ.
Khema (security) is the opposite of fear.
An ổn (khema) là đối nghịch với sợ hãi.
Yaṃ bhayaṃ, taṃ vaṭṭāmisalokāmisehi avippamuttattā sāmisaṃ.
That which is fear is sāmisa (with relish) because it is not free from the relish of existence and worldly relish.
Cái gì là sợ hãi, cái đó là hữu lậu (sāmisa) vì chưa thoát khỏi các lậu hoặc của vòng luân hồi và các lậu hoặc thế gian.
Sāmisapaṭipakkhato nirāmisaṃ.
Nirāmisa (without relish) is the opposite of with relish.
Vô lậu (nirāmisa) là đối nghịch với hữu lậu.
Yaṃ sāmisaṃ, taṃ saṅkhāramattameva.
That which is with relish is merely saṅkhāra.
Cái gì là hữu lậu, cái đó chỉ là các hành (saṅkhāra).
Saṅkhārapaṭipakkhato santattā nibbānaṃ.
Nibbāna is the opposite of saṅkhāra, being tranquil.
Niết Bàn (nibbāna) là đối nghịch với các hành vì sự an tịnh.
Saṅkhārā hi ādittā, nibbānaṃ santanti.
For saṅkhāras are burning, Nibbāna is tranquil.
Thật vậy, các hành bị đốt cháy, còn Niết Bàn là an tịnh.
Dukkhākārena bhayākārena sāmisākārena saṅkhārākārenāti evaṃ tena tena ākārena pavattiṃ sandhāya tathā tathā vuttanti veditabbanti.
It should be understood that it is spoken of in various ways—in terms of suffering, in terms of fear, in terms of relish, and in terms of saṅkhāra—referring to existence in each respective aspect.
Như vậy, cần phải hiểu rằng các điều đó được nói đến theo từng khía cạnh như khía cạnh khổ, khía cạnh sợ hãi, khía cạnh hữu lậu, khía cạnh các hành, v.v., tùy theo sự vận hành.
11. Pariggahaṭṭhādīni ekatiṃsa vissajjanāni ariyamaggakkhaṇavasena niddiṭṭhāni.
11. The thirty-one explanations beginning with pariggahaṭṭha (the meaning of comprehension) are set forth in terms of the moment of the Noble Path.
11. Ba mươi mốt câu trả lời như 'trạng thái nắm giữ' (pariggahaṭṭha) được trình bày theo khía cạnh của sát-na đạo Thánh (ariyamagga-kkhana).
Ariyamaggasampayuttā hi dhammā ādito pabhuti uppādanatthaṃ pariggayhante iti pariggahā, tesaṃ sabhāvo pariggahaṭṭho.
Indeed, the phenomena associated with the Noble Path are comprehended for their arising from the beginning; thus, they are called pariggaha (comprehension), and their nature is pariggahaṭṭha.
Thật vậy, các pháp tương ưng với đạo Thánh được nắm giữ để sinh khởi ngay từ ban đầu, do đó chúng là 'sự nắm giữ' (pariggaha); bản chất của chúng là 'trạng thái nắm giữ' (pariggahaṭṭha).
Tesaṃyeva aññamaññaparivārabhāvena parivāraṭṭho.
Their mutual accompaniment is parivāraṭṭha (the meaning of accompaniment).
'Trạng thái tùy tùng' (parivāraṭṭha) là do sự tùy tùng lẫn nhau của chính chúng.
Bhāvanāpāripūrivasena paripūraṭṭho.
Their perfection through development is paripūraṭṭha (the meaning of perfection).
'Trạng thái viên mãn' (paripūraṭṭha) là do sự viên mãn của sự tu tập (bhāvanā).
Tesaṃyeva samādhivasena ekārammaṇapariggahamapekkhitvā ekaggaṭṭho.
Their one-pointedness, considering the comprehension of a single object through concentration, is ekaggaṭṭha (the meaning of one-pointedness).
'Trạng thái nhất tâm' (ekaggaṭṭha) là do sự định tâm (samādhi), với sự nắm giữ một đối tượng duy nhất của chính chúng.
Nānārammaṇavikkhepābhāvamapekkhitvā avikkhepaṭṭho.
Their non-distraction, considering the absence of scattering among various objects, is avikkhepaṭṭha (the meaning of non-distraction).
'Trạng thái không tán loạn' (avikkhepaṭṭha) là do không có sự tán loạn đến các đối tượng khác nhau.
Vīriyavasena paggahaṭṭho.
Their exertion through energy is paggahaṭṭha (the meaning of exertion).
'Trạng thái tinh cần' (paggahaṭṭha) là do sự tinh tấn (vīriya).
Samādhivasena udakena nhānīyacuṇṇānaṃ viya avippakiṇṇatā avisāraṭṭho.
Their unscattered nature, like bathing powder with water, through concentration, is avisāraṭṭha (the meaning of unscatteredness).
'Trạng thái không phân tán' (avisāraṭṭha) là do sự không phân tán, như bột tắm với nước, nhờ sự định tâm (samādhi).
Samādhiyogena alulitattā anāvilaṭṭho.
Their unagitated nature through the practice of concentration is anāvilaṭṭha (the meaning of unagitatedness).
'Trạng thái không xao động' (anāvilaṭṭha) là do không bị xáo trộn bởi sự kết hợp của định tâm.
Avikampitattā aniñjanaṭṭho.
Their unshakeable nature is aniñjanaṭṭha (the meaning of unshakeableness).
'Trạng thái không rung chuyển' (aniñjanaṭṭha) là do không bị rung chuyển.
Ekattupaṭṭhānavasenāti samādhiyogena ca ekārammaṇe bhusaṃ patiṭṭhānavasena ca.
Ekattupaṭṭhānavasenāti means by way of the practice of concentration and by way of firmly establishing oneself in a single object.
'Theo khía cạnh của sự hiện hữu duy nhất' (ekattupaṭṭhānavasenā) là do sự kết hợp của định tâm và sự an trú vững chắc trên một đối tượng duy nhất.
Ṭhitaṭṭhoti ārammaṇe niccalabhāvena patiṭṭhitaṭṭho.
Ṭhitaṭṭhoti means the meaning of being established immovably in the object.
'Trạng thái an trú' (ṭhitaṭṭho) là trạng thái an trú vững chắc trên đối tượng.
Tassa nibbānārammaṇassa ālambanabhāvena ārammaṇaṭṭho.
The meaning of being an object is ārammaṇaṭṭha for that object which is Nibbāna.
'Trạng thái đối tượng' (ārammaṇaṭṭha) là do đối tượng Niết Bàn đó là nơi nương tựa.
Tattheva nikāmacārabhāvena gocaraṭṭho.
The meaning of being a range is gocaraṭṭha due to freely moving in that very Nibbāna.
'Trạng thái cảnh giới' (gocaraṭṭha) là do sự tự do đi lại trong chính Niết Bàn đó.
Nissaraṇapahānabhāvena nibbānassa pahānaṭṭho.
The meaning of abandonment is pahānaṭṭha for Nibbāna, by way of the abandonment of defilements.
'Trạng thái đoạn trừ' (pahānaṭṭha) của Niết Bàn là do khía cạnh thoát ly và đoạn trừ.
Kilesapariccāgavasena ariyamaggassa pariccāgaṭṭho.
The meaning of relinquishment is pariccāgaṭṭha for the Noble Path, by way of the relinquishment of defilements.
'Trạng thái từ bỏ' (pariccāgaṭṭha) của đạo Thánh là do khía cạnh từ bỏ các phiền não.
Dubhato vuṭṭhānavasena vuṭṭhānaṭṭho.
The meaning of emergence is vuṭṭhānaṭṭha by way of emerging from both (existence and signs).
'Trạng thái xuất ly' (vuṭṭhānaṭṭha) là do xuất ly khỏi cả hai.
Nimittapavattehi nivattanavasena nivattanaṭṭho.
The meaning of turning away is nivattanaṭṭha by way of turning away from signs and existence.
'Trạng thái quay lại' (nivattanaṭṭha) là do quay lại từ các tướng hành.
Nibbutattā santaṭṭho.
The meaning of tranquility is santaṭṭha due to being extinguished.
'Trạng thái an tịnh' (santaṭṭha) là do đã được dập tắt (nibbutattā).
Atappakattā uttamattā ca paṇītaṭṭho.
The meaning of sublimity is paṇītaṭṭha due to being unassailable and supreme.
'Trạng thái thù thắng' (paṇītaṭṭha) là do không bị thiêu đốt và là tối thượng.
Kilesehi vimuttattā, ārammaṇe ca adhimuttattā vimuttaṭṭho.
The meaning of liberation is vimuttaṭṭha due to being liberated from defilements and being devoted to the object (Nibbāna).
'Trạng thái giải thoát' (vimuttaṭṭha) là do được giải thoát khỏi các phiền não và được giải thoát trong đối tượng.
Āsavānaṃ avisayabhāvena parisuddhattā anāsavaṭṭho.
The meaning of taintlessness is anāsavaṭṭha due to being purified by not being within the range of the taints.
'Trạng thái vô lậu' (anāsavaṭṭha) là do thanh tịnh vì không phải là đối tượng của các lậu hoặc (āsava).
Kilesakantārasaṃsārakantārātikkamanena taraṇaṭṭho.
The meaning of crossing over is taraṇaṭṭha by transcending the wilderness of defilements and the wilderness of saṃsāra.
'Trạng thái vượt qua' (taraṇaṭṭha) là do vượt qua sa mạc phiền não và sa mạc luân hồi.
Saṅkhāranimittābhāvena animittaṭṭho.
The meaning of signlessness is animittaṭṭha due to the absence of the sign of conditioned phenomena.
'Trạng thái vô tướng' (animittaṭṭha) là do không có tướng hành.
Taṇhāpaṇidhiabhāvena appaṇihitaṭṭho.
The meaning of desirelessness is appaṇihitaṭṭha due to the absence of craving and aspiration.
'Trạng thái vô nguyện' (appaṇihitaṭṭha) là do không có sự khao khát.
Attasārābhāvena suññataṭṭho.
The meaning of emptiness is suññataṭṭha due to the absence of a self-essence.
'Trạng thái không' (suññataṭṭha) là do không có tự ngã.
Vimuttirasena ekarasatāya, samathavipassanānaṃ ekarasatāya vā ekarasaṭṭho.
The meaning of having one taste is ekarasaṭṭha either due to having one taste by the taste of liberation, or due to samatha and vipassanā having one taste.
'Trạng thái đồng vị' (ekarasaṭṭha) là do có một vị duy nhất là vị giải thoát, hoặc do thiền định (samatha) và tuệ quán (vipassanā) có một vị duy nhất.
Samathavipassanānaṃ aññamaññaṃ anativattanaṭṭho.
The meaning of non-transgression is anativattanaṭṭha for samatha and vipassanā regarding each other.
'Trạng thái không vượt qua nhau' (anativattanaṭṭha) của thiền định và tuệ quán.
Tesaṃyeva yuganaddhaṭṭho.
The meaning of being yoked together is yuganaddhaṭṭho for these very two.
'Trạng thái song hành' (yuganaddhaṭṭha) của chính chúng.
Ariyamaggassa saṅkhārato niggamane niyyānaṭṭho.
The meaning of leading out is niyyānaṭṭha for the Noble Path in its emergence from conditioned phenomena.
'Trạng thái xuất ly' (niyyānaṭṭha) của đạo Thánh là sự thoát ly khỏi các hành.
Nibbānasampāpanena hetuṭṭho.
The meaning of cause is hetuṭṭha by attaining Nibbāna.
'Trạng thái nhân' (hetuṭṭha) là do sự đạt đến Niết Bàn.
Nibbānapaccakkhakaraṇena dassanaṭṭho.
The meaning of seeing is dassanaṭṭha by direct experience of Nibbāna.
'Trạng thái thấy' (dassanaṭṭha) là do sự chứng ngộ Niết Bàn.
Adhipatibhāvena ādhipateyyaṭṭhoti.
The meaning of supremacy is ādhipateyyaṭṭhoti by way of being a dominant factor.
'Trạng thái chủ tể' (ādhipateyyaṭṭha) là do khía cạnh thống trị.
12. Samathādīni cattāri vissajjanāni samathavipassanāvasena niddiṭṭhāni.
12. The four explanations beginning with samatha are set forth in terms of samatha and vipassanā.
12. Bốn câu trả lời như 'thiền định' (samatha) được trình bày theo khía cạnh thiền định và tuệ quán.
Aniccādivasena anu anu passanato anupassanaṭṭho.
The meaning of repeated contemplation is anupassanaṭṭha due to repeatedly seeing in terms of impermanence, etc.
'Trạng thái quán sát liên tục' (anupassanaṭṭha) là do quán sát liên tục theo khía cạnh vô thường, v.v.
Yuganaddhassa samathavipassanādvayassa ekarasabhāvena anativattanaṭṭho.
The meaning of non-transgression is anativattanaṭṭho due to the two, samatha and vipassanā, being yoked together and having one taste.
'Trạng thái không vượt qua nhau' (anativattanaṭṭha) là do hai pháp thiền định và tuệ quán song hành có vị duy nhất.
Sikkhādīni nava vissajjanāni ariyamaggassa ādimajjhapariyosānavasena niddiṭṭhāni.
The nine explanations beginning with sikkhā are set forth in terms of the beginning, middle, and end of the Noble Path.
Chín câu trả lời như 'giới' (sikkhā) được trình bày theo khía cạnh ban đầu, giữa và cuối của đạo Thánh.
Sikkhitabbattā sikkhā.
Sikkhā (training) is so called because it is to be trained.
'Giới' (sikkhā) là do cần phải học.
Tassā samādātabbato samādānaṭṭho.
The meaning of undertaking is samādānaṭṭho because it is to be undertaken.
'Trạng thái thọ trì' (samādānaṭṭha) là do cần phải thọ trì giới đó.
Sīle patiṭṭhāya kammaṭṭhānavasena gahitassa ārammaṇassa bhāvanāpavattiṭṭhānattā gocaraṭṭhānattā ca gocaraṭṭho.
Based on virtue, it is gocaraṭṭha (sphere of activity) because it is the place where the meditation object, taken in the manner of a kammaṭṭhāna, proceeds in development, and because it is a sphere of activity.
'Trạng thái cảnh giới' (gocaraṭṭha) là do sự an trú trên giới, và là nơi phát triển tu tập đối tượng đã được nắm giữ theo khía cạnh thiền quán, cũng như là cảnh giới.
Samathakāle vipassanākāle vā kosajjavasena līnassa cittassa dhammavicayavīriyapītisambojjhaṅgabhāvanāvasena ussāhanaṭṭho paggahaṭṭho.
In the time of samatha or vipassanā, it is paggahaṭṭha (the meaning of exertion) because it is the meaning of exerting the mind that has become slack due to idleness, by means of developing the enlightenment factors of dhammavicaya, vīriya, and pīti.
'Trạng thái tinh cần' (paggahaṭṭho) là sự thúc đẩy tâm bị chùng xuống do lười biếng trong thời thiền định hoặc thời tuệ quán, bằng cách tu tập các chi giác ngộ như trạch pháp, tinh tấn, hỷ.
Uddhaccavasena uddhatassa cittassa passaddhisamādhiupekkhāsambojjhaṅgabhāvanāvasena sannisīdāpanaṭṭho niggahaṭṭho.
It is niggahaṭṭha (the meaning of restraint) because it is the meaning of settling down the mind that has become agitated due to restlessness, by means of developing the enlightenment factors of passaddhi, samādhi, and upekkhā.
'Trạng thái kiềm chế' (niggahaṭṭho) là sự làm lắng dịu tâm bị xao động do phóng dật, bằng cách tu tập các chi giác ngộ như khinh an, định, xả.
Ubho visuddhānanti ubhato visuddhānaṃ, līnuddhatapakkhato nivāretvā visuddhānaṃ cittānanti attho.
Ubho visuddhānanti means "of minds purified in both ways," that is, of minds purified by preventing them from the side of slackness and agitation.
'Cả hai đều thanh tịnh' (ubho visuddhānaṃ) có nghĩa là tâm thanh tịnh sau khi đã ngăn chặn sự chùng xuống và phóng dật.
Majjhimabhāve ṭhitānaṃ santativasena pavattamānānaṃ cittānaṃ vasena bahuvacanaṃ katanti veditabbaṃ.
It should be understood that the plural is used for minds that are in a middle state and proceed continuously.
Cần phải hiểu rằng số nhiều được dùng để chỉ các tâm an trú ở trạng thái trung dung và vận hành liên tục.
Ussāhanasannisīdāpanesu sabyāpārābhāvo ajjhupekkhanaṭṭho.
The absence of engagement in exertion and settling down is ajjhupekkhanaṭṭha (the meaning of equanimity).
'Trạng thái xả' (ajjhupekkhanaṭṭha) là không có sự bận tâm trong việc thúc đẩy và làm lắng dịu.
Samappavattassa cittassa vasena bhāvanā visesādhigamaṭṭho.
The development by means of the mind proceeding evenly is visesādhigamaṭṭha (the meaning of attaining distinction).
'Trạng thái đạt được điều đặc biệt' (visesādhigamaṭṭha) là sự tu tập theo tâm vận hành đồng đều.
Ariyamaggapātubhāvavasena uttaripaṭivedhaṭṭho.
It is uttaripaṭivedhaṭṭha (the meaning of higher penetration) by way of the manifestation of the Noble Path.
'Trạng thái thâm nhập cao hơn' (uttaripaṭivedhaṭṭha) là do sự hiển lộ của đạo Thánh.
Ariyamaggasiddhacatusaccapaṭivedhavasena saccābhisamayaṭṭho.
It is saccābhisamayaṭṭha (the meaning of the penetration of truths) by way of the penetration of the Four Noble Truths accomplished by the Noble Path.
'Trạng thái chứng ngộ sự thật' (saccābhisamayaṭṭha) là do sự thâm nhập Tứ Thánh Đế được thành tựu bởi đạo Thánh.
Phalasamāpattivasena nirodhe patiṭṭhāpakaṭṭho.
It is patiṭṭhāpakaṭṭha (the meaning of establishing) in cessation by way of fruition attainment.
'Trạng thái an trú' (patiṭṭhāpakaṭṭha) vào sự diệt (nirodha) là do sự nhập quả.
Sā hi taṃsamaṅgipuggalaṃ nirodhasaṅkhāte nibbāne patiṭṭhāpeti.
For it establishes the person endowed with it in Nibbāna, which is called cessation.
Thật vậy, sự nhập quả đó khiến người có được nó an trú vào Niết Bàn, tức là sự diệt.
Saddhindriyādīni pañca vissajjanāni indriyaṭṭhavasena vuttāni.
The five answers beginning with saddhindriya are stated in the sense of faculties.
Năm câu trả lời như 'tín căn' (saddhindriya) được trình bày theo khía cạnh căn (indriya).
Adhimokkhaṭṭhoti adhimuccanaṭṭho.
Adhimokkhaṭṭha means the meaning of resolving.
'Trạng thái quyết định' (adhimokkhaṭṭha) là trạng thái quyết định.
Upaṭṭhānaṭṭhoti ārammaṇaṃ upecca patiṭṭhānaṭṭho.
Upaṭṭhānaṭṭha means the meaning of approaching and establishing oneself in the object.
'Trạng thái an trú' (upaṭṭhānaṭṭha) là trạng thái an trú gần đối tượng.
Dassanaṭṭhoti sabhāvapekkhanaṭṭho.
Dassanaṭṭha means the meaning of perceiving the true nature.
'Trạng thái thấy' (dassanaṭṭha) là trạng thái thấy bản chất.
Saddhābalādīni pañca vissajjanāni balaṭṭhavasena niddiṭṭhāni.
The five answers beginning with saddhābala are designated in the sense of powers.
Năm câu trả lời như 'tín lực' (saddhābala) được trình bày theo khía cạnh lực (bala).
Akampiyaṭṭhena saddhāva balanti saddhābalaṃ.
Faith itself is power by reason of its unshakeability, hence saddhābala.
Niềm tin là sức mạnh vì không thể bị lay chuyển, do đó là tín lực (saddhābala).
Assaddhiyeti assaddhiyena.
Assaddhiye means by faithlessness.
'Trong sự không tín' (assaddhiye) là do sự không tín.
Assaddhiyanti ca saddhāpaṭipakkhabhūto cittuppādo.
Assaddhiya is a mental state that is the opposite of faith.
'Sự không tín' (assaddhiya) là tâm sở đối nghịch với niềm tin.
Akampiyaṭṭhoti akampetabbaṭṭho, kampetuṃ na sakkāti attho.
Akampiyaṭṭha means the meaning of being unshakeable; it means that it cannot be shaken.
'Trạng thái không lay chuyển' (akampiyaṭṭho) là trạng thái không thể bị lay chuyển, nghĩa là không thể lay chuyển được.
Kosajjeti kusītabhāvasaṅkhātena thinamiddhena.
Kosajje means by sloth and torpor, which is idleness.
'Trong sự lười biếng' (kosajje) là do sự hôn trầm thụy miên, tức là trạng thái lười biếng.
Pamādeti satipaṭipakkhena cittuppādena.
Pamāde means by a mental state that is the opposite of mindfulness.
'Trong sự phóng dật' (pamāde) là do tâm sở đối nghịch với chánh niệm.
Uddhacceti avūpasamasaṅkhātena uddhaccena.
Uddhacce means by restlessness, which is non-calmness.
'Trong sự phóng dật' (uddhacce) là do sự phóng dật, tức là sự không lắng dịu.
Avijjāyāti mohena.
Avijjāyā means by delusion.
'Trong sự vô minh' (avijjāya) là do sự si mê.
Satisambojjhaṅgādīni satta vissajjanāni bojjhaṅgaṭṭhavasena niddiṭṭhāni.
The seven answers beginning with satisambojjhaṅga are designated in the sense of factors of enlightenment.
Bảy câu trả lời như 'niệm giác chi' (satisambojjhaṅga) được trình bày theo khía cạnh giác chi (bojjhaṅga).
Bujjhanakassa aṅgo bojjhaṅgo.
A factor of one who awakens is a bojjhaṅga.
Chi phần của người giác ngộ là giác chi (bojjhaṅga).
Pasattho sundaro ca bojjhaṅgo sambojjhaṅgo, satiyeva sambojjhaṅgo satisambojjhaṅgo.
A praiseworthy and beautiful factor of enlightenment is a sambojjhaṅga; mindfulness itself is a sambojjhaṅga, hence satisambojjhaṅga.
Giác chi được tán thán và tốt đẹp là giác chi tối thượng (sambojjhaṅga); niệm (sati) chính là giác chi tối thượng, đó là niệm giác chi (satisambojjhaṅgā).
Dhamme vicinātīti dhammavicayo.
One discerns phenomena, hence dhammavicaya.
Phân tích các pháp, đó là trạch pháp.
Paññāyetaṃ nāmaṃ.
This is a name for wisdom.
Đây là tên của trí tuệ (paññā).
Pavicayaṭṭhoti vicāraṭṭho.
Pavicayaṭṭha means the meaning of investigation.
'Trạng thái phân tích' (pavicayaṭṭha) là trạng thái suy xét.
Pīnayatīti pīti.
It gladdens, hence pīti.
Làm cho vui thích, đó là hỷ (pīti).
Pharaṇaṭṭhoti visaraṇaṭṭho.
Pharaṇaṭṭha means the meaning of pervading.
'Trạng thái lan tỏa' (pharaṇaṭṭha) là trạng thái trải rộng.
Passambhanaṃ passaddhi.
Calming is passaddhi.
Sự lắng dịu là khinh an (passaddhi).
Upasamaṭṭhoti niddarathaṭṭho.
Upasamaṭṭha means the meaning of freedom from agitation.
'Trạng thái an tịnh' (upasamaṭṭha) là trạng thái không còn sự phiền não.
Upapattito ikkhatīti upekkhā, samaṃ pekkhati apakkhapatitāva hutvā pekkhatīti attho.
It looks appropriately, hence upekkhā; it means it looks evenly, being impartial.
Quán sát một cách thích hợp, đó là xả (upekkhā); nghĩa là quán sát một cách công bằng, không nghiêng về bên nào.
Sā idha tatramajjhattupekkhā, bojjhaṅgupekkhātipi tassā nāmaṃ.
Here, that is tatramajjhattupekkhā; bojjhaṅgupekkhā is also its name.
Ở đây, xả đó là xả trung tính (tatramajjhattupekkhā); nó cũng có tên là giác chi xả (bojjhaṅgupekkhā).
Samavāhitalakkhaṇattā paṭisaṅkhānaṭṭho.
It is paṭisaṅkhānaṭṭha (the meaning of reflection) due to having the characteristic of being carried together.
'Trạng thái xem xét' (paṭisaṅkhānaṭṭha) là do có đặc tính được thực hiện một cách đồng đều.
Sammādiṭṭhādīni aṭṭha vissajjanāni maggavasena niddiṭṭhāni.
The eight answers beginning with sammādiṭṭhi are designated in the sense of the path.
Tám câu trả lời như 'chánh kiến' (sammādiṭṭhi) được trình bày theo khía cạnh đạo (magga).
Sammā passati, sammā vā tāya passanti, pasatthā sundarā vā diṭṭhīti sammādiṭṭhi.
One sees rightly, or by it one sees rightly, or it is a praiseworthy and beautiful view, hence sammādiṭṭhi.
Thấy đúng đắn, hoặc thấy đúng đắn bằng cái đó; hoặc là chánh kiến được tán thán, tốt đẹp. Đó là Sammādiṭṭhi (Chánh kiến).
Tassā sammādiṭṭhiyā.
Of that sammādiṭṭhi.
Của Sammādiṭṭhi đó.
Sammā saṅkappeti, sammā vā tena saṅkappenti, pasattho sundaro vā saṅkappoti sammāsaṅkappo.
One resolves rightly, or by it one resolves rightly, or it is a praiseworthy and beautiful resolve, hence sammāsaṅkappa.
Tư duy đúng đắn, hoặc tư duy đúng đắn bằng cái đó; hoặc là tư duy được tán thán, tốt đẹp. Đó là Sammāsaṅkappo (Chánh tư duy).
Abhiropanaṭṭhoti cittassa ārammaṇāropanaṭṭho.
Abhiropanaṭṭha means the meaning of directing the mind to the object.
Abhiropanaṭṭho (nghĩa là hướng đến) là nghĩa của việc hướng tâm đến đối tượng.
Ārammaṇābhiniropanaṭṭhotipi pāṭho.
The reading "ārammaṇābhiniropanaṭṭha" is also found.
Cũng có bản văn là ārammaṇābhiniropanaṭṭho.
Sammā vadati, sammā vā tāya vadanti, pasatthā sundarā vā vācāti sammāvācā.
One speaks rightly, or by it one speaks rightly, or it is a praiseworthy and beautiful speech, hence sammāvācā.
Nói đúng đắn, hoặc nói đúng đắn bằng cái đó; hoặc là lời nói được tán thán, tốt đẹp. Đó là Sammāvācā (Chánh ngữ).
Micchāvācāviratiyā etaṃ nāmaṃ.
This is a name for abstaining from wrong speech.
Đây là tên gọi của sự kiêng cữ tà ngữ.
Pariggahaṭṭhoti catubbidhavacīsaṃvarapariggahaṭṭho.
Pariggahaṭṭha means the meaning of embracing the fourfold restraint of speech.
Pariggahaṭṭho (nghĩa là sự thâu tóm) là nghĩa của sự thâu tóm bốn loại giới ngữ.
Sammā karoti, sammā vā tena karonti, pasatthaṃ sundaraṃ vā kammanti sammākammaṃ, sammākammameva sammākammanto.
One acts rightly, or by it one acts rightly, or it is a praiseworthy and beautiful action, hence sammākamma; sammākamma itself is sammākammanta.
Làm đúng đắn, hoặc làm đúng đắn bằng cái đó; hoặc là hành động được tán thán, tốt đẹp. Đó là Sammākammaṃ (Chánh nghiệp), chỉ riêng Sammākammaṃ là Sammākammanto (Chánh nghiệp).
Micchākammantaviratiyā etaṃ nāmaṃ.
This is a name for abstaining from wrong action.
Đây là tên gọi của sự kiêng cữ tà nghiệp.
Samuṭṭhānaṭṭhoti tividhakāyasaṃvarasamuṭṭhānaṭṭho.
Samuṭṭhānaṭṭha means the meaning of the arising of the threefold bodily restraint.
Samuṭṭhānaṭṭho (nghĩa là sự phát sinh) là nghĩa của sự phát sinh ba loại giới thân.
Sammā ājīvati, sammā vā tena ājīvanti, pasattho sundaro vā ājīvoti sammāājīvo.
One lives rightly, or by it one lives rightly, or it is a praiseworthy and beautiful livelihood, hence sammāājīva.
Sống đúng đắn, hoặc sống đúng đắn bằng cái đó; hoặc là sinh kế được tán thán, tốt đẹp. Đó là Sammāājīvo (Chánh mạng).
Micchājīvaviratiyā etaṃ nāmaṃ.
This is a name for abstaining from wrong livelihood.
Đây là tên gọi của sự kiêng cữ tà mạng.
Vodānaṭṭhoti parisuddhaṭṭho.
Vodānaṭṭha means the meaning of purity.
Vodānaṭṭho (nghĩa là sự thanh tịnh) là nghĩa của sự thanh tịnh.
Sammā vāyamati, sammā vā tena vāyamanti, pasattho sundaro vā vāyāmoti sammāvāyāmo.
One strives rightly, or they strive rightly by means of it, or it is praised, excellent striving; thus, Right Exertion (sammāvāyāmo).
Cố gắng đúng đắn, hoặc cố gắng đúng đắn bằng cái đó; hoặc là sự tinh tấn được tán thán, tốt đẹp. Đó là Sammāvāyāmo (Chánh tinh tấn).
Sammā sarati, sammā vā tāya saranti, pasatthā sundarā vā satīti sammāsati.
One remembers rightly, or they remember rightly by means of it, or it is praised, excellent mindfulness; thus, Right Mindfulness (sammāsati).
Niệm đúng đắn, hoặc niệm đúng đắn bằng cái đó; hoặc là niệm được tán thán, tốt đẹp. Đó là Sammāsati (Chánh niệm).
Sammā samādhiyati, sammā vā tena samādhiyanti, pasattho sundaro vā samādhīti sammāsamādhi.
One concentrates rightly, or they concentrate rightly by means of it, or it is praised, excellent concentration; thus, Right Concentration (sammāsamādhi).
Định tâm đúng đắn, hoặc định tâm đúng đắn bằng cái đó; hoặc là sự định tâm được tán thán, tốt đẹp. Đó là Sammāsamādhi (Chánh định).
13. Indriyādīni dasa vissajjanāni rāsikatvā anupubbapaṭipāṭivasena niddiṭṭhāni.
13. The ten explanations, beginning with Indriyā (faculties), are stated by grouping them and in progressive order.
13. Mười giải thích từ Indriya trở đi được trình bày theo thứ tự tuần tự, gộp lại thành một nhóm.
Ādhipateyyaṭṭhoti indaṭṭhakaraṇavasena adhipatiattho.
The meaning of dominance is the meaning of being a chief, in the sense of performing the function of mastery.
Ādhipateyyaṭṭho (nghĩa là sự tối thượng) là nghĩa của sự tối thượng theo cách làm chủ.
Akampiyaṭṭhoti paṭipakkhehi kampetuṃ asakkuṇeyyaṭṭho.
The meaning of immovability is the meaning of being impossible to shake by opponents.
Akampiyaṭṭho (nghĩa là không bị lay chuyển) là nghĩa của việc không thể bị lay chuyển bởi các đối thủ.
Niyyānaṭṭhoti lokiyalokuttarānampi paṭipakkhato niggamanaṭṭho.
The meaning of leading out is the meaning of departing from opponents, even for the mundane and supramundane.
Niyyānaṭṭho (nghĩa là sự thoát ly) là nghĩa của sự thoát ly khỏi các đối thủ của cả thế gian và siêu thế.
Hetuṭṭhoti micchādiṭṭhādīnaṃ pahānāya sammādiṭṭhādayo hetūti vā sabbepi sammādiṭṭhādayo nibbānasampāpakahetūti vā hetuṭṭho.
The meaning of cause is that Right View and so on are causes for the abandonment of Wrong View and so on, or that all Right View and so on are causes for attaining Nibbāna.
Hetuṭṭho (nghĩa là nhân) là nghĩa của nhân, hoặc là chánh kiến và các pháp khác là nhân để đoạn trừ tà kiến và các pháp khác, hoặc là tất cả chánh kiến và các pháp khác là nhân đưa đến Niết Bàn.
Satipaṭṭhānesu ārammaṇesu okkhanditvā pakkhanditvā upaṭṭhānato upaṭṭhānaṃ, satiyeva upaṭṭhānaṃ satipaṭṭhānaṃ.
As it enters and penetrates the objects of the Satipaṭṭhānas, it is a firm establishment; mindfulness itself is a firm establishment, hence Satipaṭṭhāna.
Sự thiết lập niệm, tức là niệm được thiết lập, là Satipaṭṭhānaṃ (Niệm xứ), do sự xâm nhập và thâm nhập vào các đối tượng của niệm xứ.
Kāyavedanācittadhammesu panassā asubhadukkhāniccānattākāragahaṇavase subhasukhaniccattasaññāpahānakiccasādhanavasena ca pavattito catudhā bhedo hoti.
Its fourfold division arises from its operation in the body, feelings, mind, and phenomena, in the sense of grasping the aspects of impurity, suffering, impermanence, and non-self, and in the sense of accomplishing the task of abandoning the perceptions of beauty, pleasure, permanence, and self.
Hơn nữa, nó có bốn loại khác biệt do sự vận hành của nó trong thân, thọ, tâm và pháp, theo cách nắm bắt các khía cạnh bất tịnh, khổ, vô thường, vô ngã, và theo cách thực hiện nhiệm vụ đoạn trừ các tưởng tịnh, lạc, thường, ngã.
Etāni pubbabhāge nānācittesu labbhanti, maggakkhaṇe pana ekāyeva sati cattāri nāmāni labhati.
These are found in various states of mind in the preliminary stage, but at the moment of the Path, one and the same mindfulness receives four names.
Những điều này được tìm thấy trong các tâm khác nhau ở giai đoạn đầu, nhưng trong khoảnh khắc đạo, chỉ một niệm duy nhất có được bốn tên gọi.
Sammappadhānesu padahanti etenāti padhānaṃ, sobhanaṃ padhānaṃ sammappadhānaṃ. Sammā vā padahanti etenāti sammappadhānaṃ, sobhanaṃ vā taṃ kilesavirūpattavirahato padhānañca hitasukhanipphādakattena seṭṭhabhāvāvahanato padhānabhāvakaraṇato vā sammappadhānaṃ.
They strive rightly by means of this, hence padhānaṃ (striving); excellent striving is Right Exertion (sammappadhānaṃ). Or, they strive rightly by means of this, hence sammappadhānaṃ; or, it is excellent because it is free from the defilements' distorted nature, and it is striving because it brings about a state of excellence by producing benefit and happiness, or by causing the state of striving, hence sammappadhānaṃ.
Trong các Chánh cần, người ta tinh tấn bằng cái này, nên gọi là Padhānaṃ (sự tinh tấn); sự tinh tấn tốt đẹp là Sammappadhānaṃ (Chánh cần). Hoặc người ta tinh tấn đúng đắn bằng cái này, nên gọi là Sammappadhānaṃ; hoặc đó là sự tinh tấn tốt đẹp do không có sự biến dạng của phiền não, và là sự tinh tấn do mang lại trạng thái tối thượng bằng cách tạo ra lợi ích và hạnh phúc.
Vīriyassetaṃ adhivacanaṃ.
This is a designation for energy (vīriya).
Đây là tên gọi của tinh tấn.
Uppannānuppannānaṃ anuppannuppannānañca akusalakusalānaṃ dhammānaṃ pahānānuppattiuppādaṭṭhitikiccasādhanavasena pavattito panassa catudhā bhedo hoti.
Its fourfold division arises from its operation in accomplishing the tasks of abandoning unarisen unwholesome states, preventing the arising of unwholesome states, causing the arising of wholesome states, and maintaining arisen wholesome states.
Hơn nữa, nó có bốn loại khác biệt do sự vận hành của nó, theo cách thực hiện nhiệm vụ đoạn trừ, không phát sinh, phát sinh và duy trì các pháp bất thiện và thiện đã phát sinh và chưa phát sinh.
Etānipi pubbabhāge nānācittesu labbhanti, maggakkhaṇe pana ekameva vīriyaṃ cattāri nāmāni labhati.
These are also found in various states of mind in the preliminary stage, but at the moment of the Path, one and the same energy receives four names.
Những điều này cũng được tìm thấy trong các tâm khác nhau ở giai đoạn đầu, nhưng trong khoảnh khắc đạo, chỉ một tinh tấn duy nhất có được bốn tên gọi.
Padahanaṭṭhoti ussāhanaṭṭho.
The meaning of striving is the meaning of exertion.
Padahanaṭṭho (nghĩa là sự tinh tấn) là nghĩa của sự nỗ lực.
Padhānaṭṭhotipi pāṭho, soyevattho.
Padhānaṭṭho is also a reading, and it has the same meaning.
Cũng có bản văn là padhānaṭṭho, nghĩa cũng tương tự.
Iddhipādānanti ettha chandavīriyacittavīmaṃsāsu ekeko ijjhatīti iddhi, samijjhati nipphajjatīti attho.
Here, regarding Iddhipādas (bases of psychic power), each of desire, energy, mind, and investigation succeeds, which means it is accomplished or fulfilled, hence iddhi.
Trong Iddhipāda (Tứ thần túc) này, mỗi một trong dục, tinh tấn, tâm, quán là thành tựu, nghĩa là đạt được, hoàn thành.
Ijjhanti vā etāya sattā iddhā vuddhā ukkaṃsagatā hontīti iddhi, paṭhamenatthena iddhi eva pādo iddhipādo, iddhikoṭṭhāsoti attho.
Or, by means of this, beings succeed, grow, and reach excellence, hence iddhi. In the first sense, iddhi itself is the base, iddhipādo, meaning a component of psychic power.
Hoặc chúng sanh nhờ đó mà thành tựu, phát triển, đạt đến sự ưu việt, nên gọi là iddhi (thần thông). Theo nghĩa thứ nhất, chính iddhi là pādo, là iddhipādo (thần túc), nghĩa là một phần của thần thông.
Dutiyenatthena iddhiyā pādoti iddhipādo.
In the second sense, it is the base of psychic power, hence iddhipādo.
Theo nghĩa thứ hai, pādo của iddhi là iddhipādo.
Pādoti patiṭṭhā, adhigamūpāyoti attho.
Pādo means a foundation, or a means of attainment.
Pādo (nghĩa là nền tảng) là nền tảng, nghĩa là phương tiện để đạt được.
Tena hi yasmā uparūpari visesasaṅkhātaṃ iddhiṃ pajjanti pāpuṇanti, tasmā pādoti vuccati.
For indeed, because they attain (pajjanti, pāpuṇanti) the higher and higher psychic power, which is a special quality, it is called pādo.
Vì nhờ đó mà người ta đạt được sự thành tựu, tức là sự ưu việt cao hơn, nên gọi là pādo.
Ete chandādayo pubbabhāge adhipativasena nānācittesu labbhanti, maggakkhaṇe pana saheva labbhanti.
These, beginning with desire, are found in various states of mind in the preliminary stage in the sense of dominance, but at the moment of the Path, they are found simultaneously.
Những dục và các pháp khác này được tìm thấy trong các tâm khác nhau ở giai đoạn đầu theo cách làm chủ, nhưng trong khoảnh khắc đạo, chúng được tìm thấy đồng thời.
Ijjhanaṭṭhoti nipphajjanaṭṭho patiṭṭhānaṭṭho vā.
The meaning of succeeding is the meaning of being accomplished or established.
Ijjhanaṭṭho (nghĩa là sự thành tựu) là nghĩa của sự hoàn thành hoặc sự thiết lập.
Saccānanti catunnaṃ ariyasaccānaṃ.
Of the Truths means of the four Noble Truths.
Saccānaṃ (nghĩa là các sự thật) là của bốn Thánh đế.
Tathaṭṭhoti yathāsabhāvaṭṭho.
The meaning of reality is the meaning of being as it is.
Tathaṭṭho (nghĩa là sự như thật) là nghĩa của sự như thật.
Imāni aṭṭha vissajjanāni lokiyalokuttaramissakāni.
These eight explanations are a mixture of mundane and supramundane.
Tám giải thích này là hỗn hợp của thế gian và siêu thế.
Payogānanti catunnaṃ ariyamaggapayogānaṃ.
Of the endeavors means of the four endeavors of the Noble Path.
Payogānaṃ (nghĩa là các sự thực hành) là của bốn sự thực hành Thánh đạo.
Paṭippassaddhaṭṭhoti catunnaṃ ariyaphalānaṃ paṭippassaddhaṭṭho.
The meaning of being subsided is the meaning of being subsided in the four Noble Fruits.
Paṭippassaddhaṭṭho (nghĩa là sự an tịnh) là nghĩa của sự an tịnh của bốn Thánh quả.
Maggapayogo hi phalakkhaṇe paṭippassaddho hoti niṭṭhitakiccattā.
For the endeavor of the Path subsides at the moment of the Fruit, because its task is completed.
Vì sự thực hành đạo được an tịnh trong khoảnh khắc quả do đã hoàn thành nhiệm vụ.
Maggapayogānaṃ phalodayena paṭippassaddhabhāvo vā.
Or, the subsidence of the Path's endeavors with the arising of the Fruit.
Hoặc là trạng thái an tịnh của các sự thực hành đạo do sự phát sinh của quả.
Phalānaṃ sacchikiriyaṭṭhoti ariyaphalānaṃ paccavekkhaṇavasena paccakkhakaraṇaṭṭho.
The meaning of realizing the Fruits is the meaning of making the Noble Fruits manifest through review.
Phalānaṃ sacchikiriyaṭṭho (nghĩa là sự chứng ngộ các quả) là nghĩa của việc chứng ngộ các Thánh quả bằng cách quán xét.
Ārammaṇasacchikiriyā vuttā hoti, phalakkhaṇe paṭilābhasacchikiriyā vā.
Realization of the object is stated, or realization of attainment at the moment of the Fruit.
Được nói là sự chứng ngộ đối tượng, hoặc là sự chứng ngộ đạt được trong khoảnh khắc quả.
Vitakkādīni pañca vissajjanāni jhānaṅgavasena niddiṭṭhāni.
The five explanations, beginning with Vitakkā (initial application), are stated in terms of the jhāna factors.
Năm giải thích từ Vitakka trở đi được trình bày theo khía cạnh của các chi thiền.
Vitakkanaṃ vitakko, ūhananti vuttaṃ hoti.
Thinking is vitakko, meaning conceiving.
Sự tầm cầu là Vitakko (Tầm), được nói là sự suy xét.
Vicaraṇaṃ vicāro, anusañcaraṇanti vuttaṃ hoti.
Pondering is vicāro, meaning repeatedly examining.
Sự tứ sát là Vicāro (Tứ), được nói là sự liên tục suy xét.
Upavicāraṭṭhoti anumajjanaṭṭho.
The meaning of close examination is the meaning of repeated investigation.
Upavicāraṭṭho (nghĩa là sự suy xét kỹ càng) là nghĩa của sự suy xét kỹ càng.
Abhisandanaṭṭhoti temanaṭṭho samādhivasena cittassa ekaggaṭṭho.
The meaning of pervading is the meaning of moistening, or the meaning of the mind's one-pointedness through concentration.
Abhisandanaṭṭho (nghĩa là sự làm ướt đẫm) là nghĩa của sự làm ướt đẫm, nghĩa là sự nhất tâm của tâm theo cách định tâm.
Āvajjanādīni pañcadasa vissajjanāni pakiṇṇakavasena niddiṭṭhāni.
The fifteen explanations, beginning with Āvajjanā (adverting), are stated as miscellaneous.
Mười lăm giải thích từ Āvajjanā trở đi được trình bày theo khía cạnh hỗn hợp.
Pañcadvāramanodvāresu bhavaṅgārammaṇato aññārammaṇe cittasantānaṃ namentānaṃ dvinnaṃ cittānaṃ āvajjanaṭṭho.
The meaning of adverting is of the two consciousnesses (the five-door adverting consciousness and the mind-door adverting consciousness) that incline the mind-continuum towards an object other than the bhavaṅga object, in the five sense doors and the mind door.
Āvajjanaṭṭho (nghĩa là sự hướng tâm) là nghĩa của sự hướng tâm của hai tâm hướng tâm đến một đối tượng khác với đối tượng của bhavaṅga (hộ kiếp) ở năm cửa và ý môn.
Viññāṇassa vijānanaṭṭho.
The meaning of cognizing is of consciousness.
Vijānanaṭṭho (nghĩa là sự nhận biết) của thức (viññāṇa).
Paññāya pajānanaṭṭho.
The meaning of knowing thoroughly is of wisdom.
Pajānanaṭṭho (nghĩa là sự hiểu biết) của tuệ (paññā).
Saññāya sañjānanaṭṭho.
The meaning of perceiving is of perception.
Sañjānanaṭṭho (nghĩa là sự ghi nhận) của tưởng (saññā).
Samādhissa ekodaṭṭho.
The meaning of one-pointedness is of concentration.
Ekodaṭṭho (nghĩa là sự nhất tâm) của định (samādhi).
Dutiyajjhānasmiñhi samādhi eko udetīti ekodīti vuccati, vitakkavicārehi anajjhāruḷhattā aggo seṭṭho hutvā uppajjatīti attho.
For in the second jhāna, concentration arises as supreme, hence it is called ekodī, meaning it is not overcome by vitakka and vicāra, but arises as excellent and supreme.
Vì trong thiền thứ hai, định phát sinh một cách ưu việt, nên được gọi là ekodī (nhất tâm), nghĩa là nó phát sinh trở thành tối thượng, cao quý do không bị tầm và tứ chế ngự.
Seṭṭhopi hi loke ekoti vuccati.
Indeed, even in the world, the supreme is called "one."
Trong thế gian, cái tối thượng cũng được gọi là eko.
Vitakkavicāravirahito vā eko asahāyo hutvā udetītipi vaṭṭati.
Alternatively, it is suitable to say that it arises as solitary, without companions, being free from vitakka and vicāra.
Hoặc cũng có thể là nó phát sinh một cách đơn độc, không có bạn đồng hành, do không có tầm và tứ.
Sabbopi vā kusalasamādhi nīvaraṇādīnaṃ uddhaccasseva vā paṭipakkhattā tehi anajjhāruḷhoti aggo hutvā udetīti vā tehi virahitoti asahāyo hutvā udetīti vā ekodīti yujjati.
Or, all wholesome concentration is called ekodī because it is not overcome by hindrances and so forth, or by uddhacca itself, thus arising as supreme, or because it is free from them, thus arising as solitary.
Hoặc tất cả các định thiện cũng được gọi là ekodī vì chúng không bị các triền cái và các pháp khác, hoặc chỉ riêng phóng dật, chế ngự, nên chúng phát sinh trở thành tối thượng, hoặc chúng phát sinh một cách đơn độc do không có chúng.
Abhiññāya ñātaṭṭhoti ñātapariññāya sabhāvajānanaṭṭho.
The meaning of knowing through direct knowledge is the meaning of knowing the inherent nature through ñāta-pariññā.
Abhiññāya ñātaṭṭho (nghĩa là sự hiểu biết bằng thắng trí) là nghĩa của sự hiểu biết bản chất bằng sự liễu tri (ñātapariññā).
Pariññāya tīraṇaṭṭhoti tīraṇapariññāya aniccādito upaparikkhaṇaṭṭho.
The meaning of discerning through full understanding is the meaning of examining thoroughly, beginning with impermanence, through tīraṇa-pariññā.
Pariññāya tīraṇaṭṭho (nghĩa là sự phân tích bằng liễu tri) là nghĩa của sự quán xét từ vô thường và các pháp khác bằng sự thẩm định (tīraṇapariññā).
Pahānassa pariccāgaṭṭhoti pahānapariññāya paṭipakkhapajahanaṭṭho.
The meaning of relinquishing through abandonment is the meaning of abandoning the opposing defilements through pahāna-pariññā.
Pahānassa pariccāgaṭṭho (nghĩa là sự từ bỏ bằng sự đoạn trừ) là nghĩa của sự từ bỏ đối thủ bằng sự đoạn trừ (pahānapariññā).
Samappavattāya bhāvanāya ekarasaṭṭho.
The meaning of having a single taste is of development that proceeds uniformly.
Ekarasaṭṭho (nghĩa là sự đồng vị) của sự tu tập vận hành đồng đều.
Phassanaṭṭhoti phusanaṭṭho vindanaṭṭho.
The meaning of contact is the meaning of touching, the meaning of experiencing.
Phassanaṭṭho (nghĩa là sự xúc chạm) là nghĩa của sự xúc chạm, nghĩa là sự cảm nhận.
Pīḷābhāravahanādinā khandhaṭṭho.
The meaning of aggregate is by way of suffering, carrying a burden, and so forth.
Khandhaṭṭho (nghĩa là uẩn) là nghĩa của uẩn do sự chịu đựng gánh nặng đau khổ và các pháp khác.
Suññādinā dhātuṭṭho.
The meaning of element is by way of emptiness and so forth.
Dhātuṭṭho (nghĩa là giới) là nghĩa của giới do sự trống rỗng và các pháp khác.
Sakasakamariyādāyatanādinā āyatanaṭṭho.
The meaning of base is by way of its own boundary, sphere, and so forth.
Āyatanaṭṭho (nghĩa là xứ) là nghĩa của xứ do sự mở rộng giới hạn của riêng mỗi cái và các pháp khác.
Paccayehi saṅgamma katavasena saṅkhataṭṭho.
The meaning of conditioned is by way of being made by the coming together of conditions.
Saṅkhataṭṭho (nghĩa là hữu vi) là nghĩa của hữu vi do được tạo thành bởi sự kết hợp của các duyên.
Tabbiparītena asaṅkhataṭṭho.
The meaning of unconditioned is by the opposite of that.
Asaṅkhataṭṭho (nghĩa là vô vi) là nghĩa của vô vi do trái ngược với điều đó.
14. Cittaṭṭhādīni pañcadasa vissajjanāni cittasambandhena niddiṭṭhāni.
14. The fifteen elucidations, beginning with the meaning of citta, are explained in relation to citta.
14. Mười lăm giải thích từ Cittaṭṭhā trở đi được trình bày theo sự liên hệ với tâm.
Cittaṭṭhoti ettha ārammaṇaṃ cintetīti cittaṃ, vijānātīti attho.
Here, in " the meaning of citta," citta means it thinks of the object, which is to say, it cognizes.
Trong Cittaṭṭho (nghĩa là tâm) này, cittaṃ là cái suy nghĩ về đối tượng, nghĩa là cái nhận biết.
Yaṃ panettha javanaṃ hoti, taṃ javanavīthivasena attano santānaṃ cinotītipi cittaṃ, yaṃ vipākaṃ hoti, taṃ kammakilesehi citantipi cittaṃ, sabbampi yathānurūpaṃ cittatāya cittaṃ, cittakaraṇatāya cittaṃ, yaṃ vaṭṭassa paccayo hoti, taṃ saṃsāradukkhaṃ cinotītipi cittaṃ.
Moreover, whatever javana there is, that citta also means it accumulates its own continuum by way of the javana process, or whatever vipāka there is, that citta also means it is accumulated by kamma and defilements; all citta, according to its nature, is citta by its variegated nature, citta by its nature of making variegated; whatever is a condition for the round of existence, that citta also means it accumulates the suffering of saṃsāra.
Ở đây, cái nào là javana (tốc hành tâm), thì tâm ấy được gọi là citta (tâm) vì nó tích lũy dòng tục sinh của chính mình theo lộ trình javana. Cái nào là vipāka (quả), thì tâm ấy cũng được gọi là citta vì nó được tích lũy bởi nghiệp và phiền não. Tất cả đều là citta do bản chất đa dạng của nó, là citta do khả năng tạo ra sự đa dạng. Cái nào là duyên cho vòng luân hồi (vaṭṭa), thì tâm ấy cũng được gọi là citta vì nó tích lũy khổ đau của luân hồi (saṃsāra).
Evaṃ ārammaṇe cittatādito cittaṭṭho.
Thus, the meaning of citta is by way of its variegated nature regarding the object, and so forth.
Như vậy, cittaṭṭha (ý nghĩa của tâm) là do sự đa dạng của tâm trong đối tượng (ārammaṇa) và các yếu tố khác.
Cittuppādane phaluppādane vā nāssa antaramatthīti anantaraṃ, anantarassa bhāvo ānantariyaṃ, cittassa ānantariyaṃ cittānantariyaṃ, so cittānantariyaṭṭho. Arahato cuticittaṃ vajjetvā yassa kassaci samanantaraniruddhassa cittassa anantaracittuppādane samatthabhāvo maggacittassa anantaraṃ phaluppādane samatthabhāvoti adhippāyo. Cittassa vuṭṭhānaṭṭhoti gotrabhucittassa nimittato, maggacittassa nimittapavattato vuṭṭhānaṭṭho.
There is no interval in the arising of consciousness or the arising of fruition for such a one, hence it is anantara. The state of being anantara is ānantariya. The ānantariya of citta is cittānantariya; that is the meaning of cittānantariya. The intention is the ability of any immediately ceased consciousness (except the cuti-citta of an Arahant) to cause the arising of the next consciousness, and the ability of the path-consciousness to cause the arising of fruition immediately after it. The meaning of the rising up of consciousness is the rising up of the gotrabhū-citta from the sign, and the rising up of the magga-citta from the occurrence of the sign.
Không có khoảng cách giữa sự phát sinh của tâm và sự phát sinh của quả, nên nó là anantara (không gián đoạn). Trạng thái không gián đoạn là ānantariya. Sự không gián đoạn của tâm là cittānantariya. Đó là cittānantariyaṭṭha (ý nghĩa của sự không gián đoạn của tâm). Ý nghĩa là khả năng của bất kỳ tâm nào đã diệt ngay lập tức (samanantaraniruddha), ngoại trừ tâm tử (cuticitta) của A-la-hán, để làm phát sinh tâm kế tiếp (anantaracittuppādane), và khả năng làm phát sinh quả (phaluppādane) ngay sau tâm Đạo (maggacitta). Cittassa vuṭṭhānaṭṭha (ý nghĩa của sự thoát ly của tâm) là sự thoát ly của gotrabhucitta (chuyển tộc tâm) khỏi nimitta (tướng) của các hành (saṅkhāra), và sự thoát ly của maggacitta (Đạo tâm) khỏi nimitta (tướng) và sự hiện hữu của các hành (saṅkhāra) và các uẩn danh (nāmakhandha) của quả (vipāka).
Cittassa vivaṭṭanaṭṭhoti tasseva cittadvayassa yathāvuttato vuṭṭhitassa nibbāne vivaṭṭanaṭṭho.
The meaning of the turning away of consciousness is the turning away of those two consciousnesses, having risen up as stated, towards Nibbāna.
Cittassa vivaṭṭanaṭṭha (ý nghĩa của sự xoay chuyển của tâm) là sự xoay chuyển của hai tâm (gotrabhucitta và maggacitta) đã thoát ly như đã nói ở trên, hướng về Nibbāna.
Cittassa hetuṭṭhoti cittassa hetupaccayabhūtānaṃ navannaṃ hetūnaṃ hetuṭṭho.
The meaning of the root of consciousness is the meaning of the root of the nine roots that are the root-conditions for consciousness.
Cittassa hetuṭṭha (ý nghĩa của nhân của tâm) là ý nghĩa của chín nhân (hetu) thiện, bất thiện, vô ký, là nhân duyên (hetupaccaya) của tâm.
Cittassa paccayaṭṭhoti cittassa vatthārammaṇādīnaṃ anekesaṃ paccayānaṃ paccayaṭṭho.
The meaning of the condition of consciousness is the meaning of the condition of the many conditions of consciousness, such as the base and the object.
Cittassa paccayaṭṭha (ý nghĩa của duyên của tâm) là ý nghĩa của nhiều duyên của tâm, như vatthu (nền tảng) và ārammaṇa (đối tượng).
Cittassa vatthuṭṭhoti cittassa vatthubhūtānaṃ cakkhusotaghānajivhākāyahadayavatthūnaṃ vatthuṭṭho.
The meaning of the base of consciousness is the meaning of the base of the eye-base, ear-base, nose-base, tongue-base, body-base, and heart-base, which are the bases for consciousness.
Cittassa vatthuṭṭha (ý nghĩa của nền tảng của tâm) là ý nghĩa của các nền tảng của tâm, như nhãn căn, nhĩ căn, tỷ căn, thiệt căn, thân căn và ý căn.
Cittassa bhūmaṭṭhoti cittassa uppattidesavasena kāmāvacarādibhūmiattho.
The meaning of the plane of consciousness is the meaning of the plane, such as the kāma-plane, by way of the place of origin of consciousness.
Cittassa bhūmaṭṭha (ý nghĩa của cõi của tâm) là ý nghĩa của các cõi như kāmāvacara (Dục giới) theo cách thức là nơi phát sinh của tâm, hoặc là ý nghĩa của các cõi như kāmāvacara (Dục giới) theo cách thức là nơi phát sinh của tâm, tức là tập hợp ba uẩn như thọ (vedanā), hoặc là ý nghĩa của các cõi như Dục giới.
Cittassa ārammaṇaṭṭhoti rūpādiārammaṇaṭṭho.
The meaning of the object of consciousness is the meaning of the object, such as rūpa.
Cittassa ārammaṇaṭṭha (ý nghĩa của đối tượng của tâm) là ý nghĩa của các đối tượng như sắc (rūpa) và các đối tượng khác.
Paricitassārammaṇassa sañcaraṇaṭṭhānaṭṭhena gocaraṭṭho.
The meaning of domain is the place where the familiar object moves about.
Gocaraṭṭha (ý nghĩa của phạm vi hoạt động) là ý nghĩa của nơi mà đối tượng đã quen thuộc (paricita) thường xuyên hoạt động, hoặc là ý nghĩa của nơi mà tâm, tức là sự phòng hộ (saṃvara), hoạt động.
Upari vuttaviññāṇacariyāvasena cariyaṭṭho.
The meaning of conduct is by way of the conduct of viññāṇa mentioned above.
Cariyaṭṭha (ý nghĩa của hành vi) là ý nghĩa của hành vi (cariya) của thức (viññāṇa) sẽ được nói ở trên.
Atha vā payogasamudācāraṭṭho cariyaṭṭho.
Alternatively, the meaning of conduct is the meaning of application and practice.
Hoặc, cariyaṭṭha là ý nghĩa của hành vi (cariya) của sự phối hợp (samudācāra) các tâm sở (cetasika) tương ưng (sampayutta) hoặc là ý nghĩa của hành vi (cariya).
Cittassa gamanābhāvepi dūrasantikārammaṇagahaṇavasena gataṭṭho.
Even though consciousness does not move, the meaning of having gone is by way of grasping distant and near objects.
Mặc dù tâm không đi đến nơi khác, nhưng gataṭṭha (ý nghĩa của sự đi) là ý nghĩa của sự nắm bắt đối tượng xa và gần.
Abhinīhāraṭṭhoti gahitārammaṇato aññārammaṇamanasikāratthaṃ cittassa abhinīharaṇaṭṭho.
The meaning of drawing forth is the meaning of drawing forth consciousness for the purpose of attending to an object other than the grasped object.
Abhinīhāraṭṭha (ý nghĩa của sự hướng tới) là ý nghĩa của sự hướng tâm đến việc tác ý một đối tượng khác từ đối tượng đã nắm bắt, hoặc là ý nghĩa của sự phát sinh của việc tác ý một đối tượng khác.
Cittassa niyyānaṭṭhoti maggacittassa vaṭṭato niyyānaṭṭho.
The meaning of going forth of consciousness is the going forth of the path-consciousness from the round of existence.
Cittassa niyyānaṭṭha (ý nghĩa của sự thoát ly của tâm) là ý nghĩa của sự thoát ly của Đạo tâm (maggacitta) khỏi vòng luân hồi (vaṭṭa).
‘‘Nekkhammaṃ paṭiladdhassa kāmacchandato cittaṃ nissaṭaṃ hotī’’tiādinā (paṭi. ma. 1.24, 191 thokaṃ visadisaṃ) nayena cittassa nissaraṇaṭṭho.
The meaning of escape of consciousness is by the method beginning with "For one who has attained renunciation, the mind is freed from sensual desire."
Cittassa nissaraṇaṭṭha (ý nghĩa của sự giải thoát của tâm) là theo cách thức như: “Tâm của người đã đạt được viễn ly (nekkhamma) thoát khỏi dục tham (kāmacchanda)” và các câu tương tự.
15. Ekattādīni dvācattālīsa vissajjanāni ekattasambandhena niddiṭṭhāni.
15. The forty-two explanations, beginning with ekattā, are described in relation to ekatta.
15. Bốn mươi hai lời giải thích bắt đầu bằng ekatta và các từ khác được giải thích theo mối quan hệ với ekatta.
Ekatteti ārammaṇekatte, ekārammaṇeti attho.
Ekatte means oneness of object, i.e., having a single object.
Ekatte (trong sự hợp nhất) có nghĩa là trong sự hợp nhất của đối tượng (ārammaṇa), tức là trong một đối tượng duy nhất.
Paṭhamajjhānavasena pakkhandanaṭṭho.
The meaning of entering by way of the first jhāna.
Pakkhandanaṭṭha (ý nghĩa của sự thâm nhập) là theo thiền thứ nhất.
Dutiyajjhānavasena pasīdanaṭṭho.
The meaning of clarifying by way of the second jhāna.
Pasīdanaṭṭha (ý nghĩa của sự trong sạch) là theo thiền thứ hai.
Tatiyajjhānavasena santiṭṭhanaṭṭho.
The meaning of firmly establishing by way of the third jhāna.
Santiṭṭhanaṭṭha (ý nghĩa của sự an trú vững chắc) là theo thiền thứ ba.
Catutthajjhānavasena muccanaṭṭho.
The meaning of releasing by way of the fourth jhāna.
Muccanaṭṭha (ý nghĩa của sự giải thoát) là theo thiền thứ tư.
Paccavekkhaṇavasena etaṃ santanti passanaṭṭho.
The meaning of seeing "this is peaceful" by way of reviewing.
Passanaṭṭha (ý nghĩa của sự thấy) là thấy rằng "điều này là an tịnh" theo cách quán xét.
Yānīkataṭṭhādayo pañca samādhissa vasībhāvavisesā.
The five special aspects of mastery of samādhi begin with yānīkataṭṭha.
Yānīkataṭṭha và năm trạng thái khác là những đặc điểm của sự thuần thục (vasībhāva) của định (samādhi).
Yānīkataṭṭhoti yuttayānasadisakataṭṭho.
Yānīkataṭṭha means the state of being made like a well-yoked vehicle.
Yānīkataṭṭha (ý nghĩa của sự đã được làm thành cỗ xe) là ý nghĩa của sự đã được làm giống như một cỗ xe đã được điều khiển.
Vatthukataṭṭhoti patiṭṭhaṭṭhena vatthu viya kataṭṭho.
Vatthukataṭṭha means the state of being made like a basis by way of being established.
Vatthukataṭṭha (ý nghĩa của sự đã được làm thành nền tảng) là ý nghĩa của sự đã được làm như một nền tảng theo ý nghĩa của sự an trú.
Anuṭṭhitaṭṭhoti paccupaṭṭhitaṭṭho.
Anuṭṭhitaṭṭha means the state of being present.
Anuṭṭhitaṭṭha (ý nghĩa của sự đã được hiện diện) là ý nghĩa của sự đã được hiện diện.
Paricitaṭṭhoti samantato citaṭṭho.
Paricitaṭṭha means the state of being developed from all sides.
Paricitaṭṭha (ý nghĩa của sự đã được tu tập) là ý nghĩa của sự đã được tu tập khắp nơi, hoặc là ý nghĩa của sự đã được phát triển từ mọi phía.
Susamāraddhaṭṭhoti suṭṭhu samāraddhaṭṭho, sukataṭṭhoti attho.
Susamāraddhaṭṭha means the state of being well-undertaken; that is, the state of being well-practiced.
Susamāraddhaṭṭha (ý nghĩa của sự đã được bắt đầu tốt đẹp) là ý nghĩa của sự đã được bắt đầu rất tốt đẹp, tức là ý nghĩa của sự đã được làm tốt đẹp.
Āvajjanasamāpajjanaadhiṭṭhānavuṭṭhānapaccavekkhaṇavasitāvasena vā paṭipāṭiyā pañca padāni yojetabbāni.
Alternatively, the five terms should be linked in sequence by way of the mastery of advertence, attainment, determination, emergence, and reviewing.
Hoặc, năm thuật ngữ này nên được kết hợp theo thứ tự với các năng lực (vasitā) là āvajjanā (hướng tâm), samāpajjanā (nhập định), adhiṭṭhānā (kiên định), vuṭṭhānā (xuất định), và paccavekkhaṇā (quán xét).
Kasiṇādiārammaṇabhāvanāya sikhāppattakāle cittacetasikānaṃ pariggahaparivāraparipūraṭṭho.
Pariggahaparivāraparipūraṭṭha is the meaning of the mind and mental factors being encompassed, surrounded, and fulfilled when the meditation on kasiṇa and other objects reaches its peak.
Pariggahaparivāraparipūraṭṭha (ý nghĩa của sự nắm giữ, bao quanh và hoàn thiện) là sự nắm giữ, bao quanh và hoàn thiện của tâm và các tâm sở (cittacetasika) khi sự tu tập đối tượng như kasiṇa đạt đến đỉnh cao, tức là khi đạt đến cận định (upacāra-jhāna) và an định (appanā-jhāna).
Tesaṃyeva sammā samāhitattā ekārammaṇe samosaraṇena samodhānaṭṭho. Tesaṃyeva balappattiyā ārammaṇaṃ abhibhavitvā patiṭṭhānavasena adhiṭṭhānaṭṭho.
Samodhānaṭṭha is the meaning of their coming together on a single object due to their being rightly concentrated. Adhiṭṭhānaṭṭha is the meaning of their becoming established by overpowering the object due to their having attained strength.
Samodhānaṭṭha (ý nghĩa của sự hòa hợp) là sự hòa hợp của chính những tâm và tâm sở đó, do đã được định tâm đúng đắn, tụ hội vào một đối tượng duy nhất. Adhiṭṭhānaṭṭha (ý nghĩa của sự an trú vững chắc) là sự an trú của chính những tâm và tâm sở đó, do đã đạt được sức mạnh, vượt qua đối tượng như kasiṇa hoặc tướng đối phần (paṭibhāga-nimitta) hiện ra.
Samathassa vipassanāya vā ādito, ādarena vā sevanavasena āsevanaṭṭho.
Āsevanaṭṭha means the meaning of serving or frequenting, either from the beginning of samatha or vipassanā, or by way of diligent practice.
Āsevanaṭṭha (ý nghĩa của sự thực hành) là sự thực hành samatha (tịnh chỉ) hoặc vipassanā (quán) từ ban đầu, hoặc sự thực hành với sự tôn kính.
Vaḍḍhanavasena bhāvanaṭṭho.
Bhāvanaṭṭha means the meaning of development by way of increase.
Bhāvanaṭṭha (ý nghĩa của sự tu tập) là theo cách phát triển.
Punappunaṃ karaṇavasena bahulīkammaṭṭho.
Bahulīkammaṭṭha means the meaning of frequent practice by way of doing it again and again.
Bahulīkammaṭṭha (ý nghĩa của sự thực hành nhiều lần) là theo cách thực hành lặp đi lặp lại.
Bahulīkatassa suṭṭhu samuṭṭhitavasena susamuggataṭṭho.
Susamuggataṭṭha means the meaning of well-arisen by way of the well-arising of that which has been frequently practiced.
Susamuggataṭṭha (ý nghĩa của sự phát sinh tốt đẹp) là theo cách phát sinh rất tốt đẹp của pháp đã được thực hành nhiều lần, hoặc theo cách phát sinh của Đạo Tu-đà-hoàn trong dòng tâm thức của chính mình.
Susamuggatassa paccanīkehi suṭṭhu vimuttivasena ārammaṇe ca suṭṭhu adhimuttivasena suvimuttaṭṭho.
Suvimuttaṭṭha means the meaning of well-liberated by way of being well-freed from adversaries and well-inclined towards the object for that which is well-arisen.
Suvimuttaṭṭha (ý nghĩa của sự giải thoát hoàn toàn) là theo cách giải thoát hoàn toàn khỏi các phiền não đối nghịch, và theo cách hoàn toàn chú tâm vào Nibbāna, đối tượng của người đã đạt được Đạo Tu-đà-hoàn.
Bujjhanaṭṭhādīni cattāri padāni bojjhaṅgavasena vuttāni.
The four terms, beginning with bujjhanaṭṭha, are stated by way of the bojjhaṅgas.
Bốn thuật ngữ bắt đầu bằng bujjhanaṭṭha và các từ khác được nói theo ý nghĩa của các chi giác ngộ (bojjhaṅga).
Sotāpattimaggabojjhaṅgānaṃ bujjhanaṭṭho.
Bujjhanaṭṭha is the meaning of knowing for the bojjhaṅgas of the Stream-entry path.
Bujjhanaṭṭha (ý nghĩa của sự giác ngộ) là của các chi giác ngộ thuộc Đạo Tu-đà-hoàn (sotāpattimagga-bojjhaṅga).
Sakadāgāmimaggabojjhaṅgānaṃ anubujjhanaṭṭho.
Anubujjhanaṭṭha is the meaning of knowing in accordance with the Stream-entry path for the bojjhaṅgas of the Once-returning path.
Anubujjhanaṭṭha (ý nghĩa của sự giác ngộ theo sau) là của các chi giác ngộ thuộc Đạo Tư-đà-hàm (sakadāgāmimagga-bojjhaṅga).
Anāgāmimaggabojjhaṅgānaṃ paṭibujjhanaṭṭho.
Paṭibujjhanaṭṭha is the meaning of penetrating knowledge for the bojjhaṅgas of the Non-returning path.
Paṭibujjhanaṭṭha (ý nghĩa của sự giác ngộ thấu triệt) là của các chi giác ngộ thuộc Đạo A-na-hàm (anāgāmimagga-bojjhaṅga).
Arahattamaggabojjhaṅgānaṃ sambujjhanaṭṭho.
Sambujjhanaṭṭha is the meaning of perfect knowledge for the bojjhaṅgas of the Arahantship path.
Sambujjhanaṭṭha (ý nghĩa của sự giác ngộ hoàn toàn) là của các chi giác ngộ thuộc Đạo A-la-hán (arahattamagga-bojjhaṅga).
Vipassanābojjhaṅgānaṃ vā bujjhanaṭṭho.
Alternatively, bujjhanaṭṭha is the meaning of knowing for the bojjhaṅgas of vipassanā.
Hoặc, bujjhanaṭṭha là của các chi giác ngộ thuộc tuệ quán (vipassanā-bojjhaṅga).
Dassanamaggabojjhaṅgānaṃ anubujjhanaṭṭho.
Anubujjhanaṭṭha is the meaning of knowing appropriately for the bojjhaṅgas of the path of vision.
Anubujjhanaṭṭha là của các chi giác ngộ thuộc Đạo Kiến (dassana-magga-bojjhaṅga).
Bhāvanāmaggabojjhaṅgānaṃ paṭibujjhanaṭṭho.
Paṭibujjhanaṭṭha is the meaning of penetrating knowledge for the bojjhaṅgas of the path of development.
Paṭibujjhanaṭṭha là của các chi giác ngộ thuộc Đạo Tu (bhāvanā-magga-bojjhaṅga).
Phalabojjhaṅgānaṃ sambujjhanaṭṭho.
Sambujjhanaṭṭha is the meaning of perfect knowledge for the bojjhaṅgas of the fruition.
Sambujjhanaṭṭha là của các chi giác ngộ thuộc quả (phala-bojjhaṅga).
Yathāvuttanayeneva bojjhaṅgānaṃ tassa tassa puggalassa bodhanādikaraṇena bodhanaṭṭhādayo cattāro atthā veditabbā.
In the aforementioned manner, the four meanings, beginning with bodhanaṭṭha, should be understood as the bojjhaṅgas causing the awakening of each individual.
Bốn ý nghĩa bắt đầu bằng bodhanaṭṭha và các ý nghĩa khác nên được hiểu là do sự giác ngộ, v.v., của mỗi cá nhân (puggalassa) đó, bởi chính các chi giác ngộ (bojjhaṅga) đã được nói theo cách thức như vậy, hoặc theo cách thức là nhân chủ động (hetukattu).
Yathāvuttānaṃyeva bojjhaṅgānaṃ bujjhanaṭṭhena ‘‘bodho’’ti laddhanāmassa puggalassa pakkhe bhavattā bodhipakkhiyā nāma.
The bojjhaṅgas, being the aforementioned, are called bodhipakkhiyā because they are in the sphere of the individual who has attained the name "bodha" (awakening) by way of the meaning of knowing.
Do ý nghĩa của sự giác ngộ của các chi giác ngộ đã được nói như vậy, nên chúng được gọi là bodhipakkhiyā (pháp trợ Bồ-đề) vì chúng thuộc về người đã đạt được danh hiệu "bodhi" (giác ngộ), tức là người Tu-đà-hoàn, hoặc vì chúng hiện hữu như một ân huệ cho người đó.
Tesaṃ yathāvuttānaṃyeva bodhipakkhiyaṭṭhādayo cattāro atthā veditabbā.
The four meanings, beginning with bodhipakkhiyaṭṭha, of these very bojjhaṅgas, as stated, should be understood.
Bốn ý nghĩa bắt đầu bằng bodhipakkhiyaṭṭha và các ý nghĩa khác của chính những pháp trợ Bồ-đề đã được nói như vậy nên được hiểu.
Vipassanāpaññāvasena jotanaṭṭho.
Jotanaṭṭha is the meaning of illuminating by way of vipassanā wisdom.
Jotanaṭṭha (ý nghĩa của sự chiếu sáng) là theo tuệ quán (vipassanā-paññā).
Kamato catumaggapaññāvasena ujjotanānujjotanapaṭijjotanasañjotanaṭṭho.
Ujjotanānujjotanapaṭijjotanasañjotanaṭṭha is the meaning of illuminating, further illuminating, counter-illuminating, and perfectly illuminating, in sequence, by way of the wisdom of the four paths.
Theo thứ tự, ujjotanānujjotanapaṭijjotanasañjotanaṭṭha (ý nghĩa của sự phát sáng, sự tiếp tục phát sáng, sự phản chiếu sáng và sự chiếu sáng hoàn toàn) là theo tuệ của bốn Đạo (catumagga-paññā).
Kamato catumaggapaññāvasena vā jotanaṭṭhādayo, phalapaññāvasena sañjotanaṭṭho veditabbo.
Alternatively, the meanings beginning with jotanaṭṭha should be understood in sequence by way of the wisdom of the four paths, and sañjotanaṭṭha by way of the wisdom of fruition.
Hoặc, các ý nghĩa bắt đầu bằng jotanaṭṭha và các ý nghĩa khác là theo thứ tự tuệ của bốn Đạo, và sañjotanaṭṭha nên được hiểu là theo tuệ của quả (phala-paññā).
16. Patāpanaṭṭhādīni aṭṭhārasa vissajjanāni ariyamaggavasena niddiṭṭhāni.
16. The eighteen explanations, beginning with patāpanaṭṭha, are described by way of the Noble Path.
16. Mười tám lời giải thích bắt đầu bằng patāpanaṭṭha và các từ khác được giải thích theo ý nghĩa của Thánh Đạo (ariyamagga).
Ariyamaggo hi yassuppajjati, taṃ patāpeti pabhāseti virocāpetīti patāpano, tassa patāpanaṭṭho.
The Noble Path, when it arises for someone, makes them shine, illumines them, and makes them radiant; thus, it is patāpana, and patāpanaṭṭha is its meaning of radiance.
Thánh Đạo (ariyamagga) làm cho người mà nó phát sinh trở nên rạng rỡ, chiếu sáng, chói lọi, nên nó được gọi là patāpana (sự rạng rỡ). Do đó, patāpanaṭṭha là ý nghĩa của sự rạng rỡ của Thánh Đạo.
Tasseva atipabhassarabhāvena sayaṃ virocanaṭṭho.
Virocanaṭṭha is the meaning of its own radiance due to its exceeding brilliance.
Virocanaṭṭha (ý nghĩa của sự tự chói lọi) là sự tự chói lọi của chính Thánh Đạo do bản chất cực kỳ sáng chói của nó.
Kilesānaṃ visosanena santāpanaṭṭho.
Santāpanaṭṭha is the meaning of burning up defilements by drying them out.
Santāpanaṭṭha (ý nghĩa của sự thiêu đốt) là sự thiêu đốt các phiền não bằng cách làm chúng khô héo.
Amalanibbānārammaṇattā amalaṭṭho.
Amalaṭṭha is the meaning of being stainless due to having the undefiled Nibbāna as its object.
Amalaṭṭha (ý nghĩa của sự không ô nhiễm) là do Nibbāna không ô nhiễm là đối tượng.
Sampayuttamalābhāvena vimalaṭṭho.
Vimalaṭṭha is the meaning of being free from defilement due to the absence of associated defilements.
Vimalaṭṭha (ý nghĩa của sự không vết nhơ) là do không có phiền não tương ưng (sampayuttamala).
Ārammaṇakaraṇamalābhāve nimmalaṭṭho.
Nimmalaṭṭha is the meaning of being without defilement due to the absence of defilements that cause it to be an object.
Nimmalaṭṭha (ý nghĩa của sự không tì vết) là do không có phiền não tạo tác đối tượng (ārammaṇakaraṇamala).
Atha vā sotāpattimaggassa amalaṭṭho.
Alternatively, amalaṭṭha is the meaning for the Stream-entry path.
Hoặc, amalaṭṭha là của Đạo Tu-đà-hoàn (sotāpattimagga).
Sakadāgāmianāgāmimaggānaṃ vimalaṭṭho.
Vimalaṭṭha is the meaning for the Once-returning and Non-returning paths.
Vimalaṭṭha là của Đạo Tư-đà-hàm và A-na-hàm (sakadāgāmianāgāmimagga).
Arahattamaggassa nimmalaṭṭho.
Nimmalaṭṭha is the meaning for the Arahantship path.
Nimmalaṭṭha là của Đạo A-la-hán (arahattamagga).
Atha vā sāvakamaggassa amalaṭṭho.
Alternatively, amalaṭṭha is the meaning for the path of a disciple.
Hoặc, amalaṭṭha là của Đạo Thanh Văn (sāvakamagga).
Paccekabuddhamaggassa vimalaṭṭho.
Vimalaṭṭha is the meaning for the path of a Paccekabuddha.
Vimalaṭṭha là của Đạo Độc Giác Phật (paccekabuddhamagga).
Sammāsambuddhamaggassa nimmalaṭṭho.
Nimmalaṭṭha is the meaning for the path of a Sammāsambuddha.
Nimmalaṭṭha là của Đạo Chánh Đẳng Giác Phật (sammāsambuddhamagga).
Kilesavisamābhāvena samaṭṭho.
Samaṭṭha is the meaning of being even due to the absence of unevenness of defilements.
Samaṭṭha (ý nghĩa của sự bình đẳng) là do không có sự bất bình đẳng của các phiền não.
‘‘Sammā mānābhisamayā’’tiādīsu (ma. ni. 1.28; a. ni. 3.33; 5.200) viya kilesappahānaṭṭhena samayaṭṭho.
Samayaṭṭha is the meaning of abandoning by way of the abandonment of defilements, as in "rightly overcoming conceit" and so on.
Samayaṭṭha (ý nghĩa của sự diệt trừ) là ý nghĩa của sự diệt trừ các phiền não, như trong các đoạn kinh "Sammā mānābhisamayā" (sự diệt trừ kiêu mạn đúng đắn) và các đoạn tương tự.
Vikkhambhanatadaṅgasamucchedapaṭippassaddhinissaraṇasaṅkhātesu pañcasu vivekesu samucchedavivekattā vivekaṭṭho, vinābhāvaṭṭho.
Among the five kinds of seclusion, namely, suppression, temporary abandonment, complete eradication, tranquilisation, and escape, it is called seclusion (vivekaṭṭho) due to being seclusion by complete eradication (samucchedaviveka), meaning separation.
Vivekaṭṭha (ý nghĩa của sự viễn ly), tức là ý nghĩa của sự tách rời, là do nó là sự viễn ly đoạn diệt (samucchedaviveka) trong năm loại viễn ly: vikkhambhana (trấn áp), tadaṅga (đoạn phần), samuccheda (đoạn diệt), paṭippassaddhi (tịnh chỉ), và nissaraṇa (giải thoát).
Nissaraṇaviveke nibbāne caraṇato vivekacariyaṭṭho.
It is called seclusion-practice (vivekacariyaṭṭho) due to its course in Nibbāna, which is the seclusion of escape.
Vivekacariyaṭṭha (ý nghĩa của hành vi viễn ly) là do nó hoạt động trong Nibbāna, là sự viễn ly giải thoát (nissaraṇaviveka).
Pañcasu virāgesu samucchedavirāgattā virāgaṭṭho, virajjanaṭṭho.
Among the five kinds of dispassion, it is called dispassion (virāgaṭṭho) due to being dispassion by complete eradication (samucchedavirāga), meaning detachment.
Virāgaṭṭha (ý nghĩa của sự ly tham), tức là ý nghĩa của sự không còn tham ái, là do nó là sự ly tham đoạn diệt (samucchedavirāga) trong năm loại ly tham.
Nissaraṇavirāge nibbāne caraṇato virāgacariyaṭṭho.
It is called dispassion-practice (virāgacariyaṭṭho) due to its course in Nibbāna, which is the dispassion of escape.
Virāgacariyaṭṭha (ý nghĩa của hành vi ly tham) là do nó hoạt động trong Nibbāna, là sự ly tham giải thoát (nissaraṇavirāga).
Pañcasu nirodhesu samucchedanirodhattā nirodhaṭṭho.
Among the five kinds of cessation, it is called cessation (nirodhaṭṭho) due to being cessation by complete eradication (samucchedanirodha).
Nirodhaṭṭha (ý nghĩa của sự đoạn diệt) là do nó là sự đoạn diệt đoạn tận (samucchedanirodha) trong năm loại đoạn diệt.
Dukkhanirodhe nibbāne caraṇato nirodhacariyaṭṭho.
It is called cessation-practice (nirodhacariyaṭṭho) due to its course in Nibbāna, which is the cessation of suffering.
Do hành trì trong Nibbāna, sự diệt khổ, nên có nghĩa là hành nirodha (diệt trừ).
Pariccāgapakkhandanavosaggattā vosaggaṭṭho.
It is called relinquishment (vosaggaṭṭho) due to being abandonment, penetration, and giving up.
Do sự buông bỏ (vosagga) là sự từ bỏ (pariccāga) và sự hướng đến (pakkhandana), nên có nghĩa là buông bỏ (vosagga).
Ariyamaggo hi samucchedavasena kilesappahānato pariccāgavosaggo, ārammaṇakaraṇena nibbānapakkhandanato pakkhandanavosaggo ca.
For the Noble Path, indeed, it is relinquishment by abandonment (pariccāgavosagga) due to the abandonment of defilements by way of complete eradication, and it is relinquishment by penetration (pakkhandanavosagga) due to penetrating Nibbāna by making it an object.
Thật vậy, Bát Chánh Đạo là sự từ bỏ (pariccāga-vosagga) do sự đoạn trừ phiền não bằng cách nhổ tận gốc rễ (samuccheda), và là sự hướng đến (pakkhandana-vosagga) do hướng đến Nibbāna bằng cách lấy Nibbāna làm đối tượng.
Vipassanā pana tadaṅgavasena kilesappahānato pariccāgavosaggo, tanninnabhāvena nibbānapakkhandanato pakkhandanavosaggo.
However, insight (vipassanā) is relinquishment by abandonment (pariccāgavosagga) due to the abandonment of defilements by way of temporary abandonment (tadaṅga), and it is relinquishment by penetration (pakkhandanavosagga) due to penetrating Nibbāna by inclining towards it.
Còn vipassanā là sự từ bỏ (pariccāga-vosagga) do sự đoạn trừ phiền não bằng cách từng phần (tadaṅga), và là sự hướng đến (pakkhandana-vosagga) do khuynh hướng hướng về Nibbāna.
Na so idha adhippeto.
That is not intended here.
Điều đó không được đề cập ở đây.
Vosaggabhāvena caraṇato vosaggacariyaṭṭho.
It is called relinquishment-practice (vosaggacariyaṭṭho) due to its course by way of relinquishment.
Do hành trì với tính chất buông bỏ (vosagga), nên có nghĩa là hành vosagga (buông bỏ).
Pañcasu vimuttīsu samucchedavimuttittā vimuttaṭṭho.
Among the five kinds of liberation, it is called liberation (vimuttaṭṭho) due to being liberation by complete eradication (samucchedavimutti).
Do là sự giải thoát đoạn trừ (samuccheda-vimutti) trong năm loại giải thoát, nên có nghĩa là giải thoát (vimutta).
Nissaraṇavimuttiyaṃ caraṇato vimutticariyaṭṭho.
It is called liberation-practice (vimutticariyaṭṭho) due to its course in the liberation of escape (nissaraṇavimutti).
Do hành trì trong sự giải thoát xuất ly (nissaraṇa-vimutti), nên có nghĩa là hành vimutti (giải thoát).
Chandavīriyacittavīmaṃsāsaṅkhātesu catūsu iddhipādesu ekekaiddhipādavasena dasa dasa katvā caturiddhipādavasena chandaṭṭhādīni cattālīsa vissajjanāni niddiṭṭhāni.
Forty explanations, such as desire (chandaṭṭha), have been designated according to the four bases of spiritual power (iddhipāda)—desire, effort, consciousness, and investigation—with ten explanations for each base of spiritual power.
Bốn mươi cách giải thích về chandaṭṭha (ý muốn) v.v. đã được trình bày theo bốn iddhipāda (thần túc) là ý muốn (chanda), tinh tấn (vīriya), tâm (citta) và quán sát (vīmaṃsā), mỗi iddhipāda có mười cách.
Kattukamyataṭṭho chandaṭṭho.
Desire (chandaṭṭho) means the state of wishing to do.
Ý nghĩa của sự mong muốn làm là chandaṭṭha (ý muốn).
Chandaṃ sīsaṃ katvā bhāvanārambhakāle mūlaṭṭho.
When one makes desire primary and begins meditation, it is the root (mūlaṭṭho).
Khi bắt đầu tu tập, lấy ý muốn làm đầu, nên có nghĩa là mūlaṭṭha (căn bản).
Sahajātānaṃ patiṭṭhābhāvena pādaṭṭho.
It is the basis (pādaṭṭho) by being the support for co-arisen phenomena.
Do là nền tảng của các pháp đồng sinh, nên có nghĩa là pādaṭṭha (cước).
Padaṭṭhoti vā pāṭho.
Or the reading is padaṭṭho.
Hoặc là pāṭha (cách đọc) là padaṭṭha.
Iddhipādattā adhipatibhāvena padhānaṭṭho.
It is the principal (padhānaṭṭho) by being a dominant factor, as it is a base of spiritual power.
Do là iddhipāda (thần túc), nên có nghĩa là padhānaṭṭha (chủ yếu) với tính chất adhipati (làm chủ).
Payogakāle ijjhanaṭṭho.
It is the accomplishment (ijjhanaṭṭho) at the time of application.
Trong lúc thực hành, nên có nghĩa là ijjhanaṭṭha (thành tựu).
Saddhāsampayogena adhimokkhaṭṭho.
It is determination (adhimokkhaṭṭho) through association with faith.
Do kết hợp với đức tin, nên có nghĩa là adhimokkhaṭṭha (quyết định).
Vīriyasampayogena paggahaṭṭho.
It is exertion (paggahaṭṭho) through association with effort.
Do kết hợp với tinh tấn, nên có nghĩa là paggahaṭṭha (nỗ lực).
Satisampayogena upaṭṭhānaṭṭho.
It is establishment (upaṭṭhānaṭṭho) through association with mindfulness.
Do kết hợp với niệm, nên có nghĩa là upaṭṭhānaṭṭha (thiết lập).
Samādhisampayogena avikkhepaṭṭho.
It is non-distraction (avikkhepaṭṭho) through association with concentration.
Do kết hợp với định, nên có nghĩa là avikkhepaṭṭha (không tán loạn).
Paññāsampayogena dassanaṭṭho.
It is seeing (dassanaṭṭho) through association with wisdom.
Do kết hợp với tuệ, nên có nghĩa là dassanaṭṭha (thấy biết).
Paggahaṭṭho vīriyaṭṭho.
Effort (vīriyaṭṭho) means the state of exertion.
Ý nghĩa của sự nỗ lực là vīriyaṭṭha (tinh tấn).
Vīriyaṃ sīsaṃ katvā bhāvanārambhakāle mūlaṭṭho.
When one makes effort primary and begins meditation, it is the root.
Khi bắt đầu tu tập, lấy tinh tấn làm đầu, nên có nghĩa là mūlaṭṭha (căn bản).
Sayaṃ vīriyattā paggahaṭṭho.
It is the state of exertion (paggahaṭṭho) because it is effort itself.
Do tự thân là tinh tấn, nên có nghĩa là paggahaṭṭha (nỗ lực).
Cintanaṭṭhādiko cittaṭṭho.
Consciousness (cittaṭṭho) means the state of thinking and so on.
Ý nghĩa của sự suy nghĩ v.v. là cittaṭṭha (tâm).
Cittaṃ sīsaṃ katvā bhāvanārambhakāle mūlaṭṭho.
When one makes consciousness primary and begins meditation, it is the root.
Khi bắt đầu tu tập, lấy tâm làm đầu, nên có nghĩa là mūlaṭṭha (căn bản).
Upaparikkhanaṭṭho vīmaṃsaṭṭho.
Investigation (vīmaṃsaṭṭho) means the state of examining.
Ý nghĩa của sự khảo sát là vīmaṃsaṭṭha (quán sát).
Vīmaṃsaṃ sīsaṃ katvā bhāvanārambhakāle mūlaṭṭho.
When one makes investigation primary and begins meditation, it is the root.
Khi bắt đầu tu tập, lấy quán sát làm đầu, nên có nghĩa là mūlaṭṭha (căn bản).
Sayaṃ vīmaṃsattā dassanaṭṭho.
It is the state of seeing (dassanaṭṭho) because it is investigation itself.
Do tự thân là quán sát, nên có nghĩa là dassanaṭṭha (thấy biết).
17. Dukkhassa pīḷanaṭṭhotiādīni soḷasa vissajjanāni saccānaṃ tathalakkhaṇavasena niddiṭṭhāni.
17. Sixteen explanations such as the state of oppression of suffering (dukkhassa pīḷanaṭṭho) have been designated according to the true characteristics of the Truths.
17. Mười sáu cách giải thích về Dukkhassa pīḷanaṭṭha (nghĩa bị bức bách của khổ) v.v. đã được trình bày theo đặc tính chân thật của các sự thật.
Dukkhadassaneneva pīḷanaṭṭho.
It is the state of oppression (pīḷanaṭṭho) simply by seeing suffering.
Chỉ do thấy khổ, nên có nghĩa là bị bức bách (pīḷana).
Dukkhāyūhanasamudayadassanena saṅkhataṭṭho.
It is the state of being conditioned (saṅkhataṭṭho) by seeing the origination that strives for suffering.
Do thấy sự tập khởi tạo tác khổ, nên có nghĩa là được tạo tác (saṅkhata).
Sabbakilesasantāpaharasusītalamaggadassanena santāpaṭṭho.
It is the state of torment (santāpaṭṭho) by seeing the path that removes the torment of all defilements and is extremely cool.
Do thấy con đường mát lạnh diệt trừ mọi phiền não, nên có nghĩa là nhiệt não (santāpa).
Avipariṇāmadhammanirodhadassanena vipariṇāmaṭṭho.
It is the state of change (vipariṇāmaṭṭho) by seeing the cessation of phenomena that are subject to change.
Do thấy sự diệt trừ các pháp không biến đổi, nên có nghĩa là biến đổi (vipariṇāma).
Samudayadassaneneva āyūhanaṭṭho.
It is the state of striving (āyūhanaṭṭho) simply by seeing origination.
Chỉ do thấy sự tập khởi, nên có nghĩa là tạo tác (āyūhana).
Samudayāyūhitadukkhadassanena nidānaṭṭho.
It is the state of being a source (nidānaṭṭho) by seeing suffering that is striven for by origination.
Do thấy khổ được tập khởi tạo tác, nên có nghĩa là nguyên nhân (nidāna).
Visaññogabhūtanirodhadassanena saññogaṭṭho.
It is the state of connection (saññogaṭṭho) by seeing cessation as being disconnected.
Do thấy sự diệt trừ là không liên kết, nên có nghĩa là liên kết (saññoga).
Niyyānabhūtamaggadassanena palibodhaṭṭho.
It is the state of hindrance (palibodhaṭṭho) by seeing the path as being a means of escape.
Do thấy con đường là sự xuất ly, nên có nghĩa là trói buộc (palibodha).
Nirodhadassaneneva nissaraṇaṭṭho.
It is the state of escape (nissaraṇaṭṭho) simply by seeing cessation.
Chỉ do thấy sự diệt trừ, nên có nghĩa là xuất ly (nissaraṇa).
Avivekabhūtasamudayadassanena vivekaṭṭho.
It is the state of seclusion (vivekaṭṭho) by seeing origination as being non-secluded.
Do thấy sự tập khởi là không biệt lập, nên có nghĩa là biệt lập (viveka).
Saṅkhatabhūtamaggadassanena asaṅkhataṭṭho.
It is the state of being unconditioned (asaṅkhataṭṭho) by seeing the path as being conditioned.
Do thấy con đường là được tạo tác, nên có nghĩa là không tạo tác (asaṅkhata).
Visabhūtadukkhadassanena amataṭṭho.
It is the state of deathlessness (amataṭṭho) by seeing suffering as being like poison.
Do thấy khổ là chất độc, nên có nghĩa là bất tử (amata).
Maggadassaneneva niyyānaṭṭho.
It is the state of leading out (niyyānaṭṭho) simply by seeing the path.
Chỉ do thấy con đường, nên có nghĩa là xuất ly (niyyāna).
Nibbānasampattiyā ahetubhūtasamudayadassanena hetuṭṭho.
It is the state of being a cause (hetuṭṭho) by seeing origination as being the non-cause for the attainment of Nibbāna.
Do thấy sự tập khởi là không phải nguyên nhân đưa đến Nibbāna, nên có nghĩa là nguyên nhân (hetu).
Sududdasanirodhadassanena dassanaṭṭho.
It is the state of seeing (dassanaṭṭho) by seeing cessation, which is very difficult to see.
Do thấy sự diệt trừ rất khó thấy, nên có nghĩa là thấy biết (dassana).
Kapaṇajanasadisadukkhadassanena uḷārakulasadiso ādhipateyyaṭṭho pātubhavatīti.
It is the state of dominance (ādhipateyyaṭṭho), like a noble family, by seeing suffering as being like a wretched person.
Do thấy khổ giống như người nghèo hèn, nên có nghĩa là quyền uy (ādhipateyya) giống như gia đình cao quý xuất hiện.
Evaṃ taṃtaṃsaccadassanena tadaññasaccadassanena ca ekekassa saccassa cattāro cattāro lakkhaṇaṭṭhā vuttā.
Thus, four characteristic meanings have been stated for each Truth, by seeing that particular Truth and by seeing the other Truths.
Như vậy, bốn ý nghĩa đặc tính của mỗi sự thật đã được trình bày thông qua việc thấy sự thật đó và thấy các sự thật khác.
Tathaṭṭhādīni dvādasa vissajjanāni sabbadhammasaṅgāhakadvādasapadavasena niddiṭṭhāni.
The state of being so (tathaṭṭha) and the other twelve explanations have been designated according to the twelve terms that encompass all phenomena.
Mười hai cách giải thích về tathaṭṭha (chân thật) v.v. đã được trình bày theo mười hai từ ngữ bao gồm tất cả các pháp.
Tathaṭṭhoti yathāsabhāvaṭṭho.
The state of being so (tathaṭṭho) means the state of being as it is in reality.
Tathaṭṭha là ý nghĩa của bản chất đúng như thật.
Anattaṭṭhoti attavirahitaṭṭho.
The state of non-self (anattaṭṭho) means the state of being devoid of self.
Anattaṭṭha là ý nghĩa của sự không có tự ngã.
Saccaṭṭhoti avisaṃvādanaṭṭho.
The state of truth (saccaṭṭho) means the state of not deceiving.
Saccaṭṭha là ý nghĩa của sự không sai lạc.
Paṭivedhaṭṭhoti paṭivijjhitabbaṭṭho.
The state of penetration (paṭivedhaṭṭho) means the state of being penetrable.
Paṭivedhaṭṭha là ý nghĩa của sự cần phải thấu hiểu.
Abhijānanaṭṭhoti abhijānitabbaṭṭho.
The state of full understanding (abhijānanaṭṭho) means the state of being fully understood.
Abhijānanaṭṭha là ý nghĩa của sự cần phải biết rõ.
Parijānanaṭṭhoti ñātatīraṇapariññāya parijānitabbaṭṭho.
Parijānanaṭṭho means the sense of being fully understood through ñāta-pariññā and tīraṇa-pariññā.
Parijānanaṭṭha là ý nghĩa của sự cần phải hiểu rõ bằng ñātapariññā (trí tuệ hiểu biết) và tīraṇapariññā (trí tuệ thẩm định).
Dhammaṭṭhoti sabhāvadhāraṇādiattho.
Dhammaṭṭho means the sense of upholding its intrinsic nature, and so on.
Dhammaṭṭha là ý nghĩa của sự duy trì bản chất v.v.
Dhātuṭṭhoti suññādiattho.
Dhātuṭṭho means the sense of being devoid (of a living being), and so on.
Dhātuṭṭha là ý nghĩa của sự trống rỗng v.v.
Ñātaṭṭhoti jānituṃ sakkuṇeyyaṭṭho.
Ñātaṭṭho means the sense of being knowable.
Ñātaṭṭha là ý nghĩa của sự có thể biết được.
Sacchikiriyaṭṭhoti sacchikātabbaṭṭho.
Sacchikiriyaṭṭho means the sense of being realizable.
Sacchikiriyaṭṭha là ý nghĩa của sự cần phải chứng ngộ.
Phassanaṭṭhoti ñāṇena phusitabbaṭṭho.
Phassanaṭṭho means the sense of being touched by knowledge.
Phassanaṭṭha là ý nghĩa của sự cần phải xúc chạm bằng trí tuệ.
Abhisamayaṭṭhoti paccavekkhaṇañāṇena abhisammāgantabbaṭṭho, ñāṇena paṭilabhitabbaṭṭho vā.
Abhisamayaṭṭho means the sense of being rightly attained by the knowledge of review, or the sense of being obtained by knowledge.
Abhisamayaṭṭha là ý nghĩa của sự cần phải thấu hiểu đúng đắn bằng trí tuệ quán xét, hoặc là ý nghĩa của sự cần phải đạt được bằng trí tuệ.
Paṭilābhopi hi ‘‘atthābhisamayā dhīro’’tiādīsu (saṃ. ni. 1.130) viya abhisamayoti vuccati.
For indeed, attainment is also called abhisamaya, as in "the wise one, by the attainment of meaning" and so on.
Thật vậy, sự đạt được cũng được gọi là abhisamaya, như trong "atthābhisamayā dhīro" v.v.
18. Nekkhammādīni satta vissajjanāni upacārajjhānavasena niddiṭṭhāni.
18. The seven liberations, such as renunciation, are specified in terms of upacāra-jhāna.
18. Bảy cách giải thích về nekkhammā v.v. đã được trình bày theo upacāra-jhāna (cận định).
Nekkhammanti kāmacchandassa paṭipakkho alobho.
Nekkhamma (renunciation) is non-greed, the opposite of sensual desire.
Nekkhamma là alobha (vô tham), đối nghịch với kāmacchanda (dục tham).
Ālokasaññāti thinamiddhassa paṭipakkhe ālokanimitte saññā.
Ālokasaññā (perception of light) is the perception of the light-sign, the opposite of sloth and torpor.
Ālokasaññā là saññā (tưởng) về ālokanimitta (tướng ánh sáng), đối nghịch với thinamiddha (hôn trầm, thụy miên).
Avikkhepoti uddhaccassa paṭipakkho samādhi.
Avikkhepo (non-distraction) is concentration, the opposite of restlessness.
Avikkhepa là samādhi (định), đối nghịch với uddhacca (trạo cử).
Dhammavavatthānanti vicikicchāya paṭipakkhaṃ ñāṇaṃ.
Dhammavavatthāna (determination of phenomena) is knowledge, the opposite of doubt.
Dhammavavatthāna là ñāṇa (trí tuệ), đối nghịch với vicikicchā (hoài nghi).
Ñāṇanti avijjāya paṭipakkhaṃ ñāṇaṃ.
Ñāṇa (knowledge) is knowledge, the opposite of ignorance.
Ñāṇa là ñāṇa (trí tuệ), đối nghịch với avijjā (vô minh).
Pāmojjanti aratipaṭipakkhā pīti.
Pāmojja (joy) is delight, the opposite of discontent.
Pāmojja là pīti (hỷ), đối nghịch với arati (bất lạc).
Paṭhamajjhānādīni aṭṭha vissajjanāni rūpārūpasamāpattivasena niddiṭṭhāni.
The eight liberations, such as the first jhāna, are specified in terms of the form and formless attainments.
Tám cách giải thích về paṭhamajjhāna (sơ thiền) v.v. đã được trình bày theo rūpārūpasamāpatti (thiền sắc giới và vô sắc giới).
Heṭṭhā pana rūpasamāpattianantaraṃ rūpajjhānasambandhena cattāro brahmavihārā niddiṭṭhā.
Below, however, after the form attainments, the four Brahmavihāras are specified in connection with the form jhānas.
Tuy nhiên, ở dưới, ngay sau rūpasamāpatti (thiền sắc giới), bốn brahmavihāra (phạm trú) đã được trình bày liên quan đến rūpajhāna (thiền sắc giới).
Aniccānupassanādīni lokuttaramaggassa pubbabhāge aṭṭhārasamahāvipassanāvasena niddiṭṭhāni.
Aniccānupassanā (contemplation of impermanence) and so on are specified in terms of the eighteen great insights in the preceding stage of the supramundane path.
Aniccānupassanā (quán vô thường) v.v. đã được trình bày theo mười tám đại vipassanā (tuệ quán lớn) trong phần trước của lokuttaramagga (Đạo siêu thế).
Heṭṭhā pana rūpādīhi yojanūpagā satta anupassanā eva vuttā, idha pana sabbāpi vuttā.
Below, however, only the seven contemplations suitable for connection with form and so on were mentioned, but here all of them are mentioned.
Tuy nhiên, ở dưới chỉ nói đến bảy anupassanā (tùy quán) liên quan đến rūpa v.v., còn ở đây thì nói đến tất cả.
Kalāpasammasanaudayabbayānupassanā kasmā na vuttāti ce?
If it is asked why kalāpasammasana (comprehension by groups) and udayabbayānupassanā (contemplation of rise and fall) are not mentioned?
Nếu hỏi tại sao kalāpasammasana (tổng hợp các nhóm) và udayabbayānupassanā (quán sanh diệt) không được nói đến?
Tāsaṃ dvinnaṃ vasena aniccānupassanādīnaṃ sijjhanato imāsu vuttāsu tā dvepi vuttāva honti, aniccānupassanādīhi vā vinā tāsaṃ dvinnaṃ appavattito imāsu vuttāsu tā dvepi vuttāva honti.
Because the contemplations of impermanence and so on are accomplished through these two, when these are mentioned, those two are also mentioned; or because those two do not arise without the contemplations of impermanence and so on, when these are mentioned, those two are also mentioned.
Nếu đã nói đến aniccānupassanā v.v. thì hai pháp đó cũng đã được nói đến, vì aniccānupassanā v.v. được thành tựu nhờ hai pháp đó; hoặc nếu không có aniccānupassanā v.v. thì hai pháp đó không thể phát sinh, nên khi aniccānupassanā v.v. được nói đến thì hai pháp đó cũng đã được nói đến rồi.
Khayānupassanāti paccuppannānaṃ rūpakkhandhādīnaṃ bhaṅgadassanañāṇañca taṃtaṃkhandhabhaṅgadassanānantaraṃ tadārammaṇacittacetasikabhaṅgadassanañāṇañca.
Khayānupassanā (contemplation of dissolution) is the knowledge of seeing the breaking up of the present rūpakkhandha and so on, and the knowledge of seeing the breaking up of the citta and cetasikas that have those rūpakkhandhas as their object, immediately after seeing the breaking up of each respective khandha.
Khayānupassanā (quán hoại diệt) là trí tuệ thấy sự hoại diệt của các uẩn hiện tại như rūpakkhandha (sắc uẩn) v.v., và trí tuệ thấy sự hoại diệt của tâm và các tâm sở làm đối tượng ngay sau khi thấy sự hoại diệt của các uẩn đó.
Vayānupassanāti paccuppannānaṃ khandhānaṃ bhaṅgadassanānantaraṃ tadanvayeneva atītānāgatakhandhānaṃ bhaṅgadassanañāṇaṃ.
Vayānupassanā (contemplation of vanishing) is the knowledge of seeing the breaking up of past and future khandhas in sequence, immediately after seeing the breaking up of the present khandhas.
Vayānupassanā (quán suy vong) là trí tuệ thấy sự hoại diệt của các uẩn quá khứ và vị lai theo sau sự hoại diệt của các uẩn hiện tại.
Vipariṇāmānupassanāti tasmiṃ bhaṅgasaṅkhāte nirodhe adhimuttattā, atha sabbepi atītānāgatapaccuppannā khandhā vipariṇāmavantoti sabbesaṃ vipariṇāmadassanañāṇaṃ.
Vipariṇāmānupassanā (contemplation of transformation) is, due to being inclined towards that cessation called breaking up, the knowledge of seeing the transformation of all past, future, and present khandhas, thinking: "All khandhas are subject to transformation."
Vipariṇāmānupassanā (quán biến đổi) là trí tuệ thấy sự biến đổi của tất cả các uẩn quá khứ, vị lai và hiện tại, do sự quyết định vào nirodha (diệt) được gọi là hoại diệt.
Animittānupassanāti evaṃ sabbasaṅkhārānaṃ vipariṇāmaṃ disvā aniccato vipassantassa aniccānupassanāva niccanimittapajahanavasena niccanimittābhāvā animittānupassanā nāma hoti.
Animittānupassanā (contemplation of the signless) is, having thus seen the transformation of all saṅkhāras and contemplating them as impermanent, the contemplation of impermanence itself becomes the contemplation of the signless due to the abandonment of the sign of permanence, thus being without the sign of permanence.
Animittānupassanā (quán vô tướng) là chính aniccānupassanā (quán vô thường) của người quán thấy sự biến đổi của tất cả các hành như vậy, và quán vô thường, trở thành animittānupassanā do không có niccanimitta (tướng thường) bằng cách từ bỏ niccanimitta.
Appaṇihitānupassanāti aniccānupassanānantaraṃ pavattā dukkhānupassanāva sukhapatthanāpajahanavasena paṇidhiabhāvā appaṇihitānupassanā nāma hoti.
Appaṇihitānupassanā (contemplation of the desireless) is the contemplation of suffering that arises after the contemplation of impermanence, which becomes the contemplation of the desireless due to the abandonment of the aspiration for happiness, thus being without aspiration.
Appaṇihitānupassanā (quán vô nguyện) là chính dukkhānupassanā (quán khổ) phát sinh sau aniccānupassanā (quán vô thường), trở thành appaṇihitānupassanā do không có paṇidhi (nguyện) bằng cách từ bỏ sukhapatthanā (mong muốn hạnh phúc).
Suññatānupassanāti dukkhānupassanānantaraṃ pavattā anattānupassanāva attābhinivesapajahanavasena attasuññatādassanato suññatānupassanā nāma hoti.
Suññatānupassanā (contemplation of emptiness) is the contemplation of non-self that arises after the contemplation of suffering, which becomes the contemplation of emptiness due to the abandonment of the attachment to self, thus seeing the emptiness of self.
Suññatānupassanā (quán không) là chính anattānupassanā (quán vô ngã) phát sinh sau dukkhānupassanā (quán khổ), trở thành suññatānupassanā do thấy sự trống rỗng về tự ngã bằng cách từ bỏ attābhinivesa (chấp thủ tự ngã).
Adhipaññādhammavipassanāti evaṃ saṅkhārānaṃ bhaṅgaṃ passitvā passitvā aniccādito vipassantassa saṅkhārāva bhijjanti, saṅkhārānaṃ maraṇaṃ na añño koci atthīti bhaṅgavasena suññataṃ gahetvā pavattā vipassanā.
Adhipaññādhammavipassanā (insight into phenomena with higher wisdom) is the insight that arises by repeatedly seeing the dissolution of saṅkhāras and contemplating them as impermanent and so on, realizing that only saṅkhāras break up, and there is no other being or person that dies, thus grasping emptiness in terms of dissolution.
Tuệ quán pháp thượng trí (Adhipaññādhammavipassanā) là tuệ quán phát sinh sau khi đã thấy đi thấy lại sự tan rã của các hành (saṅkhāra) như vậy, và quán thấy chúng là vô thường (anicca), v.v., rằng chỉ có các hành tan rã, không có bất kỳ chúng sinh hay cá nhân nào khác chết đi. Tuệ quán này chấp thủ sự trống rỗng (suññata) dựa trên sự tan rã.
Sā hi adhipaññā ca dhammesu ca vipassanāti katvā adhipaññādhammavipassanāti vuccati.
It is called adhipaññādhammavipassanā because it is both higher wisdom and insight into phenomena.
Vì tuệ quán ấy là thượng trí (adhipaññā) và là tuệ quán về các pháp (dhammesu vipassanā), nên được gọi là tuệ quán pháp thượng trí (Adhipaññādhammavipassanā).
Yathābhūtañāṇadassananti bhaṅgaṃ disvā disvā ‘‘sabhayā saṅkhārā’’ti pavattaṃ bhayatupaṭṭhānañāṇaṃ.
Yathābhūtañāṇadassana (knowledge and vision of things as they are) is the knowledge of the manifestation of fear that arises by repeatedly seeing the dissolution, thinking: "The saṅkhāras are fearful."
Tri kiến như thật (Yathābhūtañāṇadassana) là trí tuệ hiện khởi sự sợ hãi (bhayatupaṭṭhānañāṇa), phát sinh do thấy đi thấy lại sự tan rã, rằng “các hành là đáng sợ”.
Ādīnavānupassanāti bhayatupaṭṭhānavasena uppannaṃ sabbabhavādīsu ādīnavadassanañāṇaṃ.
Ādīnavānupassanā (contemplation of danger) is the knowledge of seeing danger in all existences and so on, which arises due to the manifestation of fear.
Quán chiếu sự nguy hiểm (Ādīnavānupassanā) là trí tuệ thấy sự nguy hiểm (ādīnavadassanañāṇa) trong tất cả các cõi hữu, v.v., phát sinh do sự hiện khởi của nỗi sợ hãi.
‘‘Yā ca bhayatupaṭṭhāne paññā yañca ādīnave ñāṇaṃ yā ca nibbidā, ime dhammā ekatthā, byañjanameva nāna’’nti (paṭi. ma. 1.227) vacanato bhayatupaṭṭhānādīnavānupassanāsu vuttāsu nibbidānupassanā idhāpi vuttāva hoti.
According to the saying, "The wisdom that is the manifestation of fear, the knowledge of danger, and dispassion—these phenomena have one meaning, only the expression differs," when the contemplations of the manifestation of fear and danger are mentioned, the contemplation of dispassion is also mentioned here.
Theo lời dạy: “Trí tuệ về sự hiện khởi của nỗi sợ hãi, trí tuệ về sự nguy hiểm, và sự nhàm chán (nibbidā) – những pháp này đồng nghĩa, chỉ khác nhau về từ ngữ” thì sự quán chiếu nhàm chán (nibbidānupassanā) cũng đã được đề cập ở đây trong sự quán chiếu nỗi sợ hãi và sự nguy hiểm.
Ādito catutthaṃ katvā vuttattā panidha na vuttā.
However, because it was stated as the fourth from the beginning, it is not stated here.
Tuy nhiên, ở đây không được đề cập vì nó được nói là thứ tư từ đầu.
Paṭisaṅkhānupassanāti muñcitukamyatāñāṇavasena uppannaṃ muñcanassa upāyakaraṇaṃ paṭisaṅkhānupassanāsaññitaṃ aniccadukkhānattānupassanāñāṇaṃ.
Contemplation by Reflection (Paṭisaṅkhānupassanā) is the knowledge of impermanence, suffering, and non-self (aniccadukkhānattānupassanāñāṇaṃ), which arises by means of the knowledge of the desire to be free (muñcitukamyatāñāṇa) and is called Paṭisaṅkhānupassanā, being the means of liberation.
Quán chiếu tư duy (Paṭisaṅkhānupassanā) là trí tuệ quán chiếu vô thường, khổ, vô ngã (aniccadukkhānattānupassanāñāṇa), được gọi là quán chiếu tư duy (paṭisaṅkhānupassanāsaññitaṃ), là sự tạo ra phương tiện để giải thoát, phát sinh do trí tuệ mong muốn giải thoát (muñcitukamyatāñāṇa).
‘‘Yā ca muñcitukamyatā yā ca paṭisaṅkhānupassanā yā ca saṅkhārupekkhā, ime dhammā ekatthā, byañjanameva nāna’’nti (paṭi. ma. 1.227) vacanato paṭisaṅkhānupassanāya vuttāya muñcitukamyatāsaṅkhārupekkhāñāṇāni vuttāneva honti.
Because it is said: ‘‘The desire to be free, contemplation by reflection, and equanimity regarding formations (saṅkhārupekkhā) — these phenomena have one meaning, only the expression differs,’’ when Paṭisaṅkhānupassanā is stated, the knowledge of the desire to be free and the knowledge of equanimity regarding formations are also stated.
Theo lời dạy: “Sự mong muốn giải thoát (muñcitukamyatā), sự quán chiếu tư duy (paṭisaṅkhānupassanā), và sự xả đối với các hành (saṅkhārupekkhā) – những pháp này đồng nghĩa, chỉ khác nhau về từ ngữ” thì trí tuệ mong muốn giải thoát và trí tuệ xả đối với các hành cũng đã được đề cập khi quán chiếu tư duy.
Vivaṭṭanānupassanāti anulomañāṇavasena uppannaṃ gotrabhuñāṇaṃ.
Contemplation of Turning Away (Vivaṭṭanānupassanā) is the gotrabhuñāṇa which arises by means of anulomañāṇa.
Quán chiếu chuyển hóa (Vivaṭṭanānupassanā) là trí tuệ chuyển tộc (gotrabhuñāṇa), phát sinh do trí tuệ thuận thứ (anulomañāṇa).
Anulomañāṇena gotrabhuñāṇassa sijjhanato gotrabhuñāṇe vutte anulomañāṇaṃ vuttameva hoti.
Since gotrabhuñāṇa is perfected by anulomañāṇa, when gotrabhuñāṇa is stated, anulomañāṇa is also stated.
Vì trí tuệ chuyển tộc được thành tựu bởi trí tuệ thuận thứ, nên khi trí tuệ chuyển tộc được nói đến, trí tuệ thuận thứ cũng đã được nói đến.
Evañhi aṭṭhārasannaṃ mahāvipassanānaṃ paṭipāṭi vuccamānā pāḷiyā sameti.
Thus, the sequence of the eighteen great insights, when spoken of, accords with the Pāḷi.
Theo cách này, thứ tự của mười tám đại tuệ quán được nói đến phù hợp với kinh điển.
Vuttañhi indriyakathāyaṃ –
For it is said in the Indriya-kathā:
Trong Indriyakathā (Phẩm về các căn) có nói:
Yassa yassa ñāṇassa visuṃ visuṃ āvajjanaṃ labbhati, tassa tassa visuṃ visuṃ āvajjanaṃ vuttaṃ.
For whichever knowledge a separate advertence is obtained, for that knowledge a separate advertence is stated.
Sự hướng tâm riêng biệt được nói đến cho từng trí tuệ riêng biệt.
Vivaṭṭanānupassanāya pana āvajjanaṃ avatvāva ‘‘vivaṭṭanānupassanā ñāṇacariyā’’ti vuttaṃ.
But for Vivaṭṭanānupassanā, without stating advertence, it is simply said: ‘‘Vivaṭṭanānupassanā is knowledge-conduct.’’
Nhưng đối với quán chiếu chuyển hóa (Vivaṭṭanānupassanā), không nói đến sự hướng tâm mà chỉ nói “trí tuệ quán chiếu chuyển hóa” (vivaṭṭanānupassanā ñāṇacariyā).
Yadi saṅkhārupekkhānulomañāṇāni vivaṭṭanānupassanā nāma siyuṃ, tadāvajjanasambhavā tadatthāya ca āvajjanaṃ vadeyya, na ca tadatthāya āvajjanaṃ vuttaṃ.
If equanimity regarding formations and conformity knowledge were called Vivaṭṭanānupassanā, then, since advertence would be possible for them, advertence for their sake would be stated, but advertence for their sake is not stated.
Nếu trí tuệ xả đối với các hành và trí tuệ thuận thứ được gọi là quán chiếu chuyển hóa, thì sự hướng tâm có thể xảy ra ở đó và sự hướng tâm cho mục đích đó sẽ được nói đến, nhưng sự hướng tâm cho mục đích đó lại không được nói đến.
Gotrabhuñāṇassa pana visuṃ āvajjanaṃ natthi anulomāvajjanavīthiyaṃyeva uppattito.
However, there is no separate advertence for gotrabhuñāṇa, because it arises only in the thought-process of conformity advertence.
Tuy nhiên, trí tuệ chuyển tộc (gotrabhuñāṇa) không có sự hướng tâm riêng biệt vì nó chỉ phát sinh trong lộ trình hướng tâm thuận thứ.
Tasmā vivaṭṭanānupassanatthāya āvajjanassa avuttattā gotrabhuñāṇameva ‘‘vivaṭṭanānupassanā’’ti yujjati.
Therefore, since advertence for the sake of Vivaṭṭanānupassanā is not stated, it is appropriate that gotrabhuñāṇa itself is ‘‘Vivaṭṭanānupassanā.’’
Do đó, vì sự hướng tâm cho quán chiếu chuyển hóa không được nói đến, nên chỉ có trí tuệ chuyển tộc mới phù hợp với ý nghĩa “quán chiếu chuyển hóa”.
19. Sotāpattimaggādīni aṭṭha vissajjanāni lokuttaramaggaphalavasena niddiṭṭhāni.
19. The eight answers such as Stream-entry Path (Sotāpattimagga) are designated by way of the supramundane paths and fruits.
19. Tám lời giải thích bắt đầu bằng Đạo Tu-đà-hoàn (Sotāpattimagga) được chỉ rõ theo nghĩa đạo và quả siêu thế.
Sotassa āpajjanaṃ sotāpatti, sotāpatti eva maggo sotāpattimaggo.
Entering the stream is sotāpatti; sotāpatti itself is the path, hence sotāpattimagga.
Sự nhập vào dòng là Tu-đà-hoàn (sotāpatti); Tu-đà-hoàn chính là đạo, đó là Đạo Tu-đà-hoàn (sotāpattimaggo).
Sotāpattiyā phalaṃ sotāpattiphalaṃ, samāpajjīyatīti samāpatti, sotāpattiphalameva samāpatti sotāpattiphalasamāpatti.
The fruit of sotāpatti is sotāpattiphala; that which is entered upon is samāpatti; sotāpattiphala itself is samāpatti, hence sotāpattiphalasamāpatti.
Quả của Tu-đà-hoàn là Quả Tu-đà-hoàn (sotāpattiphalaṃ); được nhập vào là nhập định (samāpatti); Quả Tu-đà-hoàn chính là nhập định, đó là nhập định Quả Tu-đà-hoàn (sotāpattiphalasamāpatti).
Paṭisandhivasena sakiṃyeva imaṃ lokaṃ āgacchatīti sakadāgāmī, tassa maggo sakadāgāmimaggo.
One who comes to this world only once by way of rebirth is a sakadāgāmī; his path is sakadāgāmimagga.
Chỉ một lần trở lại cõi này theo nghĩa tái sinh là Tư-đà-hàm (sakadāgāmī); đạo của vị ấy là Đạo Tư-đà-hàm (sakadāgāmimaggo).
Sakadāgāmissa phalaṃ sakadāgāmiphalaṃ.
The fruit of a sakadāgāmī is sakadāgāmiphala.
Quả của Tư-đà-hàm là Quả Tư-đà-hàm (sakadāgāmiphalaṃ).
Paṭisandhivaseneva kāmabhavaṃ na āgacchatīti anāgāmī, tassa maggo anāgāmimaggo.
One who does not come to the sense-sphere existence again by way of rebirth is an anāgāmī; his path is anāgāmimagga.
Không trở lại cõi dục theo nghĩa tái sinh là A-na-hàm (anāgāmī); đạo của vị ấy là Đạo A-na-hàm (anāgāmimaggo).
Anāgāmissa phalaṃ anāgāmiphalaṃ.
The fruit of an anāgāmī is anāgāmiphala.
Quả của A-na-hàm là Quả A-na-hàm (anāgāmiphalaṃ).
Kilesehi ārakattā, kilesārīnaṃ hatattā, saṃsāracakkassa arānaṃ hatattā, pāpakaraṇe rahābhāvā, paccayādīnaṃ arahattā arahaṃ, arahato bhāvo arahattaṃ.
One is an arahat because of being far from defilements (kilesehi ārakattā), because defilement-enemies are slain (kilesārīnaṃ hatattā), because the spokes (arānaṃ) of the wheel of saṃsāra are slain (saṃsāracakkassa arānaṃ hatattā), because there is no secrecy in doing evil (pāpakaraṇe rahābhāvā), and because of being worthy of requisites (paccayādīnaṃ arahattā). The state of an arahat is arahatta.
A-la-hán (arahaṃ) là do xa lìa các phiền não, do đã diệt trừ kẻ thù phiền não, do đã diệt trừ các nan hoa của bánh xe luân hồi, do không có nơi ẩn náu để làm điều ác, do xứng đáng với các yếu tố, v.v. Trạng thái của A-la-hán là A-la-hán (arahattaṃ).
Kiṃ taṃ?
What is that?
Đó là gì?
Arahattaphalaṃ.
It is arahattaphala.
Quả A-la-hán (arahattaphalaṃ).
Arahattassa maggo arahattamaggo.
The path to arahatta is arahattamagga.
Đạo của A-la-hán là Đạo A-la-hán (arahattamaggo).
Arahattameva phalaṃ arahattaphalaṃ.
Arahantship itself is the fruit, arahattaphala.
Quả A-la-hán chính là Quả A-la-hán (arahattaphalaṃ).
Saṃvaraṭṭhenātiādīni aṭṭha vissajjanāni sīlādibalapariyosānadhammavasena niddiṭṭhāni.
The eight explanations, beginning with "by way of restraint," are stated according to the phenomena culminating in the powers of virtue and so on.
Tám lời giải thích bắt đầu bằng “ Theo nghĩa phòng hộ” (Saṃvaraṭṭhenā) được chỉ rõ theo các pháp kết thúc bằng giới và lực, v.v.
Sīlavisuddhīti suparisuddhapātimokkhasaṃvarādicatubbidhaṃ sīlaṃ dussīlyamalavisodhanato.
Sīlavisuddhi refers to the fourfold virtue, such as the perfectly pure Pātimokkha restraint, because it purifies the defilement of unvirtuousness.
Giới thanh tịnh (Sīlavisuddhi) là giới hạnh bốn phần như giới luật thanh tịnh hoàn toàn, v.v., vì nó thanh lọc cấu uế của sự thiếu giới hạnh.
Cittavisuddhīti saupacārā aṭṭha samāpattiyo.
Cittavisuddhi refers to the eight attainments with access concentration.
Tâm thanh tịnh (Cittavisuddhi) là tám thiền định có cận định.
Cittasīsena hettha samādhi vutto.
Here, concentration is spoken of by way of mind.
Ở đây, định (samādhi) được đề cập dưới tiêu đề tâm (citta).
So cittamalavisodhanato cittavisuddhi.
That concentration is cittavisuddhi because it purifies mental defilements.
Định ấy là tâm thanh tịnh vì nó thanh lọc cấu uế của tâm.
Diṭṭhivisuddhīti nāmarūpānaṃ yathāsabhāvadassanaṃ sattadiṭṭhimalavisodhanato diṭṭhivisuddhi.
Diṭṭhivisuddhi is the seeing of mind-and-matter according to their true nature, being diṭṭhivisuddhi because it purifies the seven defilements of wrong view.
Kiến thanh tịnh (Diṭṭhivisuddhi) là sự thấy danh sắc theo bản chất của chúng, là kiến thanh tịnh vì nó thanh lọc cấu uế của bảy tà kiến.
Muttaṭṭhenāti tadaṅgavasena upakkilesato vimuttaṭṭhena ārammaṇe ca adhimuttaṭṭhena.
By way of being freed means by way of being freed from defilements by way of temporary suppression, and by way of being convinced in the object.
Theo nghĩa giải thoát (Muttaṭṭhenā) là theo nghĩa giải thoát khỏi các phiền não phụ thuộc theo từng phần, và theo nghĩa quyết định đối với đối tượng.
Vimokkhoti tadaṅgavimokkho.
Vimokkha is temporary liberation.
Giải thoát (Vimokkho) là giải thoát từng phần (tadaṅgavimokkho).
Paṭivedhaṭṭhena vijjāti pubbenivāsānussatiñāṇaṃ purimabhavapaṭivedhaṭṭhena vijjā, dibbacakkhuñāṇaṃ sattānaṃ cutūpapātapaṭivedhaṭṭhena vijjā, āsavānaṃ khaye ñāṇaṃ saccapaṭivedhaṭṭhena vijjā.
Knowledge by way of penetration refers to the knowledge of past lives as knowledge by way of penetrating previous existences; the divine eye knowledge as knowledge by way of penetrating the passing away and rebirth of beings; and the knowledge of the destruction of the Taints as knowledge by way of penetrating the truths.
Minh theo nghĩa thâm nhập (Paṭivedhaṭṭhena vijjā): Túc mạng minh (pubbenivāsānussatiñāṇa) là minh theo nghĩa thâm nhập các đời trước; Thiên nhãn minh (dibbacakkhuñāṇa) là minh theo nghĩa thâm nhập sự sinh và diệt của chúng sinh; Lậu tận minh (āsavānaṃ khaye ñāṇa) là minh theo nghĩa thâm nhập các sự thật.
Paṭivedhaṭṭhenāti jānanaṭṭhena.
By way of penetration means by way of knowing.
Theo nghĩa thâm nhập là theo nghĩa hiểu biết.
Pariccāgaṭṭhena vimuttīti yaṃ yaṃ pariccattaṃ, tato tato vimuttattā phalavimutti.
Liberation by way of relinquishment is the fruit-liberation, due to being liberated from whatever has been relinquished.
Giải thoát theo nghĩa từ bỏ (Pariccāgaṭṭhena vimuttī) là giải thoát quả (phalavimutti), vì nó giải thoát khỏi những gì đã được từ bỏ.
Samucchedaṭṭhena khaye ñāṇanti kilesasamucchindanatthena kilesakkhayakare ariyamagge ñāṇaṃ.
Knowledge of destruction by way of eradication is knowledge in the Noble Path that causes the destruction of defilements, by way of eradicating defilements.
“Trí về sự diệt tận (khaye ñāṇa)” là trí tuệ trong Thánh đạo (ariyamagga) làm diệt tận các phiền não, theo ý nghĩa diệt tận phiền não.
Paṭippassaddhaṭṭhena anuppāde ñāṇanti maggakiccasaṅkhātapayogapaṭippassaddhattā paṭisandhivasena anuppādabhūte taṃtaṃmaggavajjhakilesānaṃ anuppādapariyosāne uppanne ariyaphale ñāṇaṃ.
Knowledge of non-arising by way of subsidence is knowledge in the Noble Fruit that arises at the culmination of the non-arising of defilements to be abandoned by each respective path, which are in a state of non-arising in terms of rebirth, due to the subsidence of the endeavor, which is called the path-function.
“Trí về sự không tái sinh (anuppāde ñāṇa)” là trí tuệ trong Thánh quả (ariyaphala) phát sinh khi các phiền não cần được đoạn trừ bởi Thánh đạo tương ứng đã không còn tái sinh, do sự an tịnh của sự nỗ lực được gọi là nhiệm vụ của đạo, và do sự không tái sinh theo cách tái tục.
20. Chando mūlaṭṭhenātiādīni nava vissajjanāni ariyamaggassa ādimajjhapariyosānavasena niddiṭṭhāni.
20. The nine explanations, beginning with "desire by way of root," are stated according to the beginning, middle, and end of the Noble Path.
20. Chín giải đáp như “Ý muốn là gốc (chando mūlaṭṭhena)” v.v. được trình bày theo các giai đoạn ban đầu, giữa và cuối của Thánh đạo (ariyamagga).
Chando mūlaṭṭhenāti kusalānaṃ dhammānaṃ kattukamyatāchando paṭipattiyā ca nipphattiyā ca mūlattā mūlaṭṭhena.
Desire by way of root means the desire to act for wholesome phenomena, by way of root, because it is the root of both practice and the accomplishment of the Path and Fruit.
“Ý muốn là gốc (chando mūlaṭṭhena)” là ý muốn làm các pháp thiện (kusalānaṃ dhammānaṃ kattukamyatāchando) là gốc rễ của sự thực hành (paṭipatti) và sự thành tựu (nipphatti), do đó có ý nghĩa là gốc.
Manasikāro samuṭṭhānaṭṭhenāti yonisomanasikāro sabbakusaladhamme samuṭṭhāpetīti samuṭṭhānaṭṭhena.
Attention by way of origination means wise attention, by way of origination, because it causes all wholesome phenomena to arise.
“Tác ý là nguồn gốc (manasikāro samuṭṭhānaṭṭhena)” là tác ý đúng đắn (yonisomanasikāra) làm phát sinh tất cả các pháp thiện (sabbakusaladhamme), do đó có ý nghĩa là nguồn gốc.
Phasso samodhānaṭṭhenāti yasmā taṇhāya visesena vedanā padhānakāraṇaṃ, taṇhā ca pahīyamānā visesena vedanāya pariññātāya pahīyati, tassā ca vedanāya phassova padhānakāraṇaṃ, tasmiṃ pariññāte vedanā pariññātā hoti, tasmā sattasu abhiññeyyavatthūsu phasso paṭhamaṃ vutto.
Contact by way of conjunction is stated first among the seven objects of higher knowledge because feeling is the primary cause of craving, and craving is abandoned especially when feeling is fully understood; and contact is the primary cause of that feeling, so when it is fully understood, feeling is fully understood.
“Xúc là sự kết hợp (phasso samodhānaṭṭhena)” là vì ái dục (taṇhā) mà thọ (vedanā) là nguyên nhân chính yếu, và ái dục được đoạn trừ đặc biệt khi thọ được liễu tri (pariññāta); và xúc (phassa) là nguyên nhân chính yếu của thọ đó, khi xúc được liễu tri thì thọ cũng được liễu tri. Do đó, trong bảy đối tượng cần được thắng tri (abhiññeyyavatthū), xúc được nói đến đầu tiên.
So ca tikasannipātasaṅkhātassa attano kāraṇassa vasena paveditattā ‘‘tikasannipātapaccupaṭṭhāno’’ti vuttattā samodhānaṭṭhena abhiññeyyo.
And that contact is to be known by way of conjunction, because it is declared by way of its own cause, which is called the concurrence of three factors, and because it is said to be "appearing as the concurrence of three factors."
Và xúc (phassa) ấy cần phải được thắng tri theo nghĩa là sự hội tụ (samodhānaṭṭhena), bởi vì nó được tuyên bố theo phương diện là nguyên nhân của chính nó, được gọi là sự hội tụ ba (tikasannipāta), và được nói là “sự hiện hữu của sự hội tụ ba” (tikasannipātapaccupaṭṭhāno).
Keci pana ‘‘ñāṇaphasso phasso’’ti vadanti.
However, some say that "contact is knowledge-contact."
Tuy nhiên, một số người nói rằng “sự xúc chạm của trí tuệ” (ñāṇaphasso) chính là xúc (phassa).
Yasmā pana vedanā cittacetasike attano vase vattāpayamānā tattha samosarati pavisati, cittasantānameva vā pavisati, tasmā samosaraṇaṭṭhena abhiññeyyāti vuttā.
But since feeling, by making mental concomitants act according to its will, converges and enters into them, or rather, enters into the continuum of consciousness, it is therefore said to be "to be known by way of convergence."
Vì thọ (vedanā) làm cho tâm và các tâm sở vận hành theo ý muốn của nó, và nó nhập vào các tâm sở ấy, hoặc nó nhập vào dòng tâm thức, do đó nó được nói là cần phải được thắng tri theo nghĩa là sự hội tụ (samosaraṇaṭṭhena abhiññeyyā).
Keci pana ‘‘sabbānipi pariññeyyāni vedanāsu samosaranti, vedanāsu pariññātāsu sabbaṃ taṇhāvatthu pariññātaṃ hoti.
However, some say: "All phenomena to be fully understood converge in feelings. When feelings are fully understood, all objects of craving are fully understood.
Tuy nhiên, một số người nói rằng: “Tất cả những pháp cần phải được liễu tri đều hội tụ trong các thọ (vedanā).
Taṃ kissa hetu?
Why is that?
Khi các thọ được liễu tri, tất cả các đối tượng của tham ái đều được liễu tri.
Vedanāpaccayā hi sabbāpi taṇhā.
Because all craving is conditioned by feeling.
Tại sao lại như vậy?
Tasmā vedanā samosaraṇaṭṭhena abhiññeyyā’’ti vadanti.
Therefore, feeling is to be known by way of convergence."
Vì tất cả tham ái đều do duyên thọ mà sinh.
Yasmā sabbagopānasīnaṃ ābandhanato kūṭāgārakaṇṇikā viya cittacetasikānaṃ sampiṇḍanato samādhi kusalānaṃ dhammānaṃ pamukho hoti jeṭṭhako, tasmā samādhi pamukhaṭṭhenāti vuttaṃ.
Since concentration, like the finial of a gabled house binding all rafters, is the chief and foremost of wholesome phenomena due to its consolidating mental concomitants, it is therefore said, "concentration by way of prominence."
Do đó, thọ cần phải được thắng tri theo nghĩa là sự hội tụ (samosaraṇaṭṭhena abhiññeyyā).” Bởi vì, giống như chóp nóc của một ngôi nhà có mái nhọn là nơi buộc tất cả các đòn tay, định (samādhi) là pháp chủ yếu, là pháp đứng đầu trong các thiện pháp của tâm và các tâm sở, do đó được nói là định theo nghĩa là pháp chủ yếu.
Pāmukhaṭṭhenātipi pāṭho.
The reading "pāmukhaṭṭhenāpi" also exists.
Cũng có bản đọc là Pāmukhaṭṭhenātipi.
Yasmā samathavipassanaṃ bhāventassa ārammaṇūpaṭṭhānādhipati hoti sati, satiyā upaṭṭhite ārammaṇe sabbepi kusalā dhammā sakaṃ sakaṃ kiccaṃ sādhenti, tasmā sati ādhipateyyaṭṭhenāti vuttaṃ.
Since, for one developing samatha-vipassanā, mindfulness (sati) becomes the chief factor in bringing the object to mind, and when the object is brought to mind by mindfulness, all wholesome states accomplish their respective functions, therefore it is said, " mindfulness is by way of dominance."
Bởi vì khi hành giả tu tập samatha và vipassanā, niệm (sati) là pháp tối thượng trong việc thiết lập đối tượng; khi đối tượng được thiết lập bởi niệm, tất cả các thiện pháp đều hoàn thành nhiệm vụ riêng của chúng, do đó được nói là niệm theo nghĩa là pháp tối thượng (sati ādhipateyyaṭṭhenā).
Paññā taduttaraṭṭhenāti ariyamaggapaññā tesaṃ kusalānaṃ dhammānaṃ uttaraṭṭhena seṭṭhaṭṭhena abhiññeyyā.
Wisdom is by way of surpassing them means that the wisdom of the noble path (ariyamagga-paññā) should be known as superior, as excellent, to those wholesome states.
Tuệ theo nghĩa là vượt trội hơn (paññā taduttaraṭṭhenā) có nghĩa là tuệ của Bát Thánh Đạo cần phải được thắng tri theo nghĩa là vượt trội hơn, là tối thượng hơn các thiện pháp ấy.
Atha vā tato kilesehi, saṃsāravaṭṭato vā uttarati samatikkamatīti taduttarā, tassā attho taduttaraṭṭho.
Alternatively, it surpasses, overcomes, either defilements (kilesa) or the cycle of saṃsāra, hence "taduttarā" (that which surpasses them); its meaning is "by way of surpassing them."
Hoặc là, nó vượt qua, vượt thoát khỏi các phiền não, hoặc vượt thoát khỏi vòng luân hồi (saṃsāravaṭṭa), do đó gọi là taduttarā, ý nghĩa của nó là taduttaraṭṭho.
Tena taduttaraṭṭhena.
Therefore, by way of surpassing them.
Do đó, theo nghĩa là vượt trội hơn (taduttaraṭṭhena).
Tatuttaraṭṭhenātipi pāṭho, tato uttaraṭṭhenāti attho.
"Tatuttaraṭṭhenātipi" is also a reading, meaning "by way of surpassing that."
Cũng có bản đọc là Tatuttaraṭṭhenātipi, nghĩa là theo nghĩa vượt trội hơn cái đó.
Vimutti sāraṭṭhenāti phalavimutti aparihānivasena thirattā sāro, taṃ atikkamitvā aññassa pariyesitabbassa abhāvatopi sāro.
Liberation is by way of being the essence (sāraṭṭhena) means that the liberation of fruition (phalavimutti) is the essence because of its stability, due to its non-deterioration, and also because there is nothing else to be sought beyond it.
Giải thoát theo nghĩa là cốt lõi (vimutti sāraṭṭhenā): Giải thoát quả (phalavimutti) là cốt lõi (sāra) vì nó vững chắc, không bị suy thoái; nó cũng là cốt lõi vì không có gì khác cần phải tìm kiếm vượt qua nó.
Sā vimutti tena sāraṭṭhena abhiññeyyā.
That liberation should be known by way of being the essence.
Giải thoát ấy cần phải được thắng tri theo nghĩa là cốt lõi.
Amatogadhaṃ nibbānanti natthi etassa maraṇasaṅkhātaṃ matanti amataṃ, kilesavisapaṭipakkhattā agadantipi amataṃ, sacchikiriyāya sattānaṃ patiṭṭhābhūtanti ogadhaṃ, saṃsāradukkhasantibhūtattā nibbutanti nibbānaṃ, natthettha taṇhāsaṅkhātaṃ vānantipi nibbānaṃ.
Nibbāna, the Deathless Refuge (amatogadhaṃ nibbānaṃ): It is "deathless" (amataṃ) because it has no death, which is mortality. It is also "deathless" because it is an antidote (agadaṃ) to the poison of defilements. It is a "refuge" (ogadhaṃ) because it is a foundation for beings to realize. It is "Nibbāna" because it is extinguished (nibbutaṃ) as the cessation of the suffering of saṃsāra, and also because there is no craving (taṇhā), which is attachment, therein.
Nibbāna là nơi an trú bất tử (amatogadhaṃ nibbānaṃ): Nibbāna là bất tử (amata) vì không có sự chết (maraṇa) trong nó; nó cũng là bất tử (amata) vì nó là thuốc giải độc, đối kháng với chất độc phiền não; nó là nơi an trú (ogadha) cho chúng sinh để chứng ngộ; nó là sự tịch tịnh (nibbuta) vì nó làm lắng dịu khổ đau của luân hồi (saṃsāradukkha); nó là Nibbāna vì không có tham ái (taṇhā) trong đó.
Taṃ sāsanassa niṭṭhābhūtattā pariyosānaṭṭhena abhiññeyyaṃ.
That Nibbāna, being the culmination of the Teaching, should be known by way of being the ultimate goal.
Nó cần phải được thắng tri theo nghĩa là cứu cánh (pariyosānaṭṭhena abhiññeyyaṃ) vì nó là mục đích cuối cùng của giáo pháp.
Evaṃ imasmiṃ abhiññeyyaniddese sattasahassāni sattasatāni cattālīsañca vissajjanāni honti.
Thus, in this Abhiññeyyaniddesa, there are seven thousand, seven hundred and forty explanations.
Như vậy, trong phần trình bày về các pháp cần thắng tri này, có bảy ngàn bảy trăm bốn mươi lời giải thích.
21. Pariññeyyaniddese kiñcāpi pariññāsaddena ñātapariññā, tīraṇapariññā, pahānapariññāti tisso pariññā saṅgahitā.
In the Pariññeyyaniddesa, although the term "pariññā" (full understanding) encompasses three types of full understanding—understanding by knowing (ñātapariññā), understanding by investigation (tīraṇapariññā), and understanding by abandoning (pahānapariññā)—
21. Trong phần trình bày về các pháp cần liễu tri (Pariññeyyaniddesa), mặc dù từ “pariññā” bao gồm ba loại liễu tri: ñātapariññā (liễu tri bằng sự biết), tīraṇapariññā (liễu tri bằng sự thẩm sát), và pahānapariññā (liễu tri bằng sự đoạn trừ).
Heṭṭhā ‘‘abhiññeyyā’’ti ñātapariññāya vuttattā upari ‘‘pahātabbā’’ti pahānapariññāya vuttattā tīraṇapariññāva idha adhippetā.
since understanding by knowing was mentioned earlier as "to be thoroughly known" (abhiññeyyā), and understanding by abandoning will be mentioned later as "to be abandoned" (pahātabbā), here only understanding by investigation (tīraṇapariññā) is intended.
Tuy nhiên, ở đây, chỉ có tīraṇapariññā được đề cập, vì ñātapariññā đã được nói đến ở phần dưới với từ “abhiññeyyā” (cần thắng tri), và pahānapariññā sẽ được nói đến ở phần trên với từ “pahātabbā” (cần đoạn trừ).
Phasso sāsavo upādāniyoti āsavānañceva upādānānañca paccayabhūto tebhūmakaphasso.
Contact (phasso) with taints (sāsavo) and clinging (upādāniyo) refers to the three-realm contact (tebhūmaka-phasso) that is a condition for both taints and clinging.
Xúc có lậu hoặc và là đối tượng của chấp thủ (Phasso sāsavo upādāniyo) là xúc thuộc ba cõi (tebhūmakaphasso) làm nhân duyên cho các lậu hoặc (āsava) và các chấp thủ (upādāna).
Sopi hi attānaṃ ārammaṇaṃ katvā pavattamānehi saha āsavehīti sāsavo, ārammaṇabhāvaṃ upagantvā upādānasambandhanena upādānānaṃ hitoti upādāniyo.
Indeed, that contact is "with taints" (sāsavo) because it occurs together with taints that arise by taking itself as an object. It is "with clinging" (upādāniyo) because, having become an object, it is beneficial for clinging through its connection with clinging.
Xúc ấy có lậu hoặc (sāsavo) vì nó hiện hành cùng với các lậu hoặc khi tự lấy mình làm đối tượng; nó là đối tượng của chấp thủ (upādāniyo) vì nó trở thành đối tượng và liên kết với các chấp thủ, mang lại lợi ích cho các chấp thủ.
Yasmā phasse tīraṇapariññāya pariññāte phassamukhena sesāpi arūpadhammā tadanusārena ca rūpadhammā pariññāyanti, tasmā ekova phasso vutto.
Since, when contact is fully understood by understanding by investigation (tīraṇapariññā), the remaining immaterial states (arūpadhammā) and, in accordance with them, the material states (rūpadhammā) are also fully understood through contact, therefore only contact is mentioned.
Bởi vì khi xúc được liễu tri bằng tīraṇapariññā (liễu tri bằng sự thẩm sát), các pháp vô sắc còn lại và cả các pháp sắc theo đó cũng được liễu tri, do đó chỉ một mình xúc được nói đến.
Evaṃ sesesupi yathāyogaṃ yojetabbaṃ.
Similarly, in other instances, it should be applied as appropriate.
Tương tự như vậy, cần phải áp dụng thích hợp cho các pháp còn lại.
Nāmanti cattāro khandhā arūpino nibbānañca.
Name (nāma) refers to the four immaterial aggregates and Nibbāna.
Danh (Nāmaṃ) là bốn uẩn vô sắc và Nibbāna.
Rūpanti cattāri ca mahābhūtāni catunnañca mahābhūtānaṃ upādāyarūpāni catuvīsati.
Form (rūpa) refers to the four great primary elements and the twenty-four derived forms dependent on the four great primary elements.
Sắc (Rūpaṃ) là bốn đại oai nghi và hai mươi bốn sắc y đại (upādāyarūpāni) của bốn đại oai nghi.
Cattāro khandhā namanaṭṭhena nāmaṃ.
The four aggregates are "name" by way of bending.
Bốn uẩn là danh (nāmaṃ) theo nghĩa là sự nghiêng về (namanaṭṭhena).
Te hi ārammaṇābhimukhā namanti.
For they bend towards the object.
Chúng nghiêng về phía đối tượng.
Sabbampi nāmanaṭṭhena nāmaṃ.
All is "name" by way of bending.
Tất cả đều là danh theo nghĩa nghiêng về.
Cattāro hi khandhā ārammaṇe aññamaññaṃ nāmenti, nibbānaṃ ārammaṇādhipatipaccayatāya attani anavajjadhamme nāmeti.
For the four aggregates bend each other to the object, and Nibbāna bends blameless states to itself by way of being a condition of object-dominance.
Bốn uẩn nghiêng về nhau trong đối tượng; Nibbāna làm cho các pháp vô tội nghiêng về mình theo duyên tối thượng của đối tượng.
Santativasena sītādīhi ruppanaṭṭhena rūpaṃ.
Form is by way of being afflicted by cold and so forth, in terms of continuity.
Sắc (rūpaṃ) là pháp bị biến hoại bởi lạnh, v.v., theo dòng tương tục.
Ruppanaṭṭhenāti kuppanaṭṭhena.
By way of being afflicted means by way of being disturbed.
Theo nghĩa bị biến hoại (Ruppanaṭṭhenā) là theo nghĩa bị quấy rầy.
Santativipariṇāmavasena hi sītādīhi ghaṭṭanīyaṃ dhammajātaṃ rūpanti vuccati.
Indeed, the aggregate of phenomena that is to be struck by cold and so forth, in terms of the alteration of continuity, is called form.
Thật vậy, tập hợp các pháp có thể bị tác động bởi lạnh, v.v., theo sự biến đổi của dòng tương tục, được gọi là sắc.
Idha pana nāmanti lokikameva adhippetaṃ, rūpaṃ pana ekantena lokikameva.
However, here "name" is intended only as mundane, while "form" is entirely mundane.
Tuy nhiên, ở đây, danh chỉ có nghĩa là danh thế gian, còn sắc thì hoàn toàn là sắc thế gian.
Tisso vedanāti sukhā vedanā, dukkhā vedanā, adukkhamasukhā vedanā.
Three feelings (tisso vedanā) are pleasant feeling, painful feeling, and neither-pleasant-nor-painful feeling.
Ba thọ (Tisso vedanā) là lạc thọ (sukhā vedanā), khổ thọ (dukkhā vedanā), và bất khổ bất lạc thọ (adukkhamasukhā vedanā).
Tā lokikā eva.
These are solely mundane.
Chúng đều là thế gian.
Āhārāti paccayā.
Nutriments (āhārā) are conditions.
Các món ăn (Āhārā) là các nhân duyên.
Paccayā hi attano phalaṃ āharantīti āhārā.
For conditions bring forth their own results, hence they are nutriments.
Các nhân duyên mang lại quả của chính chúng, do đó gọi là các món ăn (āhārā).
Kabaḷīkāro āhāro phassāhāro manosañcetanāhāro viññāṇāhāroti cattāro.
There are four kinds of nutriment: physical nutriment, contact nutriment, mental volition nutriment, and consciousness nutriment.
Có bốn loại: đoàn thực (kabaḷīkāro āhāro), xúc thực (phassāhāro), tư niệm thực (manosañcetanāhāro), và thức thực (viññāṇāhāro).
Vatthuvasena kabaḷīkātabbattā kabaḷīkāro, ajjhoharitabbattā āhāro.
It is called physical nutriment because it is to be made into a physical mass due to its substantial nature; it is called nutriment because it is to be ingested.
Đoàn thực (kabaḷīkāro) là thức ăn được nhai nuốt theo phương diện vật chất; nó là món ăn (āhāro) vì nó được nuốt vào.
Odanakummāsādivatthukāya ojāyetaṃ nāmaṃ.
This name refers to the essence (ojā) that has rice, gruel, and so forth as its basis.
Tên này là của chất dinh dưỡng (ojā) có vật chất là cơm, cháo, v.v.
Sā hi ojaṭṭhamakarūpāni āharatīti āhāro.
Indeed, that essence brings forth the eight rūpas with essence as the eighth, hence it is nutriment.
Thật vậy, chất dinh dưỡng ấy mang lại tám sắc tố có chất dinh dưỡng là thứ tám, do đó là món ăn.
Cakkhusamphassādiko chabbidho phasso tisso vedanā āharatīti āhāro.
Contact, which is sixfold, starting with eye-contact, brings forth the three feelings, hence it is nutriment.
Xúc sáu loại, bắt đầu từ nhãn xúc, mang lại ba thọ, do đó là món ăn.
Manaso sañcetanā, na sattassāti manosañcetanā yathā cittekaggatā.
Manosañcetanā is the mental volition, not that of a being, just as in cittekaggatā.
Manosañcetanā là sự tác ý của tâm, không phải của chúng sinh, giống như cittekaggatā (nhất tâm).
Manasā vā sampayuttā sañcetanā manosañcetanā yathā ājaññaratho.
Or, sañcetanā conjoined with the mind is manosañcetanā, just as in ājaññaratho (a noble steed's chariot).
Hoặc, sañcetanā (tư tâm sở) hợp với tâm (manasā) được gọi là manosañcetanā, như từ ājaññaratho (xe ngựa tốt).
Tebhūmakakusalākusalacetanā.
These are the wholesome and unwholesome volitions pertaining to the three planes of existence.
Đó là cetanā thiện và bất thiện thuộc ba cõi.
Sā hi tayo bhave āharatīti āhāro.
Indeed, that volition brings forth the three existences, hence it is nutriment.
Vì cetanā ấy mang đến ba cõi, nên gọi là āhāra (dưỡng liệu).
Viññāṇanti ekūnavīsatibhedaṃ paṭisandhiviññāṇaṃ.
Consciousness refers to the nineteen kinds of rebirth-linking consciousness (paṭisandhi-viññāṇa).
Thức (Viññāṇa) là thức tái sinh gồm mười chín loại.
Tañhi paṭisandhināmarūpaṃ āharatīti āhāro.
Indeed, that consciousness brings forth the rebirth-linking nāma-rūpa, hence it is nutriment.
Vì thức ấy mang đến danh-sắc tái sinh, nên gọi là āhāra.
Upādānakkhandhāti upādānagocarā khandhā, majjhapadalopo daṭṭhabbo.
Aggregates of clinging (upādānakkhandhā) are aggregates that are the domain of clinging; the elision of the middle term (gocara) should be understood.
Các uẩn bị chấp thủ (Upādānakkhandhā) là các uẩn là đối tượng của chấp thủ; cần phải hiểu là có sự lược bỏ trung từ.
Upādānasambhūtā vā khandhā upādānakkhandhā yathā tiṇaggi thusaggi.
Or, aggregates arisen from clinging are aggregates of clinging, like a grass fire or a chaff fire.
Hoặc, các uẩn sinh ra từ chấp thủ được gọi là các uẩn bị chấp thủ, như tiṇaggi (lửa cỏ) và thusaggi (lửa trấu).
Upādānavidheyyā vā khandhā upādānakkhandhā yathā rājapuriso.
Or, aggregates subject to clinging are aggregates of clinging, like a king's man.
Hoặc, các uẩn bị chấp thủ được gọi là các uẩn bị chấp thủ, như rājapuriso (người của vua).
Upādānappabhavā vā khandhā upādānakkhandhā yathā puppharukkho phalarukkho.
Or, aggregates originating from clinging are aggregates of clinging, like a flowering tree or a fruit tree.
Hoặc, các uẩn có nguồn gốc từ chấp thủ được gọi là các uẩn bị chấp thủ, như puppharukkho (cây hoa) và phalarukkho (cây quả).
Upādānāni pana kāmupādānaṃ diṭṭhupādānaṃ sīlabbatupādānaṃ attavādupādānanti cattāri.
The clingings (upādānāni) are four: sensual clinging (kāmupādāna), clinging to views (diṭṭhupādāna), clinging to rites and rituals (sīlabbatupādāna), and clinging to a doctrine of self (attavādupādāna).
Bốn loại chấp thủ là: chấp thủ dục, chấp thủ tà kiến, chấp thủ giới cấm, và chấp thủ ngã kiến.
Atthato pana bhusaṃ ādānanti upādānaṃ.
In terms of meaning, upādāna is clinging firmly.
Tuy nhiên, về mặt ý nghĩa, chấp thủ là sự bám víu một cách mạnh mẽ.
Rūpupādānakkhandho, vedanupādānakkhandho, saññupādānakkhandho, saṅkhārupādānakkhandho, viññāṇupādānakkhandhoti pañca.
There are five: the aggregate of clinging to form, the aggregate of clinging to feeling, the aggregate of clinging to perception, the aggregate of clinging to mental formations, and the aggregate of clinging to consciousness.
Có năm loại: sắc uẩn bị chấp thủ, thọ uẩn bị chấp thủ, tưởng uẩn bị chấp thủ, hành uẩn bị chấp thủ, và thức uẩn bị chấp thủ.
Viññāṇaṭṭhitiyoti paṭisandhiviññāṇassa ṭhānāni saviññāṇakā khandhā eva.
Stations of consciousness are the places where rebirth-linking consciousness stands, which are indeed the aggregates accompanied by consciousness.
Các trú xứ của thức là các nơi nương tựa của thức tái sinh, chính là các uẩn có thức.
Tattha seyyathāpīti nidassanatthe nipāto.
In this context, seyyathāpi is a particle used in the sense of an example.
Ở đây, từ seyyathāpi là một giới từ biểu thị ý nghĩa ví dụ.
Manussāti aparimāṇesupi cakkavāḷesu aparimāṇānaṃ manussānaṃ vaṇṇasaṇṭhānādivasena dvepi ekasadisā natthi.
Humans are so called because, even in countless world-systems, no two of the countless humans are exactly alike in terms of color, shape, and so forth.
Loài người (Manussā): Ngay cả trong vô số vũ trụ, không có hai người nào giống hệt nhau về màu sắc, hình dáng, v.v. trong vô số người.
Yepi vaṇṇena vā saṇṭhānena vā sadisā honti, tepi ālokitavilokitādīhi visadisāva honti, tasmā nānattakāyāti vuttā.
Even if they are similar in color or shape, they are dissimilar in terms of looking, glancing, and so on; therefore, they are called nānattakāyā (having diverse bodies).
Ngay cả những người giống nhau về màu sắc hoặc hình dáng, họ vẫn khác nhau về cách nhìn, cách cử chỉ, v.v., do đó được gọi là thân dị biệt.
Paṭisandhisaññā pana nesaṃ tihetukāpi duhetukāpi ahetukāpi hoti, tasmā nānattasaññinoti vuttā.
Their rebirth-linking perception (paṭisandhisaññā) can be with three roots, two roots, or no roots; therefore, they are called nānattasaññino (having diverse perceptions).
Tuy nhiên, tưởng tái sinh của họ có thể là tam nhân, nhị nhân, hoặc vô nhân, do đó được gọi là tưởng dị biệt.
Ekacce ca devāti cha kāmāvacaradevā.
Some devas refers to the devas of the six sensuous planes (kāmāvacara devas).
Một số chư thiên là sáu cõi chư thiên dục giới.
Tesu hi kesañci kāyo nīlo hoti, kesañci pītakādivaṇṇo, saññā pana nesaṃ tihetukāpi duhetukāpi hoti, ahetukā na hoti.
Among them, the bodies of some are blue, while the bodies of others are yellow and so forth; their perception, however, is either with three roots or two roots, but not without roots.
Trong số đó, thân của một số vị có màu xanh, thân của một số vị có màu vàng, v.v.; tuy nhiên, tưởng của họ có thể là tam nhân hoặc nhị nhân, nhưng không phải là vô nhân.
Ekacce ca vinipātikāti catuapāyavinimuttā punabbasumātā yakkhinī, piyaṅkaramātā, phussamittā, dhammaguttāti evamādayo aññe ca vemānikā petā.
And some vinipātikā are yakkhinīs free from the four lower realms, such as Punabbasumātā, Piyaṅkaramātā, Phussamittā, Dhammaguttā, and other vimānika petas.
Một số chúng sinh đọa xứ là những dạ-xoa-ni như Punabbasu-mātā, Piyaṅkara-mātā, Phussamittā, Dhammaguttā, v.v., những người thoát khỏi bốn đường ác, và các ngạ quỷ Vemaṇika khác.
Etesañhi odātakāḷamaṅguracchavisāmavaṇṇādivasena ceva kisathūlarassadīghavasena ca kāyo nānā hoti, manussānaṃ viya tihetukadvihetukāhetukavasena saññāpi.
Indeed, their bodies are diverse, by way of white, black, beetle-like, or golden complexions, and by way of being lean, stout, short, or tall; and their perceptions are also diverse, like those of humans, by way of being three-rooted (tihetuka), two-rooted (dvihetuka), or rootless (ahetuka).
Thân của họ khác nhau về màu sắc như trắng, đen, xám, xanh đậm, v.v., cũng như về hình dáng như gầy, mập, lùn, cao; và tưởng của họ cũng có thể là tam nhân, nhị nhân hoặc vô nhân như loài người.
Te pana devā viya na mahesakkhā, kapaṇamanussā viya appesakkhā dullabhaghāsacchādanā dukkhapīḷitā viharanti.
However, they are not as powerful as devas; they live with little power, finding food and clothing with difficulty, and afflicted by suffering, like wretched humans.
Tuy nhiên, những vị này không có uy lực lớn như chư thiên, mà sống với uy lực nhỏ bé như những người nghèo khổ, khó kiếm thức ăn và quần áo, bị khổ đau giày vò.
Ekacce kāḷapakkhe dukkhitā juṇhapakkhe sukhitā honti, tasmā sukhasamussayato vinipatitattā vinipātikāti vuttā.
Some are miserable during the dark fortnight and happy during the bright fortnight. Therefore, they are called vinipātikā (fallen) because they have fallen from an accumulation of happiness.
Một số vị khổ sở trong kỳ trăng tối và hạnh phúc trong kỳ trăng sáng, do đó họ được gọi là vinipātikā (chúng sinh đọa xứ) vì đã sa đọa khỏi sự tích lũy hạnh phúc.
Ye panettha tihetukā, tesaṃ dhammābhisamayopi hoti piyaṅkaramātādīnaṃ viya.
Among them, those who are three-rooted (tihetuka) also attain the comprehension of the Dhamma, like Piyaṅkaramātā and others.
Những vị tam nhân trong số này cũng có thể chứng ngộ Pháp, như Piyaṅkara-mātā và những vị khác.
Brahmakāyikāti brahmapārisajjabrahmapurohitamahābrahmāno.
Brahmakāyikā are the Brahmā-pārisajjā, Brahmā-purohitā, and Mahābrahmās.
Phạm Thiên (Brahmakāyikā) là các Phạm Thiên Phạm Chúng, Phạm Thiên Phạm Phụ, và Đại Phạm Thiên.
Paṭhamābhinibbattāti te sabbepi paṭhamajjhānena nibbattā.
First arisen means all of them are born through the first jhāna.
Sơ khởi (Paṭhamābhinibbattā) là tất cả các vị ấy đều sinh ra do sơ thiền.
Brahmapārisajjā pana parittena, brahmapurohitā majjhimena, kāyo ca tesaṃ vipphārikataro hoti.
The Brahmā-pārisajjā, however, are born from a slight (jhāna), and the Brahmā-purohitā from a medium (jhāna), and their bodies are more expansive.
Phạm Thiên Phạm Chúng sinh ra do thiền định yếu kém, Phạm Thiên Phạm Phụ do thiền định trung bình, và thân của họ rộng lớn hơn.
Mahābrahmāno paṇītena, kāyo pana nesaṃ ativipphārikataro hoti.
The Mahābrahmās are born from a refined (jhāna), and their bodies are exceedingly expansive.
Đại Phạm Thiên sinh ra do thiền định cao thượng, và thân của họ cực kỳ rộng lớn.
Iti te kāyassa nānattā, paṭhamajjhānavasena saññāya ekattā nānattakāyā ekattasaññinoti vuttā.
Thus, because of the diversity of their bodies and the unity of their perception by way of the first jhāna, they are called "diverse in body, unified in perception."
Như vậy, vì thân của họ dị biệt và tưởng của họ đồng nhất do sơ thiền, nên họ được gọi là thân dị biệt, tưởng đồng nhất.
Yathā ca te, evaṃ catūsu apāyesu sattā.
And just as they are, so are beings in the four lower realms.
Và cũng như các vị ấy, các chúng sinh trong bốn đường ác cũng vậy.
Nirayesu hi kesañci gāvutaṃ, kesañci aḍḍhayojanaṃ, kesañci tigāvutaṃ attabhāvo hoti, devadattassa pana yojanasatiko jāto.
In the hells, some beings have a body of one gāvuta, some half a yojana, some three gāvutas, but Devadatta's body became one hundred yojanas.
Trong các địa ngục, thân của một số chúng sinh dài một gāvuta, một số nửa yojana, một số ba gāvuta; còn thân của Devadatta thì dài một trăm yojana.
Tiracchānesupi keci khuddakā honti, keci mahantā.
Among animals too, some are small, some are large.
Trong loài súc sinh cũng có loài nhỏ bé, có loài to lớn.
Pettivisayesupi keci saṭṭhihatthā keci asītihatthā honti keci suvaṇṇā keci dubbaṇṇā.
Among the peta realm too, some are sixty cubits, some eighty cubits, some are beautiful, some are ugly.
Trong cõi ngạ quỷ cũng có loài cao sáu mươi khuỷu tay, có loài cao tám mươi khuỷu tay; có loài có màu vàng, có loài có màu xấu xí.
Tathā kālakañcikā asurā.
Similarly, the Kāḷakañcika asuras.
Cũng vậy là các A-tu-la Kālakañcika.
Apicettha dīghapiṭṭhikā petā nāma saṭṭhiyojanikāpi honti, saññā pana sabbesampi akusalavipākāhetukāva hoti.
Moreover, among the petas called Dīghapiṭṭhikā, some are even sixty yojanas, but the perception of all of them is only unwholesome resultant, rootless (ahetuka).
Hơn nữa, trong số này, các ngạ quỷ tên là Dīghapiṭṭhika có thể dài sáu mươi yojana, nhưng tưởng của tất cả chúng sinh này đều là vô nhân do quả bất thiện.
Iti apāyikāpi ‘‘nānattakāyā ekattasaññino’’ti saṅkhaṃ gacchanti.
Thus, beings in the lower realms also fall under the category of "diverse in body, unified in perception."
Như vậy, chúng sinh trong các đường ác cũng được xếp vào loại “thân dị biệt, tưởng đồng nhất”.
Subhakiṇhāti subhena vokiṇṇā vikiṇṇā, subhena sarīrappabhāvaṇṇena ekagghanāti attho.
Subhakiṇhā (Of Resplendent Glory) means permeated or diffused with beauty, meaning they possess a single mass of beautiful bodily radiance.
Subhakiṇhā (Biến Tịnh Thiên) có nghĩa là thân họ hòa quyện, lan tỏa với vẻ đẹp, tức là thân họ có màu sắc rực rỡ đồng nhất.
Etesañhi na ābhassarānaṃ viya chijjitvā chijjitvā pabhā gacchatīti.
For their radiance does not emanate in broken fragments like that of the Ābhassarā.
Ánh sáng của các vị này không tỏa ra từng đợt như của các vị Ábhassarā.
Catukkanaye tatiyassa, pañcakanaye catutthassa parittamajjhimapaṇītassa jhānassavasena parittasubhaappamāṇasubhasubhakiṇhā nāma hutvā nibbattanti.
In the four-jhāna system, by way of the third jhāna, and in the five-jhāna system, by way of the slight, medium, and refined fourth jhāna, they are born as Parittasubha (Of Limited Glory), Appamāṇasubha (Of Immeasurable Glory), and Subhakiṇhā (Of Resplendent Glory).
Theo tứ thiền, các vị sinh ra do tu tập thiền thứ ba, và theo ngũ thiền, các vị sinh ra do tu tập thiền thứ tư ở mức độ yếu kém, trung bình và cao thượng được gọi là Parittasubhā (Thiểu Tịnh Thiên), Appamāṇasubhā (Vô Lượng Tịnh Thiên) và Subhakiṇhā (Biến Tịnh Thiên).
Iti sabbepi te ekattakāyā ceva catutthajjhānasaññāya ekattasaññino cāti veditabbā.
Thus, all of them should be understood as "unified in body" and "unified in perception" by way of the perception of the fourth jhāna.
Như vậy, tất cả các vị ấy đều được biết là thân đồng nhất và tưởng đồng nhất do tưởng của tứ thiền.
Vehapphalāpi catutthaviññāṇaṭṭhitimeva bhajanti.
The Vehapphalā (Great Rewarders) also belong to the fourth consciousness-station.
Các vị Vehapphalā (Quảng Quả Thiên) cũng thuộc về trú xứ của thức thứ tư.
Asaññasattā viññāṇābhāvā ettha saṅgahaṃ na gacchanti, sattāvāsesu gacchanti.
The Asaññasattā (Non-percipient beings), due to the absence of consciousness, are not included here but are included among the abodes of beings.
Các vị Asaññasattā (Vô Tưởng Hữu Tình) không được bao gồm ở đây do không có thức, nhưng họ được bao gồm trong chín cõi chúng sinh.
Tattha anuparivattantīti anubandhanti nappajahanti, lokato na nivattantīti attho.
Therein, anuparivattanti means they follow, they do not abandon, they do not turn away from the world; this is the meaning.
Trong đó, anuparivattanti có nghĩa là theo sát, không từ bỏ, không rời khỏi thế gian.
Lābhoti pabbajitassa cīvarādi, gahaṭṭhassa dhanadhaññādi lābho.
Gain refers to robes and so forth for a renunciant, and wealth, grain and so forth for a householder.
Lợi đắc (Lābho) là y phục, v.v., đối với người xuất gia; là tài sản, ngũ cốc, v.v., đối với người tại gia.
Soyeva alabbhamāno lābho alābho.
That same gain, when not attained, is loss.
Chính lợi đắc đó khi không đạt được thì gọi là bất lợi đắc (alābho).
Na lābho alābhoti vuccamāne atthābhāvāpattito pariññeyyo na siyā.
If it were said that gain is not loss, then it would not be a knowable phenomenon due to the absence of its meaning.
Nếu nói “không phải lợi đắc là bất lợi đắc” thì sẽ không có sự hiểu biết đúng đắn vì ý nghĩa không đầy đủ.
Yasoti parivāro.
Fame refers to a retinue.
Danh tiếng (Yaso) là sự tùy tùng.
Soyeva alabbhamānā yaso ayaso.
That same fame, when not attained, is disrepute.
Chính danh tiếng đó khi không đạt được thì gọi là bất danh tiếng (ayaso).
Nindāti avaṇṇabhaṇanaṃ.
Blame refers to speaking ill of someone.
Chỉ trích (Nindā) là nói lời chê bai.
Pasaṃsāti vaṇṇabhaṇanaṃ.
Praise refers to speaking well of someone.
Tán thán (Pasaṃsā) là nói lời khen ngợi.
Sukhanti kāmāvacarānaṃ kāyikacetasikaṃ.
Happiness refers to physical and mental happiness for those in the kāma-loka.
Lạc (Sukhaṃ) là lạc thân và lạc tâm đối với chúng sanh trong cõi Dục.
Dukkhanti puthujjanasotāpannasakadāgāmīnaṃ kāyikacetasikaṃ, anāgāmiarahantānaṃ kāyikameva.
Suffering refers to physical and mental suffering for ordinary people, Sotāpannas, and Sakadāgāmīs; and only physical suffering for Anāgāmīs and Arahants.
Khổ (Dukkhaṃ) là khổ thân và khổ tâm đối với phàm phu, Dự Lưu, Nhất Lai; chỉ là khổ thân đối với Bất Lai và A-la-hán.
Dasāyatanānīti cakkhāyatanaṃ rūpāyatanaṃ sotāyatanaṃ saddāyatanaṃ ghānāyatanaṃ gandhāyatanaṃ jivhāyatanaṃ rasāyatanaṃ kāyāyatanaṃ phoṭṭhabbāyatananti evaṃ dasa.
The ten āyatanas are the eye-ayatana, visible-form-ayatana, ear-ayatana, sound-ayatana, nose-ayatana, smell-ayatana, tongue-ayatana, taste-ayatana, body-ayatana, and tangible-object-ayatana; thus, there are ten.
Mười xứ (Dasāyatanāni) là nhãn xứ, sắc xứ, nhĩ xứ, thanh xứ, tỷ xứ, hương xứ, thiệt xứ, vị xứ, thân xứ, xúc xứ, như vậy là mười.
Manāyatanadhammāyatanāni pana lokuttaramissakattā na gahitāni.
However, the mind-ayatana and phenomena-ayatana are not included because they are mixed with supramundane states.
Tuy nhiên, ý xứ và pháp xứ không được bao gồm vì chúng liên quan đến các pháp siêu thế.
Imesu dasasu vissajjanesu vipassanāvasena tīraṇapariññā vuttā, ‘‘sabbaṃ, bhikkhave, pariññeyya’’ntiādīsu pana anaññātaññassāmītindriyādīnaṃ tiṇṇaṃ, nirodhapaṭipadānaṃ sacchikiriyābhāvanaṭṭhānaṃ tesaṃyeva paṭivedhaṭṭhānaṃ dukkhādīnaṃ nissaraṇassa anuppādādīnaṃ pañcadasannaṃ, pariggahaṭṭhādīnaṃ ekatiṃsāya, uttaripaṭivedhaṭṭhādīnaṃ tiṇṇaṃ, maggaṅgānaṃ aṭṭhannaṃ, ‘‘payogānaṃ paṭippassaddhaṭṭho’’tiādīnaṃ dvinnaṃ, asaṅkhataṭṭhassa vuṭṭhānaṭṭhādīnaṃ dvinnaṃ, niyyānaṭṭhassa anubujjhanaṭṭhādīnaṃ tiṇṇaṃ, anubodhanaṭṭhādīnaṃ tiṇṇaṃ, anubodhapakkhiyādīnaṃ tiṇṇaṃ, ujjotanaṭṭhādīnaṃ catunnaṃ, patāpanaṭṭhādīnaṃ aṭṭhārasannaṃ, vivaṭṭanānupassanādīnaṃ navannaṃ, khayeñāṇaanuppādeñāṇānaṃ paññāvimuttinibbānānanti imesaṃ dhammānaṃ paṭilābhavasena tīraṇapariññā vuttā, sesānaṃ yathāyogaṃ vipassanāvasena ca paṭilābhavasena ca tīraṇapariññā vuttāti veditabbā.
In these ten explanations, tīraṇapariññā is stated by way of insight. However, in phrases like ‘‘Bhikkhus, all is to be fully understood’’, tīraṇapariññā is stated by way of the attainment of these dhammas: the three, such as the anaññātaññassāmītindriya; the actualization and development of the cessation and the path; the penetration of these very two; the escape from suffering and so forth; the fifteen, such as non-arising; the thirty-one, such as the state of full comprehension; the three, such as the state of higher penetration; the eight path factors; the two, such as ‘‘the state of the cessation of efforts’’; the state of the unconditioned; the two, such as the state of emergence; the state of release; the three, such as the state of fully understanding; the three, such as the state of full awakening; the three, such as those pertaining to full awakening; the four, such as the state of illumination; the eighteen, such as the state of burning up; the nine, such as the contemplation of turning away; and the knowledge of destruction, the knowledge of non-arising, wisdom-liberation, and Nibbāna. It should be understood that for the remaining dhammas, tīraṇapariññā is stated appropriately by way of insight and by way of attainment.
Trong mười sự giải thích này, sự liễu tri thẩm định (tīraṇapariññā) được nói đến theo phương diện quán chiếu (vipassanā). Còn trong các đoạn như “Này các Tỳ-khưu, tất cả cần phải được liễu tri,” sự liễu tri thẩm định được nói đến theo phương diện thành tựu các pháp như ba căn ‘ta sẽ biết điều chưa biết’, sự chứng đắc và tu tập các đạo diệt, sự thâm nhập các đạo diệt đó, sự giải thoát khỏi khổ, v.v., mười lăm ý nghĩa như sự không sanh khởi, v.v., ba mươi mốt ý nghĩa như sự thâu tóm, v.v., ba ý nghĩa như sự thâm nhập cao hơn, v.v., tám chi phần của đạo, hai ý nghĩa như ‘sự an tịnh các nỗ lực’, v.v., ý nghĩa vô vi, hai ý nghĩa như sự xuất khởi, v.v., ý nghĩa xuất ly, ba ý nghĩa như sự giác ngộ, v.v., ba ý nghĩa như sự khai thị, v.v., ba ý nghĩa như các pháp thuộc giác ngộ, v.v., bốn ý nghĩa như sự soi sáng, v.v., mười tám ý nghĩa như sự đốt cháy, v.v., chín ý nghĩa như sự quán chiếu chuyển hóa, v.v., trí tuệ về sự đoạn tận và trí tuệ về sự không sanh khởi, trí tuệ giải thoát và Nibbāna. Đối với các pháp còn lại, sự liễu tri thẩm định được nói đến theo phương diện quán chiếu và phương diện thành tựu tùy theo sự thích hợp, cần phải hiểu như vậy.
Yesaṃ yesaṃ dhammānaṃ paṭilābhatthāya vāyamantassa, te te dhammā paṭiladdhā honti.
The dhammas for the attainment of which one strives are attained. Thus, those dhammas are both fully understood and analyzed.
Đối với bất kỳ pháp nào mà người ta nỗ lực để thành tựu, thì những pháp đó đều đã được thành tựu.
Evaṃ te dhammā pariññātā ceva honti tīritā cāti hi kiccasamāpanaṭṭhena tīraṇapariññā vuttā.
Indeed, tīraṇapariññā is stated in the sense of the completion of the task.
Như vậy, những pháp đó được liễu tri và đã được thẩm định (tīritā), nghĩa là liễu tri thẩm định được nói đến theo ý nghĩa hoàn thành công việc.
Kicce hi samāpite te dhammā paṭiladdhā hontīti.
For when the task is completed, those dhammas are attained.
Vì khi công việc hoàn thành, những pháp đó đã được thành tựu.
Keci pana ‘‘avipassanūpagānaṃ ñātapariññā’’ti vadanti.
Some, however, say, ‘‘ñātapariññā for those not leading to insight.’’
Một số người nói rằng “liễu tri nhận thức (ñātapariññā)” là dành cho những pháp không thuộc về quán chiếu.
Abhiññeyyena ñātapariññāya vuttattā taṃ na sundaraṃ.
That is not good, as ñātapariññā has been stated in relation to what is to be directly known.
Điều đó không đúng vì liễu tri nhận thức đã được nói đến trong phần Abhiññeyya (các pháp cần được thắng tri).
Pariññātā ceva honti tīritā cāti te paṭiladdhā eva dhammā pariññātā ca nāma honti, tīritā ca nāmāti attho.
Both fully understood and analyzed means that those dhammas, once attained, are called both fully understood and analyzed.
Được liễu tri và đã được thẩm định (Pariññātā ceva honti tīritā cā) có nghĩa là những pháp đã được thành tựu đó được gọi là đã được liễu tri và đã được thẩm định.
Evaṃ kiccasamāpanatthavasena pariññātattho vutto hoti.
Thus, the meaning of pariññāta is stated in the sense of the completion of the task.
Như vậy, ý nghĩa của liễu tri được nói đến theo phương diện hoàn thành công việc.
Tisso taṇhāti kāmataṇhā, bhavataṇhā, vibhavataṇhā.
The three cravings are craving for sensual pleasures (kāmataṇhā), craving for existence (bhavataṇhā), and craving for annihilation (vibhavataṇhā).
Tisso taṇhā (ba loại ái) là kāmataṇhā (dục ái), bhavataṇhā (ái hữu) và vibhavataṇhā (ái phi hữu).
Tāsaṃ abhidhamme evaṃ niddeso kato – tattha katamā bhavataṇhā?
Their definition in the Abhidhamma is as follows: Therein, what is craving for existence?
Trong A-tì-đàm, sự giải thích về chúng được thực hiện như sau: Ở đây, bhavataṇhā (ái hữu) là gì?
Bhavadiṭṭhisahagato rāgo…pe… cittassa sārāgo, ayaṃ vuccati bhavataṇhā.
It is the passion accompanied by the view of existence… the strong attachment of the mind; this is called craving for existence.
Là sự tham ái đi kèm với tà kiến hữu thường (bhavadiṭṭhi-sahagato rāgo)…v.v… là sự tham đắm trong tâm; đây được gọi là bhavataṇhā (ái hữu).
Tattha katamā vibhavataṇhā?
Therein, what is craving for annihilation?
Ở đây, vibhavataṇhā (ái phi hữu) là gì?
Ucchedadiṭṭhisahagato rāgo…pe… cittassa sārāgo, ayaṃ vuccati vibhavataṇhā.
It is the passion accompanied by the view of annihilation… the strong attachment of the mind; this is called craving for annihilation.
Là sự tham ái đi kèm với tà kiến đoạn diệt (ucchedadiṭṭhi-sahagato rāgo)…v.v… là sự tham đắm trong tâm; đây được gọi là vibhavataṇhā (ái phi hữu).
Avasesā taṇhā kāmataṇhā.
The remaining craving is craving for sensual pleasures.
Khát ái còn lại là kāmataṇhā (dục ái).
Tattha katamā kāmataṇhā?
Therein, what is craving for sensual pleasures?
Ở đây, kāmataṇhā (dục ái) là gì?
Kāmadhātupaṭisaṃyutto rāgo…pe… cittassa sārāgo, ayaṃ vuccati kāmataṇhā.
Greed connected with the Kāma-sphere…pe… the mind’s strong attachment, this is called kāmataṇhā.
Là sự tham ái liên quan đến cõi dục (kāmadhātu-paṭisaṃyutto rāgo)…v.v… là sự tham đắm trong tâm; đây được gọi là kāmataṇhā (dục ái).
Tattha katamā bhavataṇhā?
Among these, what is bhavataṇhā?
Ở đây, bhavataṇhā (ái hữu) là gì?
Rūpadhātuarūpadhātupaṭisaṃyutto rāgo…pe… tattha katamā vibhavataṇhā?
Greed connected with the Rūpa-sphere and Arūpa-sphere…pe… Among these, what is vibhavataṇhā?
Là sự tham ái liên quan đến cõi sắc và cõi vô sắc (rūpadhātu-arūpadhātu-paṭisaṃyutto rāgo)…v.v… Ở đây, vibhavataṇhā (ái phi hữu) là gì?
Ucchedadiṭṭhisahagato rāgo…pe… (vibha. 916).
Greed accompanied by the annihilation-view…pe….
Là sự tham ái đi kèm với tà kiến đoạn diệt (ucchedadiṭṭhi-sahagato rāgo)…v.v…
Aṭṭhakathāyaṃ pana ‘‘pañcakāmaguṇiko rāgo kāmataṇhā, rūpārūpabhavesu rāgo jhānanikantisassatadiṭṭhisahagato rāgo bhavavasena patthanā bhavataṇhā, ucchedadiṭṭhisahagato rāgo vibhavataṇhā’’ti vuttaṃ.
In the Aṭṭhakathā, however, it is stated: “Greed for the five sense-objects is kāmataṇhā; greed for the rūpa and arūpa existences, greed accompanied by attachment to jhāna and by the eternalist view, and aspiration for existence, is bhavataṇhā; greed accompanied by the annihilation-view is vibhavataṇhā.”
Tuy nhiên, trong Chú Giải, đã nói rằng: “Tham ái đối với năm dục trần là kāmataṇhā (dục ái); tham ái đối với các cõi sắc và vô sắc, tham ái đi kèm với sự khao khát thiền định (jhānanikanti) và tà kiến thường còn (sassatadiṭṭhi), sự khao khát theo hữu là bhavataṇhā (ái hữu); tham ái đi kèm với tà kiến đoạn diệt là vibhavataṇhā (ái phi hữu).”
Ayaṃ dasuttarasuttapariyāyena yojanā.
This is an application according to the Dasuttara Sutta method.
Đây là cách sắp xếp theo kinh Dasuttara.
Saṅgītipariyāyena pana abhidhammapariyāyena ca ‘‘aparāpi tisso taṇhā kāmataṇhā rūpataṇhā arūpataṇhā.
Furthermore, according to the Saṅgīti method and the Abhidhamma method, other three cravings are mentioned: kāmataṇhā, rūpataṇhā, arūpataṇhā.
Còn theo kinh Saṅgīti và theo A-tì-đàm, thì các loại ái khác cũng phù hợp ở đây, đó là: “Ba loại ái khác là kāmataṇhā (dục ái), rūpataṇhā (sắc ái), arūpataṇhā (vô sắc ái).
Aparāpi tisso taṇhā rūpataṇhā arūpataṇhā nirodhataṇhā’’ti (dī. ni. 3.305; vibha. 917-918) vuttā taṇhāpi ettha yujjanti.
Also, other three cravings are rūpataṇhā, arūpataṇhā, and nirodhataṇhā. These cravings are also applicable here.
Ba loại ái khác là rūpataṇhā (sắc ái), arūpataṇhā (vô sắc ái), nirodhataṇhā (diệt ái).”
Tāsu pañca kāmadhāturūpadhātuarūpadhātupaṭisaṃyuttā, antimā ucchedadiṭṭhisahagatā.
Among these, five are connected with the Kāma-sphere, Rūpa-sphere, and Arūpa-sphere; the last one is accompanied by the annihilation-view.
Trong số đó, năm loại đầu liên quan đến dục giới, sắc giới và vô sắc giới; loại cuối cùng (nirodhataṇhā) đi kèm với tà kiến đoạn diệt.
Cattāro oghāti kāmogho, bhavogho, diṭṭhogho, avijjogho.
Four Floods are the flood of sensuality (kāmogha), the flood of existence (bhavogha), the flood of views (diṭṭhogha), and the flood of ignorance (avijjogha).
Cattāro oghā (bốn dòng nước lũ) là kāmogha (dục lũ), bhavogha (hữu lũ), diṭṭhogha (kiến lũ), avijjogha (vô minh lũ).
Yassa saṃvijjanti, taṃ vaṭṭasmiṃ ohananti osīdāpentīti oghā.
Those in whom they are found, they sink and cause to sink into saṃsāra, hence they are called floods (ogha).
Những gì tồn tại trong một người, chúng nhấn chìm và làm cho người đó lún sâu vào vòng luân hồi (vaṭṭasmiṃ ohananti osīdāpenti), do đó chúng được gọi là oghā (dòng nước lũ).
Balavakilesā ete.
These are powerful defilements.
Đây là những phiền não mạnh mẽ.
Kāmaguṇasaṅkhāte kāme ogho kāmogho.
The flood in sensual pleasures, called sense-objects, is the flood of sensuality (kāmogha).
Dòng nước lũ trong các dục được gọi là kāmaguṇa (dục trần) là kāmogha (dục lũ).
Kāmataṇhāyetaṃ nāmaṃ.
This is a name for kāmataṇhā.
Đây là tên gọi của kāmataṇhā (dục ái).
Rūpārūpasaṅkhāte kammato ca upapattito ca duvidhepi bhave ogho bhavogho.
The flood in both types of existence—that which is called rūpa and arūpa, and that which arises from kamma and rebirth—is the flood of existence (bhavogha).
Dòng nước lũ trong hai loại hữu, hữu do nghiệp và hữu do tái sinh, được gọi là rūpa (sắc) và arūpa (vô sắc) là bhavogha (hữu lũ).
Bhavataṇhāyetaṃ nāmaṃ.
This is a name for bhavataṇhā.
Đây là tên gọi của bhavataṇhā (ái hữu).
Diṭṭhi eva ogho diṭṭhogho.
View itself is a flood, hence the flood of views (diṭṭhogha).
Tà kiến (diṭṭhi) chính là dòng nước lũ, diṭṭhogha (kiến lũ).
‘‘Sassato loko’’tiādikāya diṭṭhiyā etaṃ nāmaṃ.
This is a name for views such as “the world is eternal”.
Đây là tên gọi của các tà kiến như "thế gian là thường còn" (sassato loko) v.v.
Avijjā eva ogho avijjogho, dukkhādīsu aññāṇassetaṃ nāmaṃ.
Ignorance itself is a flood, hence the flood of ignorance (avijjogha); this is a name for unknowing regarding suffering, etc.
Vô minh (avijjā) chính là dòng nước lũ, avijjogha (vô minh lũ), đây là tên gọi của sự không biết về Khổ v.v.
Pañca nīvaraṇānīti kāmacchandanīvaraṇaṃ byāpādanīvaraṇaṃ thinamiddhanīvaraṇaṃ uddhaccakukkuccanīvaraṇaṃ vicikicchānīvaraṇaṃ.
Five Hindrances are the hindrance of sensual desire (kāmacchandanīvaraṇa), the hindrance of ill-will (byāpādanīvaraṇa), the hindrance of sloth and torpor (thinamiddhanīvaraṇa), the hindrance of restlessness and remorse (uddhaccakukkuccanīvaraṇa), and the hindrance of doubt (vicikicchānīvaraṇa).
Pañca nīvaraṇāni (năm triền cái) là kāmacchandanīvaraṇa (dục tham triền cái), byāpādanīvaraṇa (sân hận triền cái), thinamiddhanīvaraṇa (hôn trầm thụy miên triền cái), uddhaccakukkuccanīvaraṇa (trạo cử hối quá triền cái), vicikicchānīvaraṇa (nghi ngờ triền cái).
Cittaṃ nīvaranti pariyonandhantīti nīvaraṇāni.
They obstruct and envelop the mind, hence they are hindrances (nīvaraṇāni).
Chúng che lấp và trói buộc tâm (cittaṃ nīvaranti pariyonandhanti), nên được gọi là nīvaraṇāni (triền cái).
Kāmīyantīti kāmā.
They are desired, hence kāma.
Chúng được khao khát (kāmīyanti), nên gọi là kāmā (dục).
Pañca kāmaguṇā.
The five sense-objects.
Năm dục trần.
Kāmesu chando kāmacchando.
Desire for sensual pleasures is sensual desire (kāmacchando).
Sự ham muốn (chando) trong các dục là kāmacchando (dục tham).
Kāmayatīti vā kāmo, kāmo eva chando, na kattukamyatāchando na dhammacchandoti kāmacchando.
Or, it desires, hence kāma; kāma itself is desire, not the desire to do or the desire for Dhamma, hence kāmacchando.
Hoặc, nó khao khát (kāmayati) nên gọi là kāma (dục); dục chính là ham muốn, không phải là ham muốn muốn làm (kattukamyatāchando) hay ham muốn pháp (dhammacchando), nên là kāmacchando (dục tham).
Kāmataṇhāyetaṃ nāmaṃ.
This is a name for kāmataṇhā.
Đây là tên gọi của kāmataṇhā (dục ái).
Byāpajjati tena cittaṃ pūtibhāvaṃ gacchati, byāpādayati vā vinayācārarūpasampattihitasukhānīti byāpādo.
The mind becomes spoiled by it, or it destroys good conduct, beauty, welfare, and happiness, hence byāpādo.
Tâm trở nên hư hoại (pūtibhāvaṃ gacchati) bởi nó, hoặc nó hủy hoại sự viên mãn về giới luật, oai nghi, sắc đẹp, lợi ích và hạnh phúc (vinayācārarūpasampattihitasukhāni), nên gọi là byāpādo (sân hận).
Dosassetaṃ nāmaṃ.
This is a name for dosa.
Đây là tên gọi của dosa (sân).
Thinanatā thinaṃ, middhanatā middhaṃ, anussāhasaṃhananatā asattivighāto cāti attho.
Slothfulness is thina, torpor is middha, meaning lack of energy and hindrance of ability.
Sự không linh hoạt của tâm là thinaṃ (hôn trầm), sự không linh hoạt của các tâm sở là middhaṃ (thụy miên), nghĩa là sự thiếu nghị lực và sự suy yếu do bất lực.
Cittassa anussāho thinaṃ, cetasikānaṃ akammaññatā middhaṃ, thinañca middhañca thinamiddhaṃ.
The mind's lack of energy is thina, the mental factors' unsuitability for work is middha; thina and middha together are thinamiddha.
Sự thiếu nghị lực của tâm là thinaṃ (hôn trầm), sự không thích hợp cho công việc của các tâm sở là middhaṃ (thụy miên), hôn trầm và thụy miên là thinamiddhaṃ (hôn trầm thụy miên).
Uddhatassa bhāvo uddhaccaṃ, avūpasamoti attho.
The state of being restless is uddhacca, meaning lack of tranquility.
Trạng thái của sự phóng dật là uddhaccaṃ (trạo cử), nghĩa là sự không an tịnh.
Vikkhepassetaṃ nāmaṃ.
This is a name for distraction.
Đây là tên gọi của vikkhepa (phóng dật).
Kucchitaṃ kataṃ kukataṃ, kukatassa bhāvo kukkuccaṃ, garahitakiriyabhāvoti attho.
An ill-done action is kukata; the state of having done ill is kukkucca, meaning the state of blameworthy action.
Hành động xấu xa (kucchitaṃ kataṃ) là kukataṃ (việc làm xấu), trạng thái của việc làm xấu là kukkuccaṃ (hối quá), nghĩa là trạng thái của hành động đáng trách.
Pacchānutāpassetaṃ nāmaṃ.
This is a name for remorse.
Đây là tên gọi của pacchānutāpa (hối hận).
Vigatā cikicchāti vicikicchā, vigatapaññāti attho.
Doubt (vicikicchā) is the absence of wisdom, meaning the absence of clear understanding.
Sự chữa trị đã qua đi (vigatā cikicchā) là vicikicchā (nghi ngờ), nghĩa là trí tuệ đã mất.
Sabhāvaṃ vā vicinanto etāya kicchati kilamatīti vicikicchā.
Or, one suffers and is troubled by it while investigating the true nature, hence vicikicchā.
Hoặc, do suy xét bản chất mà khổ sở, mệt mỏi (vicinanto etāya kicchati kilamati), nên gọi là vicikicchā (nghi ngờ).
Buddhādīsu saṃsayassetaṃ nāmaṃ.
This is a name for doubt regarding the Buddha and so forth.
Đây là tên gọi của sự hoài nghi về Đức Phật v.v.
Kāmacchando eva nīvaraṇaṃ kāmacchandanīvaraṇaṃ.
Sensual desire itself is a hindrance, hence kāmacchandanīvaraṇa.
Dục tham chính là triền cái, kāmacchandanīvaraṇa (dục tham triền cái).
Evaṃ sesesupi.
Similarly for the rest.
Tương tự đối với các loại còn lại.
Sattānusayāti kāmarāgānusayo paṭighānusayo mānānusayo diṭṭhānusayo vicikicchānusayo bhavarāgānusayo avijjānusayo.
Seven Latent Tendencies are the latent tendency of sensual lust (kāmarāgānusayo), the latent tendency of aversion (paṭighānusayo), the latent tendency of conceit (mānānusayo), the latent tendency of views (diṭṭhānusayo), the latent tendency of doubt (vicikicchānusayo), the latent tendency of lust for existence (bhavarāgānusayo), and the latent tendency of ignorance (avijjānusayo).
Bảy tùy miên (sattānusayā) là kāmarāgānusaya (dục tham tùy miên), paṭighānusaya (sân hận tùy miên), mānānusaya (ngã mạn tùy miên), diṭṭhānusaya (kiến tùy miên), vicikicchānusaya (nghi tùy miên), bhavarāgānusaya (hữu tham tùy miên), avijjānusaya (vô minh tùy miên).
Appahīnaṭṭhena anusentīti anusayā.
They lie latent because they have not been abandoned, hence anusayā.
Chúng tiềm tàng (anusenti) vì chưa được đoạn trừ (appahīnaṭṭhena), nên gọi là anusayā (tùy miên).
Kāmesu rāgo kāmarāgo, kāmo eva vā rāgoti kāmarāgo.
Lust for sensual pleasures is kāmarāgo, or kāma itself is lust, hence kāmarāgo.
Tham ái trong các dục là kāmarāgo (dục tham), hoặc dục chính là tham ái nên là kāmarāgo (dục tham).
Ārammaṇasmiṃ paṭihaññatīti paṭighaṃ.
It strikes against the object, hence paṭighaṃ.
Nó va chạm (paṭihaññati) vào đối tượng (ārammaṇasmiṃ), nên là paṭighaṃ (sân hận).
Ayāthāvadassanaṭṭhena diṭṭhi.
Diṭṭhi is seeing incorrectly.
Diṭṭhi (kiến) theo nghĩa thấy không đúng như thật (ayāthāvadassanaṭṭhena).
Seyyādivasena maññatīti māno.
One conceives oneself as superior, etc., hence māno.
Nó tưởng tượng (maññati) theo cách "ta hơn" v.v., nên là māno (ngã mạn).
Bhavesu rāgo bhavarāgo.
Lust for existences is bhavarāgo.
Tham ái trong các cõi hữu là bhavarāgo (hữu tham).
Thāmagato kāmarāgo kāmarāgānusayo.
Sensual lust that has become strong is kāmarāgānusayo.
Dục tham đã trở nên mạnh mẽ là kāmarāgānusaya (dục tham tùy miên).
Evaṃ sesesupi.
Similarly for the rest.
Tương tự đối với các loại còn lại.
Aṭṭha micchattāti micchādiṭṭhi micchāsaṅkappo micchāvācā micchākammanto micchāājīvo micchāvāyāmo micchāsati micchāsamādhi.
Eight Wrong Things are wrong view (micchādiṭṭhi), wrong intention (micchāsaṅkappo), wrong speech (micchāvācā), wrong action (micchākammanto), wrong livelihood (micchāājīvo), wrong effort (micchāvāyāmo), wrong mindfulness (micchāsati), and wrong concentration (micchāsamādhi).
Tám tà pháp (aṭṭha micchattā) là micchādiṭṭhi (tà kiến), micchāsaṅkappo (tà tư duy), micchāvācā (tà ngữ), micchākammanto (tà nghiệp), micchāājīvo (tà mạng), micchāvāyāmo (tà tinh tấn), micchāsati (tà niệm), micchāsamādhi (tà định).
‘‘Hitasukhāvahā me bhavissantī’’ti evaṃ āsīsitāpi tathāabhāvato asubhādīsuyeva subhantiādiviparītappavattito ca micchāsabhāvāti micchattā.
Even if one wishes, "These will bring me welfare and happiness," because they do not exist in that way, and because they arise in a contrary manner, such as* the impure as pure, they are of a wrong nature, hence they are called wrongness.
Mặc dù được ước mong rằng "chúng sẽ mang lại lợi ích và hạnh phúc cho ta", nhưng vì chúng không như vậy, và vì chúng hoạt động trái ngược như cho rằng những điều bất tịnh v.v. là tịnh, nên chúng có bản chất sai lầm (micchāsabhāvā), do đó chúng là micchattā (tà pháp).
Micchā passati, micchā vā etāya passantīti micchādiṭṭhi.
One sees wrongly, therefore it is wrong view. Or, by this, they see wrongly, therefore it is wrong view.
Nó thấy sai lầm (micchā passati), hoặc người ta thấy sai lầm bởi nó (micchā vā etāya passantīti), nên là micchādiṭṭhi (tà kiến).
Atha vā viparītā diṭṭhīti micchādiṭṭhi, ayāthāvadiṭṭhīti vā micchādiṭṭhi, virajjhitvā gahaṇato vā vitathā diṭṭhīti micchādiṭṭhi, anattāvahattā paṇḍitehi kucchitā diṭṭhīti vāmicchādiṭṭhi.
Or else, it is a view contrary to Right View, therefore it is wrong view. Or, it is an unreal view, therefore it is wrong view. Or, due to grasping erroneously, it is a false view, therefore it is wrong view. Or, because it brings harm, it is a view despised by the wise, therefore it is wrong view.
Hoặc, kiến giải sai lệch là micchādiṭṭhi, hoặc kiến giải không đúng như thật là micchādiṭṭhi, hoặc kiến giải sai lầm vì bị nắm giữ một cách sai lệch là micchādiṭṭhi, hoặc kiến giải bị các bậc hiền trí chỉ trích vì mang lại điều bất lợi là micchādiṭṭhi.
Micchāsaṅkappādīsupi eseva nayo.
The same method applies to wrong intention and so on.
Tương tự đối với micchāsaṅkappa (tà tư duy) v.v.
Micchādiṭṭhīti sassatucchedābhiniveso.
Wrong view is the adherence to eternalism or annihilationism.
Micchādiṭṭhi (tà kiến) là sự chấp thủ vào thường kiến và đoạn kiến.
Micchāsaṅkappoti kāmavitakkāditividho vitakko.
Wrong intention is the three kinds of intention, such as intention for sensual pleasure (kāmavitakka).
Micchāsaṅkappo (tà tư duy) là ba loại tầm (vitakko) như dục tầm (kāmavitakka) v.v.
Micchāvācāti musāvādādicatubbidhā cetanā.
Wrong speech is the four kinds of volition, such as false speech.
Micchāvācā (tà ngữ) là bốn loại tư tâm (cetanā) như nói dối (musāvāda) v.v.
Micchākammantoti pāṇātipātāditividhā cetanā.
Wrong action is the three kinds of volition, such as taking life.
Micchākammanto (tà nghiệp) là ba loại tư tâm như sát sinh (pāṇātipāta) v.v.
Micchāājīvoti micchājīvapayogasamuṭṭhāpikā cetanā.
Wrong livelihood is the volition that gives rise to the practice of wrong livelihood.
Micchāājīvo (tà mạng) là tư tâm khởi lên việc thực hành tà mạng.
Micchāvāyāmoti akusalacittasampayuttaṃ vīriyaṃ.
Wrong effort is energy associated with unwholesome states of mind.
Micchāvāyāmo (tà tinh tấn) là tinh tấn đi kèm với các tâm bất thiện.
Micchāsatīti satipaṭipakkhabhūto akusalacittuppādo.
Wrong mindfulness is the arising of unwholesome states of mind, which is contrary to mindfulness.
Micchāsatī (tà niệm) là sự sinh khởi của tâm bất thiện đối nghịch với niệm.
Micchāsamādhīti akusalasamādhi.
Wrong concentration is unwholesome concentration.
Micchāsamādhi (tà định) là định bất thiện.
Nava taṇhāmūlakāti (dī. ni. 2.103; 3.359) taṇhaṃ paṭicca pariyesanā, pariyesanaṃ paṭicca lābho, lābhaṃ paṭicca vinicchayo, vinicchayaṃ paṭicca chandarāgo, chandarāgaṃ paṭicca ajjhosānaṃ, ajjhosānaṃ paṭicca pariggaho, pariggahaṃ paṭicca macchariyaṃ, macchariyaṃ paṭicca ārakkho, ārakkhādhikaraṇaṃ daṇḍādānasatthādānakalahaviggahavivādatuvaṃtuvaṃpesuññamusāvādā aneke pāpakā akusalā dhammā sambhavanti (dī. ni. 2.104; 3.359).
Nine roots of craving are: Dependent on craving is seeking; dependent on seeking is gain; dependent on gain is assessment; dependent on assessment is desire and lust; dependent on desire and lust is clinging; dependent on clinging is possessiveness; dependent on possessiveness is avarice; dependent on avarice is guarding; dependent on guarding, many evil, unwholesome states arise, such as taking up a stick, taking up a weapon, quarrels, disputes, altercations, tuvaṃtuvaṃ, slander, and false speech.
Chín pháp gốc từ ái là: do ái mà có sự tìm cầu; do sự tìm cầu mà có sự thâu hoạch; do sự thâu hoạch mà có sự quyết đoán; do sự quyết đoán mà có dục ái (chandarāga); do dục ái mà có sự chấp thủ; do sự chấp thủ mà có sự chiếm hữu; do sự chiếm hữu mà có sự keo kiệt; do sự keo kiệt mà có sự gìn giữ; do sự gìn giữ làm nhân mà có việc cầm gậy, cầm khí giới, cãi vã, tranh chấp, bất hòa, nói lời thô tục, nói lời đâm thọc, nói dối, và nhiều pháp bất thiện, ác pháp khác phát sinh.
Ime nava taṇhāmūlakā dhammā.
These nine are states rooted in craving.
Chín pháp này là các pháp gốc từ ái.
Taṇhā mūlaṃ etesanti taṇhāmūlakā.
Craving is the root of these, hence they are called "rooted in craving."
“Taṇhāmūlakā” có nghĩa là ái là gốc rễ của chúng.
Pariyesanādayo akusalā eva.
Seeking and the rest are unwholesome.
Các pháp như sự tìm cầu, v.v., đều là bất thiện.
Taṇhaṃ, paṭiccāti taṇhaṃ nissāya.
Dependent on craving means relying on craving.
Taṇhaṃ, paṭiccāti: nương vào ái.
Pariyesanāti rūpādiārammaṇapariyesanā.
Seeking is the seeking of sense objects such as forms.
Pariyesanāti: sự tìm cầu các đối tượng như sắc, v.v.
Sā hi taṇhāya sati hoti.
Indeed, it arises when there is craving.
Quả thật, điều đó xảy ra khi có ái.
Lābhoti rūpādiārammaṇapaṭilābho, so hi pariyesanāya sati hoti.
Gain is the acquisition of sense objects such as forms; indeed, it arises when there is seeking.
Lābhoti: sự thâu hoạch các đối tượng như sắc, v.v., quả thật điều đó xảy ra khi có sự tìm cầu.
Vinicchayo pana ñāṇataṇhādiṭṭhivitakkavasena catubbidho.
Assessment, however, is fourfold, according to knowledge, craving, views, and intention (vitakka).
Sự quyết đoán (vinicchaya) có bốn loại theo trí tuệ, ái, tà kiến và tầm.
Tattha ‘‘sukhavinicchayaṃ jaññā, sukhavinicchayaṃ ñatvā ajjhattaṃ sukhamanuyuñjeyyā’’ti (ma. ni. 3.323) ayaṃ ñāṇavinicchayo.
Among these, "One should know the assessment of happiness; having known the assessment of happiness, one should cultivate happiness within oneself" – this is assessment by knowledge.
Trong đó, “Nên biết sự quyết đoán về lạc; sau khi biết sự quyết đoán về lạc, nên chuyên tâm vào lạc nội tại” thì đây là ñāṇavinicchayo (sự quyết đoán bằng trí tuệ).
‘‘Vinicchayoti dve vinicchayā taṇhāvinicchayo ca diṭṭhivinicchayo cā’’ti (mahāni. 102) evaṃ āgatāni aṭṭhasatataṇhāvicaritāni taṇhāvinicchayo.
"There are two kinds of assessment: assessment by craving and assessment by views" – the one hundred and eight modes of craving mentioned in this way are assessment by craving.
“Vinicchaya có hai loại: taṇhāvinicchaya (sự quyết đoán bằng ái) và diṭṭhivinicchaya (sự quyết đoán bằng tà kiến)” thì 108 loại ái hành (taṇhāvicarita) được đề cập như vậy là taṇhāvinicchayo.
Dvāsaṭṭhi diṭṭhiyo diṭṭhivinicchayo.
The sixty-two views are assessment by views.
Sáu mươi hai loại tà kiến là diṭṭhivinicchayo.
‘‘Chando kho, devānaminda, vitakkanidāno’’ti (dī. ni. 2.358) imasmiṃ pana sutte idha vinicchayoti vutto vitakkoyeva āgato.
However, in this Sutta, "Desire, O king of devas, has intention as its source," the intention mentioned here is the very assessment spoken of.
Tuy nhiên, trong kinh này: “Này Thiên chủ, chando (dục) có tầm làm nhân”, thì ở đây, tầm được đề cập chính là vinicchaya.
Lābhaṃ labhitvā hi iṭṭhāniṭṭhaṃ sundarāsundarañca vitakkeneva vinicchināti ‘‘ettakaṃ me rūpārammaṇatthāya bhavissati, ettakaṃ saddādiārammaṇatthāya, ettakaṃ mayhaṃ bhavissati, ettakaṃ parassa, ettakaṃ paribhuñjissāmi, ettakaṃ nidahissāmī’’ti.
For, having obtained gain, one assesses with intention (vitakka) what is desirable and undesirable, beautiful and unbeautiful, saying: "This much will be for my visual object, this much for auditory and other objects, this much will be mine, this much for another, this much I will consume, this much I will store away."
Sau khi thâu hoạch được lợi lộc, người ta quyết đoán điều mình ưa thích hay không ưa thích, đẹp hay không đẹp, chỉ bằng tầm: “Chừng này sẽ dùng cho đối tượng sắc, chừng này cho đối tượng thinh, v.v.; chừng này sẽ là của tôi, chừng này là của người khác; chừng này tôi sẽ hưởng dùng, chừng này tôi sẽ cất giữ”.
Tena vuttaṃ – ‘‘lābhaṃ paṭicca vinicchayo’’ti.
Therefore it is said: "Dependent on gain is assessment."
Vì vậy, có lời dạy: “Do thâu hoạch mà có sự quyết đoán”.
Chandarāgoti evaṃ akusalavitakkena vitakkite vatthusmiṃ dubbalarāgo ca balavarāgo ca uppajjati.
Desire and lust: In an object thus intended by unwholesome intention (vitakka), weak lust and strong lust arise.
Chandarāgoti: Khi một vật được tầm cầu bằng tầm bất thiện như vậy, thì dục ái yếu và dục ái mạnh phát sinh.
Chandoti ettha dubbalarāgassādhivacanaṃ, rāgoti balavarāgassa.
Here, desire is a term for weak lust, and lust is for strong lust.
Ở đây, chando là tên gọi của dục ái yếu, rāgo là tên gọi của dục ái mạnh.
Ajjhosānanti ahaṃ mamāti balavasanniṭṭhānaṃ.
Clinging is the strong conviction of "I am" and "mine."
Ajjhosānaṃti: sự quyết định mạnh mẽ “đây là tôi, đây là của tôi”.
Pariggahoti taṇhādiṭṭhivasena pariggahakaraṇaṃ.
Possessiveness is the act of possessing by way of craving and views.
Pariggahoti: sự chiếm hữu theo ái và tà kiến.
Macchariyanti parehi sādhāraṇabhāvassa asahanatā.
Avarice is the inability to tolerate the common possession of things by others.
Macchariyaṃti: sự không chịu nổi việc người khác có chung.
Tenevassa porāṇā evaṃ vacanatthaṃ vadanti ‘‘idaṃ acchariyaṃ mayhameva hotu, mā aññassa acchariyaṃ hotūti pavattattā macchariyanti vuccatī’’ti.
It is for this very reason that the ancients explain its etymology thus: "It is called avarice (macchariya) because it arises with the thought, 'May this wonder be mine alone, may it not be another's wonder.'"
Chính vì vậy, các bậc cổ đức giải thích ý nghĩa của từ này như sau: “Nó được gọi là macchariya vì nó diễn ra với ý nghĩ: ‘Điều kỳ diệu này chỉ thuộc về tôi, đừng để nó thuộc về người khác’”.
Ārakkhoti dvārapidahanamañjūsagopanādivasena suṭṭhu rakkhaṇaṃ.
Guarding is protecting well by means such as closing doors and securing chests.
Ārakkhoti: sự bảo vệ kỹ lưỡng bằng cách đóng cửa, cất giữ trong rương, v.v.
Adhikarotīti adhikaraṇaṃ.
It causes greatly, therefore it is a cause (adhikaraṇa).
“Adhikarotīti adhikaraṇaṃ” (làm cho trội lên, đó là adhikaraṇa).
Kāraṇassetaṃ nāmaṃ.
This is a name for a cause.
Đây là tên của một nguyên nhân.
Ārakkhādhikaraṇanti bhāvanapuṃsakaṃ, ārakkhahetūti attho.
Guarding as a cause is a verbal noun (bhāvanapuṃsakaṃ); the meaning is "due to guarding as a cause."
Ārakkhādhikaraṇaṃti: là một danh từ trung tính mang ý nghĩa động từ, nghĩa là “do sự gìn giữ làm nhân”.
Daṇḍādānādīsu paranisedhanatthaṃ daṇḍassa ādānaṃ daṇḍādānaṃ.
Among "taking up a stick" and so on, taking up a stick to prevent others is taking up a stick.
Trong các pháp như cầm gậy, v.v., việc cầm gậy để ngăn cản người khác là daṇḍādānaṃ.
Ekatodhārādinā satthassa ādānaṃ satthādānaṃ.
Taking up a weapon, such as a single-edged sword, is satthādānaṃ (taking up a weapon).
Việc cầm khí giới như dao một lưỡi, v.v., là satthādānaṃ.
Kāyakalahopi vācākalahopi kalaho.
Physical strife or verbal strife is kalaho (strife).
Cãi vã bằng thân hay bằng lời đều là kalaho.
Purimo purimo virodho viggaho.
The earlier and earlier opposition is viggaho (quarrel).
Sự chống đối trước đó là viggaho.
Pacchimo pacchimo vivādo.
The later and later opposition is vivādo (dispute).
Sự tranh cãi sau đó là vivādo.
Tuvaṃtuvanti agāravavasena tuvaṃtuvaṃvacanaṃ.
Saying "you, you" out of disrespect is tuvaṃtuvaṃvacanaṃ (mutual reviling).
Tuvaṃtuvaṃti: nói lời “ngươi, ngươi” một cách thiếu tôn trọng.
Idāni anekabhedena pahānena pahātabbe dassetuṃ dve pahānānītiādi āraddhaṃ.
Now, to show the things to be abandoned by abandonment of various kinds, the passage beginning with "two abandonments" is commenced.
Bây giờ, để trình bày các pháp cần được đoạn trừ bằng nhiều loại đoạn trừ khác nhau, nên đã bắt đầu với dve pahānāni (hai sự đoạn trừ), v.v.
Pahānesu hi viññātesu tena tena pahātabbā dhammā suviññeyyā honti.
For when abandonments are understood, the dhammas to be abandoned by each are easily understood.
Quả thật, khi các sự đoạn trừ được hiểu rõ, thì các pháp cần được đoạn trừ bằng từng loại đoạn trừ đó sẽ dễ hiểu.
Pañcasu pahānesu lokikāni ca dve pahānāni appayogaṃ nissaraṇappahānañca ṭhapetvā appayogāneva dve lokuttarapahānāni paṭhamaṃ vuttāni.
Among the five abandonments, having set aside the two mundane abandonments (tadanga-pahāna and vikkhambhana-pahāna) and the abandonment of escape (nissaraṇa-pahāna) where defilements are not fit to be associated, the two supramundane abandonments (samuccheda-pahāna and paṭippassaddhi-pahāna) where defilements are not fit to be associated are mentioned first.
Trong năm loại đoạn trừ, sau khi bỏ qua hai loại đoạn trừ thế gian là taḍaṅgappahāna (đoạn trừ nhất thời) và vikkhambhanappahāna (đoạn trừ bằng trấn áp), và nissaraṇappahāna (đoạn trừ bằng xuất ly) là Niết Bàn, thì hai loại đoạn trừ siêu thế (lokuttara) là samucchedappahāna và paṭippassaddhippahāna đã được nói đến trước tiên.
Sammā ucchijjanti etena kilesāti samucchedo, pahīyanti etena kilesāti pahānaṃ.
Defilements are utterly cut off by this, thus it is cutting off (samucchedo); defilements are abandoned by this, thus it is abandonment (pahānaṃ).
Các phiền não được đoạn tận hoàn toàn bằng pháp này, nên gọi là samuccheda (đoạn tận); các phiền não được đoạn trừ bằng pháp này, nên gọi là pahāna (đoạn trừ).
Samucchedasaṅkhātaṃ pahānaṃ, na sesappahānanti samucchedappahānaṃ.
The abandonment termed cutting off, and not other abandonments, is samucchedappahānaṃ (abandonment by cutting off).
Sự đoạn trừ được gọi là samuccheda, chứ không phải các sự đoạn trừ còn lại, nên gọi là samucchedappahānaṃ (đoạn trừ bằng đoạn tận).
Kilesānaṃ paṭippassaddhattā paṭippassaddhi, pahīnattā pahānaṃ, paṭippassaddhisaṅkhātaṃ pahānaṃ paṭippassaddhippahānaṃ.
Because of the subsiding of defilements, it is subsiding (paṭippassaddhi); because of their abandonment, it is abandonment (pahānaṃ); the abandonment termed subsiding is paṭippassaddhippahānaṃ (abandonment by tranquillization).
Vì các phiền não được an tịnh trở lại nên gọi là paṭippassaddhi (an tịnh), vì được đoạn trừ nên gọi là pahāna (đoạn trừ); sự đoạn trừ được gọi là paṭippassaddhi là paṭippassaddhippahānaṃ (đoạn trừ bằng an tịnh).
Lokaṃ uttaratīti lokuttaro.
It transcends the world, thus it is lokuttaro (supramundane).
Pháp vượt lên thế gian nên gọi là lokuttaro (siêu thế).
Nibbānasaṅkhātaṃ khayaṃ gacchatīti khayagāmī, khayagāmī ca so maggo cāti khayagāmimaggo, taṃ bhāvayato so maggo samucchedappahānanti attho.
It goes to the cessation (khayaṃ), which is Nibbāna, thus it is khayagāmī; it is both khayagāmī and a path (maggo), thus it is khayagāmimaggo (the path leading to cessation). The meaning is that for one who cultivates it, that path is abandonment by cutting off.
Pháp đi đến sự diệt tận được gọi là Niết Bàn nên gọi là khayagāmī (đi đến sự diệt tận); con đường đó vừa đi đến sự diệt tận vừa là con đường nên gọi là khayagāmimaggo (đạo đi đến sự diệt tận); ý nghĩa là đối với người tu tập đạo đó, đạo đó là samucchedappahāna.
Tathā phalakkhaṇe lokuttaraphalameva paṭippassaddhippahānaṃ.
Similarly, at the moment of fruition, the supramundane fruition itself is abandonment by tranquillization.
Tương tự, vào khoảnh khắc quả, chỉ có quả siêu thế là paṭippassaddhippahāna.
Kāmānametaṃ nissaraṇantiādīsu kāmato rūpato saṅkhatato nissaranti etenāti nissaraṇaṃ, tehi vā nissaṭattā nissaraṇaṃ.
In passages such as "This is the escape from sensual pleasures" (kāmānametaṃ nissaraṇaṃ), it is called nissaraṇaṃ (escape) because one escapes from sensual pleasures, from material existence, and from conditioned phenomena by means of it; or it is nissaraṇaṃ because one has escaped from them.
Trong các đoạn như Kāmānametaṃ nissaraṇaṃti (đây là sự xuất ly khỏi dục), v.v., pháp mà nhờ đó người ta xuất ly khỏi dục, khỏi sắc, khỏi các pháp hữu vi, nên gọi là nissaraṇaṃ (sự xuất ly); hoặc vì đã xuất ly khỏi chúng nên gọi là nissaraṇaṃ.
Asubhajjhānaṃ.
The meditation on impurity (asubhajjhānaṃ).
Thiền bất tịnh.
Kāmehi nikkhantattā nekkhammaṃ.
It is nekkhammaṃ (renunciation) because it has come forth from sensual pleasures.
Vì đã xuất ly khỏi dục nên gọi là nekkhammaṃ (sự xuất ly).
Anāgāmimaggo vā.
Or it is the Anāgāmi path.
Hoặc là đạo Bất Hoàn.
Asubhajjhānañhi vikkhambhanato kāmānaṃ nissaraṇaṃ, taṃ jhānaṃ pādakaṃ katvā uppāditaanāgāmimaggo pana samucchedato sabbaso kāmānaṃ accantanissaraṇaṃ.
For the meditation on impurity is an escape from sensual pleasures by way of suppression (vikkhambhana), but the Anāgāmi path, developed with that meditation as its basis, is an ultimate escape from sensual pleasures by way of cutting off (samuccheda).
Quả thật, thiền bất tịnh là sự xuất ly khỏi dục bằng cách trấn áp (vikkhambhana); còn đạo Bất Hoàn được phát triển dựa trên thiền đó là sự xuất ly hoàn toàn khỏi dục bằng cách đoạn tận (samuccheda).
Ruppatīti rūpaṃ, na rūpaṃ arūpaṃ mittapaṭipakkhā amittā viya, lobhādipaṭipakkhā alobhādayo viya ca rūpapaṭipakkhoti attho.
It is afflicted (ruppati), thus it is rūpa. Not rūpa is arūpa, just as those opposed to a friend are enemies (amittā), and those opposed to greed (lobha) and so forth are non-greed (alobha) and so forth. The meaning is that it is the opposite of rūpa.
Pháp bị hoại diệt nên gọi là rūpa (sắc); pháp không phải sắc là arūpa (vô sắc), giống như kẻ thù là đối nghịch của bạn bè, và vô tham, v.v., là đối nghịch của tham, v.v.; ý nghĩa là đối nghịch của sắc.
Phalavasena vā natthettha rūpanti arūpaṃ, arūpameva āruppaṃ.
Or, in terms of fruition, there is no rūpa here, thus it is arūpa; arūpa itself is āruppaṃ (immateriality).
Hoặc theo nghĩa quả, không có sắc ở đây nên gọi là arūpa; chính arūpa là āruppaṃ (vô sắc giới).
Arūpajjhānāni.
The immaterial absorptions (arūpajjhānāni).
Các thiền vô sắc.
Tāni rūpānaṃ nissaraṇaṃ nāma.
These are called the escape from material existence.
Chúng được gọi là sự xuất ly khỏi sắc.
Arūpehipi arahattamaggo puna uppattinivāraṇato sabbaso rūpānaṃ nissaraṇaṃ nāma.
And the Arahantship path, even from the immaterial states, is called the complete escape from material existence because it prevents re-arising.
Đạo A-la-hán, thậm chí đối với các thiền vô sắc, cũng là sự xuất ly hoàn toàn khỏi sắc vì ngăn chặn sự tái sinh.
Bhūtanti jātaṃ.
Bhūtaṃ means arisen.
Bhūtaṃti: đã sinh.
Saṅkhatanti paccayehi saṅgamma kataṃ.
Saṅkhataṃ means made by the combination of causes.
Saṅkhataṃti: được tạo tác do các duyên hợp lại.
Paṭiccasamuppannanti te te paccaye paṭicca sammā saha ca uppannaṃ.
Paṭiccasamuppannaṃ means arisen rightly and together, dependent on those various causes.
Paṭiccasamuppannaṃti: pháp phát sinh một cách đúng đắn và đồng thời nương vào các duyên đó.
Paṭhamena sañjātattadīpanena aniccatā, dutiyena aniccassāpi sato paccayānubhāvadīpanena parāyattatā, tatiyena parāyattassāpi sato paccayānaṃ abyāpārattadīpanena evaṃdhammatā dīpitā hoti.
By the first (bhūtaṃ), impermanence is indicated through showing the state of having arisen; by the second (saṅkhataṃ), dependence on others is indicated through showing the influence of causes, even though it is impermanent; by the third (paṭiccasamuppannaṃ), the nature of being so is indicated through showing the non-involvement of causes, even though it is dependent on others.
Bằng cách trình bày sự sinh khởi đầu tiên, tánh vô thường được chỉ ra; bằng cách trình bày sự tùy thuộc vào duyên của pháp vô thường thứ hai, tánh tùy thuộc vào tha nhân được chỉ ra; bằng cách trình bày sự không hoạt động của các duyên của pháp tùy thuộc vào tha nhân thứ ba, tánh như vậy được chỉ ra.
Nirodhoti nibbānaṃ.
Nirodho is Nibbāna.
Nirodhoti: Niết Bàn.
Nibbānañhi āgamma dukkhaṃ nirujjhatīti nirodhoti vuccati.
For Nibbāna is called nirodha because suffering ceases by relying on it.
Quả thật, Niết Bàn được gọi là nirodha (sự diệt) vì khổ được diệt tận khi nương vào Niết Bàn.
So eva ca sabbasaṅkhatato nissaṭattā tassa saṅkhatassa nissaraṇaṃ nāma.
And that very Nibbāna is called the escape from conditioned phenomena because it has escaped from all conditioned phenomena.
Chính Niết Bàn đó, vì đã xuất ly khỏi tất cả các pháp hữu vi, nên được gọi là sự xuất ly khỏi pháp hữu vi đó.
Aṭṭhakathāyaṃ pana –
However, in the Commentary—
Tuy nhiên, trong Chú Giải có nói:
Nekkhammaṃ paṭiladdhassātiādīsu asubhajjhānassa nissaraṇatte vikkhambhanappahānena, anāgāmimaggassa nissaraṇatte samucchedappahānena kāmā pahīnā ceva honti pariccattā ca.
In passages such as "for one who has attained renunciation" (nekkhammaṃ paṭiladdhassa), when the meditation on impurity is the escape, sensual pleasures are abandoned and relinquished by abandonment by suppression (vikkhambhanappahāna); when the Anāgāmi path is the escape, sensual pleasures are abandoned and relinquished by abandonment by cutting off (samucchedappahāna).
Trong các đoạn như Nekkhammaṃ paṭiladdhassāti (người đã đạt được sự xuất ly), v.v., khi thiền bất tịnh là sự xuất ly, thì các dục được đoạn trừ và được từ bỏ bằng sự đoạn trừ bằng trấn áp; khi đạo Bất Hoàn là sự xuất ly, thì các dục được đoạn trừ và được từ bỏ bằng sự đoạn trừ bằng đoạn tận.
Arūpajjhānānaṃ nissaraṇatte ca arahattamaggassa nissaraṇatte ca evameva rūpā yojetabbā.
Similarly, material existences should be applied in the same way when the immaterial absorptions are the escape, and when the Arahantship path is the escape.
Trong việc xuất ly khỏi các thiền vô sắc và xuất ly khỏi đạo A-la-hán, các sắc cũng cần được áp dụng theo cách tương tự.
Rūpesu hi chandarāgappahānena rūpānaṃ samucchedo hoti.
For in regard to material existences, the cutting off of material existences occurs through the abandonment of desire-and-lust (chandarāga).
Thật vậy, trong các sắc, sự đoạn trừ tham ái (chandarāga) dẫn đến sự đoạn diệt hoàn toàn của các sắc.
Rūpāti cettha liṅgavipallāso kato.
Here, rūpā (material existences) is a gender inversion.
Ở đây, có sự đổi giống (liṅgavipallāso) trong từ “rūpā”.
Nibbānassa nissaraṇatte nissaraṇappahānena, arahattaphalassa nissaraṇatte paṭippassaddhippahānena saṅkhārā pahīnā ceva honti pariccattā ca.
When Nibbāna is the escape, the saṅkhārās are abandoned and relinquished through abandonment as escape (nissaraṇappahāna); when the fruit of Arahantship is the escape, the saṅkhārās are abandoned and relinquished through abandonment by tranquilization (paṭippassaddhippahāna).
Trong việc xuất ly khỏi Nibbāna, các hành (saṅkhārā) bị đoạn trừ và bị từ bỏ bởi sự đoạn trừ xuất ly (nissaraṇappahānena); trong việc xuất ly khỏi quả A-la-hán, các hành bị đoạn trừ và bị từ bỏ bởi sự đoạn trừ tịch tịnh (paṭippassaddhippahānena).
Nibbānassa ca nissaraṇatte ārammaṇakaraṇavasena paṭilābho veditabbo.
And the attainment of Nibbāna as escape should be understood as occurring by way of making it an object (ārammaṇa).
Và trong việc xuất ly khỏi Nibbāna, sự chứng đắc cần được hiểu theo phương diện lấy Nibbāna làm đối tượng.
Dukkhasaccantiādīsu pariññāpaṭivedhantiādi bhāvanapuṃsakavacanaṃ.
In phrases such as “Dukkhasacca” (Truth of Suffering), “pariññāpaṭivedha” (penetration by full understanding) and so on is a verbal noun (bhāvanapuṃsakavacanaṃ).
Trong các cụm từ như Dukkhasaccaṃ (Khổ đế), v.v., cụm từ pariññāpaṭivedhaṃ (sự thâm nhập liễu tri) là một danh từ trung tính.
Pariññāya paṭivedho pariññāpaṭivedho.
Penetration by full understanding (pariññāpaṭivedho) is penetration by knowing fully (pariññāya paṭivedho).
Sự thâm nhập bằng liễu tri là pariññāpaṭivedhaṃ.
Taṃ pariññāpaṭivedhaṃ.
That is, penetration by full understanding.
Đó là sự thâm nhập liễu tri.
Esa nayo sesesupi.
This method applies to the remaining ones as well.
Quy tắc này cũng áp dụng cho các trường hợp còn lại.
Pajahātīti tathā tathā paṭivijjhanto pahātabbe kilese pajahatīti attho gahetabbo.
The meaning of “pajahāti” (abandons) should be taken as: one who penetrates in such and such a way abandons the defilements that are to be abandoned.
Nghĩa của pajahāti (đoạn trừ) cần được hiểu là: khi thâm nhập các pháp theo cách này, hành giả đoạn trừ các phiền não cần phải đoạn trừ.
Lokiyalokuttaresupi chandarāgappahānena vā tāni pajahatīti attho.
Or, the meaning is that one abandons them in both mundane and supramundane realms by abandoning sensual desire (chandarāga).
Hoặc là, nó có nghĩa là đoạn trừ chúng bằng cách từ bỏ tham ái (chandarāga) trong cả thế gian và siêu thế.
Pajahatītipi pāṭho.
“Pajahatīti” is also a reading.
Cũng có bản đọc là Pajahatītipi.
Yathā nāvā apubbaṃ acarimaṃ ekakkhaṇe cattāri kiccāni karoti, orimaṃ tīraṃ pajahati, sotaṃ chindati, bhaṇḍaṃ vahati, pārimaṃ tīraṃ appeti, evamevaṃ maggañāṇaṃ apubbaṃ acarimaṃ ekakkhaṇe cattāri saccāni abhisameti, dukkhaṃ pariññābhisamayena abhisameti, samudayaṃ pahānābhisamayena abhisameti, maggaṃ bhāvanābhisamayena abhisameti, nirodhaṃ sacchikiriyābhisamayena abhisameti.
Just as a boat performs four functions simultaneously, without prior or subsequent action, in a single moment—it leaves the near bank, cuts through the current, carries its cargo, and reaches the far bank—even so, path-knowledge (maggañāṇa) comprehends the four Noble Truths simultaneously, without prior or subsequent action, in a single moment: it comprehends suffering by way of full understanding (pariññābhisamaya), the origin by way of abandonment (pahānābhisamaya), the path by way of development (bhāvanābhisamaya), and cessation by way of realization (sacchikiriyābhisamaya).
Giống như một chiếc thuyền thực hiện bốn việc cùng một lúc, không trước không sau: nó rời bỏ bờ bên này, cắt dòng nước, chở hàng hóa, và cập bến bờ bên kia. Tương tự như vậy, trí tuệ đạo (maggañāṇa) chứng ngộ Tứ Thánh Đế cùng một lúc, không trước không sau: nó chứng ngộ Khổ đế bằng sự thâm nhập liễu tri (pariññābhisamayena), Tập đế bằng sự thâm nhập đoạn trừ (pahānābhisamayena), Đạo đế bằng sự thâm nhập tu tập (bhāvanābhisamayena), và Diệt đế bằng sự thâm nhập chứng ngộ (sacchikiriyābhisamayena).
Kiṃ vuttaṃ hoti?
What is meant by this?
Điều này có nghĩa là gì?
‘‘Nirodhaṃ ārammaṇaṃ katvā cattāri saccāni pāpuṇāti passati paṭivijjhatī’’ti (visuddhi. 2.839) vuttattā ekakkhaṇepi visuṃ visuṃ viya pahānāni vuttānīti veditabbāni.
Since it is said, “Making cessation (nirodha) its object, one attains, sees, and penetrates the four Noble Truths” (Visuddhi. 2.839), it should be understood that the abandonments are spoken of as if distinct, even in a single moment.
Cần phải hiểu rằng, vì đã được nói là “lấy Diệt đế làm đối tượng, người ta chứng đạt, thấy, và thâm nhập Tứ Thánh Đế” (visuddhi. 2.839), nên dù trong một sát-na, các sự đoạn trừ được nói đến như là riêng biệt.
Pañcasu pahānesu yaṃ sasevāle udake pakkhittena ghaṭena sevālassa viya tena tena lokiyasamādhinā nīvaraṇādīnaṃ paccanīkadhammānaṃ vikkhambhanaṃ dūrīkaraṇaṃ, idaṃ vikkhambhanappahānaṃ nāma.
Among the five kinds of abandonment, that which is the suppression (vikkhambhanaṃ) or removal (dūrīkaraṇaṃ) of obstructive mental states (paccanīkadhamma) like the hindrances (nīvaraṇādayo) by means of various mundane concentrations (lokiyasamādhi), like the removal of moss by a pot thrown into moss-covered water, is called abandonment by suppression (vikkhambhanappahānaṃ).
Trong năm loại đoạn trừ, sự loại bỏ, sự làm cho xa lìa các pháp đối nghịch như các triền cái (nīvaraṇa), v.v., bằng các định thế gian khác nhau, giống như việc loại bỏ rong rêu bằng một cái bình thả vào nước có rong rêu, đó gọi là đoạn trừ bằng cách trấn áp (vikkhambhanappahānaṃ).
Vikkhambhanappahānañca nīvaraṇānaṃ paṭhamaṃ jhānaṃ bhāvayatoti nīvaraṇānaṃyeva pahānaṃ pākaṭattā vuttanti veditabbaṃ.
And it should be understood that “abandonment by suppression is primarily of the hindrances for one who develops the first jhāna” means that the abandonment of the hindrances alone is mentioned due to its prominence.
Và cần phải hiểu rằng đoạn trừ bằng cách trấn áp các triền cái khi tu tập thiền thứ nhất (vikkhambhanappahānañca nīvaraṇānaṃ paṭhamaṃ jhānaṃ bhāvayato) được nói đến là sự đoạn trừ của riêng các triền cái vì tính hiển nhiên của nó.
Nīvaraṇāni hi jhānassa pubbabhāgepi pacchābhāgepi na sahasā cittaṃ ajjhottharanti, ajjhotthaṭesu ca tesu jhānaṃ parihāyati, vitakkādayo pana dutiyajjhānādito pubbe pacchā ca appaṭipakkhā hutvā pavattanti.
For the hindrances do not suddenly overwhelm the mind either before or after the jhāna; and when they do overwhelm, the jhāna declines. However, vitakka and so on, before and after the second jhāna and so forth, occur without opposition.
Thật vậy, các triền cái không dễ dàng xâm chiếm tâm cả ở giai đoạn trước và sau thiền; và khi chúng đã xâm chiếm, thiền sẽ bị suy thoái. Tuy nhiên, các tầm (vitakka), v.v., từ thiền thứ hai trở đi, hiện hành không có đối thủ cả trước và sau.
Tasmā nīvaraṇānaṃ vikkhambhanaṃ pākaṭaṃ.
Therefore, the suppression of the hindrances is evident.
Do đó, sự trấn áp các triền cái là điều hiển nhiên.
Yaṃ pana rattibhāge samujjalitena padīpena andhakārassa viya tena tena vipassanāya avayavabhūtena jhānaṅgena paṭipakkhavaseneva tassa tassa ca pahātabbadhammassa pahānaṃ, idaṃ tadaṅgappahānaṃ nāma.
That which is the abandonment of each of the states to be abandoned by means of the corresponding jhāna factor, which is a part of insight (vipassanā), specifically as an opponent, like the removal of darkness by a brightly burning lamp at night, is called abandonment by substitution of opposites (tadaṅgappahānaṃ).
Còn sự đoạn trừ nào, giống như ánh sáng của ngọn đèn rực cháy trong đêm tối, đoạn trừ bóng tối, thì sự đoạn trừ các pháp cần phải đoạn trừ ấy, do từng chi thiền (jhānaṅga) thuộc về vipassanā, theo cách đối trị, sự đoạn trừ ấy được gọi là tadaṅgappahāna (đoạn trừ từng phần).
Tadaṅgappahānañca diṭṭhigatānaṃ nibbedhabhāgiyaṃ samādhiṃ bhāvayatoti diṭṭhigatānaṃyeva pahānaṃ oḷārikavasena vuttanti veditabbaṃ.
And it should be understood that “abandonment by substitution of opposites is of wrong views for one who develops concentration conducive to penetration (nibbedhabhāgiyaṃ samādhiṃ)” means that the abandonment of wrong views alone is mentioned due to their gross nature.
Và sự đoạn trừ từng phần (tadaṅgappahāna) là của các tà kiến (diṭṭhigata) cho người tu tập định (samādhi) thuộc phần xuyên thấu (nibbedhabhāgiya) – điều này cần được hiểu rằng chỉ sự đoạn trừ các tà kiến được nói đến theo cách thô thiển.
Diṭṭhigatañhi oḷārikaṃ, niccasaññādayo sukhumā.
For wrong views are gross, while perceptions of permanence and so on are subtle.
Thật vậy, tà kiến (diṭṭhigata) là thô thiển, còn các tưởng thường hằng (niccasaññā) v.v... là vi tế.
Tattha diṭṭhigatānanti diṭṭhiyeva diṭṭhigataṃ ‘‘gūthagataṃ muttagata’’ntiādīni (a. ni. 9.11) viya.
Here, “diṭṭhigatānaṃ” (of wrong views) means diṭṭhi (wrong view) itself is diṭṭhigataṃ, like “gūthagataṃ muttagataṃ” (feces-gone, urine-gone) and so on.
Trong đó, từ “diṭṭhigatānaṃ” (các tà kiến) có nghĩa là chính tà kiến (diṭṭhi) là diṭṭhigata, giống như các ví dụ “gūthagataṃ muttagataṃ” (phân đã đi, nước tiểu đã đi) v.v...
Gantabbābhāvato ca diṭṭhiyā gatamattamevetantipi diṭṭhigataṃ, dvāsaṭṭhidiṭṭhīsu antogadhattā diṭṭhīsu gatantipi diṭṭhigataṃ.
And because there is no destination to go to, it is merely the going of views (diṭṭhiyā gatamattamevetanti), hence diṭṭhigataṃ; or, because it is included among the sixty-two wrong views, it is that which has gone into views, hence diṭṭhigataṃ.
Và vì không có gì để đi đến, nên “diṭṭhigataṃ” cũng có nghĩa là chỉ sự đi đến của tà kiến; và vì bao hàm trong sáu mươi hai tà kiến, nên “diṭṭhigataṃ” cũng có nghĩa là đi đến trong các tà kiến.
Bahuvacanena tesaṃ diṭṭhigatānaṃ.
By the plural, it refers to those wrong views.
Với số nhiều, là của các tà kiến ấy.
Nibbedhabhāgiyaṃ samādhinti vipassanāsampayuttaṃ samādhiṃ.
Nibbedhabhāgiyaṃ samādhi (concentration conducive to penetration) means concentration associated with insight (vipassanā).
Định thuộc phần xuyên thấu (nibbedhabhāgiyaṃ samādhiṃ) là định đi kèm với tuệ quán (vipassanā).
Yaṃ pana asanivicakkābhihatassa (visuddhi. 2.851) rukkhassa viya ariyamaggañāṇena saṃyojanānaṃ dhammānaṃ yathā na puna pavattati, evaṃ pahānaṃ, idaṃ samucchedappahānaṃ nāma.
That which is the abandonment of the fetters (saṃyojanāni) by the knowledge of the Noble Path (ariyamaggañāṇa) in such a way that they do not arise again, like a tree struck by a thunderbolt, is called abandonment by extirpation (samucchedappahānaṃ).
Còn sự đoạn trừ các pháp kiết sử (saṃyojana) bằng trí tuệ đạo Thánh (ariyamaggañāṇa) sao cho chúng không tái diễn nữa, giống như cây bị sét đánh (asanivicakkābhihatassa), thì sự đoạn trừ ấy được gọi là samucchedappahānaṃ (đoạn trừ tận gốc).
Nirodho nibbānanti nirodhasaṅkhātaṃ nibbānaṃ.
Nirodho Nibbānanti (cessation is Nibbāna) means Nibbāna, which is called cessation.
Nirodho nibbānanti là Nibbāna được gọi là sự diệt trừ (nirodha).
Evaṃ pahānavasena pahātabbe dhamme dassetvā idāni sarūpeneva puna pahātabbe dhamme dassetuṃ sabbaṃ, bhikkhave, pahātabbantiādimāha.
Having thus shown the states to be abandoned by way of abandonment, the text now states, “ Bhikkhus, all should be abandoned” and so on, to show the states to be abandoned again in their own nature.
Sau khi trình bày các pháp cần đoạn trừ theo cách đoạn trừ như vậy, bây giờ để trình bày lại các pháp cần đoạn trừ theo chính bản chất của chúng, Ngài đã nói “ Này các Tỳ-khưu, tất cả đều cần phải đoạn trừ” v.v...
Tattha cakkhādīni chandarāgappahānena pahātabbāni.
Here, the eye and so on are to be abandoned by the abandonment of sensual desire (chandarāga).
Trong đó, mắt (cakkhu) v.v... cần phải đoạn trừ bằng cách đoạn trừ tham ái (chandarāga).
Rūpaṃ passanto pajahātītiādīsu rūpaṃ aniccādito passanto pahātabbe kilese pajahāti.
In phrases such as “ Rūpaṃ passanto pajahāti” (seeing form, one abandons), seeing form as impermanent and so on, one abandons the defilements that are to be abandoned.
Trong các câu “ người thấy sắc thì đoạn trừ” v.v..., người thấy sắc (rūpa) là vô thường v.v... thì đoạn trừ các phiền não cần phải đoạn trừ.
Cakkhuṃ…pe… jarāmaraṇaṃ…pe… amatogadhaṃ nibbānanti peyyāladvaye anaññātaññassāmītindriyaṃ ‘‘passanto pajahātī’’tiādīsu tesu lokuttaresu anaññātaññassāmītindriyaṃ passanto udikkhanto apekkhamāno icchamāno vipassanākkhaṇesu pahātabbe kilese pajahātīti taṃtaṃdhammānurūpena yojetabbaṃ.
In the two ellipses, Cakkhuṃ…pe… jarāmaraṇaṃ…pe… amatogadhaṃ nibbāna (eye...etc....aging-and-death...etc....Nibbāna, the immortal abode), and in phrases like 'seeing, one abandons' within those supramundane faculties, the anaññātaññassāmītindriya (faculty of knowing what is not yet known), when one sees, observes, contemplates, desires, one abandons the defilements that are to be abandoned during the moments of insight, and this should be applied in accordance with the respective Dhammas.
Trong hai đoạn văn lặp lại (peyyāla) về “mắt… v.v… già chết… v.v… Nibbāna là nơi bất tử” (amatogadhaṃ nibbāna), cần phải kết hợp theo từng pháp tương ứng, rằng người thấy (passanto), tức là người quán sát, mong đợi, ước muốn, trong các sát-na tuệ quán (vipassanākkhaṇa), thì đoạn trừ các phiền não cần phải đoạn trừ trong các pháp siêu thế ấy như anaññātaññassāmītindriyaṃ (căn biết điều chưa biết).
25. Bhāvetabbaniddese kāyagatāsatīti kāyagatāsatisuttante (ma. ni. 3.153 ādayo) vuttā ānāpānacatuiriyāpathakhuddakairiyāpathadvattiṃsākāracatudhātunavasivathikāpaṭikūla- vavatthāpakamanasikārasampayuttā yathānurūpaṃ rūpajjhānasampayuttā ca sati.
In the section on what is to be developed, kāyagatāsati refers to the mindfulness, as described in the Kāyagatāsati Sutta (MN 3.153 ff.), associated with mindfulness of breathing, the four postures, the minor postures, the thirty-two parts of the body, the four elements, the nine charnel ground contemplations, and the analysis of repulsiveness, as well as the mindfulness associated with the rūpajjhānas, as appropriate.
25. Trong phần giải thích về các pháp cần tu tập, kāyagatāsatī (niệm thân) là chánh niệm (sati) được nói đến trong Kāyagatāsati Suttanta, đi kèm với sự chú tâm vào hơi thở ra vào (ānāpāna), bốn oai nghi chính, các oai nghi nhỏ, ba mươi hai thể trược, bốn đại, chín giai đoạn tử thi, sự quán xét ghê tởm, và đi kèm với các thiền sắc giới (rūpajjhāna) tùy theo sự thích hợp.
Sā hi tesu kāyesu gatā pavattāti kāyagatāti vuccati.
Indeed, because it has gone into, or is present in, these bodies, it is called kāyagatā (mindfulness directed to the body).
Chính chánh niệm ấy được gọi là kāyagatā (niệm thân) vì nó đi vào (gatā) và diễn tiến (pavattati) trong các thân ấy.
Sātasahagatāti madhurasukhavedayitasaṅkhātena sātena saha ekuppādādibhāvaṃ gatā.
Sātasahagatā means accompanied by sāta, which is defined as pleasant feeling or sweet pleasurable feeling, existing together with it in terms of co-arising and so on.
Sātasahagatā (đi kèm với sự hài lòng) là đi đến trạng thái cùng khởi lên v.v... với sự hài lòng (sāta) được gọi là thọ lạc ngọt ngào.
Tabbhāve vokiṇṇe ārammaṇe nissaye saṃsaṭṭhe dissati sahagatasaddo pañcasu atthesu jinavacane.
The word sahagata appears in the Buddha's teachings in five meanings: in the sense of 'being of that nature', 'mixed with', 'having as object', 'having as support', and 'associated with'.
Từ sahagata trong lời Phật dạy được thấy ở năm nghĩa: trong trạng thái ấy, trong sự hỗn tạp, trong đối tượng, trong chỗ nương tựa, trong sự hòa lẫn.
‘‘Yāyaṃ taṇhā ponobbhavikā nandirāgasahagatā’’ti (vibha. 203) ettha tabbhāve, nandirāgabhūtāti attho.
In the phrase ‘‘Yāyaṃ taṇhā ponobbhavikā nandirāgasahagatā’’ (Vibh. 203), it is in the sense of 'being of that nature', meaning 'being of the nature of delight and lust'.
Trong câu ‘‘Yāyaṃ taṇhā ponobbhavikā nandirāgasahagatā’’ (Vibh. 203) (ái ấy là ái tái sinh, đi kèm với sự hoan hỷ và dục), thì ở đây là trong trạng thái ấy, nghĩa là trở thành hoan hỷ và dục.
‘‘Yā, bhikkhave, vīmaṃsā kosajjasahagatā kosajjasampayuttā’’ti (saṃ. ni. 5.832) ettha vokiṇṇe, antarantarā uppajjamānena kosajjena vokiṇṇāti attho.
In the phrase ‘‘Yā, bhikkhave, vīmaṃsā kosajjasahagatā kosajjasampayuttā’’ (SN 5.832), it is in the sense of 'mixed with', meaning 'mixed with idleness arising intermittently'.
Trong câu ‘‘Yā, bhikkhave, vīmaṃsā kosajjasahagatā kosajjasampayuttā’’ (Saṃ. Ni. 5.832) (Này các Tỳ-khưu, sự quán xét nào đi kèm với sự biếng nhác, tương ưng với sự biếng nhác), thì ở đây là trong sự hỗn tạp, nghĩa là hỗn tạp với sự biếng nhác khởi lên xen kẽ.
‘‘Lābhī hoti rūpasahagatānaṃ vā samāpattīnaṃ arūpasahagatānaṃ vā samāpattīna’’nti (pu. pa. 3-8) ettha ārammaṇe, rūpārūpārammaṇānanti attho.
In the phrase ‘‘Lābhī hoti rūpasahagatānaṃ vā samāpattīnaṃ arūpasahagatānaṃ vā samāpattīna’’ (Pu. Pa. 3-8), it is in the sense of 'having as object', meaning 'having material or immaterial objects'.
Trong câu ‘‘Lābhī hoti rūpasahagatānaṃ vā samāpattīnaṃ arūpasahagatānaṃ vā samāpattīna’’ (Pu. Pa. 3-8) (được các thiền định đi kèm với sắc hoặc đi kèm với vô sắc), thì ở đây là trong đối tượng, nghĩa là các đối tượng sắc và vô sắc.
‘‘Aṭṭhikasaññāsahagataṃ satisambojjhaṅgaṃ bhāvetī’’ti (saṃ. ni. 5.238) ettha nissaye, aṭṭhikasaññānissayaṃ aṭṭhikasaññaṃ bhāvetvā paṭiladdhanti attho.
In the phrase ‘‘Aṭṭhikasaññāsahagataṃ satisambojjhaṅgaṃ bhāvetī’’ (SN 5.238), it is in the sense of 'having as support', meaning 'the factor of mindfulness enlightenment obtained by developing the perception of bones as its support'.
Trong câu ‘‘Aṭṭhikasaññāsahagataṃ satisambojjhaṅgaṃ bhāvetī’’ (Saṃ. Ni. 5.238) (tu tập niệm giác chi đi kèm với xương tưởng), thì ở đây là trong chỗ nương tựa, nghĩa là niệm giác chi nương tựa vào xương tưởng, được thành tựu sau khi tu tập xương tưởng.
‘‘Idaṃ sukhaṃ imāya pītiyā sahagataṃ hoti sahajātaṃ sampayutta’’nti (vibha. 578) ettha saṃsaṭṭhe, sammissanti attho.
In the phrase ‘‘Idaṃ sukhaṃ imāya pītiyā sahagataṃ hoti sahajātaṃ sampayutta’’ (Vibh. 578), it is in the sense of 'associated with', meaning 'mixed with'.
Trong câu ‘‘Idaṃ sukhaṃ imāya pītiyā sahagataṃ hoti sahajātaṃ sampayutta’’ (Vibh. 578) (lạc này đi kèm với hỷ này, cùng sinh, tương ưng), thì ở đây là trong sự hòa lẫn, nghĩa là hòa lẫn.
Imasmimpi pade saṃsaṭṭho adhippeto.
In this particular term too, 'associated with' is intended.
Trong từ này (sātasahagatā) cũng có ý nghĩa là hòa lẫn.
Sātasaṃsaṭṭhā hi sātasahagatāti vuttā.
Indeed, mindfulness mixed with sāta is called sātasahagatā.
Chính niệm được hòa lẫn với sự hài lòng nên được gọi là sātasahagatā.
Sā hi ṭhapetvā catutthaṃ jhānaṃ sesesu sātasahagatā hoti, satipi ca upekkhāsahagatatte yebhuyyavasena sātasahagatāti vuttā, purimajjhānamūlakattā vā catutthajjhānassa sātasahagatāya upekkhāsahagatāpi vuttāva hoti, upekkhāya pana sante sukhe vuttattā bhagavatā sātasahagatāti catutthajjhānasampayuttāpi vuttāva hoti.
This mindfulness, except for the fourth jhāna, is sātasahagatā in the remaining jhānas. Even if it is accompanied by equanimity, it is generally referred to as sātasahagatā. Or, because the fourth jhāna has the preceding jhānas as its root, the mindfulness accompanied by equanimity is also implicitly referred to as sātasahagatā. Furthermore, because the Buddha included equanimity in the definition of tranquil happiness, the mindfulness associated with the fourth jhāna is also implicitly referred to as sātasahagatā.
Niệm ấy, trừ thiền thứ tư, thì ở các thiền còn lại đều đi kèm với sự hài lòng; và dù có đi kèm với xả, nhưng chủ yếu được nói là đi kèm với sự hài lòng. Hoặc vì thiền thứ tư có gốc từ các thiền trước, nên niệm đi kèm với xả cũng được nói là đi kèm với sự hài lòng. Hoặc vì Đức Phật đã nói lạc trong xả là lạc tịnh, nên niệm đi kèm với thiền thứ tư cũng được nói là đi kèm với sự hài lòng.
Samatho ca vipassanā cāti kāmacchandādayo paccanīkadhamme sameti vināsetīti samatho.
Samatha and vipassanā: Samatha is that which calms and destroys opposing qualities such as sensual desire.
Samatha và vipassanā – Samatha là pháp làm lắng dịu, diệt trừ các pháp đối nghịch như dục tham (kāmacchanda) v.v...
Samādhissetaṃ nāmaṃ.
This is a name for samādhi.
Đây là tên của samādhi (định).
Aniccatādivasena vividhehi ākārehi dhamme passatīti vipassanā.
Vipassanā is that which sees phenomena in various ways, such as impermanence.
Vị ấy quán sát các pháp bằng nhiều phương cách như vô thường (aniccatā), do đó gọi là vipassanā (tuệ quán).
Paññāyetaṃ nāmaṃ.
This is a name for wisdom.
Đây là tên của paññā (trí tuệ).
Ime pana dve dasuttarapariyāye pubbabhāgāti vuttā, saṅgītipariyāye ca lokiyalokuttaramissakāti.
These two, however, are said to be preliminary in the Dasuttara method, and in the Saṅgīti method, they are said to be a mixture of mundane and supramundane.
Tuy nhiên, hai pháp này được nói trong Dasuttara-pariyāya là phần sơ khởi (pubbabhāga), và trong Saṅgīti-pariyāya là hỗn hợp thế gian (lokiya) và siêu thế (lokuttara).
Tayo samādhīti savitakko savicāro samādhi, avitakko vicāramatto samādhi, avitakko avicāro samādhi.
Three kinds of samādhi are: samādhi accompanied by initial application and sustained application (savitakko savicāro samādhi), samādhi without initial application but with sustained application (avitakko vicāramatto samādhi), and samādhi without initial application and without sustained application (avitakko avicāro samādhi).
Ba loại samādhi là: samādhi có tầm (savitakka), có tứ (savicāra); samādhi không tầm (avitakka), chỉ có tứ (vicāramatta); samādhi không tầm (avitakka), không tứ (avicāra).
Sampayogavasena vattamānena saha vitakkena savitakko, saha vicārena savicāro.
Savitakko means accompanied by initial application (vitakka) and savicāro means accompanied by sustained application (vicāra), in terms of their co-existence.
Samādhi có tầm (savitakka) là có tầm (vitakka) đồng sinh, có tứ (savicāra) là có tứ (vicāra) đồng sinh theo cách tương ưng.
So khaṇikasamādhi, vipassanāsamādhi, upacārasamādhi, paṭhamajjhānasamādhi.
This refers to momentary concentration (khaṇikasamādhi), insight concentration (vipassanāsamādhi), access concentration (upacārasamādhi), and the concentration of the first jhāna (paṭhamajjhānasamādhi).
Đó là samādhi sát na (khaṇikasamādhi), samādhi tuệ quán (vipassanāsamādhi), samādhi cận định (upacārasamādhi), samādhi đệ nhất thiền (paṭhamajjhānasamādhi).
Natthi etassa vitakkoti avitakko.
Avitakko means there is no initial application for it.
Không có tầm (vitakka) trong samādhi này, nên gọi là không tầm (avitakka).
Vitakkavicāresu vicāro mattā paramā pamāṇaṃ etassāti vicāramatto, vicārato uttari vitakkena sampayogaṃ na gacchatīti attho.
Vicāramatto means that among initial and sustained application, sustained application is its ultimate measure or limit, meaning it does not go beyond sustained application to be accompanied by initial application.
Trong tầm (vitakka) và tứ (vicāra), tứ (vicāra) là mức độ tối thượng, là giới hạn của samādhi này, nghĩa là không có sự tương ưng với tầm (vitakka) vượt quá tứ (vicāra) nên gọi là chỉ có tứ (vicāramatta).
So pañcakanaye dutiyajjhānasamādhi, tadubhayavirahito avitakko avicāro samādhi.
This refers to the concentration of the second jhāna in the five-fold system, and the samādhi devoid of both initial and sustained application is called avitakko avicāro samādhi.
Trong hệ thống ngũ thiền, đó là samādhi đệ nhị thiền; samādhi không tầm (avitakka), không tứ (avicāra) là không có cả hai (tầm và tứ).
So catukkanaye dutiyajjhānādi, pañcakanaye tatiyajjhānādi rūpāvacarasamādhi.
This refers to the rūpāvacara samādhi from the second jhāna onwards in the four-fold system, and from the third jhāna onwards in the five-fold system.
Trong hệ thống tứ thiền, đó là samādhi từ đệ nhị thiền trở đi; trong hệ thống ngũ thiền, đó là samādhi sắc giới (rūpāvacarasamādhi) từ đệ tam thiền trở đi.
Ime tayopi lokiyā eva.
All three of these are mundane (lokiya) only.
Cả ba loại này đều là thế gian (lokiya).
Saṅgītipariyāye aparepi tayo samādhī vuttā – ‘‘suññato samādhi, animitto samādhi, appaṇihito samādhī’’ti (dī. ni. 3.305).
In the Saṅgīti method, three other kinds of samādhi are mentioned: ‘‘empty concentration (suññato samādhi), signless concentration (animitto samādhi), and desireless concentration (appaṇihito samādhi)’’.
Trong Saṅgīti-pariyāya, ba loại samādhi khác cũng được đề cập: “samādhi không (suññato samādhi), samādhi vô tướng (animitto samādhi), samādhi vô nguyện (appaṇihito samādhi)”.
Na te idha adhippetā.
These are not intended here.
Những loại đó không được đề cập ở đây.
Cattāro satipaṭṭhānāti kāyānupassanāsatipaṭṭhānaṃ, vedanānupassanāsatipaṭṭhānaṃ, cittānupassanāsatipaṭṭhānaṃ, dhammānupassanāsatipaṭṭhānaṃ.
Four foundations of mindfulness are mindfulness established on contemplation of the body, mindfulness established on contemplation of feelings, mindfulness established on contemplation of consciousness, and mindfulness established on contemplation of phenomena.
Bốn pháp niệm xứ (satipaṭṭhāna) là: niệm xứ quán thân (kāyānupassanāsatipaṭṭhāna), niệm xứ quán thọ (vedanānupassanāsatipaṭṭhāna), niệm xứ quán tâm (cittānupassanāsatipaṭṭhāna), niệm xứ quán pháp (dhammānupassanāsatipaṭṭhāna).
Pubbabhāge cuddasavidhena kāyaṃ pariggaṇhato kāyānupassanāsatipaṭṭhānaṃ, navavidhena vedanaṃ pariggaṇhato vedanānupassanāsatipaṭṭhānaṃ, soḷasavidhena cittaṃ pariggaṇhato cittānupassanāsatipaṭṭhānaṃ, pañcavidhena dhamme pariggaṇhato dhammānupassanāsatipaṭṭhānaṃ veditabbaṃ.
In the preliminary stage, kāyānupassanāsatipaṭṭhānaṃ is to be understood as one who comprehends the body in fourteen ways; vedanānupassanāsatipaṭṭhānaṃ as one who comprehends feelings in nine ways; cittānupassanāsatipaṭṭhānaṃ as one who comprehends consciousness in sixteen ways; and dhammānupassanāsatipaṭṭhānaṃ as one who comprehends phenomena in five ways.
Trong phần sơ khởi (pubbabhāga), niệm xứ quán thân (kāyānupassanāsatipaṭṭhāna) nên được hiểu là việc quán sát thân theo mười bốn cách; niệm xứ quán thọ (vedanānupassanāsatipaṭṭhāna) là việc quán sát thọ theo chín cách; niệm xứ quán tâm (cittānupassanāsatipaṭṭhāna) là việc quán sát tâm theo mười sáu cách; niệm xứ quán pháp (dhammānupassanāsatipaṭṭhāna) là việc quán sát pháp theo năm cách.
Lokuttaraṃ pana idha na adhippetaṃ.
However, the supramundane is not intended here.
Tuy nhiên, siêu thế (lokuttara) không được đề cập ở đây.
Pañcaṅgiko samādhīti pañca aṅgāni assa santīti pañcaṅgiko, catutthajjhānasamādhi.
Five-factored concentration means that it has five factors, hence it is five-factored; it refers to the concentration of the fourth jhāna.
Samādhi có năm chi phần (pañcaṅgiko samādhi) là samādhi có năm chi phần, tức là samādhi đệ tứ thiền.
Pītipharaṇatā, sukhapharaṇatā, cetopharaṇatā, ālokapharaṇatā, paccavekkhaṇanimittanti pañca aṅgāni.
The five factors are: pervasion of rapture, pervasion of happiness, pervasion of mind, pervasion of light, and the sign of reviewing.
Năm chi phần là: sự lan tỏa hỷ (pītipharaṇatā), sự lan tỏa lạc (sukhapharaṇatā), sự lan tỏa tâm (cetopharaṇatā), sự lan tỏa ánh sáng (ālokapharaṇatā), và tướng quán xét (paccavekkhaṇanimitta).
Pītiṃ pharamānā uppajjatīti dvīsu jhānesu paññā pītipharaṇatā nāma.
The wisdom that arises pervading rapture in the first two jhāna is called pītipharaṇatā.
Trí tuệ (paññā) phát sinh khi lan tỏa hỷ (pīti) trong hai thiền (đệ nhất và đệ nhị) được gọi là sự lan tỏa hỷ (pītipharaṇatā).
Sukhaṃ pharamānā uppajjatīti tīsu jhānesu paññā sukhapharaṇatā nāma.
The wisdom that arises pervading happiness in the first three jhāna is called sukhapharaṇatā.
Trí tuệ (paññā) phát sinh khi lan tỏa lạc (sukha) trong ba thiền (đệ nhất, đệ nhị và đệ tam) được gọi là sự lan tỏa lạc (sukhapharaṇatā).
Paresaṃ ceto pharamānā uppajjatīti cetopariyapaññā cetopharaṇatā nāma.
The wisdom of knowing others' minds, which arises pervading the mind of others, is called cetopharaṇatā.
Trí tuệ biết tâm người khác (cetopariya-paññā) phát sinh khi lan tỏa tâm (citta) của người khác được gọi là sự lan tỏa tâm (cetopharaṇatā).
Ālokaṃ pharamānā uppajjatīti dibbacakkhupaññā ālokapharaṇatā nāma.
The divine eye wisdom, which arises pervading light, is called ālokapharaṇatā.
Trí tuệ thiên nhãn (dibbacakkhu-paññā) phát sinh khi lan tỏa ánh sáng (āloka) được gọi là sự lan tỏa ánh sáng (ālokapharaṇatā).
Paccavekkhaṇañāṇaṃ paccavekkhaṇanimittaṃ nāma.
The knowledge of reviewing is called paccavekkhaṇanimittaṃ.
Tuệ quán xét (paccavekkhaṇañāṇa) được gọi là tướng quán xét (paccavekkhaṇanimitta).
Vuttampi cetaṃ –
It is also said:
Điều này cũng đã được nói:
Cha anussatiṭṭhānānīti punappunaṃ uppajjanato satiyo eva anussatiyo, pavattitabbaṭṭhānasmiṃyeva pavattattā saddhāpabbajitassa kulaputtassa anurūpā satiyotipi anussatiyo, anussatiyo eva pītiādīnaṃ ṭhānattā anussatiṭṭhānāni.
Six recollections (anussatiṭṭhānāni): The recollections (satiyo) are called anussatiyo because they arise repeatedly. They are also called anussatiyo because they are appropriate recollections for a noble son who has gone forth out of faith, as they occur precisely in the proper sphere of action. Or, the recollections themselves are called anussatiṭṭhānāni because they are the basis for rapture and so forth.
Sáu pháp tùy niệm (anussatiṭṭhāna) là những niệm (sati) được phát sinh lặp đi lặp lại nên gọi là tùy niệm (anussati); hoặc là những tùy niệm (anussati) phù hợp với thiện nam tử đã xuất gia với tín tâm (saddhāpabbajita) vì chúng chỉ phát sinh ở những nơi cần được phát sinh; hoặc chính những tùy niệm (anussati) này là nền tảng (ṭhāna) của hỷ (pīti) v.v., nên gọi là anussatiṭṭhāna.
Katamāni cha?
Which six?
Sáu pháp nào?
Buddhānussati dhammānussati saṅghānussati sīlānussati cāgānussati devatānussati (dī. ni. 3.327).
Recollection of the Buddha, recollection of the Dhamma, recollection of the Saṅgha, recollection of morality, recollection of generosity, and recollection of devas.
Phật tùy niệm (Buddhānussati), Pháp tùy niệm (Dhammānussati), Tăng tùy niệm (Saṅghānussati), Giới tùy niệm (Sīlānussati), Thí tùy niệm (Cāgānussati), Thiên tùy niệm (Devatānussati).
Bojjhaṅgāti bodhiyā, bodhissa vā aṅgā.
Factors of awakening (bojjhaṅgā) are the factors of bodhi, or of the awakened one.
Các chi phần giác ngộ (Bojjhaṅga) là các chi phần của sự giác ngộ (bodhi), hoặc của người giác ngộ (bodhi).
Idaṃ vuttaṃ hoti – yā esā dhammasāmaggī yāya lokuttaramaggakkhaṇe uppajjamānāya līnuddhaccapatiṭṭhānāyūhanakāmasukhattakilamathānuyogaucchedasassatābhinivesādīnaṃ anekesaṃ upaddavānaṃ paṭipakkhabhūtāya satidhammavicayavīriyapītipassaddhisamādhiupekkhāsaṅkhātāya dhammasāmaggiyā ariyasāvako bujjhatīti katvā bodhīti vuccati.
This is what is meant: That assemblage of dhammas by which, when it arises at the moment of the supramundane path, an Ariyan disciple awakens, is called bodhi. This assemblage of dhammas is the opponent of many dangers such as sloth and torpor, restlessness, agitation, the pursuit of sensual pleasures, self-mortification, and the extreme views of annihilationism and eternalism, and it consists of mindfulness, investigation of dhammas, energy, rapture, tranquility, concentration, and equanimity.
Điều này có nghĩa là: sự hòa hợp của các pháp này, tức là sự hòa hợp của niệm (sati), trạch pháp (dhammavicaya), tinh tấn (vīriya), hỷ (pīti), khinh an (passaddhi), định (samādhi), và xả (upekkhā), là đối nghịch với nhiều chướng ngại như hôn trầm (līna), trạo cử (uddhacca), chấp thủ (patiṭṭhāna), tích tập (āyūhana), dục lạc (kāmasukha), khổ hạnh (attakilamatha), tà kiến đoạn diệt (uccheda) và thường kiến (sassata) v.v., phát sinh vào khoảnh khắc của Đạo siêu thế (lokuttaramagga), nhờ đó vị Thánh đệ tử (ariyasāvaka) giác ngộ (bujjhati), nên được gọi là giác ngộ (bodhi).
Bujjhatīti kilesasantānaniddāya vuṭṭhahati, cattāri vā ariyasaccāni paṭivijjhati, nibbānameva vā sacchikaroti, tassā dhammasāmaggisaṅkhātāya bodhiyā aṅgātipi bojjhaṅgā jhānaṅgamaggaṅgādayo viya.
Awakens means he arises from the slumber of the defilement-continuum, or he penetrates the Four Noble Truths, or he realizes Nibbāna. Therefore, they are called bojjhaṅgā, factors of that bodhi which is the assemblage of dhammas, just like jhāna factors, path factors, and so forth.
Giác ngộ (bujjhati) có nghĩa là thoát khỏi giấc ngủ của dòng phiền não (kilesasantāna), hoặc thấu hiểu Tứ Thánh Đế (ariyasaccāni), hoặc chứng đắc Niết Bàn (nibbāna); các chi phần của sự giác ngộ (bodhi) ấy, tức là sự hòa hợp của các pháp, cũng được gọi là các chi phần giác ngộ (bojjhaṅga), giống như các chi phần thiền (jhānaṅga), các chi phần đạo (maggaṅga) v.v.
Yo panesa yathāvuttappakārāya etāya dhammasāmaggiyā bujjhatīti katvā ariyasāvako bodhīti vuccati, tassa bodhissa aṅgātipi bojjhaṅgā senaṅgarathaṅgādayo viya.
And because an Ariyan disciple awakens by this assemblage of dhammas of the aforementioned kind, he is called bodhi. Therefore, they are also called bojjhaṅgā, factors of that awakened one, just like army factors, chariot factors, and so forth.
Hoặc, vị Thánh đệ tử (ariyasāvaka) được gọi là giác ngộ (bodhi) vì vị ấy giác ngộ nhờ sự hòa hợp của các pháp đã nói trên; các chi phần của sự giác ngộ (bodhi) ấy cũng được gọi là các chi phần giác ngộ (bojjhaṅga), giống như các chi phần của quân đội (senāṅga), các chi phần của xe (rathaṅga) v.v.
Tenāhu aṭṭhakathācariyā ‘‘bujjhanakassa puggalassa aṅgāti vā bojjhaṅgā’’ti.
Hence the Aṭṭhakathācariyā said: “Or, they are called bojjhaṅgā because they are factors of the awakening person.”
Do đó, các vị Luận sư (Aṭṭhakathācariya) đã nói: “Hoặc các chi phần của người giác ngộ (bujjhanaka puggalassa aṅga) cũng là các chi phần giác ngộ (bojjhaṅga).”
Apica ‘‘bojjhaṅgāti kenaṭṭhena bojjhaṅgā, bodhāya saṃvattantīti bojjhaṅgā’’tiādinā (paṭi. ma. 2.17) nayena bojjhaṅgaṭṭho veditabbo.
Furthermore, the meaning of bojjhaṅga should be understood by the method beginning with: “Why are they called bojjhaṅgā? They conduce to awakening, therefore they are bojjhaṅgā.”
Hơn nữa, ý nghĩa của bojjhaṅga nên được hiểu theo cách như: “Bojjhaṅga, vì ý nghĩa gì mà gọi là bojjhaṅga? Vì chúng dẫn đến sự giác ngộ (bodhāya saṃvattanti) nên là bojjhaṅga” v.v.
Ariyo aṭṭhaṅgiko maggoti taṃtaṃmaggavajjhakilesehi ārakattā ariyabhāvakarattā ariyaphalapaṭilābhakarattā ca ariyo.
Noble Eightfold Path (Ariyo aṭṭhaṅgiko maggo) is noble because it is far from the defilements that are to be abandoned by each path, because it brings about the state of an Ariya, and because it brings about the attainment of Ariyan fruits.
Bát Chánh Đạo (Ariyo aṭṭhaṅgiko maggo) là Thánh (ariya) vì nó xa lìa các phiền não (kilesa) mà mỗi đạo cần đoạn trừ, vì nó tạo nên trạng thái Thánh (ariyabhāva), và vì nó mang lại sự chứng đắc Thánh quả (ariyaphala).
Aṭṭha aṅgāni assāti aṭṭhaṅgiko.
It is eight-factored because it has eight factors.
Nó có tám chi phần nên gọi là có tám chi phần (aṭṭhaṅgiko).
Soyaṃ caturaṅgikā viya senā, pañcaṅgikaṃ viya ca tūriyaṃ aṅgamattameva hoti, aṅgavinimutto natthi.
This (path/factor) is only a collection of factors, like a four-division army or a five-instrument orchestra; there is nothing apart from the factors.
Đạo này chỉ là các chi phần, giống như một đội quân có bốn chi phần hoặc một dàn nhạc có năm chi phần; không có gì tách rời khỏi các chi phần.
Bojjhaṅgamaggaṅgā lokuttarā, dasuttarapariyāyena pubbabhāgāpi labbhanti.
The Bojjhaṅgas and Maggaṅgas are supramundane (lokuttara); by way of the Dasuttara discourse, they are also obtained as preliminary parts.
Các chi phần giác ngộ (bojjhaṅga) và các chi phần đạo (maggaṅga) là siêu thế (lokuttara); trong Dasuttara-pariyāya, chúng cũng được xem là phần sơ khởi (pubbabhāga).
Nava pārisuddhipadhāniyaṅgānīti sīlavisuddhi pārisuddhipadhāniyaṅgaṃ, cittavisuddhi pārisuddhipadhāniyaṅgaṃ, diṭṭhivisuddhi pārisuddhipadhāniyaṅgaṃ, kaṅkhāvitaraṇavisuddhi pārisuddhipadhāniyaṅgaṃ, maggāmaggañāṇadassanavisuddhi pārisuddhipadhāniyaṅgaṃ, paṭipadāñāṇadassanavisuddhi pārisuddhipadhāniyaṅgaṃ, ñāṇadassanavisuddhi pārisuddhipadhāniyaṅgaṃ, paññā pārisuddhipadhāniyaṅgaṃ, vimutti pārisuddhipadhāniyaṅgaṃ (dī. ni. 3.359).
Nine Factors for Purity and Exertion are: Sīlavisuddhi (purity of morality) is a factor for purity and exertion; Cittavisuddhi (purity of mind) is a factor for purity and exertion; Diṭṭhivisuddhi (purity of view) is a factor for purity and exertion; Kaṅkhāvitaraṇavisuddhi (purity by overcoming doubt) is a factor for purity and exertion; Maggāmaggañāṇadassanavisuddhi (purity of knowledge and vision of what is path and not path) is a factor for purity and exertion; Paṭipadāñāṇadassanavisuddhi (purity of knowledge and vision of the way) is a factor for purity and exertion; Ñāṇadassanavisuddhi (purity of knowledge and vision) is a factor for purity and exertion; Paññā (wisdom) is a factor for purity and exertion; Vimutti (liberation) is a factor for purity and exertion.
Chín chi phần thanh tịnh và tinh tấn (Nava pārisuddhipadhāniyaṅgāni) là: Thanh tịnh giới (sīlavisuddhi) là chi phần thanh tịnh và tinh tấn, Thanh tịnh tâm (cittavisuddhi) là chi phần thanh tịnh và tinh tấn, Thanh tịnh kiến (diṭṭhivisuddhi) là chi phần thanh tịnh và tinh tấn, Thanh tịnh vượt nghi (kaṅkhāvitaraṇavisuddhi) là chi phần thanh tịnh và tinh tấn, Thanh tịnh tri kiến đạo phi đạo (maggāmaggañāṇadassanavisuddhi) là chi phần thanh tịnh và tinh tấn, Thanh tịnh tri kiến đạo lộ (paṭipadāñāṇadassanavisuddhi) là chi phần thanh tịnh và tinh tấn, Thanh tịnh tri kiến (ñāṇadassanavisuddhi) là chi phần thanh tịnh và tinh tấn, Trí tuệ (paññā) là chi phần thanh tịnh và tinh tấn, Giải thoát (vimutti) là chi phần thanh tịnh và tinh tấn.
Sīlavisuddhīti visuddhiṃ pāpetuṃ samatthaṃ catupārisuddhisīlaṃ.
Sīlavisuddhi means the fourfold purity of morality (catupārisuddhisīla) capable of bringing about purity.
Thanh tịnh giới (Sīlavisuddhi) là Tứ Thanh Tịnh Giới (catupārisuddhisīla) có khả năng dẫn đến sự thanh tịnh.
Tañhi dussīlyamalaṃ visodheti.
For it purifies the defilement of immorality.
Thật vậy, giới này làm sạch vết nhơ của ác giới (dussīlya-mala).
Pārisuddhipadhāniyaṅganti parisuddhabhāvassa padhānaṃ uttamaṃ aṅgaṃ.
Pārisuddhipadhāniyaṅga means the excellent factor that is the primary cause of purity.
Chi phần thanh tịnh và tinh tấn (Pārisuddhipadhāniyaṅga) là chi phần tối thượng của trạng thái thanh tịnh.
Cittavisuddhīti vipassanāya padaṭṭhānabhūtā paguṇā aṭṭha samāpattiyo.
Cittavisuddhi means the eight attainments (samāpattiyo) that are well-practiced and serve as the proximate cause for vipassanā.
Thanh tịnh tâm (Cittavisuddhi) là tám định (samāpatti) đã được thuần thục, là nền tảng của tuệ quán (vipassanā).
Tā hi kāmacchandādicittamalaṃ visodhenti.
For they purify the mental defilement of sensual desire and so forth.
Thật vậy, chúng làm sạch vết nhơ tâm (citta-mala) như dục tham (kāmacchanda) v.v.
Diṭṭhivisuddhīti sappaccayanāmarūpadassanaṃ.
Diṭṭhivisuddhi means the vision of nāma-rūpa with its conditions.
Thanh tịnh kiến (Diṭṭhivisuddhi) là sự quán sát danh sắc (nāmarūpa) có duyên.
Tañhi sattadiṭṭhimalaṃ visodheti.
For it purifies the defilement of seven views.
Thật vậy, nó làm sạch vết nhơ của bảy loại tà kiến (sattadiṭṭhi-mala).
Kaṅkhāvitaraṇavisuddhīti paccayākārañāṇaṃ.
Kaṅkhāvitaraṇavisuddhi means knowledge of the causal nexus (paccayākārañāṇa).
Thanh tịnh vượt nghi (Kaṅkhāvitaraṇavisuddhi) là tuệ về các duyên (paccayākārañāṇa).
Tena hi tīsu addhāsu paccayavasena dhammā pavattantīti passanto tīsupi addhāsu sattakaṅkhāmalaṃ vitaranto visujjhati.
For by seeing that phenomena arise in dependence on conditions throughout the three times, one becomes purified by overcoming the defilement of seven doubts concerning all three times.
Do đó, khi quán thấy các pháp vận hành theo duyên trong ba thời, hành giả vượt qua bảy loại cấu uế của nghi ngờ trong cả ba thời và trở nên thanh tịnh.
Maggāmaggañāṇadassanavisuddhīti udayabbayānupassanakkhaṇe uppannā obhāsañāṇapītipassaddhisukhaadhimokkhapaggahaupaṭṭhānaupekkhānikantīti dasa vipassanupakkilesā, na maggo, vīthipaṭipannaṃ udayabbayañāṇaṃ maggoti evaṃ maggāmagge ñāṇaṃ nāma.
Maggāmaggañāṇadassanavisuddhi means the ten imperfections of insight (vipassanupakkilesā) that arise at the moment of contemplating rise and fall—namely, radiance, knowledge, rapture, tranquility, happiness, strong faith, exertion, mindfulness, equanimity, and attachment—are not the path; the knowledge of rise and fall that has entered the course of insight is the path. Thus, it is knowledge of what is path and what is not path.
Thanh tịnh tri kiến về đạo và phi đạo (Maggāmaggañāṇadassanavisuddhi) có nghĩa là tuệ biết về đạo và phi đạo như sau: Mười loại phiền não phụ của thiền quán (vipassanupakkilesā) là ánh sáng (obhāsa), tuệ (ñāṇa), hỷ (pīti), khinh an (passaddhi), lạc (sukha), thắng giải (adhimokkha), tinh cần (paggaha), an trú (upaṭṭhāna), xả (upekkhā), và thích thú (nikanti) phát sinh trong khoảnh khắc quán chiếu sự sinh diệt (udayabbayānupassanā) thì không phải là đạo; còn tuệ về sự sinh diệt (udayabbayañāṇa) đã đi vào con đường (thiền quán) mới là đạo.
Tena hi amaggamalaṃ visodheti.
For by it, one purifies the defilement of what is not the path.
Do đó, nó thanh lọc cấu uế của phi đạo.
Paṭipadāñāṇadassanavisuddhīti vīthipaṭipannaṃ udayabbayānupassanāñāṇaṃ bhaṅgānupassanāñāṇaṃ bhayatupaṭṭhānānupassanāñāṇaṃ ādīnavānupassanāñāṇaṃ nibbidānupassanāñāṇaṃ muñcitukamyatāñāṇaṃ paṭisaṅkhānupassanāñāṇaṃ saṅkhārupekkhāñāṇaṃ anulomañāṇanti imāni nava vipassanāñāṇāni.
Paṭipadāñāṇadassanavisuddhi means these nine knowledges of insight: the knowledge of contemplating rise and fall that has entered the course of insight, the knowledge of contemplating dissolution, the knowledge of the appearance of fear, the knowledge of contemplating danger, the knowledge of contemplating disenchantment, the knowledge of the desire for liberation, the knowledge of re-contemplation, the knowledge of equanimity regarding formations, and the knowledge of conformity.
Thanh tịnh tri kiến về con đường (Paṭipadāñāṇadassanavisuddhi) là chín tuệ thiền quán (vipassanāñāṇa) này: tuệ quán chiếu sự sinh diệt (udayabbayānupassanāñāṇa) đã đi vào con đường (thiền quán), tuệ quán chiếu sự hoại diệt (bhaṅgānupassanāñāṇa), tuệ quán chiếu sự hiện khởi của đáng sợ (bhayatupaṭṭhānānupassanāñāṇa), tuệ quán chiếu sự nguy hiểm (ādīnavānupassanāñāṇa), tuệ quán chiếu sự nhàm chán (nibbidānupassanāñāṇa), tuệ quán chiếu ước muốn thoát ly (muñcitukamyatāñāṇa), tuệ quán chiếu sự phản tư (paṭisaṅkhānupassanāñāṇa), tuệ xả đối với các hành (saṅkhārupekkhāñāṇa), và tuệ thuận thứ (anulomañāṇa).
Tāni hi niccasaññādimalaṃ visodhenti.
For they purify the defilement of the perception of permanence and so forth.
Chúng thanh lọc cấu uế của tưởng thường, v.v.
Ñāṇadassanavisuddhīti catuariyamaggapaññā.
Ñāṇadassanavisuddhi means the wisdom of the four Noble Paths.
Thanh tịnh tri kiến (Ñāṇadassanavisuddhi) là tuệ của bốn Thánh đạo (catuariyamaggapaññā).
Sā hi samucchedato sakasakamaggavajjhakilesamalaṃ visodheti.
For it purifies the defilement of kamma that is to be abandoned by its respective path, by way of eradication.
Chính nó thanh lọc cấu uế của các phiền não bị loại trừ bởi mỗi đạo tương ứng, bằng cách đoạn diệt hoàn toàn.
Paññāti arahattaphalapaññā.
Paññā means the wisdom of Arahantship.
Tuệ (Paññā) là tuệ của quả A-la-hán (arahattaphalapaññā).
Vimuttīti arahattaphalavimutti.
Vimutti means the liberation of Arahantship.
Giải thoát (Vimutti) là sự giải thoát của quả A-la-hán (arahattaphalavimutti).
Dasa kasiṇāyatanānīti ‘‘pathavīkasiṇameko sañjānāti uddhaṃ adho tiriyaṃ advayaṃ appamāṇaṃ, āpokasiṇameko sañjānāti…pe… tejokasiṇameko sañjānāti…pe… vāyokasiṇameko sañjānāti…pe… nīlakasiṇameko sañjānāti…pe… pītakasiṇameko sañjānāti…pe… lohitakasiṇameko sañjānāti…pe… odātakasiṇameko sañjānāti…pe… ākāsakasiṇameko sañjānāti…pe… viññāṇakasiṇameko sañjānāti uddhaṃ adho tiriyaṃ advayaṃ appamāṇa’’nti (a. ni. 10.25; dī. ni. 3.360) evaṃ vuttāni dasa.
Ten kasiṇa-āyatanas means the ten as stated: "One perceives the earth kasiṇa above, below, across, non-dual, immeasurable; one perceives the water kasiṇa...; one perceives the fire kasiṇa...; one perceives the air kasiṇa...; one perceives the blue kasiṇa...; one perceives the yellow kasiṇa...; one perceives the red kasiṇa...; one perceives the white kasiṇa...; one perceives the space kasiṇa...; one perceives the consciousness kasiṇa above, below, across, non-dual, immeasurable."
Mười xứ biến xứ (Dasa kasiṇāyatanāni) là mười loại đã được nói đến như sau: "Một người nhận thức biến xứ đất (pathavīkasiṇa) là một, trên, dưới, ngang, không hai, vô lượng; một người nhận thức biến xứ nước (āpokasiṇa) là một... một người nhận thức biến xứ lửa (tejokasiṇa) là một... một người nhận thức biến xứ gió (vāyokasiṇa) là một... một người nhận thức biến xứ xanh (nīlakasiṇa) là một... một người nhận thức biến xứ vàng (pītakasiṇa) là một... một người nhận thức biến xứ đỏ (lohitakasiṇa) là một... một người nhận thức biến xứ trắng (odātakasiṇa) là một... một người nhận thức biến xứ không gian (ākāsakasiṇa) là một... một người nhận thức biến xứ thức (viññāṇakasiṇa) là một, trên, dưới, ngang, không hai, vô lượng."
Etāni hi sakalapharaṇaṭṭhena kasiṇāni, tadārammaṇānaṃ dhammānaṃ khettaṭṭhena adhiṭṭhānaṭṭhena vā āyatanāni.
These are kasiṇas in the sense of pervading completely, and āyatanas in the sense of being the field or the basis for the mental states that have them as their object.
Những biến xứ này được gọi là kasiṇa vì chúng lan tỏa khắp mọi nơi; và là āyatana vì chúng là nền tảng hoặc căn cứ cho các pháp lấy chúng làm đối tượng.
Uddhanti uparigaganatalābhimukhaṃ.
Uddhaṃ means facing upwards towards the sky.
Trên (Uddhaṃ) có nghĩa là hướng lên bầu trời phía trên.
Adhoti heṭṭhābhūmitalābhimukhaṃ.
Adho means facing downwards towards the ground.
Dưới (Adho) có nghĩa là hướng xuống mặt đất phía dưới.
Tiriyanti khettamaṇḍalamiva samantā paricchinnaṃ.
Tiriyaṃ means delimited all around, like a circular field.
Ngang (Tiriyaṃ) có nghĩa là được bao quanh mọi phía như một vòng tròn của cánh đồng.
Ekacco hi uddhameva kasiṇaṃ vaḍḍheti ekacco adho, ekacco samantato.
Indeed, some expand the kasiṇa only upwards, some downwards, some all around.
Có người chỉ phát triển biến xứ lên trên, có người xuống dưới, có người khắp mọi phía.
Ekopi tena tena vā kāraṇena evaṃ pasāreti ālokamiva rūpadassanakāmo.
Even one person expands it in this way for various reasons, just as one who desires to see forms spreads light.
Một người cũng có thể mở rộng nó theo cách này hay cách khác, giống như người muốn nhìn thấy hình sắc thì mở rộng ánh sáng.
Tena vuttaṃ – ‘‘pathavīkasiṇameko sañjānāti uddhaṃ adho tiriya’’nti (a. ni. 10.25; dī. ni. 3.360).
Therefore it is said: "One perceives the earth kasiṇa above, below, across."
Do đó, đã nói: "Một người nhận thức biến xứ đất là một, trên, dưới, ngang."
Advayanti idaṃ pana ekassa aññabhāvānupagamanatthaṃ vuttaṃ.
Advayaṃ (non-dual) is stated to mean that one (kasiṇa) does not assume the nature of another.
Không hai (Advaya) được nói đến để chỉ rằng một (biến xứ) không trở thành cái khác.
Yathā hi udakaṃ paviṭṭhassa sabbadisāsu udakameva hoti na aññaṃ, evameva pathavīkasiṇaṃ pathavīkasiṇameva hoti, natthi tassa aññakasiṇasambhedoti.
Just as for one who has entered the water, there is only water in all directions and nothing else, so too is the earth kasiṇa only the earth kasiṇa; there is no mixing of other kasiṇas with it.
Ví như khi một người đi vào nước, khắp mọi phía chỉ là nước chứ không phải cái gì khác, cũng vậy, biến xứ đất chỉ là biến xứ đất, không có sự pha trộn với biến xứ khác.
Esa nayo sabbattha.
This principle applies everywhere.
Nguyên tắc này cũng áp dụng cho tất cả (các biến xứ) khác.
Appamāṇanti idaṃ tassa tassa pharaṇaappamāṇavasena vuttaṃ.
The term " Boundless" (Appamāṇa) here is stated with reference to the boundlessness of the pervasion of each kasiṇa.
Vô lượng (Appamāṇa) được nói đến theo nghĩa lan tỏa vô hạn của nó.
Tañhi manasā pharanto sakalameva pharati, na ‘‘ayamassa ādi idaṃ majjha’’nti pamāṇaṃ gaṇhātīti.
For when one pervades it with the mind, one pervades the whole, not taking a measure saying, "This is its beginning, this is its middle."
Khi quán tưởng nó bằng tâm, hành giả lan tỏa khắp mọi nơi, không nắm giữ giới hạn "đây là khởi đầu của nó, đây là giữa của nó."
Ākāsakasiṇanti kasiṇugghāṭimākāso paricchedākāsakasiṇañca.
Space kasiṇa refers to the space left by removing the kasiṇa (kasiṇugghāṭimākāsa) and the delimited space kasiṇa (paricchedākāsakasiṇa).
Biến xứ không gian (Ākāsakasiṇa) là không gian được khai mở từ biến xứ (kasiṇugghāṭimākāsa) và biến xứ không gian giới hạn (paricchedākāsakasiṇa).
Viññāṇakasiṇanti kasiṇugghāṭimākāse pavattaviññāṇaṃ.
Consciousness kasiṇa refers to the consciousness that arises in the space left by removing the kasiṇa.
Biến xứ thức (Viññāṇakasiṇa) là thức phát sinh trong không gian được khai mở từ biến xứ (kasiṇugghāṭimākāse pavattaviññāṇa).
Tattha kasiṇavasena kasiṇugghāṭimākāse, kasiṇugghāṭimākāsavasena tattha pavattaviññāṇe uddhaṃadhotiriyatā veditabbā, paricchedākāsakasiṇassapi vaḍḍhanīyattā tassa vasenapīti.
Here, the upward, downward, and transversal extent (uddhaṃadhotiriyatā) should be understood in the space left by removing the kasiṇa by way of kasiṇa, and in the consciousness arising therein by way of the space left by removing the kasiṇa, and also by way of the delimited space kasiṇa, as it too is to be developed.
Ở đây, cần hiểu sự "trên, dưới, ngang" theo nghĩa biến xứ trong không gian được khai mở từ biến xứ, và theo nghĩa không gian được khai mở từ biến xứ trong thức phát sinh trong đó; cũng như theo nghĩa biến xứ không gian giới hạn vì nó cũng có thể được phát triển.
26. Idāni bhāvanāpabhedaṃ dassento dve bhāvanātiādimāha.
26. Now, showing the divisions of development, he begins with "two kinds of development".
Bây giờ, để trình bày sự phân loại của sự tu tập (bhāvanā), ngài nói đến "hai sự tu tập" (dve bhāvanā), v.v.
Tattha lokiyātiādīsu loko vuccati lujjanapalujjanaṭṭhena vaṭṭaṃ, tasmiṃ pariyāpannabhāvena loke niyuttāti lokiyā, lokiyānaṃ dhammānaṃ bhāvanā lokiyā.
Among these, in " mundane" (lokiyā) and so on, "world" (loka) refers to saṃsāra, in the sense of decaying and breaking up; "mundane" means engaged in the world by being included therein. The development of mundane phenomena is mundane.
Trong đó, trong "thế gian" (lokiyā), v.v., thế gian (loka) được gọi là vòng luân hồi (vaṭṭa) theo nghĩa là nó bị hủy hoại và tan rã. Vì nó thuộc về thế gian, nên nó được gọi là thế gian (lokiyā). Sự tu tập các pháp thế gian là thế gian.
Kiñcāpi dhammānaṃ bhāvanāti vohāravasena vuccati, tehi pana visuṃ bhāvanā natthi.
Although it is spoken of as "the development of phenomena," there is no development distinct from them.
Mặc dù được gọi là sự tu tập các pháp, nhưng không có sự tu tập nào tách rời khỏi chúng.
Te eva hi dhammā bhāviyamānā bhāvanāti vuccanti.
Indeed, those very phenomena, when developed, are called " development."
Chính những pháp đó, khi được tu tập, được gọi là tu tập (bhāvanā).
Uttiṇṇāti uttarā, loke apariyāpannabhāvena lokato uttarāti lokuttarā.
"Transcendent" (uttiṇṇā) means superior, beyond the world, by not being included in the world, hence " supramundane" (lokuttarā).
Vượt lên (uttiṇṇā) là cao hơn (uttarā). Vì không thuộc về thế gian, nên nó vượt lên thế gian, do đó là siêu thế (lokuttarā).
Rūpabhavasaṅkhāte rūpe avacarantīti rūpāvacarā.
They dwell in rūpa, which is called the rūpa-bhava, hence they are rūpāvacara.
Những gì vận hành trong sắc giới (rūpabhava) được gọi là sắc giới (rūpāvacarā).
Kusalasaddo panettha ārogyaanavajjachekasukhavipākesu dissati.
The word kusala here is seen in the meanings of health, blamelessness, skill, and pleasant result.
Từ kusala ở đây được thấy trong các nghĩa khỏe mạnh, không lỗi lầm, khéo léo và quả báo an lạc.
‘‘Kacci nu bhoto kusalaṃ?
In phrases like, "Are you well, venerable sir? Are you free from illness, venerable sir?" it refers to health.
"Ngài có khỏe không?
Kacci bhoto anāmaya’’ntiādīsu (jā. 1.15.146; 2.20.129) ārogye.
.
Ngài có bình an không?" v.v., là nghĩa khỏe mạnh.
‘‘Katamo pana, bhante, kāyasamācāro kusalo?
In "Which bodily conduct, venerable sir, is wholesome? That bodily conduct, great king, which is blameless,"
"Bạch Thế Tôn, thế nào là thân hành thiện lành?
Yo kho, mahārāja, kāyasamācāro anavajjo’’ti (ma. ni. 2.361) ca ‘‘puna caparaṃ, bhante, etadānuttariyaṃ, yathā bhagavā dhammaṃ deseti kusalesu dhammesū’’ti (dī. ni. 3.145) ca evamādīsu anavajje.
and "Furthermore, venerable sir, this is the highest, that the Blessed One teaches the Dhamma concerning wholesome states," and so on, it refers to blamelessness.
Thưa Đại vương, thân hành nào không có lỗi lầm," và "Thêm nữa, bạch Thế Tôn, đây là điều tối thượng, như Thế Tôn thuyết pháp về các pháp thiện lành," v.v., là nghĩa không lỗi lầm.
‘‘Taṃ kiṃ maññasi, rājakumāra, kusalo tvaṃ rathassa aṅgapaccaṅgāna’’nti?
In "What do you think, prince, are you skilled in the parts and accessories of a chariot?"
"Thưa Hoàng tử, ngài nghĩ sao, ngài có khéo léo với các bộ phận của xe không?"
(Ma. ni. 2.87) ‘‘kusalā naccagītassa sikkhitā cāturitthiyo’’ti (jā. 2.22.94) ca ādīsu cheke.
and "Skilled in dancing and singing are the four women," and so on, it refers to skill.
"Bốn người phụ nữ giỏi ca múa, đã được huấn luyện," v.v., là nghĩa khéo léo.
‘‘Kusalānaṃ dhammānaṃ samādānahetu evamidaṃ puññaṃ pavaḍḍhatī’’ti (dī. ni. 3.80) ‘‘kusalassa kammassa katattā upacitattā’’ti (dha. sa. 431) ca ādīsu sukhavipāke.
In "Due to undertaking wholesome states, this merit increases thus," and "due to having done and accumulated wholesome kamma," and so on, it refers to pleasant result.
"Do nhân duyên chấp nhận các pháp thiện lành, công đức này tăng trưởng," và "Do đã làm và tích lũy nghiệp thiện lành," v.v., là nghĩa quả báo an lạc.
Svāyamidha ārogyepi anavajjepi sukhavipākepi vaṭṭati.
Here, this word applies to health, blamelessness, and pleasant result.
Từ này ở đây phù hợp với cả nghĩa khỏe mạnh, không lỗi lầm và quả báo an lạc.
Vacanattho panettha kucchite pāpake dhamme salayanti calayanti kampenti viddhaṃsentīti kusalā, kucchitena vā ākārena sayanti pavattantīti kusā, te akusalasaṅkhāte kuse lunanti chindantīti kusalā, kucchitānaṃ vā sānato tanukaraṇato kusaṃ, ñāṇaṃ.
The etymological meaning here is: they shake, stir, tremble, and destroy vile, evil states, therefore they are kusala; or, they occur in a vile manner, therefore they are kusā, and they cut or sever those kusā, which are unwholesome states, therefore they are kusala; or, kusa is knowledge, from the thinning (tanukaraṇa) of vile things (kucchitānaṃ sānato).
Ý nghĩa của từ này là: những gì làm rung chuyển, lay động, khuấy động, và phá hủy các pháp ác xấu xa được gọi là kusala; hoặc những gì vận hành theo cách xấu xa được gọi là kusā, và chúng cắt đứt các kusā (ác pháp) được gọi là akusala, do đó là kusala; hoặc do làm cho các pháp xấu xa trở nên mỏng manh, nên là kusa, tức là tuệ.
Tena kusena lātabbā gahetabbā pavattetabbāti kusalā, yathā vā kusā ubhayabhāgagataṃ hatthappadesaṃ lunanti, evamimepi uppannānuppannabhāvena ubhayabhāgagataṃ saṃkilesapakkhaṃ lunanti, tasmā kusā viya lunantīti kusalā.
By that kusa (knowledge) they are to be taken, grasped, and brought into being, therefore they are kusala; or, just as kusā (kusa grass) cut the part of the hand that is on both sides, so too do these, by their arisen and unarisen nature, cut off the defiled side that is on both sides; therefore, like kusā, they cut, hence they are kusala.
Những gì cần được nắm giữ, cần được thực hành bằng tuệ đó được gọi là kusala; hoặc giống như cỏ kusā cắt đứt phần tay bị kẹt ở cả hai phía, cũng vậy, những pháp này, bằng cách phát sinh và chưa phát sinh, cắt đứt phe ô nhiễm ở cả hai phía, do đó, chúng cắt đứt như cỏ kusā, nên được gọi là kusala.
Tesaṃ rūpāvacarakusalānaṃ bhāvanā.
The development of these rūpāvacara wholesome states.
Sự tu tập các pháp thiện lành sắc giới đó.
Arūpabhavasaṅkhāte arūpe avacarantīti arūpāvacarā.
They dwell in arūpa, which is called the arūpa-bhava, hence they are arūpāvacara.
Những gì vận hành trong vô sắc giới (arūpabhava) được gọi là vô sắc giới (arūpāvacarā).
Tebhūmakavaṭṭe pariyāpannā antogadhāti pariyāpannā, tasmiṃ na pariyāpannāti apariyāpannā, lokuttarā.
Included, encompassed within the three-plane saṃsāra, hence "included"; not included therein, hence " not included," which means lokuttara.
Những gì thuộc về, bao gồm trong ba cõi luân hồi được gọi là thuộc về (pariyāpannā); những gì không thuộc về trong đó được gọi là không thuộc về (apariyāpannā), tức là siêu thế.
‘‘Yogavihitesu vā kammāyatanesu yogavihitesu vā sippāyatanesu yogavihitesu vā vijjāṭṭhānesu kammassakataṃ vā saccānulomikaṃ vā rūpaṃ aniccanti vā, vedanā aniccāti vā, saññā aniccāti vā, saṅkhārā aniccāti vā, viññāṇaṃ aniccanti vā yaṃ evarūpaṃ anulomikaṃ khantiṃ diṭṭhiṃ ruciṃ mudiṃ pekkhaṃ dhammanijjhānakkhantiṃ parato asutvā paṭilabhati, ayaṃ vuccati cintāmayā paññā.
“That wisdom which one obtains without hearing from another, such as the conviction, view, liking, approval, observation, or the patient contemplation of phenomena (dhammanijjhānakkhanti) in regard to karmic actions, or crafts, or branches of knowledge, that form is impermanent, or feeling is impermanent, or perception is impermanent, or volitional formations are impermanent, or consciousness is impermanent, is called wisdom born of reflection (cintāmayā paññā).
"Hoặc trong các nghiệp xứ đã được sắp đặt bởi thiền định, hoặc trong các kỹ nghệ xứ đã được sắp đặt bởi thiền định, hoặc trong các xứ của tri kiến đã được sắp đặt bởi thiền định, hoặc về nghiệp báo (kammassakata) hoặc về sự tương thuận với chân lý, hoặc 'sắc là vô thường', hoặc 'thọ là vô thường', hoặc 'tưởng là vô thường', hoặc 'hành là vô thường', hoặc 'thức là vô thường', sự kiên nhẫn, quan điểm, sự ưa thích, sự hoan hỷ, sự quán sát, sự kiên nhẫn trong việc quán xét pháp tương ứng như vậy mà không nghe từ người khác, đây được gọi là tuệ do tư duy (cintāmayā paññā).
Yogavihitesu vā kammāyatanesu…pe… dhammanijjhānakkhantiṃ parato sutvā paṭilabhati, ayaṃ vuccati sutamayā paññā.
That wisdom which one obtains after hearing from another regarding karmic actions…pe… patient contemplation of phenomena is called wisdom born of learning (sutamayā paññā).
Hoặc trong các nghiệp xứ đã được sắp đặt bởi thiền định... v.v... sự kiên nhẫn trong việc quán xét pháp tương ứng mà nghe từ người khác, đây được gọi là tuệ do nghe (sutamayā paññā).
Sabbāpi samāpannassa paññā bhāvanāmayā paññā’’ti (vibha. 768).
All wisdom of one who has attained jhāna is wisdom born of meditation (bhāvanāmayā paññā)’’ (Vibh. 768).
Tất cả trí tuệ của người đã nhập định là trí tuệ do tu tập mà thành.
Sā pana kāmāvacarabhāvanā āvajjanabhavaṅgapātehi antaritattā bhāvanāti na vuttāti veditabbā.
It should be understood that this sense-sphere meditation (kāmāvacarabhāvanā) is not called meditation because it is interrupted by advertence and bhavanga-fallings.
Tuy nhiên, cần phải hiểu rằng sự tu tập thuộc cõi Dục (kāmāvacarabhāvanā) ấy không được gọi là tu tập (bhāvanā) vì bị xen kẽ bởi các tâm hướng tâm (āvajjana) và tâm hữu phần (bhavaṅga) rơi rụng.
Sabbesaṃ pana puññānaṃ tividhapuññakiriyavatthūnaṃ antogadhattā upacārasamādhivipassanāsamādhīnaṃ bhāvanāmayapuññatā siddhā.
However, the nature of being merit born of meditation (bhāvanāmayapuññatā) is established for both access concentration (upacārasamādhi) and insight concentration (vipassanāsamādhi), as they are included in all merits, the three kinds of meritorious deeds.
Tuy vậy, vì tất cả các công đức đều nằm trong ba loại cơ sở tạo công đức (puññakiriyavatthu), nên sự tu tập của định cận hành (upacārasamādhi) và định quán (vipassanāsamādhi) được xem là công đức do tu tập (bhāvanāmayapuññatā) đã được thiết lập.
Idha pana lokiyabhāvanāya eva saṅgahitā.
Here, however, it is included only in mundane meditation.
Ở đây, chỉ có sự tu tập thế gian (lokiyabhāvanā) được bao gồm.
Rūpārūpāvacarānaṃ tividhabhāve hīnāti lāmakā.
In the three types of rūpāvacara and arūpāvacara meditation, inferior (hīnā) means low.
Trong ba trạng thái của các cõi sắc (rūpāvacara) và vô sắc (arūpāvacara), hīnā (hạ) có nghĩa là thấp kém.
Hīnuttamānaṃ majjhe bhavā majjhā, majjhimātipi pāṭho.
Middling (majjhā) means existing between the inferior and superior; the reading majjhimā also exists.
Ở giữa các trạng thái hạ và thượng là majjhā (trung), cũng có bản đọc là majjhimā.
Padhānabhāvaṃ nītāti paṇītā, uttamāti attho.
Excellent (paṇītā) means brought to a principal state, which signifies supreme.
Được đưa đến trạng thái chủ yếu là paṇītā (thượng), nghĩa là tối thượng.
Āyūhanavasena ayaṃ hīnamajjhimapaṇītatā veditabbā.
This inferiority, middling quality, and excellence should be understood in terms of exertion.
Sự hạ, trung, thượng này cần được hiểu theo cách tinh tấn (āyūhana).
Yassā hi āyūhanakkhaṇe chando vā hīno hoti vīriyaṃ vā cittaṃ vā vīmaṃsā vā, sā hīnā nāma.
Indeed, that meditation is called inferior (hīnā) in whose moment of exertion the desire, or energy, or mind, or investigation is inferior.
Thật vậy, nếu trong khoảnh khắc tinh tấn, ý muốn (chanda), tinh tấn (vīriya), tâm (citta) hoặc sự thẩm sát (vīmaṃsā) là thấp kém, thì đó gọi là hạ.
Yassā te dhammā majjhimā, sā majjhimā nāma.
That in which these qualities are middling is called middling (majjhimā).
Nếu những pháp ấy là trung bình, thì đó gọi là trung.
Yassā te dhammā paṇītā, sā paṇītā nāma.
That in which these qualities are excellent is called excellent (paṇītā).
Nếu những pháp ấy là thượng, thì đó gọi là thượng.
Mudukehi vā indriyehi sampayuttā hīnā nāma, majjhimehi indriyehi sampayuttā majjhimā, adhimattehi indriyehi sampayuttā paṇītā nāma.
Or, that associated with weak faculties is called inferior (hīnā); that associated with middling faculties is middling (majjhimā); that associated with strong faculties is called excellent (paṇītā).
Hoặc, nếu đi kèm với các căn mềm yếu thì gọi là hạ; nếu đi kèm với các căn trung bình thì gọi là trung; nếu đi kèm với các căn mạnh mẽ thì gọi là thượng.
Apariyāpannāya hīnamajjhimattābhāvā paṇītatā eva vuttā.
As supramundane (apariyāpanna) has no inferiority or middling quality, only its excellence is stated.
Đối với pháp siêu thế (apariyāpanna), vì không có trạng thái hạ và trung, nên chỉ nói đến trạng thái thượng.
Sā hi uttamaṭṭhena atappakaṭṭhena ca paṇītā.
For it is excellent in the sense of being supreme and in the sense of being insatiable.
Thật vậy, pháp ấy là tối thượng (paṇītā) theo nghĩa cao tột và không thể bị vượt qua (atappakaṭṭhena).
27. Paṭhamabhāvanācatukke bhāvetīti ekasmiṃyeva khaṇe tathā tathā paṭivijjhanto ariyamaggaṃ bhāveti.
In the first tetrad of meditation, one meditates (bhāveti) means one meditates on the Noble Path, penetrating it in various ways at a single moment.
27. Trong tứ chi tu tập đầu tiên, bhāvetī (tu tập) có nghĩa là tu tập Đạo Thánh (ariyamagga) bằng cách thấu hiểu theo nhiều cách khác nhau chỉ trong một khoảnh khắc.
Dutiyabhāvanācatukke esanābhāvanāti appanāpubbabhāge bhāvanā.
In the second tetrad of meditation, meditation of seeking (esanābhāvanā) refers to meditation in the preliminary stage before absorption (appanā).
Trong tứ chi tu tập thứ hai, esanābhāvanā (tu tập tìm cầu) là sự tu tập ở giai đoạn trước khi nhập định (appanā).
Sā hi appanaṃ esanti etāyāti esanāti vuttā.
Indeed, it is called seeking because absorption is sought through it.
Thật vậy, nó được gọi là esanā (tìm cầu) vì nhờ đó mà người ta tìm kiếm sự nhập định.
Paṭilābhabhāvanāti appanābhāvanā.
Meditation of attainment (paṭilābhabhāvanā) refers to absorption meditation.
Paṭilābhabhāvanā (tu tập thành tựu) là sự tu tập nhập định.
Sā hi tāya esanāya paṭilabbhatīti paṭilābhoti vuttā.
Indeed, it is called attainment because it is attained through that seeking.
Thật vậy, nó được gọi là paṭilābha (thành tựu) vì sự nhập định được thành tựu nhờ sự tìm cầu đó.
Ekarasābhāvanāti paṭilābhe vasībhāvaṃ pattukāmassa payogakāle bhāvanā.
Meditation of single taste (ekarasābhāvanā) refers to meditation at the time of practice for one who desires to achieve mastery in absorption.
Ekarasābhāvanā (tu tập đồng vị) là sự tu tập trong giai đoạn thực hành của người mong muốn đạt được sự thuần thục (vasībhāva) trong sự thành tựu.
Sā hi tena tena pahānena tehi tehi kilesehi vimuttattā vimuttirasena ekarasāti katvā ekarasāti vuttā.
Indeed, it is called single taste because it has a single taste, the taste of liberation, due to being liberated from various defilements through various abandonments.
Thật vậy, nó được gọi là ekarasā (đồng vị) vì nó có một vị duy nhất là vị giải thoát (vimuttirasa), do đã được giải thoát khỏi các phiền não (kilesa) khác nhau nhờ sự đoạn trừ khác nhau.
Āsevanābhāvanāti paṭilābhe vasippattassa yathāruci paribhogakāle bhāvanā.
Meditation of repeated practice (āsevanābhāvanā) refers to meditation at the time of enjoying at will for one who has attained mastery in absorption.
Āsevanābhāvanā (tu tập thực hành) là sự tu tập trong giai đoạn sử dụng tùy ý của người đã đạt được sự thuần thục trong sự thành tựu.
Sā hi bhusaṃ sevīyatīti āsevanāti vuttā.
Indeed, it is called repeated practice because it is practiced extensively.
Thật vậy, nó được gọi là āsevanā (thực hành) vì nó được thực hành một cách thường xuyên.
Keci pana ‘‘āsevanābhāvanā vasīkammaṃ, ekarasābhāvanā sabbatthikā’’ti vaṇṇayanti.
Some, however, explain that "meditation of repeated practice is mastery, and meditation of single taste is applicable everywhere."
Một số người giải thích rằng ‘‘āsevanābhāvanā là sự thuần thục (vasīkamma), ekarasābhāvanā là sự phổ quát (sabbatthikā).’’
Catukkavibhāge samādhiṃ samāpajjantānanti vattamānasamīpe vattamānavacanaṃ.
In the division of the tetrad, for those entering concentration (samādhiṃ samāpajjantānaṃ) is a present tense expression used for what is close to the present.
Trong phần phân loại tứ chi, cụm từ samādhiṃ samāpajjantānaṃ (những người đang nhập định) là một cách nói ở thì hiện tại gần với thì hiện tại.
Tattha jātāti tasmiṃ pubbabhāge jātā.
Born therein (tattha jātā) means born in that preliminary stage.
Tattha jātā (sinh khởi ở đó) có nghĩa là sinh khởi ở giai đoạn trước đó.
Ekarasā hontīti appanuppādane samānakiccā honti.
They have a single taste (ekarasā honti) means they have a common function in producing absorption.
Ekarasā honti (trở nên đồng vị) có nghĩa là có cùng chức năng trong việc tạo ra sự nhập định.
Samādhiṃ samāpannānanti appitappanānaṃ.
For those who have entered concentration (samādhiṃ samāpannānaṃ) means for those with attained absorption.
Samādhiṃ samāpannānaṃ (những người đã nhập định) có nghĩa là những người đã đạt được sự nhập định.
Tattha jātāti tassā appanāya jātā.
Born therein (tattha jātā) means born from that absorption.
Tattha jātā (sinh khởi ở đó) có nghĩa là sinh khởi từ sự nhập định đó.
Aññamaññaṃ nātivattantīti samappavattiyā aññamaññaṃ nātikkamanti.
They do not transcend each other (aññamaññaṃ nātivattanti) means they do not exceed each other in their harmonious activity.
Aññamaññaṃ nātivattanti (không vượt qua lẫn nhau) có nghĩa là không vượt quá lẫn nhau trong sự vận hành đồng đều.
Adhimokkhaṭṭhena saddhindriyaṃ bhāvayatotiādīsu ekakkhaṇepi ekekassa indriyassa sakasakakiccakaraṇe taṃtaṃnissayavasena sakasakakiccakārakāni sesānipi indriyāni vimuttirasena ekarasā hontīti vimuttiraseneva ekarasaṭṭhena bhāvanā.
In phrases like ‘one developing the faculty of faith with the characteristic of determination (adhimokkhaṭṭhena saddhindriyaṃ bhāvayato)’, even in a single moment, when each faculty performs its respective function, the other faculties, which perform their respective functions depending on those respective conditions, also have a single taste, the taste of liberation; thus, meditation is in the sense of having a single taste through the taste of liberation itself.
Trong các câu như adhimokkhaṭṭhena saddhindriyaṃ bhāvayato (tu tập tín căn theo nghĩa quyết định), ngay cả trong một khoảnh khắc, khi mỗi căn thực hiện chức năng riêng của nó, các căn còn lại cũng trở nên đồng vị với vị giải thoát (vimuttirasa), nhờ vào sự nương tựa lẫn nhau, thực hiện chức năng riêng của chúng. Do đó, sự tu tập là đồng vị theo nghĩa có một vị duy nhất là vị giải thoát.
Balabojjhaṅgamaggaṅgesupi eseva nayo.
The same method applies to the powers, factors of enlightenment, and factors of the path.
Đối với các lực (bala), chi phần giác ngộ (bojjhaṅga) và chi phần đạo (maggaṅga) cũng vậy.
Ekarasāti ca liṅgavipallāso kato.
And the gender inversion ekarasā has been made.
Và ekarasā là một sự đảo ngược giống.
Idha bhikkhūti imasmiṃ sāsane bhikkhu.
Here, a bhikkhu (idha bhikkhū) means a bhikkhu in this Dispensation.
Idha bhikkhū (Tỳ-kheo ở đây) có nghĩa là Tỳ-kheo trong giáo pháp này.
Saṃsāre bhayaṃ ikkhatīti bhikkhu.
A bhikkhu is one who sees danger in saṃsāra.
Tỳ-kheo là người quán chiếu sự sợ hãi trong luân hồi.
Pubbaṇhasamayantiādīsu accantasaṃyogatthe upayogavacanaṃ, atthato pana bhummameva, divasassa pubbakāleti attho.
In phrases like ‘in the forenoon (pubbaṇhasamaya)’, the locative case is used in the sense of constant association, but in meaning, it is merely the locative, meaning ‘in the early part of the day’.
Trong các cụm từ như pubbaṇhasamaya (buổi sáng), đó là cách dùng từ để chỉ sự liên tục tuyệt đối, nhưng về ý nghĩa, nó chỉ là thì sở thuộc, nghĩa là vào buổi sáng của một ngày.
Āsevatīti vasippattaṃ samādhiṃ bhusaṃ sevati.
Practices (āsevati) means one extensively practices the concentration that has reached mastery.
Āsevatī (thực hành) có nghĩa là thường xuyên thực hành sự định đã đạt được sự thuần thục.
Majjhanhikasamayanti divasassa majjhakāle.
Majjhanhikasamaya means at midday.
Majjhanhikasamaya (buổi trưa) có nghĩa là vào giữa ngày.
Sāyanhasamayanti divasassa sāyanhakāle.
Sāyanhasamaya means at the evening time of the day.
Sāyanhasamaya (buổi chiều) có nghĩa là vào buổi chiều của một ngày.
Purebhattanti divābhattato purekāle.
Purebhatta means before the daytime meal.
Purebhatta (trước bữa ăn) có nghĩa là trước bữa ăn ban ngày.
Pacchābhattanti divābhattato pacchākāle.
Pacchābhatta means after the daytime meal.
Pacchābhatta (sau bữa ăn) có nghĩa là sau bữa ăn ban ngày.
Purimepi yāmeti rattiyā paṭhame koṭṭhāse.
Purimepi yāme means in the first part of the night.
Purimepi yāme (trong canh đầu) có nghĩa là trong phần đầu của đêm.
Kāḷeti kāḷapakkhe.
Kāḷe means during the dark fortnight.
Kāḷe (vào đêm) có nghĩa là vào kỳ tối (kāḷapakka).
Juṇheti sukkapakkhe.
Juṇhe means during the bright fortnight.
Juṇhe (vào ngày) có nghĩa là vào kỳ sáng (sukkapakkha).
Purimepi vayokhandheti paṭhame vayokoṭṭhāse, paṭhamavayeti attho.
Purimepi vayokhandhe means in the first division of life, that is, in the first age.
Purimepi vayokhandhe (trong phần đời đầu tiên) có nghĩa là trong phần đầu tiên của tuổi thọ, tức là tuổi trẻ.
Tīsu ca vayesu vassasatāyukassa purisassa ekekasmiṃ vaye catumāsādhikāni tettiṃsa vassāni honti.
And among the three ages, for a person with a lifespan of one hundred years, each age consists of thirty-three years and four months.
Trong ba giai đoạn của cuộc đời, đối với một người sống trăm tuổi, mỗi giai đoạn là ba mươi ba năm và bốn tháng.
28. Tatiyabhāvanācatukke tattha jātānaṃ dhammānaṃ anativattanaṭṭhenāti tattha nekkhammādīsu bhāvanāvisesesu jātānaṃ samādhipaññāsaṅkhātānaṃ yuganaddhadhammānaṃ aññamaññaṃ anatikkamanabhāvena.
28. In the third tetrad of development, tatthajātānaṃ dhammānaṃ anativattanaṭṭhenā means by the non-transgression of the conascent qualities, referring to the yuganaddha qualities, namely samādhi and paññā, which arise in those specific developments such as renunciation, in the sense of their not transgressing each other.
28. Trong tứ chi tu tập thứ ba, tattha jātānaṃ dhammānaṃ anativattanaṭṭhenā (theo nghĩa các pháp sinh khởi ở đó không vượt quá nhau) có nghĩa là theo cách các pháp song hành (yuganaddha), tức là định và tuệ, sinh khởi trong các loại tu tập đặc biệt như xuất ly (nekkhamma) v.v., không vượt quá lẫn nhau.
Indriyānaṃ ekarasaṭṭhenāti tattheva saddhādīnaṃ indriyānaṃ nānākilesehi vimuttattā vimuttirasena ekarasabhāvena.
Indriyānaṃ ekarasaṭṭhenā means by the singleness of taste of the faculties such as faith, in that very context, due to their liberation from various defilements, they have a single taste, the taste of liberation.
Indriyānaṃ ekarasaṭṭhenā (theo nghĩa các căn đồng vị) có nghĩa là theo cách các căn như tín (saddhā) v.v., sinh khởi ở đó, có một vị duy nhất là vị giải thoát (vimuttirasa) do đã được giải thoát khỏi các phiền não khác nhau.
Tadupagavīriyavāhanaṭṭhenāti tesaṃ anativattanaekarasabhāvānaṃ anucchavikassa vīriyassa vāhanabhāvena.
Tadupagavīriyavāhanaṭṭhenā means by the carrying out of energy suitable for those states of non-transgression and singleness of taste.
Tadupagavīriyavāhanaṭṭhenā (theo nghĩa tinh tấn phù hợp được duy trì) có nghĩa là theo cách tinh tấn phù hợp được duy trì cho các trạng thái không vượt quá và đồng vị đó.
Āsevanaṭṭhenāti yā tassa tasmiṃ samaye pavattā āsevanā.
Āsevanaṭṭhenā means by the practice that occurs at that time.
Āsevanaṭṭhenā (theo nghĩa thực hành) có nghĩa là theo cách thực hành đã diễn ra vào thời điểm đó.
Tassā āsevanāya āsevanabhāvena.
By the nature of that practice, as practice.
Theo cách thực hành của sự thực hành đó.
Rūpasaññanti kusalavipākakiriyavasena pañcadasavidhaṃ rūpāvacarajjhānasaṅkhātaṃ rūpasaññaṃ.
Rūpasaññā means the perception of form, which is the rūpāvacara jhāna, of fifteen kinds, according to wholesome, resultant, and functional consciousness.
Rūpasaññaṃ (tưởng về sắc) có nghĩa là tưởng về sắc (rūpasañña) được gọi là thiền sắc giới (rūpāvacarajjhāna) có mười lăm loại theo nghiệp thiện và tâm duy tác.
Rūpāvacarajjhānampi hi rūpanti vuccati ‘‘rūpī rūpāni passatī’’tiādīsu (dī. ni. 2.174; a. ni. 8.66; dha. sa. 248), tassa jhānassa ārammaṇampi ‘‘bahiddhā rūpāni passati suvaṇṇadubbaṇṇānī’’tiādīsu (dī. ni. 2.173; a. ni. 8.65-66; dha. sa. 247, 249).
Indeed, rūpāvacara jhāna is also called rūpa in passages like "One with form sees forms," and its object is also called rūpa in passages like "One sees external forms, beautiful and ugly."
Thiền sắc giới cũng được gọi là sắc trong các câu như ‘‘người có sắc thấy các sắc’’ (rūpī rūpāni passati) và đối tượng của thiền đó cũng được gọi là sắc trong các câu như ‘‘thấy các sắc bên ngoài, tốt xấu’’ (bahiddhā rūpāni passati suvaṇṇadubbaṇṇānī).
Rūpāvacarajjhānañhi saññāsīsena rūpe saññāti katvā rūpasaññāti vuccati.
Rūpāvacara jhāna is called rūpasaññā because it is a perception of rūpa, with saññā as its head.
Thiền sắc giới được gọi là tưởng về sắc (rūpasaññā) vì nó là tưởng về sắc, với tưởng là đứng đầu.
Paṭighasaññanti kusalavipākā pañca, akusalavipākā pañcāti evaṃ dasavidhaṃ paṭighasaññaṃ.
Paṭighasaññā means the perception of impingement, of ten kinds: five wholesome-resultant and five unwholesome-resultant.
Paṭighasaññaṃ (tưởng về xung đối) có nghĩa là tưởng về xung đối có mười loại, gồm năm loại do nghiệp thiện và năm loại do nghiệp bất thiện.
Dvipañcaviññāṇasampayuttā hi saññā cakkhādīnaṃ vatthūnaṃ rūpādīnaṃ ārammaṇānañca paṭighātena uppannattā paṭighasaññāti vuccati.
Indeed, the perception associated with the double fivefold consciousness is called paṭighasaññā because it arises from the impingement of bases such as the eye and objects such as form.
Tưởng đi kèm với mười thức song ngũ (dvipañcaviññāṇa) được gọi là tưởng về xung đối (paṭighasaññā) vì nó sinh khởi do sự va chạm (paṭighāta) của các căn như mắt v.v. và các đối tượng như sắc v.v.
Rūpasaññā saddasaññā gandhasaññā rasasaññā phoṭṭhabbasaññātipi etissā eva nāmaṃ.
Rūpasaññā (perception of form), saddasaññā (perception of sound), gandhasaññā (perception of smell), rasasaññā (perception of taste), phoṭṭhabbasaññā (perception of touch) are also names for this same perception.
Các tên gọi như tưởng về sắc, tưởng về tiếng, tưởng về mùi, tưởng về vị, tưởng về xúc cũng là của tưởng xung đối này.
Nānattasaññanti aṭṭha kāmāvacarakusalasaññā, dvādasa akusalasaññā, ekādasa kāmāvacarakusalavipākasaññā, dve akusalavipākasaññā, ekādasa kāmāvacarakiriyasaññāti evaṃ catucattālīsavidhaṃ nānattasaññaṃ.
Nānattasaññā means the perception of diversity, of forty-four kinds: eight kāmaloka wholesome perceptions, twelve unwholesome perceptions, eleven kāmaloka wholesome-resultant perceptions, two unwholesome-resultant perceptions, and eleven kāmaloka functional perceptions.
Nānattasaññaṃ (tưởng về dị biệt) có nghĩa là tưởng về dị biệt có bốn mươi bốn loại, gồm tám tưởng thiện dục giới, mười hai tưởng bất thiện, mười một tưởng quả thiện dục giới, hai tưởng quả bất thiện, và mười một tưởng duy tác dục giới.
Sā hi nānatte nānāsabhāve rūpasaddādibhede gocare pavattā saññāti nānattasaññā, catucattālīsabhedato nānattā nānāsabhāvā aññamaññaṃ asadisā saññāti vā nānattasaññāti vuccati.
Indeed, it is called nānattasaññā because it is a perception that occurs in diverse objects of various natures, such as form and sound, or because it is a perception that is diverse, of various natures, and dissimilar to each other due to its forty-four distinctions.
Tưởng này được gọi là tưởng về dị biệt (nānattasaññā) vì nó vận hành trên các đối tượng dị biệt, có các đặc tính khác nhau, như sắc, tiếng v.v. Hoặc nó được gọi là tưởng về dị biệt vì nó là tưởng có bốn mươi bốn loại, có các đặc tính khác nhau, không giống nhau.
Saññābahukattepi jātiggahaṇena ekavacanaṃ kataṃ.
Even though there are many perceptions, the singular form is used by taking it as a class.
Mặc dù có nhiều tưởng, nhưng cách dùng số ít được thực hiện bằng cách lấy chủng loại.
Niccasaññanti niccanti saññaṃ niccasaññaṃ.
Niccasaññā means the perception of permanence.
Niccasaññaṃ (tưởng về thường) có nghĩa là tưởng cho là thường.
Evaṃ sukhasaññaṃ attasaññaṃ.
Similarly, the perception of happiness and the perception of self.
Tương tự, tưởng cho là lạc (sukhasaññaṃ), tưởng cho là ngã (attasaññaṃ).
Nandinti sappītikaṃ taṇhaṃ.
Nandi means craving accompanied by joy.
Nandi (hoan hỷ) có nghĩa là tham ái có hỷ.
Rāganti nippītikaṃ taṇhaṃ.
Rāga means craving without joy.
Rāga (tham) có nghĩa là tham ái không có hỷ.
Samudayanti rāgassa samudayaṃ.
Samudaya means the arising of craving.
Samudaya (tập khởi) có nghĩa là sự tập khởi của tham.
Atha vā bhaṅgānupassanāya bhaṅgasseva dassanato saṅkhārānaṃ udayaṃ.
Or, it means the arising of formations, because in the contemplation of dissolution, one sees only dissolution.
Hoặc, sự sinh khởi của các hành (saṅkhāra), vì trong quán hoại diệt (bhaṅgānupassanā) chỉ thấy sự hoại diệt.
Ādānanti nibbattanavasena kilesānaṃ, adosadassāvitāya saṅkhatārammaṇassa vā ādānaṃ.
Ādāna means the grasping of defilements in the sense of their production, or the grasping of conditioned objects through the absence of seeing fault.
Ādāna (chấp thủ) có nghĩa là sự chấp thủ các phiền não theo cách sinh khởi, hoặc sự chấp thủ đối tượng hữu vi (saṅkhatārammaṇa) do không thấy lỗi lầm.
Ghanasaññanti santativasena ghananti saññaṃ.
Ghanasaññā means the perception of solidity in the sense of continuity.
Ghanasaññaṃ (tưởng về khối) có nghĩa là tưởng cho là khối theo cách liên tục.
Āyūhananti saṅkhārānaṃ atthāya payogakaraṇaṃ.
Āyūhana means the exertion of effort for the sake of formations.
Āyūhana (tinh tấn) có nghĩa là sự nỗ lực vì lợi ích của các hành.
Dhuvasaññanti thiranti saññaṃ.
Dhuvasaññā means the perception of stability.
Dhuvasaññā là nhận thức rằng (các pháp) là kiên cố.
Nimittanti niccanimittaṃ.
Nimitta means the sign of permanence.
Nimitta là tướng trường tồn.
Paṇidhinti sukhapatthanaṃ.
Paṇidhi means the aspiration for happiness.
Paṇidhi là khát vọng hạnh phúc.
Abhinivesanti atthi attāti abhinivesaṃ.
Abhinivesa means the conviction that there is a self.
Abhinivesa là sự cố chấp rằng ‘có một tự ngã’.
Sārādānābhinivesanti niccasārattasāragahaṇābhinivesaṃ.
Sārādānābhinivesa means the conviction of grasping permanence and self as essence.
Sārādānābhinivesa là sự cố chấp vào việc nắm giữ tinh túy của sự thường còn và tự ngã.
Sammohābhinivesanti ‘‘ahosiṃ nu kho ahaṃ atītamaddhāna’’ntiādivasena (saṃ. ni. 2.20) ‘‘issarato loko sambhotī’’tiādivasena ca sammohābhinivesaṃ.
Sammohābhinivesa means the conviction of delusion, as in "Was I, indeed, in the past?" and "The world arises from a creator."
Sammohābhinivesa là sự cố chấp của sự si mê, theo nghĩa như trong câu: “Phải chăng ta đã từng hiện hữu trong thời quá khứ?” và theo nghĩa như trong câu: “Thế giới này sinh khởi từ một đấng tối cao.”
Ālayābhinivesanti ādīnavādassanena allīyitabbamidanti abhinivesaṃ.
Ālayābhinivesa means the conviction that this is to be clung to, due to not seeing the danger.
Ālayābhinivesa là sự cố chấp rằng ‘điều này đáng được bám víu’ do không thấy được sự nguy hiểm.
Appaṭisaṅkhanti anupāyagahaṇaṃ.
Appaṭisaṅkhā means inappropriate grasping.
Appaṭisaṅkhā là sự nắm giữ không đúng cách.
Saññogābhinivesanti kāmayogādikaṃ kilesappavattiṃ.
Saññogābhinivesa means the occurrence of defilements such as the yoke of sensuality.
Saññogābhinivesa là sự vận hành của các phiền não như dục kiết sử (kāmayoga).
Diṭṭhekaṭṭheti diṭṭhīhi saha ekasmiṃ ṭhitāti diṭṭhekaṭṭhā.
Diṭṭhekaṭṭhe means defilements that exist in one person together with views (diṭṭhī). Therefore, they are called diṭṭhekaṭṭhā.
Diṭṭhekaṭṭhe là các phiền não cùng tồn tại với các tà kiến (diṭṭhī) trong một người, do đó chúng được gọi là diṭṭhekaṭṭhā.
Te diṭṭhekaṭṭhe.
Those defilements existing together with views.
Những phiền não đó là diṭṭhekaṭṭhā.
Kilesenti upatāpenti, vibādhenti vāti kilesā.
They torment, or oppress; therefore, they are called defilements (kilesā).
Chúng làm phiền nhiễu, làm khổ, làm tổn hại, do đó chúng được gọi là kilesā (phiền não).
Te kilese.
Those defilements that torment and oppress.
Những phiền não đó.
Duvidhañhi ekaṭṭhaṃ pahānekaṭṭhaṃ sahajekaṭṭhañca.
Indeed, there are two kinds of 'existing together' (ekaṭṭha): 'existing together in abandonment' (pahānekaṭṭha) and 'co-arising together' (sahajekaṭṭha).
Thật vậy, có hai loại ekaṭṭha: pahānekaṭṭha (cùng đoạn diệt) và sahajekaṭṭha (cùng sinh khởi).
Pahānekaṭṭhaṃ sakkāyadiṭṭhipamukhāhi tesaṭṭhiyā diṭṭhīhi saha (paṭi. ma. aṭṭha. 2.1.118) yāva sotāpattimaggena pahānā, tāva ekasmiṃ puggale ṭhitāti attho.
Pahānekaṭṭha means that the sixty-three views, headed by sakkāyadiṭṭhi, exist in one person until they are abandoned by the path of stream-entry (sotāpattimagga).
Pahānekaṭṭha có nghĩa là các tà kiến sáu mươi ba loại, đứng đầu là thân kiến (sakkāyadiṭṭhi), cùng tồn tại trong một người cho đến khi chúng bị đoạn diệt bởi Sơ quả Đạo (sotāpattimagga).
Idamidhādhippetaṃ.
This is what is intended here.
Điều này được đề cập ở đây.
Dasasu hi kilesesu idha diṭṭhikilesoyeva āgato.
Among the ten defilements, only the defilement of wrong view (diṭṭhikilesa) is mentioned here.
Trong mười phiền não, ở đây chỉ có phiền não tà kiến (diṭṭhikilesa) được đề cập.
Sesesu pana apāyagamanīyo lobho doso moho māno vicikicchā thinaṃ uddhaccaṃ ahirikaṃ anottappanti nava kilesā diṭṭhiyā saha pahānekaṭṭhā hutvā sotāpattimaggena pahīyanti, rāgadosamohapamukhesu vā diyaḍḍhesu kilesasahassesu sotāpattimaggena diṭṭhiyā pahīyamānāya diṭṭhiyā saha apāyagamanīyā sabbakilesā pahānekaṭṭhavasena pahīyanti, sahajekaṭṭhe diṭṭhiyā saha ekasmiṃ citte ṭhitāti attho.
However, among the remaining defilements, the nine defilements that lead to the lower realms (apāya), namely greed, hatred, delusion, conceit, doubt, sloth, restlessness, shamelessness, and fearlessness of wrongdoing, together with wrong view, are abandoned by the path of stream-entry as 'existing together in abandonment'. Alternatively, among the one and a half thousand defilements headed by lust, hatred, and delusion, when wrong view is abandoned by the path of stream-entry, all defilements leading to the lower realms are abandoned as 'existing together in abandonment' with wrong view. Sahajekaṭṭha means that they exist in the same mind together with wrong view.
Tuy nhiên, chín phiền não còn lại là tham, sân, si, mạn, hoài nghi, hôn trầm, trạo cử, vô tàm, vô quý, cùng với tà kiến, là những phiền não dẫn đến các khổ cảnh (apāyagamanīya), chúng bị đoạn diệt bởi Sơ quả Đạo theo cách cùng đoạn diệt (pahānekaṭṭha); hoặc, trong một ngàn rưỡi phiền não, đứng đầu là tham, sân, si, khi tà kiến bị đoạn diệt bởi Sơ quả Đạo, thì tất cả các phiền não dẫn đến các khổ cảnh cùng với tà kiến cũng bị đoạn diệt theo cách cùng đoạn diệt. Còn sahajekaṭṭha có nghĩa là các phiền não cùng tồn tại trong một tâm với tà kiến.
Sotāpattimaggena hi dvīsu diṭṭhisampayuttaasaṅkhārikacittesu pahīyamānesu tehi sahajāto lobho moho uddhaccaṃ ahirikaṃ anottappanti ime kilesā sahajekaṭṭhavasena pahīyanti, dvīsu diṭṭhisampayuttasasaṅkhārikacittesu pahīyamānesu tehi sahajāto lobho moho thinaṃ uddhaccaṃ ahirikaṃ anottappanti ime kilesā sahajekaṭṭhavasena pahīyanti.
Indeed, when the two unprompted cittas associated with wrong view are abandoned by the path of stream-entry, the defilements of greed, delusion, restlessness, shamelessness, and fearlessness of wrongdoing, which co-arise with them, are abandoned as 'co-arising together'. When the two prompted cittas associated with wrong view are abandoned, the defilements of greed, delusion, sloth, restlessness, shamelessness, and fearlessness of wrongdoing, which co-arise with them, are abandoned as 'co-arising together'.
Thật vậy, khi hai tâm câu hữu với tà kiến và không có tác động (diṭṭhisampayuttaasaṅkhārikacitta) bị đoạn diệt bởi Sơ quả Đạo, thì các phiền não tham, si, trạo cử, vô tàm, vô quý sinh khởi cùng với chúng cũng bị đoạn diệt theo cách cùng sinh khởi (sahajekaṭṭha); khi hai tâm câu hữu với tà kiến và có tác động (diṭṭhisampayuttasasaṅkhārikacitta) bị đoạn diệt, thì các phiền não tham, si, hôn trầm, trạo cử, vô tàm, vô quý sinh khởi cùng với chúng cũng bị đoạn diệt theo cách cùng sinh khởi.
Oḷārike kileseti oḷārikabhūte kāmarāgabyāpāde.
Oḷārike kilese means the coarse defilements of sensual lust (kāmarāga) and ill-will (byāpāda).
Oḷārike kilese là các phiền não thô thiển, tức là dục tham (kāmarāga) và sân hận (byāpāda).
Anusahagate kileseti sukhumabhūte kāmarāgabyāpāde.
Anusahagate kilese means the subtle defilements of sensual lust and ill-will.
Anusahagate kilese là các phiền não vi tế, tức là dục tham và sân hận.
Sabbakileseti maggattayena pahīnāvasese.
Sabbakilese means the remaining defilements after they have been abandoned by the three paths.
Sabbakilese là những phiền não còn lại sau khi đã bị đoạn diệt bởi ba Đạo (hạ ba Đạo).
Vīriyaṃ vāhetīti yogāvacaro vīriyaṃ pavatteti.
Vīriyaṃ vāhetī means the meditator (yogāvacara) exerts effort.
Vīriyaṃ vāhetī có nghĩa là hành giả vận dụng tinh tấn.
Heṭṭhā esanāpaṭilābhaekarasaāsevanavacanāni bhāvanānaṃ visesadassanatthaṃ vuttāni ‘‘evaṃbhūtā ca bhāvanā’’ti.
Below, the terms 'seeking', 'attainment', 'single taste', and 'cultivation' were stated to show the distinctions of the bhāvanās, as in "such is bhāvanā".
Các từ ngữ về sự tìm cầu (esanā), sự thành tựu (paṭilābha), sự đồng vị (ekarasa) và sự thực hành (āsevana) đã được nêu ở phần trước để chỉ ra sự khác biệt của các pháp tu (bhāvanā) theo ý nghĩa “pháp tu là như vậy”.
Idha ‘‘tattha jātānaṃ dhammānaṃ anativattanaṭṭhena indriyānaṃ ekarasaṭṭhena tadupagavīriyavāhanaṭṭhena āsevanaṭṭhenā’’ti vacanāni bhāvanāhetudassanatthaṃ vuttāni ‘‘iminā ca iminā ca hetunā bhāvanā’’ti.
Here, the statements "by the non-transgression of phenomena that have arisen there, by the single taste of the faculties, by the exertion of effort related to that, by cultivation" were stated to show the causes of bhāvanā, as in "bhāvanā exists by this and that cause".
Ở đây, các từ ngữ “theo ý nghĩa không vượt qua các pháp đã sinh khởi ở đó, theo ý nghĩa các căn đồng vị, theo ý nghĩa vận dụng tinh tấn phù hợp, theo ý nghĩa thực hành” được nêu ra để chỉ ra nguyên nhân của pháp tu theo ý nghĩa “pháp tu là do nguyên nhân này và nguyên nhân này”.
Heṭṭhā āsevanābhāvanāti nānākkhaṇavasena vuttā, idha āsevanaṭṭhena bhāvanāti ekakkhaṇavasenāti viseso.
Below, 'cultivation is bhāvanā' was stated in terms of different moments, whereas here, 'bhāvanā by way of cultivation' is stated in terms of a single moment; this is the distinction.
Ở phần trước, āsevanābhāvanā (pháp tu thực hành) được nói theo nghĩa các khoảnh khắc khác nhau, còn ở đây, āsevanaṭṭhena bhāvanā (pháp tu theo ý nghĩa thực hành) được nói theo nghĩa một khoảnh khắc duy nhất, đó là sự khác biệt.
Rūpaṃ passanto bhāvetītiādīsu rūpādīni passitabbākārena passanto bhāvetabbaṃ bhāvanaṃ bhāvetīti attho.
In phrases like rūpaṃ passanto bhāvetī (seeing form, he cultivates), the meaning is that one who sees forms and so on in the manner in which they should be seen, cultivates the bhāvanā that should be cultivated.
Trong các câu như Rūpaṃ passanto bhāvetī (Người thấy sắc thì tu tập), ý nghĩa là: người thấy sắc v.v... theo cách thức đáng được thấy thì tu tập pháp tu đáng được tu tập.
Ekarasā hontīti vimuttirasena, kiccarasena vā ekarasā honti.
Ekarasā hontī means they have a single taste, either with the taste of liberation (vimuttirasa) or the taste of function (kiccarasa).
Ekarasā hontī có nghĩa là chúng đồng vị về hương vị giải thoát (vimuttirasa) hoặc hương vị chức năng (kiccarasa).
Vimuttirasoti sampattiraso.
Vimuttiraso means the taste of accomplishment.
Vimuttirasa là hương vị thành tựu.
Kiccasampattiatthena raso nāma pavuccatīti hi vuttanti.
For it is said that "taste" is spoken of in the sense of accomplishment of function.
Thật vậy, đã nói rằng: “Hương vị được gọi là như vậy theo ý nghĩa thành tựu chức năng.”
29. Sacchikātabbaniddese dasa ekuttaravissajjanāni paṭilābhasacchikiriyāvasena vuttāni.
In the Sacchikātabbaniddesa (Section on What is to be Realized), the ten answers, each increasing by one, are stated in terms of realization through attainment.
Trong phần giải thích về các pháp cần chứng ngộ (Sacchikātabbaniddesa), mười câu trả lời tăng dần đã được nêu theo ý nghĩa chứng ngộ thành tựu.
Tattha akuppā cetovimuttīti arahattaphalavimutti.
Among these, akuppā cetovimuttī means the liberation of mind (cetovimutti) that is the fruit of arahantship.
Trong đó, akuppā cetovimutti là sự giải thoát tâm của quả A-la-hán.
Sā hi na kuppati na calati na parihāyatīti akuppā, sabbakilesehi cittassa vimuttattā cetovimuttīti vuccati.
Indeed, it is called akuppā because it does not waver, does not shake, and does not decline, and it is called cetovimutti because the mind is liberated from all defilements.
Thật vậy, sự giải thoát đó không bị lay chuyển, không bị dao động, không bị suy giảm, nên được gọi là akuppā (bất động); và vì tâm được giải thoát khỏi tất cả các phiền não, nên được gọi là cetovimutti (tâm giải thoát).
Vijjāti tisso vijjā.
Vijjā means the three knowledges (vijjā).
Vijjā là ba minh (tisso vijjā).
Vimuttīti dasuttarapariyāyena arahattaphalaṃ vuttaṃ, saṅgītipariyāyena pana ‘‘vimuttīti dve vimuttiyo cittassa ca adhimutti nibbānañcā’’ti (dī. ni. aṭṭha. 3.304) vuttaṃ.
Vimuttī (liberation) is stated as the fruit of arahantship in the Dasuttara Sutta, but in the Saṅgīti Sutta, it is said: "Vimutti means two kinds of liberation: the mind's freedom from hindrances and Nibbāna."
Vimutti được nói đến như quả A-la-hán trong phương pháp Dasuttara; còn trong phương pháp Saṅgīti, đã nói rằng: “Vimutti có hai loại giải thoát: sự giải thoát của tâm và Nibbāna.”
Ettha ca aṭṭha samāpattiyo nīvaraṇādīhi suṭṭhu vimuttattā vimutti nāma, nibbānaṃ sabbasaṅkhatato vimuttattā vimutti nāma.
Here, the eight attainments are called vimutti because they are perfectly liberated from hindrances and so on, and Nibbāna is called vimutti because it is liberated from all conditioned things.
Ở đây, tám thiền định được gọi là vimutti vì chúng được giải thoát hoàn toàn khỏi các triền cái v.v...; Nibbāna được gọi là vimutti vì nó được giải thoát khỏi tất cả các pháp hữu vi.
Tisso vijjāti pubbenivāsānussatiñāṇaṃ vijjā sattānaṃ cutūpapāte ñāṇaṃ vijjā āsavānaṃ khaye ñāṇaṃ vijjā.
Tisso vijjā (the three knowledges) are: the knowledge of recollecting past lives (pubbenivāsānussatiñāṇa), the knowledge of the passing away and reappearance of beings (sattānaṃ cutūpapāte ñāṇaṃ), and the knowledge of the destruction of the taints (āsavānaṃ khaye ñāṇaṃ).
Tisso vijjā (ba minh) là: minh túc mạng trí (pubbenivāsānussatiñāṇaṃ), minh sinh tử trí của chúng sanh (sattānaṃ cutūpapāte ñāṇaṃ), minh lậu tận trí (āsavānaṃ khaye ñāṇaṃ).
Tamavijjhanaṭṭhena vijjā, viditakaraṇaṭṭhenāpi vijjā.
It is vijjā in the sense of piercing through ignorance, and also vijjā in the sense of making things known.
Chúng là vijjā (minh) theo ý nghĩa xuyên phá vô minh, và cũng là vijjā theo ý nghĩa làm cho hiển lộ.
Pubbenivāsānussatiñāṇañhi uppajjamānaṃ pubbenivāsaṃ chādetvā ṭhitaṃ tamaṃ vijjhati, pubbenivāsañca viditaṃ karotīti vijjā.
Indeed, when the knowledge of recollecting past lives arises, it pierces through the darkness of delusion that obscures past existences and makes past existences known; hence it is vijjā.
Thật vậy, khi minh túc mạng trí sinh khởi, nó xuyên phá bóng tối che lấp các đời sống quá khứ và làm cho các đời sống quá khứ hiển lộ, nên nó là vijjā.
Cutūpapāte ñāṇaṃ cutipaṭisandhicchādakaṃ tamaṃ vijjhati, cutūpapātañca viditaṃ karotīti vijjā.
The knowledge of the passing away and reappearance of beings pierces the darkness that conceals rebirth, and makes the passing away and reappearance known; thus, it is called vijjā.
Minh sinh tử trí xuyên phá bóng tối che lấp sự tử và tái sinh, và làm cho sự tử và tái sinh hiển lộ, nên nó là vijjā.
Āsavānaṃ khaye ñāṇaṃ catusaccacchādakaṃ tamaṃ vijjhati, catusaccadhamme ca viditaṃ karotīti vijjā.
The knowledge of the destruction of the āsavas pierces the darkness that conceals the Four Noble Truths, and makes the doctrines of the Four Noble Truths known; thus, it is called vijjā.
Minh lậu tận trí xuyên phá bóng tối che lấp Tứ Thánh Đế, và làm cho các pháp Tứ Thánh Đế hiển lộ, nên nó là vijjā.
Cattāri sāmaññaphalānīti sotāpattiphalaṃ, sakadāgāmiphalaṃ, anāgāmiphalaṃ, arahattaphalaṃ.
The four fruits of recluseship are the fruit of stream-entry (sotāpattiphala), the fruit of once-returning (sakadāgāmiphala), the fruit of non-returning (anāgāmiphala), and the fruit of arahantship (arahattaphala).
Cattāri sāmaññaphalāni (bốn quả Sa-môn) là: quả Sơ quả (sotāpattiphala), quả Nhất lai (sakadāgāmiphala), quả Bất hoàn (anāgāmiphala), quả A-la-hán (arahattaphala).
Pāpadhamme sameti vināsetīti samaṇo, samaṇassa bhāvo sāmaññaṃ.
One who suppresses and destroys evil dharmas is a samaṇa; the state of a samaṇa is sāmañña.
Người đoạn diệt các pháp ác được gọi là Sa-môn (samaṇa), trạng thái của Sa-môn là sāmañña (Sa-môn hạnh).
Catunnaṃ ariyamaggānametaṃ nāmaṃ.
This is a name for the four Noble Paths.
Đây là tên gọi của bốn Thánh Đạo.
Sāmaññassa phalāni sāmaññaphalāni.
The fruits of sāmañña are sāmaññaphalāni.
Các quả của Sa-môn hạnh là sāmaññaphalāni (quả Sa-môn).
Pañca dhammakkhandhāti sīlakkhandho, samādhikkhandho, paññākkhandho, vimuttikkhandho, vimuttiñāṇadassanakkhandho.
The five aggregates of dhamma are the aggregate of morality (sīlakkhandha), the aggregate of concentration (samādhikkhandha), the aggregate of wisdom (paññākkhandha), the aggregate of liberation (vimuttikkhandha), and the aggregate of the knowledge and vision of liberation (vimuttiñāṇadassanakkhandha).
Pañca dhammakkhandhā (năm pháp uẩn) là: giới uẩn (sīlakkhandho), định uẩn (samādhikkhandho), tuệ uẩn (paññākkhandho), giải thoát uẩn (vimuttikkhandho), giải thoát tri kiến uẩn (vimuttiñāṇadassanakkhandho).
Dhammakkhandhāti dhammavibhāgā dhammakoṭṭhāsā.
Aggregates of dhamma means divisions of dhamma, portions of dhamma.
Dhammakkhandhā là các phân loại pháp, các bộ phận pháp.
Sīlakkhandhādīsupi eseva nayo.
The same method applies to the sīlakkhandha and so on.
Trong các từ như Sīlakkhandhā v.v... cũng theo cách tương tự.
Lokiyalokuttarā sīlasamādhipaññā eva sīlasamādhipaññākkhandhā.
The supramundane and mundane morality, concentration, and wisdom are precisely the aggregates of morality, concentration, and wisdom.
Giới, định, tuệ thuộc thế gian và siêu thế chính là giới uẩn, định uẩn, tuệ uẩn.
Samucchedapaṭippassaddhinissaraṇavimuttiyo eva vimuttikkhandho.
The liberations by eradication (samuccheda), tranquilisation (paṭippassaddhi), and escape (nissaraṇa) are precisely the aggregate of liberation.
Các giải thoát đoạn diệt (samuccheda), an tịnh (paṭippassaddhi), và xuất ly (nissaraṇa) chính là giải thoát uẩn.
Tividhā vimuttipaccavekkhaṇā eva vimuttiñāṇadassanakkhandho.
The three kinds of knowledge of reviewing liberation are precisely the aggregate of the knowledge and vision of liberation.
Tri kiến về ba loại giải thoát chính là giải thoát tri kiến uẩn.
So lokiyo eva.
That is entirely mundane.
Giải thoát tri kiến uẩn đó chỉ là thế gian.
Jānanaṭṭhena ñāṇameva dassanaṭṭhena dassananti ñāṇadassanaṃ, vimuttīnaṃ ñāṇadassanaṃ vimuttiñāṇadassananti vuccati.
Knowledge itself is called "knowledge" in the sense of knowing, and "vision" in the sense of seeing; the knowledge and vision of liberations is called vimuttiñāṇadassana.
Tri kiến (ñāṇa) theo nghĩa biết chính là tri kiến (dassana) theo nghĩa thấy, tri kiến về các giải thoát được gọi là giải thoát tri kiến.
Vikkhambhanatadaṅgavimuttiyo pana samādhipaññākkhandheheva saṅgahitā.
However, the liberations by suppression (vikkhambhana) and by substitution of opposites (tadaṅga) are included in the aggregates of concentration and wisdom.
Còn các giải thoát tạm thời (vikkhambhana) và từng phần (tadaṅga) thì đã được bao gồm trong định uẩn và tuệ uẩn.
Ime pañca dhammakkhandhā sekkhānaṃ sekkhā, asekkhānaṃ asekkhāti vuttā.
These five aggregates of dhamma are said to be "of trainees" for trainees, and "of accomplished ones" for accomplished ones.
Năm pháp uẩn này được nói là thuộc hàng Hữu học đối với các bậc Hữu học, và thuộc hàng Vô học đối với các bậc Vô học.
Etesu hi lokiyā ca nissaraṇavimutti ca nevasekkhānāsekkhā.
Among these, the mundane ones and the liberation by escape are neither of trainees nor of accomplished ones.
Trong số đó, các pháp thế gian và giải thoát xuất ly (nissaraṇavimutti) không phải là Hữu học cũng không phải là Vô học.
Sekkhā hontāpi sekkhānaṃ ime iti sekkhā, asekkhānaṃ ime iti asekkhāti vuccanti.
Even though they exist, they are called "of trainees" because they belong to trainees, and "of accomplished ones" because they belong to accomplished ones.
Mặc dù là Hữu học, nhưng chúng được gọi là Hữu học vì chúng thuộc về các bậc Hữu học; và được gọi là Vô học vì chúng thuộc về các bậc Vô học.
‘‘Sekkhena vimuttikkhandhena samannāgato hotī’’ti ettha pana nissaraṇavimuttiyā ārammaṇakaraṇavasena samannāgatoti veditabbo.
In the phrase "he is endowed with the aggregate of liberation of a trainee," it should be understood that he is endowed by way of making the liberation by escape an object.
Trong câu: “Vị ấy thành tựu giải thoát uẩn của bậc Hữu học”, cần hiểu rằng vị ấy thành tựu giải thoát uẩn theo ý nghĩa lấy giải thoát xuất ly làm đối tượng.
Cha abhiññāti cha adhikāni ñāṇāni.
The six higher knowledges are the six superior knowledges.
Cha abhiññā là sáu thắng trí (ñāṇa) siêu việt.
Katamā cha?
Which six?
Sáu thắng trí đó là gì?
Iddhividhañāṇaṃ, dibbasotadhātuñāṇaṃ, pubbenivāsānussatiñāṇaṃ, cetopariyañāṇaṃ, dibbacakkhuñāṇaṃ, āsavānaṃ khaye ñāṇanti imā cha.
These six are: the knowledge of psychic powers (iddhividhañāṇa), the knowledge of the divine ear element (dibbasotadhātuñāṇa), the knowledge of recollecting past lives (pubbenivāsānussatiñāṇa), the knowledge of discerning minds (cetopariyañāṇa), the knowledge of the divine eye (dibbacakkhuñāṇa), and the knowledge of the destruction of the āsavas (āsavānaṃ khaye ñāṇa).
Đó là: thần thông trí (iddhividhañāṇa), thiên nhĩ trí (dibbasotadhātuñāṇa), túc mạng trí (pubbenivāsānussatiñāṇa), tha tâm trí (cetopariyañāṇa), thiên nhãn trí (dibbacakkhuñāṇa), và lậu tận trí (āsavānaṃ khaye ñāṇaṃ).
‘‘Puna caparaṃ, bhikkhave, khīṇāsavassa bhikkhuno cattāro satipaṭṭhānā bhāvitā honti subhāvitā.
“Furthermore, bhikkhus, for a bhikkhu whose āsavas are destroyed, the four foundations of mindfulness are developed, well-developed.
“Lại nữa, này các Tỳ-khưu, bốn pháp Niệm xứ (satipaṭṭhāna) đã được Tỳ-khưu bậc A-la-hán tu tập, tu tập viên mãn.
Pañcindriyāni bhāvitāni honti subhāvitāni.
The five faculties are developed, well-developed.
Năm căn (indriya) đã được tu tập, tu tập viên mãn.
Satta bojjhaṅgā bhāvitā honti subhāvitā.
The seven factors of awakening are developed, well-developed.
Bảy Chi phần Giác ngộ (bojjhaṅga) đã được tu tập, tu tập viên mãn.
Ariyo aṭṭhaṅgiko maggo bhāvito hoti subhāvito.
The Noble Eightfold Path is developed, well-developed.
Bát Chánh Đạo (ariyo aṭṭhaṅgiko maggo) đã được tu tập, tu tập viên mãn.
Yampi, bhikkhave, khīṇāsavassa bhikkhuno ariyo aṭṭhaṅgiko maggo bhāvito hoti subhāvito, idampi khīṇāsavassa bhikkhuno balaṃ hoti, yaṃ balaṃ āgamma khīṇāsavo bhikkhu āsavānaṃ khayaṃ paṭijānāti ‘khīṇā me āsavā’’’ti (a. ni. 10.90; dī. ni. 3.357; paṭi. ma. 2.44).
And this, bhikkhus, that for a bhikkhu whose āsavas are destroyed, the Noble Eightfold Path is developed, well-developed—this is a power for a bhikkhu whose āsavas are destroyed, relying on which power, a bhikkhu whose āsavas are destroyed declares the destruction of the āsavas: ‘My āsavas are destroyed.’”
Này các Tỳ-khưu, việc Bát Chánh Đạo đã được Tỳ-khưu bậc A-la-hán tu tập, tu tập viên mãn, đây cũng là một lực của Tỳ-khưu bậc A-la-hán, nhờ lực này mà Tỳ-khưu bậc A-la-hán tuyên bố sự diệt tận các lậu hoặc, rằng ‘các lậu hoặc của tôi đã diệt tận’.”
Aṭṭha vimokkhāti ārammaṇe adhimuccanaṭṭhena paccanīkadhammehi ca suṭṭhu muccanaṭṭhena vimokkhā.
The eight liberations (vimokkhā) are so called because they enter into the object and are well liberated from opposing phenomena.
Tám giải thoát (Aṭṭha vimokkhā) nghĩa là: các sự giải thoát (vimokkha) bởi ý nghĩa được giải thoát khỏi các pháp đối nghịch và bởi ý nghĩa được giải thoát hoàn toàn khỏi các pháp đối nghịch nhờ sự quyết định đối với các đối tượng.
‘‘Katame aṭṭha?
‘‘Which are the eight?
“Tám điều đó là gì?
Rūpī rūpāni passati, ayaṃ paṭhamo vimokkho.
One with form sees forms; this is the first liberation.
Vị hữu sắc (rūpī) thấy các sắc (rūpa): đây là giải thoát thứ nhất.
Ajjhattaṃ arūpasaññī bahiddhā rūpāni passati, ayaṃ dutiyo vimokkho.
Not perceiving form internally, one sees external forms; this is the second liberation.
Vị nội có tưởng vô sắc (ajjhattaṃ arūpasaññī) thấy các sắc bên ngoài (bahiddhā rūpāni): đây là giải thoát thứ hai.
‘Subha’nteva adhimutto hoti, ayaṃ tatiyo vimokkho.
One is intent on ‘beautiful’; this is the third liberation.
Vị ấy quyết định ‘là tịnh’ (subha): đây là giải thoát thứ ba.
Sabbaso rūpasaññānaṃ samatikkamā paṭighasaññānaṃ atthaṅgamā nānattasaññānaṃ amanasikārā ‘ananto ākāso’ti ākāsānañcāyatanaṃ upasampajja viharati, ayaṃ catuttho vimokkho.
With the complete transcending of perceptions of form, with the disappearance of perceptions of resistance, and with the non-attention to perceptions of diversity, one enters upon and abides in the sphere of infinite space, thinking: ‘Space is infinite’; this is the fourth liberation.
Vượt qua hoàn toàn các tưởng về sắc (rūpasaññā), diệt trừ các tưởng về đối ngại (paṭighasaññā), không tác ý các tưởng về sai biệt (nānattasaññā), vị ấy chứng đạt và an trú trong Không vô biên xứ (ākāsānañcāyatana) với ý niệm ‘không gian là vô biên’ (ananto ākāso): đây là giải thoát thứ tư.
Sabbaso ākāsānañcāyatanaṃ samatikkamma ‘anantaṃ viññāṇa’nti viññāṇañcāyatanaṃ upasampajja viharati, ayaṃ pañcamo vimokkho.
With the complete transcending of the sphere of infinite space, one enters upon and abides in the sphere of infinite consciousness, thinking: ‘Consciousness is infinite’; this is the fifth liberation.
Vượt qua hoàn toàn Không vô biên xứ, vị ấy chứng đạt và an trú trong Thức vô biên xứ (viññāṇañcāyatana) với ý niệm ‘thức là vô biên’ (anantaṃ viññāṇaṃ): đây là giải thoát thứ năm.
Sabbaso viññāṇañcāyatanaṃ samatikkamma ‘natthi kiñcī’ti ākiñcaññāyatanaṃ upasampajja viharati, ayaṃ chaṭṭho vimokkho.
With the complete transcending of the sphere of infinite consciousness, one enters upon and abides in the sphere of nothingness, thinking: ‘There is nothing’; this is the sixth liberation.
Vượt qua hoàn toàn Thức vô biên xứ, vị ấy chứng đạt và an trú trong Vô sở hữu xứ (ākiñcaññāyatana) với ý niệm ‘không có gì cả’ (natthi kiñcī): đây là giải thoát thứ sáu.
Sabbaso ākiñcaññāyatanaṃ samatikkamma nevasaññānāsaññāyatanaṃ upasampajja viharati, ayaṃ sattamo vimokkho.
With the complete transcending of the sphere of nothingness, one enters upon and abides in the sphere of neither perception nor non-perception; this is the seventh liberation.
Vượt qua hoàn toàn Vô sở hữu xứ, vị ấy chứng đạt và an trú trong Phi tưởng phi phi tưởng xứ (nevasaññānāsaññāyatana): đây là giải thoát thứ bảy.
Sabbaso nevasaññānāsaññāyatanaṃ samatikkamma saññāvedayitanirodhaṃ upasampajja viharati, ayaṃ aṭṭhamo vimokkho’’ti (dī. ni. 2.174; 3.358; a. ni. 8.66).
With the complete transcending of the sphere of neither perception nor non-perception, one enters upon and abides in the cessation of perception and feeling; this is the eighth liberation.’’
Vượt qua hoàn toàn Phi tưởng phi phi tưởng xứ, vị ấy chứng đạt và an trú trong Diệt thọ tưởng định (saññāvedayitanirodha): đây là giải thoát thứ tám.”
Dasa asekkhā dhammāti upari sikkhitabbābhāvato na sikkhantīti asekkhā.
The ten asekkhā phenomena are called asekkhā because there is no further training to be done, so they do not train.
Mười pháp vô học (Dasa asekkhā dhammā) nghĩa là: không còn gì để học hỏi thêm nữa, nên không còn học hỏi, gọi là vô học (asekkha).
Atha vā tīsu sikkhāsu sikkhantīti sekkhā, vuddhippattā sekkhāti asekkhā, arahanto.
Alternatively, those who train in the three trainings are sekkhā; those who have reached the pinnacle of development are asekkhā, meaning Arahants.
Hoặc nữa, những vị đang học hỏi trong ba học pháp (sikkhā) thì gọi là hữu học (sekkhā); những vị đã đạt đến sự phát triển tột bậc của hữu học thì gọi là vô học, tức là các bậc A-la-hán.
Asekkhānaṃ ime iti asekkhā.
These belong to the asekkhā, hence they are asekkhā.
Đây là các pháp thuộc về các bậc vô học, nên gọi là vô học.
‘‘Katame dasa?
‘‘Which are the ten?
“Mười điều đó là gì?
Asekkhā sammādiṭṭhi, asekkho sammāsaṅkappo, asekkhā sammāvācā, asekkho sammākammanto, asekkho sammāājīvo, asekkho sammāvāyāmo, asekkhā sammāsati, asekkho sammāsamādhi, asekkhaṃ sammāñāṇaṃ, asekkhā sammāvimuttī’’ti (dī. ni. 3.348, 360).
Asekkhā right view, asekkhā right intention, asekkhā right speech, asekkhā right action, asekkhā right livelihood, asekkhā right effort, asekkhā right mindfulness, asekkhā right concentration, asekkhā right knowledge, asekkhā right liberation.’’
Chánh kiến vô học (asekkhā sammādiṭṭhi), chánh tư duy vô học (asekkho sammāsaṅkappo), chánh ngữ vô học (asekkhā sammāvācā), chánh nghiệp vô học (asekkho sammākammanto), chánh mạng vô học (asekkho sammāājīvo), chánh tinh tấn vô học (asekkho sammāvāyāmo), chánh niệm vô học (asekkhā sammāsati), chánh định vô học (asekkho sammāsamādhi), chánh trí vô học (asekkhā sammāñāṇaṃ), chánh giải thoát vô học (asekkhā sammāvimuttī).”
Asekkhaṃ sammāñāṇanti arahattaphalapaññaṃ ṭhapetvā sesalokiyapaññā.
Asekkhā right knowledge refers to the remaining mundane knowledge, excluding the wisdom of Arahantship.
Chánh trí vô học (Asekkhaṃ sammāñāṇaṃ) là trí tuệ thuộc về thế gian còn lại, ngoại trừ trí tuệ thuộc quả vị A-la-hán.
Sammāvimuttīti arahattaphalavimutti.
Right liberation refers to the liberation that is the fruit of Arahantship.
Chánh giải thoát (Sammāvimuttī) là sự giải thoát thuộc quả vị A-la-hán.
Aṭṭhakathāyaṃ (dī. ni. aṭṭha. 3.348) pana vuttaṃ –
However, in the Commentary, it is stated:
Tuy nhiên, trong Chú giải có nói:
Sabbaṃ, bhikkhave, sacchikātabbantiādīsu ārammaṇasacchikiriyā veditabbā.
In phrases like ‘All, bhikkhus, is to be realized,’ realization by way of object is to be understood.
Trong các câu như “Này các Tỳ-khưu, tất cả phải được chứng ngộ” (Sabbaṃ, bhikkhave, sacchikātabbaṃ), cần hiểu là sự chứng ngộ đối tượng.
Rūpaṃ passanto sacchikarotītiādīsu rūpādīni lokiyāni passitabbākārena passanto tāneva rūpādīni ārammaṇasacchikiriyāya sacchikaroti, rūpādīni vā passitabbākārena passanto tena hetunā sacchikātabbaṃ nibbānaṃ sacchikaroti.
In phrases like ‘One who sees form realizes,’ one who sees forms and so on, which are mundane, in the manner in which they should be seen, realizes those very forms and so on by way of objective realization; or, one who sees forms and so on in the manner in which they should be seen, by that reason, realizes Nibbāna, which is to be realized.
Trong các câu như “Thấy sắc thì chứng ngộ” (Rūpaṃ passanto sacchikaroti) v.v… vị ấy thấy các sắc v.v… thuộc thế gian theo cách cần thấy, và chính các sắc v.v… đó được vị ấy chứng ngộ bằng sự chứng ngộ đối tượng; hoặc vị ấy thấy các sắc v.v… theo cách cần thấy, và do nguyên nhân đó mà vị ấy chứng ngộ Niết-bàn cần được chứng ngộ.
Passantoti hi padaṃ hetuatthepi akkharacintakā icchanti.
For grammarians accept that the word ‘seeing’ can also be in the sense of cause.
Vì các nhà ngữ pháp cũng chấp nhận từ “passanto” (thấy) có nghĩa là nguyên nhân.
Anaññātaññassāmītindriyādīni pana lokuttarāni paccavekkhaṇavasena passanto tāneva ārammaṇasacchikiriyāya sacchikaroti.
However, seeing the supramundane faculties, such as the faculty of 'I shall know what is not yet known,' by way of reviewing*, one realizes those very* by way of realizing them as an object.
Còn đối với các pháp siêu thế như căn “Tôi sẽ biết điều chưa biết” (Anaññātaññassāmītindriya) v.v… thì vị ấy thấy chúng theo cách quán xét (paccavekkhaṇa) và chính chúng được vị ấy chứng ngộ bằng sự chứng ngộ đối tượng.
‘‘Amatogadhaṃ nibbānaṃ pariyosānaṭṭhena sacchikarotī’’ti idaṃ pariññeyyapahātabbasacchikātabbabhāvetabbesu sacchikātabbattā ujukameva.
The statement, ‘‘one realizes Nibbāna, which is immersed in the Deathless, as the ultimate goal,’’ is simply a straightforward teaching, because among the dhammas to be fully understood, to be abandoned, to be realized, and to be developed, Nibbāna is to be realized.
Câu “Chứng ngộ Niết-bàn là nơi an trú bất tử theo ý nghĩa là điểm kết thúc” thì hoàn toàn đúng đắn vì Niết-bàn là pháp cần được chứng ngộ trong số các pháp cần được liễu tri, cần được đoạn trừ, cần được chứng ngộ và cần được tu tập.
Ye ye dhammā sacchikatā honti, te te dhammā phassitā hontīti ārammaṇasacchikiriyāya sacchikatā ārammaṇaphassena phuṭṭhā honti, paṭilābhasacchikiriyāya sacchikatā paṭilābhaphassena phuṭṭhā hontīti.
The meaning of, ‘‘Whatever dhammas are realized, those dhammas are touched,’’ is that those realized by way of objective realization are touched by objective contact, and those realized by way of attainment-realization are touched by attainment-contact.
“Các pháp nào được chứng ngộ, các pháp ấy được xúc chạm” nghĩa là: các pháp được chứng ngộ bằng sự chứng ngộ đối tượng thì được xúc chạm bằng sự xúc chạm đối tượng; các pháp được chứng ngộ bằng sự chứng ngộ thành tựu thì được xúc chạm bằng sự xúc chạm thành tựu.
30. Idāni yasmā hānabhāgiyāditā ekekasseva samādhissa avatthābhedena hoti, tasmā hānabhāgiyacatukkaṃ ekatoyeva niddiṭṭhaṃ.
Now, since the states of decline, etc., occur due to the different stages of each jhāna, the four kinds of decline are expounded together.
Vì sự suy thoái v.v… của mỗi thiền định xảy ra do sự khác biệt về trạng thái, nên Tứ chi suy thoái được trình bày cùng một lúc.
Tattha paṭhamassa jhānassa lābhinti paṭhamassa jhānassa lābhino.
There, ‘‘a recipient of the first jhāna’’ means one who has attained the first jhāna.
Ở đây, người thành tựu thiền thứ nhất (paṭhamassa jhānassa lābhī) có nghĩa là người đã thành tựu thiền thứ nhất (paṭhamassa jhānassa lābhino).
Sāmiatthe upayogavacanaṃ.
The genitive case is used in the sense of possession.
Đó là một từ ngữ được dùng theo nghĩa sở hữu.
Lābho sacchikiriyā assa atthīti lābhīti vuccati.
One is called a recipient (lābhī) because one has the attainment (lābha), which is realization.
Được gọi là người thành tựu (lābhī) vì người ấy có sự chứng đắc (lābho sacchikiriyā).
Kāmasahagatāti ettha sahagatasaddassa ārammaṇattho adhippeto, vatthukāmakilesakāmārammaṇāti attho.
In ‘‘associated with sensual pleasure (kāmasahagatā),’’ the word sahagata is intended to mean "having as its object." The meaning is: having as their object sensual objects, defilements, or sensual pleasures.
Trong từ kāmasahagatā, ý nghĩa của từ "sahagata" (đi kèm) là "đối tượng", tức là đối tượng là dục cảnh vật chất và dục cảnh phiền não.
Saññāmanasikārāti javanasaññā ca tadāvajjanamanasikāro ca, saññāsampayuttamanasikāropi vaṭṭati.
‘‘Perceptions and attentions’’ refers to javana-perception and the adverting attention to it; attention associated with perception is also acceptable.
Saññāmanasikārā (tưởng và tác ý) là tưởng trong tâm tốc hành và tác ý hướng tâm đến đối tượng đó; cũng có thể là tác ý đi kèm với tưởng.
Samudācarantīti pavattanti.
‘‘Arise’’ (samudācarantī) means they occur.
Samudācarantī có nghĩa là phát sinh.
Dhammoti paṭhamajjhānadhammo.
‘‘Dhamma’’ refers to the dhamma of the first jhāna.
Dhamma ở đây là pháp thiền thứ nhất.
Jhānā parihāyanto tīhi kāraṇehi parihāyati kilesasamudācārena vā asappāyakiriyāya vā ananuyogena vā.
One declines from jhāna due to three reasons: the arising of defilements, inappropriate conduct, or lack of practice.
Người thoái thất thiền thoái thất do ba nguyên nhân: do phiền não phát sinh, do hành vi không thích hợp, hoặc do không tinh tấn.
Kilesasamudācārena parihāyanto sīghaṃ parihāyati, kammārāmatābhassārāmatāniddārāmatāsaṅgaṇikārāmatānuyogavasena asappāyakiriyāya parihāyanto dandhaṃ parihāyati, gelaññapaccayavekallādinā palibodhena abhikkhaṇaṃ asamāpajjanto ananuyogena parihāyantopi dandhaṃ parihāyati.
One who declines due to the arising of defilements declines quickly; one who declines due to inappropriate conduct, by way of attachment to work, attachment to chatter, attachment to sleep, or attachment to company, declines slowly; one who declines due to lack of practice, by not frequently entering* due to obstacles such as illness or lack of requisites, also declines slowly.
Người thoái thất do phiền não phát sinh thì thoái thất nhanh chóng; người thoái thất do hành vi không thích hợp, như ưa thích công việc, ưa thích nói chuyện, ưa thích ngủ nghỉ, ưa thích giao du, thì thoái thất chậm; người thoái thất do không tinh tấn, như không thể nhập thiền thường xuyên do bệnh tật, thiếu thốn vật chất, v.v., thì cũng thoái thất chậm.
Idha pana balavakāraṇameva dassento kilesasamudācāramevāha.
Here, however, only the arising of defilements is mentioned, showing it as the strong reason.
Tuy nhiên, ở đây, chỉ nói đến sự phát sinh của phiền não, nhằm chỉ ra nguyên nhân mạnh mẽ.
Dutiyajjhānādīhi pana parihāyanto heṭṭhimaheṭṭhimajjhānanikantisamudācārenapi parihāyati.
One who declines from the second jhāna and so on also declines due to attachment to the lower jhānas.
Người thoái thất từ các thiền thứ hai trở đi cũng thoái thất do sự phát sinh của sự ưa thích các thiền thấp hơn.
Kittāvatā parihīno hotīti?
To what extent is one considered to have declined?
Thoái thất đến mức độ nào?
Yadā na sakkoti samāpajjituṃ, ettāvatā parihīno hotīti.
One is considered to have declined when one is unable to enter*.
Khi không thể nhập thiền, đến mức độ đó là thoái thất.
Tadanudhammatāti anupavatto dhammo anudhammo, jhānaṃ adhikaṃ katvā pavattassa nikantidhammassetaṃ adhivacanaṃ.
‘‘Its corresponding dhamma (tadanudhammatā)’’ means a dhamma that follows, or a dhamma that is predominant. This is a term for the dhamma of craving that arises by making jhāna its object or by making it predominant.
Tadanudhammatā (pháp tùy thuận theo đó) là pháp phát sinh theo sau (anudhammo), đây là tên gọi của pháp ưa thích (nikanti) phát sinh khi thiền được xem là chủ yếu.
Anudhammo eva anudhammatā, tassa jhānassa anudhammatā tadanudhammatā.
Anudhammo itself is anudhammatā; the anudhammatā of that jhāna is tadanudhammatā.
Pháp tùy thuận (anudhammo) chính là sự tùy thuận (anudhammatā); sự tùy thuận của thiền ấy là tadanudhammatā.
Satīti nikanti.
‘‘Mindfulness (satī)’’ refers to craving.
Sati (niệm) ở đây là sự ưa thích (nikanti).
Santiṭṭhatīti patiṭṭhāti.
‘‘Remains (santiṭṭhatī)’’ means it is established.
Santiṭṭhatī có nghĩa là an trú.
Taṃ paṭhamajjhānaṃ anuvattamānā nikanti pavattatīti vuttaṃ hoti.
It is said that craving, following that first jhāna, occurs.
Điều này có nghĩa là sự ưa thích phát sinh theo thiền thứ nhất đó.
Avitakkasahagatāti dutiyajjhānārammaṇā.
‘‘Associated with non-discursive thought (avitakkasahagatā)’’ means having the second jhāna as its object.
Avitakkasahagatā (đi kèm với không tầm) có nghĩa là đối tượng của thiền thứ hai.
Tañhi natthettha vitakkoti avitakkanti vuccati.
For, since there is no discursive thought in it, it is called avitakka.
Thiền đó được gọi là avitakka (không tầm) vì không có tầm ở trong đó.
Nibbidāsahagatāti vipassanārammaṇā.
‘‘Associated with disenchantment (nibbidāsahagatā)’’ means having vipassanā as its object.
Nibbidāsahagatā (đi kèm với sự yếm ly) có nghĩa là đối tượng của tuệ quán (vipassanā).
Sā hi saṅkhāresu nibbindanato nibbidāti vuccati.
For, it is called nibbidā because it is disenchanted with the conditioned phenomena.
Tuệ quán được gọi là nibbidā (sự yếm ly) vì nó yếm ly các hành.
‘‘Nibbindaṃ virajjatī’’ti (mahāva. 23; saṃ. ni. 3.61) hi vuttaṃ.
Indeed, it is said, ‘‘Being disenchanted, one becomes dispassionate.’’
Quả thật, đã nói: "Yếm ly thì ly tham."
Virāgūpasaṃhitāti ariyamaggapaṭisaññuttā vipassanā.
‘‘Connected with dispassion (virāgūpasaṃhitā)’’ refers to vipassanā connected with the Noble Path.
Virāgūpasaṃhitā (liên hệ đến ly tham) là tuệ quán liên quan đến Thánh đạo.
Vipassanā hi sikhāppattā maggavuṭṭhānaṃ pāpeti.
For, vipassanā, when it reaches its peak, leads to the emergence of the path.
Quả thật, tuệ quán khi đạt đến đỉnh cao sẽ đưa đến sự xuất khởi của đạo.
Tasmā vipassanārammaṇā saññāmanasikārā ‘‘virāgūpasaṃhitā’’ti vuccanti, ‘‘virāgā vimuccatī’’ti hi vuttaṃ.
Therefore, perceptions and attentions that have vipassanā as their object are called ‘‘connected with dispassion,’’ for it is said, ‘‘From dispassion, one is liberated.’’
Do đó, tưởng và tác ý có đối tượng là tuệ quán được gọi là "virāgūpasaṃhitā" (liên hệ đến ly tham), vì quả thật đã nói: "Ly tham thì giải thoát."
Vitakkasahagatāti vitakkavasena paṭhamajjhānārammaṇā.
‘‘Associated with discursive thought (vitakkasahagatā)’’ means having the first jhāna as its object, by way of discursive thought.
Vitakkasahagatā (đi kèm với tầm) có nghĩa là đối tượng của thiền thứ nhất theo cách của tầm.
Upekkhāsukhasahagatāti tatramajjhattupekkhāya ca sukhavedanāya ca vasena tatiyajjhānārammaṇā.
‘‘Associated with equanimity and happiness (upekkhāsukhasahagatā)’’ means having the third jhāna as its object, by way of equanimity of mental neutrality and pleasant feeling.
Upekkhāsukhasahagatā (đi kèm với xả và lạc) có nghĩa là đối tượng của thiền thứ ba theo cách của xả trung tính và lạc thọ.
Pītisukhasahagatāti pītiyā ca sukhavedanāya ca vasena dutiyajjhānārammaṇā.
‘‘Associated with rapture and happiness (pītisukhasahagatā)’’ means having the second jhāna as its object, by way of rapture and pleasant feeling.
Pītisukhasahagatā (đi kèm với hỷ và lạc) có nghĩa là đối tượng của thiền thứ hai theo cách của hỷ và lạc thọ.
Adukkhamasukhasahagatāti upekkhāvedanāvasena catutthajjhānārammaṇā.
‘‘Associated with neither-painful-nor-pleasant (adukkhamasukhasahagatā)’’ means having the fourth jhāna as its object, by way of equanimity-feeling.
Adukkhamasukhasahagatā (đi kèm với không khổ không lạc) có nghĩa là đối tượng của thiền thứ tư theo cách của xả thọ.
Sā hi vedanā na dukkhā na sukhāti adukkhamasukhāti vuccati, ma-kāro panettha padasandhivasena vutto.
For, that feeling is called adukkhamasukha because it is neither painful nor pleasant; the letter ‘ma’ here is stated by way of euphonic conjunction of words.
Thọ đó được gọi là adukkhamasukha (không khổ không lạc) vì nó không khổ cũng không lạc; chữ "ma" ở đây được dùng theo cách nối từ.
Rūpasahagatāti rūpajjhānārammaṇā.
‘‘Associated with form (rūpasahagatā)’’ means having the form jhānas as their object.
Rūpasahagatā (đi kèm với sắc) có nghĩa là đối tượng của thiền sắc giới.
Nevasaññānāsaññāyatane ṭhitassa hānabhāgiyaṭhitibhāgiyanibbedhabhāgiyattesu vijjamānesupi visesabhāgiyattābhāvā nevasaññānāsaññāyatanaṃ na niddiṭṭhaṃ.
The sphere of neither-perception-nor-non-perception (nevasaññānāsaññāyatana) is not mentioned because, even though the qualities of decline, stability, and penetration exist for one abiding in it, the quality of distinction (visesabhāgiya) is absent.
Đối với người an trú trong phi tưởng phi phi tưởng xứ, mặc dù có các phần thoái thất, phần an trú, phần thấu triệt, nhưng vì không có phần đặc biệt, nên phi tưởng phi phi tưởng xứ không được chỉ ra.
Sabbopi cesa lokiyo samādhi pamādavihārissa mudindriyassa hānabhāgiyo hoti, appamādavihārissa mudindriyassa ṭhitibhāgiyo hoti, taṇhācaritassa tikkhindriyassa visesabhāgiyo hoti, diṭṭhicaritassa tikkhindriyassa nibbedhabhāgiyo hotīti vuccati.
And all this mundane samādhi is conducive to decline for one who dwells in heedlessness and has dull faculties; it is conducive to stability for one who dwells in heedfulness and has dull faculties; it is conducive to distinction for one whose conduct is rooted in craving and has sharp faculties; it is conducive to penetration for one whose conduct is rooted in wrong view and has sharp faculties—so it is said.
Và tất cả định thế gian này đều là phần thoái thất đối với người sống buông lung với căn tánh yếu kém; là phần an trú đối với người sống không buông lung với căn tánh yếu kém; là phần đặc biệt đối với người có hành vi tham ái với căn tánh sắc bén; là phần thấu triệt đối với người có hành vi tà kiến với căn tánh sắc bén.
31. Idāni yasmā ekekopi lokiyadhammo tilakkhaṇabbhāhato, tasmā lakkhaṇattikaṃ ekato niddiṭṭhaṃ.
Now, since each and every mundane phenomenon is afflicted by the three characteristics, the triad of characteristics is expounded together.
31. Giờ đây, vì mỗi pháp thế gian đều bị ba đặc tính chi phối, nên ba loại đặc tính được trình bày cùng nhau.
Tattha aniccaṃ khayaṭṭhenāti tattha tattheva khīyanabhāvena aniccaṃ.
Therein, impermanent in the sense of decay means impermanent due to the nature of wearing away in each and every instance.
Ở đây, vô thường theo nghĩa hoại diệt (aniccaṃ khayaṭṭhenā) có nghĩa là vô thường theo nghĩa hoại diệt ở từng nơi từng chỗ.
‘‘Khayadhammattā, vayadhammattā, virāgadhammattā, nirodhadhammattā anicca’’nti eke.
Some say: “Impermanent due to being subject to decay, subject to destruction, subject to dispassion, subject to cessation.”
Một số người nói: "Vô thường vì có tính chất hoại diệt, có tính chất biến mất, có tính chất ly tham, có tính chất đoạn diệt."
Dukkhaṃ bhayaṭṭhenāti sappaṭibhayatāya dukkhaṃ.
Suffering in the sense of fear means suffering due to being fraught with danger.
Khổ theo nghĩa đáng sợ (dukkhaṃ bhayaṭṭhenā) có nghĩa là khổ vì có tính chất đáng sợ.
Yañhi aniccaṃ, taṃ bhayāvahaṃ hoti sīhopamasutte (saṃ. ni. 3.78) devānaṃ viya.
For that which is impermanent is fraught with danger, like for the devas in the Simile of the Lion Sutta.
Quả thật, cái gì vô thường thì đáng sợ, như đối với các chư thiên trong Kinh Sư Tử (Sīhopama Sutta).
‘‘Jātijarābyādhimaraṇabhayaṭṭhena dukkha’’nti eke.
Some say: “Suffering in the sense of the danger of birth, aging, sickness, and death.”
Một số người nói: "Khổ theo nghĩa đáng sợ của sinh, già, bệnh, chết."
Anattā asārakaṭṭhenāti ‘‘attā nivāsī kārako vedako sayaṃvasī’’ti evaṃ parikappitassa attasārassa abhāvena anattā.
Non-self in the sense of being without essence means non-self due to the absence of a self-essence conceived as “the self dwells, acts, experiences, and is self-controlled.”
Vô ngã theo nghĩa không có cốt lõi (anattā asārakaṭṭhenā) có nghĩa là vô ngã vì không có cái cốt lõi của tự ngã được giả định như "ngã là người cư trú, là người tạo tác, là người cảm thọ, là người tự chủ."
Yañhi aniccaṃ dukkhaṃ, taṃ attanopi aniccataṃ vā udayabbayapīḷanaṃ vā dhāretuṃ na sakkoti, kuto tassa kārakādibhāvo.
For that which is impermanent and suffering cannot sustain its own impermanence or the oppression of arising and passing away; how then could it be an agent and so forth?
Quả thật, cái gì vô thường và khổ thì không thể giữ được tính vô thường của tự ngã hay sự bức bách của sinh diệt, thì làm sao có thể có tính chất tạo tác, v.v. của nó?
Vuttañca ‘‘rūpañca hidaṃ, bhikkhave, attā abhavissa, nayidaṃ rūpaṃ ābādhāya saṃvatteyyā’’tiādi (mahāva. 20).
And it has been said: “If, bhikkhus, this form were self, this form would not lead to affliction,” and so forth.
Và đã nói: "Này các Tỳ-kheo, nếu sắc này là tự ngã, thì sắc này sẽ không dẫn đến bệnh tật," v.v.
‘‘Attasāraniccasāravirahitattā anattā’’ti eke.
Some say: “Non-self due to being devoid of self-essence and permanent essence.”
Một số người nói: "Vô ngã vì không có cốt lõi của tự ngã và cốt lõi của thường hằng."
Tathā hissa ‘‘ekampi jātiṃ dvepi jātiyo’’tiādīsu (pārā. 12) bhavo attho.
Thus, in phrases like “one birth, two births,” its meaning is existence.
Cũng vậy, trong các câu như "ekampi jātiṃ dvepi jātiyo" (một đời, hai đời), ý nghĩa là hữu (bhava).
‘‘Akkhitto anupakkuṭṭho jātivādenā’’ti (dī. ni. 1.331) ettha kulaṃ.
In “not reviled, not reproached by birth,” it means family.
Trong câu "Akkhitto anupakkuṭṭho jātivādenā" (không bị chỉ trích, không bị quở trách về dòng dõi), ý nghĩa là gia tộc (kula).
‘‘Atthi, visākhe, nigaṇṭhā nāma samaṇajātī’’ti (a. ni. 3.71) ettha nikāyo.
In “Visakha, there is a group of ascetics called Nigaṇṭhas,” it means group.
Trong câu "Atthi, Visākhe, nigaṇṭhā nāma samaṇajātī" (Này Visākha, có một nhóm sa-môn tên là Ni-kiền-tử), ý nghĩa là nhóm (nikāyo).
‘‘Yatohaṃ, bhagini, ariyāya jātiyā jāto nābhijānāmī’’ti (ma. ni. 2.351) ettha ariyasīlaṃ.
In “Since I, sister, was born of the Noble Birth, I do not recall,” it means Noble Virtue.
Trong câu "Yatohaṃ, bhagini, ariyāya jātiyā jāto nābhijānāmī" (Này chị, từ khi tôi sinh ra với sự sinh của bậc Thánh, tôi không nhớ mình đã từng cố ý sát hại sinh vật), ý nghĩa là giới hạnh của bậc Thánh (ariyasīlaṃ).
‘‘Tiriyā nāma tiṇajāti nābhiyā uggantvā nabhaṃ āhacca ṭhitā ahosī’’ti (a. ni. 5.196) ettha paññatti.
In “A grass-species called Tiriyā grew up from my navel and stood touching the sky,” it means designation.
Trong câu "Tiriyā nāma tiṇajāti nābhiyā uggantvā nabhaṃ āhacca ṭhitā ahosī" (Một loại cỏ tên là Tiriyā mọc từ rốn, vươn lên chạm đến trời), ý nghĩa là sự chế định (paññatti).
‘‘Jāti dvīhi khandhehi saṅgahitā’’ti (dhātu. 71) ettha saṅkhatalakkhaṇaṃ.
In “Birth is comprised of two aggregates,” it means the characteristic of conditioned phenomena.
Trong câu "Jāti dvīhi khandhehi saṅgahitā" (Sự sinh được bao gồm trong hai uẩn), ý nghĩa là đặc tính hữu vi (saṅkhatalakkhaṇaṃ).
‘‘Sampatijāto, ānanda, bodhisatto’’ti (ma. ni. 3.207) ettha pasūti.
In “Ānanda, the Bodhisatta is newly born,” it means procreation.
Trong câu "Sampatijāto, Ānanda, bodhisatto" (Này Ānanda, Bồ-tát vừa mới sinh ra), ý nghĩa là sự sinh nở (pasūti).
‘‘Bhavapaccayā jātī’’ti (vibha. 354) ca ‘‘jātipi dukkhā’’ti (paṭi. ma. 1.33; vibha. 190) ca ettha pariyāyato paṭisandhikhandhā.
And in “Conditioned by existence is birth” and “birth is also suffering,” by way of implication, it refers to the rebirth-linking aggregates.
Trong câu "Bhavapaccayā jātī" (Hữu duyên sinh) và "jātipi dukkhā" (sinh cũng là khổ), ý nghĩa gián tiếp là các uẩn tái sinh (paṭisandhikhandhā).
Nippariyāyato pana tattha tattha nibbattamānānaṃ sattānaṃ ye ye khandhā pātubhavanti, tesaṃ tesaṃ paṭhamaṃ pātubhāvo.
However, in its literal sense, it is the first manifestation of those aggregates that arise for beings born in various existences.
Tuy nhiên, theo nghĩa trực tiếp, đó là sự xuất hiện đầu tiên của các uẩn của chúng sinh đang tái sinh ở bất cứ nơi nào.
Kasmā panesā jāti dukkhāti ce?
If it is asked, why is this birth suffering?
Nếu hỏi: "Vì sao sự sinh này là khổ?"
Anekesaṃ dukkhānaṃ vatthubhāvato.
Because it is the basis for many sufferings.
Vì nó là nền tảng của vô số khổ.
Anekāni hi dukkhāni.
For there are many sufferings.
Quả thật, có vô số khổ.
Seyyathidaṃ – dukkhadukkhaṃ, vipariṇāmadukkhaṃ, saṅkhāradukkhaṃ, paṭicchannadukkhaṃ, appaṭicchannadukkhaṃ, pariyāyadukkhaṃ, nippariyāyadukkhanti.
Namely: suffering as pain, suffering due to change, suffering as conditioned phenomena, hidden suffering, unhidden suffering, suffering by implication, and suffering in the literal sense.
Chẳng hạn như: Khổ khổ (dukkha-dukkha), khổ biến hoại (vipariṇāma-dukkha), khổ hành (saṅkhāra-dukkha), khổ ẩn kín (paṭicchanna-dukkha), khổ không ẩn kín (appaṭicchanna-dukkha), khổ gián tiếp (pariyāya-dukkha), khổ trực tiếp (nippariyāya-dukkha).
Ettha kāyikacetasikā dukkhā vedanāsabhāvato ca nāmato ca dukkhattā dukkhadukkhanti vuccati.
Here, painful feelings, both bodily and mental, are called suffering as pain because they are suffering by nature and by name.
Trong các khổ này, thọ khổ về thân và tâm được gọi là khổ khổ (dukkhadukkha) vì bản chất và danh xưng của nó là khổ.
Sukhā vedanā vipariṇāmena dukkhuppattihetuto vipariṇāmadukkhaṃ.
Pleasant feeling is suffering due to change because it is the cause for the arising of suffering through its alteration.
Thọ lạc là hoại khổ (vipariṇāmadukkhaṃ) vì là nguyên nhân phát sinh khổ do sự biến đổi của nó.
Upekkhāvedanā ceva avasesā ca tebhūmakasaṅkhārā udayabbayapaṭipīḷitattā saṅkhāradukkhaṃ.
Equanimity feeling and the remaining conditioned phenomena of the three planes of existence are suffering as conditioned phenomena because they are repeatedly oppressed by arising and passing away.
Thọ xả và các hành (saṅkhārā) còn lại trong ba cõi là hành khổ (saṅkhāradukkhaṃ) vì bị sự sinh diệt liên tục bức bách.
Kaṇṇasūladantasūlarāgajapariḷāhadosajapariḷāhādi kāyikacetasiko ābādho pucchitvā jānitabbato upakkamassa ca apākaṭabhāvato paṭicchannadukkhaṃ.
The bodily and mental ailment such as earache, toothache, burning caused by lust, burning caused by hatred, etc., is hidden suffering because it must be known by asking and because its cause is not manifest.
Các bệnh đau về thân và tâm như đau tai, đau răng, sự bức bách do tham ái, sự bức bách do sân hận, v.v., được gọi là khổ kín (paṭicchannadukkhaṃ) vì phải hỏi mới biết và vì sự khởi phát của chúng không rõ ràng.
Dvattiṃsakammakāraṇādisamuṭṭhāno ābādho apucchitvāva jānitabbato upakkamassa ca pākaṭabhāvato appaṭicchannadukkhaṃ.
An ailment arising from the thirty-two kinds of karma-actions, etc., is unhidden suffering because it can be known without asking and because its cause is manifest.
Bệnh phát sinh do 32 loại hình phạt, v.v., được gọi là khổ không kín (appaṭicchannadukkhaṃ) vì có thể biết mà không cần hỏi và vì sự khởi phát của chúng rõ ràng.
Ṭhapetvā dukkhadukkhaṃ sesaṃ dukkhasaccavibhaṅge (vibha. 190 ādayo) āgataṃ jātiādi sabbampi tassa tassa dukkhassa vatthubhāvato pariyāyadukkhaṃ.
Setting aside dukkha-dukkha, all the remaining sufferings, such as birth, etc., mentioned in the analysis of the Noble Truth of Suffering, are indirect suffering because they are the basis for those respective sufferings.
Trừ khổ khổ ra, tất cả những gì được đề cập trong phần phân tích Khổ Đế (Vibh. 190, v.v.) như sinh, v.v., đều là khổ gián tiếp (pariyāyadukkhaṃ) vì chúng là đối tượng của khổ đó.
Dukkhadukkhaṃ pana nippariyāyadukkhanti vuccati.
Dukkha-dukkha, however, is called direct suffering.
Còn khổ khổ thì được gọi là khổ trực tiếp (nippariyāyadukkhaṃ).
Tatrāyaṃ jāti yaṃ taṃ bālapaṇḍitasuttādīsu (ma. ni. 3.246 ādayo) bhagavatāpi upamāvasena pakāsitaṃ āpāyikaṃ dukkhaṃ, yañca sugatiyampi manussaloke gabbhokkantimūlakādibhedaṃ dukkhaṃ uppajjati, tassa vatthubhāvato dukkhā.
Among these, this birth is suffering because it is the basis for the suffering in the woeful states, which was expounded by the Blessed One metaphorically in the Bālapaṇḍita Sutta and other suttas, and also for the suffering that arises even in happy existences in the human world, such as that rooted in conception in the womb and other types.
Trong đó, sự sinh này là khổ vì nó là đối tượng của khổ trong các cõi đọa xứ, mà Đức Thế Tôn đã thuyết giảng bằng ví dụ trong các kinh như kinh Kẻ Ngu Người Trí (M.N. 3.246, v.v.), và cũng là đối tượng của khổ phát sinh trong các cõi thiện như khổ do sự nhập thai trong cõi người, v.v.
Tatridaṃ gabbhokkantimūlakādibhedaṃ dukkhaṃ – ayañhi satto mātukucchimhi nibbattamāno na uppalapadumapuṇḍarīkādīsu nibbattati, atha kho heṭṭhā āmāsayassa upari pakkāsayassa udarapaṭalapiṭṭhikaṇṭakānaṃ vemajjhe paramasambādhe tibbandhakāre nānākuṇapagandhaparibhāvitaparamaduggandhapavanavicarite adhimattajegucche kucchippadese pūtimacchapūtikummāsacandanikādīsu kimi viya nibbattati.
This is the suffering rooted in conception in the womb: indeed, when this being is born in the mother's womb, it is not born in lotuses, water lilies, white lotuses, etc., but rather, like a worm, it is born in a highly repulsive part of the womb, below the stomach and above the intestines, in the midst of the abdominal wall and spinal column, in an extremely confined space, in profound darkness, permeated by the stench of various corpses and foul-smelling winds, like a worm in rotten fish, rotten barley gruel, or a cesspool.
Trong đó, khổ do sự nhập thai, v.v., là: Khi chúng sinh này tái sinh trong bụng mẹ, nó không tái sinh trong hoa sen xanh, sen hồng, sen trắng, v.v., mà lại tái sinh trong một vùng bụng vô cùng ghê tởm, cực kỳ chật hẹp, tối tăm mù mịt, nằm giữa dạ dày và ruột già, giữa thành bụng và xương sống, nơi tràn ngập mùi hôi thối của đủ loại xác chết và bị gió hôi thối cực độ thổi qua, giống như một con sâu trong cá thối, cháo thối, nước thải, v.v.
So tattha nibbatto dasa māse mātukucchisambhavena usmanā puṭapākaṃ viya paccamāno piṭṭhapiṇḍi viya sediyamāno samiñjanapasāraṇādivirahito adhimattaṃ dukkhaṃ paccanubhotīti.
Born there, for ten months, being cooked like a medicine in a poultice by the heat arising from the mother's womb, and being steamed like a dough ball, deprived of bending and stretching, etc., it experiences extreme suffering.
Chúng sinh đó, khi đã tái sinh ở đó, phải chịu đựng khổ đau tột độ trong mười tháng, bị nung nấu như thuốc gói trong lá, bị hấp như bánh bột, do hơi nóng phát sinh trong bụng mẹ, không thể co duỗi, v.v.
Idaṃ tāva gabbhokkantimūlakaṃ dukkhaṃ.
This, then, is the suffering rooted in conception in the womb.
Đây là khổ do sự nhập thai (gabbhokkantimūlakaṃ).
Jarāpi dukkhāti ettha duvidhā jarā saṅkhatalakkhaṇañca, khaṇḍiccādisammato santatiyaṃ ekabhavapariyāpannakhandhapurāṇabhāvo ca.
Here, in the phrase old age is suffering, old age is of two kinds: the characteristic of conditioned phenomena, and the aging of the aggregates belonging to one existence, which is conventionally understood as decay and so forth. That is what is intended here. This old age is suffering because it is a saṅkhāra-dukkha and because it is the basis of suffering. For the bodily and mental suffering that arises due to the slackening of limbs, distortion of faculties, disfigurement, destruction of youth, impairment of strength, loss of mindfulness and wisdom, and being scorned by others, old age is the basis. Therefore, it is said:
Trong câu “ Già cũng là khổ” (Jarāpi dukkhā), già có hai loại: đặc tính của các pháp hữu vi (saṅkhata-lakkhaṇa) và sự cũ kỹ của các uẩn thuộc một đời sống liên tục, được gọi là sự sứt mẻ, v.v.
Sā idha adhippetā.
That is what is intended here.
Ở đây, loại già thứ hai được đề cập.
Sā panesā dukkhā saṅkhāradukkhabhāvato ceva dukkhavatthuto ca.
This old age is suffering because it is a saṅkhāra-dukkha and because it is the basis of suffering.
Sự già này là khổ vì nó là hành khổ (saṅkhāradukkha) và là đối tượng của khổ.
Yaṃ hidaṃ aṅgapaccaṅgasithilībhāvaindriyavikāravirūpatā yobbanavināsabalūpaghātasatimativippavāsaparaparibhavādianekappaccayaṃ kāyikacetasikaṃ dukkhamuppajjati, jarā tassa vatthu.
For the bodily and mental suffering that arises due to the slackening of limbs, distortion of faculties, disfigurement, destruction of youth, impairment of strength, loss of mindfulness and wisdom, and being scorned by others, old age is the basis.
Thật vậy, khổ đau về thân và tâm phát sinh do nhiều nguyên nhân như sự lỏng lẻo của các chi phần, sự biến đổi của các căn, hình dạng xấu xí, sự hủy hoại của tuổi trẻ, sự suy yếu của sức mạnh, sự mất trí nhớ và trí tuệ, sự bị người khác khinh miệt, v.v., thì sự già là đối tượng của khổ đó.
Tenetaṃ vuccati –
Therefore, it is said:
Do đó, có lời này:
Maraṇampi dukkhanti etthāpi duvidhaṃ maraṇaṃ – saṅkhatalakkhaṇañca, yaṃ sandhāya vuttaṃ – ‘‘jarāmaraṇaṃ dvīhi khandhehi saṅgahita’’nti (dhātu. 71).
Here, in death is suffering, death is also of two kinds: the characteristic of conditioned phenomena, with reference to which it is said, “old age and death are comprised of two aggregates”; and the severance of the continuity of the life faculty belonging to one existence, with reference to which it is said, “there is always fear from death”. That is what is intended here. Birth-conditioned death, accidental death, sudden death, death by exhaustion of life-span, and death by exhaustion of merit are also names for this. Furthermore, momentary death, conventional death, and cutting-off death – these distinctions should be understood here. The breaking up of existing rūpa and arūpa phenomena is called momentary death. “Tissa is dead, Phussa is dead”—this is called conventional death because there is no being in the ultimate sense; “the crop is dead, the tree is dead”—this is called conventional death because there is no life faculty. The passing away of an Arahant without rebirth is called cutting-off death. Excluding external conventional death, the other conventional death and cutting-off death are comprised by the aforementioned severance of continuity. It is suffering because it is the basis of suffering. Therefore, it is said:
Trong câu “ Chết cũng là khổ” (Maraṇampi dukkhaṃ), chết cũng có hai loại: đặc tính của các pháp hữu vi (saṅkhata-lakkhaṇa), như đã nói: “Già và chết được bao gồm trong hai uẩn.”
Ekabhavapariyāpannajīvitindriyappabandhavicchedo ca, yaṃ sandhāya vuttaṃ – ‘‘niccaṃ maraṇato bhaya’’nti (su. ni. 581).
The severance of the continuity of the life faculty belonging to one existence, with reference to which it is said, “there is always fear from death”.
Và sự đoạn tuyệt của dòng sinh mạng thuộc một đời sống, như đã nói: “Luôn luôn sợ hãi cái chết.”
Taṃ idha adhippetaṃ.
That is what is intended here.
Ở đây, loại thứ hai được đề cập.
Jātipaccayamaraṇaṃ upakkamamaraṇaṃ sarasamaraṇaṃ āyukkhayamaraṇaṃ puññakkhayamaraṇantipi tasseva nāmaṃ.
Birth-conditioned death, accidental death, sudden death, death by exhaustion of life-span, and death by exhaustion of merit are also names for this.
Cái chết do duyên sanh, cái chết do phương tiện, cái chết do cảm xúc, cái chết do hết tuổi thọ, cái chết do hết phước cũng là tên gọi của chính nó.
Puna khaṇikamaraṇaṃ sammutimaraṇaṃ samucchedamaraṇanti ayampettha bhedo veditabbo.
Furthermore, momentary death, conventional death, and cutting-off death – these distinctions should be understood here.
Lại nữa, cần phải biết sự phân biệt ở đây là: cái chết trong khoảnh khắc, cái chết quy ước, và cái chết đoạn tận.
Pavatte rūpārūpadhammānaṃ bhedo khaṇikamaraṇaṃ nāma.
The breaking up of existing rūpa and arūpa phenomena is called momentary death.
Sự hoại diệt của các pháp sắc và phi sắc trong dòng tương tục được gọi là cái chết trong khoảnh khắc.
‘‘Tisso mato, phusso mato’’ti idaṃ paramatthato sattassa abhāvā, ‘‘sassaṃ mataṃ, rukkho mato’’ti idaṃ jīvitindriyassa abhāvā sammutimaraṇaṃ nāma.
“Tissa is dead, Phussa is dead”—this is called conventional death because there is no being in the ultimate sense; “the crop is dead, the tree is dead”—this is called conventional death because there is no life faculty.
“Tisso đã chết, Phusso đã chết” — điều này, vì không có chúng sanh theo nghĩa chân đế, và “lúa đã chết, cây đã chết” — điều này, vì không có mạng quyền, nên được gọi là cái chết quy ước.
Khīṇāsavassa appaṭisandhikā kālakiriyā samucchedamaraṇaṃ nāma.
The passing away of an Arahant without rebirth is called cutting-off death.
Sự mệnh chung không còn tái sanh của bậc lậu tận được gọi là cái chết đoạn tận.
Bāhirakaṃ sammutimaraṇaṃ ṭhapetvā itaraṃ sammutimaraṇañca samucchedamaraṇañca yathāvuttapabandhavicchedeneva saṅgahitaṃ.
Excluding external conventional death, the other conventional death and cutting-off death are comprised by the aforementioned severance of continuity.
Trừ cái chết quy ước bên ngoài, cái chết quy ước còn lại và cái chết đoạn tận được bao gồm chính bởi sự đoạn tuyệt của dòng tương tục đã được nói đến.
Dukkhassa pana vatthubhāvato dukkhaṃ.
It is suffering because it is the basis of suffering.
Nhưng vì là nền tảng của khổ, nên nó là khổ.
Tenetaṃ vuccati –
Therefore, it is said:
Do đó, điều này được nói:
Tathā hi indhanamiva pāvako, lakkhamiva paharaṇāni, gorūpaṃ viya ḍaṃsamakasādayo, khettamiva lāyakā, gāmaṃ viya gāmaghātakā, upādānakkhandhapañcakameva jātiādayo nānappakārehi vibādhentā tiṇalatādīni viya bhūmiyaṃ, pupphaphalapallavāni viya rukkhesu upādānakkhandhesuyeva nibbattanti.
Just as fire afflicts fuel, weapons afflict targets, mosquitoes and gnats afflict cattle, reapers afflict a field or its crops, and village-destroyers afflict a village, so too, birth and so forth, afflicting the five aggregates of clinging in various ways, arise only in the aggregates of clinging, just as grass and creepers arise on the earth, and flowers, fruits, and sprouts arise on trees.
Thật vậy, cũng như lửa đối với nhiên liệu, vũ khí đối với mục tiêu, ruồi muỗi đối với đàn bò, người gặt đối với ruộng lúa, kẻ cướp làng đối với ngôi làng, sanh, v.v., bằng nhiều cách khác nhau, làm khổ não chính năm uẩn thủ, và chúng phát sinh ngay trong các uẩn thủ, giống như cỏ và dây leo trên mặt đất, hoa, quả và chồi non trên cây.
Upādānakkhandhānañca ādidukkhaṃ jāti, majjhedukkhaṃ jarā, pariyosānadukkhaṃ maraṇaṃ, māraṇantikadukkhābhighātena pariḍayhanadukkhaṃ soko, tadasahanato lālappanadukkhaṃ paridevo, tato dhātukkhobhasaṅkhātaaniṭṭhaphoṭṭhabbasamāyogato kāyassa ābādhanadukkhaṃ dukkhaṃ, tena ābādhiyamānānaṃ puthujjanānaṃ tattha paṭighuppattito cetobādhanadukkhaṃ domanassaṃ, sokādivuddhiyā janitavisādānaṃ anutthunanadukkhaṃ upāyāso, manorathavighātappattānaṃ icchāvighātadukkhaṃ icchitālābhoti evaṃ nānappakārato upaparikkhiyamānā upādānakkhandhāva dukkhāti yadetaṃ ekamekaṃ dassetvā vuccamānaṃ anekehipi kappehi na sakkā anavasesato vattuṃ, taṃ sabbampi dukkhaṃ ekajalabindumhi sakalasamuddajalarasaṃ viya yesu kesuci pañcasu upādānakkhandhesu saṅkhipitvā dassetuṃ ‘‘saṅkhittena pañcupādānakkhandhā dukkhā’’ti bhagavatā vuttameva thero avocāti.
And among the aggregates of clinging, birth is suffering at the beginning, old age is suffering in the middle, and death is suffering at the end. Sorrow is the suffering of burning due to the affliction of suffering ending in death. Lamentation is the suffering of wailing due to not enduring that (sorrow). Then, physical pain is the suffering of bodily affliction due to the conjunction with unpleasant contact, which is the disturbance of the elements. Mental pain is the suffering of mental affliction for ordinary people who are afflicted by that (physical pain), due to the arising of aversion there. Despair is the suffering of lamenting, generated by the increase of sorrow and so forth. Not getting what one wants is the suffering of frustrated desire for those whose hopes are thwarted. Thus, when examined in various ways, it is the aggregates of clinging themselves that are suffering. This suffering, when shown one by one and spoken of, cannot be fully described even in many aeons. All that suffering, like the taste of all ocean water in a single drop of water, is condensed and shown in these five aggregates of clinging, as the Blessed One said, "In brief, the five aggregates of clinging are suffering." This is what the Elder taught, bringing it into the Pāṭisambhidāmagga Pāḷi.
Và đối với các uẩn thủ, khổ ban đầu là sanh, khổ ở giữa là già, khổ cuối cùng là chết, khổ bị thiêu đốt bởi sự áp bức của khổ đau tận cùng là cái chết gọi là sầu, khổ than khóc do không thể chịu đựng được gọi là bi, từ đó khổ về sự bệnh hoạn của thân do sự tiếp xúc với xúc chạm không mong muốn được gọi là sự xáo trộn của các đại gọi là khổ, khổ về sự bệnh hoạn của tâm do sự phát sinh của sân hận ở nơi các phàm phu đang bị bệnh hoạn ấy hành hạ gọi là ưu, khổ rên rỉ của những người có nỗi buồn được tạo ra bởi sự gia tăng của sầu muộn v.v… gọi là não, khổ do chướng ngại của ý muốn nơi những người gặp phải sự cản trở của nguyện vọng gọi là cầu bất đắc khổ; như vậy, khi được xem xét theo nhiều cách khác nhau, chính các uẩn thủ là khổ. Điều này, nếu được trình bày từng cái một, thì dù có nói trong nhiều kiếp cũng không thể nói hết được không còn sót lại. Vị Trưởng lão đã nói lại chính lời mà Đức Thế Tôn đã dạy: “Tóm lại, năm uẩn thủ là khổ”, nhằm để trình bày tất cả những khổ đau ấy một cách tóm tắt trong bất kỳ năm uẩn thủ nào, giống như hương vị của toàn bộ nước biển được tóm gọn trong một giọt nước.
Tattha katamā jātītiādīsu padabhājanīyesu tatthāti dukkhasaccaniddese vuttesu jātiādīsu.
In the section on the analysis of terms such as “What is birth there?”, “there” refers to birth and so forth mentioned in the exposition of the Noble Truth of Suffering.
Ở đây, sanh là gì v.v..., trong các phần phân tích từ ngữ này, ở đây có nghĩa là trong số sanh v.v... đã được nói đến trong phần giải thích về Khổ đế.
Yā tesaṃ tesaṃ sattānanti saṅkhepato anekesaṃ sattānaṃ sādhāraṇaniddeso.
“The birth of these and those beings” is a general exposition of many beings in brief.
Sự sanh của các chúng sanh này, chúng sanh nọ là cách trình bày chung cho nhiều chúng sanh một cách tóm tắt.
Yā devadattassa jāti, yā somadattassa jātīti evañhi divasampi kathiyamāne neva sattā pariyādānaṃ gacchanti, na sabbaṃ aparatthadīpanaṃ sijjhati, imehi pana dvīhi padehi na koci satto apariyādinno hoti, na kiñci aparatthadīpanaṃ na sijjhati.
Indeed, if one were to speak of the birth of Devadatta and the birth of Somadatta in this manner for a whole day, beings would not be exhausted, nor would the explanation of all other matters be completed. However, with these two terms, no being is left unmentioned, and no explanation of other matters is left incomplete.
Thật vậy, nếu nói: “Sự sanh của Devadatta, sự sanh của Somadatta”, thì dù có nói cả ngày, các chúng sanh cũng không thể được kể hết, và việc giải thích cho tất cả các trường hợp khác cũng không thể hoàn thành. Nhưng với hai từ này, không có chúng sanh nào không được bao gồm, không có sự giải thích nào cho các trường hợp khác mà không được hoàn thành.
Tamhi tamhīti ayaṃ gatijātivasena anekesaṃ sattanikāyānaṃ sādhāraṇaniddeso.
“In this and that” is a general exposition of many groups of beings in terms of their destinies and births.
Trong chúng sanh đoàn này, chúng sanh đoàn nọ là cách trình bày chung cho nhiều chúng sanh đoàn theo phương diện thú và loài.
Sattanikāyeti sattānaṃ nikāye, sattaghaṭāyaṃ sattasamūheti attho.
“Group of beings” means a group of beings, a collection of beings, a multitude of beings.
Trong chúng sanh đoàn có nghĩa là trong đoàn thể của các chúng sanh, trong tập hợp của các chúng sanh, trong nhóm của các chúng sanh.
Jātīti jāyanavasena.
“Birth” (jāti) is in the sense of being born.
Sanh (jāti) là theo phương diện sinh ra.
Idamettha sabhāvapaccattaṃ.
This here is its specific characteristic (sabhāvapaccatta).
Đây là từ ngữ riêng biệt chỉ bản chất ở đây.
Sañjātīti sañjāyanavasena.
“Complete birth” (sañjāti) is in the sense of being completely born.
Sự sanh khởi (sañjāti) là theo phương diện sinh ra hoàn toàn.
Upasaggena padaṃ vaḍḍhitaṃ.
The word is extended by the prefix.
Từ này được mở rộng bằng một tiếp đầu ngữ.
Okkantīti okkamanavasena.
“Descent” (okkanti) is in the sense of descending.
Sự nhập thai (okkanti) là theo phương diện đi vào.
Jāyanaṭṭhena vā jāti, sā aparipuṇṇāyatanavasena vuttā.
Or, it is jāti in the sense of being born, and it is spoken of in terms of an incomplete sense-sphere.
Hoặc, do có nghĩa là sinh ra nên gọi là sanh (jāti); điều đó được nói theo phương diện các xứ chưa hoàn thiện.
Sañjāyanaṭṭhena sañjāti, sā paripuṇṇāyatanavasena vuttā.
It is sañjāti in the sense of being completely born, and it is spoken of in terms of a complete sense-sphere.
Do có nghĩa là sinh ra hoàn toàn nên gọi là sự sanh khởi (sañjāti); điều đó được nói theo phương diện các xứ đã hoàn thiện.
Okkamanaṭṭhena okkanti, sā aṇḍajajalābujavasena vuttā.
It is okkanti in the sense of descending, and it is spoken of in terms of egg-born and womb-born beings.
Do có nghĩa là đi vào nên gọi là sự nhập thai (okkanti); điều đó được nói theo phương diện noãn sanh và thai sanh.
Te hi aṇḍakosaṃ vatthikosañca okkamanti, okkamantā pavisantā viya paṭisandhiṃ gaṇhanti.
For they descend into the egg-shell and the womb-membrane, and by descending, they take rebirth as if entering.
Thật vậy, chúng đi vào vỏ trứng và bao tử cung; khi đi vào, chúng thụ thai giống như đang đi vào bên trong.
Abhinibbattanaṭṭhena abhinibbatti, sā saṃsedajaopapātikavasena vuttā.
“Arising” (abhinibbatti) is in the sense of clearly arising, and it is spoken of in terms of moisture-born and spontaneous-born beings.
Do có nghĩa là hiện hữu rõ ràng nên gọi là sự hiện hữu (abhinibbatti); điều đó được nói theo phương diện thấp sanh và hóa sanh.
Te hi pākaṭā eva hutvā nibbattanti, ayaṃ tāva sammutikathā.
For they arise having become manifest. This is conventional discourse for now.
Thật vậy, chúng hiện hữu một cách rõ ràng rồi sinh ra. Đây trước hết là cách nói theo tục đế.
Idāni khandhānaṃ pātubhāvo, āyatanānaṃ paṭilābhoti paramatthakathā hoti.
Now, “the manifestation of the aggregates, the acquisition of the sense-spheres” is ultimate discourse.
Bây giờ, sự xuất hiện của các uẩn, sự thành tựu của các xứ là cách nói theo chân đế.
Khandhā eva hi paramatthato pātubhavanti, na sattā.
For in the ultimate sense, it is only the aggregates that manifest, not beings.
Thật vậy, theo chân đế, chỉ có các uẩn xuất hiện, chứ không phải chúng sanh.
Ettha ca khandhānanti ekavokārabhave ekassa, catuvokārabhave catunnaṃ, pañcavokārabhave pañcannampi gahaṇaṃ veditabbaṃ.
Here, “of the aggregates” should be understood as the inclusion of one aggregate in a one-constituent existence, four in a four-constituent existence, and all five in a five-constituent existence.
Ở đây, cần hiểu rằng của các uẩn là sự bao gồm một uẩn trong cõi nhất uẩn, bốn uẩn trong cõi tứ uẩn, và cả năm uẩn trong cõi ngũ uẩn.
Pātubhāvoti uppatti.
“Manifestation” is arising.
Sự xuất hiện là sự sinh khởi.
Āyatanānanti tatra tatra uppajjamānāyatanavasena saṅgaho veditabbo.
“Of the sense-spheres” should be understood as inclusion in terms of the sense-spheres arising in each respective existence.
Của các xứ cần được hiểu là sự tổng hợp theo phương diện các xứ sinh khởi ở nơi này nơi kia.
Paṭilābhoti santatiyaṃ pātubhāvoyeva.
“Acquisition” is simply manifestation in the continuity.
Sự thành tựu chính là sự xuất hiện trong dòng tương tục.
Pātubhavantāneva hi tāni paṭiladdhāni nāma honti.
For when they manifest, they are said to be acquired.
Thật vậy, chính khi chúng đang xuất hiện thì chúng mới được gọi là đã thành tựu.
Ayaṃ vuccati jātīti ayaṃ jāti nāma kathīyati.
“This is called birth” means this is designated as birth.
Điều này được gọi là sanh, tức là điều này được gọi là sanh.
Jarāniddese jarāti sabhāvapaccattaṃ.
In the exposition of old age, “old age” (jarā) is its specific characteristic (sabhāvapaccatta).
Trong phần giải thích về già, già (jarā) là từ ngữ riêng biệt chỉ bản chất.
Jīraṇatāti ākāraniddeso.
“Aging” (jīraṇatā) is an exposition of its mode.
Sự già nua (jīraṇatā) là cách trình bày về hình thái.
Khaṇḍiccantiādayo tayo kālātikkame kiccaniddesā, pacchimā dve pakatiniddesā.
“Broken teeth” and the following three are expositions of function in terms of the passing of time; the latter two are expositions of its nature.
Ba từ răng rụng (khaṇḍicca) v.v... là cách trình bày về chức năng khi thời gian trôi qua, hai từ cuối cùng là cách trình bày về bản chất.
Ayañhi jarāti iminā padena sabhāvato dīpitā, tenassā idaṃ sabhāvapaccattaṃ.
Indeed, this old age is revealed in its nature by the word “jarā”; hence, this is its specific characteristic.
Thật vậy, sự già này được giải thích về bản chất bằng từ “jarā”, do đó đây là từ ngữ riêng biệt chỉ bản chất của nó.
Jīraṇatāti iminā ākārato, tenassāyaṃ ākāraniddeso.
It is revealed in its mode by the word “jīraṇatā”; hence, this is an exposition of its mode.
Bằng từ “jīraṇatā”, nó được giải thích về hình thái, do đó đây là cách trình bày về hình thái của nó.
Khaṇḍiccanti iminā kālātikkame dantanakhānaṃ khaṇḍitabhāvakaraṇakiccato.
"Khaṇḍiccaṃ" (brokenness) is indicated by this as the action of causing the teeth and nails to become broken due to the passage of time.
Bằng từ “khaṇḍicca”, nó được giải thích về chức năng làm cho răng và móng trở nên gãy rụng khi thời gian trôi qua.
Pāliccanti iminā kesalomānaṃ palitabhāvakaraṇakiccato.
"Pāliccaṃ" (greyness) is indicated by this as the action of causing the hair and body-hair to become grey.
Bằng từ pālicca, nó được giải thích về chức năng làm cho tóc và lông trở nên bạc trắng.
Valittacatāti iminā maṃsaṃ milāpetvā tace valibhāvakaraṇakiccato dīpitā.
"Valittacatā" (wrinkled skin) is indicated by this as the action of causing the flesh to wither and the skin to wrinkle.
Bằng từ valittacatā, nó được giải thích về chức năng làm cho thịt teo lại và da trở nên nhăn nheo.
Tenassā ime tayo kālātikkame kiccaniddesā.
Therefore, these three are descriptions of the actions of aging due to the passage of time.
Do đó, ba từ này là cách trình bày về chức năng của nó khi thời gian trôi qua.
Tehi imesaṃ vikārānaṃ dassanavasena pākaṭībhūtā pākaṭajarā dassitā.
By these, visible aging (pākaṭajarā), which becomes manifest through the appearance of these changes, is shown.
Qua chúng, sự già biểu lộ (pākaṭajarā), vốn đã trở nên rõ ràng qua việc thấy được những biến đổi này, đã được chỉ ra.
Yatheva hi udakassa vā vātassa vā aggino vā tiṇarukkhādīnaṃ sambhaggapalibhaggatāya vā jhāmatāya vā gatamaggo pākaṭo hoti, na ca so gatamaggo tāneva udakādīni, evameva jarāya dantādīsu khaṇḍiccādivasena gatamaggo pākaṭo cakkhuṃ ummīletvāpi gayhati, na ca khaṇḍiccādīneva jarā.
Just as the path of water, wind, or fire is evident through the brokenness or burnt state of grass, trees, and so forth, and that path is not the water itself, etc., so too, the path of aging (jarā) in the teeth and so forth, in the form of brokenness, etc., is evident and can be grasped even by opening one's eyes; yet, brokenness, etc., is not aging itself.
Thật vậy, cũng như con đường đi của nước, gió, hay lửa trở nên rõ ràng qua sự gãy đổ, tàn lụi hay cháy xém của cỏ cây v.v..., nhưng con đường đi đó không phải là chính nước, v.v...; cũng vậy, con đường đi của sự già trong răng v.v... qua việc rụng gãy v.v... trở nên rõ ràng, có thể nhận thấy được ngay cả khi mở mắt ra, nhưng sự rụng gãy v.v... không phải là chính sự già.
Na hi jarā cakkhuviññeyyā hoti.
Aging is indeed not cognizable by the eye-consciousness.
Thật vậy, sự già không phải là đối tượng có thể nhận biết bằng nhãn thức.
Āyuno saṃhāni indriyānaṃ paripākoti imehi pana padehi kālātikkameyeva abhibyattāya āyukkhayacakkhādiindriyaparipākasaṅkhātāya pakatiyā dīpitā, tenassime dve pakatiniddesāti veditabbā.
However, by these terms, "decline of life" (āyuno saṃhāni) and "decay of faculties" (indriyānaṃ paripāko), aging is indicated by its nature, which is the exhaustion of life and the decay of the eye and other faculties, becoming manifest only through the passage of time. Thus, these two should be understood as descriptions of its nature.
Còn với các từ sự suy giảm của tuổi thọ, sự chín muồi của các căn, sự già được giải thích bằng bản chất được gọi là sự suy giảm tuổi thọ và sự chín muồi của các căn như mắt v.v..., vốn đã biểu hiện rõ ràng khi thời gian trôi qua. Do đó, cần hiểu rằng hai từ này là cách trình bày về bản chất của nó.
Tattha yasmā jaraṃ pattassa āyu hāyati, tasmā jarā ‘‘āyuno saṃhānī’’ti phalūpacārena vuttā.
Among these, since the life of one who has reached old age declines, aging is called "decline of life" by way of referring to the cause by its effect.
Trong đó, vì tuổi thọ của người đã đến tuổi già bị suy giảm, nên sự già được gọi là “sự suy giảm của tuổi thọ” theo phép ẩn dụ về kết quả.
Yasmā ca daharakāle suppasannāni sukhumampi attano visayaṃ sukheneva gaṇhanasamatthāni cakkhādīni indriyāni jaraṃ pattassa paripakkāni āluḷitāni avisadāni oḷārikampi attano visayaṃ gahetuṃ asamatthāni honti, tasmā ‘‘indriyānaṃ paripāko’’ti phalūpacāreneva vuttā.
And since the eye and other faculties, which in youth were very clear and capable of easily grasping even subtle objects, become decayed, agitated, unclear, and incapable of grasping even gross objects when one reaches old age, it is called "decay of faculties" by way of referring to the cause by its effect.
Và vì các căn như mắt v.v..., vốn rất trong sáng và có khả năng nắm bắt đối tượng vi tế của mình một cách dễ dàng khi còn trẻ, khi đến tuổi già lại trở nên chín muồi, mờ đục, không rõ ràng, không có khả năng nắm bắt cả đối tượng thô của mình, nên nó được gọi là “sự chín muồi của các căn” cũng theo phép ẩn dụ về kết quả.
Sā panesā evaṃ niddiṭṭhā sabbāpi jarā pākaṭā paṭicchannāti duvidhā hoti.
All aging, thus described, is twofold: manifest (pākaṭā) and hidden (paṭicchannā).
Tất cả sự già được giải thích như vậy được chia làm hai loại: sự già biểu lộ và sự già che giấu.
Tattha dantādīsu khaṇḍādibhāvadassanato rūpadhammesu jarā pākaṭajarā nāma.
Among these, aging in material phenomena (rūpadhamma), which is seen as brokenness in teeth and so forth, is called manifest aging (pākaṭajarā).
Trong đó, sự già trong các pháp sắc được gọi là sự già biểu lộ (pākaṭajarā) do có thể thấy được tình trạng rụng gãy v.v... ở răng v.v...
Arūpadhammesu pana jarā tādisassa vikārassa adassanato paṭicchannajarā nāma.
Aging in immaterial phenomena (arūpadhamma), however, is called hidden aging (paṭicchannajarā) because such changes are not seen.
Còn sự già trong các pháp vô sắc được gọi là sự già che giấu (paṭicchannajarā) do không thấy được sự biến đổi tương tự như vậy.
Tatra yvāyaṃ khaṇḍādibhāvo dissati, so tādisānaṃ dantādīnaṃ vaṇṇoyeva.
Here, the brokenness and so forth that is seen is merely the color of such teeth and so forth.
Ở đây, tình trạng rụng gãy v.v... có thể thấy được đó chính là màu sắc của răng v.v... tương tự.
Taṃ cakkhunā disvā manodvārena cintetvā ‘‘ime dantā jarāya pahaṭā’’ti jaraṃ jānāti, udakaṭṭhāne baddhāni gosiṅgādīni oloketvā heṭṭhā udakassa atthibhāvajānanaṃ viya.
Seeing that with the eye, one reflects through the mind-door and knows that "these teeth are afflicted by aging," just as one knows the presence of water below by observing cow-horns and other objects tied in a place with water.
Người ta thấy điều đó bằng mắt, suy nghĩ qua ý môn rồi biết được sự già bằng cách nghĩ rằng “những chiếc răng này đã bị sự già tấn công”, giống như việc biết có nước ở bên dưới sau khi nhìn thấy sừng bò v.v... được cắm ở nơi có nước.
Puna ayaṃ jarā savīci avīcīti evampi duvidhā hoti.
Furthermore, this aging is also twofold: with intervals (savīci) and without intervals (avīci).
Lại nữa, sự già này cũng có hai loại: có gián đoạn (savīci) và không gián đoạn (avīci).
Tattha maṇikanakarajatapavāḷacandasūriyādīnaṃ mandadasakādīsu pāṇīnaṃ viya, pupphaphalapallavādīsu apāṇīnaṃ viya ca antarantarā vaṇṇavisesādīnaṃ dubbiññeyyattā jarā avīcijarā nāma, nirantarajarāti attho.
Among these, aging is called aging without intervals (avīcijarā), meaning continuous aging, because the specific colors and so forth of gems, gold, silver, coral, moon, sun, etc., in their initial ten-day periods, etc., are difficult to discern, similar to that of living beings, and also similar to that of non-living things like flowers, fruits, and sprouts.
Trong đó, do khó nhận biết được sự khác biệt về màu sắc v.v... ở giữa, như sự già của các vật có sự sống trong các thập niên nhỏ v.v... của ngọc, vàng, bạc, san hô, mặt trăng, mặt trời v.v..., và như sự già của các vật không có sự sống trong hoa, quả, chồi non v.v..., nên sự già được gọi là sự già không gián đoạn (avīcijarā), có nghĩa là sự già liên tục.
Tato aññesu pana yathāvuttesu antarantarā vaṇṇavisesādīnaṃ suviññeyyattā jarā savīcijarā nāma.
However, in other cases, as stated, aging is called aging with intervals (savīcijarā) because the specific colors and so forth are easily discernible.
Còn ở những vật khác như đã nói, do dễ nhận biết được sự khác biệt về màu sắc v.v... ở giữa, nên sự già được gọi là sự già có gián đoạn (savīcijarā).
Tattha savīcijarā upādiṇṇakaanupādiṇṇakavasena evaṃ veditabbā – daharakumārakānañhi paṭhamameva khīradantā nāma uṭṭhahanti, na te thirā.
Among these, aging with intervals (savīcijarā) should be understood in terms of appropriated (upādiṇṇaka) and unappropriated (anupādiṇṇaka) forms, as follows: For young children, milk teeth first appear, but they are not firm.
Trong đó, sự già có gián đoạn cần được hiểu theo phương diện của vật được chấp thủ và vật không được chấp thủ như sau: Thật vậy, đối với các bé trai nhỏ, trước hết răng sữa mọc lên, chúng không bền chắc.
Tesu pana patitesu puna dantā uṭṭhahanti.
When these fall out, permanent teeth appear again.
Nhưng khi chúng rụng đi, răng lại mọc lên lần nữa.
Te paṭhamameva setā honti, jarāvātena pahaṭakāle kāḷakā honti.
These are initially white, but when struck by the wind of aging, they become black.
Ban đầu chúng có màu trắng, khi bị gió già tấn công thì chúng trở nên đen.
Kesā paṭhamameva tambā honti, tato kāḷakā, tato setā.
Hair is initially reddish, then black, then white.
Tóc ban đầu có màu hung, sau đó trở nên đen, rồi bạc trắng.
Chavi pana salohitikā hoti.
The skin is initially reddish.
Còn da thì có màu hồng hào.
Vaḍḍhantānaṃ vaḍḍhantānaṃ odātānaṃ odātabhāvo, kāḷakānaṃ kāḷakabhāvo paññāyati.
As people grow, the whiteness of fair-skinned people and the blackness of dark-skinned people become apparent.
Khi chúng lớn lên, lớn lên, những người da trắng thì có màu da trắng, những người da đen thì có màu da đen được nhận biết.
Jarāvātena pana pahaṭakāle valiṃ gaṇhāti.
But when struck by the wind of aging, it wrinkles.
Nhưng khi bị gió già thổi đến, da sẽ nổi nếp nhăn.
Sabbampi sassaṃ vapitakāle setaṃ hoti, pacchā nīlaṃ.
All crops are white when sown, then later green.
Tất cả các loại cây trồng khi gieo trồng đều có màu trắng, sau đó chuyển sang màu xanh.
Jarāvātena pana pahaṭakāle paṇḍukaṃ hoti.
But when struck by the wind of aging, they become yellowish.
Nhưng khi bị gió già thổi đến, chúng sẽ có màu vàng nhạt.
Ambaṅkurenāpi dīpetuṃ vaṭṭati.
It is also appropriate to illustrate with a mango sprout.
Cũng có thể minh họa bằng chồi xoài.
Maraṇaniddese cutīti cavanavasena vuttaṃ.
In the definition of death (maraṇa), " cutī" (falling away) is stated in the sense of shifting.
Trong phần giải thích về cái chết, cutī (chết) được nói đến theo nghĩa dịch chuyển.
Ekacatupañcakkhandhānaṃ sāmaññavacanametaṃ.
This is a general term for one, four, or five aggregates.
Đây là một từ chung cho một, bốn hoặc năm uẩn.
Cavanatāti bhāvavacanena lakkhaṇanidassanaṃ.
" Cavanatā" (the state of falling away) is the indication of the characteristic by the abstract noun.
Cavanatā (sự dịch chuyển) là sự biểu thị đặc tính bằng một từ trạng thái.
Bhedoti cutikhandhānaṃ bhaṅguppattiparidīpanaṃ.
" Bhedo" (breaking up) is the exposition of the occurrence of the dissolution of the aggregates of falling away.
Bhedo (sự tan rã) là sự biểu thị sự phát sinh và tan rã của các uẩn khi chết.
Antaradhānanti ghaṭassa viya bhinnassa bhinnānaṃ cutikhandhānaṃ yena kenaci pariyāyena ṭhānābhāvaparidīpanaṃ.
" Antaradhānaṃ" (disappearance) is the exposition of the non-existence of a place for the broken aggregates of falling away, in any manner, like a broken pot.
Antaradhānaṃ (sự biến mất) là sự biểu thị sự không còn tồn tại của các uẩn đã tan rã khi chết, giống như một cái bình bị vỡ, theo bất kỳ cách nào.
Maccu maraṇanti maccusaṅkhātaṃ maraṇaṃ, na khaṇikamaraṇaṃ.
" Maccu maraṇaṃ" (death, mortality) refers to death as mortality, not momentary death.
Maccu maraṇaṃ (cái chết của tử thần) là cái chết được gọi là tử thần, không phải là cái chết sát-na.
Kālo nāma antako, tassa kiriyāti kālakiriyā.
Kāla (time) is the ender; its action is " kālakiriyā" (doing of time).
Kāla (thời gian) là kẻ hủy diệt, hành động của nó là kālakiriyā (sự hành động của thời gian).
Ettāvatā ca sammutiyā maraṇaṃ dīpitaṃ.
By this much, conventional death is indicated.
Cho đến đây, cái chết đã được giải thích theo nghĩa quy ước.
Idāni paramatthena dīpetuṃ khandhānaṃ bhedotiādimāha.
Now, in order to explain by way of ultimate reality, he said, "the breaking up of the aggregates," and so on.
Bây giờ, để giải thích theo nghĩa tối hậu, Đức Phật nói khandhānaṃ bhedo (sự tan rã của các uẩn), v.v.
Paramatthena hi khandhāyeva bhijjanti, na satto nāma koci marati.
For, in the ultimate sense, only the aggregates break up; no being whatsoever dies.
Thật vậy, theo nghĩa tối hậu, chỉ có các uẩn tan rã, không có chúng sinh nào chết.
Khandhesu pana bhijjamānesu satto marati, bhinnesu matoti vohāro hoti.
But when the aggregates are breaking up, the being dies; when they are broken up, the designation "dead" arises.
Nhưng khi các uẩn tan rã, chúng sinh được nói là chết, và khi chúng đã tan rã, chúng sinh được nói là đã chết.
Ettha ca catuvokārapañcavokāravasena khandhānaṃ bhedo, ekavokāravasena kaḷevarassa nikkhepo, catuvokāravasena vā khandhānaṃ bhedo, sesadvayavasena kaḷevarassa nikkhepo veditabbo.
And here, the breaking up of the aggregates should be understood as occurring in the four-constituent and five-constituent existences; the casting off of the corpse as occurring in the one-constituent existence; or, the breaking up of the aggregates as occurring in the four-constituent existence, and the casting off of the corpse as occurring in the remaining two existences.
Ở đây, sự tan rã của các uẩn ( khandhānaṃ bhedo) được hiểu theo nghĩa tứ uẩn và ngũ uẩn, sự bỏ xác ( kaḷevarassa nikkhepo) được hiểu theo nghĩa nhất uẩn, hoặc sự tan rã của các uẩn theo nghĩa tứ uẩn, và sự bỏ xác theo nghĩa hai loại còn lại.
Bhavadvayepi rūpakāyasaṅkhātassa kaḷevarassa sambhavato.
Because the corpse, which is called the physical body, exists in both types of existence.
Vì xác thân (kaḷevara), tức là thân sắc, tồn tại trong cả hai cõi hữu (bhava).
Yasmā vā cātumahārājikādīsupi khandhā bhijjanteva, na kiñci nikkhipati, tasmā tesaṃ vasena khandhānaṃ bhedo, manussādīsu kaḷevarassa nikkhepo.
Or, since the aggregates break up even in the Cātumahārājika devas and so on, and nothing is cast off, therefore, in their case, it is the breaking up of the aggregates; in the case of humans and so on, it is the casting off of the corpse.
Hoặc vì ngay cả trong cõi Tứ Đại Thiên Vương (Cātumahārājika) và các cõi khác, các uẩn cũng tan rã chứ không có gì bị bỏ lại, nên sự tan rã của các uẩn là theo nghĩa các cõi đó, còn sự bỏ xác là theo nghĩa loài người, v.v.
Ettha ca kaḷevarassa nikkhepakaraṇato maraṇaṃ ‘‘kaḷevarassa nikkhepo’’ti vuttaṃ.
And here, death is called "the casting off of the corpse" because it involves the casting off of the corpse.
Ở đây, cái chết được gọi là “sự bỏ xác” ( kaḷevarassa nikkhepo) vì nó là hành động bỏ xác.
Apica imāni jātijarāmaraṇāni nāma imesaṃ sattānaṃ vadhakapaccāmittā viya otāraṃ gavesantāni vicaranti.
Furthermore, these birth, aging, and death move about like hostile enemies seeking an opportunity to harm these beings.
Hơn nữa, những sự sinh, già, chết này giống như những kẻ thù giết người của chúng sinh, chúng đi lang thang tìm kiếm cơ hội.
Yathā hi purisassa tīsu paccāmittesu otārāpekkhesu vicarantesu eko vadeyya ‘‘ahaṃ asukaaraññassa nāma vaṇṇaṃ kathetvā etaṃ ādāya tattha gamissāmi, ettha mayhaṃ dukkaraṃ natthī’’ti.
Just as, when three enemies are seeking an opportunity to harm a man, one might say: "I will praise the beauty of a certain forest, lead him there, and take him; there is nothing difficult for me in this."
Như khi có ba kẻ thù đang rình rập một người đàn ông để tìm cơ hội, một kẻ nói: "Ta sẽ ca ngợi vẻ đẹp của khu rừng kia, rồi dẫn hắn đến đó. Việc này đối với ta không khó."
Dutiyo vadeyya ‘‘ahaṃ tava etaṃ gahetvā gatakāle pothetvā dubbalaṃ karissāmi, ettha mayhaṃ dukkaraṃ natthī’’ti.
The second might say: "When you have taken him there, I will beat him and make him weak; there is nothing difficult for me in this."
Kẻ thứ hai nói: "Khi ngươi đã dẫn hắn đến đó, ta sẽ đánh đập hắn cho yếu ớt. Việc này đối với ta không khó."
Tatiyo vadeyya ‘‘tayā etasmiṃ pothetvā dubbale kate tiṇhena asinā sīsacchedanaṃ nāma mayhaṃ bhāro hotū’’ti te evaṃ vatvā tathā kareyyuṃ.
The third might say: "When he has been beaten and made weak by you, let the task of beheading him with a sharp sword be my responsibility." Having said this, they would do so.
Kẻ thứ ba nói: "Khi ngươi đã đánh đập hắn cho yếu ớt, việc chặt đầu hắn bằng thanh gươm sắc bén sẽ là phần của ta." Sau khi nói như vậy, chúng sẽ hành động như thế.
Tattha paṭhamapaccāmittassa araññavaṇṇaṃ kathetvā taṃ ādāya tattha gatakālo viya suhajjañātimaṇḍalato nikkaḍḍhitvā yattha katthaci nibbattāpanaṃ nāma jātiyā kiccaṃ, dutiyassa pothetvā dubbalakaraṇaṃ viya nibbattakkhandhesu nipatitvā parādhīnamañcaparāyaṇabhāvakaraṇaṃ jarāya kiccaṃ, tatiyassa tiṇhena asinā sīsacchedanaṃ viya jīvitakkhayapāpanaṃ maraṇassa kiccanti veditabbaṃ.
Here, the act of birth is like the first enemy praising the beauty of the forest, leading the man there, and taking him, which means pulling him away from the circle of well-wishing relatives and causing him to be reborn somewhere or other; the act of aging is like the second enemy beating him and making him weak, which means assailing the arisen aggregates and causing him to become dependent on others and destined for a bed; and the act of death is like the third enemy beheading him with a sharp sword, which means bringing about the cessation of life. This should be understood.
Ở đây, việc kẻ thù thứ nhất ca ngợi vẻ đẹp của khu rừng và dẫn người đàn ông đến đó, giống như việc tái sinh kéo chúng sinh ra khỏi vòng thân hữu và gia đình để tái sinh ở bất cứ đâu, đó là nhiệm vụ của sự sinh (jāti). Việc kẻ thù thứ hai đánh đập cho yếu ớt, giống như việc già nua (jarā) ập đến các uẩn đã sinh, khiến chúng trở nên lệ thuộc vào giường bệnh. Việc kẻ thù thứ ba chặt đầu bằng thanh gươm sắc bén, giống như việc cái chết (maraṇa) dẫn đến sự chấm dứt sinh mạng, cần phải hiểu như vậy.
Sokaniddese viyasatīti byasanaṃ, hitasukhaṃ khipati viddhaṃsetīti attho.
In the exposition of sorrow, "byasana" (calamity) means that which destroys, that which ruins beneficial happiness.
Trong phần giải thích về sầu (soka), byasanaṃ (tai họa) có nghĩa là làm tan biến, phá hủy sự lợi ích và hạnh phúc.
Ñātīnaṃ byasanaṃ ñātibyasanaṃ, corarogabhayādīhi ñātikkhayo ñātivināsoti attho.
The calamity of relatives is ñātibyasanaṃ, meaning the destruction or ruin of relatives due to dangers from thieves, diseases, and so on.
Tai họa của thân quyến là ñātibyasanaṃ, nghĩa là sự tiêu diệt thân quyến do trộm cướp, bệnh tật, sợ hãi, v.v.
Tena ñātibyasanena.
By that calamity of relatives.
Do đó, ñātibyasanena (do tai họa của thân quyến).
Phuṭṭhassāti ajjhotthaṭassa abhibhūtassa, samannāgatassāti attho.
Phuṭṭhassa means overwhelmed, overcome, that is, endowed with.
Phuṭṭhassā (người bị chạm đến) có nghĩa là người bị áp đảo, bị chế ngự, tức là người bị vây hãm.
Sesesupi eseva nayo.
The same method applies to the remaining ones.
Trong các trường hợp còn lại cũng vậy.
Ayaṃ pana viseso – bhogānaṃ byasanaṃ bhogabyasanaṃ, rājacorādivasena bhogakkhayo bhogavināsoti attho.
This, however, is the distinction: the calamity of possessions is bhogabyasanaṃ, meaning the loss or ruin of possessions due to kings, thieves, and so on.
Tuy nhiên, có một điểm khác biệt: tai họa về tài sản là bhogabyasanaṃ, nghĩa là sự tiêu tán tài sản do vua chúa, trộm cướp, v.v.
Rogoyeva byasanaṃ rogabyasanaṃ.
Disease itself is calamity, rogabyasanaṃ.
Bệnh tật chính là tai họa, rogabyasanaṃ.
Rogo hi ārogyaṃ viyasati vināsetīti byasanaṃ.
For disease destroys and ruins health, hence it is calamity.
Bệnh tật phá hủy sức khỏe, nên nó là tai họa.
Sīlassa byasanaṃ sīlabyasanaṃ.
The calamity of morality is sīlabyasanaṃ.
Tai họa về giới là sīlabyasanaṃ.
Dussīlyassetaṃ nāmaṃ.
This is a name for immorality.
Đây là tên gọi của sự ác giới.
Sammādiṭṭhiṃ vināsayamānā uppannā diṭṭhi eva byasanaṃ diṭṭhibyasanaṃ.
Wrong view itself, having arisen by destroying right view, is calamity, diṭṭhibyasanaṃ.
Tà kiến phát sinh làm hủy hoại Chánh kiến chính là tai họa, diṭṭhibyasanaṃ.
Ettha ca purimāni dve anipphannāni, pacchimāni tīṇi nipphannāni tilakkhaṇabbhāhatāni.
Here, the first two are not produced (by kamma), while the latter three are produced (by kamma) and are affected by the three characteristics.
Trong số này, hai loại đầu tiên không phải là kết quả (anipphanna), ba loại sau là kết quả (nipphanna) và bị ảnh hưởng bởi ba đặc tính (tilakkhaṇa).
Purimāni ca tīṇi neva kusalāni na akusalāni, sīladiṭṭhibyasanadvayaṃ akusalaṃ.
And the first three are neither wholesome nor unwholesome, while the two calamities of morality and view are unwholesome.
Ba loại đầu tiên không phải là thiện cũng không phải là bất thiện, còn hai loại tai họa về giới và kiến là bất thiện.
Aññataraññatarenāti gahitesu vā yena kenaci aggahitesu vā mittāmaccabyasanādīsu yena kenaci.
Aññataraññatarena means by any one of the three calamities already mentioned, or by any one of those not mentioned, such as the calamity of friends or ministers.
Aññataraññatarenā (bởi bất kỳ cái nào khác) có nghĩa là bởi bất kỳ tai họa nào trong số những tai họa đã được đề cập, hoặc bởi bất kỳ tai họa nào trong số những tai họa chưa được đề cập như tai họa của bạn bè, người thân, v.v.
Samannāgatassāti samanubandhassa aparimuccamānassa.
Samannāgatassa means of one who is followed by, who cannot escape.
Samannāgatassā (người bị vây hãm) có nghĩa là người bị ràng buộc, không thể thoát khỏi.
Aññataraññatarena dukkhadhammenāti yena kenaci sokadukkhassa uppattihetunā.
By any one of various painful conditions means by any cause whatsoever for the arising of the suffering of sorrow.
Aññataraññatarena dukkhadhammenā (bởi bất kỳ pháp khổ nào khác) có nghĩa là bởi bất kỳ nguyên nhân nào gây ra khổ sầu.
Sokoti socanakavasena soko.
Sorrow (soko) means sorrow by way of grieving.
Soko (sầu) là sầu do trạng thái sầu muộn.
Idaṃ tehi kāraṇehi uppajjanakasokassa sabhāvapaccattaṃ.
This (term soka) is the intrinsic meaning of sorrow that arises due to those causes (such as loss of relatives).
Đây là bản chất của sầu phát sinh từ những nguyên nhân đó.
Socanāti socanākāro.
Grieving (socanā) means the manner of grieving.
Socanā (sự sầu muộn) là trạng thái sầu muộn.
Socitattanti socitabhāvo.
The state of having grieved (socitattaṃ) means the state of having grieved.
Socitattaṃ (trạng thái sầu muộn) là trạng thái sầu muộn.
Antosokoti abbhantarasoko.
Inner sorrow (antosoko) means internal sorrow.
Antosoko (nội sầu) là sầu bên trong.
Dutiyapadaṃ upasaggena vaḍḍhitaṃ.
The second term is expanded by the prefix.
Từ thứ hai được thêm tiền tố.
So hi abbhantaraṃ sukkhāpento viya parisukkhāpento viya uppajjatīti ‘‘antosoko antoparisoko’’ti vuccati.
For that sorrow arises as if drying up the mind, as if drying it up completely, hence it is called "inner sorrow, inner pervasive sorrow."
Nó được gọi là "nội sầu, nội biệt sầu" (antosoko antoparisoko) vì nó phát sinh như thể làm khô héo, làm khô kiệt tâm trí từ bên trong.
Cetaso parijjhāyanāti cittassa parijjhāyanākāro.
Mental burning (cetaso parijjhāyanā) means the mind's manner of burning up.
Cetaso parijjhāyanā (sự thiêu đốt của tâm) là trạng thái thiêu đốt của tâm.
Soko hi uppajjamāno aggi viya cittaṃ jhāpeti dahati, ‘‘cittaṃ me jhāmaṃ, na me kiñci paṭibhātī’’ti vadāpeti.
For when sorrow arises, it burns and consumes the mind like fire, making one say, "My mind is burnt, nothing appears to me."
Khi sầu phát sinh, nó thiêu đốt, đốt cháy tâm như lửa, khiến người ta nói: "Tâm tôi bị thiêu đốt, tôi không nghĩ ra được điều gì."
Dukkhito mano dummano, tassa bhāvo domanassaṃ.
A mind afflicted by suffering is a distressed mind (dummano); its state is distress (domanassaṃ).
Tâm bị khổ là tâm đau khổ (dummano), trạng thái đó là domanassaṃ (ưu khổ).
Anupaviṭṭhaṭṭhena sokova sallanti sokasallaṃ.
Sorrow itself is a dart, by reason of its penetrating deeply, hence the dart of sorrow (sokasallaṃ).
Sầu chính là mũi tên (salla) vì nó đâm sâu vào bên trong, nên gọi là sokasallaṃ (mũi tên sầu).
Paridevaniddese ‘‘mayhaṃ dhītā, mayhaṃ putto’’ti evaṃ ādissa ādissa devanti rodanti etenāti ādevo.
In the explanation of lamentation, wailing (ādevo) means that by which they lament and weep, pointing out "my daughter, my son," and so on.
Trong phần giải thích về than khóc (parideva), ādevo (than vãn) là do người ta than khóc, kêu la bằng cách chỉ ra từng điều như "con gái của tôi, con trai của tôi".
Taṃ taṃ vaṇṇaṃ parikittetvā parikittetvā devanti etenāti paridevo.
Lamentation (paridevo) means that by which they lament, repeatedly extolling this and that quality.
Paridevo (than khóc) là do người ta than khóc bằng cách lặp đi lặp lại những lời ca ngợi phẩm chất đó.
Tato parāni dve dve padāni purimadvayasseva ākārabhāvaniddesavasena vuttāni.
The subsequent two pairs of terms are stated by way of indicating the manner and state of the preceding two.
Hai từ tiếp theo được nói đến theo nghĩa biểu thị trạng thái và bản chất của hai từ trước đó.
Vācāti vacanaṃ.
Speech (vācā) means speaking.
Vācā (lời nói) là sự nói.
Palāpoti tucchaṃ niratthakavacanaṃ.
Babbling (palāpo) means empty, meaningless speech.
Palāpo (lời nói vô ích) là lời nói trống rỗng, vô nghĩa.
Upaḍḍhabhaṇitaaññabhaṇitādivasena virūpo palāpoti vippalāpo.
Babbling that is distorted by way of half-spoken or otherwise spoken words is incoherent babbling (vippalāpo).
Vippalāpo (lời nói lảm nhảm) là lời nói vô ích bị biến dạng do nói nửa vời, nói lạc đề, v.v.
Lālappoti punappunaṃ lapanaṃ.
Wailing (lālappo) means repeated speaking.
Lālappo (sự lặp đi lặp lại) là sự nói lặp đi lặp lại.
Lālappanākāro lālappanā.
The manner of wailing is lālappanā.
Trạng thái nói lặp đi lặp lại là lālappanā.
Lālappitassa bhāvo lālappitattaṃ.
The state of having wailed is lālappitattaṃ.
Trạng thái của người nói lặp đi lặp lại là lālappitattaṃ.
Dukkhaniddese kāyanissitattā kāyikaṃ.
In the explanation of suffering, bodily (kāyikaṃ) is due to its reliance on the body.
Trong phần giải thích về khổ (dukkha), kāyikaṃ (thuộc về thân) là do nó nương tựa vào thân.
Amadhuraṭṭhena asātaṃ.
Unpleasant (asātaṃ) is by reason of its being disagreeable.
Asātaṃ (không đáng ưa) là do nó không ngọt ngào.
Kāyikapadena cetasikaasātaṃ paṭikkhipati, asātapadena kāyikasātaṃ.
The term kāyika excludes mental unpleasantness, and the term asāta excludes bodily pleasantness.
Từ "kāyika" bác bỏ sự không đáng ưa thuộc về tâm (cetasika asātaṃ), và từ "asāta" bác bỏ sự đáng ưa thuộc về thân (kāyika sātaṃ).
Tadeva dukkhayatīti dukkhaṃ, yassuppajjati, taṃ dukkhitaṃ karotīti attho.
That itself causes suffering, hence suffering (dukkhaṃ); the meaning is that it makes one who experiences it suffer.
Chính nó làm cho khổ, nên gọi là dukkhaṃ, nghĩa là nó làm cho người mà nó phát sinh trở nên đau khổ.
Dukkhamattā vā dukkhaṃ.
Or suffering is due to its being difficult to endure.
Hoặc khổ là do nó khó chịu đựng (dukkhamattā).
Kāyasamphassajanti kāyasamphasse jātaṃ.
Arising from bodily contact (kāyasamphassajaṃ) means born from bodily contact.
Do xúc chạm thân có nghĩa là phát sinh từ xúc chạm thân.
Asātaṃ dukkhaṃ vedayitanti asātaṃ vedayitaṃ na sātaṃ, dukkhaṃ vedayitaṃ na sukhaṃ.
Unpleasant, painful feeling (asātaṃ dukkhaṃ vedayitaṃ) means that unpleasant feeling is not pleasant, and painful feeling is not happiness.
Cảm thọ khổ không thích ý có nghĩa là cảm thọ không thích ý không phải là thích ý, cảm thọ khổ không phải là lạc.
Parato tīṇi padāni itthiliṅgavasena vuttāni.
The three subsequent terms are stated in the feminine gender.
Ba từ tiếp theo được nói theo giống cái.
Asātā vedanā na sātā, dukkhā vedanā na sukhāti ayameva panettha attho.
Here, the meaning is simply that unpleasant feeling is not pleasant, and painful feeling is not happiness.
Ở đây, ý nghĩa là: cảm thọ không thích ý không phải là thích ý, cảm thọ khổ không phải là lạc.
Yaṃ kāyikaṃ asātaṃ dukkhaṃ vedayitaṃ, yā kāyasamphassajā asātā dukkhā vedanā, idaṃ vuccati dukkhanti evaṃ yojanā veditabbā.
The connection should be understood thus: "That which is bodily unpleasant, painful feeling, that which is unpleasant, painful feeling born of bodily contact, this is called suffering."
Cần phải hiểu cách kết nối như sau: Cái gì là cảm thọ khổ không thích ý thuộc về thân, cái gì là cảm thọ khổ không thích ý phát sinh do xúc chạm thân, cái đó được gọi là khổ.
Appiyasampayoganiddese idhāti imasmiṃ loke.
In the explanation of association with the disliked, here (idhā) means in this world.
Trong phần giải thích về Appiyasampayoga (hội ngộ với điều không ưa thích), idha (ở đây) có nghĩa là trong thế giới này.
Yassāti ye assa.
Whose (yassā) is ye assa (which belong to him).
Yassā có nghĩa là "mà của người ấy".
Aniṭṭhāti apariyesitā.
Undesirable (aniṭṭhā) means not sought after.
Aniṭṭhā có nghĩa là những điều không được mong cầu.
Pariyesitā vā hontu apariyesitā vā, nāmamevetaṃ amanāpārammaṇānaṃ.
Whether sought after or not sought after, this is simply a name for disagreeable objects.
Dù là được mong cầu hay không được mong cầu, đây chỉ là tên gọi của những đối tượng không vừa ý.
Manasmiṃ na kamanti na pavisantīti akantā.
They do not enter, do not penetrate the mind, hence disagreeable (akantā).
Akantā (không đáng yêu) là những điều không đi vào, không xâm nhập vào tâm.
Manasmiṃ na appiyanti, na vā manaṃ vaḍḍhentīti amanāpā.
They are not dear to the mind, or they do not increase the mind, hence unpleasant (amanāpā).
Amanāpā (không vừa ý) là những điều không được yêu thích trong tâm, hoặc không làm cho tâm tăng trưởng.
Rūpātiādi tesaṃ sabhāvanidassanaṃ.
Forms (rūpā) and so on are an indication of their nature.
Rūpā (sắc) v.v. là sự chỉ rõ bản chất của chúng.
Anatthaṃ kāmenti icchantīti anatthakāmā.
They wish for what is not beneficial, hence those who wish for harm (anatthakāmā).
Anatthakāmā (mong muốn điều bất lợi) là những người mong muốn, khao khát điều bất lợi.
Ahitaṃ kāmenti icchantīti ahitakāmā.
They wish for what is unwholesome, hence those who wish for disadvantage (ahitakāmā).
Ahitakāmā (mong muốn điều không có lợi) là những người mong muốn, khao khát điều không có lợi.
Aphāsuṃ dukkhavihāraṃ kāmenti icchantīti aphāsukāmā.
They wish for an uncomfortable, painful abiding, hence those who wish for discomfort (aphāsukāmā).
Aphāsukāmā (mong muốn sự không an ổn) là những người mong muốn, khao khát sự không an ổn, sự sống trong khổ đau.
Catūhi yogehi khemaṃ nibbhayaṃ vivaṭṭaṃ na kāmenti, sabhayaṃ vaṭṭameva nesaṃ kāmenti icchantīti ayogakkhemakāmā.
They do not wish for safety, fearlessness, liberation from the four yogas; they wish for rebirth, which is full of fear, hence those who wish for what is not safe from bondage (ayogakkhemakāmā).
Ayogakkhemakāmā (mong muốn sự không an toàn khỏi ách buộc) là những người không mong muốn sự an toàn, không sợ hãi, không thoát khỏi bốn ách buộc (yoga), mà chỉ mong muốn sự luân hồi đầy sợ hãi cho chúng.
Apica saddhādīnaṃ vuddhisaṅkhātassa atthassa akāmanato, tesaṃyeva hānisaṅkhātassa anatthassa ca kāmanato anatthakāmā.
Furthermore, because they do not wish for the benefit consisting of the growth of faith and so on, and because they wish for the harm consisting of the decline of these very things, they are anatthakāmā.
Hơn nữa, anatthakāmā (mong muốn điều bất lợi) là do không mong muốn lợi ích được gọi là sự tăng trưởng của niềm tin v.v., và do mong muốn điều bất lợi được gọi là sự suy giảm của chúng.
Saddhādīnaṃyeva upāyabhūtassa hitassa akāmanato, saddhāhāniādīnaṃ upāyabhūtassa ahitassa ca kāmanato ahitakāmā.
Because they do not wish for the wholesome, which is the means to faith and so on, and because they wish for the unwholesome, which is the means to the decline of faith and so on, they are ahitakāmā.
Ahitakāmā (mong muốn điều không có lợi) là do không mong muốn lợi ích là phương tiện của niềm tin v.v., và do mong muốn điều bất lợi là phương tiện của sự suy giảm niềm tin v.v.
Phāsuvihārassa akāmanato, aphāsuvihārassa ca kāmanato aphāsukāmā.
Because they do not wish for comfortable abiding, and because they wish for uncomfortable abiding, they are aphāsukāmā.
Aphāsukāmā (mong muốn sự không an ổn) là do không mong muốn sự sống an ổn, và do mong muốn sự sống không an ổn.
Yassa kassaci nibbhayassa akāmanato, bhayassa ca kāmanato ayogakkhemakāmāti evamettha attho daṭṭhabbo.
From not desiring freedom from danger, and from desiring danger, the meaning here should be understood as ayogakkhemakāmā (those who desire what is not safe/secure).
Ở đây, ý nghĩa là: ayogakkhemakāmā (mong muốn sự không an toàn khỏi ách buộc) là do không mong muốn sự không sợ hãi của bất cứ ai, và do mong muốn sự sợ hãi.
Saṅgatīti gantvā saṃyogo.
Saṅgati means going and joining.
Saṅgatī (hội ngộ) có nghĩa là đi đến và kết hợp.
Samāgamoti āgatehi saṃyogo.
Samāgama means joining with those who have arrived.
Samāgamo (tụ hội) có nghĩa là kết hợp với những người đã đến.
Samodhānanti ṭhānanisajjādīsu sahabhāvo.
Samodhāna means being together in standing, sitting, and so forth.
Samodhānaṃ (cùng nhau) có nghĩa là cùng hiện diện trong các tư thế đứng, ngồi, v.v.
Missībhāvoti sabbakiccānaṃ sahakaraṇaṃ.
Missībhāva means performing all tasks together.
Missībhāvo (sự hòa lẫn) có nghĩa là cùng thực hiện mọi công việc.
Ayaṃ sattavasena yojanā.
This is an explanation in terms of sentient beings.
Đây là cách kết nối theo nghĩa chúng sinh.
Saṅkhāravasena pana yaṃ labbhati, taṃ gahetabbaṃ.
However, what is obtained in terms of conditioned phenomena (saṅkhāra) should be taken.
Tuy nhiên, cái gì được hiểu theo nghĩa các hành (saṅkhāra) thì nên lấy cái đó.
So pana appiyasampayogo atthato eko dhammo nāma natthi, kevalaṃ appiyasampayuttānaṃ duvidhassāpi dukkhassa vatthubhāvato dukkhoti vutto.
But that association with the disagreeable is not, in essence, a single phenomenon; it is merely called suffering because it is the basis for both kinds of suffering (physical and mental) for those associated with the disagreeable.
Nhưng sự hội ngộ với điều không ưa thích (appiyasampayoga) này, về bản chất, không phải là một pháp duy nhất; nó chỉ được gọi là khổ vì nó là cơ sở cho cả hai loại khổ phát sinh ở những người hội ngộ với điều không ưa thích.
Piyavippayoganiddeso vuttapaṭipakkhanayena veditabbo.
The explanation of separation from the agreeable should be understood by the opposite method of what has been stated.
Phần giải thích về Piyavippayoga (xa lìa điều ưa thích) nên được hiểu theo cách ngược lại với những gì đã nói.
Mātā vātiādi panettha atthakāme sarūpena dassetuṃ vuttaṃ.
Here, mother or and so forth is stated to show those who desire welfare in their true form.
Ở đây, Mātā vā (mẹ hay) v.v. được nói ra để chỉ rõ những người mong muốn lợi ích (atthakāma) theo bản chất của họ.
Tattha mamāyatīti mātā, piyāyatīti pitā.
Among them, she who cherishes is mother; he who loves is father.
Trong đó, người yêu thương là mātā (mẹ); người yêu quý là pitā (cha).
Bhajatīti bhātā, tathā bhaginī.
He who attends is brother; likewise, sister.
Người phụng sự là bhātā (anh/em), tương tự là bhaginī (chị/em gái).
Mettāyantīti mittā, minanti vā sabbaguyhesu anto pakkhipantīti mittā.
They who are friendly are friends; or, they who measure (minanti) by placing all secrets within are friends.
Những người có lòng từ là mittā (bạn bè), hoặc những người giữ kín mọi bí mật trong lòng là mittā.
Kiccakaraṇīyesu sahabhāvaṭṭhena amā hontīti amaccā.
They who are together by virtue of being involved in duties and tasks are ministers (amaccā).
Amaccā (bạn bè thân thiết, quan chức) là những người cùng chung sống trong các công việc cần làm.
‘‘Ayaṃ amhākaṃ ajjhattiko’’ti evaṃ jānanti, ñāyantīti vā ñātī.
They know, "This one is our own," or they are known (ñāyanti); hence they are relatives (ñātī).
Những người biết rằng "người này là người thân của chúng ta", hoặc được biết đến, là ñātī (thân quyến).
Lohitena sambandhāti sālohitā.
They who are connected by blood are blood-relatives (sālohitā).
Sālohitā (bà con huyết thống) là những người có quan hệ huyết thống.
Pitupakkhikā ñātī, mātupakkhikā sālohitā.
Relatives are those on the father's side; blood-relatives are those on the mother's side.
Ñātī là thân quyến bên cha, sālohitā là bà con bên mẹ.
Mātāpitupakkhikā vā ñātī, sassusasurapakkhikā sālohitā.
Or, relatives are those on the mother's and father's side; blood-relatives are those on the side of the mother-in-law and father-in-law.
Hoặc ñātī là thân quyến bên cha mẹ, sālohitā là bà con bên nhà chồng/vợ.
Ayampi piyavippayogo atthato eko dhammo nāma natthi, kevalaṃ piyavippayuttānaṃ duvidhassāpi dukkhassa vatthubhāvato dukkhoti vutto.
This separation from the agreeable is also not, in essence, a single phenomenon; it is merely called suffering because it is the basis for both kinds of suffering for those separated from the agreeable.
Sự xa lìa điều ưa thích (piyavippayoga) này cũng không phải là một pháp duy nhất về bản chất; nó chỉ được gọi là khổ vì nó là cơ sở cho cả hai loại khổ phát sinh ở những người xa lìa điều ưa thích.
Idamettha sabbaaṭṭhakathāvacanaṃ.
This is the statement of all the commentaries here.
Đây là toàn bộ lời giải thích của các chú giải (aṭṭhakathā) về vấn đề này.
Saccānaṃ pana tathalakkhaṇattā sampayogavippayogavacanehi appiyapiyavatthūniyeva visesitānīti vattuṃ yujjatīti.
However, since the Noble Truths have their true characteristics, it is proper to say that only disagreeable and agreeable objects are distinguished by the terms "association" and "separation."
Tuy nhiên, vì các chân lý có đặc tính chân thật, nên có thể nói rằng các từ "hội ngộ" và "xa lìa" chỉ đặc trưng cho những đối tượng không ưa thích và ưa thích.
Icchitālābhaniddese jātidhammānanti jātisabhāvānaṃ jātipakatikānaṃ.
In the explanation of not obtaining what is desired, jātidhammānaṃ means those whose nature is birth, those whose characteristic is birth.
Trong phần giải thích về Icchitālābha (không đạt được điều mong muốn), jātidhammānaṃ (những người có bản chất sinh) có nghĩa là những người có bản chất sinh, có tính chất sinh.
Icchā uppajjatīti taṇhā uppajjati.
Desire arises means craving arises.
Icchā uppajjatī (mong muốn phát sinh) có nghĩa là tham ái (taṇhā) phát sinh.
Aho vatāti patthanā.
Aho vata is a wish.
Aho vatā là lời ước nguyện.
Assāmāti bhaveyyāma.
Assāma means "may we be."
Assāmā có nghĩa là "chúng ta sẽ là".
Na kho panetaṃ icchāya pattabbanti yaṃ etaṃ ‘‘aho vata mayaṃ na jātidhammā assāma, na ca vata no jāti āgaccheyyā’’ti evaṃ pahīnasamudayesu sādhūsu vijjamānaṃ ajātidhammattaṃ parinibbutesu ca vijjamānaṃ jātiyā anāgamanaṃ icchitaṃ, taṃ icchantassāpi maggabhāvanāya vinā appattabbato, anicchantassāpi ca bhāvanāya pattabbato na icchāya pattabbaṃ nāma hoti.
But this is not to be attained by wishing means that which is desired—namely, the state of not having the nature of birth, which exists in noble ones who have abandoned the origin (of suffering), and the non-occurrence of birth, which exists in those who have attained Nibbāna—even for one who wishes for it, it is not to be attained without the development of the path; and for one who does not wish for it, it is to be attained through development. Hence, it is not something to be attained by wishing.
Na kho panetaṃ icchāya pattabbaṃ có nghĩa là: cái được mong muốn, "ước gì chúng ta không có bản chất sinh, ước gì sự sinh không đến với chúng ta", tức là trạng thái không có bản chất sinh hiện hữu ở những bậc thánh đã đoạn trừ tập khởi, và sự không đến của sự sinh hiện hữu ở những bậc đã nhập Niết Bàn; điều đó, dù người ta có mong muốn đi chăng nữa, cũng không thể đạt được nếu không tu tập con đường (đạo), và dù không mong muốn đi chăng nữa, cũng có thể đạt được bằng cách tu tập; vì vậy, nó không phải là điều có thể đạt được bằng mong muốn.
Idampīti etampi.
This too means this as well.
Idampī (điều này cũng vậy) có nghĩa là điều này cũng vậy.
Upari sesāni upādāya apisaddo.
The word api (also) is used with reference to the remaining (items) above.
Từ api (cũng) được thêm vào để bao gồm các điều còn lại ở trên.
34. Samudayasaccaniddese yāyaṃ taṇhāti yā ayaṃ taṇhā.
34. In the explanation of the Noble Truth of the Origin of Suffering, yāyaṃ taṇhā means "whatever craving this is."
34. Trong phần giải thích về Tập Đế, yāyaṃ taṇhā có nghĩa là yā ayaṃ taṇhā (tham ái này).
Ponobhavikāti punabbhavakaraṇaṃ punobhavo, punobhavo sīlamassāti ponobhavikā.
Ponobhavikā means "that which causes renewed existence," because renewed existence is punobhava, and its characteristic is renewed existence.
Ponobhavikā (dẫn đến tái sinh) có nghĩa là punabbhavakaraṇaṃ (việc tạo ra sự tái sinh) là punobhavo (tái sinh); ponobhavikā là vì nó có bản chất tái sinh.
Apica punabbhavaṃ deti, punabbhavāya saṃvattati, punappunaṃ bhave nibbattetīti ponobhavikā.
Furthermore, it gives renewed existence, it leads to renewed existence, it causes existence to arise again and again; hence, it is ponobhavikā.
Hơn nữa, nó là ponobhavikā vì nó ban tặng sự tái sinh, nó dẫn đến sự tái sinh, nó liên tục tạo ra sự hiện hữu.
Sā panesā punabbhavassa dāyikāpi atthi adāyikāpi, punabbhavāya saṃvattanikāpi atthi asaṃvattanikāpi, dinnāya paṭisandhiyā upadhivepakkamattāpi.
And this craving may be either a giver of renewed existence or not a giver; it may lead to renewed existence or not lead to it; it may also be merely a condition for the maturation of results in the form of rebirth-linking.
Tuy nhiên, tham ái này có thể là cái ban tặng sự tái sinh hoặc không ban tặng, có thể là cái dẫn đến sự tái sinh hoặc không dẫn đến, và có thể là cái chỉ làm cho các thành phần của sự hiện hữu (upadhi) chín muồi sau khi đã có sự tái sinh.
Sā tippakārāpi ponobhavikāti nāmaṃ labhati.
This craving, even when it is of three kinds, receives the name ponobhavikā.
Tham ái, dù thuộc ba loại này, đều được gọi là ponobhavikā.
Ponabbhavikātipi pāṭho, soyevattho.
The reading is also ponabbhavikā; the meaning is the same.
Cũng có cách đọc ponabbhavikā, ý nghĩa vẫn như vậy.
Abhinandanasaṅkhātena nandirāgena saha gatāti nandirāgasahagatā.
It is accompanied by the delight-passion (nandirāga) in the sense of delighting; hence, nandirāgasahagatā.
Nandirāgasahagatā (đi kèm với tham ái hoan hỷ) có nghĩa là đi kèm với tham ái hoan hỷ, tức là sự hoan hỷ.
Nandirāgena saddhiṃ atthato ekattameva gatāti vuttaṃ hoti.
It means that it is, in essence, one with delight-passion.
Có nghĩa là, về bản chất, nó đã đạt đến sự đồng nhất với tham ái hoan hỷ.
Tatra tatrābhinandinīti yatra yatra attabhāvo nibbattati, tatra tatra abhinandinī.
Tatra tatrābhinandinī means delighting wherever a self-existence (attabhāva) arises.
Tatra tatrābhinandinī (hoan hỷ ở mọi nơi) có nghĩa là hoan hỷ ở bất cứ nơi nào mà sự hiện hữu (attabhāva) phát sinh.
Rūpādīsu vā ārammaṇesu tatra tatrābhinandinī, rūpābhinandinī saddagandharasaphoṭṭhabbadhammābhinandinīti attho.
Or, delighting in various objects such as forms; that is, delighting in forms, delighting in sounds, smells, tastes, tangibles, and mental phenomena.
Hoặc hoan hỷ ở mọi đối tượng như sắc v.v., tức là hoan hỷ với sắc, hoan hỷ với âm thanh, mùi hương, vị, xúc chạm và pháp.
Tatra tatrābhinandītipi pāṭho, tatra tatra abhinandayatīti attho.
The reading is also tatra tatrābhinandī; its meaning is "causing delight in various places."
Cũng có cách đọc tatra tatrābhinandī, có nghĩa là làm cho hoan hỷ ở mọi nơi.
Seyyathidanti nipāto, tassa sā katamā iti ceti attho.
Seyyathidaṃ is an indeclinable particle, and its meaning is "which craving is that?"
Seyyathidaṃ là một từ ngữ, có nghĩa là "tham ái đó là gì?".
Kāmataṇhāti kāme taṇhā, pañcakāmaguṇikarāgassetaṃ adhivacanaṃ.
Kāmataṇhā means craving for sensuality; this is a term for the lust (rāga) for the five sense objects.
Kāmataṇhā (dục ái) là tham ái đối với dục lạc; đây là tên gọi của tham ái liên quan đến năm đối tượng dục lạc.
Bhavataṇhāti bhave taṇhā.
Bhavataṇhā means craving for existence.
Bhavataṇhā (hữu ái) là tham ái đối với sự hiện hữu.
Bhavapatthanāvasena uppannassa sassatadiṭṭhisahagatassa rāgassa rūpārūpabhavarāgassa ca jhānanikantiyā ca etaṃ adhivacanaṃ.
This is a term for the lust (rāga) that arises due to the aspiration for existence, accompanied by the eternalist view (sassatadiṭṭhi), and also for the lust for material and immaterial existence (rūpārūpabhava-rāga), and for delight in jhāna.
Đây là tên gọi của tham ái phát sinh do mong muốn sự hiện hữu, của tham ái đi kèm với tà kiến thường còn, của tham ái đối với các cõi sắc và vô sắc, và của sự dính mắc vào thiền định.
Vibhavataṇhāti vibhave taṇhā.
Vibhavataṇhā means craving for non-existence.
Vibhavataṇhā (phi hữu ái) là tham ái đối với sự không hiện hữu.
Ucchedadiṭṭhisahagatarāgassetaṃ adhivacanaṃ.
This is a term for the lust (rāga) accompanied by the annihilationist view (ucchedadiṭṭhi).
Đây là tên gọi của tham ái đi kèm với tà kiến đoạn diệt.
Idāni tassā taṇhāya vatthuṃ vitthārato dassetuṃ sā kho panesātiādimāha.
Now, to extensively explain the basis of that craving, he states, “sā kho panesa” (That craving, indeed, this…).
Bây giờ, để trình bày chi tiết cơ sở của tham ái đó, Ngài nói sā kho panesā (tham ái đó).
Tattha uppajjatīti jāyati.
Therein, “uppajjati” means arises.
Trong đó, uppajjatī (phát sinh) có nghĩa là sinh khởi.
Nivisatīti punappunaṃ pavattivasena patiṭṭhāti.
“Nivisati” means becomes established by repeatedly occurring.
Nivisati có nghĩa là được thiết lập do sự diễn tiến lặp đi lặp lại.
Uppajjamānā kattha uppajjati, nivisamānā kattha nivisatīti sambandho.
The connection is: where does it arise when it arises? Where does it become established when it becomes established?
Khi sanh khởi, nó sanh khởi ở đâu; khi an trú, nó an trú ở đâu, đây là sự liên kết.
Yaṃ loke piyarūpaṃ sātarūpanti yaṃ lokasmiṃ piyasabhāvañceva madhurasabhāvañca.
“Yaṃ loke piyarūpaṃ sātarūpaṃ” means whatever is lovely and delightful in the world.
Thứ gì trong đời là sắc khả ái, sắc khả hỷ có nghĩa là bất cứ thứ gì trong thế gian có bản chất đáng yêu và bản chất ngọt ngào.
Cakkhu loketiādīsu lokasmiñhi cakkhuādīsu mamattena abhiniviṭṭhā sattā sampattiyaṃ patiṭṭhitā attano cakkhuṃ ādāsādīsu nimittaggahaṇānusārena vippasannaṃ pañcapasādaṃ suvaṇṇavimāne ugghāṭitamaṇisīhapañjaraṃ viya maññanti, sotaṃ rajatapanāḷikaṃ viya pāmaṅgasuttakaṃ viya ca maññanti, tuṅganāsāti laddhavohāraṃ ghānaṃ vaṭṭetvā ṭhapitaharitālavaṭṭiṃ viya maññanti, jivhaṃ rattakambalapaṭalaṃ viya mudusiniddhamadhurarasadaṃ maññanti, kāyaṃ sālalaṭṭhiṃ viya suvaṇṇatoraṇaṃ viya ca maññanti, manaṃ aññesaṃ manena asadisaṃ uḷāraṃ maññanti, rūpaṃ suvaṇṇakaṇikārapupphādivaṇṇaṃ viya, saddaṃ mattakaravīkakokilamandadhamitamaṇivaṃsanigghosaṃ viya, attanā paṭiladdhāni catusamuṭṭhānikagandhārammaṇādīni ‘‘kassaññassa evarūpāni atthī’’ti maññanti, tesaṃ evaṃ maññamānānaṃ tāni cakkhādīni piyarūpāni ceva sātarūpāni ca honti.
Regarding “cakkhu loke” and so on: indeed, beings who are attached to the eye and so forth in the world with a sense of possessiveness, and who are established in prosperity, consider their own eye—the fivefold sensitive matter (pañcapasāda) which is exceedingly clear by following the perception of reflections in mirrors and so on—to be like a jewel-studded lion-cage opened in a golden palace; they consider the ear to be like a silver tube or a carpenter's line; they consider the nose, known as the prominent nose, to be like a stick of orpiment (haritāla) rolled and placed; they consider the tongue to be like a soft, smooth, sweet-tasting red woolen blanket; they consider the body to be like a sālalaṭṭhi (a type of tree) or a golden archway; they consider the mind to be noble, unlike the minds of others; they consider visible objects (rūpa) to be like the color of golden kanikāra flowers and so on; they consider sounds to be like the gentle hum of a drunken karavīka bird, a cuckoo, or a jewel-studded flute; and they think, "Who else has such objects of smell, taste, touch, and mental phenomena, which arise from the four causes, as I have?" For those who think in this way, these eyes and so on become both lovely and delightful.
Trong các câu Mắt trong đời v.v..., thật vậy, các chúng sanh đã chú tâm vào mắt v.v... trong thế gian với lòng yêu mến, được thiết lập trong sự thành tựu, họ xem mắt của mình, tức là năm loại tịnh sắc rất trong sáng theo cách nắm bắt hình ảnh trong gương v.v..., giống như cửa sổ sư tử bằng ngọc được mở ra trong cung điện bằng vàng; họ xem tai giống như ống dẫn bằng bạc và giống như sợi dây con dọi; họ xem mũi, vốn được gọi là mũi cao, giống như một thỏi hùng hoàng được vo tròn và đặt xuống; họ xem lưỡi, vốn mang lại vị ngọt ngào, mềm mại và mịn màng, giống như một tấm thảm len màu đỏ; họ xem thân giống như cây sala non và giống như cổng vòm bằng vàng; họ xem tâm là cao quý, không giống với tâm của người khác; họ xem sắc giống như màu sắc của hoa huỳnh anh bằng vàng v.v...; họ xem tiếng giống như âm thanh của sáo ngọc được thổi nhẹ nhàng, tiếng chim cu và chim karavīka say mật; họ nghĩ rằng: “Ai khác có được những đối tượng như hương thơm do bốn nguồn sanh v.v... mà mình đã có được?” Đối với những người nghĩ như vậy, những thứ mắt v.v... đó trở thành sắc khả ái và sắc khả hỷ.
Atha nesaṃ tattha anuppannā ceva taṇhā uppajjati, uppannā ca punappunaṃ pavattivasena nivisati.
Then, craving that has not yet arisen in them arises there, and craving that has arisen becomes established there by repeatedly occurring.
Khi ấy, đối với họ, ái dục chưa sanh khởi thì sanh khởi ở đó, và ái dục đã sanh khởi thì an trú do sự diễn tiến lặp đi lặp lại.
Tasmā thero ‘‘cakkhu loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā uppajjamānā uppajjatī’’tiādimāha.
Therefore, the Elder said, "The eye in the world is lovely and delightful; it is there that this craving arises when it arises," and so on.
Vì vậy, Trưởng lão đã nói: “Mắt trong đời là sắc khả ái, sắc khả hỷ, khi ái dục này sanh khởi, nó sanh khởi ở đây” v.v...
Tattha uppajjamānāti yadā uppajjati, tadā ettha uppajjatīti attho.
Therein, “uppajjamānā” means when it arises, it arises here; this is the meaning.
Ở đây, khi sanh khởi có nghĩa là khi nó sanh khởi, nó sanh khởi ở đây.
Tasmā taṃ dukkhanirodhaṃ dassento samudayanirodhena dassetuṃ evamāha.
Therefore, to show that cessation of suffering, he stated it by means of the cessation of the origin.
Do đó, để chỉ ra sự diệt khổ ấy, Ngài đã nói như vậy để chỉ ra bằng sự diệt của tập.
Sīhasamānavuttino hi tathāgatā, te dukkhaṃ nirodhentā dukkhanirodhañca dassentā hetumhi paṭipajjanti, na phale.
For the Tathāgatas, whose conduct is like that of a lion, when they bring suffering to cessation and demonstrate the cessation of suffering, they proceed with the cause, not with the result.
Thật vậy, các đấng Như Lai có cách hành xử giống như sư tử, khi các Ngài diệt khổ và chỉ ra sự diệt khổ, các Ngài thực hành trên nhân, không phải trên quả.
Suvānavuttino pana aññatitthiyā, te dukkhaṃ nirodhentā dukkhanirodhañca dassentā attakilamathānuyogena ceva tasseva ca desanāya phale paṭipajjanti, na hetumhīti.
But other sectarians, whose conduct is like that of a dog, when they bring suffering to cessation and demonstrate the cessation of suffering, they proceed with the result by means of self-mortification and the teaching thereof, not with the cause.
Còn các ngoại đạo có cách hành xử giống như loài chó, khi họ diệt khổ và chỉ ra sự diệt khổ, họ thực hành trên quả bằng khổ hạnh ép xác và bằng việc thuyết giảng về chính điều đó, chứ không phải trên nhân.
Sīhasamānavuttitāya satthā hetumhi paṭipajjanto ‘‘yo tassāyevā’’tiādimāha.
Because of the Teacher's lion-like conduct, he proceeds with the cause, saying, “yo tassāyeva” (which is that itself), and so on.
Do cách hành xử giống như sư tử, bậc Đạo Sư, khi thực hành trên nhân, đã nói: “Sự diệt tận không dư tàn của chính ái dục ấy” v.v...
Dhammasenāpatipi satthārā vuttakkamenevāha.
The Dhamma-senāpati (General of the Dhamma) also spoke in the same order as taught by the Teacher.
Vị Thống Soái Chánh Pháp cũng nói theo trình tự mà bậc Đạo Sư đã nói.
Tattha tassāyeva taṇhāyāti yā sā taṇhā ‘‘ponobhavikā’’ti vatvā kāmataṇhādivasena vibhattā uppattinivesanavasena ca heṭṭhā pakāsitā, tassāyeva taṇhāya.
Therein, “tassāyeva taṇhāya” means that craving itself, which was described as "leading to renewed existence" (ponobhavikā) and distinguished as craving for sensuality and so on, and which was explained below in terms of its arising and establishment—that craving itself.
Ở đây, của chính ái dục ấy có nghĩa là của chính ái dục ấy, tức là ái dục đã được nói là “đưa đến tái sanh”, được phân loại theo dục ái v.v..., và đã được giải thích ở phần trước theo phương diện nơi sanh khởi và nơi an trú.
Asesavirāganirodhoti virāgo vuccati maggo, ‘‘virāgā vimuccatī’’ti (ma. ni. 1.245; saṃ. ni. 3.12; mahāva. 23) hi vuttaṃ.
“Asesavirāganirodho” means the path is called virāga (dispassion), for it is said, "Through dispassion, one is liberated."
Sự diệt tận không dư tàn của ái dục (Asesavirāganirodho): Ly tham (virāga) được gọi là đạo, vì có câu nói rằng “nhờ ly tham mà được giải thoát” (M. i. 167; S. iii. 51; Vin. i. 14).
Virāgena nirodho virāganirodho, anusayasamugghātato aseso virāganirodho asesavirāganirodho.
Cessation through dispassion is virāganirodha; complete cessation through dispassion is asesavirāganirodha, due to the eradication of underlying tendencies (anusaya).
Sự diệt do ly tham là virāganirodho; sự diệt tận không dư tàn của ái dục do ly tham từ việc nhổ sạch các tùy miên là asesavirāganirodho.
Atha vā virāgoti hi pahānaṃ vuccati, tasmā aseso virāgo aseso nirodhoti evampettha yojanā daṭṭhabbā.
Alternatively, virāga is said to be abandonment; therefore, complete dispassion is complete cessation—this is how the connection should be understood here.
Hoặc, virāga được gọi là sự từ bỏ, do đó, sự ly tham không dư tàn là sự diệt tận không dư tàn, nên hiểu sự kết hợp ở đây là như vậy.
Atthato pana sabbāneva panetāni asesavirāganirodhotiādīni nibbānasseva vevacanāni.
In terms of meaning, all these, such as "the complete fading away and cessation," are indeed synonyms for Nibbāna.
Tuy nhiên, về mặt ý nghĩa, tất cả những từ này như asesavirāganirodho v.v... đều là các danh từ đồng nghĩa của Niết-bàn.
Paramatthato hi dukkhanirodhaṃ ariyasaccanti nibbānaṃ vuccati.
Indeed, in the ultimate sense, Nibbāna is called "the noble truth of the cessation of suffering."
Thật vậy, về mặt chân đế, Niết-bàn được gọi là Thánh đế về sự diệt khổ.
Yasmā pana taṃ āgamma taṇhā asesā virajjati nirujjhati, tasmā taṃ ‘‘tassāyeva taṇhāya asesavirāganirodho’’ti vuccati.
Since, by relying on it, craving completely fades away and ceases, therefore it is called "the complete fading away and cessation of that very craving."
Tuy nhiên, vì nương vào đó mà ái dục ly tham không dư tàn, diệt tận, nên nó được gọi là “sự diệt tận không dư tàn của chính ái dục ấy”.
Nibbānañca āgamma taṇhā cajīyati paṭinissajjīyati muccati na allīyati, kāmaguṇālayesu cettha ekopi ālayo natthi, tasmā nibbānaṃ cāgo paṭinissaggo mutti anālayoti vuccati.
And relying on Nibbāna, craving is abandoned, relinquished, freed, and does not cling; and in this Nibbāna, there is not even a single dwelling place among the dwelling places of sense pleasures. Therefore, Nibbāna is called relinquishment, abandonment, liberation, non-attachment.
Và nương vào Niết-bàn, ái dục được từ bỏ, xả ly, giải thoát, không dính mắc, và trong đó không có một nơi nương náu nào trong các nơi nương náu của dục lạc, do đó Niết-bàn được gọi là sự từ bỏ, sự xả ly, sự giải thoát, sự không nương náu.
Ekameva hi nibbānaṃ, nāmāni panassa sabbasaṅkhatānaṃ nāmapaṭipakkhavasena anekāni honti.
Nibbāna is indeed one, but its names are many, in opposition to the names of all conditioned things.
Thật vậy, Niết-bàn chỉ có một, nhưng tên gọi của nó lại có nhiều, theo phương diện đối lập với tên gọi của tất cả các pháp hữu vi.
Seyyathidaṃ – asesavirāgo asesanirodho cāgo paṭinissaggo mutti anālayo rāgakkhayo dosakkhayo mohakkhayo taṇhākkhayo anuppādo appavattaṃ animittaṃ appaṇihitaṃ anāyūhanaṃ appaṭisandhi anupapatti agati ajātaṃ ajaraṃ abyādhi amataṃ asokaṃ aparidevaṃ anupāyāsaṃ asaṃkiliṭṭhantiādīni.
These are: complete fading away, complete cessation, relinquishment, abandonment, liberation, non-attachment, destruction of lust, destruction of hatred, destruction of delusion, destruction of craving, non-arising, non-continuance, signless, desireless, non-exertion, non-relinking, non-rebirth, non-going, unborn, unaging, unailing, deathless, sorrowless, lamentationless, despairless, uncorrupted, and so on.
Chẳng hạn như: ly tham không dư tàn, diệt tận không dư tàn, từ bỏ, xả ly, giải thoát, không nương náu, đoạn tận tham, đoạn tận sân, đoạn tận si, đoạn tận ái, không sanh, không diễn tiến, vô tướng, vô nguyện, không tạo tác, không tái sanh, không sinh khởi, không đi đến, không sanh, không già, không bệnh, bất tử, không sầu, không bi, không khổ não, không ô nhiễm v.v...
Idāni maggena chinnāya nibbānaṃ āgamma appavattippattāyapi ca taṇhāya yesu vatthūsu tassā uppatti dassitā, tattheva abhāvaṃ dassetuṃ sā kho panesātiādimāha.
Now, to show the non-existence of craving in those very objects where its arising was shown, even though it has attained non-continuance by means of the path and relying on Nibbāna, the Elder said, "That craving, indeed..." and so on.
Bây giờ, để chỉ ra sự vắng mặt của ái dục ngay tại những đối tượng mà sự sanh khởi của nó đã được chỉ ra, dù ái dục đã bị cắt đứt bởi đạo và đã đạt đến trạng thái không diễn tiến nhờ nương vào Niết-bàn, ngài nói: Nhưng ái dục ấy v.v...
Tattha yathā puriso khette jātaṃ tittakālābuvalliṃ disvā aggato paṭṭhāya mūlaṃ pariyesitvā chindeyya, sā anupubbena milāyitvā appaññattiṃ gaccheyya, tato tasmiṃ khette tittakālābu niruddhā pahīnāti vucceyya, evameva khette tittakālābu viya cakkhādīsu taṇhā.
Just as a man, seeing a bitter gourd creeper grown in a field, might search for its root from the top and cut it, and it would gradually wither and become unidentifiable, and then it would be said that the bitter gourd in that field has ceased and been abandoned; in the same way, craving in the eye and so on is like the bitter gourd in the field.
Ở đây, cũng như một người, khi thấy một dây bầu đắng mọc trong ruộng, sẽ tìm gốc từ ngọn rồi chặt đứt nó, dây bầu đó sẽ dần dần héo úa và biến mất, khi đó người ta nói rằng bầu đắng trong ruộng đó đã diệt, đã được đoạn trừ; cũng vậy, ái dục trong mắt v.v... giống như dây bầu đắng trong ruộng.
Sā ariyamaggena mūlacchinnā nibbānaṃ āgamma appavattiṃ gacchati.
That craving, having its root cut by the Noble Path, attains non-continuance by relying on Nibbāna.
Nó, khi bị cắt đứt gốc rễ bởi Thánh đạo, sẽ đi đến trạng thái không diễn tiến nhờ nương vào Niết-bàn.
Evaṃ gatā pana tesu vatthūsu khette tittakālābu viya na paññāyati.
Having thus ceased, it is not perceived in those objects, just like the bitter gourd in the field.
Khi đã đi đến trạng thái như vậy, nó không còn được nhận biết trong những đối tượng đó, giống như dây bầu đắng trong ruộng.
Yathā ca aṭavito core ānetvā nagarassa dakkhiṇadvāre ghāteyyuṃ, tato aṭaviyaṃ corā matāti vā māritāti vā vucceyyuṃ, evameva aṭaviyaṃ corā viya yā cakkhādīsu taṇhā, sā dakkhiṇadvāre corā viya nibbānaṃ āgamma niruddhattā nibbāne niruddhā.
And just as if thieves were brought from the forest and executed at the southern gate of the city, and then it would be said that the thieves in the forest are dead or have been killed; in the same way, craving in the eye and so on is like the thieves in the forest, and having ceased by relying on Nibbāna, like the thieves at the southern gate, it has ceased in Nibbāna.
Và cũng như người ta bắt những tên cướp từ trong rừng về và giết chúng ở cổng phía nam của thành phố, khi đó người ta nói rằng những tên cướp trong rừng đã chết hoặc đã bị giết; cũng vậy, ái dục trong mắt v.v... giống như những tên cướp trong rừng, nó đã diệt trong Niết-bàn vì đã được diệt nhờ nương vào Niết-bàn, giống như những tên cướp ở cổng phía nam.
Evaṃ niruddhā pana tesu vatthūsu aṭaviyaṃ corā viya na paññāyati.
Having thus ceased, it is not perceived in those objects, just like the thieves in the forest.
Khi đã được diệt như vậy, nó không còn được nhận biết trong những đối tượng đó, giống như những tên cướp trong rừng.
Tenassā tattheva nirodhaṃ dassento ‘‘cakkhu loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā pahīyamānā pahīyatī’’tiādimāha.
Therefore, showing its cessation right there, he said, "The eye is dear and pleasing in the world; there, that craving, being abandoned, is abandoned," and so on.
Do đó, để chỉ ra sự diệt của nó ngay tại đó, ngài nói: “Mắt trong đời là sắc khả ái, sắc khả hỷ, khi ái dục này được đoạn trừ, nó được đoạn trừ ở đây” v.v...
Atha vā taṇhuppādavatthussa pariññātattā pariññātavatthusmiṃ puna na uppajjanato anuppādanirodhavasena taṇhuppādavatthusmiṃyeva nirujjhatīti vuccati.
Alternatively, it is said that craving ceases in the very objects of its arising by way of non-arising-cessation, because the objects of craving's arising have been fully understood, and it does not arise again in a fully understood object.
Hoặc, vì đối tượng sanh khởi của ái dục đã được liễu tri, và vì nó không sanh khởi lại trong đối tượng đã được liễu tri, nên được nói rằng nó diệt ngay trong đối tượng sanh khởi của ái dục theo phương diện diệt do không sanh khởi.
Ettha ca uppajjanapaṭipakkhavasena pahīyatīti vuttaṃ, nivisanapaṭipakkhavasena nirujjhatīti.
Here, "abandoned" is said by way of being the opposite of arising, and "ceases" by way of being the opposite of establishing itself.
Và ở đây, từ “được đoạn trừ” (pahīyati) được nói theo phương diện đối lập với sự sanh khởi, và từ “diệt” (nirujjhati) được nói theo phương diện đối lập với sự an trú.
Idāni aṅgamattameva maggo aṅgavinimutto natthīti dassento sammādiṭṭhi…pe… sammāsamādhītiādimāha.
Now, showing that the path is merely a collection of factors and there is nothing apart from its factors, he said, "Right View... and so on... Right Concentration."
Bây giờ, để chỉ ra rằng chỉ có các chi phần mới là đạo, không có đạo nào tách rời khỏi các chi phần, ngài nói sammādiṭṭhi… cho đến… sammāsamādhi v.v...
Tattha sammā dassanalakkhaṇā sammādiṭṭhi. Sammā abhiniropanalakkhaṇo sammāsaṅkappo.
Among these, Right View has the characteristic of seeing correctly. Right Intention has the characteristic of applying correctly.
Trong đó, sammādiṭṭhi có đặc tính thấy đúng. Sammāsaṅkappo có đặc tính hướng đến đúng.
Sammā pariggahalakkhaṇā sammāvācā.
Right Speech has the characteristic of grasping correctly.
Sammāvācā có đặc tính thâu nhiếp đúng.
Sammā samuṭṭhāpanalakkhaṇo sammākammanto.
Right Action has the characteristic of originating correctly.
Sammākammanto có đặc tính khởi lên đúng.
Sammā vodāpanalakkhaṇo sammāājīvo.
Right Livelihood has the characteristic of purifying correctly.
Sammāājīvo có đặc tính thanh lọc đúng.
Sammā paggahalakkhaṇo sammāvāyāmo.
Right Effort has the characteristic of exerting correctly.
Sammāvāyāmo có đặc tính nâng đỡ đúng.
Sammā upaṭṭhānalakkhaṇā sammāsati.
Right Mindfulness has the characteristic of establishing correctly.
Sammāsati có đặc tính an trú đúng.
Sammā samādhānalakkhaṇo sammāsamādhi.
Right Concentration has the characteristic of unifying correctly.
Sammāsamādhi có đặc tính định tĩnh đúng.
Tesu ekekassa tīṇi tīṇi kiccāni honti.
Each of these has three functions.
Trong số đó, mỗi một chi phần có ba phận sự.
Seyyathidaṃ – sammādiṭṭhi tāva aññehipi attano paccanīkakilesehi saddhiṃ micchādiṭṭhiṃ pajahati, nirodhañca ārammaṇaṃ karoti, sampayuttadhamme ca passati tappaṭicchādakamohavidhamanavasena asammohato.
For example, Right View, first of all, abandons wrong view together with its own other opposing defilements, including delusion and so on that are co-existent. It also makes Nibbāna its object, and due to non-delusion, by dispelling the delusion that conceals Nibbāna, it sees the associated phenomena.
Ví như – trước hết, sammādiṭṭhi từ bỏ micchādiṭṭhi cùng với các phiền não đối nghịch khác của nó, lấy sự diệt làm đối tượng, và thấy các pháp tương ưng do không si mê qua việc xua tan si mê che lấp đối tượng ấy.
Sammāsaṅkappādayopi tatheva micchāsaṅkappādīni ca pajahanti, nibbānañca ārammaṇaṃ karonti.
Right Intention and the others likewise abandon wrong intention and so on, and they make Nibbāna their object.
Sammāsaṅkappa v.v... cũng như vậy, từ bỏ micchāsaṅkappa v.v... và lấy Nibbāna làm đối tượng.
Visesato panettha sammāsaṅkappo sahajātadhamme sammā abhiniropeti, sammāvācā sammā pariggaṇhāti, sammākammanto sammā samuṭṭhāpeti, sammāājīvo sammā vodāpeti, sammāvāyāmo sammā paggaṇhāti, sammāsati sammā upaṭṭhāpeti, sammāsamādhi sammā samādahati.
Specifically, among these, Right Intention rightly directs co-arising phenomena; Right Speech rightly comprehends; Right Action rightly generates; Right Livelihood rightly purifies; Right Effort rightly exerts; Right Mindfulness rightly establishes; Right Concentration rightly concentrates.
Đặc biệt ở đây, sammāsaṅkappa hướng các pháp đồng sanh đến đúng, sammāvācā thâu nhiếp đúng, sammākammanto khởi lên đúng, sammāājīvo thanh lọc đúng, sammāvāyāmo nâng đỡ đúng, sammāsati an trú đúng, sammāsamādhi định tĩnh đúng.
Apicesā sammādiṭṭhi nāma pubbabhāge nānākkhaṇā nānārammaṇā hoti, maggakāle ekakkhaṇā ekārammaṇā.
Furthermore, this Right View, in its preliminary stage, has various moments and various objects, but at the moment of the Path, it has one moment and one object.
Hơn nữa, sammādiṭṭhi này trong giai đoạn đầu có nhiều sát-na khác nhau, nhiều đối tượng khác nhau; vào lúc đạo sanh, nó có một sát-na, một đối tượng.
Kiccato pana ‘‘dukkhe ñāṇa’’ntiādīni cattāri nāmāni labhati.
As for its function, it obtains four names such as ‘knowledge of suffering’.
Về phương diện phận sự, nó có bốn tên gọi là “trí về khổ” v.v...
Sammāsaṅkappādayopi pubbabhāge nānākkhaṇā nānārammaṇā honti, maggakāle ekakkhaṇā ekārammaṇā.
Right Intention and the others, in their preliminary stage, also have various moments and various objects, but at the moment of the Path, they have one moment and one object.
Sammāsaṅkappa v.v... trong giai đoạn đầu cũng có nhiều sát-na khác nhau, nhiều đối tượng khác nhau; vào lúc đạo sanh, chúng có một sát-na, một đối tượng.
Tesu sammāsaṅkappo kiccato nekkhammasaṅkappotiādīni tīṇi nāmāni labhati.
Among these, Right Intention, as for its function, obtains three names such as ‘intention of renunciation’.
Trong số đó, sammāsaṅkappa, về phương diện phận sự, có ba tên gọi là nekkhammasaṅkappa v.v...
Sammāvācādayo tayo pubbabhāge viratiyopi honti cetanāyopi, maggakkhaṇe pana viratiyoyeva.
Right Speech and the other two, in their preliminary stage, are also abstinences and volitions, but at the moment of the Path, they are only abstinences.
Ba chi phần sammāvācā v.v... trong giai đoạn đầu vừa là sự kiêng cữ vừa là tác ý, nhưng vào sát-na đạo sanh, chúng chỉ là sự kiêng cữ.
Sammāvāyāmo sammāsatīti idampi dvayaṃ kiccato sammappadhānasatipaṭṭhānavasena cattāri nāmāni labhati.
This pair, Right Effort and Right Mindfulness, as for their function, obtains four names by way of Right Endeavours and Foundations of Mindfulness.
Cặp đôi này, sammāvāyāmo và sammāsati, về phương diện phận sự, có bốn tên gọi theo cách của sammappadhāna và satipaṭṭhāna.
Sammāsamādhi pana pubbabhāgepi maggakkhaṇepi sammāsamādhiyeva.
Right Concentration, however, is Right Concentration itself both in the preliminary stage and at the moment of the Path.
Còn sammāsamādhi thì trong giai đoạn đầu cũng như vào sát-na đạo sanh, vẫn chỉ là sammāsamādhi.
Sammāsaṅkappo pana tassā bahūpakāro.
Right Intention, however, is very beneficial to it.
Còn sammāsaṅkappa thì rất hữu ích cho sammādiṭṭhi ấy.
Tasmā tadanantaraṃ vutto.
Therefore, it is mentioned immediately after.
Do đó, nó được nói đến ngay sau đó.
Yathā hi heraññiko hatthena parivattetvā parivattetvā cakkhunā kahāpaṇaṃ olokento ‘‘ayaṃ kūṭo ayaṃ cheko’’ti jānāti, evaṃ yogāvacaropi pubbabhāge vitakkena vitakketvā vitakketvā vipassanāpaññāya olokayamāno ‘‘ime dhammā kāmāvacarā, ime rūpāvacarādayo’’ti jānāti.
Just as a money-changer, by turning a coin over and over with his hand and examining it with his eye, knows, ‘This is counterfeit, this is genuine,’ so too a meditator, in the preliminary stage, by repeatedly reflecting with thought and examining with insight-wisdom, knows, ‘These phenomena are of the sense-sphere, these are of the form-sphere,’ and so on.
Ví như người đổi tiền, sau khi lật qua lật lại đồng kahāpaṇa bằng tay và nhìn bằng mắt, biết được “đồng này giả, đồng này thật”; cũng vậy, hành giả trong giai đoạn đầu, sau khi tầm cầu liên tục bằng vitakka và nhìn bằng trí tuệ vipassanā, biết được “các pháp này thuộc cõi dục, các pháp này thuộc cõi sắc v.v...”
Yathā vā pana purisena koṭiyaṃ gahetvā parivattetvā parivattetvā dinnaṃ mahārukkhaṃ tacchako vāsiyā tacchetvā kamme upaneti, evaṃ vitakkena vitakketvā vitakketvā dinnadhamme yogāvacaro paññāya ‘‘ime dhammā kāmāvacarā, ime rūpāvacarā’’tiādinā nayena paricchinditvā kamme upaneti.
Or, just as a carpenter, having been given a large log by a man who has held it by the end and turned it over and over, cuts it with an axe and applies it to his work, so too a meditator, having been given phenomena by repeatedly reflecting with thought, discerns them with wisdom, saying, ‘These phenomena are of the sense-sphere, these are of the form-sphere,’ and so on, and applies them to the work of insight.
Hoặc ví như người thợ mộc, sau khi đẽo bằng rìu khúc gỗ lớn đã được một người khác cầm ở đầu lật qua lật lại, rồi đem dùng vào việc; cũng vậy, hành giả, sau khi phân định các pháp đã được tầm cầu liên tục bằng vitakka theo cách “các pháp này thuộc cõi dục, các pháp này thuộc cõi sắc” v.v... bằng trí tuệ, rồi đem dùng vào việc (tu tập).
Tasmā sammāsaṅkappo sammādiṭṭhānantaraṃ vutto.
Therefore, Right Intention is mentioned immediately after Right View.
Do đó, sammāsaṅkappa được nói đến ngay sau sammādiṭṭhi.
Sammādiṭṭhiniddese ‘‘dukkhe ñāṇa’’ntiādinā catusaccakammaṭṭhānaṃ dassitaṃ.
In the exposition of Sammādiṭṭhi (Right View), the meditation on the Four Noble Truths is shown by the phrase 'knowledge of suffering' and so on.
Trong phần giải về sammādiṭṭhi, đề mục thiền về Tứ Thánh Đế đã được chỉ ra bằng câu “trí về khổ” v.v...
Tattha purimāni dve saccāni vaṭṭaṃ, pacchimāni dve vivaṭṭaṃ.
Among those four Noble Truths, the first two are Saṃsāra (the round of existence), and the latter two are the cessation of Saṃsāra.
Trong đó, hai đế đầu là luân hồi, hai đế sau là thoát ly luân hồi.
Tesu bhikkhuno vaṭṭe kammaṭṭhānābhiniveso hoti, vivaṭṭe natthi abhiniveso.
Among these, a bhikkhu's (monk's) absorption in the meditation object is with the two truths of Saṃsāra; there is no absorption in the two truths of the cessation of Saṃsāra.
Trong số đó, vị tỳ khưu có sự chú tâm vào đề mục thiền về luân hồi, còn về thoát ly luân hồi thì không có sự chú tâm.
Purimāni hi dve saccāni ‘‘pañcakkhandhā dukkhaṃ, taṇhā samudayo’’ti evaṃ saṅkhepena ca, ‘‘katame pañcakkhandhā?
For the first two truths, the practitioner performs the meditation by learning them from a teacher, both concisely, saying, "The five aggregates are suffering; craving is the origin," and extensively, saying, "What are the five aggregates? The form aggregate," and so on, repeatedly reciting them.
Thật vậy, đối với hai đế đầu, hành giả thực hành công việc (thiền) bằng cách học hỏi từ vị thầy cả một cách tóm tắt, như “năm uẩn là khổ, ái là tập khởi”,
Rūpakkhandho’’tiādinā nayena vitthārena ca ācariyasantike uggaṇhitvā vācāya punappunaṃ parivattento yogāvacaro kammaṃ karoti.
For the first two truths, the practitioner performs the meditation by learning them from a teacher, both concisely, saying, "The five aggregates are suffering; craving is the origin," and extensively, saying, "What are the five aggregates? The form aggregate," and so on, repeatedly reciting them.
và một cách chi tiết theo phương pháp “năm uẩn là gì? Sắc uẩn” v.v..., rồi lặp đi lặp lại bằng lời nói.
Itaresu pana dvīsu saccesu ‘‘nirodhasaccaṃ iṭṭhaṃ kantaṃ manāpaṃ, maggasaccaṃ iṭṭhaṃ kantaṃ manāpa’’nti evaṃ savaneneva kammaṃ karoti.
But regarding the other two truths, he performs the task by merely hearing, "The truth of cessation is desirable, pleasing, agreeable; the truth of the path is desirable, pleasing, agreeable."
Còn đối với hai đế còn lại, vị ấy thực hành công việc chỉ bằng cách nghe rằng “diệt đế là đáng mong muốn, đáng ưa thích, đáng hài lòng; đạo đế là đáng mong muốn, đáng ưa thích, đáng hài lòng”.
So evaṃ kammaṃ karonto cattāri saccāni ekapaṭivedhena paṭivijjhati, ekābhisamayena abhisameti.
Performing the task in this way, he penetrates the four truths with a single penetration, he fully comprehends them with a single full comprehension.
Khi thực hành công việc như vậy, vị ấy thâm nhập bốn đế bằng một sự thâm nhập duy nhất, liễu ngộ bằng một sự liễu ngộ duy nhất.
Dukkhaṃ pariññāpaṭivedhena paṭivijjhati, samudayaṃ pahānapaṭivedhena paṭivijjhati.
He penetrates suffering with the penetration of full understanding, he penetrates the origin with the penetration of abandonment.
Vị ấy thâm nhập khổ bằng sự thâm nhập của liễu tri, thâm nhập tập khởi bằng sự thâm nhập của đoạn tận.
Nirodhaṃ sacchikiriyāpaṭivedhena paṭivijjhati, maggaṃ bhāvanāpaṭivedhena paṭivijjhati.
He penetrates cessation with the penetration of realization, he penetrates the path with the penetration of development.
Vị ấy thâm nhập sự diệt bằng sự thâm nhập của chứng ngộ, thâm nhập đạo bằng sự thâm nhập của tu tập.
Dukkhaṃ pariññābhisamayena…pe… maggaṃ bhāvanābhisamayena abhisameti.
He fully comprehends suffering with the full comprehension of full understanding... and so on... he fully comprehends the path with the full comprehension of development.
Vị ấy liễu ngộ khổ bằng sự liễu ngộ của liễu tri... cho đến... liễu ngộ đạo bằng sự liễu ngộ của tu tập.
Evamassa pubbabhāge dvīsu saccesu uggahaparipucchāsavanadhāraṇasammasanapaṭivedho hoti, dvīsu savanapaṭivedhoyeva.
Thus, in his preliminary stage, there is penetration of learning, questioning, hearing, retaining, and contemplating regarding the two truths (of suffering and origin); regarding the other two (cessation and path), there is only penetration of hearing.
Như vậy, đối với vị ấy, trong giai đoạn đầu, đối với hai đế có sự thâm nhập qua học hỏi, hỏi han, nghe, ghi nhớ, và quán xét; đối với hai đế kia, chỉ có sự thâm nhập qua nghe.
Aparabhāge tīsu kiccato paṭivedho hoti nirodhe ārammaṇapaṭivedho.
In the later stage, there is penetration by function regarding three (suffering, origin, path), and penetration by object regarding cessation.
Trong giai đoạn sau, đối với ba đế có sự thâm nhập qua phận sự; đối với diệt đế có sự thâm nhập qua đối tượng.
Tattha sabbampi paṭivedhañāṇaṃ lokuttaraṃ, savanadhāraṇasammasanañāṇaṃ lokiyaṃ kāmāvacaraṃ.
Therein, all knowledge of penetration is supramundane (lokuttara), while the knowledge of hearing, retaining, and contemplating is mundane (lokiya) and pertains to the sense-sphere (kāmāvacara).
Trong đó, tất cả trí tuệ thâm nhập đều là siêu thế; trí tuệ nghe, ghi nhớ, quán xét là thế gian, thuộc cõi dục.
Paccavekkhaṇā pana pattasaccassa hoti, ayañca ādikammiko.
However, reviewing knowledge (paccavekkhaṇā-ñāṇa) belongs to one who has attained the truths, and this practitioner is a beginner.
Còn sự quán xét lại thì xảy ra đối với người đã chứng đạt thánh đế, và vị này là người sơ cơ.
Tasmā sā idha na vuttā.
Therefore, it is not mentioned here.
Do đó, nó không được nói đến ở đây.
Imassa ca bhikkhuno pubbe pariggahato ‘‘dukkhaṃ parijānāmi, samudayaṃ pajahāmi, nirodhaṃ sacchikaromi, maggaṃ bhāvemī’’ti ābhogasamannāhāramanasikārapaccavekkhaṇā natthi, pariggahato paṭṭhāya hoti.
And for this bhikkhu, prior to comprehension, there is no advertence, attention, mental application, or reviewing, thinking, "I fully understand suffering, I abandon the origin, I realize cessation, I develop the path"; it arises only from the moment of comprehension onwards.
Và đối với vị Tỳ-khưu này, trước khi nắm giữ (các pháp Tứ Thánh Đế) bằng trí tuệ không lầm lẫn, không có sự chú tâm, sự quán xét, sự tư duy (với ý nghĩ): “Ta biết rõ khổ, ta đoạn trừ tập, ta chứng ngộ diệt, ta tu tập đạo.” Điều này chỉ có từ khi nắm giữ (các pháp Tứ Thánh Đế) trở đi.
Aparabhāge pana dukkhaṃ pariññātameva hoti…pe… maggo bhāvitova hoti.
But in the later stage, suffering is already fully understood... and so on... the path is already developed.
Nhưng sau đó, khổ đã được biết rõ…pe… đạo đã được tu tập.
Tattha dve saccāni duddasattā gambhīrāni, dve gambhīrattā duddasāni.
Among these, two truths (suffering and origin) are profound due to being difficult to see, and two (cessation and path) are difficult to see due to being profound.
Trong đó, hai sự thật (khổ và tập) thì khó thấy vì sâu xa, hai sự thật (diệt và đạo) thì khó thấy vì sâu xa.
Dukkhasaccañhi uppattito pākaṭaṃ, khāṇukaṇṭakappahārādīsu ‘‘aho dukkha’’nti vattabbatampi āpajjati.
The truth of suffering is manifest in its arising; in situations like being struck by a stump or a thorn, one might even exclaim, "Oh, suffering!"
Khổ đế thì hiển lộ qua sự phát sinh, đến nỗi khi bị gai đâm hay vấp phải gốc cây, người ta phải thốt lên: “Ôi, khổ quá!”
Samudayasaccaṃ khāditukāmatābhuñjitukāmatādivasena uppattito pākaṭaṃ.
The truth of origin is manifest in its arising, in terms of desires to eat, to consume, and so on.
Tập đế thì hiển lộ qua sự phát sinh dưới dạng ước muốn ăn uống, v.v.
Lakkhaṇapaṭivedhato pana ubhayampi gambhīraṃ.
However, both are profound in terms of penetrating their characteristics.
Tuy nhiên, cả hai (khổ và tập) đều sâu xa khi được thấu hiểu qua đặc tính của chúng.
Iti tāni duddasattā gambhīrāni.
Thus, these are profound due to being difficult to see.
Do đó, chúng sâu xa vì khó thấy.
Itaresaṃ pana dvinnaṃ dassanatthāya payogo bhavaggaggahaṇatthaṃ hatthapasāraṇaṃ viya, avīciphusanatthaṃ pādapasāraṇaṃ viya, satadhā bhinnassa vālassa koṭiyā koṭipaṭipādanaṃ viya ca hoti.
But the effort to see the other two is like stretching out a hand to grasp the highest existence, or stretching out a foot to touch Avīci hell, or trying to touch the tip of a hair that has been split a hundred times.
Còn đối với hai sự thật kia (diệt và đạo), sự nỗ lực để thấy chúng giống như việc vươn tay để nắm lấy đỉnh của cõi hữu, hay duỗi chân để chạm đến cõi Vô gián, hoặc như việc đặt đầu mút của một sợi lông bị chẻ thành trăm mảnh vào đúng đầu mút kia.
Iti tāni gambhīrattā duddasāni.
Thus, these are difficult to see due to being profound.
Do đó, chúng khó thấy vì sâu xa.
Evaṃ duddasattā gambhīresu gambhīrattā ca duddasesu catūsu saccesu uggahādivasena pubbabhāgañāṇuppattiṃ sandhāya idaṃ ‘‘dukkhe ñāṇa’’ntiādi vuttaṃ.
Therefore, referring to the arising of preliminary knowledge through learning and so on, regarding these four truths—which are profound due to being difficult to see, and difficult to see due to being profound—this statement "knowledge of suffering" and so on, was made.
Như vậy, khi nói “trí tuệ về khổ,” v.v., là để chỉ sự phát sinh của các tuệ thuộc giai đoạn sơ khởi, như sự thâu tóm, v.v., trong bốn sự thật vừa khó thấy vì sâu xa, vừa sâu xa vì khó thấy.
Paṭivedhakkhaṇe pana ekameva taṃ ñāṇaṃ hoti.
However, at the moment of penetration, that knowledge is just one.
Nhưng vào khoảnh khắc thấu hiểu, trí tuệ ấy chỉ là một.
Apare panāhu – catubbidhaṃ saccesu ñāṇaṃ sutamayañāṇaṃ vavatthānañāṇaṃ sammasanañāṇaṃ abhisamayañāṇanti.
Others say that knowledge of the truths is fourfold: knowledge from hearing, knowledge of discernment, knowledge of contemplation, and knowledge of full comprehension.
Tuy nhiên, những người khác lại nói rằng có bốn loại trí tuệ về các sự thật: trí tuệ do nghe (sutamayañāṇa), trí tuệ phân biệt (vavatthānañāṇa), trí tuệ quán xét (sammasanañāṇa), và trí tuệ chứng ngộ (abhisamayañāṇa).
Tattha katamaṃ sutamayañāṇaṃ?
Among these, what is knowledge from hearing?
Vậy, trí tuệ do nghe là gì?
Saṃkhittena vā vitthārena vā cattāri saccāni sutvā jānāti ‘‘idaṃ dukkhaṃ, ayaṃ samudayo, ayaṃ nirodho, ayaṃ maggo’’ti.
Having heard the four truths concisely or extensively, one knows, "This is suffering, this is the origin, this is cessation, this is the path."
Là khi nghe về Tứ Thánh Đế một cách tóm tắt hay chi tiết, người ấy biết: “Đây là khổ, đây là tập, đây là diệt, đây là đạo.”
Idaṃ sutamayañāṇaṃ.
This is knowledge from hearing.
Đây là trí tuệ do nghe.
Katamaṃ vavatthānañāṇaṃ?
What is knowledge of discernment?
Trí tuệ phân biệt là gì?
So sutānaṃ atthaṃ upaparikkhati dhammato ca lakkhaṇato ca, ‘‘ime dhammā imasmiṃ sacce pariyāpannā, imassa saccassa idaṃ lakkhaṇa’’nti sanniṭṭhānaṃ karoti.
That person who has heard examines the meaning in terms of the nature and characteristics of the Dhamma, and determines, "These phenomena are included in this truth; this is the characteristic of this truth."
Người ấy quán xét ý nghĩa của những gì đã nghe, cả về bản chất lẫn đặc tính, và quyết định: “Những pháp này thuộc về sự thật này, đặc tính của sự thật này là như thế này.”
Idaṃ vavatthānañāṇaṃ.
This is knowledge of discernment.
Đây là trí tuệ phân biệt.
Katamaṃ sammasanañāṇaṃ?
What is knowledge of contemplation?
Trí tuệ quán xét là gì?
So evaṃ yathānupubbaṃ cattāri saccāni vavatthapetvā atha dukkhameva gahetvā yāva gotrabhuñāṇaṃ aniccato dukkhato anattato sammasati.
Having thus distinguished the four truths in due order, he then takes only suffering and comprehends it as impermanent, as suffering, and as non-self, up to the gotrabhuñāṇa.
Sau khi phân biệt Tứ Thánh Đế theo thứ tự như vậy, người ấy chỉ lấy khổ đế làm đối tượng và quán xét nó là vô thường, khổ, vô ngã cho đến trí chuyển tộc (gotrabhuñāṇa).
Idaṃ sammasanañāṇaṃ.
This is sammasanañāṇa.
Đây là trí tuệ quán xét.
Katamaṃ abhisamayañāṇaṃ?
What is abhisamayañāṇa?
Trí tuệ chứng ngộ là gì?
Lokuttaramaggakkhaṇe ekena ñāṇena cattāri saccāni apubbaṃ acarimaṃ abhisameti ‘‘dukkhaṃ pariññābhisamayena, samudayaṃ pahānābhisamayena, nirodhaṃ sacchikiriyābhisamayena maggaṃ bhāvanābhisamayena abhisametī’’ti.
At the moment of the supramundane path, with a single knowledge, one penetrates the four truths simultaneously, without prior or subsequent sequence, thus: ‘Suffering is penetrated by comprehension, the origin by abandonment, cessation by realization, and the path by development.’
Vào khoảnh khắc của đạo siêu thế, với một trí tuệ duy nhất, người ấy chứng ngộ Tứ Thánh Đế một cách đồng thời, không trước không sau: “Chứng ngộ khổ bằng cách biết rõ, chứng ngộ tập bằng cách đoạn trừ, chứng ngộ diệt bằng cách chứng đạt, chứng ngộ đạo bằng cách tu tập.”
Idaṃ abhisamayañāṇanti.
This is abhisamayañāṇa.
Đây là trí tuệ chứng ngộ.
Tattha yogāvacaro kāmavitakkassa padaghātanatthaṃ kāmavitakkaṃ vā sammasati aññaṃ vā pana kiñci saṅkhāraṃ.
Here, the meditator, in order to strike down the thought of sensuality, contemplates either the thought of sensuality itself or some other formation.
Trong đó, hành giả (yogāvacaro) quán xét tầm dục (kāmavitakko) hoặc bất kỳ hành (saṅkhāra) nào khác để diệt trừ gốc rễ của tầm dục.
Athassa vipassanākkhaṇe vipassanāsampayutto saṅkappo tadaṅgavasena kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati, vipassanaṃ ussukkāpetvā maggaṃ pāpeti.
Then, at the moment of insight, the intention associated with insight arises, striking down and cutting off the thought of sensuality by way of temporary suppression, stimulating insight and leading to the path.
Sau đó, vào khoảnh khắc của tuệ quán (vipassanā), tư duy (saṅkappo) tương ưng với tuệ quán phát sinh, diệt trừ và cắt đứt gốc rễ của tầm dục theo cách đoạn phần (tadaṅgavasena), thúc đẩy tuệ quán để đạt đến đạo.
Athassa maggakkhaṇe maggasampayutto saṅkappo samucchedavasena kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati.
Then, at the moment of the path, the intention associated with the path arises, striking down and cutting off the thought of sensuality by way of eradication.
Sau đó, vào khoảnh khắc của đạo, tư duy tương ưng với đạo phát sinh, diệt trừ và cắt đứt gốc rễ của tầm dục theo cách đoạn diệt (samucchedavasena).
Byāpādavitakkassapi padaghātanatthaṃ byāpādavitakkaṃ vā aññaṃ vā saṅkhāraṃ, vihiṃsāvitakkassa padaghātanatthaṃ vihiṃsāvitakkaṃ vā aññaṃ vā saṅkhāraṃ sammasati.
Similarly, in order to strike down the thought of ill-will, he contemplates either the thought of ill-will or some other formation; and in order to strike down the thought of harmfulness, he contemplates either the thought of harmfulness or some other formation.
Tương tự, để diệt trừ gốc rễ của tầm ác ý (byāpādavitakko), người ấy quán xét tầm ác ý hoặc một hành khác; để diệt trừ gốc rễ của tầm hại mình hại người (vihiṃsāvitakko), người ấy quán xét tầm hại mình hại người hoặc một hành khác.
Athassa vipassanākkhaṇeti sabbaṃ purimanayeneva yojetabbaṃ.
Then, at the moment of insight, and so on, everything should be connected in the same way as before.
Sau đó, vào khoảnh khắc của tuệ quán, tất cả đều phải được kết nối theo cách tương tự như đã nói ở trên.
Kāmavitakkādīnaṃ pana tiṇṇampi pāḷiyaṃ vibhattesu aṭṭhatiṃsārammaṇesu ekakammaṭṭhānampi apaccanīkaṃ nāma natthi.
However, among the thirty-eight objects enumerated in the Pāḷi for these three—sensual thoughts and so on—there is not a single meditation subject that is not an antagonist.
Tuy nhiên, trong số ba loại tầm (kāmavitakka, v.v.) được phân loại trong kinh tạng, không có một đối tượng thiền định nào trong số ba mươi tám đối tượng thiền định (trừ không gian và ánh sáng) mà không phải là đối nghịch.
Ekantato pana kāmavitakkassa tāva asubhesu paṭhamajjhānameva paccanīkaṃ, byāpādavitakkassa mettāya tikacatukkajjhānāni, vihiṃsaāvitakkassa karuṇāya tikacatukkajjhānāni.
But specifically, the first jhāna, which occurs with the asubha meditation subjects, is the antagonist to sensual thought; the three or four jhānas of mettā are antagonists to ill-will; and the three or four jhānas of karuṇā are antagonists to harmfulness.
Nhưng một cách tuyệt đối, đối với tầm dục (kāmavitakko), sơ thiền (paṭhamajjhāna) phát sinh trong các quán bất tịnh (asubha) là đối nghịch; đối với tầm ác ý (byāpādavitakko), tam thiền (tikajjhāna) và tứ thiền (catukkajjhāna) phát sinh trong tâm từ (mettā) là đối nghịch; đối với tầm hại mình hại người (vihiṃsāvitakko), tam thiền và tứ thiền phát sinh trong tâm bi (karuṇā) là đối nghịch.
Tasmā asubhaparikammaṃ katvā jhānaṃ samāpannassa samāpattikkhaṇe jhānasampayutto vitakko vikkhambhanavasena kāmavitakkassa paccanīko hutvā uppajjati, jhānaṃ pādakaṃ katvā vipassanaṃ paṭṭhapentassa vipassanākkhaṇe vipassanāsampayutto saṅkappo tadaṅgavasena kāmavitakkassa paccanīko hutvā uppajjati, vipassanaṃ ussukkāpetvā maggaṃ pāpentassa maggakkhaṇe maggasampayutto saṅkappo samucchedavasena kāmavitakkassa paccanīko hutvā uppajjati.
Therefore, for one who has performed the preliminary work of asubha and attained jhāna, at the moment of attainment, the vitakka associated with jhāna arises as an antagonist to sensual thought by way of suppression; for one who makes jhāna the foundation and establishes insight, at the moment of insight, the saṅkappa associated with insight arises as an antagonist to sensual thought by way of temporary suppression; for one who stimulates insight and leads to the path, at the moment of the path, the saṅkappa associated with the path arises as an antagonist to sensual thought by way of eradication.
Do đó, đối với người đã thực hành quán bất tịnh và nhập thiền, vào khoảnh khắc nhập thiền, tầm (vitakko) tương ưng với thiền phát sinh, trở thành đối nghịch của tầm dục bằng cách trấn áp (vikkhambhanavasena); đối với người đã lấy thiền làm nền tảng và bắt đầu tuệ quán (vipassanā), vào khoảnh khắc của tuệ quán, tư duy (saṅkappo) tương ưng với tuệ quán phát sinh, trở thành đối nghịch của tầm dục bằng cách đoạn phần (tadaṅgavasena); đối với người đã thúc đẩy tuệ quán và đạt đến đạo, vào khoảnh khắc của đạo, tư duy tương ưng với đạo phát sinh, trở thành đối nghịch của tầm dục bằng cách đoạn diệt (samucchedavasena).
Evaṃ uppanno nekkhammasaṅkappoti vuccatīti veditabbo.
It should be understood that an intention arising in this way is called nekkhamma-saṅkappa.
Nên biết rằng tư duy xuất ly (nekkhammasaṅkappo) phát sinh như vậy.
Sammāājīvaniddese idhāti imasmiṃ sāsane.
In the explanation of Right Livelihood: Here means in this Dispensation.
Trong phần giải thích về Chánh Mạng (sammāājīva), “ở đây” (idha) có nghĩa là trong giáo pháp này.
Ariyasāvakoti ariyassa buddhassa sāvako.
An Ariyan disciple means a disciple of the Ariyan Buddha.
“Thánh đệ tử” (ariyasāvako) là đệ tử của Đức Phật, bậc Thánh.
Micchāājīvaṃ pahāyāti pāpakaṃ ājīvaṃ pajahitvā.
Having abandoned wrong livelihood means having given up evil livelihood.
“Từ bỏ tà mạng” (micchāājīvaṃ pahāyā) có nghĩa là từ bỏ cách sống sai trái.
Sammāājīvenāti buddhappasatthena kusalaājīvena.
By right livelihood means by blameless livelihood praised by the Buddha.
Với chánh mạng là với thiện mạng được đức Phật tán thán.
Jīvikaṃ kappetīti jīvitappavattiṃ pavatteti.
Maintains his life means sustains his life.
Nuôi mạng là làm cho sự sống tiếp diễn.
Idhāpi yasmā aññeneva cittena kāyadvāravītikkamā viramati, aññeneva vacīdvāravītikkamā, tasmā pubbabhāge nānākkhaṇesu uppajjati, maggakkhaṇe pana dvīsu dvāresu sattannaṃ kammapathānaṃ vasena uppannāya micchāājīvadussīlyacetanāya padacchedato anuppattisādhanavasena maggaṅgaṃ pūrayamānā ekāva sammāājīvasaṅkhātā kusalaveramaṇi uppajjati.
Here too, because one abstains from transgressions of the bodily door with one mind, and from transgressions of the verbal door with another, therefore, in the preliminary stage, they arise at different moments. But at the moment of the Path, only one wholesome abstinence, called Right Livelihood, arises, fulfilling the Path factor by cutting off the root of the immoral volition of wrong livelihood, which arises in terms of the seven courses of action through the two doors, and thereby preventing its arising.
Ở đây cũng vậy, vì người ấy từ bỏ sự vi phạm qua thân môn bằng một tâm khác, từ bỏ sự vi phạm qua khẩu môn bằng một tâm khác, cho nên trong giai đoạn đầu, chúng sanh khởi ở những sát-na khác nhau; nhưng trong sát-na đạo, chỉ có một thiện chế ngự duy nhất, được gọi là chánh mạng, sanh khởi, làm viên mãn đạo chi theo cách thành tựu sự không sanh khởi bằng việc đoạn trừ tận gốc tác ý tà mạng bất thiện giới đã sanh khởi trong hai môn theo bảy nghiệp lộ.
Ayaṃ sammāājīvo nāma.
This is called Right Livelihood.
Đây được gọi là chánh mạng.
Sammāvāyāmaniddese idha bhikkhūti imasmiṃ sāsane paṭipannako bhikkhu.
In the explanation of Right Effort: Here a bhikkhu means a bhikkhu who practices in this Dispensation.
Trong phần giải về chánh tinh tấn, này các Tỷ-kheo, ở đây là vị Tỷ-kheo đang thực hành trong giáo pháp này.
Anuppannānanti anibbattānaṃ.
Of unarisen means of those not yet produced.
Chưa sanh là chưa khởi lên.
Pāpakānanti lāmakānaṃ.
Of evil means of wretched (things).
Ác là xấu xa.
Akusalānaṃ dhammānanti akosallasambhūtānaṃ dhammānaṃ.
Of unwholesome states means of states born of unskillfulness.
Bất thiện pháp là các pháp sanh từ sự không khéo léo.
Anuppādāyāti na uppādanatthāya.
For their non-arising means for not causing them to arise.
Để không sanh khởi là với mục đích không làm cho sanh khởi.
Chandaṃ janetīti kattukamyatāsaṅkhātaṃ kusalacchandaṃ janeti uppādeti.
He generates desire means he generates wholesome desire, which is called the wish to act, he produces it.
Sanh khởi ý muốn là sanh khởi, làm phát sanh thiện dục được gọi là lòng mong muốn làm.
Vāyamatīti payogaṃ janeti parakkamaṃ karoti.
He endeavors means he generates exertion, he makes supreme effort.
Tinh tấn là sanh khởi sự nỗ lực, thực hiện sự cố gắng.
Vīriyaṃ ārabhatīti kāyikaṃ cetasikaṃ vīriyaṃ karoti.
He arouses energy means he exerts physical and mental energy.
Nỗ lực tinh tấn là thực hiện tinh tấn thuộc thân và thuộc tâm.
Cittaṃ paggaṇhātīti teneva sahajātavīriyena cittaṃ ukkhipati.
He exerts his mind means he uplifts his mind with that co-arisen energy.
Nâng đỡ tâm là nâng tâm lên bằng chính tinh tấn đồng sanh đó.
Padahatīti padhānavīriyaṃ karoti.
He strives means he makes strenuous effort.
Cố gắng là thực hiện tinh tấn nỗ lực.
Paṭipāṭiyā panetāni cattāripi padāni āsevanābhāvanābahulīkammasātaccakiriyāhi yojetabbāni.
These four terms should be connected in order with repeated practice, development, frequent action, and continuous action.
Tuy nhiên, bốn thuật ngữ này nên được áp dụng tuần tự với các hành động thực hành, tu tập, làm cho sung mãn, và làm một cách liên tục.
Uppannānanti anuppannānanti avattabbataṃ āpannānaṃ.
Of arisen means of those that have reached the state of not being described as unarisen.
Đã sanh là đã đến trạng thái không thể nói là "chưa sanh".
Pahānāyāti pajahanatthāya.
For their abandonment means for giving them up.
Để đoạn trừ là với mục đích đoạn trừ.
Anuppannānaṃ kusalānaṃ dhammānanti anibbattānaṃ kosallasambhūtānaṃ dhammānaṃ.
Of unarisen wholesome states means of wholesome states not yet produced, born of skillfulness.
Các thiện pháp chưa sanh là các pháp sanh từ sự khéo léo chưa khởi lên.
Uppādāyāti uppādanatthāya.
For their arising means for causing them to arise.
Để sanh khởi là với mục đích làm cho sanh khởi.
Uppannānanti nibbattānaṃ.
Of arisen means of those that have been produced.
Đã sanh là đã khởi lên.
Ṭhitiyāti ṭhitatthāya.
For their continuance means for their remaining.
Để an trú là với mục đích an trú.
Asammosāyāti anassanatthaṃ.
For their non-disappearance means for them not to perish.
Để không quên lãng là để không mất đi.
Bhiyyobhāvāyāti punappunaṃ bhāvāya.
For their increase means for their repeated existence.
Để tăng trưởng là để phát triển lặp đi lặp lại.
Vepullāyāti vipulabhāvāya.
For their growth means for their expansive existence.
Để quảng đại là để trở nên rộng lớn.
Bhāvanāyāti vaḍḍhiyā.
For their development means for their growth.
Để tu tập là để phát triển.
Pāripūriyāti paripūraṇatthāya.
For their perfection means for their complete fulfillment.
Để viên mãn là với mục đích làm cho trọn vẹn.
Tattha ekaccassa vattaganthadhutaṅgasamādhivipassanānavakammabhavānaṃ aññataravasena kilesā na samudācaranti.
Therein, for some individual, defilements do not occur by way of one of the following: practice of duties, learning the Dhamma, observing dhutaṅga, developing samādhi, cultivating vipassanā, performing new meritorious deeds, or being born in a Brahma realm.
Trong đó, đối với một số người, các phiền não không biểu hiện do một trong các lý do sau: bổn phận, học pháp, đầu đà, định, tuệ, công việc xây dựng mới, hoặc do cảnh giới (sanh).
Kathaṃ?
How is this?
Như thế nào?
Ekacco hi vattasampanno hoti, asīti khandhakavattāni cuddasa mahāvattāni cetiyaṅgaṇabodhiyaṅgaṇapānīyamāḷakauposathāgāraāgantukagamikavattāni ca karontasseva kilesā okāsaṃ na labhanti.
Some bhikkhu is endowed with observances. For that bhikkhu, while performing the eighty Khandhaka observances, the fourteen great observances, and the observances related to the cetiya enclosure, the Bodhi tree enclosure, the water pavilion, the Uposatha hall, and for arriving and departing guests, defilements do not find an opportunity to arise.
Có người đầy đủ bổn phận; khi người ấy đang thực hành tám mươi bổn phận trong các thiên, mười bốn đại bổn phận, và các bổn phận tại sân tháp, sân bồ-đề, nhà nước uống, nhà trai giới, cho khách đến và cho người đi, các phiền não không có cơ hội phát sanh.
Aparabhāge panassa vattāni vissajjetvā bhinnavattassa carato ayonisomanasikāraṃ sativossaggañca āgamma uppajjanti.
But later, when he has abandoned the observances and is living with broken observances, defilements arise in him due to unwise attention and laxity of mindfulness.
Nhưng về sau, khi người ấy từ bỏ các bổn phận và sống với bổn phận bị phá vỡ, chúng sanh khởi do tác ý không như lý và thất niệm.
Evampi asamudācāravasena anuppannā uppajjanti nāma.
Thus, too, defilements that had not arisen previously, arise by way of non-occurrence.
Như vậy, những pháp chưa sanh theo nghĩa chưa biểu hiện được gọi là sanh khởi.
Ekacco ganthayutto hoti, ekampi nikāyaṃ gaṇhāti dvepi tayopi cattāropi pañcapi.
Some bhikkhu is engaged in studies; he learns one Nikāya, or two, or three, or four, or five.
Có người chuyên tâm học pháp, học một bộ Nikāya, hai, ba, bốn, hoặc cả năm bộ.
Tassa tepiṭakaṃ buddhavacanaṃ atthavasena pāḷivasena anusandhivasena pubbāparavasena gaṇhantassa sajjhāyantassa cintentassa vācentassa desentassa pakāsentassa kilesā okāsaṃ na labhanti.
For that bhikkhu, while learning, reciting, contemplating, teaching, expounding, or proclaiming the Tepiṭaka Buddha's word by way of meaning, by way of Pāḷi, by way of connection, and by way of prior and subsequent context, defilements do not find an opportunity.
Khi người ấy học, tụng đọc, suy tư, giảng dạy, thuyết giảng, và làm sáng tỏ lời Phật dạy trong Tam Tạng theo nghĩa, theo văn, theo sự liên kết, theo trước sau, các phiền não không có cơ hội phát sanh.
Aparabhāge panassa ganthakammaṃ pahāya kusītassa carato ayonisomanasikārasativossagge āgamma uppajjanti.
But later, when he has abandoned his studies and is living idly, defilements arise in him due to unwise attention and laxity of mindfulness.
Nhưng về sau, khi người ấy từ bỏ việc học pháp và sống lười biếng, chúng sanh khởi do tác ý không như lý và thất niệm.
Evampi asamudācāravasena anuppannā uppajjanti nāma.
Thus, too, defilements that had not arisen previously, arise by way of non-occurrence.
Như vậy, những pháp chưa sanh theo nghĩa chưa biểu hiện được gọi là sanh khởi.
Kathaṃ ananubhūtārammaṇavasena?
How do they arise by way of an unexperienced object?
Thế nào là theo nghĩa đối tượng chưa từng được kinh nghiệm?
Idhekacco ananubhūtapubbaṃ manāpikādibhedaṃ ārammaṇaṃ labhati, tassa tattha ayonisomanasikārasativossagge āgamma rāgādayo kilesā uppajjanti.
Here, some individual obtains an object, such as a pleasing one, that he has not experienced before. Then, in relation to that object, defilements such as lust arise in him due to unwise attention and laxity of mindfulness.
Ở đây, có người gặp một đối tượng thuộc loại khả ái, v.v., mà trước đây chưa từng kinh nghiệm; nơi người ấy, các phiền não như tham, v.v., sanh khởi do tác ý không như lý và thất niệm đối với đối tượng đó.
Evaṃ ananubhūtārammaṇavasena anuppannā uppajjanti nāma.
Thus, defilements that had not arisen previously, arise by way of an unexperienced object.
Như vậy, do đối tượng chưa từng được kinh nghiệm, các pháp chưa sanh được gọi là sanh khởi.
Evaṃ anuppannānaṃ akusalānaṃ uppāde sati attano anatthaṃ passitvā tesaṃ anuppādāya satipaṭṭhānabhāvanānuyogena paṭhamaṃ sammappadhānaṃ bhāveti, uppannesu pana tesu tesaṃ appahānato attano anatthaṃ passitvā tesaṃ pahānāya dutiyaṃ tatheva sammappadhānaṃ bhāveti.
Thus, when unwholesome states that had not arisen previously arise, seeing his own detriment, he cultivates the first Right Exertion with diligence in the development of mindfulness in order to prevent their arising. But when they have arisen, seeing his own detriment due to their non-abandonment, he cultivates the second Right Exertion in the same way, in order to abandon them.
Như vậy, khi các pháp bất thiện chưa sanh khởi lên, thấy được sự bất lợi cho bản thân, vị ấy tu tập chánh tinh tấn thứ nhất bằng cách nỗ lực tu tập niệm xứ để chúng không sanh khởi. Hơn nữa, khi chúng đã sanh khởi, thấy được sự bất lợi cho bản thân do không đoạn trừ chúng, vị ấy tu tập chánh tinh tấn thứ hai cũng theo cách đó để đoạn trừ chúng.
Anuppannā kusalā dhammāti samathavipassanā ceva maggo ca.
“Wholesome states that have not arisen” are samatha-vipassanā and the Path.
Các pháp thiện chưa sanh là samatha-vipassanā (chỉ-quán) và đạo.
Tesaṃ anuppāde attano anatthaṃ passitvā tesaṃ uppādanatthāya tatheva tatiyaṃ sammappadhānaṃ bhāveti.
When these have not arisen, seeing his own detriment, he cultivates the third Right Exertion in the same way in order to bring them about.
Thấy được sự bất lợi cho bản thân khi chúng chưa sanh, vị ấy tu tập chánh tinh tấn thứ ba cũng theo cách đó để làm cho chúng sanh khởi.
Uppannā kusalā dhammāti samathavipassanāva.
“Wholesome states that have arisen” are samatha-vipassanā.
Các pháp thiện đã sanh chỉ là samatha-vipassanā.
Maggo pana sakiṃ uppajjitvā nirujjhamāno anatthāya saṃvattanako nāma natthi.
However, a path that arises once and then ceases, becoming a cause for harm, does not exist.
Hơn nữa, đạo, sau khi sanh khởi một lần rồi diệt, không được gọi là thứ dẫn đến bất lợi.
So hi phalassa paccayaṃ datvāva nirujjhati.
Indeed, that path ceases only after giving its condition to the fruit.
Bởi vì nó diệt đi sau khi đã trao duyên cho quả.
Tāsaṃ samathavipassanānaṃ nirodhato attano anatthaṃ passitvā tāsaṃ ṭhitiyā tatheva catutthaṃ sammappadhānaṃ bhāveti.
Seeing the harm to oneself from the cessation of those samatha and vipassanā, one develops the fourth right exertion for their continuance.
Thấy được sự bất lợi cho bản thân do sự diệt đi của samatha-vipassanā ấy, vị ấy tu tập chánh tinh tấn thứ tư cũng theo cách đó để chúng được an trú.
Lokuttaramaggakkhaṇe pana ekameva vīriyaṃ.
However, at the moment of the supramundane path, there is only one effort.
Còn trong sát-na đạo siêu thế, chỉ có một tinh tấn duy nhất.
Ye evaṃ anuppannā uppajjeyyuṃ, te yathā neva uppajjanti, evaṃ tesaṃ anuppannānaṃ anuppādakiccaṃ, uppannānañca pahānakiccaṃ sādheti.
Thus, it accomplishes the task of non-arising for those unarisen wholesome states that would otherwise arise, so that they do not arise, and the task of abandoning those unwholesome states that have arisen.
Những pháp nào chưa sanh mà có thể sanh khởi, vị ấy hoàn thành phận sự làm cho những pháp chưa sanh ấy không sanh khởi, và phận sự đoạn trừ những pháp đã sanh, theo cách mà chúng sẽ không bao giờ sanh khởi.
Uppannāti cettha catubbidhaṃ uppannaṃ vattamānuppannaṃ bhūtāpagatuppannaṃ okāsakatuppannaṃ bhūmiladdhuppannanti.
Here, arisen (uppannā) is fourfold: presently arisen, past-ceased-arisen, opportunity-made-arisen, and foundation-obtained-arisen.
Và ở đây, đã sanh có bốn loại: đã sanh trong hiện tại, đã sanh rồi qua đi, đã sanh do có cơ hội, và đã sanh do đạt được cảnh giới.
Tattha sabbampi uppādajarābhaṅgasamaṅgisaṅkhātaṃ vattamānuppannaṃ nāma.
Among these, all phenomena endowed with arising, aging, and dissolution are called presently arisen.
Trong đó, tất cả những gì được gọi là có đủ sanh, già, diệt thì được gọi là đã sanh trong hiện tại.
Ārammaṇarasaṃ anubhavitvā niruddhaṃ anubhūtāpagatasaṅkhātaṃ kusalākusalaṃ uppādādittayamanuppatvā niruddhaṃ bhutvāpagatasaṅkhātaṃ sesasaṅkhatañca bhūtāpagatuppannaṃ nāma.
Wholesome and unwholesome kamma that has experienced the taste of an object and ceased, described as having experienced and departed; and other conditioned phenomena that have reached the three moments of arising and so forth and ceased, described as having been and departed, are called past-ceased-arisen.
Pháp thiện và bất thiện đã diệt sau khi kinh nghiệm vị của đối tượng, được gọi là đã kinh nghiệm rồi qua đi; và pháp hữu vi còn lại đã diệt sau khi trải qua ba giai đoạn sanh v.v., được gọi là đã có rồi qua đi, thì được gọi là đã sanh rồi qua đi.
‘‘Yānissa tāni pubbe katāni kammānī’’ti evamādinā (ma. ni. 3.248) nayena vuttaṃ kammaṃ atītampi samānaṃ aññaṃ vipākaṃ paṭibāhitvā attano vipākassa okāsaṃ katvā ṭhitattā tathā katokāsañca vipākaṃ anuppannampi samānaṃ evaṃ kate okāse ekantena uppajjanato okāsakatuppannaṃ nāma.
Kamma spoken of in the manner of "those deeds he formerly did," even though past, having set aside other results and made an opportunity for its own result, thus having made an opportunity, and its result, even though unarisen, definitely arising in the opportunity thus made, is called opportunity-made-arisen.
Nghiệp được nói đến qua phương pháp như "Những nghiệp nào của người ấy đã được làm từ trước" v.v., dù đã là quá khứ, nhưng do nó ngăn cản quả khác và tạo cơ hội cho quả của chính nó, và quả đã được tạo cơ hội như vậy, dù chưa sanh, nhưng chắc chắn sẽ sanh khởi khi cơ hội đã được tạo ra, nên được gọi là đã sanh do có cơ hội.
Tāsu tāsu bhūmīsu asamūhataṃ akusalaṃ bhūmiladdhuppannaṃ nāma.
Unwholesome states that have not been uprooted in those various planes of existence are called foundation-obtained-arisen (bhūmiladdhuppanna).
Pháp bất thiện chưa được nhổ bỏ trong các cảnh giới này khác thì được gọi là đã sanh do đạt được cảnh giới.
Ettha ca bhūmiyā bhūmiladdhassa ca nānattaṃ veditabbaṃ – bhūmīti hi vipassanāya ārammaṇabhūtā tebhūmakā pañcakkhandhā.
Here, the distinction between the foundation (bhūmi) and that which has obtained the foundation (bhūmiladdha) should be understood: foundation refers to the five aggregates of the three planes of existence, which are the objects of vipassanā.
Và ở đây, cần phải biết sự khác biệt giữa cảnh giới (bhūmi) và cái đạt được cảnh giới (bhūmiladdha) – cảnh giới là năm uẩn trong ba cõi, là đối tượng của vipassanā.
Bhūmiladdhaṃ nāma tesu khandhesu uppattirahaṃ kilesajātaṃ.
That which has obtained the foundation refers to the class of defilements fit to arise in those aggregates.
Cái đạt được cảnh giới là tập hợp phiền não có khả năng sanh khởi trong các uẩn ấy.
Tena hi sā bhūmiladdhā nāma hotīti tasmā bhūmiladdhanti vuccati.
Because that foundation is obtained by those defilements, it is called "bhūmiladdha."
Bởi vì cảnh giới ấy được gọi là đã được đạt đến bởi nó, cho nên nó được gọi là cái đạt được cảnh giới.
Sā ca kho na ārammaṇavasena.
And that foundation is not obtained in the sense of being an object.
Và điều đó không phải theo phương diện đối tượng.
Ārammaṇavasena hi sabbepi atītānāgate pariññātepi ca khīṇāsavānaṃ khandhe ārabbha kilesā uppajjanti.
For, in the sense of being an object, defilements arise even with respect to the aggregates of Arahants, which are past and future, and have been fully understood.
Bởi vì theo phương diện đối tượng, phiền não sanh khởi khi lấy các uẩn của bậc Vô Lậu làm đối tượng, dù tất cả chúng là quá khứ, vị lai hay đã được liễu tri.
Yadi ca taṃ bhūmiladdhaṃ nāma siyā, tassa appaheyyato na koci bhavamūlaṃ pajaheyya.
If that class of defilements were called "bhūmiladdha," then no one would abandon the root of existence, because it would be unabandonable.
Và nếu đó được gọi là cái đạt được cảnh giới, thì do không thể đoạn trừ nó, không ai có thể từ bỏ được gốc rễ của hữu.
Vatthuvasena pana bhūmiladdhaṃ veditabbaṃ.
However, "bhūmiladdha" should be understood in the sense of a basis.
Nhưng cần phải hiểu cái đạt được cảnh giới theo phương diện vật (vatthu).
Yattha yattha hi vipassanāya apariññātā khandhā uppajjanti, tattha tattha uppādato pabhuti tesu vaṭṭamūlaṃ kilesajātaṃ anuseti.
Wherever aggregates not fully understood by vipassanā arise, there, from the moment of their arising, the class of defilements, which is the root of the cycle of existence, lies dormant in them.
Bởi vì, ở bất cứ nơi đâu các uẩn chưa được liễu tri bởi vipassanā sanh khởi, thì ở đó, tập hợp phiền não là gốc rễ của vòng luân hồi ngủ ngầm trong chúng từ lúc sanh khởi.
Taṃ appahīnaṭṭhena bhūmiladdhanti veditabbaṃ.
That class of defilements should be understood as "bhūmiladdha" due to its unabandoned state.
Cần phải hiểu rằng nó là cái đạt được cảnh giới theo nghĩa là chưa được đoạn trừ.
Tattha ca yassa yesu khandhesu appahīnaṭṭhena anusayitā kilesā, tassa te eva khandhā tesaṃ kilesānaṃ vatthu, na aññesaṃ santakā khandhā.
Among these, for a person in whose aggregates defilements lie dormant as unabandoned, those very aggregates are the basis for those defilements, not the aggregates belonging to others.
Và trong đó, đối với người nào mà các phiền não ngủ ngầm trong các uẩn nào theo nghĩa là chưa được đoạn trừ, thì chính các uẩn đó là vật của các phiền não ấy, chứ không phải các uẩn thuộc về người khác.
Atītakkhandhesu ca appahīnānusayitānaṃ kilesānaṃ atītakkhandhāva vatthu, na itare.
And for defilements that lie dormant as unabandoned in past aggregates, the past aggregates themselves are the basis, not the others.
Và đối với các phiền não ngủ ngầm chưa được đoạn trừ trong các uẩn quá khứ, thì chính các uẩn quá khứ là vật, chứ không phải các uẩn khác.
Esa nayo anāgatādīsu.
The same method applies to future aggregates and so forth.
Phương pháp này cũng áp dụng cho các uẩn vị lai v.v.
Tathā kāmāvacarakkhandhesu appahīnānusayitānaṃ kilesānaṃ kāmāvacarakkhandhā eva vatthu, na itare.
Similarly, for defilements that lie dormant as unabandoned in aggregates of the sensuous realm, the aggregates of the sensuous realm themselves are the basis, not the others.
Tương tự, đối với các phiền não ngủ ngầm chưa được đoạn trừ trong các uẩn cõi Dục, thì chính các uẩn cõi Dục là vật, chứ không phải các uẩn khác.
Esa nayo rūpārūpāvacaresu.
The same method applies to the fine-material and immaterial realms.
Phương pháp này cũng áp dụng cho các uẩn cõi Sắc và Vô Sắc.
Sotāpannādīsu pana yassa yassa ariyapuggalassa khandhesu taṃ taṃ vaṭṭamūlaṃ kilesajātaṃ tena tena maggena pahīnaṃ, tassa tassa te te khandhā pahīnānaṃ tesaṃ tesaṃ vaṭṭamūlakānaṃ kilesānaṃ avatthuto bhūmīti saṅkhaṃ na labhanti.
However, in the case of stream-enterers and so forth, for whichever noble person, in whose aggregates that particular class of defilements, the root of the cycle of existence, has been abandoned by that particular path, for that person, those aggregates do not attain the designation of "foundation" as they are not a basis for those abandoned defilements, which are the root of the cycle of existence.
Còn đối với các bậc Tu-đà-hoàn v.v., đối với bậc Thánh nhân nào mà tập hợp phiền não là gốc rễ của vòng luân hồi trong các uẩn đã được đoạn trừ bởi đạo tương ứng, thì các uẩn của vị ấy không được gọi là cảnh giới (bhūmi) vì chúng không còn là vật cho các phiền não gốc rễ của vòng luân hồi đã được đoạn trừ ấy.
Puthujjanassa sabbaso vaṭṭamūlakilesānaṃ appahīnattā yaṃkiñci kariyamānaṃ kammaṃ kusalamakusalaṃ vā hoti, iccassa kammakilesapaccayāva vaṭṭaṃ vaṭṭati, tassa tasseva taṃ vaṭṭamūlaṃ rūpakkhandheyeva, na vedanādīsu.
For an ordinary person, since the defilements that are the root of the cycle of existence are entirely unabandoned, whatever kamma, wholesome or unwholesome, is performed, for him, the cycle of existence revolves solely due to kamma and defilements as conditions.
Đối với phàm phu, do các phiền não gốc rễ của vòng luân hồi hoàn toàn chưa được đoạn trừ, bất kỳ nghiệp nào được làm, dù thiện hay bất thiện, đều phát sanh; do đó, vòng luân hồi của người ấy xoay vần chỉ do duyên nghiệp và phiền não. Không nên nói rằng gốc rễ của vòng luân hồi ấy chỉ có trong sắc uẩn, chứ không có trong thọ uẩn v.v.
Viññāṇakkhandheyeva vā, na rūpakkhandhādīsūti na vattabbaṃ.
It should not be said that for that very person, that root of the cycle of existence is only in the aggregate of form, and not in feeling and so forth, or only in the aggregate of consciousness, and not in the aggregate of form and so forth.
hoặc chỉ có trong thức uẩn, chứ không có trong sắc uẩn v.v.
Avisesena pañcasupi khandhesu anusayitattā.
Because it lies dormant in all five aggregates without distinction.
Vì nó ngủ ngầm trong cả năm uẩn một cách không phân biệt.
Kathaṃ?
How?
Như thế nào?
Pathavīrasādi viya rukkhe.
Like the sap of the earth in a tree.
Giống như vị đất v.v. trong cây.
Yathā hi mahārukkhe pathavītalaṃ adhiṭṭhāya pathavīrasañca āporasañca nissāya tappaccayā mūlakhandhasākhāpasākhāpallavapalāsapupphaphalehi vaḍḍhitvā nabhaṃ pūretvā yāva kappāvasānā bījaparamparāya rukkhapaveṇiṃ santānayamāne ṭhite taṃ pathavīrasādimūleyeva, na khandhādīsu.
Just as a great tree, standing on the surface of the earth, relying on the essence of the earth and the essence of water, grows through these conditions with its roots, trunk, branches, sub-branches, shoots, leaves, flowers, and fruits, filling the sky and maintaining its lineage through a succession of seeds until the end of a world-cycle, that essence of the earth and so on is in the roots alone, not in the trunk and other parts.
Giống như một cây lớn, đứng vững trên mặt đất, nương vào vị đất và vị nước, nhờ duyên đó mà phát triển với rễ, thân, cành lớn, cành nhỏ, chồi, lá, hoa, quả, vươn cao chiếm cả bầu trời, và duy trì dòng giống cây qua các thế hệ hạt giống cho đến hết kiếp; khi đó, không thể nói rằng vị đất v.v. ấy chỉ có trong rễ, chứ không có trong thân cây v.v.
Phaleyeva vā, na mūlādīsūti na vattabbaṃ.
Nor should it be said that it is only in the fruits, and not in the roots and other parts.
hoặc chỉ có trong quả, chứ không có trong rễ v.v.
Avisesena sabbesu mūlādīsu anugatattāti.
Because it pervades all, the roots and so on, without distinction.
Vì nó thấm nhuần trong tất cả rễ v.v. một cách không phân biệt.
Yathā pana tasseva rukkhassa pupphaphalādīsu nibbinno koci puriso catūsu disāsu maṇḍūkakaṇṭakaṃ nāma visakaṇṭakaṃ ākoṭeyya, atha so rukkho tena visasamphassena phuṭṭho pathavīrasaāporasānaṃ pariyādinnattā appasavadhammataṃ āgamma puna santānaṃ nibbattetuṃ na sakkuṇeyya, evameva khandhappavattiyaṃ nibbinno kulaputto tassa purisassa catūsu disāsu rukkhe visayojanaṃ viya attano santāne catumaggabhāvanaṃ ārabhati.
However, just as if a certain person, disgusted with the flowers and fruits of that same tree, were to drive a poisonous thorn called a maṇḍūkakaṇṭaka into it in the four directions, then that tree, afflicted by the touch of that poison, would be unable to produce further growth, having exhausted the essence of the earth and water, and thus having the nature of not flourishing; even so, a noble son, disgusted with the continuation of the aggregates, undertakes the development of the four paths in his own continuum, just as that person applies poison to the tree in the four directions.
Nhưng, giống như một người nào đó, chán ngán hoa quả v.v. của chính cây đó, có thể đóng một loại gai độc gọi là gai cóc vào cây từ bốn phía, rồi cây đó, bị nhiễm độc, do vị đất và vị nước bị cạn kiệt, sẽ trở nên không thể sinh sôi và không thể tạo ra dòng dõi mới; cũng vậy, một thiện nam tử, chán ngán sự diễn tiến của các uẩn, bắt đầu tu tập bốn đạo trong dòng tâm của mình, giống như người kia tẩm độc vào cây từ bốn phía.
Athassa so khandhasantāno tena catumaggavisasamphassena sabbaso vaṭṭamūlakilesānaṃ pariyādinnattā kiriyasabhāvamattaṃ upagatakāyakammādisabbakammappabhedo hutvā āyatiṃ punabbhavānabhinibbattanadhammataṃ āgamma bhavantarasantānaṃ nibbattetuṃ na sakkoti, kevalaṃ carimaviññāṇanirodhena nirindhano viya jātavedo anupādāno parinibbāyati.
Then, due to the touch of that poison, which is the four paths, that continuum of aggregates, having completely exhausted the root defilements of the cycle of existence, becomes merely the nature of kamma-producing consciousness (kiriya-citta), having all types of kamma such as bodily kamma, and is unable to produce a continuum of another existence in the future, having attained the nature of not giving rise to further rebirth. It simply attains parinibbāna, like a fire without fuel, without clinging.
Khi đó, dòng uẩn của vị ấy, do sự tiếp xúc với chất độc của bốn đạo, do các phiền não gốc rễ của vòng luân hồi đã hoàn toàn bị cạn kiệt, trở thành các loại nghiệp như thân nghiệp v.v. chỉ còn là trạng thái duy tác, và do đạt đến trạng thái không tái sanh trong tương lai, không thể tạo ra dòng dõi ở kiếp sau, mà chỉ đơn thuần, với sự diệt của thức cuối cùng, vị ấy nhập Vô Dư Niết-bàn, không còn chất đốt, giống như ngọn lửa không còn nhiên liệu.
Evaṃ bhūmiyā bhūmiladdhassa ca nānattaṃ veditabbaṃ.
Thus, the distinction between bhūmi and bhūmiladdha should be understood.
Như vậy, cần phải biết sự khác biệt giữa cảnh giới và cái đạt được cảnh giới.
Aparampi catubbidhaṃ uppannaṃ samudācāruppannaṃ ārammaṇādhiggahituppannaṃ avikkhambhituppannaṃ asamūhatuppannanti.
Furthermore, there are four kinds of uppanna: samudācāruppanna, ārammaṇādhiggahituppanna, avikkhambhituppanna, and asamūhatuppanna.
Lại nữa, có bốn loại đã sanh khác: đã sanh do biểu hiện, đã sanh do đối tượng được nắm bắt, đã sanh do chưa được chế ngự, và đã sanh do chưa được nhổ bỏ.
Tattha vattamānuppannameva samudācāruppannaṃ.
Among these, samudācāruppanna is simply the uppanna that is currently arisen.
Trong đó, chính cái đã sanh trong hiện tại là đã sanh do biểu hiện.
Cakkhādīnaṃ pana āpāthagate ārammaṇe pubbabhāge anuppajjamānampi kilesajātaṃ ārammaṇassa adhiggahitattā eva aparabhāge ekantena uppattito ārammaṇādhiggahituppannanti vuccati.
But a collection of defilements, even if not yet arisen in the prior phase when an object has come into the range of the eye and other senses, is called ārammaṇādhiggahituppanna because it is grasped by the object, and therefore will certainly arise in the later phase.
Hơn nữa, khi đối tượng đi vào tầm hoạt động của mắt v.v., dù tập hợp phiền não chưa sanh khởi trong giai đoạn đầu, nhưng do đối tượng đã được nắm bắt, nó chắc chắn sẽ sanh khởi trong giai đoạn sau, nên được gọi là đã sanh do đối tượng được nắm bắt.
Samathavipassanānaṃ aññataravasena avikkhambhitaṃ kilesajātaṃ cittasantatimanārūḷhampi uppattinivārakassa hetuno abhāvā avikkhambhituppannaṃ nāma.
A collection of defilements that has not been suppressed by either samatha or vipassanā, even if it has not yet entered the mental continuum, is called avikkhambhituppanna due to the absence of a cause preventing its arising.
Tập hợp phiền não chưa được chế ngự bằng một trong hai phương pháp samatha hoặc vipassanā, dù chưa khởi lên trong dòng tâm, nhưng do không có nhân ngăn cản sự sanh khởi, nên được gọi là đã sanh do chưa được chế ngự.
Samathavipassanāvasena pana vikkhambhitampi ariyamaggena asamūhatattā uppattidhammataṃ anatītattā asamūhatuppannanti vuccati.
However, even if suppressed by samatha or vipassanā, a collection of defilements is called asamūhatuppanna because it has not been eradicated by the noble path and has not transcended the nature of arising.
Vả lại, phiền não dù đã được trấn áp bằng sức mạnh của samatha và vipassanā, nhưng vì chưa được nhổ bật gốc rễ bởi Thánh đạo, vì chưa vượt qua được pháp tánh của sự sanh khởi, nên được gọi là asamūhatuppanna (sanh khởi do chưa bị nhổ bật gốc rễ).
Tividhampi cetaṃ ārammaṇādhiggahitāvikkhambhitāsamūhatuppannaṃ bhūmiladdheneva saṅgahaṃ gacchatīti veditabbaṃ.
It should be understood that these three kinds of uppanna — ārammaṇādhiggahita, avikkhambhita, and asamūhata — are included within bhūmiladdha.
Và nên biết rằng, cả ba loại sanh khởi này – ārammaṇādhiggahita (sanh khởi do đối tượng chi phối), avikkhambhita (sanh khởi do chưa bị trấn áp), và asamūhata (sanh khởi do chưa bị nhổ bật gốc rễ) – đều được bao gồm trong bhūmiladdha (sanh khởi do đạt được cảnh giới).
Atha maggakkhaṇe kathaṃ anuppannānaṃ kusalānaṃ uppādāya bhāvanā hoti, kathañca uppannānaṃ ṭhitiyāti?
Then, at the moment of the path, how is there development for the arising of unarisen wholesome states, and how for the persistence of arisen ones?
Vậy, trong sát-na đạo, sự tu tập để làm sanh khởi các pháp thiện chưa sanh khởi, và sự tu tập để làm an trú các pháp thiện đã sanh khởi diễn ra như thế nào?
Maggappavattiyā eva.
By the very occurrence of the path.
Chính nhờ sự diễn tiến của đạo.
Maggo hi pavattamāno pubbe anuppannapubbattā anuppanno nāma vuccati.
For the path, when it is occurring, is called "unarisen" because it has not arisen before.
Bởi vì, đạo khi đang diễn tiến, do trước đây chưa từng sanh khởi, nên được gọi là chưa sanh khởi (anuppanna).
Anāgatapubbañhi ṭhānaṃ āgantvā ananubhūtapubbaṃ vā ārammaṇaṃ anubhavitvā vattāro bhavanti ‘‘anāgataṭṭhānaṃ āgatamha, ananubhūtaṃ ārammaṇaṃ anubhavāmā’’ti.
Indeed, people say, "We have come to a place we have not been to before, we are experiencing an object we have not experienced before," having come to a place not previously arrived at, or having experienced an object not previously experienced.
Thật vậy, những người đến một nơi chưa từng đến, hoặc trải nghiệm một đối tượng chưa từng trải nghiệm, thường nói rằng: “Chúng tôi đã đến một nơi chưa từng đến, chúng tôi đang trải nghiệm một đối tượng chưa từng trải nghiệm.”
Yāvassa pavatti, ayameva ṭhiti nāmāti ṭhitiyā bhāvetītipi vattuṃ vaṭṭati.
And it is proper to say that "as long as it occurs, this is called persistence," and thus one develops for persistence.
Chừng nào sự diễn tiến của nó còn, thì đây chính là sự an trú (ṭhiti), do đó cũng có thể nói rằng vị ấy tu tập để an trú.
Evametassa bhikkhuno idaṃ lokuttaramaggakkhaṇe ekameva vīriyaṃ ‘‘anuppannānaṃ pāpakānaṃ akusalānaṃ dhammānaṃ anuppādāyā’’tiādīni cattāri nāmāni labhati.
In this way, for that bhikkhu, this one effort at the moment of the supramundane path receives four names, such as "for the non-arising of unarisen evil, unwholesome states."
Như vậy, đối với vị tỳ khưu này, chỉ một tinh tấn duy nhất trong sát-na đạo siêu thế này lại nhận được bốn tên gọi là “để không cho các pháp ác, bất thiện chưa sanh được sanh khởi” v.v...
Ayaṃ lokuttaramaggakkhaṇe sammappadhānakathā.
This is the discourse on sammappadhāna at the moment of the supramundane path.
Đây là phần trình bày về Chánh Cần trong sát-na đạo siêu thế.
Evamettha lokiyalokuttaramissakā sammappadhānā niddiṭṭhāti.
Thus, here, sammappadhāna that are mixed with mundane and supramundane are described.
Như vậy, ở đây, các Chánh Cần được trình bày là sự pha trộn giữa hiệp thế và siêu thế.
Sammāsatiniddese kāyeti rūpakāye.
In the explanation of Right Mindfulness, " kāya" refers to the rūpakāya.
Trong phần giải về Chánh Niệm, kāye (trong thân) có nghĩa là trong sắc thân.
Rūpakāyo hi idha aṅgapaccaṅgānaṃ kesādīnañca dhammānaṃ samūhaṭṭhena hatthikāyarathakāyādayo viya kāyoti adhippeto.
Indeed, here, the rūpakāya is intended as "kāya" in the sense of a collection of major and minor limbs and of phenomena such as hairs, just like an elephant's body or a chariot's body.
Bởi vì sắc thân ở đây, do ý nghĩa là sự tập hợp của các pháp như các chi phần lớn nhỏ và tóc v.v..., được hiểu là thân (kāya), giống như thân voi, thân xe v.v...
Yathā ca samūhaṭṭhena, evaṃ kucchitānaṃ āyaṭṭhena.
And just as it is in the sense of a collection, so too it is in the sense of being the source of repulsive things.
Và cũng như do ý nghĩa là sự tập hợp, nó còn có ý nghĩa là nơi phát sanh của những thứ đáng ghê tởm.
Kucchitānañhi paramajegucchānaṃ so āyotipi kāyo.
Indeed, that body is also "kāya" in the sense of being the source of extremely repulsive things.
Bởi vì nó là nơi phát sanh (āya) của những thứ đáng ghê tởm, vô cùng đáng ghê tởm, nên cũng là thân (kāya).
Āyoti uppattideso.
" Āya" means place of origin.
Āya có nghĩa là nơi sanh khởi.
Tatrāyaṃ vacanattho – āyanti tatoti āyo.
Here is the etymology: "They come into it, therefore it is āya."
Ở đây, cách giải thích từ ngữ là: “Āyanti tato” (chúng đến từ đó), nên là “āyo” (nơi phát sanh).
Ke āyanti?
Who come into it?
Những gì đến?
Kucchitā kesādayo.
The repulsive hairs and so forth.
Những thứ đáng ghê tởm như tóc v.v...
Iti kucchitānaṃ āyoti kāyo.
Thus, it is "kāya" as the source of repulsive things.
Do đó, “kucchitānaṃ āyo” (nơi phát sanh của những thứ đáng ghê tởm), nên là “kāyo” (thân).
Kāyānupassīti kāyaṃ anupassanasīlo, kāyaṃ vā anupassamāno.
" Kāyānupassī" means one who is accustomed to contemplating the body, or one who contemplates the body.
Kāyānupassī (quán thân) có nghĩa là người có thói quen quán chiếu thân, hoặc người đang quán chiếu thân.
Kāyeti ca vatvāpi puna kāyānupassīti dutiyaṃ kāyaggahaṇaṃ asammissato vavatthānaghanavinibbhogādidassanatthaṃ katanti veditabbaṃ.
It should be understood that even after saying "in the body" (kāye), the second mention of "body" (kāyānupassī) is made to show the distinct demarcation and the detailed analysis of the aggregate, and so forth.
Và nên biết rằng, sau khi đã nói kāye (trong thân), việc dùng từ “kāya” lần thứ hai trong kāyānupassī được thực hiện nhằm mục đích chỉ ra sự phân định không lẫn lộn, sự phân rã khối đặc, v.v...
Tena na kāye vedanānupassī cittadhammānupassī vā, atha kho kāyānupassīyevāti kāyasaṅkhāte vatthusmiṃ kāyānupassanākārasseva dassanena asammissato vavatthānaṃ dassitaṃ hoti.
By this, it is shown that one does not contemplate feelings or mind-states in the body, but rather contemplates the body itself, thereby showing the distinct demarcation by presenting only the aspect of body-contemplation in the object called "body."
Do đó, vị ấy không phải là người quán thọ, quán tâm, hay quán pháp trong thân, mà chính là người quán thân. Như vậy, bằng cách chỉ ra sự quán chiếu chính tự thân trong đối tượng được gọi là thân, sự phân định không lẫn lộn đã được chỉ rõ.
Tathā na kāye aṅgapaccaṅgavinimuttaekadhammānupassī, nāpi kesalomādivinimuttaitthipurisānupassī.
Similarly, one does not contemplate a single phenomenon separate from the major and minor limbs in the body, nor does one contemplate a man or woman separate from hairs, body-hairs, and so forth.
Tương tự, vị ấy không phải là người quán một pháp duy nhất tách rời khỏi các chi phần lớn nhỏ trong thân, cũng không phải là người quán người nam hay người nữ tách rời khỏi tóc, lông v.v...
Yopi cettha kesalomādiko bhūtupādāyasamūhasaṅkhāto kāyo, tatthāpi na bhūtupādāyavinimuttaekadhammānupassī, atha kho rathasambhārānupassako viya aṅgapaccaṅgasamūhānupassī, nagarāvayavānupassako viya kesalomādisamūhānupassī, kadalikkhandhapattavaṭṭivinibhujjako viya rittamuṭṭhiviniveṭhako viya ca bhūtupādāyasamūhānupassīyevāti samūhavaseneva kāyasaṅkhātassa vatthuno nānappakārato dassanena ghanavinibbhogo dassito hoti.
Even the body here, which is a collection of primary elements and derivatives like hairs and body-hairs, is not contemplated as a single phenomenon separate from the primary elements and derivatives; rather, just as one contemplates the components of a chariot, one contemplates the collection of major and minor limbs; just as one contemplates the parts of a city, one contemplates the collection of hairs, body-hairs, and so forth; and just as one peels the layers of a banana trunk or unravels an empty fist, one contemplates the collection of primary elements and derivatives. Thus, by showing the object called "body" in various ways, primarily as an aggregate, the detailed analysis of the aggregate is shown.
Và ngay cả đối với thân này, được gọi là sự tập hợp của các đại và các pháp do đại tạo thành như tóc, lông v.v..., vị ấy cũng không phải là người quán một pháp duy nhất tách rời khỏi các đại và các pháp do đại tạo thành; mà đúng hơn, vị ấy chính là người quán sự tập hợp của các chi phần lớn nhỏ như người xem xét các bộ phận của cỗ xe, là người quán sự tập hợp của tóc, lông v.v... như người xem xét các thành phần của một thành phố, và là người quán sự tập hợp của các đại và các pháp do đại tạo thành như người bóc tách từng lớp bẹ của thân cây chuối hay như người mở một nắm tay rỗng. Như vậy, bằng cách quán chiếu đối tượng được gọi là thân theo nhiều cách khác nhau chỉ thuần túy là sự tập hợp, sự phân rã khối đặc đã được chỉ rõ.
Na hettha yathāvuttasamūhavinimutto kāyo vā itthī vā puriso vā añño vā koci dhammo dissati, yathāvuttadhammasamūhamatteyeva pana tathā tathā sattā micchābhinivesaṃ karonti.
For here, no body, woman, man, or any other phenomenon separate from the aforementioned aggregate is seen; rather, beings mistakenly conceive in various ways only in the mere aggregate of the aforementioned phenomena.
Bởi vì ở đây, không có thân, người nữ, người nam, hay bất kỳ pháp nào khác được thấy tách rời khỏi sự tập hợp đã nói; mà chúng sanh chỉ chấp thủ sai lầm theo những cách như vậy đối với chính sự tập hợp của các pháp đã nói mà thôi.
Tenāhu porāṇā –
Therefore, the ancients said:
Vì thế, các bậc cổ nhân đã nói:
Aniccadukkhānattāsubhākārasamūhānupassīyevāti vuttaṃ hoti.
It is said that one contemplates the aggregate of impermanent, suffering, non-self, and unattractive aspects.
có nghĩa là, vị ấy chính là người quán sự tập hợp của các khía cạnh vô thường, khổ, vô ngã, bất tịnh.
Atha vā yvāyaṃ mahāsatipaṭṭhāne ‘‘idha, bhikkhave, bhikkhu araññagato vā rukkhamūlagato vā…pe… so satova assasatī’’tiādinā (dī. ni. 2.374; ma. ni. 1.107) nayena assāsapassāsādi cuṇṇakajātaaṭṭhikapariyosāno kāyo vutto, yo ca parato satipaṭṭhānakathāyaṃ ‘‘idhekacco pathavīkāyaṃ aniccato anupassati, āpokāyaṃ, tejokāyaṃ, vāyokāyaṃ, kesakāyaṃ, lomakāyaṃ, chavikāyaṃ, cammakāyaṃ, maṃsakāyaṃ, ruhirakāyaṃ, nhārukāyaṃ, aṭṭhikāyaṃ, aṭṭhimiñjakāya’’nti (paṭi. ma. 3.35) kāyo vutto, tassa sabbassa imasmiṃyeva kāye anupassanato kāye kāyānupassīti evampi attho daṭṭhabbo.
Alternatively, the body described in the Mahāsatipaṭṭhāna Sutta, beginning with "Here, bhikkhus, a bhikkhu gone to the forest or to the root of a tree... he breathes in mindfully" and ending with the minutest bone fragments (breathings-in and out, etc.), and the body described later in the Satipaṭṭhāna-kathā as "Here, some contemplate the earth element as impermanent, the water element, the fire element, the air element, the hair element, the body-hair element, the skin element, the hide element, the flesh element, the blood element, the sinew element, the bone element, the bone-marrow element," all of this body is contemplated in this very body; thus, this meaning of "contemplating the body in the body" should also be understood.
Hoặc là, trong kinh Đại Niệm Xứ, thân được nói đến theo phương pháp bắt đầu bằng “Này các Tỳ khưu, ở đây, vị Tỳ khưu đi đến khu rừng, hoặc đi đến gốc cây... vị ấy thở vào chánh niệm...” v.v..., từ hơi thở vào ra cho đến cuối cùng là xương biến thành bột; và sau đó, trong phần thuyết về niệm xứ, thân lại được nói đến: “Ở đây, có người quán địa đại là vô thường, quán thủy đại, hỏa đại, phong đại, thân tóc, thân lông, thân da, thân bì, thân thịt, thân máu, thân gân, thân xương, thân tủy xương,” do quán chiếu tất cả các thân đó ngay trong chính thân này, nên cũng nên hiểu ý nghĩa là “kāye kāyānupassī” (quán thân trong thân).
Kāye kāyānupassīti assāsapassāsakāyādike bahudhā vutte kāye ekekakāyānupassī.
"Kāye kāyānupassī" (contemplating the body in the body) means contemplating one or another of the various types of body, such as the body of in-breaths and out-breaths, as explained in many ways.
Kāye kāyānupassī (quán thân trong thân): trong các thân được nói đến một cách đa dạng như thân hơi thở vào ra v.v..., vị ấy là người quán chiếu từng thân một.
Viharatīti catūsu iriyāpathavihāresu aññataravihārasamāyogaparidīpanametaṃ, ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā apatamānaṃ attānaṃ harati pavattetīti attho.
"Viharati" (dwells) indicates the association with one of the four postures (iriyāpatha-vihāra); the meaning is that one carries on and maintains oneself, cutting off the discomfort of one posture with another posture, not allowing oneself to fall or perish.
Viharati (trú): đây là sự chỉ rõ sự gắn liền với một trong bốn loại trú bằng oai nghi. Có nghĩa là, vị ấy duy trì, làm cho tự thân mình tiếp diễn mà không gục ngã, bằng cách cắt đứt sự đau nhức của một oai nghi này bằng một oai nghi khác.
Ātāpīti kāyapariggāhakavīriyasamāyogaparidīpanametaṃ.
"Ātāpī" (ardent) indicates the association with energy (vīriya) that comprehends the body.
Ātāpī (nhiệt tâm): đây là sự chỉ rõ sự gắn liền với tinh tấn, yếu tố nắm bắt thân.
So hi yasmā tasmiṃ samaye yaṃ taṃ vīriyaṃ tīsu bhavesu kilesānaṃ ātāpanato ātāpoti vuccati, tena samannāgato hoti, tasmā ‘‘ātāpī’’ti vuccati.
Indeed, because the energy at that time is called "ātāpa" (ardor) due to its burning up of defilements in the three planes of existence, and one is endowed with it, therefore one is called "ātāpī".
Bởi vì, vào thời điểm đó, vị ấy được trang bị tinh tấn, mà tinh tấn đó được gọi là ātāpa (sự nhiệt tâm) do nó làm thiêu đốt các phiền não trong ba cõi, nên vị ấy được gọi là “ātāpī” (người nhiệt tâm).
Sampajānoti kāyapariggāhakena sampajaññasaṅkhātena ñāṇena samannāgato.
"Sampajāno" (clearly comprehending) means endowed with the knowledge called clear comprehension (sampajañña) that comprehends the body.
Sampajāno (tỉnh giác): được trang bị trí tuệ, được gọi là tỉnh giác, yếu tố nắm bắt thân.
Satimāti kāyapariggāhikāya satiyā samannāgato.
"Satimā" (mindful) means endowed with mindfulness (sati) that comprehends the body.
Satimā (chánh niệm): được trang bị niệm, yếu tố nắm bắt thân.
Ayaṃ pana yasmā satiyā ārammaṇaṃ pariggahetvā paññāya anupassati.
This person, being mindful, apprehends the object and contemplates with wisdom.
Vả lại, vị ấy, sau khi dùng niệm để nắm bắt đối tượng, liền dùng trí tuệ để quán chiếu.
Na hi sativirahitassa anupassanā nāma atthi.
For there is no contemplation for one devoid of mindfulness.
Bởi vì, đối với người thiếu niệm, không thể có sự quán chiếu.
Tenevāha – ‘‘satiñca khvāhaṃ, bhikkhave, sabbatthikaṃ vadāmī’’ti (saṃ. ni. 5.234).
That is why it is said: "Mindfulness, bhikkhus, I declare to be essential everywhere."
Vì thế, Ngài đã nói – “Này các Tỳ-khưu, Ta tuyên bố rằng niệm là điều cần thiết trong mọi trường hợp.”
Tasmā ettha ‘‘kāye kāyānupassī viharatī’’ti ettāvatā kāyānupassanāsatipaṭṭhānakammaṭṭhānaṃ vuttaṃ hoti.
Therefore, here, by "kāye kāyānupassī viharati," the meditation subject of mindfulness of the body is stated.
Do đó, ở đây, chỉ với câu “trú quán thân trên thân” là đề mục niệm xứ quán thân đã được nói đến.
Atha vā yasmā anātāpino antosaṅkhepo antarāyakaro hoti, asampajāno upāyapariggahe anupāyaparivajjane ca sammuyhati, muṭṭhassati upāyāpariccāge anupāyāpariggahe ca asamattho hoti, tenassa taṃ kammaṭṭhānaṃ na sampajjati, tasmā yesaṃ dhammānaṃ ānubhāvena taṃ sampajjati, tesaṃ dassanatthaṃ ‘‘ātāpī sampajāno satimā’’ti idaṃ vuttanti veditabbaṃ.
Alternatively, since for one who is not ardent, inner contraction is an obstacle; one who is not clearly comprehending becomes confused in apprehending the right means and avoiding the wrong means; and one who is unmindful is incapable of abandoning the right means and apprehending the wrong means, their meditation subject does not succeed. Therefore, to show the qualities by the power of which it succeeds, "ātāpī sampajāno satimā" is stated.
Hoặc là, vì rằng đối với người không có tinh tấn, sự co rút nội tâm sẽ gây ra trở ngại; người không có tỉnh giác sẽ mê mờ trong việc nắm bắt phương pháp và từ bỏ phi phương pháp; người thất niệm sẽ không có khả năng trong việc không từ bỏ phương pháp và không nắm bắt phi phương pháp, do đó đề mục của người ấy không thành tựu. Vì vậy, để chỉ ra các pháp mà nhờ vào năng lực của chúng, đề mục ấy được thành tựu, cần hiểu rằng câu “tinh cần, tỉnh giác, chánh niệm” đã được nói đến.
Iti kāyānupassanāsatipaṭṭhānaṃ sampayogaṅgañca dassetvā idāni pahānaṅgaṃ dassetuṃ vineyya loke abhijjhādomanassanti vuttaṃ.
Having thus shown the Satipaṭṭhāna of contemplation of the body and its associated factors, now, to show the factor of abandonment, "vineyya loke abhijjhādomanassaṃ" (removing covetousness and displeasure in the world) is stated.
Như vậy, sau khi đã chỉ ra niệm xứ quán thân và các chi tương ưng, bây giờ để chỉ ra chi phần đoạn trừ, câu nhiếp phục tham ưu ở đời đã được nói đến.
Tattha vineyyāti tadaṅgavinayena vā vikkhambhanavinayena vā vinayitvā.
Here, "vineyya" (having removed) means having eliminated either by temporary suppression (tadaṅgavinaya) or by suppression through counteraction (vikkhambhanavinaya).
Trong đó, nhiếp phục có nghĩa là đã nhiếp phục bằng sự nhiếp phục nhất thời (tadaṅgavinaya) hoặc bằng sự nhiếp phục do đè nén (vikkhambhanavinaya).
Loketi yvāyaṃ kāyo pubbe pariggahito, sveva idha lujjanapalujjanaṭṭhena loko nāma.
"Loke" (in the world): that very body, which was previously apprehended, is here called "world" in the sense of decay and disintegration.
Ở đời có nghĩa là chính thân này đã được nắm bắt trước đây, ở đây được gọi là đời (loka) với ý nghĩa là hoại diệt và tan rã.
Tasmiṃ loke abhijjhaṃ domanassañca pajahitvāti attho.
The meaning is, having abandoned covetousness and displeasure in that world.
Nghĩa là, đã từ bỏ tham và ưu trong đời ấy.
Yasmā panassa na kāyamatteyeva abhijjhādomanassaṃ pahīyati, vedanādīsupi pahīyatiyeva, tasmā ‘‘pañcapi upādānakkhandhā loko’’ti (vibha. 362) vibhaṅge vuttaṃ.
However, since covetousness and displeasure are not abandoned only in the body, but are also abandoned in feelings and so on, it is stated in the Vibhaṅga: "The five aggregates of clinging are the world."
Tuy nhiên, vì rằng không chỉ tham và ưu đối với thân được từ bỏ, mà chúng cũng được từ bỏ trong các thọ v.v., do đó trong bộ Phân Tích (Vibhaṅga) có nói: “Năm uẩn thủ là đời.”
Lokasaṅkhātattāyeva tesaṃ dhammānaṃ atthuddhāravasenetaṃ vuttanti veditabbaṃ.
It should be understood that this is stated by way of extracting the meaning of those phenomena, precisely because they are designated as "world."
Cần hiểu rằng điều này được nói theo cách trích dẫn ý nghĩa của các pháp ấy, chính vì chúng được gọi là đời.
Yaṃ panāha – ‘‘tattha katamo loko (vibha. 538), sveva kāyo loko’’ti ayamevettha attho.
And what is said: "What is the world there? That very body is the world" – this is the meaning here.
Còn điều được nói rằng – “Trong đó, thế nào là đời, chính thân này là đời,” đây chính là ý nghĩa ở đây.
Abhijjhādomanassanti ca samāsetvā vuttaṃ.
"Abhijjhādomanassaṃ" (covetousness and displeasure) is stated as a compound.
Và câu tham ưu được nói gộp lại.
Saṃyuttaṅguttarapāṭhantaresu pana visuṃ katvā paṭhanti.
However, in other passages of the Saṃyutta and Aṅguttara Nikāyas, they are recited separately.
Tuy nhiên, trong các bản kinh khác của Tương Ưng Bộ và Tăng Chi Bộ, người ta đọc tách rời.
Sā pana abhijjhāyanti patthayanti etāya, sayaṃ vā abhijjhāyati, abhijjhāyanamattameva vā esāti abhijjhā.
"Abhijjhā" (covetousness) is that by which one desires, or one desires oneself, or it is merely the act of desiring.
Tham (abhijjhā) đó là: người ta tham muốn bởi nó, hoặc tự nó tham muốn, hoặc nó chỉ là sự tham muốn mà thôi, nên gọi là tham.
Yasmā panettha abhijjhāgahaṇena kāmacchando, domanassagahaṇena byāpādo saṅgahaṃ gacchati, tasmā nīvaraṇapariyāpannabalavadhammadvayadassanena nīvaraṇappahānaṃ vuttaṃ hotīti veditabbaṃ.
Since here, by the apprehension of covetousness, sensual desire (kāmacchanda) is included, and by the apprehension of displeasure, ill-will (byāpāda) is included, it should be understood that the abandonment of hindrances (nīvaraṇa) is stated by showing these two strong phenomena included in the hindrances.
Vì rằng ở đây, qua việc đề cập đến tham (abhijjhā), dục tham (kāmacchanda) được bao gồm; qua việc đề cập đến ưu (domanassa), sân (byāpāda) được bao gồm, do đó, cần hiểu rằng sự đoạn trừ các triền cái đã được nói đến bằng cách chỉ ra hai pháp mạnh mẽ thuộc về triền cái.
Visesena panettha abhijjhāvinayena kāyasampattimūlakassa anurodhassa, domanassavinayena kāyavipattimūlakassa virodhassa, abhijjhāvinayena ca kāye abhiratiyā, domanassavinayena kāyabhāvanāya anabhiratiyā, abhijjhāvinayena kāye abhūtānaṃ subhasukhabhāvādīnaṃ pakkhepassa, domanassavinayena kāye bhūtānaṃ asubhāsukhabhāvādīnaṃ apanayanassa pahānaṃ vuttaṃ.
Specifically here, by the removal of covetousness, the abandonment of attachment (anurodha) rooted in the body's prosperity, and by the removal of displeasure, the abandonment of aversion (virodha) rooted in the body's misfortune, are stated. Also, by the removal of covetousness, the abandonment of delight in the body, and by the removal of displeasure, the abandonment of non-delight in the cultivation of the body, are stated. By the removal of covetousness, the abandonment of projecting non-existent qualities like beauty and pleasure onto the body, and by the removal of displeasure, the abandonment of removing existent qualities like impurity and suffering from the body, are stated.
Tuy nhiên, một cách đặc biệt, ở đây, việc đoạn trừ sự thuận theo (anurodha) bắt nguồn từ sự thành tựu của thân được nói đến qua việc nhiếp phục tham; việc đoạn trừ sự chống đối (virodha) bắt nguồn từ sự bất toàn của thân được nói đến qua việc nhiếp phục ưu. Và qua việc nhiếp phục tham, sự hoan hỷ trong thân được đoạn trừ; qua việc nhiếp phục ưu, sự không hoan hỷ trong việc tu tập về thân được đoạn trừ. Qua việc nhiếp phục tham, sự gán ghép những điều không có thật như tịnh, lạc v.v. vào thân được đoạn trừ; qua việc nhiếp phục ưu, sự loại bỏ những điều có thật như bất tịnh, khổ v.v. trong thân được đoạn trừ.
Tena yogāvacarassa yogānubhāvo yogasamatthatā ca dīpitā hoti.
Thereby, the yogī's power of practice and capacity for practice are illuminated.
Qua đó, năng lực tu tập và khả năng tu tập của hành giả được làm sáng tỏ.
Yogānubhāvo hi esa, yadayaṃ anurodhavirodhavippamutto aratiratisaho abhūtapakkhepabhūtāpanayanavirahito ca hoti.
For this is the power of practice: to be free from attachment and aversion, to endure both delight and non-delight, and to be free from projecting non-existent qualities and removing existent ones.
Vì rằng đây chính là năng lực tu tập, khi hành giả thoát khỏi sự thuận theo và chống đối, chịu đựng được sự không hoan hỷ và hoan hỷ, và không còn gán ghép điều không thật và loại bỏ điều có thật.
Anurodhavirodhavippamutto cesa aratiratisaho abhūtaṃ apakkhipanto bhūtañca anapanento yogasamattho hotīti.
And when one is free from attachment and aversion, endures both delight and non-delight, does not project non-existent qualities, and does not remove existent ones, then one is capable of practice.
Và hành giả này, khi thoát khỏi sự thuận theo và chống đối, chịu đựng được sự không hoan hỷ và hoan hỷ, không gán ghép điều không thật và không loại bỏ điều có thật, thì trở nên có khả năng tu tập.
Vedanāsu vedanānupassītiādīsu ca vedanādīnaṃ puna vacane payojanaṃ kāyānupassanāyaṃ vuttanayeneva yathāyogaṃ yojetvā veditabbaṃ.
In "vedanāsu vedanānupassī" (contemplating feelings in feelings) and so on, the purpose of repeating feelings and so forth should be understood by applying it appropriately in the same way as described for kāyānupassanā.
Trong các câu “quán thọ trên các thọ” v.v., mục đích của việc lặp lại các thọ v.v. cần được hiểu bằng cách áp dụng tương ứng theo phương pháp đã được nói trong phần quán thân.
Ayaṃ pana asādhāraṇattho – sukhādīsu anekappabhedāsu vedanāsu visuṃ visuṃ aniccādito ekekavedanānupassīti, sarāgādike soḷasappabhede citte visuṃ visuṃ aniccādito ekekacittānupassīti, kāyavedanācittāni ṭhapetvā sesatebhūmakadhammesu visuṃ visuṃ aniccādito ekekadhammānupassīti, satipaṭṭhānasuttante (dī. ni. 2.382; ma. ni. 1.115) vuttanayena nīvaraṇādidhammānupassīti vā.
This is the special meaning: contemplating each feeling separately as impermanent and so on, among feelings of various kinds such as pleasure; contemplating each mind separately as impermanent and so on, among the sixteen kinds of mind such as with passion; contemplating each phenomenon separately as impermanent and so on, among the remaining three-realm phenomena apart from body, feelings, and mind; or contemplating phenomena such as hindrances in the manner taught in the Satipaṭṭhāna Sutta.
Tuy nhiên, đây là ý nghĩa đặc thù – trong các thọ có nhiều loại khác nhau như lạc v.v., là người quán từng thọ một theo vô thường v.v.; trong tâm có mười sáu loại khác nhau như tâm có tham v.v., là người quán từng tâm một theo vô thường v.v.; sau khi đặt qua một bên thân, thọ và tâm, trong các pháp tam giới còn lại, là người quán từng pháp một theo vô thường v.v., hoặc là người quán các pháp như triền cái v.v. theo phương pháp đã được nói trong Kinh Niệm Xứ.
Ettha ca ‘‘kāye’’ti ekavacanaṃ sarīrassa ekattā, ‘‘citte’’ti ekavacanaṃ cittassa sabhāvabhedābhāvato jātiggahaṇena katanti veditabbaṃ.
Here, the singular number "kāye" (in the body) is due to the body being one, and the singular number "citte" (in the mind) is understood to be made by taking the class, due to the mind having no difference in its nature.
Và ở đây, cần hiểu rằng số ít “trên thân” (kāye) được dùng vì thân thể là một thể thống nhất, còn số ít “trên tâm” (citte) được dùng theo cách chỉ chung chủng loại vì tâm không có sự khác biệt về bản chất.
Yathā ca vedanādayo anupassitabbā, tathā anupassanto vedanāsu vedanānupassī, citte cittānupassī, dhammesu dhammānupassīti veditabbo.
And just as feelings and so forth are to be contemplated, so too one who contemplates them should be understood as contemplating feelings in feelings, mind in mind, and phenomena in phenomena.
Và như thế nào các thọ v.v. cần được quán chiếu, người đang quán chiếu như vậy cần được biết là người quán thọ trên các thọ, người quán tâm trên tâm, người quán pháp trên các pháp.
Kathaṃ tāva vedanā anupassitabbā?
How, then, are feelings to be contemplated?
Vậy, các thọ cần được quán chiếu như thế nào?
Sukhā tāva vedanā dukkhato, dukkhā vedanā sallato, adukkhamasukhā vedanā aniccato anupassitabbā.
Pleasant feelings are to be contemplated as suffering, painful feelings as a dart, and neither-pleasant-nor-painful feelings as impermanent.
Trước hết, thọ lạc cần được quán chiếu là khổ, thọ khổ là mũi tên, thọ không khổ không lạc là vô thường.
Yathāha –
As it is said:
Như có lời dạy rằng –
Sabbā eva cetā dukkhatopi anupassitabbā.
All these feelings should also be contemplated as suffering.
Tất cả chúng cũng cần được quán chiếu là khổ.
Vuttañhetaṃ ‘‘yaṃkiñci vedayitaṃ, sabbaṃ taṃ dukkhasminti vadāmī’’ti (saṃ. ni. 4.259).
For it has been said: "Whatever is felt, all that I declare to be suffering."
Vì có lời dạy rằng: “Bất cứ điều gì được cảm thọ, Ta nói rằng tất cả đều nằm trong khổ.”
Sukhadukkhatopi ca anupassitabbā.
And they should also be contemplated as pleasant and painful.
Và chúng cũng cần được quán chiếu là lạc và khổ.
Yathāha – ‘‘sukhā vedanā ṭhitisukhā vipariṇāmadukkhā.
As it is said: "Pleasant feeling is pleasant in its persistence, painful in its change.
Như có lời dạy rằng: “Thọ lạc thì an lạc khi tồn tại, đau khổ khi biến hoại.
Dukkhā vedanā ṭhitidukkhā vipariṇāmasukhā.
Painful feeling is painful in its persistence, pleasant in its change.
Thọ khổ thì đau khổ khi tồn tại, an lạc khi biến hoại.
Adukkhamasukhā vedanā ñāṇasukhā aññāṇadukkhā’’ti (ma. ni. 1.465).
Neither-pleasant-nor-painful feeling is pleasant with knowledge, painful without knowledge."
Thọ không khổ không lạc thì an lạc khi có trí tuệ, đau khổ khi không có trí tuệ.”
Apica aniccādisattaanupassanāvasenāpi anupassitabbā.
Furthermore, they should also be contemplated by way of the seven contemplations such as impermanence.
Hơn nữa, chúng cũng cần được quán chiếu theo bảy pháp quán như vô thường v.v.
Cittadhammesupi cittaṃ tāva ārammaṇādhipatisahajātabhūmikammavipākakiriyādinānattabhedānaṃ aniccādisattaanupassanānaṃ sarāgādisoḷasabhedānañca vasena anupassitabbaṃ, dhammā salakkhaṇasāmaññalakkhaṇānaṃ suññatādhammassa aniccādisattaanupassanānaṃ santāsantādīnañca vasena anupassitabbā.
Among mind-phenomena, the mind should first be contemplated by way of the various differences such as object, predominance, concomitance, realm, kamma, result, and action, and by way of the seven contemplations such as impermanence, and the sixteen kinds such as with passion. Phenomena should be contemplated by way of their specific characteristics and general characteristics, by way of the phenomenon of emptiness, by way of the seven contemplations such as impermanence, and by way of existence and non-existence.
Trong các pháp thuộc về tâm, trước hết tâm cần được quán chiếu theo các sự khác biệt đa dạng như đối tượng, chủ đạo, đồng sanh, cõi, nghiệp, quả, duy tác v.v., theo bảy pháp quán như vô thường v.v., và theo mười sáu loại như tâm có tham v.v.; các pháp cần được quán chiếu theo tự tướng và cộng tướng, theo pháp tánh không, theo bảy pháp quán như vô thường v.v., và theo sự hiện hữu, không hiện hữu v.v.
Kāmañcettha yassa kāyasaṅkhāte loke abhijjhādomanassaṃ pahīnaṃ, tassa vedanādilokesupi taṃ pahīnameva, nānāpuggalavasena pana nānākkhaṇikasatipaṭṭhānabhāvanāvasena ca sabbattha vuttaṃ.
Although for one whose covetousness and distress have been abandoned in the world of the body, they are also abandoned in the worlds of feelings and so on, it is stated everywhere due to different individuals and due to the development of mindfulness in different moments.
Mặc dù ở đây, đối với người nào mà tham ưu trong thế giới gọi là thân đã được đoạn trừ, thì tham ưu đó trong các thế giới thọ v.v. cũng đã được đoạn trừ, nhưng nó được nói đến ở mọi nơi theo phương diện các cá nhân khác nhau và theo phương diện sự tu tập niệm xứ trong các khoảnh khắc khác nhau.
Yato vā ekattha pahīnaṃ, sesesupi pahīnaṃ hoti.
Or, because what is abandoned in one is also abandoned in the others,
Hoặc là, vì khi được đoạn trừ ở một nơi, nó cũng được đoạn trừ ở những nơi còn lại.
Tenevassa tattha pahānadassanatthampi evaṃ vuttanti veditabbaṃ.
it should be understood that it is stated thus even to show its abandonment there.
Cần hiểu rằng, chính vì lý do đó mà nó được nói như vậy, cũng là để chỉ ra sự đoạn trừ ở những nơi đó.
Iti ime cattāro satipaṭṭhānā pubbabhāge nānācittesu labbhanti.
Thus, these four foundations of mindfulness are found in different minds in the preliminary stage.
Như vậy, bốn niệm xứ này, trong giai đoạn đầu, có thể đạt được trong các tâm khác nhau.
Aññeneva hi cittena kāyaṃ pariggaṇhāti, aññena vedanaṃ, aññena cittaṃ, aññena dhamme pariggaṇhāti.
For one comprehends the body with one mind, feelings with another, mind with another, and phenomena with another.
Vì rằng, người ta nắm bắt thân bằng một tâm khác, nắm bắt thọ bằng một tâm khác, nắm bắt tâm bằng một tâm khác, và nắm bắt các pháp bằng một tâm khác.
Lokuttaramaggakkhaṇe pana ekacitteyeva labbhanti.
However, at the moment of the supramundane path, they are found in a single mind.
Tuy nhiên, trong khoảnh khắc của đạo siêu thế, chúng có thể đạt được trong cùng một tâm.
Ādito hi kāyaṃ pariggaṇhitvā āgatassa vipassanāsampayuttā sati kāyānupassanā nāma, tāya satiyā samannāgato puggalo kāyānupassī nāma.
For the person who has come having first comprehended the body, the mindfulness associated with vipassanā is called kāyānupassanā, and the person endowed with that mindfulness is called kāyānupassī.
Thật vậy, đối với người đã đến sau khi nắm bắt thân từ đầu, niệm tương ưng với tuệ quán được gọi là quán thân, và người được trang bị với niệm đó được gọi là người quán thân.
Vipassanaṃ ussukkāpetvā ariyamaggaṃ pattassa maggakkhaṇe maggasampayuttā sati kāyānupassanā nāma, tāya satiyā samannāgato puggalo kāyānupassī nāma.
For the person who has aroused vipassanā and attained the Noble Path, at the moment of the path, the mindfulness associated with the path is called kāyānupassanā, and the person endowed with that mindfulness is called kāyānupassī.
Đối với người đã nỗ lực tu tập vipassanā và đắc Thánh đạo, niệm tương ưng với đạo trong khoảnh khắc đạo được gọi là kāyānupassanā (quán thân); cá nhân có được niệm ấy được gọi là kāyānupassī (người quán thân).
Vedanaṃ pariggaṇhitvā cittaṃ pariggaṇhitvā dhamme pariggaṇhitvā āgatassa vipassanāsampayuttā sati dhammānupassanā nāma, tāya satiyā samannāgato puggalo dhammānupassī nāma.
For the person who has come having comprehended feelings, having comprehended mind, having comprehended phenomena, the mindfulness associated with vipassanā is called dhammānupassanā, and the person endowed with that mindfulness is called dhammānupassī.
Đối với người đã nắm bắt thọ, nắm bắt tâm, nắm bắt các pháp mà đến, niệm tương ưng với vipassanā được gọi là dhammānupassanā (quán pháp); cá nhân có được niệm ấy được gọi là dhammānupassī (người quán pháp).
Vipassanaṃ ussukkāpetvā ariyamaggaṃ pattassa maggakkhaṇe maggasampayuttā sati dhammānupassanā nāma, tāya satiyā samannāgato puggalo dhammānupassī nāma.
For a person who has exerted themselves in vipassanā and attained the Noble Path, the mindfulness associated with the path at the moment of the path is called dhammānupassanā. A person endowed with that mindfulness is called a dhammānupassī.
Đối với người đã nỗ lực tu tập vipassanā và đắc Thánh đạo, niệm tương ưng với đạo trong khoảnh khắc đạo được gọi là dhammānupassanā (quán pháp); cá nhân có được niệm ấy được gọi là dhammānupassī (người quán pháp).
Evaṃ tāva desanā puggale tiṭṭhati.
Thus, first of all, the teaching stands with reference to the individual.
Như vậy, trước hết, bài pháp đứng trên phương diện cá nhân.
Kāye pana ‘‘subha’’nti vipallāsappahānā kāyapariggāhikā sati maggena samijjhatīti kāyānupassanā nāma.
But in the case of the body, the mindfulness that comprehends the body, which abandons the perversion of 'beautiful' (subha), is perfected by the path; therefore, it is called kāyānupassanā.
Còn trên phương diện các pháp, niệm nắm bắt thân, có tác dụng từ bỏ sự điên đảo cho rằng trong thân có "cái đẹp", được thành tựu bởi đạo, nên được gọi là kāyānupassanā (quán thân).
Vedanāya ‘‘sukhā’’ti vipallāsappahānā vedanāpariggāhikā sati maggena samijjhatīti vedanānupassanā nāma.
In the case of feeling, the mindfulness that comprehends feeling, which abandons the perversion of 'pleasant' (sukha), is perfected by the path; therefore, it is called vedanānupassanā.
Niệm nắm bắt thọ, có tác dụng từ bỏ sự điên đảo cho rằng trong thọ có "lạc", được thành tựu bởi đạo, nên được gọi là vedanānupassanā (quán thọ).
Citte ‘‘nicca’’nti vipallāsappahānā cittapariggāhikā sati maggena samijjhatīti cittānupassanā nāma.
In the case of mind, the mindfulness that comprehends mind, which abandons the perversion of 'permanent' (nicca), is perfected by the path; therefore, it is called cittānupassanā.
Niệm nắm bắt tâm, có tác dụng từ bỏ sự điên đảo cho rằng trong tâm có "thường", được thành tựu bởi đạo, nên được gọi là cittānupassanā (quán tâm).
Dhammesu ‘‘attā’’ti vipallāsappahānā dhammapariggāhikā sati maggena samijjhatīti dhammānupassanā nāma.
In the case of phenomena, the mindfulness that comprehends phenomena, which abandons the perversion of 'self' (attā), is perfected by the path; therefore, it is called dhammānupassanā.
Niệm nắm bắt các pháp, có tác dụng từ bỏ sự điên đảo cho rằng trong các pháp có "tự ngã", được thành tựu bởi đạo, nên được gọi là dhammānupassanā (quán pháp).
Iti ekāva maggasampayuttā sati catukiccasādhakattena cattāri nāmāni labhati.
Thus, the single mindfulness associated with the path obtains four names due to its accomplishment of four functions.
Như vậy, chỉ một niệm duy nhất tương ưng với đạo, do hoàn thành bốn phận sự, đã nhận được bốn tên gọi.
Tena vuttaṃ ‘‘lokuttaramaggakkhaṇe pana ekacitteyeva labbhantī’’ti.
Therefore, it is said, "But at the moment of the supramundane path, they are obtained in one and the same mind."
Do đó, đã nói rằng "còn trong khoảnh khắc đạo siêu thế, chúng được thành tựu chỉ trong một tâm duy nhất".
Sammāsamādhiniddese vivicceva kāmehīti kāmehi viviccitvā vinā hutvā apakkamitvā.
In the exposition of right concentration, "quite secluded from sense-desires" (vivicceva kāmehī) means having become secluded from sense-desires, having become free, having departed.
Trong phần giải thích về Chánh định, vivicceva kāmehi (ly dục) có nghĩa là đã ly, đã tách rời, đã tránh xa khỏi các dục.
Yo panāyamettha evakāro, so niyamatthoti veditabbo.
And the particle eva here should be understood as having the meaning of restriction.
Còn từ eva ở đây nên được hiểu theo nghĩa xác định.
Yasmā ca niyamattho, tasmā paṭhamajjhānaṃ upasampajja viharaṇasamaye avijjamānānampi kāmānaṃ tassa paṭhamajjhānassa paṭipakkhabhāvaṃ kāmapariccāgeneva cassa adhigamaṃ dīpeti.
And because it has the meaning of restriction, it indicates both that sense-desires are opposed to that first jhāna, even though they are not present at the time of abiding having entered upon the first jhāna, and that its attainment is solely through the abandonment of sense-desires.
Và vì nó có nghĩa xác định, nên nó chỉ ra rằng các dục, dù không hiện hữu vào thời điểm an trú sau khi đã chứng đắc sơ thiền, vẫn là đối nghịch với sơ thiền ấy, và việc chứng đắc sơ thiền chỉ có thể đạt được qua việc từ bỏ các dục.
Kathaṃ?
How?
Làm thế nào?
‘‘Vivicceva kāmehī’’ti evañhi niyame kayiramāne idaṃ paññāyati – nūnimassa jhānassa kāmā paṭipakkhabhūtā, yesu sati idaṃ na pavattati, andhakāre sati padīpobhāso viya, tesaṃ pariccāgeneva cassa adhigamo hoti orimatīrapariccāgena pārimatīrassa viya.
When the restriction is made thus: "quite secluded from sense-desires," this is understood: surely sense-desires are opposed to this jhāna, in the presence of which it does not arise, just as the light of a lamp does not arise in the presence of darkness; and its attainment is solely through their abandonment, just as the far shore is attained through the abandonment of the near shore.
Khi sự xác định được thực hiện như vậy qua câu "ly dục", điều này trở nên rõ ràng: chắc chắn các dục là đối nghịch với thiền này; khi chúng có mặt thì thiền này không thể khởi sinh, giống như ánh sáng đèn không thể có mặt khi bóng tối tồn tại; và việc chứng đắc thiền này chỉ có thể có được qua việc từ bỏ chúng, giống như việc đến được bờ bên kia chỉ có thể có được qua việc rời bỏ bờ bên này.
Tasmā niyamaṃ karotīti.
Therefore, it makes the restriction.
Do đó, nó tạo ra sự xác định.
Tattha siyā, kasmā panesa pubbapadeyeva vutto, na uttarapade, kiṃ akusalehi dhammehi aviviccāpi jhānaṃ upasampajja vihareyyāti?
Here, one might ask, why is this particle mentioned only in the first phrase and not in the second? Would one then abide having entered upon jhāna even without being secluded from unwholesome states?
Ở đây, có thể có câu hỏi: tại sao từ này lại chỉ được nói ở vế trước mà không ở vế sau? Phải chăng người ta có thể an trú sau khi chứng đắc thiền mà không cần ly các pháp bất thiện?
Na kho panetaṃ evaṃ daṭṭhabbaṃ.
This should not be understood in that way.
Tuy nhiên, không nên hiểu như vậy.
Taṃnissaraṇato hi pubbapade esa vutto.
For it is mentioned in the first phrase because it is the escape from them.
Thực ra, từ này được nói ở vế trước vì đó là sự xuất ly khỏi chúng.
Kāmadhātusamatikkamanato hi kāmarāgapaṭipakkhato ca idaṃ jhānaṃ kāmānameva nissaraṇaṃ.
For this jhāna is indeed an escape from sense-desires, because it transcends the sense-sphere and is opposed to sensual lust.
Bởi vì vượt qua cõi dục và vì là đối nghịch với dục ái, thiền này chính là sự xuất ly khỏi các dục.
Yathāha – ‘‘kāmānametaṃ nissaraṇaṃ yadidaṃ nekkhamma’’nti (itivu. 72).
As it is said: "This is the escape from sense-desires, namely renunciation (nekkhamma)."
Như đã nói: "Sự xuất ly khỏi các dục chính là nekkhamma (sự xuất gia, sự từ bỏ)".
Uttarapadepi pana yathā ‘‘idheva, bhikkhave, samaṇo, idha dutiyo samaṇo’’ti (ma. ni. 1.139; a. ni. 4.241) ettha evakāro ānetvā vuccati, evaṃ vattabbo.
But in the second phrase too, it should be stated by bringing the particle eva from such passages as "Here, bhikkhus, is a recluse; here is a second recluse."
Hơn nữa, ở vế sau, từ eva cũng nên được mang đến và nói, giống như trong câu "Này các Tỳ khưu, chỉ ở đây có sa-môn, ở đây có sa-môn thứ hai".
Na hi sakkā ito aññehipi nīvaraṇasaṅkhātehi akusalehi dhammehi avivicca jhānaṃ upasampajja viharituṃ.
For it is not possible to abide having entered upon jhāna without being secluded from other unwholesome states, which are called hindrances.
Vì không thể an trú sau khi chứng đắc thiền mà không ly khỏi các pháp bất thiện khác được gọi là các triền cái.
Tasmā ‘‘vivicceva kāmehi vivicceva akusalehi dhammehī’’ti evaṃ padadvayepi esa daṭṭhabbo.
Therefore, this particle should be understood in both phrases as "quite secluded from sense-desires, quite secluded from unwholesome states."
Do đó, nên hiểu rằng từ này có ở cả hai vế: "ly dục, ly các pháp bất thiện".
Padadvayepi ca kiñcāpi viviccāti iminā sādhāraṇavacanena tadaṅgavikkhambhanasamucchedapaṭippassaddhinissaraṇavivekā cittakāyaupadhivivekā ca saṅgahaṃ gacchanti, tathāpi pubbabhāge kāyavivekacittavivekavikkhambhanavivekā daṭṭhabbā, lokuttaramaggakkhaṇe kāyavivekacittavivekasamucchedavivekapaṭippassaddhivivekanissaraṇavivekā.
And in both phrases, although the common word "secluded" (vivicca) encompasses the vivekas of suppression by substitution, cutting off, tranquilization, and escape, as well as physical seclusion, mental seclusion, and seclusion from defilements, nevertheless, in the preliminary stage, physical seclusion, mental seclusion, and seclusion by suppression should be understood; and at the moment of the supramundane path, physical seclusion, mental seclusion, seclusion by cutting off, seclusion by tranquilization, and seclusion by escape.
Và trong cả hai vế, mặc dù từ chung "ly" (vivicca) bao gồm cả tadaṅgaviveka (ly bằng chi phần đối nghịch), vikkhambhanaviveka (ly bằng sự trấn áp), samucchedaviveka (ly bằng sự đoạn tận), paṭippassaddhiviveka (ly bằng sự an tịnh), nissaraṇaviveka (ly bằng sự xuất ly), cũng như cittaviveka (tâm ly), kāyaviveka (thân ly), và upadhiviveka (ly khỏi các sanh y), tuy nhiên, trong giai đoạn chuẩn bị, nên hiểu là có kāyaviveka, cittaviveka và vikkhambhanaviveka; trong khoảnh khắc đạo siêu thế, có kāyaviveka, cittaviveka, samucchedaviveka, paṭippassaddhiviveka và nissaraṇaviveka.
Vivicca akusalehi dhammehīti kilesakāmehi sabbākusalehi vā viviccāti attho yujjati.
The meaning "secluded from defilement-sense-desires or from all unwholesome states" is appropriate for "secluded from unwholesome states" (vivicca akusalehi dhammehī).
Vivicca akusalehi dhammehi (ly các pháp bất thiện) có nghĩa là ly khỏi các phiền não dục hoặc ly khỏi tất cả các pháp bất thiện.
Tena cittaviveko vutto hoti.
By this, mental seclusion is stated.
Qua đó, cittaviveka (tâm ly) được nói đến.
Purimena cettha vatthukāmehi vivekavacanato eva kāmasukhapariccāgo, dutiyena kilesakāmehi vivekavacanato nekkhammasukhapariggaho vibhāvito hoti.
Here, by the former, the abandonment of sensual pleasure, due to the statement of seclusion from objective sensuality, and by the latter, the acquisition of the pleasure of renunciation, due to the statement of seclusion from defiling sensuality, is made clear.
Trong đó, vế trước, do nói về sự ly khỏi các vật dục, đã làm rõ sự từ bỏ dục lạc; vế sau, do nói về sự ly khỏi các phiền não dục, đã làm rõ sự nắm bắt lạc của sự xuất ly.
Evaṃ vatthukāmakilesakāmavivekavacanatoyeva ca etesaṃ paṭhamena saṃkilesavatthuppahānaṃ, dutiyena saṃkilesappahānaṃ.
And thus, due to the statement of seclusion from objective sensuality and defiling sensuality, by the former of these, the abandonment of the basis of defilement, and by the latter, the abandonment of defilement itself, is made clear.
Như vậy, chính do việc nói về sự ly khỏi vật dục và phiền não dục mà vế thứ nhất chỉ ra sự từ bỏ nền tảng của phiền não, và vế thứ hai chỉ ra sự từ bỏ chính phiền não.
Paṭhamena lolabhāvassa hetupariccāgo, dutiyena bālabhāvassa.
By the former, the abandonment of the cause of greed, and by the latter, the cause of foolishness.
Vế thứ nhất là sự từ bỏ nguyên nhân của trạng thái tham lam, vế thứ hai là sự từ bỏ nguyên nhân của trạng thái ngu si.
Paṭhamena ca payogasuddhi, dutiyena āsayaposanaṃ vibhāvitaṃ hotīti viññātabbaṃ.
And by the former, the purity of effort, and by the latter, the cultivation of intention, is made clear; thus it should be understood.
Và nên hiểu rằng, vế thứ nhất làm rõ sự trong sạch trong hành động, vế thứ hai làm rõ sự nuôi dưỡng ý hướng trong sạch.
Esa tāva nayo kāmehīti ettha vuttakāmesu vatthukāmapakkhe.
This is the method for the objective sensuality aspect among the sensuality mentioned in "from sensuality" (kāmehi).
Trước hết, đó là phương pháp trong trường hợp các dục được nói đến trong từ "kāmehi" là vật dục.
Kilesakāmapakkhe pana chandoti ca rāgoti ca evamādīhi anekabhedo kāmacchandova kāmoti adhippeto.
However, in the aspect of defiling sensuality, "sensuality" (kāma) is intended to mean kāmacchanda (sensual desire) itself, which has many distinctions such as "desire" (chanda) and "lust" (rāga).
Còn trong trường hợp phiền não dục, chính dục tham (kāmacchanda) với nhiều loại khác nhau như chanda (ý muốn), rāga (tham ái), v.v., được hiểu là "dục".
So ca akusalapariyāpannopi samāno ‘‘tattha katame kāmā, chando kāmo’’tiādinā (vibha. 564) nayena vibhaṅge upari jhānaṅgapaṭipakkhato visuṃ vutto, kilesakāmattā vā purimapade vutto, akusalapariyāpannattā dutiyapade.
Although it is included among unwholesome things, it is stated separately in the Vibhaṅga as being opposed to the jhāna factors, in the manner of "What are sensuality? Desire is sensuality." Or, because it is defiling sensuality, it is mentioned in the first phrase; because it is included among unwholesome things, it is mentioned in the second phrase.
Và dục tham đó, dù thuộc về bất thiện, nhưng trong Vibhaṅga, nó được nói riêng biệt vì là đối nghịch với các thiền chi ở phần sau, theo cách "Ở đây, thế nào là các dục? Dục là chanda..."; hoặc được nói ở vế trước vì là phiền não dục, và ở vế sau vì thuộc về bất thiện.
Anekabhedato cassa kāmatoti avatvā kāmehīti vuttaṃ.
And because it has many distinctions, it is said "from sensuality" (kāmehīti) instead of "from sensuality" (kāmatoti).
Và do có nhiều loại khác nhau, nên không nói là "kāmato" mà nói là "kāmehi".
Aññesampi ca dhammānaṃ akusalabhāve vijjamāne ‘‘tattha katame akusalā dhammā, kāmacchando’’tiādinā (vibha. 564) nayena vibhaṅge upari jhānaṅgapaccanīkapaṭipakkhabhāvadassanato nīvaraṇāneva vuttāni.
Even though other phenomena are also unwholesome, only the hindrances (nīvaraṇa) are mentioned in the Vibhaṅga, in the manner of "What are unwholesome phenomena? Sensual desire" (kāmacchando), because they are seen as the opposing factors to the jhāna factors mentioned above.
Và dù các pháp khác cũng có tính chất bất thiện, nhưng trong Vibhaṅga, chỉ có các triền cái được đề cập, theo cách "Ở đây, thế nào là các pháp bất thiện? Dục tham...", vì chúng được chỉ ra là đối nghịch và là kẻ thù của các thiền chi ở phần sau.
Nīvaraṇāni hi jhānaṅgapaccanīkāni, tesaṃ jhānaṅgāneva paṭipakkhāni viddhaṃsakāni vināsakānīti vuttaṃ hoti.
For the hindrances are indeed opposed to the jhāna factors, and the jhāna factors themselves are their opponents, their destroyers, their annihilators; thus it is said.
Điều này có nghĩa là: các triền cái là kẻ thù của các thiền chi, và chính các thiền chi là đối nghịch, là kẻ hủy diệt, là kẻ tiêu diệt chúng.
Tathā hi ‘‘samādhi kāmacchandassa paṭipakkho, pīti byāpādassa, vitakko thinamiddhassa, sukhaṃ uddhaccakukkuccassa, vicāro vicikicchāyā’’ti peṭake vuttaṃ.
Thus, it is stated in the Peṭaka: "Concentration is the opponent of sensual desire, joy of ill-will, initial application of sloth and torpor, happiness of restlessness and remorse, sustained application of doubt."
Thật vậy, trong Peṭaka đã nói: "Định là đối nghịch của dục tham, hỷ là đối nghịch của sân, tầm là đối nghịch của hôn trầm-thụy miên, lạc là đối nghịch của trạo cử-hối quá, tứ là đối nghịch của hoài nghi".
Evamettha ‘‘vivicceva kāmehī’’ti iminā kāmacchandassa vikkhambhanaviveko vutto hoti.
Thus, here, by "secluded from sensuality" (vivicceva kāmehīti), the suppression-seclusion (vikkhambhanaviveka) of sensual desire is stated.
Như vậy, ở đây, bằng câu "vivicceva kāmehi", sự ly bằng cách trấn áp (vikkhambhanaviveka) đối với dục tham được nói đến.
‘‘Vivicca akusalehi dhammehī’’ti iminā pañcannampi nīvaraṇānaṃ.
By "secluded from unwholesome phenomena" (vivicca akusalehi dhammehīti), that of all five hindrances.
Bằng câu "vivicca akusalehi dhammehi", sự ly bằng cách trấn áp đối với cả năm triền cái được nói đến.
Agahitaggahaṇena pana paṭhamena kāmacchandassa, dutiyena sesanīvaraṇānaṃ.
Furthermore, by taking what was not taken, by the first, that of sensual desire, and by the second, that of the remaining hindrances.
Hoặc, theo cách phân chia (agahitaggahaṇena), vế thứ nhất nói về dục tham, vế thứ hai nói về các triền cái còn lại.
Tathā paṭhamena tīsu akusalamūlesu pañcakāmaguṇabhedavisayassa lobhassa, dutiyena āghātavatthubhedādivisayānaṃ dosamohānaṃ.
Similarly, by the first, that of greed, which has the five strands of sensuality as its object within the three roots of unwholesomeness; by the second, that of hatred and delusion, which have the nine types of objects of resentment and so forth as their objects.
Tương tự, trong ba bất thiện căn, vế thứ nhất nói về tham có đối tượng là năm loại dục trần, vế thứ hai nói về sân và si có đối tượng là các loại sự vật gây phẫn nộ, v.v.
Oghādīsu vā dhammesu paṭhamena kāmoghakāmayogakāmāsavakāmupādānaabhijjhākāyagantha kāmarāgasaññojanānaṃ, dutiyena avasesaoghayogāsavaupādānaganthasaṃyojanānaṃ.
Or, among phenomena such as floods (ogha), by the first, that of the flood of sensuality (kāmogha), the yoke of sensuality (kāmayoga), the canker of sensuality (kāmāsava), the clinging to sensuality (kāmupādāna), covetousness (abhijjhā), the bodily fetter of sensuality (kāyagantha), and the fetter of sensual lust (kāmarāgasaññojana); by the second, that of the remaining floods, yokes, cankers, clingings, fetters, and bonds.
Hoặc trong các pháp như bộc lậu (ogha), v.v., vế thứ nhất nói về dục bộc, dục phược, dục lậu, dục thủ, tham thân kết, dục ái kết; vế thứ hai nói về các bộc lậu, phược, lậu, thủ, kết, và triền còn lại.
Paṭhamena taṇhāya taṃsampayuttakānañca, dutiyena avijjāya taṃsampayuttakānañca.
By the first, that of craving and its associated phenomena; by the second, that of ignorance and its associated phenomena.
Với từ đầu tiên (là) ái và các pháp tương ưng với nó, với từ thứ hai (là) vô minh và các pháp tương ưng với nó.
Apica paṭhamena lobhasampayuttaaṭṭhacittuppādānaṃ, dutiyena sesānaṃ catunnaṃ akusalacittuppādānaṃ vikkhambhanaviveko vutto hotīti veditabbo.
Furthermore, by the first, the suppression-seclusion of the eight consciousnesses associated with greed, and by the second, that of the remaining four unwholesome consciousnesses, should be understood.
Hơn nữa, cần phải hiểu rằng với từ đầu tiên, sự viễn ly bằng cách trấn áp tám tâm sở phát sinh tương ưng với tham được nói đến; với từ thứ hai, (sự viễn ly bằng cách trấn áp) bốn tâm sở bất thiện còn lại được nói đến.
Ettāvatā ca paṭhamassa jhānassa pahānaṅgaṃ dassetvā idāni sampayogaṅgaṃ dassetuṃ savitakkaṃ savicārantiādi vuttaṃ.
Having thus shown the factor of abandonment of the first jhāna, now to show the factor of association, "with initial application and sustained application" (savitakkaṃ savicāraṃ) and so forth is stated.
Và đến đây, sau khi đã chỉ ra chi phần từ bỏ của thiền thứ nhất, bây giờ để chỉ ra chi phần tương ưng, câu savitakkaṃ savicāra (có tầm có tứ) và các câu tiếp theo được nói đến.
Tattha ārammaṇe cittassa abhiniropanalakkhaṇo vitakko.
Among these, initial application (vitakka) is characterized by the directing of the mind onto the object.
Trong đó, vitakka (tầm) có đặc tính là sự hướng tâm đến đối tượng.
Ārammaṇānumajjanalakkhaṇo vicāro.
Sustained application (vicāra) is characterized by the repeatedly pondering of the object.
Vicāra (tứ) có đặc tính là sự khảo sát đối tượng.
Santepi ca nesaṃ katthaci avippayoge oḷārikaṭṭhena pubbaṅgamaṭṭhena ca ghaṇḍābhighāto viya cetaso paṭhamābhinipāto vitakko, sukhumaṭṭhena anumajjanasabhāvena ca ghaṇḍānuravo viya anuppabandho vicāro.
Even though they are inseparable in some instances, initial application is the mind's first impingement on the object, like the striking of a bell, due to its grossness and its nature as a forerunner; sustained application is the continuous dwelling, like the reverberation of a bell, due to its subtlety and its nature of repeatedly pondering.
Và mặc dù ở một số nơi chúng không tách rời, nhưng do tính chất thô thiển và đi trước, sự tác động đầu tiên của tâm, giống như tiếng chuông khi gõ, là vitakka; do tính chất vi tế và bản chất khảo sát theo sau, sự tiếp nối không gián đoạn, giống như tiếng vang của chuông, là vicāra.
Vipphāravā cettha vitakko paṭhamuppattikāle paripphandanabhūto cittassa, ākāse uppatitukāmassa pakkhino pakkhavikkhepo viya, padumābhimukhapāto viya ca gandhānubandhacetaso bhamarassa.
Here, initial application is the mind's expansive, fluttering state at the time of its first arising, like the flapping of a bird's wings wishing to fly into the sky, or like a bee with a mind intent on fragrance falling towards a lotus.
Trong đó, vitakka có sự lan tỏa, là sự rung động của tâm vào lúc khởi sinh ban đầu, giống như sự đập cánh của con chim muốn bay lên trời, và giống như sự lao đến hoa sen của con ong có tâm theo đuổi mùi hương.
Santavutti vicāro nātiparipphandanabhūto cittassa, ākāse uppatitassa pakkhino pakkhappasāraṇaṃ viya, paribbhamanaṃ viya ca padumābhimukhapatitassa bhamarassa padumassa uparibhāge.
Sustained application is the mind's calm activity, not excessively fluttering, like the spreading of a bird's wings after it has flown into the sky, or like a bee that has fallen towards a lotus hovering above the lotus.
Vicāra có sự vận hành tĩnh lặng, không quá rung động của tâm, giống như sự giang cánh của con chim đã bay lên trời, và giống như sự bay lượn trên hoa sen của con ong đã lao đến hoa sen.
Dukanipātaṭṭhakathāyaṃ pana ‘‘ākāse gacchato mahāsakuṇassa ubhohi pakkhehi vātaṃ gahetvā pakkhe sannisīdāpetvā gamanaṃ viya ārammaṇe cetaso abhiniropanabhāvena pavatto vitakko, vātaggahaṇatthaṃ pakkhe phandāpayamānassa gamanaṃ viya anumajjanabhāvena pavatto vicāro’’ti vuttaṃ.
In the Dukanipāta Aṭṭhakathā, it is said: "Vitakka is the mental factor that arises by way of directing the mind to the object, like a great bird flying in the sky, taking the wind with both wings, and then gliding without flapping. Vicāra is the mental factor that arises by way of repeatedly examining the object, like a bird flapping its wings to catch the wind while flying."
Tuy nhiên, trong Chú giải Dukanipāta có nói: “Vitakka là sự vận hành do bản chất hướng tâm đến đối tượng, giống như sự di chuyển của con chim lớn bay trên trời, sau khi dùng cả hai cánh để đón gió rồi duỗi thẳng cánh ra; vicāra là sự vận hành do bản chất khảo sát theo sau, giống như sự di chuyển của con chim đang đập cánh để đón gió”.
Taṃ anuppabandhena pavattiyaṃ yujjati.
That simile is appropriate when it occurs continuously in the object, in the context of upacāra-appanā.
Điều đó phù hợp với sự vận hành không gián đoạn.
So pana tesaṃ viseso paṭhamadutiyajjhānesu pākaṭo hoti.
However, the distinction between them becomes evident in the first and second jhānas.
Và sự khác biệt đó của chúng trở nên rõ ràng trong thiền thứ nhất và thiền thứ hai.
Apica malaggahitaṃ kaṃsabhājanaṃ ekena hatthena daḷhaṃ gahetvā itarena hatthena cuṇṇatelavālaṇḍupakena parimajjantassa daḷhaggahaṇahattho viya vitakko, parimajjanahattho viya vicāro.
Moreover, vitakka is like the hand firmly grasping a bronze vessel stained with grime, while vicāra is like the other hand scrubbing it with a mixture of powder, oil, and a brush.
Hơn nữa, vitakka giống như bàn tay giữ chặt của người đang dùng một tay giữ chặt chiếc bát đồng bị dính bẩn và dùng tay kia chà xát bằng bột, dầu và bàn chải; vicāra giống như bàn tay chà xát.
Tathā kumbhakārassa daṇḍappahārena cakkaṃ bhamayitvā bhājanaṃ karontassa uppīḷanahattho viya vitakko, ito cito ca saṃsaraṇahattho viya vicāro.
Similarly, vitakka is like the hand pressing down for a potter who spins the wheel with a stick to make a pot, while vicāra is like the hand moving here and there.
Tương tự, vitakka giống như bàn tay ấn xuống của người thợ gốm đang làm một cái bình sau khi đã làm cho bàn xoay quay bằng cách đẩy cây gậy; vicāra giống như bàn tay di chuyển qua lại.
Tathā maṇḍalaṃ karontassa majjhe sannirujjhitvā ṭhitakaṇṭako viya abhiniropano vitakko, bahi paribbhamanakaṇṭako viya anumajjano vicāro.
Likewise, vitakka is the directing of the mind, like a pin fixed in the center for drawing a circle, while vicāra is the repeated examination, like the pin revolving around the outside.
Tương tự, vitakka là sự hướng tâm, giống như cái compa được cắm cố định ở giữa của người đang vẽ một vòng tròn; vicāra là sự khảo sát, giống như cái compa quay xung quanh bên ngoài.
Iti iminā ca vitakkena iminā ca vicārena saha vattati rukkho viya pupphena phalena cāti idaṃ jhānaṃ ‘‘savitakkaṃ savicāra’’nti vuccati.
Thus, because this jhāna occurs together with this vitakka and this vicāra, like a tree with its flowers and fruits, this jhāna is called "with vitakka, with vicāra."
Vì vậy, thiền này vận hành cùng với vitakka này và vicāra này, giống như cây có hoa và quả, nên được gọi là “savitakkaṃ savicāra” (có tầm có tứ).
Vivekajanti ettha vivitti viveko, nīvaraṇavigamoti attho.
Here, vivekaja means vivitti or viveka, which is the absence of the nīvaraṇas (hindrances).
Vivekaja (do ly dục sinh): Ở đây, sự tách biệt là viveka (ly), có nghĩa là sự vắng mặt của các triền cái.
Vivittoti vā viveko, nīvaraṇavivitto jhānasampayuttadhammarāsīti attho.
Or, viveka means that which is free from the nīvaraṇas, i.e., the aggregate of mental factors associated with jhāna that are free from the nīvaraṇas.
Hoặc, sự tách biệt là viveka, có nghĩa là tập hợp các pháp tương ưng với thiền đã tách khỏi các triền cái.
Tasmā vivekā, tasmiṃ vā viveke jātanti vivekajaṃ.
Therefore, it is "born of seclusion" (vivekaja) because it arises from seclusion, or in that seclusion.
Do đó, nó sinh ra từ sự ly (viveka), hoặc sinh ra trong sự ly đó, nên gọi là vivekaja.
Pītisukhanti ettha pīṇayatīti pīti, sā sampiyāyanalakkhaṇā.
Here, pītisukha: pīti is that which gladdens; it has the characteristic of delighting in the object.
Pītisukha (hỷ lạc): Ở đây, cái làm cho vui thích là pīti (hỷ), nó có đặc tính là sự yêu mến.
Sā panesā khuddikā pīti, khaṇikā pīti, okkantikā pīti, ubbegā pīti, pharaṇā pītīti pañcavidhā hoti.
This pīti is of five kinds: minor pīti, momentary pīti, showering pīti, uplifting pīti, and pervading pīti.
Và pīti này có năm loại: khuddikā pīti (hỷ nhỏ), khaṇikā pīti (hỷ chốc lát), okkantikā pīti (hỷ lan tỏa từng đợt), ubbegā pīti (hỷ bay bổng), và pharaṇā pīti (hỷ tràn ngập).
Tattha khuddikā pīti sarīre lomahaṃsanamattameva kātuṃ sakkoti.
Among these, minor pīti can only cause goosebumps on the body.
Trong số đó, khuddikā pīti chỉ có thể làm cho lông trên cơ thể dựng đứng.
Khaṇikā pīti khaṇe khaṇe vijjuppādasadisā hoti.
Momentary pīti is like flashes of lightning occurring moment by moment.
Khaṇikā pīti giống như tia chớp lóe lên từng khoảnh khắc.
Okkantikā pīti samuddatīraṃ vīci viya kāyaṃ okkamitvā okkamitvā bhijjati.
Showering pīti breaks forth repeatedly, pervading the body like waves crashing on the seashore.
Okkantikā pīti tràn ngập thân thể rồi tan đi, giống như sóng vỗ vào bờ biển.
Ubbegā pīti balavatī hoti kāyaṃ uddhaggaṃ katvā ākāse laṅghāpanappamāṇappattā.
Uplifting pīti is powerful, capable of raising the body into the air.
Ubbegā pīti rất mạnh mẽ, đạt đến mức có thể làm cho cơ thể bay bổng lên không trung.
Pharaṇā pīti atibalavatī hoti.
Pervading pīti is exceedingly powerful.
Pharaṇā pīti cực kỳ mạnh mẽ.
Tāya hi uppannāya sakalasarīraṃ dhamitvā pūritavatthi viya mahatā udakoghena pakkhandapabbatakucchi viya ca anupariphuṭaṃ hoti.
When it arises, the entire body is completely pervaded, like a blown-up bladder or a mountain cave filled with a great deluge of water.
Khi nó phát sinh, toàn bộ cơ thể trở nên tràn ngập, giống như một cái bong bóng được thổi đầy hơi, hoặc giống như một hang núi bị một dòng nước lớn tràn vào.
Sā panesā pañcavidhā pīti gabbhaṃ gaṇhantī paripākaṃ gacchantī duvidhaṃ passaddhiṃ paripūreti kāyapassaddhiñca cittapassaddhiñca.
This fivefold pīti, when conceived and matured, perfects two kinds of tranquility: bodily tranquility (kāyapassaddhi) and mental tranquility (cittapassaddhi).
Và năm loại pīti này, khi được thai nghén và đi đến chín muồi, sẽ làm viên mãn hai loại passaddhi (tịnh): kāyapassaddhi (thân tịnh) và cittapassaddhi (tâm tịnh).
Passaddhi gabbhaṃ gaṇhantī paripākaṃ gacchantī duvidhampi sukhaṃ paripūreti kāyikañca cetasikañca.
Tranquility, when conceived and matured, perfects two kinds of happiness: bodily happiness (kāyika sukha) and mental happiness (cetasika sukha).
Passaddhi, khi được thai nghén và đi đến chín muồi, sẽ làm viên mãn cả hai loại sukha (lạc): kāyika (thân lạc) và cetasika (tâm lạc).
Sukhaṃ gabbhaṃ gaṇhantaṃ paripākaṃ gacchantaṃ tividhaṃ samādhiṃ paripūreti – khaṇikasamādhiṃ, upacārasamādhiṃ, appanāsamādhiñcāti.
Happiness, when conceived and matured, perfects three kinds of concentration (samādhi): momentary concentration (khaṇikasamādhi), access concentration (upacārasamādhi), and absorption concentration (appanāsamādhi).
Sukha, khi được thai nghén và đi đến chín muồi, sẽ làm viên mãn ba loại samādhi (định): khaṇikasamādhi (sát-na định), upacārasamādhi (cận hành định), và appanāsamādhi (an chỉ định).
Tāsu ca yā appanāsamādhissa mūlaṃ hutvā vaḍḍhamānā samādhisampayogaṃ gatā pharaṇā pīti, ayaṃ imasmiṃ atthe adhippetā pītīti.
Among these, the pervading pīti which becomes the root of appanāsamādhi, develops, and attains association with samādhi, is the pīti intended in this context.
Trong số đó, pharaṇā pīti, vốn là gốc rễ của appanāsamādhi, phát triển và đi đến sự tương ưng với định, chính là pīti được nói đến trong ngữ cảnh này.
Itaraṃ pana sukhayatīti sukhaṃ, yassuppajjati, taṃ sukhitaṃ karotīti attho.
The other, happiness (sukha), is that which makes happy; it means that it makes a person happy when it arises in them.
Phần còn lại, cái làm cho an lạc là sukha (lạc), nghĩa là nó làm cho người mà nó phát sinh được an lạc.
Sukhanaṃ vā sukhaṃ, suṭṭhu vā khādati, khaṇati ca kāyacittābādhanti sukhaṃ, somanassavedanāyetaṃ nāmaṃ.
Or, sukha is the state of being happy; or it thoroughly consumes and digs out bodily and mental afflictions, hence sukha; this is a name for pleasant feeling (somanassavedanā).
Hoặc, sự an lạc là sukha; hoặc, nó ăn mòn, đào bới sự đau khổ của thân và tâm một cách tốt đẹp, nên gọi là sukha; đây là tên gọi của thọ hỷ (somanassavedanā).
Taṃ sātalakkhaṇaṃ.
It has the characteristic of pleasantness.
Nó có đặc tính là sự ngọt ngào.
Santepi ca nesaṃ katthaci avippayoge iṭṭhārammaṇapaṭilābhatuṭṭhi pīti, paṭiladdharasānubhavanaṃ sukhaṃ.
Even though they are not separated in some instances, pīti is the delight in obtaining a desirable object, and sukha is the experience of the taste of what has been obtained.
Và mặc dù ở một số nơi chúng không tách rời, nhưng sự vui mừng khi có được đối tượng mong muốn là pīti; sự hưởng thụ hương vị của cái đã có được là sukha.
Yattha pīti, tattha sukhaṃ.
Where there is pīti, there is sukha.
Nơi nào có pīti, nơi đó có sukha.
Yattha sukhaṃ, tattha na niyamato pīti.
Where there is sukha, pīti is not necessarily present.
Nơi nào có sukha, không nhất thiết phải có pīti.
Saṅkhārakkhandhasaṅgahitā pīti, vedanākkhandhasaṅgahitaṃ sukhaṃ.
Pīti is included in the aggregate of mental formations (saṅkhārakkhandha), while sukha is included in the aggregate of feeling (vedanākkhandha).
Pīti được bao gồm trong hành uẩn (saṅkhārakkhandha), sukha được bao gồm trong thọ uẩn (vedanākkhandha).
Kantārakhinnassa vanantudakadassanasavanesu viya pīti, vanacchāyāpavesanaudakaparibhogesu viya sukhaṃ.
It is like the pīti of a weary traveler seeing water in a forest or hearing about it, and the sukha of entering the forest shade and consuming the water.
Pīti giống như việc nhìn thấy và nghe nói về rừng và nước của người mệt mỏi trong sa mạc; sukha giống như việc đi vào bóng mát của rừng và sử dụng nước.
Tasmiṃ tasmiṃ samaye pākaṭabhāvato cetaṃ vuttanti veditabbaṃ.
It should be understood that this is stated due to their prominence at different times.
Và cần phải hiểu rằng điều này được nói đến do sự nổi bật của chúng vào những thời điểm tương ứng.
Iti ayañca pīti idañca sukhaṃ assa jhānassa, asmiṃ vā jhāne atthīti idaṃ jhānaṃ ‘‘pītisukha’’nti vuccati.
Thus, because this pīti and this sukha are in this jhāna, or belong to this jhāna, this jhāna is called " pītisukha."
Vì vậy, pīti này và sukha này thuộc về thiền này, hoặc có trong thiền này, nên thiền này được gọi là “pītisukha”.
Atha vā pīti ca sukhañca pītisukhaṃ dhammavinayādayo viya.
Alternatively, pīti and sukha together form pītisukha, like dhammavinaya (Dhamma and Vinaya) and so forth.
Hoặc là, pīti và sukha là pītisukha, giống như dhammavinaya (pháp và luật).
Vivekajaṃ pītisukhaṃ assa jhānassa, asmiṃ vā jhāne atthīti evampi vivekajaṃ pītisukhaṃ.
Joy and happiness born of seclusion belong to this jhāna, or are present in this jhāna; thus, it is also joy and happiness born of seclusion.
Pītisukha do ly dục sinh thuộc về thiền này, hoặc có trong thiền này, nên cũng là vivekajaṃ pītisukhaṃ.
Yatheva hi jhānaṃ, evaṃ pītisukhampettha vivekajameva hoti.
For just as the jhāna itself is born of seclusion, so too are the joy and happiness here born of seclusion.
Vì giống như thiền, pītisukha ở đây cũng do ly dục sinh.
Tañcassa atthīti tasmā alopasamāsaṃ katvā ekapadeneva ‘‘vivekajaṃpītisukha’’ntipi vattuṃ yujjati.
And since that (joy and happiness) are present in it, it is therefore appropriate to say "joy and happiness born of seclusion" as a single compound word, forming an alopa-samāsa.
Và nó có điều đó, do đó, sau khi tạo thành một hợp từ không lược bỏ (alopasamāsa), cũng có thể nói bằng một từ duy nhất là “vivekajaṃpītisukha”.
Paṭhamanti gaṇanānupubbatā paṭhamaṃ, paṭhamaṃ uppannantipi paṭhamaṃ.
First (paṭhamaṃ) means first in numerical order, or first as that which arises first.
Paṭhama (thứ nhất): Là thứ nhất theo thứ tự đếm, cũng là thứ nhất vì nó phát sinh đầu tiên.
Jhānanti duvidhaṃ jhānaṃ ārammaṇūpanijjhānañca lakkhaṇūpanijjhānañca.
Jhāna is twofold: jhāna as absorption in the object (ārammaṇūpanijjhāna) and jhāna as absorption in characteristics (lakkhaṇūpanijjhāna).
Jhāna (thiền): Jhāna có hai loại: ārammaṇūpanijjhāna (sự quán chiếu đối tượng) và lakkhaṇūpanijjhāna (sự quán chiếu đặc tính).
Tattha aṭṭha samāpattiyo pathavīkasiṇādiārammaṇaṃ upanijjhāyantīti ‘‘ārammaṇūpanijjhāna’’nti saṅkhyaṃ gatā.
Among these, the eight attainments are called "absorption in the object" because they absorb in objects such as the earth kasiṇa.
Trong đó, tám tầng thiền định được gọi là “ārammaṇūpanijjhāna” vì chúng quán chiếu các đối tượng như pathavīkasiṇa (biến xứ đất), v.v.
Vipassanāmaggaphalāni pana lakkhaṇūpanijjhānaṃ nāma.
Insight, path, and fruition are called absorption in characteristics.
Còn vipassanā (minh sát), magga (đạo) và phala (quả) được gọi là lakkhaṇūpanijjhāna.
Tattha vipassanā aniccādilakkhaṇassa upanijjhānato lakkhaṇūpanijjhānaṃ, vipassanāya katakiccassa maggena ijjhanato maggo lakkhaṇūpanijjhānaṃ, phalaṃ pana nirodhasaccaṃ tathalakkhaṇaṃ upanijjhāyatīti lakkhaṇūpanijjhānaṃ.
Among these, insight is absorption in characteristics because it absorbs in characteristics such as impermanence; the path is absorption in characteristics because the task accomplished by insight is fulfilled by the path; fruition, however, is absorption in characteristics because it absorbs in the characteristic of the truth of cessation (nirodhasacca).
Trong đó, vipassanā là lakkhaṇūpanijjhāna do sự quán chiếu các đặc tính như vô thường, v.v.; magga là lakkhaṇūpanijjhāna do sự thành tựu qua đạo lộ những gì đã được thực hiện bởi vipassanā; còn phala là lakkhaṇūpanijjhāna vì nó quán chiếu Diệt đế (nirodhasacca) có đặc tính như vậy.
Tesu idha pubbabhāge ārammaṇūpanijjhānaṃ, lokuttaramaggakkhaṇe lakkhaṇūpanijjhānaṃ adhippetaṃ, tasmā ārammaṇūpanijjhānato lakkhaṇūpanijjhānato paccanīkajjhāpanato ca ‘‘jhāna’’nti veditabbaṃ.
Among these, here, in the preliminary stage, absorption in the object is intended, while at the moment of the supramundane path, absorption in characteristics is intended; therefore, "jhāna" should be understood as absorption in the object, absorption in characteristics, and the burning up of adversaries.
Trong số đó, ở đây, trong giai đoạn tiền đạo, ārammaṇūpanijjhāna được nói đến; trong khoảnh khắc của đạo siêu thế, lakkhaṇūpanijjhāna được nói đến. Do đó, cần phải hiểu là “jhāna” do sự quán chiếu đối tượng, sự quán chiếu đặc tính, và sự thiêu đốt các pháp đối nghịch.
Upasampajjāti upagantvā, pāpuṇitvāti vuttaṃ hoti.
Having entered (upasampajjā) means having approached, having attained.
Upasampajja (đạt đến): Có nghĩa là đã đến gần, đã đạt được.
Upasampādayitvā vā, nipphādetvāti vuttaṃ hoti.
Or, having brought to completion, having accomplished.
Hoặc, sau khi làm cho thành tựu, có nghĩa là đã hoàn thành.
Viharatīti tadanurūpena iriyāpathavihārena iriyati, vuttappakārajhānasamaṅgī hutvā attabhāvassa vuttiṃ abhinipphādeti.
Dwells (viharatī) means he conducts himself with a mode of deportment (iriyāpathavihāra) suitable for that, being endowed with the jhāna of the aforementioned kind, he brings about the continuity of his existence.
Viharatī (trú) có nghĩa là sống với oai nghi tương ứng, sau khi đã thành tựu thiền định theo cách đã nói, vị ấy hoàn thiện sự tồn tại của tự thân.
Vitakkavicārānaṃ vūpasamāti ettha vitakkassa ca vicārassa cāti imesaṃ dvinnaṃ vūpasamā samatikkamā, dutiyajjhānakkhaṇe apātubhāvāti vuttaṃ hoti.
With the stilling of vitakka and vicāra (vitakkavicārānaṃ vūpasamā) means with the stilling of these two, vitakka and vicāra, with their transcendence, meaning their non-appearance at the moment of the second jhāna.
Vitakkavicārānaṃ vūpasamā (do sự an tịnh của tầm và tứ): Ở đây, có nghĩa là do sự an tịnh, do sự vượt qua của hai pháp này, tức là của tầm và của tứ; do chúng không xuất hiện trong khoảnh khắc của thiền thứ hai.
Tattha kiñcāpi dutiyajjhāne sabbepi paṭhamajjhānadhammā na santi, aññeyeva hi paṭhamajjhāne phassādayo, aññe idhāti.
Although all the factors of the first jhāna are not present in the second jhāna, for the contact and other factors in the first jhāna are different from those here.
Ở đó, mặc dù trong thiền thứ hai, tất cả các pháp của thiền thứ nhất đều không tồn tại, vì các pháp như xúc trong thiền thứ nhất là khác, và ở đây chúng là khác.
Oḷārikassa pana oḷārikassa aṅgassa samatikkamā paṭhamajjhānato paresaṃ dutiyajjhānādīnaṃ adhigamo hotīti dassanatthaṃ ‘‘vitakkavicārānaṃ vūpasamā’’ti evaṃ vuttanti veditabbaṃ.
However, it should be understood that "with the stilling of vitakka and vicāra" is said to show that the attainment of the second jhāna and so forth, which come after the first jhāna, occurs through the transcendence of the grosser and grosser factors.
Tuy nhiên, cần hiểu rằng việc chứng đắc các thiền sau, từ thiền thứ hai trở đi, sau thiền thứ nhất, xảy ra do sự vượt qua các chi phần thô thiển, và để chỉ ra điều này, câu "do sự an tịnh của tầm và tứ" đã được nói đến.
Ajjhattanti idha niyakajjhattaṃ adhippetaṃ, tasmā attani jātaṃ, attasantāne nibbattanti attho.
Internal (ajjhattaṃ) here refers to one's own internal state; therefore, the meaning is that which is born in oneself, that which arises in one's own continuum.
Ajjhattaṃ (nội): Ở đây, nó chỉ đến nội tâm của chính mình, do đó, ý nghĩa là sinh khởi trong tự thân, phát sinh trong dòng tâm thức của chính mình.
Tatrāyaṃ atthayojanā – eko udetīti ekodi, vitakkavicārehi anajjhārūḷhattā aggo seṭṭho hutvā udetīti attho.
Here is the explanation of the meaning: one (eko) arises (udeti), hence ekodi (one-pointedness); the meaning is that it arises as excellent, supreme, because it is not overwhelmed by vitakka and vicāra.
Ở đó, đây là cách kết hợp ý nghĩa: "sinh khởi một cách duy nhất" là ekodi; ý nghĩa là sinh khởi một cách cao tột, ưu việt, do không bị tầm và tứ chi phối.
Seṭṭhopi hi loke ekoti vuccati.
Indeed, even what is supreme is called "one" in the world.
Vì người ưu việt cũng được gọi là "duy nhất" (eko) trong đời.
Vitakkavicāravirahito vā eko asahāyo hutvā itipi vattuṃ vaṭṭati.
Or, it is also appropriate to say that it is "one," without a companion, being devoid of vitakka and vicāra.
Hoặc cũng có thể nói rằng, do không có tầm và tứ, nó sinh khởi một mình, không có bạn đồng hành.
Atha vā sampayuttadhamme udāyatīti udi, uṭṭhapetīti attho.
Alternatively, it causes the associated phenomena to arise (udāyati), meaning it establishes them.
Hoặc, "làm cho sinh khởi" (udāyati) các pháp tương ưng, ý nghĩa là "làm cho phát sinh" (uṭṭhapeti).
Seṭṭhaṭṭhena eko ca so udi cāti ekodi.
It is one (eko) in the sense of being supreme, and it causes to arise (udi), thus ekodi.
Vừa là "duy nhất" (eko) theo nghĩa ưu việt, vừa là "làm cho sinh khởi" (udi), nên gọi là ekodi.
Samādhissetaṃ adhivacanaṃ.
This is a designation for samādhi.
Đây là một tên gọi khác của định.
Iti imaṃ ekodiṃ bhāveti vaḍḍhetīti idaṃ dutiyaṃ jhānaṃ ekodibhāvaṃ.
Thus, this second jhāna is ekodibhāvaṃ (one-pointedness) because it develops and increases this ekodi.
Vì vậy, thiền thứ hai này "làm cho phát triển, làm cho tăng trưởng" (bhāveti vaḍḍheti) cái ekodi này, nên được gọi là ekodibhāvaṃ (sự phát triển nhất tâm).
So panāyaṃ ekodi yasmā cetaso, na sattassa na jīvassa.
But this ekodi belongs to the mind (cetaso), not to a being (sattassa) or a soul (jīvassa).
Và ekodi này là của tâm, không phải của chúng sinh, không phải của sinh mạng.
Tasmā etaṃ ‘‘cetaso ekodibhāva’’nti vuttaṃ.
Therefore, it is said to be "the one-pointedness of the mind."
Do đó, nó được gọi là "sự phát triển nhất tâm của tâm" (cetaso ekodibhāvaṃ).
Nanu cāyaṃ saddhā paṭhamajjhānepi atthi, ayañca ekodināmako samādhi.
But is not this saddhā present even in the first jhāna, and is not this samādhi called ekodi?
Chẳng phải tín này cũng có trong thiền thứ nhất sao, và cả định có tên là ekodi này nữa?
Atha kasmā idameva ‘‘sampasādanaṃ cetaso ekodibhāva’’nti ca vuttanti?
Then why is only this (second jhāna) referred to as "clarity of mind and one-pointedness"?
Vậy tại sao chỉ ở đây mới được gọi là "sự trong sạch, sự phát triển nhất tâm của tâm"?
Vuccate – aduñhi paṭhamajjhānaṃ vitakkavicārakkhobhena vīcitaraṅgasamākulamiva jalaṃ na suppasannaṃ hoti, tasmā satiyāpi saddhāya ‘‘sampasādana’’nti na vuttaṃ.
It is said: That first jhāna is not perfectly clear, like water agitated by waves due to the disturbance of vitakka and vicāra; therefore, even though saddhā is present, it is not called "clarity."
Xin trả lời: Thiền thứ nhất đó, do sự xáo động của tầm và tứ, giống như nước bị khuấy động bởi sóng gợn, không hoàn toàn trong sạch, do đó, mặc dù có tín, nó không được gọi là "sự trong sạch".
Na suppasannattāyeva cettha samādhipi na suṭṭhu pākaṭo.
And because it is not perfectly clear, samādhi is also not very manifest here.
Và chính vì không hoàn toàn trong sạch, nên định ở đó cũng không thật sự rõ ràng.
Tasmā ‘‘ekodibhāva’’ntipi na vuttaṃ.
Therefore, even ‘ekodibhāva’ was not stated.
Do đó, nó cũng không được gọi là "sự phát triển nhất tâm".
Imasmiṃ pana jhāne vitakkavicārapalibodhābhāvena laddhokāsā balavatī saddhā, balavasaddhāsahāyapaṭilābheneva ca samādhipi pākaṭo, tasmā idameva evaṃ vuttanti veditabbaṃ.
However, in this jhāna, due to the absence of the impediments of vitakka and vicāra, faith, having found its opportunity, becomes strong; and by the acquisition of strong faith as an ally, samādhi also becomes manifest. Therefore, it should be understood that only this* was stated in this manner.
Nhưng trong thiền này, do không có sự cản trở của tầm và tứ, tín có cơ hội trở nên mạnh mẽ, và chính nhờ có được sự hỗ trợ của tín mạnh mẽ, định cũng trở nên rõ ràng, do đó, cần hiểu rằng chỉ ở đây mới được gọi như vậy.
Avitakkaṃ avicāranti bhāvanāya pahīnattā etasmiṃ, etassa vā vitakko natthīti avitakkaṃ.
Avitakkaṃ avicāraṃ (without vitakka, without vicāra) means that in this jhāna, or for this jhāna, vitakka is absent due to its abandonment through development.
Avitakkaṃ avicāraṃ (không tầm, không tứ): Trong thiền này, hoặc đối với thiền này, không có tầm do đã được đoạn trừ bằng sự tu tập, nên gọi là không tầm.
Imināva nayena avicāraṃ.
In the same manner, it is avicāra.
Theo cách tương tự, là không tứ.
Etthāha – ‘‘nanu ca ‘vitakkavicārānaṃ vūpasamā’ti imināpi ayamattho siddho.
Here it is asked: “Is not this meaning already established by the phrase ‘due to the subsiding of vitakka and vicāra’?
Ở đây, có người hỏi: "Chẳng phải ý nghĩa này đã được xác định bởi câu 'do sự an tịnh của tầm và tứ' rồi sao?
Atha kasmā puna vuttaṃ ‘avitakkaṃ avicāra’nti’’?
Then why is it stated again as ‘avitakkaṃ avicāraṃ’?”
Vậy tại sao lại nói thêm 'không tầm, không tứ'?"
Vuccate – evametaṃ, siddhovāyamattho, na panetaṃ tadatthadīpakaṃ, nanu avocumha ‘‘oḷārikassa pana oḷārikassa aṅgassa samatikkamā paṭhamajjhānato paresaṃ dutiyajjhānādīnaṃ samadhigamo hotīti dassanatthaṃ vitakkavicārānaṃ vūpasamāti evaṃ vutta’’nti.
It is said: It is so; this meaning is indeed established, but that phrase does not clarify that meaning. Did we not say, “It was stated as ‘the subsiding of vitakka and vicāra’ to show that the attainment of the second jhāna and so on, after the first jhāna, occurs through the transcending of grosser and grosser factors”?
Xin trả lời: Đúng vậy, ý nghĩa đó đã được xác định, nhưng câu đó không phải để làm rõ ý nghĩa ấy. Chẳng phải chúng tôi đã nói: "Việc chứng đắc các thiền sau, từ thiền thứ hai trở đi, sau thiền thứ nhất, xảy ra do sự vượt qua các chi phần thô thiển, và để chỉ ra điều này, câu 'do sự an tịnh của tầm và tứ' đã được nói đến" hay sao?
Apica vitakkavicārānaṃ vūpasamā idaṃ sampasādanaṃ, na kilesakālussiyassa.
Furthermore, this purification (sampasādana) is due to the subsiding of vitakka and vicāra, not due to the agitation of defilements.
Hơn nữa, do sự an tịnh của tầm và tứ mà có sự trong sạch này, chứ không phải do sự an tịnh của sự ô nhiễm từ phiền não.
Vitakkavicārānañca vūpasamā ekodibhāvaṃ, na upacārajjhānamiva nīvaraṇappahānā, na paṭhamajjhānamiva ca aṅgapātubhāvāti evaṃ sampasādanaekodibhāvānaṃ hetuparidīpakamidaṃ vacanaṃ.
And this one-pointedness (ekodibhāva) is due to the subsiding of vitakka and vicāra, not due to the abandonment of hindrances like in access concentration (upacāra-jhāna), nor due to the manifestation of factors like in the first jhāna. Thus, this statement clarifies the cause of purification and one-pointedness.
Và do sự an tịnh của tầm và tứ mà có sự phát triển nhất tâm, chứ không phải do sự đoạn trừ các triền cái như thiền cận định, và cũng không phải do sự xuất hiện của các chi phần như thiền thứ nhất. Như vậy, câu này làm rõ nguyên nhân của sự trong sạch và sự phát triển nhất tâm.
Tathā vitakkavicārānaṃ vūpasamā idaṃ avitakkaavicāraṃ, na tatiyacatutthajjhānāni viya cakkhuviññāṇādīni viya ca abhāvāti evaṃ avitakkaavicārabhāvassa hetuparidīpakañca.
Likewise, this state of being without vitakka and vicāra (avitakka-avicāra) is due to the subsiding of vitakka and vicāra, not due to their non-existence like in the third and fourth jhāna, or like eye-consciousness and so on. Thus, it also clarifies the cause of the state of being avitakka-avicāra.
Tương tự, do sự an tịnh của tầm và tứ mà có trạng thái không tầm, không tứ này, chứ không phải do sự vắng mặt (của chúng) như trong thiền thứ ba, thứ tư, hoặc như trong nhãn thức v.v. Như vậy, nó cũng làm rõ nguyên nhân của trạng thái không tầm, không tứ.
Na vitakkavicārābhāvamattaparidīpakaṃ, vitakkavicārābhāvamattaparidīpakameva pana ‘‘avitakkaṃ avicāra’’nti idaṃ vacanaṃ.
It does not merely clarify the non-existence of vitakka and vicāra; rather, the statement “avitakkaṃ avicāraṃ” merely clarifies the non-existence of vitakka and vicāra.
Nó không chỉ đơn thuần làm rõ sự vắng mặt của tầm và tứ. Chính câu "không tầm, không tứ" mới là câu chỉ đơn thuần làm rõ sự vắng mặt của tầm và tứ.
Tasmā purimaṃ vatvāpi puna vattabbamevāti.
Therefore, even after stating the former, it must be stated again.
Do đó, sau khi đã nói câu trước, câu sau vẫn cần phải được nói đến.
Pītiyā ca virāgāti virāgo nāma vuttappakārāya pītiyā jigucchanaṃ vā samatikkamo vā, ubhinnaṃ pana antarā casaddo sampiṇḍanattho, so vūpasamaṃ vā sampiṇḍeti vitakkavicāravūpasamaṃ vā.
Pītiyā ca virāgā (from the fading of joy): Virāga means either disgust with joy of the described kind, or its transcendence. The word ‘ca’ between the two terms (pīti and virāga) has the meaning of combining. It combines either subsiding or the subsiding of vitakka and vicāra.
Pītiyā ca virāgā (do ly hỷ): Ly tham (virāga) ở đây có nghĩa là sự nhàm chán hoặc sự vượt qua đối với hỷ đã được nói đến. Từ "ca" (và) ở giữa hai từ có ý nghĩa tổng hợp, nó tổng hợp sự an tịnh hoặc tổng hợp sự an tịnh của tầm và tứ.
Tattha yadā vūpasamameva sampiṇḍeti, tadā pītiyā virāgā ca, kiñca bhiyyo vūpasamā cāti evaṃ yojanā veditabbā.
Therein, when it combines only subsiding, then the phrasing should be understood as: “from the fading of joy, and furthermore, from its subsiding.”
Ở đó, khi nó chỉ tổng hợp sự an tịnh, thì cần hiểu cách kết hợp là: do ly hỷ, và hơn nữa, do sự an tịnh.
Imissā ca yojanāya virāgo jigucchanattho hoti, tasmā pītiyā jigucchanā ca samatikkamā cāti ayamattho daṭṭhabbo.
And in this phrasing, virāga means disgust. Therefore, the meaning should be understood as: “from disgust with joy, and from its transcendence.”
Và trong cách kết hợp này, "ly tham" (virāga) có nghĩa là nhàm chán, do đó, cần hiểu ý nghĩa là: do sự nhàm chán và sự vượt qua đối với hỷ.
Yadā pana vitakkavicāravūpasamaṃ sampiṇḍeti, tadā pītiyā ca virāgā, kiñca bhiyyo vitakkavicārānañca vūpasamāti evaṃ yojanā veditabbā.
However, when it combines the subsiding of vitakka and vicāra, then the phrasing should be understood as: “from the fading of joy, and furthermore, from the subsiding of vitakka and vicāra.”
Còn khi nó tổng hợp sự an tịnh của tầm và tứ, thì cần hiểu cách kết hợp là: do ly hỷ, và hơn nữa, do sự an tịnh của tầm và tứ.
Imissā ca yojanāya virāgo samatikkamanattho hoti, tasmā pītiyā ca samatikkamā, vitakkavicārānañca vūpasamāti ayamattho daṭṭhabbo.
And in this phrasing, virāga means transcendence. Therefore, the meaning should be understood as: “from the transcendence of joy, and from the subsiding of vitakka and vicāra.”
Và trong cách kết hợp này, "ly tham" (virāga) có nghĩa là vượt qua, do đó, cần hiểu ý nghĩa là: do sự vượt qua đối với hỷ, và do sự an tịnh của tầm và tứ.
Kāmañcete vitakkavicārā dutiyajjhāneyeva vūpasantā, imassa pana jhānassa maggaparidīpanatthaṃ vaṇṇabhaṇanatthañcetaṃ vuttaṃ.
Although these vitakka and vicāra have indeed subsided in the second jhāna itself, this statement is made to clarify the path to this jhāna and to praise its excellence.
Mặc dù tầm và tứ này đã được an tịnh ngay trong thiền thứ hai, nhưng điều này được nói đến để chỉ rõ con đường và để tán thán thiền này.
Vitakkavicārānaṃ vūpasamāti hi vutte idaṃ paññāyati ‘‘nūna vitakkavicāravūpasamo maggo imassa jhānassā’’ti.
For when it is said, “due to the subsiding of vitakka and vicāra,” it is understood that “surely the subsiding of vitakka and vicāra is the path to this jhāna.”
Vì khi nói "do sự an tịnh của tầm và tứ", điều này được hiểu rằng "chắc chắn sự an tịnh của tầm và tứ là con đường của thiền này".
Yathā ca tatiye ariyamagge appahīnānampi sakkāyadiṭṭhādīnaṃ ‘‘pañcannaṃ orambhāgiyānaṃ saṃyojanānaṃ pahānā’’ti (dī. ni. 1.373; ma. ni. 2.133; saṃ. ni. 5.184; a. ni. 3.88) evaṃ pahānaṃ vuccamānaṃ vaṇṇabhaṇanaṃ hoti, tadadhigamāya ussukkānaṃ ussāhajanakaṃ, evameva idha avūpasantānampi vitakkavicārānaṃ vūpasamo vuccamāno vaṇṇabhaṇanaṃ hoti.
Just as in the third noble path (Anāgāmi-magga), even for those who have not abandoned sakkāya-diṭṭhi and so on, when the abandonment is spoken of as “the abandonment of the five lower fetters,” it becomes a praise, an inspiration for those striving for its attainment; in the same way, here, the subsiding of vitakka and vicāra, even though they have not yet completely subsided, when spoken of, becomes a praise.
Và giống như trong Thánh đạo thứ ba, việc nói về sự đoạn trừ các pháp chưa bị đoạn trừ như thân kiến v.v. qua câu "do đoạn trừ năm hạ phần kiết sử" là một sự tán thán, tạo ra sự nỗ lực cho những người đang phấn đấu để chứng đắc nó, cũng vậy, ở đây, việc nói về sự an tịnh của tầm và tứ, mặc dù chúng đã được an tịnh, cũng là một sự tán thán.
Tenāyamattho vutto ‘‘pītiyā ca samatikkamā vitakkavicārānañca vūpasamā’’ti.
Therefore, this meaning is stated: "due to the transcending of rapture and the cessation of initial and sustained application."
Do đó, ý nghĩa này được nói đến là "do sự vượt qua đối với hỷ và do sự an tịnh của tầm và tứ".
Tattha chaḷaṅgupekkhā ca brahmavihārupekkhā ca bojjhaṅgupekkhā ca tatramajjhattupekkhā ca jhānupekkhā ca pārisuddhupekkhā ca atthato ekā, tatramajjhattupekkhāva hoti.
Among these, chaḷaṅgupekkhā, brahmavihārupekkhā, bojjhaṅgupekkhā, tatramajjhattupekkhā, jhānupekkhā, and pārisuddhupekkhā are essentially one, being none other than tatramajjhattupekkhā.
Trong đó, chaḷaṅgupekkhā, brahmavihārupekkhā, bojjhaṅgupekkhā, tatramajjhattupekkhā, jhānupekkhā, và pārisuddhupekkhā, về mặt bản chất chỉ là một, chính là tatramajjhattupekkhā.
Tena tena avatthābhedena panassāyaṃ bhedo.
However, this distinction arises due to differences in their respective circumstances.
Tuy nhiên, sự phân biệt này của nó là do sự khác biệt của từng trạng thái.
Ekassāpi sato sattassa kumārayuvattherasenāpatirājādivasena bhedo viya, tasmā tāsu yattha chaḷaṅgupekkhā, na tattha bojjhaṅgupekkhādayo.
It is like the distinctions of a single being as a child, youth, elder, general, or king; therefore, it should be understood that where there is chaḷaṅgupekkhā, there are no bojjhaṅgupekkhā and so on.
Giống như sự phân biệt của cùng một chúng sinh qua các giai đoạn là thiếu niên, thanh niên, trưởng lão, tướng quân, vua chúa v.v., vì vậy, trong số chúng, ở đâu có chaḷaṅgupekkhā, ở đó không có bojjhaṅgupekkhā v.v.
Yattha vā pana bojjhaṅgupekkhā, na tattha chaḷaṅgupekkhādayo hontīti veditabbā.
And where there is bojjhaṅgupekkhā, there are no chaḷaṅgupekkhā and so on.
Hoặc ở đâu có bojjhaṅgupekkhā, ở đó không có chaḷaṅgupekkhā v.v., cần phải hiểu như vậy.
Yathā cetāsaṃ atthato ekībhāvo, evaṃ saṅkhārupekkhāvipassanupekkhānampi.
Just as these six are essentially one, so too are saṅkhārupekkhā and vipassanupekkhā.
Cũng như những tâm xả này về bản chất là một, saṅkhārupekkhā và vipassanupekkhā cũng vậy.
Paññā eva hi sā, kiccavasena dvidhā bhinnā.
Indeed, it is wisdom itself, divided into two according to its functions.
Vì nó chính là trí tuệ, được phân chia thành hai theo chức năng.
Yathā hi purisassa sāyaṃ gehaṃ paviṭṭhaṃ sappaṃ ajapadadaṇḍaṃ gahetvā pariyesamānassa taṃ thusakoṭṭhake nipannaṃ disvā ‘‘sappo nu kho, no’’ti avalokentassa sovatthikattayaṃ disvā nibbematikassa ‘‘sappo, na sappo’’ti vicinane majjhattatā uppajjati, evameva yā āraddhavipassakassa vipassanāñāṇena lakkhaṇattaye diṭṭhe saṅkhārānaṃ aniccabhāvādivicinane majjhattatā uppajjati, ayaṃ vipassanupekkhā.
Just as when a man, searching with a goat-foot-shaped stick for a snake that has entered his house in the evening, sees it lying in a pile of husks, and looking closely, seeing three auspicious marks, becomes free from doubt, and then indifference arises in his deliberation, "Is it a snake or not a snake?" -- in the same way, when a meditator who has commenced vipassanā sees the three characteristics with vipassanā-ñāṇa, the indifference that arises in his deliberation about the impermanence (anicca) and so on of the saṅkhāras, this is called vipassanā-upekkhā.
Ví như một người đàn ông, khi tìm kiếm con rắn đã vào nhà vào buổi tối bằng cây gậy có đầu chạc, thấy nó nằm trong đống trấu, khi nhìn xem "có phải là rắn hay không", thấy ba đường vằn trên cổ và hết nghi ngờ, thì sự trung bình trong việc thẩm xét "là rắn, không phải rắn" sinh khởi; cũng vậy, đối với người đã bắt đầu thực hành minh sát, khi ba tướng được thấy bằng trí minh sát, sự trung bình trong việc thẩm xét tính vô thường v.v. của các hành sinh khởi, đây là vipassanupekkhā.
Yathā pana tassa purisassa ajapadadaṇḍena gāḷhaṃ sappaṃ gahetvā ‘‘kintāhaṃ imaṃ sappaṃ aviheṭhento attānañca iminā aḍaṃsāpento muñceyya’’nti muñcanākārameva pariyesato gahaṇe majjhattatā hoti, evameva yā lakkhaṇattayassa diṭṭhattā āditte viya tayo bhave passato saṅkhāragahaṇe majjhattatā, ayaṃ saṅkhārupekkhā.
However, just as for that man, having firmly caught the snake with the goat-foot-shaped stick, and searching only for a way to release it, thinking, "How can I release this snake without harming it and without being bitten by it myself?", there is indifference in holding it; in the same way, the indifference in grasping the saṅkhāras, seeing the three existences as if ablaze due to having seen the three characteristics, this is saṅkhārupekkhā.
Vả lại, ví như người đàn ông ấy, sau khi dùng cây gậy có đầu chạc bắt chặt con rắn, khi tìm kiếm cách thả nó ra "làm sao ta có thể thả con rắn này mà không làm hại nó và cũng không để nó cắn mình", thì có sự trung bình trong việc bắt giữ; cũng vậy, do đã thấy ba tướng, khi nhìn ba cõi như đang bốc cháy, có sự trung bình trong việc nắm bắt các hành, đây là saṅkhārupekkhā.
Iti vipassanupekkhāya siddhāya saṅkhārupekkhāpi siddhāva hoti.
Thus, when vipassanā-upekkhā is accomplished, saṅkhārupekkhā is also accomplished.
Như vậy, khi vipassanupekkhā đã thành tựu, saṅkhārupekkhā cũng đã thành tựu.
Iminā panesā vicinanagahaṇesu majjhattasaṅkhātena kiccena dvidhā bhinnāti.
But this (upekkhā) is distinguished into two by its function, which is called indifference in deliberation and grasping.
Tuy nhiên, nó được phân chia thành hai do chức năng này, được gọi là sự trung bình trong việc thẩm xét và nắm bắt.
Vīriyupekkhā pana vedanupekkhā ca aññamaññañca avasesāhi ca atthato bhinnā evāti.
Vīriyupekkhā and vedanupekkhā, however, are different from each other and from the remaining (upekkhās) in terms of their essence.
Còn vīriyupekkhā và vedanupekkhā thì về bản chất khác nhau, cả với nhau và với các loại còn lại.
Āha cettha –
Here it is said:
Về điều này, có nói rằng –
Iti imāsu upekkhāsu jhānupekkhā idha adhippetā.
Among these upekkhās, jhāna-upekkhā is intended here.
Như vậy, trong các loại upekkhā này, jhānupekkhā được ngụ ý ở đây.
Sā majjhattalakkhaṇā.
It has the characteristic of indifference (majjhattatā).
Nó có đặc tính trung bình.
Etthāha – ‘‘nanu cāyaṃ atthato tatramajjhattupekkhāva hoti, sā ca paṭhamadutiyajjhānesupi atthi, tasmā tatrapi ‘upekkhako ca viharatī’ti evamayaṃ vattabbā siyā, sā kasmā na vuttā’’ti?
Here it is asked: “Is this not essentially tatramajjhattatā-upekkhā, and since that is present even in the first and second jhānas, should it not also be said there, ‘He dwells with upekkhā’? Why was it not stated?”
Ở đây, có người hỏi: "Chẳng phải tâm xả này về bản chất chính là tatramajjhattupekkhā sao? Và nó cũng có trong thiền thứ nhất và thứ hai, do đó, ở đó cũng nên nói rằng 'và an trú với tâm xả'. Tại sao lại không được nói như vậy?"
Aparibyattakiccato.
Because its function is not manifest.
Vì chức năng chưa rõ ràng.
Aparibyattañhi tassa tattha kiccaṃ vitakkādīhi abhibhūtattā, idha panāyaṃ vitakkavicārapītīhi anabhibhūtattā ukkhittasirā viya hutvā paribyattakiccā jātā, tasmā vuttāti.
For its function there is not manifest, being overwhelmed by vitakka and so on; but here, not being overwhelmed by vitakka, vicāra, and pīti, it becomes manifest in its function, like one who lifts their head, therefore it is stated.
Thật vậy, chức năng của nó ở đó chưa rõ ràng vì bị tầm v.v. lấn át, nhưng ở đây, do không bị tầm, tứ, và hỷ lấn át, nó trở nên như ngẩng cao đầu và có chức năng rõ ràng, vì vậy mới được nói đến.
Idāni sato ca sampajānoti ettha saratīti sato.
Now, in sato ca sampajāno (mindful and clearly comprehending), 'sato' means remembering.
Bây giờ, trong câu chánh niệm và tỉnh giác, người ghi nhớ là người chánh niệm.
Sampajānātīti sampajāno.
'Sampajāno' means clearly comprehending.
Người biết rõ là người tỉnh giác.
Iti puggalena sati ca sampajaññañca vuttaṃ.
Thus, by the individual, both sati (mindfulness) and sampajañña (clear comprehension) are spoken of.
Như vậy, chánh niệm và tỉnh giác được nói đến thông qua người thực hành.
Tattha saraṇalakkhaṇā sati.
Among these, sati has the characteristic of remembering.
Trong đó, chánh niệm có đặc tính ghi nhớ.
Asammohalakkhaṇaṃ sampajaññaṃ.
Sampajañña has the characteristic of non-delusion.
Tỉnh giác có đặc tính không si mê.
Tattha kiñcāpi idaṃ satisampajaññaṃ purimajjhānesupi atthi, muṭṭhassatissa hi asampajānassa upacāramattampi na sampajjati, pageva appanā.
Although this sati and sampajañña are present in the earlier jhānas as well—for one who is unmindful and lacks clear comprehension, not even access concentration (upacāra) is attained, let alone absorption (appanā)—
Trong đó, mặc dù chánh niệm và tỉnh giác này cũng có trong các tầng thiền trước – vì người thất niệm, không tỉnh giác thì ngay cả cận định cũng không thành tựu, huống chi là an chỉ định.
Oḷārikattā pana tesaṃ jhānānaṃ bhūmiyaṃ viya purisassa cittassa gati sukhā hoti, abyattaṃ tattha satisampajaññakiccaṃ.
yet, due to the coarseness of those jhānas, the movement of the mind is pleasant, like a man walking on flat ground, and the function of sati and sampajañña there is not manifest.
Tuy nhiên, do các tầng thiền đó thô thiển, sự vận hành của tâm được dễ dàng như một người đi trên mặt đất, chức năng của chánh niệm và tỉnh giác ở đó không rõ ràng.
Oḷārikaṅgappahānena pana sukhumattā imassa jhānassa purisassa khuradhārāyaṃ viya satisampajaññakiccapariggahitā eva cittassa gati icchitabbāti idheva vuttaṃ.
However, due to the subtlety of this jhāna, through the abandoning of coarse factors, the movement of the mind, grasped by the function of sati and sampajañña, is to be desired as if a man walking on a razor's edge; therefore, it is stated only here.
Nhưng do sự vi tế của tầng thiền này sau khi đã từ bỏ các chi thô thiển, sự vận hành của tâm phải được mong đợi là chỉ được duy trì bởi chức năng của chánh niệm và tỉnh giác, giống như một người đi trên lưỡi dao cạo, vì vậy nó chỉ được nói đến ở đây.
Kiñca bhiyyo – yathā dhenupago vaccho dhenuto apanīto arakkhiyamāno punadeva dhenuṃ upagacchati, evamidaṃ tatiyajjhānasukhaṃ pītito apanītampi satisampajaññārakkhena arakkhiyamānaṃ punadeva pītiṃ upagaccheyya, pītisampayuttameva siyā.
What is more, just as a calf accustomed to its mother, when separated from its mother and not guarded, returns to its mother; in the same way, this third jhāna pleasure, even when separated from pīti, if not guarded by the protection of sati and sampajañña, might return to pīti, and would be associated with pīti.
Hơn nữa, cũng như con bê con theo mẹ, khi bị tách khỏi mẹ, nếu không được canh chừng, nó sẽ lại tìm về với mẹ; cũng vậy, lạc của thiền thứ ba này, dù đã tách khỏi hỷ, nếu không được bảo vệ bởi sự canh chừng của chánh niệm và tỉnh giác, nó có thể sẽ lại tìm về với hỷ, trở thành tương ưng với hỷ.
Sukhe vāpi sattā sārajjanti, idañca atimadhuraṃ sukhaṃ tato paraṃ sukhābhāvā.
Or beings delight in pleasure, and this pleasure is exceedingly sweet, there being no pleasure superior to it.
Vả lại, chúng sanh thường đắm say trong lạc, và đây là lạc vô cùng ngọt ngào, vì không có lạc nào vượt hơn thế nữa.
Satisampajaññānubhāvena panettha sukhe asārajjanā hoti, no aññathāti imampi atthavisesaṃ dassetuṃ idaṃ idheva vuttanti veditabbaṃ.
But here, through the power of sati and sampajañña, there is no clinging to pleasure, not otherwise; this special meaning is also to be understood as being shown by stating it only here.
Nhờ năng lực của chánh niệm và tỉnh giác mà có sự không đắm say trong lạc ở đây, chứ không phải bằng cách nào khác. Cần phải hiểu rằng, để chỉ rõ ý nghĩa đặc biệt này, điều này đã được nói đến chính ở đây.
Kasmā pana taṃ te evaṃ pasaṃsantīti?
But why do they praise him thus?
Vậy tại sao các ngài lại tán thán vị ấy như vậy?
Pasaṃsārahato.
Because he is worthy of praise.
Vì vị ấy xứng đáng được tán thán.
Ayañhi yasmā atimadhurasukhe sukhapāramippattepi tatiyajjhāne upekkhako, na tattha sukhābhisaṅgena ākaḍḍhīyati.
For this individual, being equanimous in the third jhāna, which is exceedingly sweet happiness and has reached the culmination of happiness, is not drawn by attachment to that happiness.
Bởi vì, vị ấy có tâm xả ngay cả trong thiền thứ ba, vốn là đỉnh cao của lạc, một lạc vô cùng ngọt ngào; vị ấy không bị lôi cuốn bởi sự dính mắc vào lạc ở đó.
Yathā ca pīti na uppajjati, evaṃ upaṭṭhitassatitāya satimā.
And he is mindful, because his mindfulness is established in such a way that rapture does not arise.
Và vị ấy có chánh niệm do niệm đã được an lập để hỷ không sanh khởi.
Yasmā ca ariyakantaṃ ariyajanasevitameva ca asaṃkiliṭṭhaṃ sukhaṃ nāmakāyena paṭisaṃvedeti, tasmā pasaṃsāraho hoti.
And because he experiences with his mental body a happiness that is dear to the Noble Ones, served by the Noble Ones, and undefiled, he is therefore worthy of praise.
Và bởi vì vị ấy cảm thọ bằng danh thân một thứ lạc không ô nhiễm, được các bậc Thánh ưa thích và thực hành, nên vị ấy xứng đáng được tán thán.
Iti pasaṃsārahato naṃ ariyā te evaṃ pasaṃsārahahetubhūte guṇe pakāsentā ‘‘upekkhako satimā sukhavihārī’’ti evaṃ pasaṃsantīti veditabbaṃ.
Thus, it should be understood that the Noble Ones, proclaiming these qualities which are reasons for praise, praise him as “equanimous, mindful, abiding in comfort” because he is worthy of praise.
Vì vậy, cần phải hiểu rằng, do vị ấy xứng đáng được tán thán, các bậc Thánh, khi tuyên dương những phẩm chất là nguyên nhân xứng đáng được tán thán ấy, đã tán thán vị ấy rằng: ‘xả, niệm, lạc trú’.
Tatiyanti gaṇanānupubbatā tatiyaṃ, tatiyaṃ uppannantipi tatiyaṃ.
“Third” means third in numerical order, and also third because it has arisen as the third.
Thứ ba: là thứ ba theo thứ tự đếm; cũng là thứ ba vì là tầng thiền sanh khởi lần thứ ba.
Sukhassa ca pahānā dukkhassa ca pahānāti kāyikasukhassa ca kāyikadukkhassa ca pahānā.
“Through the abandoning of pleasure and the abandoning of pain” means through the abandoning of bodily pleasure and bodily pain.
Sukhassa ca pahānā dukkhassa ca pahānā (do xả lạc, do xả khổ) là do xả lạc thuộc thân và khổ thuộc thân.
Pubbevāti tañca kho pubbeva, na catutthajjhānakkhaṇe.
“Even before” means that abandoning occurs even before, not at the moment of the fourth jhāna.
Pubbevā (trước đó) là việc xả bỏ ấy đã xảy ra trước đó, chứ không phải trong khoảnh khắc của thiền thứ tư.
Somanassadomanassānaṃ atthaṅgamāti cetasikasukhassa cetasikadukkhassa cāti imesampi dvinnaṃ pubbeva atthaṅgamā, pahānā icceva vuttaṃ hoti.
“Through the disappearance of joy and sorrow” means that the disappearance of these two, mental pleasure and mental pain, also occurs even before; it is simply stated as abandoning.
Somanassadomanassānaṃ atthaṅgamā (do diệt hỷ và ưu) là do sự diệt tận, tức là sự xả bỏ, của hai pháp này, là lạc thuộc tâm và khổ thuộc tâm, cũng đã xảy ra trước đó.
Kadā pana nesaṃ pahānaṃ hoti?
But when does their abandoning occur?
Vậy khi nào sự xả bỏ chúng xảy ra?
Catunnaṃ jhānānaṃ upacārakkhaṇe.
At the proximate moment (upacāra-moment) of the four jhāna's.
Trong khoảnh khắc cận định của bốn tầng thiền.
Somanassañhi catutthassa jhānassa upacārakkhaṇeyeva pahīyati, dukkhadomanassasukhāni paṭhamadutiyatatiyānaṃ upacārakkhaṇesu.
Joy, indeed, is abandoned only at the proximate moment of the fourth jhāna, while pain, sorrow, and pleasure are abandoned at the proximate moments of the first, second, and third jhāna's respectively.
Hỷ được xả bỏ ngay trong khoảnh khắc cận định của thiền thứ tư; còn khổ, ưu, và lạc được xả bỏ trong các khoảnh khắc cận định của thiền thứ nhất, thứ hai, và thứ ba.
Evametesaṃ pahānakkamena avuttānaṃ indriyavibhaṅge (vibha. 219 ādayo) pana indriyānaṃ uddesakkameneva idhāpi vuttānaṃ sukhadukkhasomanassadomanassānaṃ pahānaṃ veditabbaṃ.
Thus, the abandoning of pleasure, pain, joy, and sorrow, which are not stated in the order of their abandoning here, but are stated here in the order of their enumeration in the Indriya-vibhaṅga, should be understood.
Như vậy, cần phải hiểu sự xả bỏ của lạc, khổ, hỷ, ưu, những pháp được nói đến ở đây theo thứ tự đề mục của các quyền trong Indriyavibhaṅga (Phân Tích về Quyền), chứ không phải theo thứ tự xả bỏ của chúng.
Yadi panetāni tassa tassa jhānassa upacārakkhaṇeyeva pahīyanti, atha kasmā ‘‘kattha cuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati?
If these are abandoned only at the proximate moment of each jhāna, then why is it said that "Where, bhikkhus, does the faculty of pain, having arisen, cease without remainder?
Nếu những thọ này được xả bỏ ngay trong khoảnh khắc cận định của mỗi tầng thiền tương ứng, vậy tại sao trong kinh lại nói sự đoạn diệt của chúng xảy ra ngay trong các tầng thiền, như trong câu: "Ở đâu khổ quyền đã sanh được đoạn diệt không còn dư tàn?
Idha, bhikkhave, bhikkhu vivicceva kāmehi…pe… paṭhamajjhānaṃ upasampajja viharati.
Here, bhikkhus, a bhikkhu, quite secluded from sensual pleasures… he enters upon and abides in the first jhāna.
Này các Tỳ khưu, ở đây, Tỳ khưu ly dục...v.v... chứng và trú thiền thứ nhất.
Ettha cuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati.
Here, the faculty of pain, having arisen, ceases without remainder.
Ở đó, khổ quyền đã sanh được đoạn diệt không còn dư tàn.
Kattha cuppannaṃ domanassindriyaṃ, sukhindriyaṃ, somanassindriyaṃ aparisesaṃ nirujjhati?
Where does the faculty of sorrow, the faculty of pleasure, the faculty of joy, having arisen, cease without remainder?
Ở đâu ưu quyền, lạc quyền, hỷ quyền đã sanh được đoạn diệt không còn dư tàn?
Idha, bhikkhave, bhikkhu sukhassa ca pahānā…pe… catutthaṃ jhānaṃ upasampajja viharati.
Here, bhikkhus, through the abandoning of pleasure… he enters upon and abides in the fourth jhāna.
Này các Tỳ khưu, ở đây, Tỳ khưu do xả lạc...v.v... chứng và trú thiền thứ tư.
Ettha cuppannaṃ somanassindriyaṃ aparisesaṃ nirujjhatī’’ti (saṃ. ni. 5.510) evaṃ jhānesveva nirodho vuttoti?
Here, the faculty of joy, having arisen, ceases without remainder" — why is cessation stated only in the jhāna's?
Ở đó, hỷ quyền đã sanh được đoạn diệt không còn dư tàn"?
Atisayanirodhattā.
Because it is an extraordinary cessation.
Vì đó là sự đoạn diệt vượt trội.
Atisayanirodho hi tesaṃ paṭhamajjhānādīsu, na nirodhoyeva.
For their extraordinary cessation occurs in the first jhāna and so forth, not merely cessation.
Sự đoạn diệt vượt trội của chúng xảy ra trong thiền thứ nhất v.v..., chứ không phải chỉ là sự đoạn diệt đơn thuần.
Nirodhoyeva pana upacārakkhaṇe, nātisayanirodho.
But mere cessation occurs at the proximate moment, not extraordinary cessation.
Sự đoạn diệt đơn thuần xảy ra trong khoảnh khắc cận định, không phải là sự đoạn diệt vượt trội.
Tathā hi nānāvajjane paṭhamajjhānūpacāre niruddhassāpi dukkhindriyassa ḍaṃsamakasādisamphassena vā visamāsanūpatāpena vā siyā uppatti, na tveva antoappanāyaṃ.
Thus, even though the faculty of pain has ceased in the proximate concentration of the first jhāna, which has various types of advertence, it might arise due to the touch of gnats, mosquitoes, etc., or due to discomfort from an uneven seat, but not within absorption (appanā).
Thật vậy, trong cận định của thiền thứ nhất với các tác ý khác nhau, dù khổ quyền đã được đoạn diệt, nó vẫn có thể sanh khởi do sự xúc chạm của ruồi, muỗi, v.v... hoặc do sự khó chịu của tư thế ngồi không thoải mái, nhưng chắc chắn không thể sanh khởi trong trạng thái an chỉ định.
Upacāre vā niruddhampetaṃ na suṭṭhu niruddhaṃ hoti paṭipakkhena avihatattā.
Or, even if it has ceased in proximate concentration, it is not truly ceased because it has not been overcome by its opposite.
Hoặc, dù đã được đoạn diệt trong cận định, nó vẫn chưa được đoạn diệt hoàn toàn vì chưa bị đối trị bởi pháp đối nghịch.
Antoappanāyaṃ pana pītipharaṇena sabbo kāyo sukhokkanto hoti, sukhokkantakāyassa ca suṭṭhu niruddhaṃ hoti dukkhindriyaṃ paṭipakkhena vihatattā.
However, within absorption, the entire body is pervaded by pleasure through the suffusion of rapture, and for one whose body is pervaded by pleasure, the faculty of pain is truly ceased, having been overcome by its opposite.
Nhưng trong trạng thái an chỉ định, toàn thân được thấm nhuần bởi lạc do sự lan tỏa của hỷ, và đối với người có thân thấm nhuần lạc, khổ quyền được đoạn diệt hoàn toàn vì đã bị đối trị bởi pháp đối nghịch.
Nānāvajjaneyeva ca dutiyajjhānūpacāre pahīnassāpi domanassindriyassa, yasmā etaṃ vitakkavicārapaccayepi kāyakilamathe cittūpaghāte ca sati uppajjati, vitakkavicārābhāve neva uppajjati.
And even though the faculty of sorrow has been abandoned in the proximate concentration of the second jhāna, which has various types of advertence, it may arise when there is physical fatigue or mental distress due to vitakka and vicāra, but it does not arise in the absence of vitakka and vicāra.
Và trong cận định của thiền thứ hai với các tác ý khác nhau, dù ưu quyền đã được xả bỏ, nhưng vì nó sanh khởi khi có sự mệt mỏi của thân và sự tổn hại của tâm, vốn là duyên của tầm và tứ, nên khi không có tầm và tứ, nó không sanh khởi.
Yattha pana uppajjati, tattha vitakkavicārabhāve.
But where it does arise, it is in the presence of vitakka and vicāra.
Ở đâu nó sanh khởi, ở đó có sự hiện hữu của tầm và tứ.
Appahīnāyeva ca dutiyajjhānūpacāre vitakkavicārāti tatthassa siyā uppatti, natveva dutiyajjhāne pahīnapaccayattā.
And since vitakka and vicāra are not yet abandoned in the proximate concentration of the second jhāna, its arising there might be possible, but not in the second jhāna itself, because its causes have been abandoned.
Và vì tầm và tứ chưa được xả bỏ trong cận định của thiền thứ hai, nên ưu quyền có thể sanh khởi ở đó, nhưng chắc chắn không thể sanh khởi trong thiền thứ hai vì các duyên của nó đã được xả bỏ.
Tathā tatiyajjhānūpacāre pahīnassāpi sukhindriyassa pītisamuṭṭhānapaṇītarūpaphuṭṭhakāyassa siyā uppatti, natveva tatiyajjhāne.
Similarly, even though the faculty of pleasure has been abandoned in the access concentration of the third jhāna, it might arise for one whose body is pervaded by exalted form arisen from rapture, but certainly not in the third jhāna itself.
Tương tự, trong cận định của thiền thứ ba, dù lạc quyền đã được xả bỏ, nhưng đối với người có thân được thấm nhuần bởi sắc pháp vi tế do hỷ sanh, nó vẫn có thể sanh khởi, nhưng chắc chắn không thể sanh khởi trong thiền thứ ba.
Tatiyajjhāne hi sukhassa paccayabhūtā pīti sabbaso niruddhā hoti.
For in the third jhāna, rapture, which is the condition for pleasure, is completely ceased.
Bởi vì trong thiền thứ ba, hỷ, là duyên của lạc, đã được đoạn diệt hoàn toàn.
Tathā catutthajjhānūpacāre pahīnassāpi somanassindriyassa āsannattā, appanāppattāya upekkhāya abhāvena sammā anatikkantattā ca siyā uppatti, natveva catutthajjhāne.
Similarly, even though the faculty of joy has been abandoned in the access concentration of the fourth jhāna, it might arise due to its proximity and due to the absence of equanimity that has attained absorption, and because it has not been fully transcended, but certainly not in the fourth jhāna itself.
Tương tự, trong cận định của thiền thứ tư, dù hỷ quyền đã được xả bỏ, nhưng do sự gần gũi (với thiền thứ ba), do chưa có xả đã đạt đến an chỉ định, và do chưa được vượt qua một cách đúng đắn, nó vẫn có thể sanh khởi, nhưng chắc chắn không thể sanh khởi trong thiền thứ tư.
Tasmā eva ca ‘‘etthuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhatī’’ti tattha tattha aparisesaggahaṇaṃ katanti.
And for this very reason, the phrase "the faculty of suffering arisen here ceases without remainder" is used in various places to signify cessation without remainder.
Chính vì vậy, ở mỗi nơi, việc sử dụng từ "không còn dư tàn" đã được thực hiện, như trong câu "ở đó, khổ quyền đã sanh được đoạn diệt không còn dư tàn".
Etthāha – ‘‘athevaṃ tassa tassa jhānassūpacāre pahīnāpi etā vedanā idha kasmā samāharī’’ti?
Here, the questioner asks: "If these feelings are abandoned in the access concentration of each jhāna, then why are they all brought together here?"
Ở đây có câu hỏi: "Nếu những thọ này đã được xả bỏ trong cận định của mỗi tầng thiền tương ứng, tại sao chúng lại được tập hợp lại ở đây?"
Sukhaggahaṇatthaṃ.
For ease of comprehension.
Để dễ nắm bắt được lạc.
Yā hi ayaṃ ‘‘adukkhamasukha’’nti ettha adukkhamasukhā vedanā vuttā, sā sukhumā dubbiññeyyā na sakkā sukhena gahetuṃ, tasmā yathā nāma duṭṭhassa yathā tathā vā upasaṅkamitvā gahetuṃ asakkuṇeyyassa goṇassa gahaṇatthaṃ gopo ekasmiṃ vaje sabbā gāvo samāharati, athekekaṃ nīharanto paṭipāṭiyā āgataṃ ‘‘ayaṃ so gaṇhatha na’’nti tampi gāhāpeti, evamevaṃ sukhaggahaṇatthaṃ sabbāpi etā samāhari.
For the feeling of neither-pain-nor-pleasure mentioned here as "neither painful nor pleasant" is subtle and difficult to discern; it cannot be easily grasped. Therefore, just as a cowherd gathers all the cows into one pen to catch a wild bull that cannot be approached and caught easily by any means, and then, leading them out one by one, points to the one that comes in sequence, saying, "This is the one, catch it!", and has it caught; in the same way, to make it easy to grasp, all these feelings were brought together.
Thật vậy, thọ bất khổ bất lạc được nói đến trong câu "bất khổ bất lạc" rất vi tế, khó nhận biết, không thể dễ dàng nắm bắt. Do đó, cũng như người chăn bò, để bắt một con bò hung dữ không thể tiếp cận và bắt một cách tùy tiện, người ấy lùa tất cả bò vào một chuồng, sau đó khi dắt từng con ra, con bò hung dữ cũng theo thứ tự đi ra, người ấy liền nói "Đây là nó, hãy bắt lấy nó" và bảo người khác bắt lấy nó; cũng vậy, để dễ nắm bắt được lạc, tất cả những thọ này đã được tập hợp lại.
Evañhi samāhaṭā etā dassetvā ‘‘yaṃ neva sukhaṃ, na dukkhaṃ, na somanassaṃ, na domanassaṃ, ayaṃ adukkhamasukhāvedanā’’ti sakkā hoti esā gāhayituṃ.
Only by thus presenting these gathered feelings can one be made to understand: "That which is neither pleasure nor pain, neither joy nor sorrow, this is the feeling of neither-pain-nor-pleasure."
Bởi vì, sau khi đã trình bày những thọ được tập hợp như vậy, người ta có thể làm cho người khác nắm bắt được thọ này bằng cách nói: "Pháp nào không phải lạc, không phải khổ, không phải hỷ, không phải ưu, đó chính là thọ bất khổ bất lạc."
Apica adukkhamasukhāya cetovimuttiyā paccayadassanatthañcāpi etā vuttāti veditabbā.
Furthermore, it should be understood that these feelings are mentioned also to show the conditions for the liberation of mind through neither-pain-nor-pleasure (adukkhamasukhā cetovimutti).
Hơn nữa, cần phải hiểu rằng những thọ này được nói đến cũng là để chỉ ra các duyên của tâm giải thoát bất khổ bất lạc.
Sukhadukkhappahānādayo hi tassā paccayā.
Indeed, the abandonment of pleasure and pain, and so on, are its conditions.
Quả vậy, việc từ bỏ lạc và khổ, v.v., là các duyên của thiền ấy.
Yathāha – ‘‘cattāro kho, āvuso, paccayā adukkhamasukhāya cetovimuttiyā samāpattiyā.
As it is said: "There are, friends, four conditions for the attainment of the liberation of mind through neither-pain-nor-pleasure.
Như đã nói: "Này hiền giả, có bốn duyên để chứng đạt tâm giải thoát không khổ không lạc.
Idhāvuso, bhikkhu sukhassa ca pahānā…pe… catutthaṃ jhānaṃ upasampajja viharati.
Here, friends, a bhikkhu, abandoning pleasure…pe… abides having entered the fourth jhāna.
Này hiền giả, ở đây, vị tỳ khưu do từ bỏ lạc... ... đạt và an trú thiền thứ tư.
Ime kho āvuso, cattāro paccayā adukkhamasukhāya cetovimuttiyā samāpattiyā’’ti (ma. ni. 1.458).
These, friends, are the four conditions for the attainment of the liberation of mind through neither-pain-nor-pleasure."
Này hiền giả, đây là bốn duyên để chứng đạt tâm giải thoát không khổ không lạc."
Yathā vā aññattha pahīnāpi sakkāyadiṭṭhiādayo tatiyamaggassa vaṇṇabhaṇanatthaṃ tattha pahīnāti vuttā, evaṃ vaṇṇabhaṇanatthampetassa jhānassetā idha vuttātipi veditabbā.
Or, just as wrong views (sakkāyadiṭṭhi) and so on, though abandoned elsewhere, are mentioned as abandoned in the third path (Anāgāmi-magga) to extol its virtues, so too, these are mentioned here to extol the virtues of this jhāna.
Hoặc, cũng nên hiểu rằng, giống như ở nơi khác, các pháp như thân kiến v.v. đã được từ bỏ (ở đạo Tu-đà-hoàn) lại được nói là đã được từ bỏ ở đạo thứ ba (đạo A-na-hàm) để tán thán đạo ấy, cũng vậy, các thọ này được nói ở đây là để tán thán thiền này.
Paccayaghātena vā ettha rāgadosānaṃ atidūrabhāvaṃ dassetumpetā vuttāti veditabbā.
Or, it should be understood that these are mentioned here to show the extreme remoteness of greed and hatred through the destruction of their conditions.
Hoặc, cũng nên hiểu rằng, chúng được nói ở đây để chỉ ra rằng tham và sân ở rất xa do đã diệt trừ các duyên của chúng.
Etāsu hi sukhaṃ somanassassa paccayo, somanassaṃ rāgassa, dukkhaṃ domanassassa, domanassaṃ dosassa.
For among these, pleasure is a condition for joy, joy for greed; pain is a condition for sorrow, sorrow for hatred.
Quả vậy, trong các thọ này, lạc là duyên của hỷ, hỷ là duyên của tham; khổ là duyên của ưu, ưu là duyên của sân.
Sukhādighātena ca sappaccayā rāgadosā hatāti atidūre hontīti.
And by the destruction of pleasure and so on, greed and hatred with their conditions are destroyed, thus they become extremely remote.
Và do diệt trừ lạc v.v., tham và sân cùng với các duyên của chúng bị tiêu diệt, nên chúng ở rất xa.
Adukkhamasukhanti dukkhābhāvena adukkhaṃ.
Neither-pain-nor-pleasure (Adukkhamasukha) means not painful due to the absence of pain.
Không khổ không lạc (adukkhamasukhaṃ): là không khổ (adukkhaṃ) do không có khổ.
Sukhābhāvena asukhaṃ.
And not pleasant due to the absence of pleasure.
Là không lạc (asukhaṃ) do không có lạc.
Etenettha dukkhasukhapaṭipakkhabhūtaṃ tatiyavedanaṃ dīpeti, na dukkhasukhābhāvamattaṃ.
By this, it indicates the third feeling, which is the opposite of pain and pleasure, not merely the absence of pain and pleasure.
Qua đó, ở đây, ngài chỉ ra thọ thứ ba, là đối nghịch của khổ và lạc, chứ không chỉ đơn thuần là sự vắng mặt của khổ và lạc.
Tatiyavedanā nāma adukkhamasukhā, upekkhātipi vuccati.
The third feeling is called neither-pain-nor-pleasure, and also upekkhā (equanimity).
Thọ thứ ba được gọi là không khổ không lạc, cũng được gọi là xả (upekkhā).
Sā iṭṭhāniṭṭhaviparītānubhavanalakkhaṇā.
Its characteristic is the experience of what is neither agreeable nor disagreeable, but neutral.
Thọ ấy có đặc tính là cảm nhận đối tượng khác với đối tượng khả hỷ và bất khả hỷ (tức đối tượng trung tính).
Upekkhāsatipārisuddhinti upekkhāya janitasatipārisuddhiṃ.
Purity of mindfulness due to equanimity (Upekkhāsatipārisuddhi) means the purity of mindfulness generated by equanimity.
Xả niệm thanh tịnh (upekkhāsatipārisuddhiṃ): là sự thanh tịnh của niệm được sinh ra bởi xả.
Imasmiñhi jhāne suparisuddhā sati, yā ca tassā satiyā pārisuddhi, sā upekkhāya katā, na aññena.
For in this jhāna, mindfulness is perfectly pure, and the purity of that mindfulness is brought about by equanimity, not by anything else.
Quả vậy, trong thiền này, niệm rất thanh tịnh, và sự thanh tịnh của niệm ấy được tạo ra bởi xả, chứ không phải bởi pháp nào khác.
Tasmā etaṃ ‘‘upekkhāsatipārisuddhi’’nti vuccati.
Therefore, this is called "purity of mindfulness due to equanimity."
Do đó, nó được gọi là "xả niệm thanh tịnh".
Yāya ca upekkhāya ettha satiyā pārisuddhi hoti, sā atthato tatramajjhattatāti veditabbā.
And the equanimity by which mindfulness becomes pure here is, in essence, tatramajjhattatā (equanimity of mind).
Và nên hiểu rằng, xả mà nhờ đó có sự thanh tịnh của niệm ở đây, về mặt ý nghĩa chính là sự trung lập (tatramajjhattatā).
Na kevalañcettha tāya satiyeva parisuddhā, apica kho sabbepi sampayuttadhammā, satisīsena pana desanā vuttā.
Not only is mindfulness pure here by that equanimity, but all conascent phenomena are also pure, but the teaching is stated with mindfulness as the principal factor.
Và không chỉ có niệm được thanh tịnh bởi xả ở đây, mà tất cả các pháp tương ưng cũng vậy, nhưng bài thuyết giảng được trình bày với niệm làm đầu.
Tattha kiñcāpi ayaṃ upekkhā heṭṭhāpi tīsu jhānesu vijjati, yathā pana divā sūriyappabhābhibhavā sommabhāvena ca attano upakārakattena vā sabhāgāya rattiyā alābhā divā vijjamānāpi candalekhā aparisuddhā hoti apariyodātā, evamayampi tatramajjhattupekkhācandalekhā vitakkādipaccanīkadhammatejābhibhavā sabhāgāya ca upekkhāvedanārattiyā alābhā vijjamānāpi paṭhamajjhānādibhede aparisuddhā hoti.
Among these, although this equanimity exists in the three lower jhāna also, just as the moonlight, though present during the day, is impure and not clear due to being overpowered by the sun's radiance, or due to its mildness, or due to not obtaining the congenial night that is beneficial to it; similarly, this moonlight of tatramajjhattatā-upekkhā, though present in the first jhāna and so on, is impure due to being overpowered by the power of opposing phenomena like vitakka (initial application) and so on, and due to not obtaining the congenial night of the feeling of equanimity.
Trong đó, mặc dù xả này cũng có mặt trong ba tầng thiền dưới, nhưng giống như vầng trăng khuyết vào ban ngày, dù có mặt nhưng không thanh tịnh, không trong sáng do bị ánh sáng mặt trời lấn át và do không có được ban đêm, là điều kiện tương hợp và hỗ trợ cho sự mát dịu của nó, cũng vậy, vầng trăng xả trung lập (tatramajjhatt'upekkhā) này, dù có mặt trong các tầng thiền như thiền thứ nhất v.v., cũng không thanh tịnh do bị sức mạnh của các pháp đối nghịch như tầm (vitakka) v.v. lấn át và do không có được ban đêm là thọ xả tương hợp.
Tassā ca aparisuddhāya divā aparisuddhacandalekhāya pabhā viya sahajātāpi satiādayo aparisuddhāva honti.
And when that equanimity is impure, just as the light of an impure moonbeam during the day, so too are mindfulness and other co-arising factors impure.
Và do sự không thanh tịnh của xả ấy, các pháp đồng sinh như niệm v.v. cũng không thanh tịnh, giống như ánh sáng của vầng trăng không thanh tịnh vào ban ngày.
Tasmā tesu ekampi ‘‘upekkhāsatipārisuddhi’’nti na vuttaṃ.
Therefore, not even one of those jhānas is called "purity of equanimity and mindfulness" (upekkhāsatipārisuddhi).
Do đó, không có tầng thiền nào trong số đó được gọi là "xả niệm thanh tịnh".
Idha pana vitakkādipaccanīkatejābhibhavābhāvā sabhāgāya ca upekkhāvedanārattiyā paṭilābhā ayaṃ tatramajjhattupekkhācandalekhā ativiya parisuddhā.
But here, due to the absence of being overwhelmed by the power of opposing factors like vitakka, and due to the attainment of a kindred night of equanimity-feeling, this equanimity of mental equipoise (tatramajjhattatā-upekkhā) is exceedingly pure.
Nhưng ở đây, do không bị sức mạnh của các pháp đối nghịch như tầm v.v. lấn át và do đã có được ban đêm là thọ xả tương hợp, nên vầng trăng xả trung lập này vô cùng thanh tịnh.
Tassā parisuddhattā parisuddhacandalekhāya pabhā viya sahajātāpi satiādayo parisuddhā honti pariyodātā.
Because it is pure, just like the light of a pure moonbeam, mindfulness and other co-arising factors are also pure and cleansed.
Do sự thanh tịnh của nó, các pháp đồng sinh như niệm v.v. cũng trở nên thanh tịnh, trong sáng, giống như ánh sáng của vầng trăng thanh tịnh.
Tasmā idameva ‘‘upekkhāsatipārisuddhi’’nti vuttanti veditabbaṃ.
Therefore, it should be understood that only this is called "purity of equanimity and mindfulness" (upekkhāsatipārisuddhi).
Do đó, nên hiểu rằng chỉ có tầng thiền này mới được gọi là "xả niệm thanh tịnh".
Catutthanti gaṇanānupubbatā catutthaṃ, catutthaṃ uppannantipi catutthaṃ.
Fourth means fourth in numerical order, and also fourth because it arises as the fourth.
Thứ tư (catutthaṃ): là thứ tư theo thứ tự đếm; cũng là thứ tư vì nó sinh khởi lần thứ tư.
Imāni cattāri jhānāni pubbabhāgepi nānā, maggakkhaṇepi.
These four jhānas are distinct even in the preliminary stage and also at the moment of the path.
Bốn tầng thiền này khác nhau cả trong giai đoạn chuẩn bị và cả trong khoảnh khắc đạo.
Pubbabhāge samāpattivasena nānā, maggakkhaṇe nānāmaggavasena.
In the preliminary stage, they are distinct by way of attainment (samāpatti); at the moment of the path, by way of different paths.
Trong giai đoạn chuẩn bị, chúng khác nhau tùy theo định chứng; trong khoảnh khắc đạo, chúng khác nhau tùy theo các đạo khác nhau.
Ekassa hi paṭhamamaggo paṭhamajjhāniko hoti, dutiyamaggādayopi paṭhamajjhānikā vā dutiyādīsu aññatarajjhānikā vā.
For one person, the first path is associated with the first jhāna; the second and subsequent paths may also be associated with the first jhāna or with any of the second and so forth.
Đối với một người, đạo thứ nhất có thể thuộc thiền thứ nhất, và các đạo thứ hai v.v. cũng có thể thuộc thiền thứ nhất hoặc thuộc một trong các thiền thứ hai v.v.
Ekassa paṭhamamaggo dutiyādīnaṃ aññatarajjhāniko hoti, dutiyādayopi dutiyādīnaṃ aññatarajjhānikā vā paṭhamajjhānikā vā.
For another, the first path is associated with one of the second and subsequent jhānas; the second and subsequent paths may also be associated with one of the second and subsequent jhānas or with the first jhāna.
Đối với một người khác, đạo thứ nhất có thể thuộc một trong các thiền thứ hai v.v., và các đạo thứ hai v.v. cũng có thể thuộc một trong các thiền thứ hai v.v. hoặc thuộc thiền thứ nhất.
Evaṃ cattāropi maggā jhānavasena sadisā vā asadisā vā ekaccasadisā vā honti.
Thus, all four paths may be similar, dissimilar, or partially similar in terms of jhāna.
Như vậy, cả bốn đạo, tùy theo thiền, có thể giống nhau, khác nhau, hoặc một phần giống nhau.
Ayaṃ panassa viseso pādakajjhānaniyamena hoti.
This distinction, however, occurs by the rule of the foundational jhāna.
Nhưng sự khác biệt này được quy định bởi thiền nền tảng (pādakajjhāna).
Paṭhamajjhānalābhino hi paṭhamajjhānā vuṭṭhāya vipassantassa uppannamaggo paṭhamajjhāniko hoti, maggaṅgabojjhaṅgāni panettha paripuṇṇāneva honti.
For one who has attained the first jhāna, the path that arises after emerging from the first jhāna and practicing vipassanā is associated with the first jhāna, and in this case, the path factors and enlightenment factors are complete.
Quả vậy, đối với người đã đắc thiền thứ nhất, sau khi xuất khỏi thiền thứ nhất và thực hành minh sát, đạo sinh khởi sẽ thuộc thiền thứ nhất; ở đây, các đạo chi và giác chi đều đầy đủ.
Dutiyajjhānato vuṭṭhāya vipassantassa uppanno dutiyajjhāniko hoti, maggaṅgāni panettha satta honti.
For one who emerges from the second jhāna and practices vipassanā, the path that arises is associated with the second jhāna, but in this case, there are seven path factors.
Đối với người xuất khỏi thiền thứ hai và thực hành minh sát, đạo sinh khởi sẽ thuộc thiền thứ hai; ở đây có bảy đạo chi.
Tatiyajjhānato vuṭṭhāya vipassantassa uppanno tatiyajjhāniko, maggaṅgāni panettha satta, bojjhaṅgāni cha honti.
For one who emerges from the third jhāna and practices vipassanā, the path that arises is associated with the third jhāna, and in this case, there are seven path factors and six enlightenment factors.
Đối với người xuất khỏi thiền thứ ba và thực hành minh sát, đạo sinh khởi sẽ thuộc thiền thứ ba; ở đây có bảy đạo chi và sáu giác chi.
Esa nayo catutthajjhānato paṭṭhāya yāva nevasaññānāsaññāyatanā.
This method applies from the fourth jhāna up to the sphere of neither perception nor non-perception.
Phương pháp này áp dụng từ thiền thứ tư cho đến Phi tưởng phi phi tưởng xứ.
Āruppe catukkapañcakajjhānaṃ uppajjati, tañca kho lokuttaraṃ, na lokiyanti vuttaṃ.
In the immaterial spheres (āruppa), the fourfold or fivefold jhāna arises, and that is supramundane, not mundane, as stated.
Trong các cõi Vô sắc, thiền tứ và thiền ngũ sinh khởi, và đó là thiền siêu thế, không phải thiền thế gian, như đã nói.
Ettha kathanti?
How is this so here?
Ở đây, như thế nào?
Etthapi paṭhamajjhānādīsu yato vuṭṭhāya sotāpattimaggaṃ paṭilabhitvā arūpasamāpattiṃ bhāvetvā yo āruppe uppanno, taṃjhānikāva tassa tattha tayo maggā uppajjanti.
Here too, after emerging from any of the first jhāna and so forth, having attained the Sotāpatti-magga, and having developed the immaterial attainments, for the person who arises in the immaterial spheres, his three higher paths there arise associated with that same jhāna.
Cũng ở đây, người nào sau khi xuất khỏi một trong các thiền thứ nhất v.v., chứng đắc đạo Tu-đà-hoàn, rồi tu tập định Vô sắc và sinh vào cõi Vô sắc, thì ba đạo (cao hơn) của người ấy sinh khởi ở đó cũng thuộc cùng loại thiền ấy.
Evaṃ pādakajjhānameva niyameti.
Thus, only the foundational jhāna determines it.
Như vậy, chính thiền nền tảng quy định.
Keci pana therā ‘‘vipassanāya ārammaṇabhūtā khandhā niyamentī’’ti vadanti.
However, some elders say, "The aggregates that are the objects of vipassanā determine it."
Tuy nhiên, một số vị trưởng lão nói rằng "các uẩn làm đối tượng của minh sát quy định".
Keci ‘‘puggalajjhāsayo niyametī’’ti vadanti.
Some say, "The individual's disposition determines it."
Một số nói rằng "khuynh hướng của cá nhân quy định".
Keci ‘‘vuṭṭhānagāminī vipassanā niyametī’’ti vadanti.
Some say, "The vipassanā leading to emergence determines it."
Một số nói rằng "minh sát dẫn đến xuất khởi (vuṭṭhānagāminī vipassanā) quy định".
Pañcamajjhānaṃ pādakaṃ katvā nibbattitamagge pana upekkhācittekaggatāvasena dve jhānaṅgāni, bojjhaṅgamaggaṅgāni cha satta ceva.
In the path produced by making the fifth jhāna the foundation, there are two jhāna factors by way of equanimity and one-pointedness of mind, and six enlightenment factors and seven path factors.
Tuy nhiên, trong đạo được tạo ra sau khi lấy thiền thứ năm làm nền tảng, có hai thiền chi là xả và nhất tâm; có sáu giác chi và bảy đạo chi.
Ayampi viseso ubhayaniyamavasena hoti.
This distinction also occurs by way of both determinations.
Sự khác biệt này cũng xảy ra do sự quy định của cả hai yếu tố (thiền nền tảng và minh sát).
Imasmiñhi naye pubbabhāgavipassanā somanassasahagatā vā upekkhāsahagatā vā hoti, vuṭṭhānagāminī upekkhāsahagatāva hoti.
In this method, the preliminary vipassanā may be accompanied by joy or by equanimity, but the vipassanā leading to emergence is always accompanied by equanimity.
Quả vậy, trong trường hợp này, minh sát trong giai đoạn chuẩn bị đi kèm với hỷ hoặc xả, nhưng minh sát dẫn đến xuất khởi chỉ đi kèm với xả.
Arūpajjhānāni pādakāni katvā uppāditamaggepi eseva nayo.
And in the path produced by making the immaterial jhānas the basis, the same method applies.
Trong đạo được tạo ra sau khi lấy các thiền Vô sắc làm nền tảng, phương pháp cũng tương tự.
Idha pana catukkanaye avitakkavicāramattassa dutiyajjhānassa abhāvā taṃ apanetvā sesānaṃ vasena yojetabbaṃ.
Here, however, in the fourfold system, due to the absence of the second jhāna which is merely avicāra (without vitakka but with vicāra), that should be removed, and the remaining ones should be applied.
Tuy nhiên, ở đây, trong hệ thống bốn thiền, do không có thiền thứ hai chỉ có tầm và tứ, nên cần loại bỏ thiền đó và áp dụng cho các thiền còn lại.
Evaṃ pādakajjhānato vuṭṭhāya ye keci saṅkhāre sammasitvā nibbattitamaggassa āsannapadese vuṭṭhitasamāpatti attanā sadisabhāvaṃ karoti bhūmivaṇṇo viya godhāvaṇṇassa.
Thus, having emerged from the foundational jhāna and contemplated whatever saṅkhāras, the attainment from which one emerged, in the vicinity of the path thus generated, becomes similar to itself, just as the color of the earth resembles the color of a monitor lizard.
Như vậy, sau khi xuất khỏi thiền nền tảng, quán xét bất kỳ các pháp hữu vi nào, định mà vị ấy đã xuất khỏi, ở nơi gần kề của đạo đã được phát sinh, làm cho (đạo) có trạng thái giống với chính nó, giống như màu sắc của đất (làm cho) màu sắc của con kỳ đà (trở nên tương tự).
Ayaṃ vuccati sammāsamādhīti yā imesu catūsu jhānesu ekaggatā, ayaṃ pubbabhāge lokiyo, aparabhāge lokuttaro sammāsamādhi nāma vuccati.
This is called Right Concentration — the one-pointedness of mind in these four jhānas is called sammāsamādhi, which is worldly (lokiya) in its preliminary stage and supramundane (lokuttara) in its later stage.
Đây được gọi là Chánh Định: Nhất tâm trong bốn thiền này, đây được gọi là Chánh Định, ở giai đoạn đầu là hiệp thế, ở giai đoạn sau là siêu thế.
Evaṃ lokiyalokuttaravasena dhammasenāpati maggasaccaṃ deseti.
Thus, the Dhamma-General teaches the Noble Truth of the Path in terms of worldly and supramundane.
Như vậy, vị Pháp Tướng quân thuyết giảng Thánh đế về Đạo theo phương diện hiệp thế và siêu thế.
Tattha lokiyamagge sabbāneva maggaṅgāni yathānurūpaṃ chasu ārammaṇesu aññatarārammaṇāni honti.
Among these, in the worldly path, all the path factors have one of the six objects as their object, as appropriate.
Trong đó, ở đạo hiệp thế, tất cả các đạo chi đều có một trong sáu đối tượng làm cảnh tùy theo sự tương ứng.
Lokuttaramagge pana catusaccappaṭivedhāya pavattassa ariyasāvakassa nibbānārammaṇaṃ avijjānusayasamugghātakaṃ paññācakkhu sammādiṭṭhi, tathā sampannadiṭṭhissa taṃsampayutto tividhamicchāsaṅkappasamugghātako cetaso nibbānapadābhiniropano sammāsaṅkappo, tathā passantassa vitakkentassa ca taṃsampayuttāva catubbidhavacīduccaritasamugghātikā micchāvācāya virati sammāvācā, tathā viramantassa taṃsampayuttāva tividhamicchākammantasamucchedikā micchākammantā virati sammākammanto, tesaṃyeva cassa vācākammantānaṃ vodānabhūtā taṃsampayuttāva kuhanādisamucchedikā micchāājīvā virati sammāājīvo, tassāyevassa sammāvācākammantājīvasaṅkhātāya sīlabhūmiyaṃ patiṭṭhamānassa tadanurūpo taṃsampayuttova kosajjasamucchedako, anuppannuppannānaṃ akusalakusalānaṃ anuppādappahānuppādaṭṭhitisādhako ca vīriyārambho sammāvāyāmo, evaṃ vāyamantassa taṃsampayuttova micchāsativiniddhunako, kāyādīsu kāyānupassanādisādhako ca cetaso asammoso sammāsati.
In the supramundane path, however, for the noble disciple practicing for the penetration of the Four Noble Truths, sammādiṭṭhi is the eye of wisdom, having Nibbāna as its object, eradicating the latent tendency of ignorance; for one endowed with such right view, sammāsaṅkappa is the mental projection towards the state of Nibbāna, associated with that, eradicating the three kinds of wrong thoughts; for one thus seeing and thinking, sammāvācā is abstinence from wrong speech, associated with that, eradicating the four kinds of verbal misconduct; for one thus abstaining, sammākammanto is abstinence from wrong action, associated with that, eradicating the three kinds of wrong bodily action; and for them, sammāājīvo is abstinence from wrong livelihood, associated with that, being the purification of their speech and action, eradicating deceit and so forth; for one established in this ground of morality, consisting of right speech, action, and livelihood, sammāvāyāmo is the exertion of effort, associated with that, corresponding to that, eradicating idleness, and accomplishing the non-arising, abandonment, arising, and establishment of unarisen and arisen wholesome and unwholesome states; for one thus striving, sammāsati is the non-forgetfulness of mind, associated with that, dispelling wrong mindfulness, and accomplishing the contemplation of the body, etc., in the body, etc.
Còn trong đạo siêu thế, đối với vị Thánh đệ tử đang thực hành để thấu triệt Tứ Thánh Đế, tuệ nhãn có Niết-bàn làm đối tượng, có khả năng nhổ bật vô minh tùy miên là Chánh Kiến; đối với vị đã thành tựu chánh kiến như vậy, sự hướng tâm về cảnh Niết-bàn tương ưng với nó, có khả năng nhổ bật ba loại tà tư duy là Chánh Tư Duy; đối với vị đang thấy và đang tư duy như vậy, sự từ bỏ tà ngữ tương ưng với nó, có khả năng nhổ bật bốn loại ác hạnh về lời nói là Chánh Ngữ; đối với vị đang từ bỏ như vậy, sự từ bỏ tà nghiệp tương ưng với nó, có khả năng đoạn trừ ba loại tà nghiệp là Chánh Nghiệp; sự từ bỏ tà mạng tương ưng với nó, là sự thanh tịnh của chính các nghiệp về lời nói và thân của vị ấy, có khả năng đoạn trừ sự giả dối v.v. là Chánh Mạng; đối với vị ấy đang an trú trên nền tảng giới hạnh bao gồm chánh ngữ, chánh nghiệp, chánh mạng, sự tinh tấn khởi lên tương ưng với nó, có khả năng đoạn trừ sự lười biếng, và có khả năng thành tựu việc không cho sanh khởi các pháp bất thiện chưa sanh, đoạn trừ các pháp bất thiện đã sanh, làm sanh khởi các pháp thiện chưa sanh và duy trì các pháp thiện đã sanh là Chánh Tinh Tấn; đối với vị đang tinh tấn như vậy, sự không quên của tâm tương ưng với nó, có khả năng rũ bỏ tà niệm, và có khả năng thành tựu quán thân trên thân v.v. là Chánh Niệm.
Evaṃ anuttarāya satiyā suvihitacittārakkhassa taṃsampayuttāva micchāsamādhividdhaṃsikā cittekaggatā sammāsamādhi.
Thus, for one whose mind is well-guarded by unsurpassed mindfulness, sammāsamādhi is the one-pointedness of mind, associated with that, destroying wrong concentration.
Như vậy, đối với vị có tâm được bảo hộ tốt đẹp bởi niệm vô thượng, sự nhất tâm tương ưng với nó, có khả năng phá hủy tà định là Chánh Định.
Esa lokuttaro ariyo aṭṭhaṅgiko maggo.
This is the supramundane, noble, eightfold path.
Đây là Bát Chánh Đạo, siêu thế, cao thượng.
Yo saha lokiyena maggena dukkhanirodhagāminipaṭipadāti saṅkhyaṃ gato, so kho panesa maggo sammādiṭṭhisaṅkappānaṃ vijjāya sesadhammānaṃ caraṇena saṅgahitattā vijjā ceva caraṇañca.
This path, which together with the worldly path is designated as the practice leading to the cessation of suffering, is indeed both knowledge (vijjā) and conduct (caraṇa), being comprised of knowledge through sammādiṭṭhi and sammāsaṅkappa, and of conduct through the remaining factors.
Con đường nào cùng với đạo hiệp thế được gọi là con đường đưa đến sự diệt khổ, con đường ấy chính là minh và hạnh, vì chánh kiến và chánh tư duy được bao hàm bởi minh, các pháp còn lại được bao hàm bởi hạnh.
Tathā tesaṃ dvinnaṃ vipassanāyānena itaresaṃ samathayānena saṅgahitattā samatho ceva vipassanā ca.
Likewise, it is both serenity (samatha) and insight (vipassanā), being comprised of insight through the vehicle of vipassanā for those two (right view and right thought), and of serenity through the vehicle of samatha for the others.
Tương tự, vì hai pháp ấy được bao hàm bởi cỗ xe minh sát, các pháp khác được bao hàm bởi cỗ xe chỉ tịnh, nên đó chính là chỉ và quán.
Tesaṃ dvinnaṃ paññākkhandhena tadanantarānaṃ tiṇṇaṃ sīlakkhandhena avasesānaṃ tiṇṇaṃ samādhikkhandhena adhipaññāadhisīlaadhicittasikkhāhi ca saṅgahitattā khandhattayañceva sikkhattayañca hoti.
It is also the three aggregates (khandhattaya) and the three trainings (sikkhāttaya), being comprised of the aggregate of wisdom (paññākkhandha) for those two, the aggregate of morality (sīlakkhandha) for the next three, and the aggregate of concentration (samādhikkhandha) for the remaining three, and by the trainings of higher wisdom (adhipaññā), higher morality (adhisīla), and higher mind (adhicitta).
Vì hai pháp ấy được bao hàm bởi tuệ uẩn, ba pháp kế tiếp được bao hàm bởi giới uẩn, ba pháp còn lại được bao hàm bởi định uẩn, và vì được bao hàm bởi tăng thượng tuệ học, tăng thượng giới học và tăng thượng tâm học, nên đó chính là ba uẩn và ba học.
Yena samannāgato ariyasāvako dassanasamatthehi cakkhūhi gamanasamatthehi ca pādehi samannāgato addhiko viya vijjācaraṇasampanno hutvā vipassanāyānena kāmasukhallikānuyogaṃ samathayānena attakilamathānuyoganti antadvayaṃ parivajjetvā majjhimapaṭipadaṃ paṭipanno paññākkhandhena mohakkhandhaṃ, sīlakkhandhena dosakkhandhaṃ, samādhikkhandhena ca lobhakkhandhaṃ padālento adhipaññāsikkhāya paññāsampadaṃ, adhisīlasikkhāya sīlasampadaṃ, adhicittasikkhāya samādhisampadanti tisso sampattiyo patvā amataṃ nibbānaṃ sacchikaroti.
The noble disciple, endowed with the eightfold path, which is called the path leading to the cessation of suffering together with the mundane path, having become accomplished in knowledge and conduct, like a traveler endowed with eyes capable of seeing and feet capable of walking, avoids the two extremes—the indulgence in sensual pleasures by the vehicle of vipassanā, and self-mortification by the vehicle of samatha—and practices the Middle Path. He shatters the aggregate of delusion with the aggregate of wisdom, the aggregate of hatred with the aggregate of virtue, and the aggregate of greed with the aggregate of concentration. Having attained the three accomplishments—the accomplishment of wisdom through the training in higher wisdom, the accomplishment of virtue through the training in higher virtue, and the accomplishment of concentration through the training in higher mind—he realizes the deathless Nibbāna.
Khi vị Thánh đệ tử được trang bị con đường này, giống như người đi đường được trang bị đôi mắt có khả năng thấy và đôi chân có khả năng đi, trở nên thành tựu minh và hạnh, bằng cỗ xe minh sát tránh xa cực đoan hưởng thụ dục lạc, bằng cỗ xe chỉ tịnh tránh xa cực đoan khổ hạnh ép xác, thực hành con đường trung đạo, dùng tuệ uẩn để phá tan si uẩn, dùng giới uẩn để phá tan sân uẩn, và dùng định uẩn để phá tan tham uẩn, bằng tăng thượng tuệ học đạt đến tuệ thành tựu, bằng tăng thượng giới học đạt đến giới thành tựu, bằng tăng thượng tâm học đạt đến định thành tựu, vị ấy chứng ngộ Niết-bàn bất tử sau khi đã đạt được ba sự thành tựu.
Ādimajjhapariyosānakalyāṇaṃ sattatiṃsabodhipakkhiyadhammaratanavicittaṃ sammattaniyāmasaṅkhātaṃ ariyabhūmiṃ okkanto hotīti.
He has entered the noble stage, which is beautiful in the beginning, middle, and end, adorned with the thirty-seven factors of enlightenment, the jewels of Dhamma, and designated as the fixed course of rightness.
Vị ấy được xem là đã bước vào thánh địa, được gọi là chánh tánh quyết định, tốt đẹp ở đoạn đầu, đoạn giữa và đoạn cuối, được trang hoàng bởi những bảo châu pháp là ba mươi bảy phẩm trợ Bồ-đề.
Apica pavattimācikkhanto bhagavā sahetukaṃ ācikkhi, nivattiñca saupāyaṃ.
Furthermore, when the Blessed One taught occurrence, he taught it with its cause, and when he taught non-occurrence, he taught it with its means.
Hơn nữa, khi Đức Thế Tôn giảng về sự diễn tiến (của khổ), Ngài đã giảng cùng với nguyên nhân của nó; và (khi giảng về) sự chấm dứt, (Ngài đã giảng) cùng với phương tiện (để đạt được).
Iti pavattinivattitadubhayahetūnaṃ etapparamato cattāreva vuttāni.
Thus, only four are taught, because they correspond to occurrence, non-occurrence, and their respective causes.
Do đó, vì giới hạn chỉ nằm trong sự diễn tiến, sự chấm dứt, và nguyên nhân của cả hai, nên chỉ có bốn Thánh đế được nói đến.
Tathā pariññeyyapahātabbasacchikātabbabhāvetabbānaṃ, taṇhāvatthutaṇhātaṇhānirodhataṇhānirodhūpāyānaṃ, ālayaālayarāmatāālayasamugghātaālayasamugghātūpāyānañca vasenāpi cattāreva vuttānīti.
Similarly, only four are taught by way of what is to be fully understood, what is to be abandoned, what is to be realized, and what is to be developed; by way of the basis of craving, craving, the cessation of craving, and the means to the cessation of craving; and by way of attachment, delight in attachment, the uprooting of attachment, and the means to the uprooting of attachment.
Tương tự, cũng nên hiểu rằng chỉ có bốn Thánh đế được nói đến theo phương diện của các pháp cần được liễu tri, cần được đoạn tận, cần được chứng ngộ, cần được tu tập; theo phương diện của nền tảng của ái, ái, sự diệt ái, và phương tiện diệt ái; và theo phương diện của nơi nương tựa, sự vui thích trong nơi nương tựa, sự nhổ bật nơi nương tựa, và phương tiện nhổ bật nơi nương tựa.
Ettha ca oḷārikattā sabbasattasādhāraṇattā ca suviññeyyanti dukkhasaccaṃ paṭhamaṃ vuttaṃ.
Among these, the Truth of Suffering is taught first because it is gross and common to all beings, and thus easily understood.
Trong đó, Thánh đế về Khổ được nói đến đầu tiên vì nó thô thiển, phổ biến cho tất cả chúng sanh, và do đó dễ nhận biết.
Tasseva hetudassanatthaṃ tadanantaraṃ samudayasaccaṃ, hetunirodhā phalanirodhoti ñāpanatthaṃ tato nirodhasaccaṃ, tadadhigamūpāyadassanatthaṃ ante maggasaccaṃ.
Immediately after that, the Truth of the Origin is taught to show its cause; then the Truth of Cessation is taught to make known that the cessation of the cause leads to the cessation of the result; and finally, the Truth of the Path is taught to show the means to its attainment.
Để chỉ ra nguyên nhân của nó, Thánh đế về Tập được nói đến ngay sau đó; để cho biết rằng do nhân diệt nên quả diệt, Thánh đế về Diệt được nói đến sau đó; và để chỉ ra phương tiện chứng ngộ nó, Thánh đế về Đạo được nói đến cuối cùng.
Bhavasukhassādagadhitānaṃ vā sattānaṃ saṃvegajananatthaṃ paṭhamaṃ dukkhamāha.
Alternatively, the Truth of Suffering is taught first to arouse a sense of urgency in beings who are infatuated with the taste of worldly happiness.
Hoặc, để làm phát sinh sự nhàm chán cho các chúng sanh đang tham đắm vị ngọt của lạc thú trong các cõi hữu, Ngài đã nói về khổ trước tiên.
Taṃ neva akataṃ āgacchati, na issaranimmānādito hoti, ito pana hotīti ñāpanatthaṃ tadanantaraṃ samudayaṃ.
Immediately after that, the Truth of the Origin is taught to make known that suffering does not arise uncaused, nor from a creator god, but rather from craving.
Để cho biết rằng khổ ấy không phải tự nhiên đến, không phải do Phạm thiên tạo ra v.v., mà là do nguyên nhân này, Ngài đã nói về Tập ngay sau đó.
Tato sahetukena dukkhena abhibhūtattā saṃviggamānasānaṃ dukkhanissaraṇagavesīnaṃ nissaraṇadassanena assāsajananatthaṃ nirodhaṃ.
Then, the Truth of Cessation is taught to inspire confidence in those whose minds are agitated by suffering with its cause and who seek an escape from suffering, by showing them the escape.
Sau đó, đối với những chúng sanh đang kinh sợ, đang tìm kiếm sự thoát khỏi khổ, vì đã bị cái khổ có nhân sanh áp đảo, Ngài thuyết về sự diệt để làm phát sanh sự an ổn bằng cách chỉ ra con đường thoát ly.
Tato nirodhādhigamanatthaṃ nirodhasampāpakaṃ magganti ayametesaṃ kamo.
Then, the Path, which leads to the attainment of cessation, is taught for the sake of attaining cessation. This is their order.
Sau đó, để đạt đến sự diệt, Ngài thuyết về con đường dẫn đến sự diệt. Đây là thứ tự của các chân lý này.
Etesu pana bhāro viya dukkhasaccaṃ daṭṭhabbaṃ, bhārādānamiva samudayasaccaṃ, bhāranikkhepanamiva nirodhasaccaṃ, bhāranikkhepanūpāyo viya maggasaccaṃ.
Among these, the Truth of Suffering should be seen as a burden, the Truth of the Origin as the taking up of a burden, the Truth of Cessation as the laying down of a burden, and the Truth of the Path as the means to lay down a burden.
Trong các chân lý này, khổ đế nên được xem như gánh nặng, tập đế như việc mang lấy gánh nặng, diệt đế như việc đặt gánh nặng xuống, và đạo đế như phương pháp đặt gánh nặng xuống.
Rogo viya vā dukkhasaccaṃ, roganidānamiva samudayasaccaṃ, rogavūpasamo viya nirodhasaccaṃ, bhesajjamiva maggasaccaṃ.
Or, the Truth of Suffering is like a disease, the Truth of the Origin is like the cause of a disease, the Truth of Cessation is like the recovery from a disease, and the Truth of the Path is like medicine.
Hoặc, khổ đế nên được xem như bệnh tật, tập đế như nguyên nhân của bệnh tật, diệt đế như sự chấm dứt bệnh tật, và đạo đế như thuốc chữa bệnh.
Dubbhikkhamiva vā dukkhasaccaṃ, dubbuṭṭhi viya samudayasaccaṃ, subhikkhamiva nirodhasaccaṃ, suvuṭṭhi viya maggasaccaṃ.
Or, the noble truth of suffering is like a famine; the noble truth of the origin of suffering is like a drought; the noble truth of the cessation of suffering is like abundance; the noble truth of the path is like good rainfall.
Hoặc, khổ đế như nạn đói, tập đế như hạn hán, diệt đế như sự sung túc, và đạo đế như mưa thuận gió hòa.
Apica verīveramūlaverasamugghātaverasamugghātūpāyehi, visarukkharukkhamūlamūlūpacchedatadupacchedūpāyehi, bhayabhayamūlanibbhayatadadhigamūpāyehi, orimatīramahoghapārimatīrataṃsampāpakavāyāmehi ca yojetvāpetāni upamāto veditabbānīti.
Furthermore, these* should be understood by way of simile, connecting them with (1) an enemy, the root of enmity, the eradication of enmity, and the means of eradicating enmity; (2) a poisonous tree, the root of the poisonous tree, the cutting off of the root, and the means of cutting it off; (3) fear, the root of fear, fearlessness, and the attainment of fearlessness; and (4) the near shore, the great flood, the far shore, and the effort to reach that far shore.
Hơn nữa, các chân lý này cũng nên được hiểu qua các ví dụ bằng cách liên kết chúng với: kẻ thù, nguồn gốc của kẻ thù, sự diệt trừ kẻ thù, và phương pháp diệt trừ kẻ thù; cây độc, gốc rễ của cây độc, sự chặt đứt gốc rễ, và phương pháp chặt đứt gốc rễ; sự sợ hãi, nguồn gốc của sự sợ hãi, sự không sợ hãi, và phương pháp đạt đến sự không sợ hãi; bờ bên này, dòng lũ lớn, bờ bên kia, và sự nỗ lực để đến được bờ bên kia.
‘‘Taṃ kiṃ maññasi, ānanda, katamaṃ nu kho dukkarataraṃ vā durabhisambhavataraṃ vā, yo dūratova sukhumena tāḷacchiggaḷena asanaṃ atipāteyya poṅkhānupoṅkhaṃ avirādhitaṃ, yo vā sattadhā bhinnassa vālassa koṭiyā koṭiṃ paṭivijjheyyāti?
“What do you think, Ānanda, which is more difficult or harder to achieve: one who from afar shoots an arrow through a fine keyhole, shaft after shaft, without missing, or one who pierces the tip of a hair split seven times with the tip of another hair?” “This, Venerable Sir, is indeed more difficult and harder to achieve: one who pierces the tip of a hair split seven times with the tip of another hair.” “Yet, Ānanda, those who penetrate thus penetrate something even more difficult to penetrate, namely, those who truly penetrate ‘This is suffering’…pe… ‘This is the path leading to the cessation of suffering’.”
“Này Ānanda, ông nghĩ thế nào, điều nào là khó làm hơn, khó thực hiện hơn: người có thể bắn một mũi tên từ xa xuyên qua một lỗ nhỏ trên lá thốt nốt, mũi này nối tiếp mũi kia không sai trật, hay người có thể dùng đầu của một sợi lông đã được chẻ bảy lần để bắn trúng đầu của một sợi lông khác?”
Etadeva, bhante, dukkaratarañceva durabhisambhavatarañca; Yo vā sattadhā bhinnassa vālassa koṭiyā koṭiṃ paṭivijjheyyāti; Atha kho te, ānanda, duppaṭivijjhataraṃ paṭivijjhanti, ye ‘idaṃ dukkha’nti yathābhūtaṃ paṭivijjhanti…pe… ‘ayaṃ dukkhanirodhagāminī paṭipadā’ti yathābhūtaṃ paṭivijjhantī’’ti (saṃ. ni. 5.1115);
“What do you think, Ānanda, which is more difficult or harder to achieve: one who from afar shoots an arrow through a fine keyhole, shaft after shaft, without missing, or one who pierces the tip of a hair split seven times with the tip of another hair?” “This, Venerable Sir, is indeed more difficult and harder to achieve: one who pierces the tip of a hair split seven times with the tip of another hair.” “Yet, Ānanda, those who penetrate thus penetrate something even more difficult to penetrate, namely, those who truly penetrate ‘This is suffering’…pe… ‘This is the path leading to the cessation of suffering’.”
“Bạch Thế Tôn, điều này khó làm hơn và khó thực hiện hơn: người có thể dùng đầu của một sợi lông đã được chẻ bảy lần để bắn trúng đầu của một sợi lông khác. Này Ānanda, thế nhưng, những người liễu tri đúng như thật rằng ‘Đây là khổ’... cho đến... ‘Đây là con đường đưa đến sự diệt khổ’ thì họ còn liễu tri được một điều khó hơn thế nữa.”
Visabhāgāni salakkhaṇavavatthānato.
They are dissimilar by the distinction of their individual characteristics.
Chúng khác biệt nhau về phương diện phân định tự tướng.
Purimāni ca dve sabhāgāni duravagāhatthena gambhīrattā lokiyattā sāsavattā ca, visabhāgāni phalahetubhedato pariññeyyapahātabbato ca.
And the first two are similar due to their profundity in being difficult to fathom, being mundane, and being associated with defilements (sāsava); they are dissimilar due to the distinction of effect and cause, and by being subject to full understanding and abandonment.
Hai chân lý đầu tiên tương đồng với nhau vì sâu xa khó thấu hiểu, thuộc về thế gian, và có lậu hoặc; chúng khác biệt nhau về phương diện phân chia quả và nhân, và về phương diện cần được liễu tri và cần được đoạn trừ.
Pacchimānipi dve sabhāgāni gambhīrattena duravagāhattā lokuttarattā anāsavattā ca, visabhāgāni visayavisayībhedato sacchikātabbabhāvetabbato ca.
The latter two are also similar due to their profundity in being difficult to fathom, being supramundane, and being unassociated with defilements (anāsava); they are dissimilar due to the distinction of object and subject, and by being subject to realization and development.
Hai chân lý sau cùng cũng tương đồng với nhau vì sâu xa khó thấu hiểu, thuộc về siêu thế, và vô lậu; chúng khác biệt nhau về phương diện phân chia đối tượng và chủ thể, và về phương diện cần được chứng ngộ và cần được tu tập.
Paṭhamatatiyāni cāpi sabhāgāni phalāpadesato, visabhāgāni saṅkhatāsaṅkhatato.
The first and third are also similar by being designated as effects; they are dissimilar by being conditioned and unconditioned.
Chân lý thứ nhất và thứ ba cũng tương đồng với nhau về phương diện được gọi là quả; chúng khác biệt nhau về phương diện hữu vi và vô vi.
Dutiyacatutthāni cāpi sabhāgāni hetuapadesato, visabhāgāni ekantakusalākusalato.
The second and fourth are also similar by being designated as causes; they are dissimilar by being exclusively unwholesome and wholesome.
Chân lý thứ hai và thứ tư cũng tương đồng với nhau về phương diện được gọi là nhân; chúng khác biệt nhau về phương diện hoàn toàn thiện và bất thiện.
Paṭhamacatutthāni cāpi sabhāgāni saṅkhatato, visabhāgāni lokiyalokuttarato.
The first and fourth are also similar by being conditioned; they are dissimilar by being mundane and supramundane.
Chân lý thứ nhất và thứ tư cũng tương đồng với nhau về phương diện hữu vi; chúng khác biệt nhau về phương diện thế gian và siêu thế.
Dutiyatatiyāni cāpi sabhāgāni nevasekkhanāsekkhabhāvato, visabhāgāni sārammaṇānārammaṇato.
The second and third are also similar by being neither trainees nor perfected ones; they are dissimilar by being with an object and without an object.
Chân lý thứ hai và thứ ba cũng tương đồng với nhau về phương diện là pháp của bậc phi hữu học và phi vô học; chúng khác biệt nhau về phương diện có đối tượng và không có đối tượng.
Sabbameva cettha dukkhaṃ ekavidhaṃ pavattibhāvato, duvidhaṃ nāmarūpato, tividhaṃ kāmarūpārūpūpapattibhavabhedato, catubbidhaṃ catuāhārabhedato, pañcavidhaṃ pañcupādānakkhandhabhedato.
Herein, all suffering is of one kind by way of existence; of two kinds by way of name-and-form; of three kinds by way of the divisions of existence in the sensual realm, form realm, and formless realm; of four kinds by way of the four nutriments; of five kinds by way of the five aggregates of clinging.
Ở đây, tất cả khổ là một loại theo phương diện là sự hiện hữu; hai loại theo phương diện danh và sắc; ba loại theo sự phân chia về sanh hữu trong cõi Dục, cõi Sắc và cõi Vô Sắc; bốn loại theo sự phân chia về bốn loại vật thực; năm loại theo sự phân chia về năm thủ uẩn.
Samudayopi ekavidho pavattakabhāvato, duvidho diṭṭhisampayuttāsampayuttato, tividho kāmabhavavibhavataṇhābhedato, catubbidho catumaggappaheyyato, pañcavidho rūpābhinandanādibhedato, chabbidho chataṇhākāyabhedato.
The origin is also of one kind by way of being the cause of arising; of two kinds by way of being associated with wrong view or not associated with wrong view; of three kinds by way of the divisions of craving for sensual pleasures, craving for existence, and craving for non-existence; of four kinds by being abandoned by the four paths; of five kinds by way of the divisions such as delighting in form; of six kinds by way of the six bodies of craving.
Tập đế cũng là một loại theo phương diện là tác nhân tạo ra sự hiện hữu; hai loại theo phương diện tương ưng và bất tương ưng với tà kiến; ba loại theo sự phân chia về ái dục, ái hữu và ái phi hữu; bốn loại theo phương diện bị bốn đạo đoạn trừ; năm loại theo sự phân chia về sự hoan hỷ trong sắc v.v...; sáu loại theo sự phân chia về sáu thân ái.
Nirodhopi ekavidho asaṅkhatadhātubhāvato, pariyāyato pana duvidho saupādisesaanupādisesato, tividho bhavattayavūpasamato, catubbidho catumaggādhigamanīyato, pañcavidho pañcābhinandanavūpasamato, chabbidho chataṇhākāyakkhayabhedato.
Cessation (Nirodha) is also onefold, due to its nature as the unconditioned element (asaṅkhatadhātu). Figuratively, however, it is twofold, as Nibbāna with residue (saupādisesa) and Nibbāna without residue (anupādisesa); threefold, due to the appeasement of the three existences; fourfold, due to being attainable by the four paths; fivefold, due to the appeasement of delight in the five sense objects; and sixfold, due to the destruction of the six craving-bodies.
Diệt đế cũng là một loại theo phương diện là giới vô vi; nhưng theo nghĩa diễn giải, nó có hai loại là hữu dư y và vô dư y; ba loại theo phương diện là sự dập tắt ba cõi; bốn loại theo phương diện được bốn đạo chứng đắc; năm loại theo phương diện là sự dập tắt năm sự hoan hỷ; sáu loại theo sự phân chia về sự đoạn tận sáu thân ái.
Maggopi ekavidho bhāvetabbato, duvidho samathavipassanābhedato, dassanabhāvanābhedato vā, tividho khandhattayabhedato.
The path (Magga) is also onefold, due to being developed; twofold, due to the distinction of tranquility (samatha) and insight (vipassanā), or due to the distinction of insight (dassana) and development (bhāvanā); threefold, due to the distinction of the three aggregates.
Đạo đế cũng là một loại theo phương diện cần được tu tập; hai loại theo sự phân chia về chỉ và quán, hoặc theo sự phân chia về kiến đạo và tu đạo; ba loại theo sự phân chia về ba uẩn.
Ayañhi sappadesattā nagaraṃ viya rajjena nippadesehi tīhi khandhehi saṅgahito.
This, indeed, due to its having parts, is encompassed by the three aggregates, which are without parts, like a city by a kingdom.
Thật vậy, vì có các thành phần, nên đạo đế này được bao gồm bởi ba uẩn không có thành phần, cũng như một thành phố được bao gồm bởi một vương quốc.
Yathāha –
As it is said:
Như có lời dạy:
‘‘Na kho, āvuso visākha, ariyena aṭṭhaṅgikena maggena tayo khandhā saṅgahitā, tīhi ca kho, āvuso visākha, khandhehi ariyo aṭṭhaṅgiko maggo saṅgahito.
“Indeed, friend Visākha, the three aggregates are not encompassed by the Noble Eightfold Path; rather, friend Visākha, the Noble Eightfold Path is encompassed by the three aggregates.
“Này hiền hữu Visākha, ba uẩn không được bao gồm bởi Bát Thánh Đạo, mà Bát Thánh Đạo, này hiền hữu Visākha, được bao gồm bởi ba uẩn.
Yā, cāvuso visākha, sammāvācā yo ca sammākammanto yo ca sammāājīvo, ime dhammā sīlakkhandhe saṅgahitā.
Whatever is right speech, right action, and right livelihood, friend Visākha—these qualities are encompassed in the aggregate of morality (sīlakkhandha).
Này hiền hữu Visākha, chánh ngữ, chánh nghiệp và chánh mạng, những pháp này được bao gồm trong giới uẩn.
Yo ca sammāvāyāmo yā ca sammāsati yo ca sammāsamādhi, ime dhammā samādhikkhandhe saṅgahitā.
Whatever is right effort, right mindfulness, and right concentration—these qualities are encompassed in the aggregate of concentration (samādhikkhandha).
Chánh tinh tấn, chánh niệm và chánh định, những pháp này được bao gồm trong định uẩn.
Yā ca sammādiṭṭhi yo ca sammāsaṅkappo, ime dhammā paññākkhandhe saṅgahitā’’ti (ma. ni. 1.462).
Whatever is right view and right intention—these qualities are encompassed in the aggregate of wisdom (paññākkhandha).”
Chánh kiến và chánh tư duy, những pháp này được bao gồm trong tuệ uẩn.”