Tathā hissa ‘‘ekampi jātiṃ dvepi jātiyo’’tiādīsu (pārā. 12) bhavo attho.
Thus, in phrases like “one birth, two births,” its meaning is existence.
Cũng vậy, trong các câu như "ekampi jātiṃ dvepi jātiyo" (một đời, hai đời), ý nghĩa là hữu (bhava).
‘‘Akkhitto anupakkuṭṭho jātivādenā’’ti (dī. ni. 1.331) ettha kulaṃ.
In “not reviled, not reproached by birth,” it means family.
Trong câu "Akkhitto anupakkuṭṭho jātivādenā" (không bị chỉ trích, không bị quở trách về dòng dõi), ý nghĩa là gia tộc (kula).
‘‘Atthi, visākhe, nigaṇṭhā nāma samaṇajātī’’ti (a. ni. 3.71) ettha nikāyo.
In “Visakha, there is a group of ascetics called Nigaṇṭhas,” it means group.
Trong câu "Atthi, Visākhe, nigaṇṭhā nāma samaṇajātī" (Này Visākha, có một nhóm sa-môn tên là Ni-kiền-tử), ý nghĩa là nhóm (nikāyo).
‘‘Yatohaṃ, bhagini, ariyāya jātiyā jāto nābhijānāmī’’ti (ma. ni. 2.351) ettha ariyasīlaṃ.
In “Since I, sister, was born of the Noble Birth, I do not recall,” it means Noble Virtue.
Trong câu "Yatohaṃ, bhagini, ariyāya jātiyā jāto nābhijānāmī" (Này chị, từ khi tôi sinh ra với sự sinh của bậc Thánh, tôi không nhớ mình đã từng cố ý sát hại sinh vật), ý nghĩa là giới hạnh của bậc Thánh (ariyasīlaṃ).
‘‘Tiriyā nāma tiṇajāti nābhiyā uggantvā nabhaṃ āhacca ṭhitā ahosī’’ti (a. ni. 5.196) ettha paññatti.
In “A grass-species called Tiriyā grew up from my navel and stood touching the sky,” it means designation.
Trong câu "Tiriyā nāma tiṇajāti nābhiyā uggantvā nabhaṃ āhacca ṭhitā ahosī" (Một loại cỏ tên là Tiriyā mọc từ rốn, vươn lên chạm đến trời), ý nghĩa là sự chế định (paññatti).
‘‘Jāti dvīhi khandhehi saṅgahitā’’ti (dhātu. 71) ettha saṅkhatalakkhaṇaṃ.
In “Birth is comprised of two aggregates,” it means the characteristic of conditioned phenomena.
Trong câu "Jāti dvīhi khandhehi saṅgahitā" (Sự sinh được bao gồm trong hai uẩn), ý nghĩa là đặc tính hữu vi (saṅkhatalakkhaṇaṃ).
‘‘Sampatijāto, ānanda, bodhisatto’’ti (ma. ni. 3.207) ettha pasūti.
In “Ānanda, the Bodhisatta is newly born,” it means procreation.
Trong câu "Sampatijāto, Ānanda, bodhisatto" (Này Ānanda, Bồ-tát vừa mới sinh ra), ý nghĩa là sự sinh nở (pasūti).
‘‘Bhavapaccayā jātī’’ti (vibha. 354) ca ‘‘jātipi dukkhā’’ti (paṭi. ma. 1.33; vibha. 190) ca ettha pariyāyato paṭisandhikhandhā.
And in “Conditioned by existence is birth” and “birth is also suffering,” by way of implication, it refers to the rebirth-linking aggregates.
Trong câu "Bhavapaccayā jātī" (Hữu duyên sinh) và "jātipi dukkhā" (sinh cũng là khổ), ý nghĩa gián tiếp là các uẩn tái sinh (paṭisandhikhandhā).
Nippariyāyato pana tattha tattha nibbattamānānaṃ sattānaṃ ye ye khandhā pātubhavanti, tesaṃ tesaṃ paṭhamaṃ pātubhāvo.
However, in its literal sense, it is the first manifestation of those aggregates that arise for beings born in various existences.
Tuy nhiên, theo nghĩa trực tiếp, đó là sự xuất hiện đầu tiên của các uẩn của chúng sinh đang tái sinh ở bất cứ nơi nào.
Kasmā panesā jāti dukkhāti ce?
If it is asked, why is this birth suffering?
Nếu hỏi: "Vì sao sự sinh này là khổ?"
Anekesaṃ dukkhānaṃ vatthubhāvato.
Because it is the basis for many sufferings.
Vì nó là nền tảng của vô số khổ.
Anekāni hi dukkhāni.
For there are many sufferings.
Quả thật, có vô số khổ.
Seyyathidaṃ – dukkhadukkhaṃ, vipariṇāmadukkhaṃ, saṅkhāradukkhaṃ, paṭicchannadukkhaṃ, appaṭicchannadukkhaṃ, pariyāyadukkhaṃ, nippariyāyadukkhanti.
Namely: suffering as pain, suffering due to change, suffering as conditioned phenomena, hidden suffering, unhidden suffering, suffering by implication, and suffering in the literal sense.
Chẳng hạn như: Khổ khổ (dukkha-dukkha), khổ biến hoại (vipariṇāma-dukkha), khổ hành (saṅkhāra-dukkha), khổ ẩn kín (paṭicchanna-dukkha), khổ không ẩn kín (appaṭicchanna-dukkha), khổ gián tiếp (pariyāya-dukkha), khổ trực tiếp (nippariyāya-dukkha).
Ettha kāyikacetasikā dukkhā vedanāsabhāvato ca nāmato ca dukkhattā dukkhadukkhanti vuccati.
Here, painful feelings, both bodily and mental, are called suffering as pain because they are suffering by nature and by name.
Trong các khổ này, thọ khổ về thân và tâm được gọi là khổ khổ (dukkhadukkha) vì bản chất và danh xưng của nó là khổ.
Sukhā vedanā vipariṇāmena dukkhuppattihetuto vipariṇāmadukkhaṃ.
Pleasant feeling is suffering due to change because it is the cause for the arising of suffering through its alteration.
Thọ lạc là hoại khổ (vipariṇāmadukkhaṃ) vì là nguyên nhân phát sinh khổ do sự biến đổi của nó.
Upekkhāvedanā ceva avasesā ca tebhūmakasaṅkhārā udayabbayapaṭipīḷitattā saṅkhāradukkhaṃ.
Equanimity feeling and the remaining conditioned phenomena of the three planes of existence are suffering as conditioned phenomena because they are repeatedly oppressed by arising and passing away.
Thọ xả và các hành (saṅkhārā) còn lại trong ba cõi là hành khổ (saṅkhāradukkhaṃ) vì bị sự sinh diệt liên tục bức bách.
Kaṇṇasūladantasūlarāgajapariḷāhadosajapariḷāhādi kāyikacetasiko ābādho pucchitvā jānitabbato upakkamassa ca apākaṭabhāvato paṭicchannadukkhaṃ.
The bodily and mental ailment such as earache, toothache, burning caused by lust, burning caused by hatred, etc., is hidden suffering because it must be known by asking and because its cause is not manifest.
Các bệnh đau về thân và tâm như đau tai, đau răng, sự bức bách do tham ái, sự bức bách do sân hận, v.v., được gọi là khổ kín (paṭicchannadukkhaṃ) vì phải hỏi mới biết và vì sự khởi phát của chúng không rõ ràng.
Dvattiṃsakammakāraṇādisamuṭṭhāno ābādho apucchitvāva jānitabbato upakkamassa ca pākaṭabhāvato appaṭicchannadukkhaṃ.
An ailment arising from the thirty-two kinds of karma-actions, etc., is unhidden suffering because it can be known without asking and because its cause is manifest.
Bệnh phát sinh do 32 loại hình phạt, v.v., được gọi là khổ không kín (appaṭicchannadukkhaṃ) vì có thể biết mà không cần hỏi và vì sự khởi phát của chúng rõ ràng.
Ṭhapetvā dukkhadukkhaṃ sesaṃ dukkhasaccavibhaṅge (vibha. 190 ādayo) āgataṃ jātiādi sabbampi tassa tassa dukkhassa vatthubhāvato pariyāyadukkhaṃ.
Setting aside dukkha-dukkha, all the remaining sufferings, such as birth, etc., mentioned in the analysis of the Noble Truth of Suffering, are indirect suffering because they are the basis for those respective sufferings.
Trừ khổ khổ ra, tất cả những gì được đề cập trong phần phân tích Khổ Đế (Vibh. 190, v.v.) như sinh, v.v., đều là khổ gián tiếp (pariyāyadukkhaṃ) vì chúng là đối tượng của khổ đó.
Dukkhadukkhaṃ pana nippariyāyadukkhanti vuccati.
Dukkha-dukkha, however, is called direct suffering.
Còn khổ khổ thì được gọi là khổ trực tiếp (nippariyāyadukkhaṃ).
Tatrāyaṃ jāti yaṃ taṃ bālapaṇḍitasuttādīsu (ma. ni. 3.246 ādayo) bhagavatāpi upamāvasena pakāsitaṃ āpāyikaṃ dukkhaṃ, yañca sugatiyampi manussaloke gabbhokkantimūlakādibhedaṃ dukkhaṃ uppajjati, tassa vatthubhāvato dukkhā.
Among these, this birth is suffering because it is the basis for the suffering in the woeful states, which was expounded by the Blessed One metaphorically in the Bālapaṇḍita Sutta and other suttas, and also for the suffering that arises even in happy existences in the human world, such as that rooted in conception in the womb and other types.
Trong đó, sự sinh này là khổ vì nó là đối tượng của khổ trong các cõi đọa xứ, mà Đức Thế Tôn đã thuyết giảng bằng ví dụ trong các kinh như kinh Kẻ Ngu Người Trí (M.N. 3.246, v.v.), và cũng là đối tượng của khổ phát sinh trong các cõi thiện như khổ do sự nhập thai trong cõi người, v.v.
Tatridaṃ gabbhokkantimūlakādibhedaṃ dukkhaṃ – ayañhi satto mātukucchimhi nibbattamāno na uppalapadumapuṇḍarīkādīsu nibbattati, atha kho heṭṭhā āmāsayassa upari pakkāsayassa udarapaṭalapiṭṭhikaṇṭakānaṃ vemajjhe paramasambādhe tibbandhakāre nānākuṇapagandhaparibhāvitaparamaduggandhapavanavicarite adhimattajegucche kucchippadese pūtimacchapūtikummāsacandanikādīsu kimi viya nibbattati.
This is the suffering rooted in conception in the womb: indeed, when this being is born in the mother's womb, it is not born in lotuses, water lilies, white lotuses, etc., but rather, like a worm, it is born in a highly repulsive part of the womb, below the stomach and above the intestines, in the midst of the abdominal wall and spinal column, in an extremely confined space, in profound darkness, permeated by the stench of various corpses and foul-smelling winds, like a worm in rotten fish, rotten barley gruel, or a cesspool.
Trong đó, khổ do sự nhập thai, v.v., là: Khi chúng sinh này tái sinh trong bụng mẹ, nó không tái sinh trong hoa sen xanh, sen hồng, sen trắng, v.v., mà lại tái sinh trong một vùng bụng vô cùng ghê tởm, cực kỳ chật hẹp, tối tăm mù mịt, nằm giữa dạ dày và ruột già, giữa thành bụng và xương sống, nơi tràn ngập mùi hôi thối của đủ loại xác chết và bị gió hôi thối cực độ thổi qua, giống như một con sâu trong cá thối, cháo thối, nước thải, v.v.
So tattha nibbatto dasa māse mātukucchisambhavena usmanā puṭapākaṃ viya paccamāno piṭṭhapiṇḍi viya sediyamāno samiñjanapasāraṇādivirahito adhimattaṃ dukkhaṃ paccanubhotīti.
Born there, for ten months, being cooked like a medicine in a poultice by the heat arising from the mother's womb, and being steamed like a dough ball, deprived of bending and stretching, etc., it experiences extreme suffering.
Chúng sinh đó, khi đã tái sinh ở đó, phải chịu đựng khổ đau tột độ trong mười tháng, bị nung nấu như thuốc gói trong lá, bị hấp như bánh bột, do hơi nóng phát sinh trong bụng mẹ, không thể co duỗi, v.v.
Idaṃ tāva gabbhokkantimūlakaṃ dukkhaṃ.
This, then, is the suffering rooted in conception in the womb.
Đây là khổ do sự nhập thai (gabbhokkantimūlakaṃ).
Yaṃ pana so mātu sahasā upakkhalanagamananisīdanauṭṭhānaparivattanādīsu surādhuttahatthagato eḷako viya ahituṇḍikahatthagato sappapotako viya ca ākaḍḍhanaparikaḍḍhanaodhunananiddhunanādinā upakkamena adhimattaṃ dukkhamanubhoti, yañca mātu sītudakapānakāle sītanarakūpapanno viya uṇhayāgubhattādiajjhoharaṇakāle aṅgāravuṭṭhisamparikiṇṇo viya loṇambilādiajjhoharaṇakāle khārāpatacchikādikammakāraṇappatto viya adhimattaṃ dukkhamanubhoti.
Furthermore, when the mother suddenly slips, walks, sits, stands up, or turns over, the being experiences extreme suffering from being pulled, dragged, shaken down, or swayed, like a sheep in the hands of a drunkard or a young snake in the hands of a snake charmer. And when the mother drinks cold water, it is as if it has fallen into a cold hell; when she swallows hot gruel or rice, it is as if it is surrounded by a shower of embers; when she swallows salty or sour food, it is as if it is subjected to actions like being salted with a pickling pot, etc., it experiences extreme suffering.
Còn khi người mẹ đột ngột trượt ngã, đi, ngồi, đứng dậy, xoay trở, v.v., thai nhi phải chịu đựng khổ đau tột độ do bị kéo, giằng, lắc, giũ, v.v., như con cừu trong tay kẻ say rượu, hay con rắn con trong tay người bắt rắn. Và khi người mẹ uống nước lạnh, thai nhi như rơi vào địa ngục băng giá; khi ăn cháo nóng, cơm nóng, v.v., thai nhi như bị lửa than bao vây; khi ăn đồ mặn, chua, v.v., thai nhi như bị hành hạ bằng các hình phạt như nước kiềm, dao cắt, v.v., phải chịu đựng khổ đau tột độ.
Idaṃ gabbhapariharaṇamūlakaṃ dukkhaṃ.
This is the suffering rooted in carrying the fetus.
Đây là khổ do sự mang thai (gabbhapariharaṇamūlakaṃ).
Jarāpi dukkhāti ettha duvidhā jarā saṅkhatalakkhaṇañca, khaṇḍiccādisammato santatiyaṃ ekabhavapariyāpannakhandhapurāṇabhāvo ca.
Here, in the phrase old age is suffering, old age is of two kinds: the characteristic of conditioned phenomena, and the aging of the aggregates belonging to one existence, which is conventionally understood as decay and so forth. That is what is intended here. This old age is suffering because it is a saṅkhāra-dukkha and because it is the basis of suffering. For the bodily and mental suffering that arises due to the slackening of limbs, distortion of faculties, disfigurement, destruction of youth, impairment of strength, loss of mindfulness and wisdom, and being scorned by others, old age is the basis. Therefore, it is said:
Trong câu “ Già cũng là khổ” (Jarāpi dukkhā), già có hai loại: đặc tính của các pháp hữu vi (saṅkhata-lakkhaṇa) và sự cũ kỹ của các uẩn thuộc một đời sống liên tục, được gọi là sự sứt mẻ, v.v.
Sā idha adhippetā.
That is what is intended here.
Ở đây, loại già thứ hai được đề cập.
Sā panesā dukkhā saṅkhāradukkhabhāvato ceva dukkhavatthuto ca.
This old age is suffering because it is a saṅkhāra-dukkha and because it is the basis of suffering.
Sự già này là khổ vì nó là hành khổ (saṅkhāradukkha) và là đối tượng của khổ.
Yaṃ hidaṃ aṅgapaccaṅgasithilībhāvaindriyavikāravirūpatā yobbanavināsabalūpaghātasatimativippavāsaparaparibhavādianekappaccayaṃ kāyikacetasikaṃ dukkhamuppajjati, jarā tassa vatthu.
For the bodily and mental suffering that arises due to the slackening of limbs, distortion of faculties, disfigurement, destruction of youth, impairment of strength, loss of mindfulness and wisdom, and being scorned by others, old age is the basis.
Thật vậy, khổ đau về thân và tâm phát sinh do nhiều nguyên nhân như sự lỏng lẻo của các chi phần, sự biến đổi của các căn, hình dạng xấu xí, sự hủy hoại của tuổi trẻ, sự suy yếu của sức mạnh, sự mất trí nhớ và trí tuệ, sự bị người khác khinh miệt, v.v., thì sự già là đối tượng của khổ đó.
Tenetaṃ vuccati –
Therefore, it is said:
Do đó, có lời này:
Maraṇampi dukkhanti etthāpi duvidhaṃ maraṇaṃ – saṅkhatalakkhaṇañca, yaṃ sandhāya vuttaṃ – ‘‘jarāmaraṇaṃ dvīhi khandhehi saṅgahita’’nti (dhātu. 71).
Here, in death is suffering, death is also of two kinds: the characteristic of conditioned phenomena, with reference to which it is said, “old age and death are comprised of two aggregates”; and the severance of the continuity of the life faculty belonging to one existence, with reference to which it is said, “there is always fear from death”. That is what is intended here. Birth-conditioned death, accidental death, sudden death, death by exhaustion of life-span, and death by exhaustion of merit are also names for this. Furthermore, momentary death, conventional death, and cutting-off death – these distinctions should be understood here. The breaking up of existing rūpa and arūpa phenomena is called momentary death. “Tissa is dead, Phussa is dead”—this is called conventional death because there is no being in the ultimate sense; “the crop is dead, the tree is dead”—this is called conventional death because there is no life faculty. The passing away of an Arahant without rebirth is called cutting-off death. Excluding external conventional death, the other conventional death and cutting-off death are comprised by the aforementioned severance of continuity. It is suffering because it is the basis of suffering. Therefore, it is said:
Trong câu “ Chết cũng là khổ” (Maraṇampi dukkhaṃ), chết cũng có hai loại: đặc tính của các pháp hữu vi (saṅkhata-lakkhaṇa), như đã nói: “Già và chết được bao gồm trong hai uẩn.”
Ekabhavapariyāpannajīvitindriyappabandhavicchedo ca, yaṃ sandhāya vuttaṃ – ‘‘niccaṃ maraṇato bhaya’’nti (su. ni. 581).
The severance of the continuity of the life faculty belonging to one existence, with reference to which it is said, “there is always fear from death”.
Và sự đoạn tuyệt của dòng sinh mạng thuộc một đời sống, như đã nói: “Luôn luôn sợ hãi cái chết.”
Taṃ idha adhippetaṃ.
That is what is intended here.
Ở đây, loại thứ hai được đề cập.
Jātipaccayamaraṇaṃ upakkamamaraṇaṃ sarasamaraṇaṃ āyukkhayamaraṇaṃ puññakkhayamaraṇantipi tasseva nāmaṃ.
Birth-conditioned death, accidental death, sudden death, death by exhaustion of life-span, and death by exhaustion of merit are also names for this.
Cái chết do duyên sanh, cái chết do phương tiện, cái chết do cảm xúc, cái chết do hết tuổi thọ, cái chết do hết phước cũng là tên gọi của chính nó.
Puna khaṇikamaraṇaṃ sammutimaraṇaṃ samucchedamaraṇanti ayampettha bhedo veditabbo.
Furthermore, momentary death, conventional death, and cutting-off death – these distinctions should be understood here.
Lại nữa, cần phải biết sự phân biệt ở đây là: cái chết trong khoảnh khắc, cái chết quy ước, và cái chết đoạn tận.
Pavatte rūpārūpadhammānaṃ bhedo khaṇikamaraṇaṃ nāma.
The breaking up of existing rūpa and arūpa phenomena is called momentary death.
Sự hoại diệt của các pháp sắc và phi sắc trong dòng tương tục được gọi là cái chết trong khoảnh khắc.
‘‘Tisso mato, phusso mato’’ti idaṃ paramatthato sattassa abhāvā, ‘‘sassaṃ mataṃ, rukkho mato’’ti idaṃ jīvitindriyassa abhāvā sammutimaraṇaṃ nāma.
“Tissa is dead, Phussa is dead”—this is called conventional death because there is no being in the ultimate sense; “the crop is dead, the tree is dead”—this is called conventional death because there is no life faculty.
“Tisso đã chết, Phusso đã chết” — điều này, vì không có chúng sanh theo nghĩa chân đế, và “lúa đã chết, cây đã chết” — điều này, vì không có mạng quyền, nên được gọi là cái chết quy ước.
Khīṇāsavassa appaṭisandhikā kālakiriyā samucchedamaraṇaṃ nāma.
The passing away of an Arahant without rebirth is called cutting-off death.
Sự mệnh chung không còn tái sanh của bậc lậu tận được gọi là cái chết đoạn tận.
Bāhirakaṃ sammutimaraṇaṃ ṭhapetvā itaraṃ sammutimaraṇañca samucchedamaraṇañca yathāvuttapabandhavicchedeneva saṅgahitaṃ.
Excluding external conventional death, the other conventional death and cutting-off death are comprised by the aforementioned severance of continuity.
Trừ cái chết quy ước bên ngoài, cái chết quy ước còn lại và cái chết đoạn tận được bao gồm chính bởi sự đoạn tuyệt của dòng tương tục đã được nói đến.
Dukkhassa pana vatthubhāvato dukkhaṃ.
It is suffering because it is the basis of suffering.
Nhưng vì là nền tảng của khổ, nên nó là khổ.
Tenetaṃ vuccati –
Therefore, it is said:
Do đó, điều này được nói:
Domanassaṃ nāma cittapīḷanalakkhaṇaṃ mānasaṃ dukkhaṃ.
Mental Pain (Domanassa) is mental suffering, characterized by the torment of the mind.
Ưu là khổ tâm, có đặc tính bức bách tâm.
Dukkhaṃ pana dukkhadukkhato kāyikadukkhāvahanato ca.
It is suffering due to its nature as dukkha-dukkha and due to bringing about physical suffering.
Nhưng nó là khổ vì là khổ khổ và vì mang đến khổ thân.
Cetodukkhasamappitā hi kese pakiriya kandanti, urāni paṭipisanti, āvaṭṭanti, vivaṭṭanti, uddhaṃpādaṃ papatanti, satthaṃ āharanti, visaṃ khādanti, rajjuyā ubbandhanti, aggiṃ pavisantīti nānappakārakaṃ dukkhamanubhavanti.
Indeed, those afflicted with mental suffering scatter their hair and weep, beat their breasts, writhe, roll about, fall head over heels, draw a knife, eat poison, hang themselves with a rope, and enter fire, thus experiencing various kinds of suffering.
Thật vậy, những người bị khổ tâm xâm chiếm, họ rũ tóc mà khóc, đấm ngực, lăn qua lộn lại, ngã ngửa chân lên trời, lấy dao, ăn thuốc độc, treo cổ bằng dây, nhảy vào lửa, và trải qua nhiều loại khổ khác nhau.
Tenetaṃ vuccati –
Therefore it is said –
Do đó, điều này được nói:
Saṅkhittena pañcupādānakkhandhāti ettha pana saṅkhittenāti desanaṃ sandhāya vuttaṃ.
Here, in “ In brief, the five aggregates of clinging,” the phrase “ in brief” is stated with reference to the teaching.
Còn ở đây, trong câu Tóm lại, năm uẩn thủ là khổ, từ tóm lại được nói đến để chỉ bài pháp.
Dukkhañhi ettakāni dukkhasatānīti vā ettakāni dukkhasahassānīti vā saṅkhipituṃ na sakkā, desanā pana sakkā.
Indeed, suffering cannot be summarized as ‘so many hundreds of sufferings’ or ‘so many thousands of sufferings,’ but the teaching can be summarized.
Thật vậy, khổ không thể được tóm lại rằng có bấy nhiêu trăm nỗi khổ hay bấy nhiêu ngàn nỗi khổ, nhưng bài pháp thì có thể.
Tasmā ‘‘dukkhaṃ nāma na aññaṃ kiñci, saṃkhittena pañcupādānakkhandhā dukkhā’’ti desanaṃ saṅkhipanto evamāha.
Therefore, intending to summarize the teaching, the Buddha says, “Suffering is nothing else; in brief, the five aggregates of clinging are suffering.”
Do đó, khi tóm tắt bài pháp, Ngài đã nói như vậy: “Khổ không phải là bất cứ điều gì khác, tóm lại, năm uẩn thủ là khổ.”
Pañcāti gaṇanaparicchedo.
Five is a numerical classification.
Năm là sự xác định về số lượng.
Upādānakkhandhāti upādānagocarā khandhā.
Aggregates of clinging are the aggregates that are the objects of clinging.
Uẩn thủ là các uẩn làm đối tượng cho sự chấp thủ.
Tathā hi indhanamiva pāvako, lakkhamiva paharaṇāni, gorūpaṃ viya ḍaṃsamakasādayo, khettamiva lāyakā, gāmaṃ viya gāmaghātakā, upādānakkhandhapañcakameva jātiādayo nānappakārehi vibādhentā tiṇalatādīni viya bhūmiyaṃ, pupphaphalapallavāni viya rukkhesu upādānakkhandhesuyeva nibbattanti.
Just as fire afflicts fuel, weapons afflict targets, mosquitoes and gnats afflict cattle, reapers afflict a field or its crops, and village-destroyers afflict a village, so too, birth and so forth, afflicting the five aggregates of clinging in various ways, arise only in the aggregates of clinging, just as grass and creepers arise on the earth, and flowers, fruits, and sprouts arise on trees.
Thật vậy, cũng như lửa đối với nhiên liệu, vũ khí đối với mục tiêu, ruồi muỗi đối với đàn bò, người gặt đối với ruộng lúa, kẻ cướp làng đối với ngôi làng, sanh, v.v., bằng nhiều cách khác nhau, làm khổ não chính năm uẩn thủ, và chúng phát sinh ngay trong các uẩn thủ, giống như cỏ và dây leo trên mặt đất, hoa, quả và chồi non trên cây.
Upādānakkhandhānañca ādidukkhaṃ jāti, majjhedukkhaṃ jarā, pariyosānadukkhaṃ maraṇaṃ, māraṇantikadukkhābhighātena pariḍayhanadukkhaṃ soko, tadasahanato lālappanadukkhaṃ paridevo, tato dhātukkhobhasaṅkhātaaniṭṭhaphoṭṭhabbasamāyogato kāyassa ābādhanadukkhaṃ dukkhaṃ, tena ābādhiyamānānaṃ puthujjanānaṃ tattha paṭighuppattito cetobādhanadukkhaṃ domanassaṃ, sokādivuddhiyā janitavisādānaṃ anutthunanadukkhaṃ upāyāso, manorathavighātappattānaṃ icchāvighātadukkhaṃ icchitālābhoti evaṃ nānappakārato upaparikkhiyamānā upādānakkhandhāva dukkhāti yadetaṃ ekamekaṃ dassetvā vuccamānaṃ anekehipi kappehi na sakkā anavasesato vattuṃ, taṃ sabbampi dukkhaṃ ekajalabindumhi sakalasamuddajalarasaṃ viya yesu kesuci pañcasu upādānakkhandhesu saṅkhipitvā dassetuṃ ‘‘saṅkhittena pañcupādānakkhandhā dukkhā’’ti bhagavatā vuttameva thero avocāti.
And among the aggregates of clinging, birth is suffering at the beginning, old age is suffering in the middle, and death is suffering at the end. Sorrow is the suffering of burning due to the affliction of suffering ending in death. Lamentation is the suffering of wailing due to not enduring that (sorrow). Then, physical pain is the suffering of bodily affliction due to the conjunction with unpleasant contact, which is the disturbance of the elements. Mental pain is the suffering of mental affliction for ordinary people who are afflicted by that (physical pain), due to the arising of aversion there. Despair is the suffering of lamenting, generated by the increase of sorrow and so forth. Not getting what one wants is the suffering of frustrated desire for those whose hopes are thwarted. Thus, when examined in various ways, it is the aggregates of clinging themselves that are suffering. This suffering, when shown one by one and spoken of, cannot be fully described even in many aeons. All that suffering, like the taste of all ocean water in a single drop of water, is condensed and shown in these five aggregates of clinging, as the Blessed One said, "In brief, the five aggregates of clinging are suffering." This is what the Elder taught, bringing it into the Pāṭisambhidāmagga Pāḷi.
Và đối với các uẩn thủ, khổ ban đầu là sanh, khổ ở giữa là già, khổ cuối cùng là chết, khổ bị thiêu đốt bởi sự áp bức của khổ đau tận cùng là cái chết gọi là sầu, khổ than khóc do không thể chịu đựng được gọi là bi, từ đó khổ về sự bệnh hoạn của thân do sự tiếp xúc với xúc chạm không mong muốn được gọi là sự xáo trộn của các đại gọi là khổ, khổ về sự bệnh hoạn của tâm do sự phát sinh của sân hận ở nơi các phàm phu đang bị bệnh hoạn ấy hành hạ gọi là ưu, khổ rên rỉ của những người có nỗi buồn được tạo ra bởi sự gia tăng của sầu muộn v.v… gọi là não, khổ do chướng ngại của ý muốn nơi những người gặp phải sự cản trở của nguyện vọng gọi là cầu bất đắc khổ; như vậy, khi được xem xét theo nhiều cách khác nhau, chính các uẩn thủ là khổ. Điều này, nếu được trình bày từng cái một, thì dù có nói trong nhiều kiếp cũng không thể nói hết được không còn sót lại. Vị Trưởng lão đã nói lại chính lời mà Đức Thế Tôn đã dạy: “Tóm lại, năm uẩn thủ là khổ”, nhằm để trình bày tất cả những khổ đau ấy một cách tóm tắt trong bất kỳ năm uẩn thủ nào, giống như hương vị của toàn bộ nước biển được tóm gọn trong một giọt nước.
Tattha katamā jātītiādīsu padabhājanīyesu tatthāti dukkhasaccaniddese vuttesu jātiādīsu.
In the section on the analysis of terms such as “What is birth there?”, “there” refers to birth and so forth mentioned in the exposition of the Noble Truth of Suffering.
Ở đây, sanh là gì v.v..., trong các phần phân tích từ ngữ này, ở đây có nghĩa là trong số sanh v.v... đã được nói đến trong phần giải thích về Khổ đế.
Yā tesaṃ tesaṃ sattānanti saṅkhepato anekesaṃ sattānaṃ sādhāraṇaniddeso.
“The birth of these and those beings” is a general exposition of many beings in brief.
Sự sanh của các chúng sanh này, chúng sanh nọ là cách trình bày chung cho nhiều chúng sanh một cách tóm tắt.
Yā devadattassa jāti, yā somadattassa jātīti evañhi divasampi kathiyamāne neva sattā pariyādānaṃ gacchanti, na sabbaṃ aparatthadīpanaṃ sijjhati, imehi pana dvīhi padehi na koci satto apariyādinno hoti, na kiñci aparatthadīpanaṃ na sijjhati.
Indeed, if one were to speak of the birth of Devadatta and the birth of Somadatta in this manner for a whole day, beings would not be exhausted, nor would the explanation of all other matters be completed. However, with these two terms, no being is left unmentioned, and no explanation of other matters is left incomplete.
Thật vậy, nếu nói: “Sự sanh của Devadatta, sự sanh của Somadatta”, thì dù có nói cả ngày, các chúng sanh cũng không thể được kể hết, và việc giải thích cho tất cả các trường hợp khác cũng không thể hoàn thành. Nhưng với hai từ này, không có chúng sanh nào không được bao gồm, không có sự giải thích nào cho các trường hợp khác mà không được hoàn thành.
Tamhi tamhīti ayaṃ gatijātivasena anekesaṃ sattanikāyānaṃ sādhāraṇaniddeso.
“In this and that” is a general exposition of many groups of beings in terms of their destinies and births.
Trong chúng sanh đoàn này, chúng sanh đoàn nọ là cách trình bày chung cho nhiều chúng sanh đoàn theo phương diện thú và loài.
Sattanikāyeti sattānaṃ nikāye, sattaghaṭāyaṃ sattasamūheti attho.
“Group of beings” means a group of beings, a collection of beings, a multitude of beings.
Trong chúng sanh đoàn có nghĩa là trong đoàn thể của các chúng sanh, trong tập hợp của các chúng sanh, trong nhóm của các chúng sanh.
Jātīti jāyanavasena.
“Birth” (jāti) is in the sense of being born.
Sanh (jāti) là theo phương diện sinh ra.
Idamettha sabhāvapaccattaṃ.
This here is its specific characteristic (sabhāvapaccatta).
Đây là từ ngữ riêng biệt chỉ bản chất ở đây.
Sañjātīti sañjāyanavasena.
“Complete birth” (sañjāti) is in the sense of being completely born.
Sự sanh khởi (sañjāti) là theo phương diện sinh ra hoàn toàn.
Upasaggena padaṃ vaḍḍhitaṃ.
The word is extended by the prefix.
Từ này được mở rộng bằng một tiếp đầu ngữ.
Okkantīti okkamanavasena.
“Descent” (okkanti) is in the sense of descending.
Sự nhập thai (okkanti) là theo phương diện đi vào.
Jāyanaṭṭhena vā jāti, sā aparipuṇṇāyatanavasena vuttā.
Or, it is jāti in the sense of being born, and it is spoken of in terms of an incomplete sense-sphere.
Hoặc, do có nghĩa là sinh ra nên gọi là sanh (jāti); điều đó được nói theo phương diện các xứ chưa hoàn thiện.
Sañjāyanaṭṭhena sañjāti, sā paripuṇṇāyatanavasena vuttā.
It is sañjāti in the sense of being completely born, and it is spoken of in terms of a complete sense-sphere.
Do có nghĩa là sinh ra hoàn toàn nên gọi là sự sanh khởi (sañjāti); điều đó được nói theo phương diện các xứ đã hoàn thiện.
Okkamanaṭṭhena okkanti, sā aṇḍajajalābujavasena vuttā.
It is okkanti in the sense of descending, and it is spoken of in terms of egg-born and womb-born beings.
Do có nghĩa là đi vào nên gọi là sự nhập thai (okkanti); điều đó được nói theo phương diện noãn sanh và thai sanh.
Te hi aṇḍakosaṃ vatthikosañca okkamanti, okkamantā pavisantā viya paṭisandhiṃ gaṇhanti.
For they descend into the egg-shell and the womb-membrane, and by descending, they take rebirth as if entering.
Thật vậy, chúng đi vào vỏ trứng và bao tử cung; khi đi vào, chúng thụ thai giống như đang đi vào bên trong.
Abhinibbattanaṭṭhena abhinibbatti, sā saṃsedajaopapātikavasena vuttā.
“Arising” (abhinibbatti) is in the sense of clearly arising, and it is spoken of in terms of moisture-born and spontaneous-born beings.
Do có nghĩa là hiện hữu rõ ràng nên gọi là sự hiện hữu (abhinibbatti); điều đó được nói theo phương diện thấp sanh và hóa sanh.
Te hi pākaṭā eva hutvā nibbattanti, ayaṃ tāva sammutikathā.
For they arise having become manifest. This is conventional discourse for now.
Thật vậy, chúng hiện hữu một cách rõ ràng rồi sinh ra. Đây trước hết là cách nói theo tục đế.
Idāni khandhānaṃ pātubhāvo, āyatanānaṃ paṭilābhoti paramatthakathā hoti.
Now, “the manifestation of the aggregates, the acquisition of the sense-spheres” is ultimate discourse.
Bây giờ, sự xuất hiện của các uẩn, sự thành tựu của các xứ là cách nói theo chân đế.
Khandhā eva hi paramatthato pātubhavanti, na sattā.
For in the ultimate sense, it is only the aggregates that manifest, not beings.
Thật vậy, theo chân đế, chỉ có các uẩn xuất hiện, chứ không phải chúng sanh.
Ettha ca khandhānanti ekavokārabhave ekassa, catuvokārabhave catunnaṃ, pañcavokārabhave pañcannampi gahaṇaṃ veditabbaṃ.
Here, “of the aggregates” should be understood as the inclusion of one aggregate in a one-constituent existence, four in a four-constituent existence, and all five in a five-constituent existence.
Ở đây, cần hiểu rằng của các uẩn là sự bao gồm một uẩn trong cõi nhất uẩn, bốn uẩn trong cõi tứ uẩn, và cả năm uẩn trong cõi ngũ uẩn.
Pātubhāvoti uppatti.
“Manifestation” is arising.
Sự xuất hiện là sự sinh khởi.
Āyatanānanti tatra tatra uppajjamānāyatanavasena saṅgaho veditabbo.
“Of the sense-spheres” should be understood as inclusion in terms of the sense-spheres arising in each respective existence.
Của các xứ cần được hiểu là sự tổng hợp theo phương diện các xứ sinh khởi ở nơi này nơi kia.
Paṭilābhoti santatiyaṃ pātubhāvoyeva.
“Acquisition” is simply manifestation in the continuity.
Sự thành tựu chính là sự xuất hiện trong dòng tương tục.
Pātubhavantāneva hi tāni paṭiladdhāni nāma honti.
For when they manifest, they are said to be acquired.
Thật vậy, chính khi chúng đang xuất hiện thì chúng mới được gọi là đã thành tựu.
Ayaṃ vuccati jātīti ayaṃ jāti nāma kathīyati.
“This is called birth” means this is designated as birth.
Điều này được gọi là sanh, tức là điều này được gọi là sanh.
Jarāniddese jarāti sabhāvapaccattaṃ.
In the exposition of old age, “old age” (jarā) is its specific characteristic (sabhāvapaccatta).
Trong phần giải thích về già, già (jarā) là từ ngữ riêng biệt chỉ bản chất.
Jīraṇatāti ākāraniddeso.
“Aging” (jīraṇatā) is an exposition of its mode.
Sự già nua (jīraṇatā) là cách trình bày về hình thái.
Khaṇḍiccantiādayo tayo kālātikkame kiccaniddesā, pacchimā dve pakatiniddesā.
“Broken teeth” and the following three are expositions of function in terms of the passing of time; the latter two are expositions of its nature.
Ba từ răng rụng (khaṇḍicca) v.v... là cách trình bày về chức năng khi thời gian trôi qua, hai từ cuối cùng là cách trình bày về bản chất.
Ayañhi jarāti iminā padena sabhāvato dīpitā, tenassā idaṃ sabhāvapaccattaṃ.
Indeed, this old age is revealed in its nature by the word “jarā”; hence, this is its specific characteristic.
Thật vậy, sự già này được giải thích về bản chất bằng từ “jarā”, do đó đây là từ ngữ riêng biệt chỉ bản chất của nó.
Jīraṇatāti iminā ākārato, tenassāyaṃ ākāraniddeso.
It is revealed in its mode by the word “jīraṇatā”; hence, this is an exposition of its mode.
Bằng từ “jīraṇatā”, nó được giải thích về hình thái, do đó đây là cách trình bày về hình thái của nó.
Khaṇḍiccanti iminā kālātikkame dantanakhānaṃ khaṇḍitabhāvakaraṇakiccato.
"Khaṇḍiccaṃ" (brokenness) is indicated by this as the action of causing the teeth and nails to become broken due to the passage of time.
Bằng từ “khaṇḍicca”, nó được giải thích về chức năng làm cho răng và móng trở nên gãy rụng khi thời gian trôi qua.
Pāliccanti iminā kesalomānaṃ palitabhāvakaraṇakiccato.
"Pāliccaṃ" (greyness) is indicated by this as the action of causing the hair and body-hair to become grey.
Bằng từ pālicca, nó được giải thích về chức năng làm cho tóc và lông trở nên bạc trắng.
Valittacatāti iminā maṃsaṃ milāpetvā tace valibhāvakaraṇakiccato dīpitā.
"Valittacatā" (wrinkled skin) is indicated by this as the action of causing the flesh to wither and the skin to wrinkle.
Bằng từ valittacatā, nó được giải thích về chức năng làm cho thịt teo lại và da trở nên nhăn nheo.
Tenassā ime tayo kālātikkame kiccaniddesā.
Therefore, these three are descriptions of the actions of aging due to the passage of time.
Do đó, ba từ này là cách trình bày về chức năng của nó khi thời gian trôi qua.
Tehi imesaṃ vikārānaṃ dassanavasena pākaṭībhūtā pākaṭajarā dassitā.
By these, visible aging (pākaṭajarā), which becomes manifest through the appearance of these changes, is shown.
Qua chúng, sự già biểu lộ (pākaṭajarā), vốn đã trở nên rõ ràng qua việc thấy được những biến đổi này, đã được chỉ ra.
Yatheva hi udakassa vā vātassa vā aggino vā tiṇarukkhādīnaṃ sambhaggapalibhaggatāya vā jhāmatāya vā gatamaggo pākaṭo hoti, na ca so gatamaggo tāneva udakādīni, evameva jarāya dantādīsu khaṇḍiccādivasena gatamaggo pākaṭo cakkhuṃ ummīletvāpi gayhati, na ca khaṇḍiccādīneva jarā.
Just as the path of water, wind, or fire is evident through the brokenness or burnt state of grass, trees, and so forth, and that path is not the water itself, etc., so too, the path of aging (jarā) in the teeth and so forth, in the form of brokenness, etc., is evident and can be grasped even by opening one's eyes; yet, brokenness, etc., is not aging itself.
Thật vậy, cũng như con đường đi của nước, gió, hay lửa trở nên rõ ràng qua sự gãy đổ, tàn lụi hay cháy xém của cỏ cây v.v..., nhưng con đường đi đó không phải là chính nước, v.v...; cũng vậy, con đường đi của sự già trong răng v.v... qua việc rụng gãy v.v... trở nên rõ ràng, có thể nhận thấy được ngay cả khi mở mắt ra, nhưng sự rụng gãy v.v... không phải là chính sự già.
Na hi jarā cakkhuviññeyyā hoti.
Aging is indeed not cognizable by the eye-consciousness.
Thật vậy, sự già không phải là đối tượng có thể nhận biết bằng nhãn thức.
Āyuno saṃhāni indriyānaṃ paripākoti imehi pana padehi kālātikkameyeva abhibyattāya āyukkhayacakkhādiindriyaparipākasaṅkhātāya pakatiyā dīpitā, tenassime dve pakatiniddesāti veditabbā.
However, by these terms, "decline of life" (āyuno saṃhāni) and "decay of faculties" (indriyānaṃ paripāko), aging is indicated by its nature, which is the exhaustion of life and the decay of the eye and other faculties, becoming manifest only through the passage of time. Thus, these two should be understood as descriptions of its nature.
Còn với các từ sự suy giảm của tuổi thọ, sự chín muồi của các căn, sự già được giải thích bằng bản chất được gọi là sự suy giảm tuổi thọ và sự chín muồi của các căn như mắt v.v..., vốn đã biểu hiện rõ ràng khi thời gian trôi qua. Do đó, cần hiểu rằng hai từ này là cách trình bày về bản chất của nó.
Tattha yasmā jaraṃ pattassa āyu hāyati, tasmā jarā ‘‘āyuno saṃhānī’’ti phalūpacārena vuttā.
Among these, since the life of one who has reached old age declines, aging is called "decline of life" by way of referring to the cause by its effect.
Trong đó, vì tuổi thọ của người đã đến tuổi già bị suy giảm, nên sự già được gọi là “sự suy giảm của tuổi thọ” theo phép ẩn dụ về kết quả.
Yasmā ca daharakāle suppasannāni sukhumampi attano visayaṃ sukheneva gaṇhanasamatthāni cakkhādīni indriyāni jaraṃ pattassa paripakkāni āluḷitāni avisadāni oḷārikampi attano visayaṃ gahetuṃ asamatthāni honti, tasmā ‘‘indriyānaṃ paripāko’’ti phalūpacāreneva vuttā.
And since the eye and other faculties, which in youth were very clear and capable of easily grasping even subtle objects, become decayed, agitated, unclear, and incapable of grasping even gross objects when one reaches old age, it is called "decay of faculties" by way of referring to the cause by its effect.
Và vì các căn như mắt v.v..., vốn rất trong sáng và có khả năng nắm bắt đối tượng vi tế của mình một cách dễ dàng khi còn trẻ, khi đến tuổi già lại trở nên chín muồi, mờ đục, không rõ ràng, không có khả năng nắm bắt cả đối tượng thô của mình, nên nó được gọi là “sự chín muồi của các căn” cũng theo phép ẩn dụ về kết quả.
Sā panesā evaṃ niddiṭṭhā sabbāpi jarā pākaṭā paṭicchannāti duvidhā hoti.
All aging, thus described, is twofold: manifest (pākaṭā) and hidden (paṭicchannā).
Tất cả sự già được giải thích như vậy được chia làm hai loại: sự già biểu lộ và sự già che giấu.
Tattha dantādīsu khaṇḍādibhāvadassanato rūpadhammesu jarā pākaṭajarā nāma.
Among these, aging in material phenomena (rūpadhamma), which is seen as brokenness in teeth and so forth, is called manifest aging (pākaṭajarā).
Trong đó, sự già trong các pháp sắc được gọi là sự già biểu lộ (pākaṭajarā) do có thể thấy được tình trạng rụng gãy v.v... ở răng v.v...
Arūpadhammesu pana jarā tādisassa vikārassa adassanato paṭicchannajarā nāma.
Aging in immaterial phenomena (arūpadhamma), however, is called hidden aging (paṭicchannajarā) because such changes are not seen.
Còn sự già trong các pháp vô sắc được gọi là sự già che giấu (paṭicchannajarā) do không thấy được sự biến đổi tương tự như vậy.
Tatra yvāyaṃ khaṇḍādibhāvo dissati, so tādisānaṃ dantādīnaṃ vaṇṇoyeva.
Here, the brokenness and so forth that is seen is merely the color of such teeth and so forth.
Ở đây, tình trạng rụng gãy v.v... có thể thấy được đó chính là màu sắc của răng v.v... tương tự.
Taṃ cakkhunā disvā manodvārena cintetvā ‘‘ime dantā jarāya pahaṭā’’ti jaraṃ jānāti, udakaṭṭhāne baddhāni gosiṅgādīni oloketvā heṭṭhā udakassa atthibhāvajānanaṃ viya.
Seeing that with the eye, one reflects through the mind-door and knows that "these teeth are afflicted by aging," just as one knows the presence of water below by observing cow-horns and other objects tied in a place with water.
Người ta thấy điều đó bằng mắt, suy nghĩ qua ý môn rồi biết được sự già bằng cách nghĩ rằng “những chiếc răng này đã bị sự già tấn công”, giống như việc biết có nước ở bên dưới sau khi nhìn thấy sừng bò v.v... được cắm ở nơi có nước.
Puna ayaṃ jarā savīci avīcīti evampi duvidhā hoti.
Furthermore, this aging is also twofold: with intervals (savīci) and without intervals (avīci).
Lại nữa, sự già này cũng có hai loại: có gián đoạn (savīci) và không gián đoạn (avīci).
Tattha maṇikanakarajatapavāḷacandasūriyādīnaṃ mandadasakādīsu pāṇīnaṃ viya, pupphaphalapallavādīsu apāṇīnaṃ viya ca antarantarā vaṇṇavisesādīnaṃ dubbiññeyyattā jarā avīcijarā nāma, nirantarajarāti attho.
Among these, aging is called aging without intervals (avīcijarā), meaning continuous aging, because the specific colors and so forth of gems, gold, silver, coral, moon, sun, etc., in their initial ten-day periods, etc., are difficult to discern, similar to that of living beings, and also similar to that of non-living things like flowers, fruits, and sprouts.
Trong đó, do khó nhận biết được sự khác biệt về màu sắc v.v... ở giữa, như sự già của các vật có sự sống trong các thập niên nhỏ v.v... của ngọc, vàng, bạc, san hô, mặt trăng, mặt trời v.v..., và như sự già của các vật không có sự sống trong hoa, quả, chồi non v.v..., nên sự già được gọi là sự già không gián đoạn (avīcijarā), có nghĩa là sự già liên tục.
Tato aññesu pana yathāvuttesu antarantarā vaṇṇavisesādīnaṃ suviññeyyattā jarā savīcijarā nāma.
However, in other cases, as stated, aging is called aging with intervals (savīcijarā) because the specific colors and so forth are easily discernible.
Còn ở những vật khác như đã nói, do dễ nhận biết được sự khác biệt về màu sắc v.v... ở giữa, nên sự già được gọi là sự già có gián đoạn (savīcijarā).
Tattha savīcijarā upādiṇṇakaanupādiṇṇakavasena evaṃ veditabbā – daharakumārakānañhi paṭhamameva khīradantā nāma uṭṭhahanti, na te thirā.
Among these, aging with intervals (savīcijarā) should be understood in terms of appropriated (upādiṇṇaka) and unappropriated (anupādiṇṇaka) forms, as follows: For young children, milk teeth first appear, but they are not firm.
Trong đó, sự già có gián đoạn cần được hiểu theo phương diện của vật được chấp thủ và vật không được chấp thủ như sau: Thật vậy, đối với các bé trai nhỏ, trước hết răng sữa mọc lên, chúng không bền chắc.
Tesu pana patitesu puna dantā uṭṭhahanti.
When these fall out, permanent teeth appear again.
Nhưng khi chúng rụng đi, răng lại mọc lên lần nữa.
Te paṭhamameva setā honti, jarāvātena pahaṭakāle kāḷakā honti.
These are initially white, but when struck by the wind of aging, they become black.
Ban đầu chúng có màu trắng, khi bị gió già tấn công thì chúng trở nên đen.
Kesā paṭhamameva tambā honti, tato kāḷakā, tato setā.
Hair is initially reddish, then black, then white.
Tóc ban đầu có màu hung, sau đó trở nên đen, rồi bạc trắng.
Chavi pana salohitikā hoti.
The skin is initially reddish.
Còn da thì có màu hồng hào.
Vaḍḍhantānaṃ vaḍḍhantānaṃ odātānaṃ odātabhāvo, kāḷakānaṃ kāḷakabhāvo paññāyati.
As people grow, the whiteness of fair-skinned people and the blackness of dark-skinned people become apparent.
Khi chúng lớn lên, lớn lên, những người da trắng thì có màu da trắng, những người da đen thì có màu da đen được nhận biết.
Jarāvātena pana pahaṭakāle valiṃ gaṇhāti.
But when struck by the wind of aging, it wrinkles.
Nhưng khi bị gió già thổi đến, da sẽ nổi nếp nhăn.
Sabbampi sassaṃ vapitakāle setaṃ hoti, pacchā nīlaṃ.
All crops are white when sown, then later green.
Tất cả các loại cây trồng khi gieo trồng đều có màu trắng, sau đó chuyển sang màu xanh.
Jarāvātena pana pahaṭakāle paṇḍukaṃ hoti.
But when struck by the wind of aging, they become yellowish.
Nhưng khi bị gió già thổi đến, chúng sẽ có màu vàng nhạt.
Ambaṅkurenāpi dīpetuṃ vaṭṭati.
It is also appropriate to illustrate with a mango sprout.
Cũng có thể minh họa bằng chồi xoài.
Maraṇaniddese cutīti cavanavasena vuttaṃ.
In the definition of death (maraṇa), " cutī" (falling away) is stated in the sense of shifting.
Trong phần giải thích về cái chết, cutī (chết) được nói đến theo nghĩa dịch chuyển.
Ekacatupañcakkhandhānaṃ sāmaññavacanametaṃ.
This is a general term for one, four, or five aggregates.
Đây là một từ chung cho một, bốn hoặc năm uẩn.
Cavanatāti bhāvavacanena lakkhaṇanidassanaṃ.
" Cavanatā" (the state of falling away) is the indication of the characteristic by the abstract noun.
Cavanatā (sự dịch chuyển) là sự biểu thị đặc tính bằng một từ trạng thái.
Bhedoti cutikhandhānaṃ bhaṅguppattiparidīpanaṃ.
" Bhedo" (breaking up) is the exposition of the occurrence of the dissolution of the aggregates of falling away.
Bhedo (sự tan rã) là sự biểu thị sự phát sinh và tan rã của các uẩn khi chết.
Antaradhānanti ghaṭassa viya bhinnassa bhinnānaṃ cutikhandhānaṃ yena kenaci pariyāyena ṭhānābhāvaparidīpanaṃ.
" Antaradhānaṃ" (disappearance) is the exposition of the non-existence of a place for the broken aggregates of falling away, in any manner, like a broken pot.
Antaradhānaṃ (sự biến mất) là sự biểu thị sự không còn tồn tại của các uẩn đã tan rã khi chết, giống như một cái bình bị vỡ, theo bất kỳ cách nào.
Maccu maraṇanti maccusaṅkhātaṃ maraṇaṃ, na khaṇikamaraṇaṃ.
" Maccu maraṇaṃ" (death, mortality) refers to death as mortality, not momentary death.
Maccu maraṇaṃ (cái chết của tử thần) là cái chết được gọi là tử thần, không phải là cái chết sát-na.
Kālo nāma antako, tassa kiriyāti kālakiriyā.
Kāla (time) is the ender; its action is " kālakiriyā" (doing of time).
Kāla (thời gian) là kẻ hủy diệt, hành động của nó là kālakiriyā (sự hành động của thời gian).
Ettāvatā ca sammutiyā maraṇaṃ dīpitaṃ.
By this much, conventional death is indicated.
Cho đến đây, cái chết đã được giải thích theo nghĩa quy ước.
Idāni paramatthena dīpetuṃ khandhānaṃ bhedotiādimāha.
Now, in order to explain by way of ultimate reality, he said, "the breaking up of the aggregates," and so on.
Bây giờ, để giải thích theo nghĩa tối hậu, Đức Phật nói khandhānaṃ bhedo (sự tan rã của các uẩn), v.v.
Paramatthena hi khandhāyeva bhijjanti, na satto nāma koci marati.
For, in the ultimate sense, only the aggregates break up; no being whatsoever dies.
Thật vậy, theo nghĩa tối hậu, chỉ có các uẩn tan rã, không có chúng sinh nào chết.
Khandhesu pana bhijjamānesu satto marati, bhinnesu matoti vohāro hoti.
But when the aggregates are breaking up, the being dies; when they are broken up, the designation "dead" arises.
Nhưng khi các uẩn tan rã, chúng sinh được nói là chết, và khi chúng đã tan rã, chúng sinh được nói là đã chết.
Ettha ca catuvokārapañcavokāravasena khandhānaṃ bhedo, ekavokāravasena kaḷevarassa nikkhepo, catuvokāravasena vā khandhānaṃ bhedo, sesadvayavasena kaḷevarassa nikkhepo veditabbo.
And here, the breaking up of the aggregates should be understood as occurring in the four-constituent and five-constituent existences; the casting off of the corpse as occurring in the one-constituent existence; or, the breaking up of the aggregates as occurring in the four-constituent existence, and the casting off of the corpse as occurring in the remaining two existences.
Ở đây, sự tan rã của các uẩn ( khandhānaṃ bhedo) được hiểu theo nghĩa tứ uẩn và ngũ uẩn, sự bỏ xác ( kaḷevarassa nikkhepo) được hiểu theo nghĩa nhất uẩn, hoặc sự tan rã của các uẩn theo nghĩa tứ uẩn, và sự bỏ xác theo nghĩa hai loại còn lại.
Bhavadvayepi rūpakāyasaṅkhātassa kaḷevarassa sambhavato.
Because the corpse, which is called the physical body, exists in both types of existence.
Vì xác thân (kaḷevara), tức là thân sắc, tồn tại trong cả hai cõi hữu (bhava).
Yasmā vā cātumahārājikādīsupi khandhā bhijjanteva, na kiñci nikkhipati, tasmā tesaṃ vasena khandhānaṃ bhedo, manussādīsu kaḷevarassa nikkhepo.
Or, since the aggregates break up even in the Cātumahārājika devas and so on, and nothing is cast off, therefore, in their case, it is the breaking up of the aggregates; in the case of humans and so on, it is the casting off of the corpse.
Hoặc vì ngay cả trong cõi Tứ Đại Thiên Vương (Cātumahārājika) và các cõi khác, các uẩn cũng tan rã chứ không có gì bị bỏ lại, nên sự tan rã của các uẩn là theo nghĩa các cõi đó, còn sự bỏ xác là theo nghĩa loài người, v.v.
Ettha ca kaḷevarassa nikkhepakaraṇato maraṇaṃ ‘‘kaḷevarassa nikkhepo’’ti vuttaṃ.
And here, death is called "the casting off of the corpse" because it involves the casting off of the corpse.
Ở đây, cái chết được gọi là “sự bỏ xác” ( kaḷevarassa nikkhepo) vì nó là hành động bỏ xác.
Apica imāni jātijarāmaraṇāni nāma imesaṃ sattānaṃ vadhakapaccāmittā viya otāraṃ gavesantāni vicaranti.
Furthermore, these birth, aging, and death move about like hostile enemies seeking an opportunity to harm these beings.
Hơn nữa, những sự sinh, già, chết này giống như những kẻ thù giết người của chúng sinh, chúng đi lang thang tìm kiếm cơ hội.
Yathā hi purisassa tīsu paccāmittesu otārāpekkhesu vicarantesu eko vadeyya ‘‘ahaṃ asukaaraññassa nāma vaṇṇaṃ kathetvā etaṃ ādāya tattha gamissāmi, ettha mayhaṃ dukkaraṃ natthī’’ti.
Just as, when three enemies are seeking an opportunity to harm a man, one might say: "I will praise the beauty of a certain forest, lead him there, and take him; there is nothing difficult for me in this."
Như khi có ba kẻ thù đang rình rập một người đàn ông để tìm cơ hội, một kẻ nói: "Ta sẽ ca ngợi vẻ đẹp của khu rừng kia, rồi dẫn hắn đến đó. Việc này đối với ta không khó."
Dutiyo vadeyya ‘‘ahaṃ tava etaṃ gahetvā gatakāle pothetvā dubbalaṃ karissāmi, ettha mayhaṃ dukkaraṃ natthī’’ti.
The second might say: "When you have taken him there, I will beat him and make him weak; there is nothing difficult for me in this."
Kẻ thứ hai nói: "Khi ngươi đã dẫn hắn đến đó, ta sẽ đánh đập hắn cho yếu ớt. Việc này đối với ta không khó."
Tatiyo vadeyya ‘‘tayā etasmiṃ pothetvā dubbale kate tiṇhena asinā sīsacchedanaṃ nāma mayhaṃ bhāro hotū’’ti te evaṃ vatvā tathā kareyyuṃ.
The third might say: "When he has been beaten and made weak by you, let the task of beheading him with a sharp sword be my responsibility." Having said this, they would do so.
Kẻ thứ ba nói: "Khi ngươi đã đánh đập hắn cho yếu ớt, việc chặt đầu hắn bằng thanh gươm sắc bén sẽ là phần của ta." Sau khi nói như vậy, chúng sẽ hành động như thế.
Tattha paṭhamapaccāmittassa araññavaṇṇaṃ kathetvā taṃ ādāya tattha gatakālo viya suhajjañātimaṇḍalato nikkaḍḍhitvā yattha katthaci nibbattāpanaṃ nāma jātiyā kiccaṃ, dutiyassa pothetvā dubbalakaraṇaṃ viya nibbattakkhandhesu nipatitvā parādhīnamañcaparāyaṇabhāvakaraṇaṃ jarāya kiccaṃ, tatiyassa tiṇhena asinā sīsacchedanaṃ viya jīvitakkhayapāpanaṃ maraṇassa kiccanti veditabbaṃ.
Here, the act of birth is like the first enemy praising the beauty of the forest, leading the man there, and taking him, which means pulling him away from the circle of well-wishing relatives and causing him to be reborn somewhere or other; the act of aging is like the second enemy beating him and making him weak, which means assailing the arisen aggregates and causing him to become dependent on others and destined for a bed; and the act of death is like the third enemy beheading him with a sharp sword, which means bringing about the cessation of life. This should be understood.
Ở đây, việc kẻ thù thứ nhất ca ngợi vẻ đẹp của khu rừng và dẫn người đàn ông đến đó, giống như việc tái sinh kéo chúng sinh ra khỏi vòng thân hữu và gia đình để tái sinh ở bất cứ đâu, đó là nhiệm vụ của sự sinh (jāti). Việc kẻ thù thứ hai đánh đập cho yếu ớt, giống như việc già nua (jarā) ập đến các uẩn đã sinh, khiến chúng trở nên lệ thuộc vào giường bệnh. Việc kẻ thù thứ ba chặt đầu bằng thanh gươm sắc bén, giống như việc cái chết (maraṇa) dẫn đến sự chấm dứt sinh mạng, cần phải hiểu như vậy.
Sokaniddese viyasatīti byasanaṃ, hitasukhaṃ khipati viddhaṃsetīti attho.
In the exposition of sorrow, "byasana" (calamity) means that which destroys, that which ruins beneficial happiness.
Trong phần giải thích về sầu (soka), byasanaṃ (tai họa) có nghĩa là làm tan biến, phá hủy sự lợi ích và hạnh phúc.
Ñātīnaṃ byasanaṃ ñātibyasanaṃ, corarogabhayādīhi ñātikkhayo ñātivināsoti attho.
The calamity of relatives is ñātibyasanaṃ, meaning the destruction or ruin of relatives due to dangers from thieves, diseases, and so on.
Tai họa của thân quyến là ñātibyasanaṃ, nghĩa là sự tiêu diệt thân quyến do trộm cướp, bệnh tật, sợ hãi, v.v.
Tena ñātibyasanena.
By that calamity of relatives.
Do đó, ñātibyasanena (do tai họa của thân quyến).
Phuṭṭhassāti ajjhotthaṭassa abhibhūtassa, samannāgatassāti attho.
Phuṭṭhassa means overwhelmed, overcome, that is, endowed with.
Phuṭṭhassā (người bị chạm đến) có nghĩa là người bị áp đảo, bị chế ngự, tức là người bị vây hãm.
Sesesupi eseva nayo.
The same method applies to the remaining ones.
Trong các trường hợp còn lại cũng vậy.
Ayaṃ pana viseso – bhogānaṃ byasanaṃ bhogabyasanaṃ, rājacorādivasena bhogakkhayo bhogavināsoti attho.
This, however, is the distinction: the calamity of possessions is bhogabyasanaṃ, meaning the loss or ruin of possessions due to kings, thieves, and so on.
Tuy nhiên, có một điểm khác biệt: tai họa về tài sản là bhogabyasanaṃ, nghĩa là sự tiêu tán tài sản do vua chúa, trộm cướp, v.v.
Rogoyeva byasanaṃ rogabyasanaṃ.
Disease itself is calamity, rogabyasanaṃ.
Bệnh tật chính là tai họa, rogabyasanaṃ.
Rogo hi ārogyaṃ viyasati vināsetīti byasanaṃ.
For disease destroys and ruins health, hence it is calamity.
Bệnh tật phá hủy sức khỏe, nên nó là tai họa.
Sīlassa byasanaṃ sīlabyasanaṃ.
The calamity of morality is sīlabyasanaṃ.
Tai họa về giới là sīlabyasanaṃ.
Dussīlyassetaṃ nāmaṃ.
This is a name for immorality.
Đây là tên gọi của sự ác giới.
Sammādiṭṭhiṃ vināsayamānā uppannā diṭṭhi eva byasanaṃ diṭṭhibyasanaṃ.
Wrong view itself, having arisen by destroying right view, is calamity, diṭṭhibyasanaṃ.
Tà kiến phát sinh làm hủy hoại Chánh kiến chính là tai họa, diṭṭhibyasanaṃ.
Ettha ca purimāni dve anipphannāni, pacchimāni tīṇi nipphannāni tilakkhaṇabbhāhatāni.
Here, the first two are not produced (by kamma), while the latter three are produced (by kamma) and are affected by the three characteristics.
Trong số này, hai loại đầu tiên không phải là kết quả (anipphanna), ba loại sau là kết quả (nipphanna) và bị ảnh hưởng bởi ba đặc tính (tilakkhaṇa).
Purimāni ca tīṇi neva kusalāni na akusalāni, sīladiṭṭhibyasanadvayaṃ akusalaṃ.
And the first three are neither wholesome nor unwholesome, while the two calamities of morality and view are unwholesome.
Ba loại đầu tiên không phải là thiện cũng không phải là bất thiện, còn hai loại tai họa về giới và kiến là bất thiện.
Aññataraññatarenāti gahitesu vā yena kenaci aggahitesu vā mittāmaccabyasanādīsu yena kenaci.
Aññataraññatarena means by any one of the three calamities already mentioned, or by any one of those not mentioned, such as the calamity of friends or ministers.
Aññataraññatarenā (bởi bất kỳ cái nào khác) có nghĩa là bởi bất kỳ tai họa nào trong số những tai họa đã được đề cập, hoặc bởi bất kỳ tai họa nào trong số những tai họa chưa được đề cập như tai họa của bạn bè, người thân, v.v.
Samannāgatassāti samanubandhassa aparimuccamānassa.
Samannāgatassa means of one who is followed by, who cannot escape.
Samannāgatassā (người bị vây hãm) có nghĩa là người bị ràng buộc, không thể thoát khỏi.
Aññataraññatarena dukkhadhammenāti yena kenaci sokadukkhassa uppattihetunā.
By any one of various painful conditions means by any cause whatsoever for the arising of the suffering of sorrow.
Aññataraññatarena dukkhadhammenā (bởi bất kỳ pháp khổ nào khác) có nghĩa là bởi bất kỳ nguyên nhân nào gây ra khổ sầu.
Sokoti socanakavasena soko.
Sorrow (soko) means sorrow by way of grieving.
Soko (sầu) là sầu do trạng thái sầu muộn.
Idaṃ tehi kāraṇehi uppajjanakasokassa sabhāvapaccattaṃ.
This (term soka) is the intrinsic meaning of sorrow that arises due to those causes (such as loss of relatives).
Đây là bản chất của sầu phát sinh từ những nguyên nhân đó.
Socanāti socanākāro.
Grieving (socanā) means the manner of grieving.
Socanā (sự sầu muộn) là trạng thái sầu muộn.
Socitattanti socitabhāvo.
The state of having grieved (socitattaṃ) means the state of having grieved.
Socitattaṃ (trạng thái sầu muộn) là trạng thái sầu muộn.
Antosokoti abbhantarasoko.
Inner sorrow (antosoko) means internal sorrow.
Antosoko (nội sầu) là sầu bên trong.
Dutiyapadaṃ upasaggena vaḍḍhitaṃ.
The second term is expanded by the prefix.
Từ thứ hai được thêm tiền tố.
So hi abbhantaraṃ sukkhāpento viya parisukkhāpento viya uppajjatīti ‘‘antosoko antoparisoko’’ti vuccati.
For that sorrow arises as if drying up the mind, as if drying it up completely, hence it is called "inner sorrow, inner pervasive sorrow."
Nó được gọi là "nội sầu, nội biệt sầu" (antosoko antoparisoko) vì nó phát sinh như thể làm khô héo, làm khô kiệt tâm trí từ bên trong.
Cetaso parijjhāyanāti cittassa parijjhāyanākāro.
Mental burning (cetaso parijjhāyanā) means the mind's manner of burning up.
Cetaso parijjhāyanā (sự thiêu đốt của tâm) là trạng thái thiêu đốt của tâm.
Soko hi uppajjamāno aggi viya cittaṃ jhāpeti dahati, ‘‘cittaṃ me jhāmaṃ, na me kiñci paṭibhātī’’ti vadāpeti.
For when sorrow arises, it burns and consumes the mind like fire, making one say, "My mind is burnt, nothing appears to me."
Khi sầu phát sinh, nó thiêu đốt, đốt cháy tâm như lửa, khiến người ta nói: "Tâm tôi bị thiêu đốt, tôi không nghĩ ra được điều gì."
Dukkhito mano dummano, tassa bhāvo domanassaṃ.
A mind afflicted by suffering is a distressed mind (dummano); its state is distress (domanassaṃ).
Tâm bị khổ là tâm đau khổ (dummano), trạng thái đó là domanassaṃ (ưu khổ).
Anupaviṭṭhaṭṭhena sokova sallanti sokasallaṃ.
Sorrow itself is a dart, by reason of its penetrating deeply, hence the dart of sorrow (sokasallaṃ).
Sầu chính là mũi tên (salla) vì nó đâm sâu vào bên trong, nên gọi là sokasallaṃ (mũi tên sầu).
Paridevaniddese ‘‘mayhaṃ dhītā, mayhaṃ putto’’ti evaṃ ādissa ādissa devanti rodanti etenāti ādevo.
In the explanation of lamentation, wailing (ādevo) means that by which they lament and weep, pointing out "my daughter, my son," and so on.
Trong phần giải thích về than khóc (parideva), ādevo (than vãn) là do người ta than khóc, kêu la bằng cách chỉ ra từng điều như "con gái của tôi, con trai của tôi".
Taṃ taṃ vaṇṇaṃ parikittetvā parikittetvā devanti etenāti paridevo.
Lamentation (paridevo) means that by which they lament, repeatedly extolling this and that quality.
Paridevo (than khóc) là do người ta than khóc bằng cách lặp đi lặp lại những lời ca ngợi phẩm chất đó.
Tato parāni dve dve padāni purimadvayasseva ākārabhāvaniddesavasena vuttāni.
The subsequent two pairs of terms are stated by way of indicating the manner and state of the preceding two.
Hai từ tiếp theo được nói đến theo nghĩa biểu thị trạng thái và bản chất của hai từ trước đó.
Vācāti vacanaṃ.
Speech (vācā) means speaking.
Vācā (lời nói) là sự nói.
Palāpoti tucchaṃ niratthakavacanaṃ.
Babbling (palāpo) means empty, meaningless speech.
Palāpo (lời nói vô ích) là lời nói trống rỗng, vô nghĩa.
Upaḍḍhabhaṇitaaññabhaṇitādivasena virūpo palāpoti vippalāpo.
Babbling that is distorted by way of half-spoken or otherwise spoken words is incoherent babbling (vippalāpo).
Vippalāpo (lời nói lảm nhảm) là lời nói vô ích bị biến dạng do nói nửa vời, nói lạc đề, v.v.
Lālappoti punappunaṃ lapanaṃ.
Wailing (lālappo) means repeated speaking.
Lālappo (sự lặp đi lặp lại) là sự nói lặp đi lặp lại.
Lālappanākāro lālappanā.
The manner of wailing is lālappanā.
Trạng thái nói lặp đi lặp lại là lālappanā.
Lālappitassa bhāvo lālappitattaṃ.
The state of having wailed is lālappitattaṃ.
Trạng thái của người nói lặp đi lặp lại là lālappitattaṃ.
Dukkhaniddese kāyanissitattā kāyikaṃ.
In the explanation of suffering, bodily (kāyikaṃ) is due to its reliance on the body.
Trong phần giải thích về khổ (dukkha), kāyikaṃ (thuộc về thân) là do nó nương tựa vào thân.
Amadhuraṭṭhena asātaṃ.
Unpleasant (asātaṃ) is by reason of its being disagreeable.
Asātaṃ (không đáng ưa) là do nó không ngọt ngào.
Kāyikapadena cetasikaasātaṃ paṭikkhipati, asātapadena kāyikasātaṃ.
The term kāyika excludes mental unpleasantness, and the term asāta excludes bodily pleasantness.
Từ "kāyika" bác bỏ sự không đáng ưa thuộc về tâm (cetasika asātaṃ), và từ "asāta" bác bỏ sự đáng ưa thuộc về thân (kāyika sātaṃ).
Tadeva dukkhayatīti dukkhaṃ, yassuppajjati, taṃ dukkhitaṃ karotīti attho.
That itself causes suffering, hence suffering (dukkhaṃ); the meaning is that it makes one who experiences it suffer.
Chính nó làm cho khổ, nên gọi là dukkhaṃ, nghĩa là nó làm cho người mà nó phát sinh trở nên đau khổ.
Dukkhamattā vā dukkhaṃ.
Or suffering is due to its being difficult to endure.
Hoặc khổ là do nó khó chịu đựng (dukkhamattā).
Kāyasamphassajanti kāyasamphasse jātaṃ.
Arising from bodily contact (kāyasamphassajaṃ) means born from bodily contact.
Do xúc chạm thân có nghĩa là phát sinh từ xúc chạm thân.
Asātaṃ dukkhaṃ vedayitanti asātaṃ vedayitaṃ na sātaṃ, dukkhaṃ vedayitaṃ na sukhaṃ.
Unpleasant, painful feeling (asātaṃ dukkhaṃ vedayitaṃ) means that unpleasant feeling is not pleasant, and painful feeling is not happiness.
Cảm thọ khổ không thích ý có nghĩa là cảm thọ không thích ý không phải là thích ý, cảm thọ khổ không phải là lạc.
Parato tīṇi padāni itthiliṅgavasena vuttāni.
The three subsequent terms are stated in the feminine gender.
Ba từ tiếp theo được nói theo giống cái.
Asātā vedanā na sātā, dukkhā vedanā na sukhāti ayameva panettha attho.
Here, the meaning is simply that unpleasant feeling is not pleasant, and painful feeling is not happiness.
Ở đây, ý nghĩa là: cảm thọ không thích ý không phải là thích ý, cảm thọ khổ không phải là lạc.
Yaṃ kāyikaṃ asātaṃ dukkhaṃ vedayitaṃ, yā kāyasamphassajā asātā dukkhā vedanā, idaṃ vuccati dukkhanti evaṃ yojanā veditabbā.
The connection should be understood thus: "That which is bodily unpleasant, painful feeling, that which is unpleasant, painful feeling born of bodily contact, this is called suffering."
Cần phải hiểu cách kết nối như sau: Cái gì là cảm thọ khổ không thích ý thuộc về thân, cái gì là cảm thọ khổ không thích ý phát sinh do xúc chạm thân, cái đó được gọi là khổ.
Appiyasampayoganiddese idhāti imasmiṃ loke.
In the explanation of association with the disliked, here (idhā) means in this world.
Trong phần giải thích về Appiyasampayoga (hội ngộ với điều không ưa thích), idha (ở đây) có nghĩa là trong thế giới này.
Yassāti ye assa.
Whose (yassā) is ye assa (which belong to him).
Yassā có nghĩa là "mà của người ấy".
Aniṭṭhāti apariyesitā.
Undesirable (aniṭṭhā) means not sought after.
Aniṭṭhā có nghĩa là những điều không được mong cầu.
Pariyesitā vā hontu apariyesitā vā, nāmamevetaṃ amanāpārammaṇānaṃ.
Whether sought after or not sought after, this is simply a name for disagreeable objects.
Dù là được mong cầu hay không được mong cầu, đây chỉ là tên gọi của những đối tượng không vừa ý.
Manasmiṃ na kamanti na pavisantīti akantā.
They do not enter, do not penetrate the mind, hence disagreeable (akantā).
Akantā (không đáng yêu) là những điều không đi vào, không xâm nhập vào tâm.
Manasmiṃ na appiyanti, na vā manaṃ vaḍḍhentīti amanāpā.
They are not dear to the mind, or they do not increase the mind, hence unpleasant (amanāpā).
Amanāpā (không vừa ý) là những điều không được yêu thích trong tâm, hoặc không làm cho tâm tăng trưởng.
Rūpātiādi tesaṃ sabhāvanidassanaṃ.
Forms (rūpā) and so on are an indication of their nature.
Rūpā (sắc) v.v. là sự chỉ rõ bản chất của chúng.
Anatthaṃ kāmenti icchantīti anatthakāmā.
They wish for what is not beneficial, hence those who wish for harm (anatthakāmā).
Anatthakāmā (mong muốn điều bất lợi) là những người mong muốn, khao khát điều bất lợi.
Ahitaṃ kāmenti icchantīti ahitakāmā.
They wish for what is unwholesome, hence those who wish for disadvantage (ahitakāmā).
Ahitakāmā (mong muốn điều không có lợi) là những người mong muốn, khao khát điều không có lợi.
Aphāsuṃ dukkhavihāraṃ kāmenti icchantīti aphāsukāmā.
They wish for an uncomfortable, painful abiding, hence those who wish for discomfort (aphāsukāmā).
Aphāsukāmā (mong muốn sự không an ổn) là những người mong muốn, khao khát sự không an ổn, sự sống trong khổ đau.
Catūhi yogehi khemaṃ nibbhayaṃ vivaṭṭaṃ na kāmenti, sabhayaṃ vaṭṭameva nesaṃ kāmenti icchantīti ayogakkhemakāmā.
They do not wish for safety, fearlessness, liberation from the four yogas; they wish for rebirth, which is full of fear, hence those who wish for what is not safe from bondage (ayogakkhemakāmā).
Ayogakkhemakāmā (mong muốn sự không an toàn khỏi ách buộc) là những người không mong muốn sự an toàn, không sợ hãi, không thoát khỏi bốn ách buộc (yoga), mà chỉ mong muốn sự luân hồi đầy sợ hãi cho chúng.
Apica saddhādīnaṃ vuddhisaṅkhātassa atthassa akāmanato, tesaṃyeva hānisaṅkhātassa anatthassa ca kāmanato anatthakāmā.
Furthermore, because they do not wish for the benefit consisting of the growth of faith and so on, and because they wish for the harm consisting of the decline of these very things, they are anatthakāmā.
Hơn nữa, anatthakāmā (mong muốn điều bất lợi) là do không mong muốn lợi ích được gọi là sự tăng trưởng của niềm tin v.v., và do mong muốn điều bất lợi được gọi là sự suy giảm của chúng.
Saddhādīnaṃyeva upāyabhūtassa hitassa akāmanato, saddhāhāniādīnaṃ upāyabhūtassa ahitassa ca kāmanato ahitakāmā.
Because they do not wish for the wholesome, which is the means to faith and so on, and because they wish for the unwholesome, which is the means to the decline of faith and so on, they are ahitakāmā.
Ahitakāmā (mong muốn điều không có lợi) là do không mong muốn lợi ích là phương tiện của niềm tin v.v., và do mong muốn điều bất lợi là phương tiện của sự suy giảm niềm tin v.v.
Phāsuvihārassa akāmanato, aphāsuvihārassa ca kāmanato aphāsukāmā.
Because they do not wish for comfortable abiding, and because they wish for uncomfortable abiding, they are aphāsukāmā.
Aphāsukāmā (mong muốn sự không an ổn) là do không mong muốn sự sống an ổn, và do mong muốn sự sống không an ổn.
Yassa kassaci nibbhayassa akāmanato, bhayassa ca kāmanato ayogakkhemakāmāti evamettha attho daṭṭhabbo.
From not desiring freedom from danger, and from desiring danger, the meaning here should be understood as ayogakkhemakāmā (those who desire what is not safe/secure).
Ở đây, ý nghĩa là: ayogakkhemakāmā (mong muốn sự không an toàn khỏi ách buộc) là do không mong muốn sự không sợ hãi của bất cứ ai, và do mong muốn sự sợ hãi.
Saṅgatīti gantvā saṃyogo.
Saṅgati means going and joining.
Saṅgatī (hội ngộ) có nghĩa là đi đến và kết hợp.
Samāgamoti āgatehi saṃyogo.
Samāgama means joining with those who have arrived.
Samāgamo (tụ hội) có nghĩa là kết hợp với những người đã đến.
Samodhānanti ṭhānanisajjādīsu sahabhāvo.
Samodhāna means being together in standing, sitting, and so forth.
Samodhānaṃ (cùng nhau) có nghĩa là cùng hiện diện trong các tư thế đứng, ngồi, v.v.
Missībhāvoti sabbakiccānaṃ sahakaraṇaṃ.
Missībhāva means performing all tasks together.
Missībhāvo (sự hòa lẫn) có nghĩa là cùng thực hiện mọi công việc.
Ayaṃ sattavasena yojanā.
This is an explanation in terms of sentient beings.
Đây là cách kết nối theo nghĩa chúng sinh.
Saṅkhāravasena pana yaṃ labbhati, taṃ gahetabbaṃ.
However, what is obtained in terms of conditioned phenomena (saṅkhāra) should be taken.
Tuy nhiên, cái gì được hiểu theo nghĩa các hành (saṅkhāra) thì nên lấy cái đó.
So pana appiyasampayogo atthato eko dhammo nāma natthi, kevalaṃ appiyasampayuttānaṃ duvidhassāpi dukkhassa vatthubhāvato dukkhoti vutto.
But that association with the disagreeable is not, in essence, a single phenomenon; it is merely called suffering because it is the basis for both kinds of suffering (physical and mental) for those associated with the disagreeable.
Nhưng sự hội ngộ với điều không ưa thích (appiyasampayoga) này, về bản chất, không phải là một pháp duy nhất; nó chỉ được gọi là khổ vì nó là cơ sở cho cả hai loại khổ phát sinh ở những người hội ngộ với điều không ưa thích.
Piyavippayoganiddeso vuttapaṭipakkhanayena veditabbo.
The explanation of separation from the agreeable should be understood by the opposite method of what has been stated.
Phần giải thích về Piyavippayoga (xa lìa điều ưa thích) nên được hiểu theo cách ngược lại với những gì đã nói.
Mātā vātiādi panettha atthakāme sarūpena dassetuṃ vuttaṃ.
Here, mother or and so forth is stated to show those who desire welfare in their true form.
Ở đây, Mātā vā (mẹ hay) v.v. được nói ra để chỉ rõ những người mong muốn lợi ích (atthakāma) theo bản chất của họ.
Tattha mamāyatīti mātā, piyāyatīti pitā.
Among them, she who cherishes is mother; he who loves is father.
Trong đó, người yêu thương là mātā (mẹ); người yêu quý là pitā (cha).
Bhajatīti bhātā, tathā bhaginī.
He who attends is brother; likewise, sister.
Người phụng sự là bhātā (anh/em), tương tự là bhaginī (chị/em gái).
Mettāyantīti mittā, minanti vā sabbaguyhesu anto pakkhipantīti mittā.
They who are friendly are friends; or, they who measure (minanti) by placing all secrets within are friends.
Những người có lòng từ là mittā (bạn bè), hoặc những người giữ kín mọi bí mật trong lòng là mittā.
Kiccakaraṇīyesu sahabhāvaṭṭhena amā hontīti amaccā.
They who are together by virtue of being involved in duties and tasks are ministers (amaccā).
Amaccā (bạn bè thân thiết, quan chức) là những người cùng chung sống trong các công việc cần làm.
‘‘Ayaṃ amhākaṃ ajjhattiko’’ti evaṃ jānanti, ñāyantīti vā ñātī.
They know, "This one is our own," or they are known (ñāyanti); hence they are relatives (ñātī).
Những người biết rằng "người này là người thân của chúng ta", hoặc được biết đến, là ñātī (thân quyến).
Lohitena sambandhāti sālohitā.
They who are connected by blood are blood-relatives (sālohitā).
Sālohitā (bà con huyết thống) là những người có quan hệ huyết thống.
Pitupakkhikā ñātī, mātupakkhikā sālohitā.
Relatives are those on the father's side; blood-relatives are those on the mother's side.
Ñātī là thân quyến bên cha, sālohitā là bà con bên mẹ.
Mātāpitupakkhikā vā ñātī, sassusasurapakkhikā sālohitā.
Or, relatives are those on the mother's and father's side; blood-relatives are those on the side of the mother-in-law and father-in-law.
Hoặc ñātī là thân quyến bên cha mẹ, sālohitā là bà con bên nhà chồng/vợ.
Ayampi piyavippayogo atthato eko dhammo nāma natthi, kevalaṃ piyavippayuttānaṃ duvidhassāpi dukkhassa vatthubhāvato dukkhoti vutto.
This separation from the agreeable is also not, in essence, a single phenomenon; it is merely called suffering because it is the basis for both kinds of suffering for those separated from the agreeable.
Sự xa lìa điều ưa thích (piyavippayoga) này cũng không phải là một pháp duy nhất về bản chất; nó chỉ được gọi là khổ vì nó là cơ sở cho cả hai loại khổ phát sinh ở những người xa lìa điều ưa thích.
Idamettha sabbaaṭṭhakathāvacanaṃ.
This is the statement of all the commentaries here.
Đây là toàn bộ lời giải thích của các chú giải (aṭṭhakathā) về vấn đề này.
Saccānaṃ pana tathalakkhaṇattā sampayogavippayogavacanehi appiyapiyavatthūniyeva visesitānīti vattuṃ yujjatīti.
However, since the Noble Truths have their true characteristics, it is proper to say that only disagreeable and agreeable objects are distinguished by the terms "association" and "separation."
Tuy nhiên, vì các chân lý có đặc tính chân thật, nên có thể nói rằng các từ "hội ngộ" và "xa lìa" chỉ đặc trưng cho những đối tượng không ưa thích và ưa thích.
Icchitālābhaniddese jātidhammānanti jātisabhāvānaṃ jātipakatikānaṃ.
In the explanation of not obtaining what is desired, jātidhammānaṃ means those whose nature is birth, those whose characteristic is birth.
Trong phần giải thích về Icchitālābha (không đạt được điều mong muốn), jātidhammānaṃ (những người có bản chất sinh) có nghĩa là những người có bản chất sinh, có tính chất sinh.
Icchā uppajjatīti taṇhā uppajjati.
Desire arises means craving arises.
Icchā uppajjatī (mong muốn phát sinh) có nghĩa là tham ái (taṇhā) phát sinh.
Aho vatāti patthanā.
Aho vata is a wish.
Aho vatā là lời ước nguyện.
Assāmāti bhaveyyāma.
Assāma means "may we be."
Assāmā có nghĩa là "chúng ta sẽ là".
Na kho panetaṃ icchāya pattabbanti yaṃ etaṃ ‘‘aho vata mayaṃ na jātidhammā assāma, na ca vata no jāti āgaccheyyā’’ti evaṃ pahīnasamudayesu sādhūsu vijjamānaṃ ajātidhammattaṃ parinibbutesu ca vijjamānaṃ jātiyā anāgamanaṃ icchitaṃ, taṃ icchantassāpi maggabhāvanāya vinā appattabbato, anicchantassāpi ca bhāvanāya pattabbato na icchāya pattabbaṃ nāma hoti.
But this is not to be attained by wishing means that which is desired—namely, the state of not having the nature of birth, which exists in noble ones who have abandoned the origin (of suffering), and the non-occurrence of birth, which exists in those who have attained Nibbāna—even for one who wishes for it, it is not to be attained without the development of the path; and for one who does not wish for it, it is to be attained through development. Hence, it is not something to be attained by wishing.
Na kho panetaṃ icchāya pattabbaṃ có nghĩa là: cái được mong muốn, "ước gì chúng ta không có bản chất sinh, ước gì sự sinh không đến với chúng ta", tức là trạng thái không có bản chất sinh hiện hữu ở những bậc thánh đã đoạn trừ tập khởi, và sự không đến của sự sinh hiện hữu ở những bậc đã nhập Niết Bàn; điều đó, dù người ta có mong muốn đi chăng nữa, cũng không thể đạt được nếu không tu tập con đường (đạo), và dù không mong muốn đi chăng nữa, cũng có thể đạt được bằng cách tu tập; vì vậy, nó không phải là điều có thể đạt được bằng mong muốn.
Idampīti etampi.
This too means this as well.
Idampī (điều này cũng vậy) có nghĩa là điều này cũng vậy.
Upari sesāni upādāya apisaddo.
The word api (also) is used with reference to the remaining (items) above.
Từ api (cũng) được thêm vào để bao gồm các điều còn lại ở trên.
34. Samudayasaccaniddese yāyaṃ taṇhāti yā ayaṃ taṇhā.
34. In the explanation of the Noble Truth of the Origin of Suffering, yāyaṃ taṇhā means "whatever craving this is."
34. Trong phần giải thích về Tập Đế, yāyaṃ taṇhā có nghĩa là yā ayaṃ taṇhā (tham ái này).
Ponobhavikāti punabbhavakaraṇaṃ punobhavo, punobhavo sīlamassāti ponobhavikā.
Ponobhavikā means "that which causes renewed existence," because renewed existence is punobhava, and its characteristic is renewed existence.
Ponobhavikā (dẫn đến tái sinh) có nghĩa là punabbhavakaraṇaṃ (việc tạo ra sự tái sinh) là punobhavo (tái sinh); ponobhavikā là vì nó có bản chất tái sinh.
Apica punabbhavaṃ deti, punabbhavāya saṃvattati, punappunaṃ bhave nibbattetīti ponobhavikā.
Furthermore, it gives renewed existence, it leads to renewed existence, it causes existence to arise again and again; hence, it is ponobhavikā.
Hơn nữa, nó là ponobhavikā vì nó ban tặng sự tái sinh, nó dẫn đến sự tái sinh, nó liên tục tạo ra sự hiện hữu.
Sā panesā punabbhavassa dāyikāpi atthi adāyikāpi, punabbhavāya saṃvattanikāpi atthi asaṃvattanikāpi, dinnāya paṭisandhiyā upadhivepakkamattāpi.
And this craving may be either a giver of renewed existence or not a giver; it may lead to renewed existence or not lead to it; it may also be merely a condition for the maturation of results in the form of rebirth-linking.
Tuy nhiên, tham ái này có thể là cái ban tặng sự tái sinh hoặc không ban tặng, có thể là cái dẫn đến sự tái sinh hoặc không dẫn đến, và có thể là cái chỉ làm cho các thành phần của sự hiện hữu (upadhi) chín muồi sau khi đã có sự tái sinh.
Sā tippakārāpi ponobhavikāti nāmaṃ labhati.
This craving, even when it is of three kinds, receives the name ponobhavikā.
Tham ái, dù thuộc ba loại này, đều được gọi là ponobhavikā.
Ponabbhavikātipi pāṭho, soyevattho.
The reading is also ponabbhavikā; the meaning is the same.
Cũng có cách đọc ponabbhavikā, ý nghĩa vẫn như vậy.
Abhinandanasaṅkhātena nandirāgena saha gatāti nandirāgasahagatā.
It is accompanied by the delight-passion (nandirāga) in the sense of delighting; hence, nandirāgasahagatā.
Nandirāgasahagatā (đi kèm với tham ái hoan hỷ) có nghĩa là đi kèm với tham ái hoan hỷ, tức là sự hoan hỷ.
Nandirāgena saddhiṃ atthato ekattameva gatāti vuttaṃ hoti.
It means that it is, in essence, one with delight-passion.
Có nghĩa là, về bản chất, nó đã đạt đến sự đồng nhất với tham ái hoan hỷ.
Tatra tatrābhinandinīti yatra yatra attabhāvo nibbattati, tatra tatra abhinandinī.
Tatra tatrābhinandinī means delighting wherever a self-existence (attabhāva) arises.
Tatra tatrābhinandinī (hoan hỷ ở mọi nơi) có nghĩa là hoan hỷ ở bất cứ nơi nào mà sự hiện hữu (attabhāva) phát sinh.
Rūpādīsu vā ārammaṇesu tatra tatrābhinandinī, rūpābhinandinī saddagandharasaphoṭṭhabbadhammābhinandinīti attho.
Or, delighting in various objects such as forms; that is, delighting in forms, delighting in sounds, smells, tastes, tangibles, and mental phenomena.
Hoặc hoan hỷ ở mọi đối tượng như sắc v.v., tức là hoan hỷ với sắc, hoan hỷ với âm thanh, mùi hương, vị, xúc chạm và pháp.
Tatra tatrābhinandītipi pāṭho, tatra tatra abhinandayatīti attho.
The reading is also tatra tatrābhinandī; its meaning is "causing delight in various places."
Cũng có cách đọc tatra tatrābhinandī, có nghĩa là làm cho hoan hỷ ở mọi nơi.
Seyyathidanti nipāto, tassa sā katamā iti ceti attho.
Seyyathidaṃ is an indeclinable particle, and its meaning is "which craving is that?"
Seyyathidaṃ là một từ ngữ, có nghĩa là "tham ái đó là gì?".
Kāmataṇhāti kāme taṇhā, pañcakāmaguṇikarāgassetaṃ adhivacanaṃ.
Kāmataṇhā means craving for sensuality; this is a term for the lust (rāga) for the five sense objects.
Kāmataṇhā (dục ái) là tham ái đối với dục lạc; đây là tên gọi của tham ái liên quan đến năm đối tượng dục lạc.
Bhavataṇhāti bhave taṇhā.
Bhavataṇhā means craving for existence.
Bhavataṇhā (hữu ái) là tham ái đối với sự hiện hữu.
Bhavapatthanāvasena uppannassa sassatadiṭṭhisahagatassa rāgassa rūpārūpabhavarāgassa ca jhānanikantiyā ca etaṃ adhivacanaṃ.
This is a term for the lust (rāga) that arises due to the aspiration for existence, accompanied by the eternalist view (sassatadiṭṭhi), and also for the lust for material and immaterial existence (rūpārūpabhava-rāga), and for delight in jhāna.
Đây là tên gọi của tham ái phát sinh do mong muốn sự hiện hữu, của tham ái đi kèm với tà kiến thường còn, của tham ái đối với các cõi sắc và vô sắc, và của sự dính mắc vào thiền định.
Vibhavataṇhāti vibhave taṇhā.
Vibhavataṇhā means craving for non-existence.
Vibhavataṇhā (phi hữu ái) là tham ái đối với sự không hiện hữu.
Ucchedadiṭṭhisahagatarāgassetaṃ adhivacanaṃ.
This is a term for the lust (rāga) accompanied by the annihilationist view (ucchedadiṭṭhi).
Đây là tên gọi của tham ái đi kèm với tà kiến đoạn diệt.
Idāni tassā taṇhāya vatthuṃ vitthārato dassetuṃ sā kho panesātiādimāha.
Now, to extensively explain the basis of that craving, he states, “sā kho panesa” (That craving, indeed, this…).
Bây giờ, để trình bày chi tiết cơ sở của tham ái đó, Ngài nói sā kho panesā (tham ái đó).
Tattha uppajjatīti jāyati.
Therein, “uppajjati” means arises.
Trong đó, uppajjatī (phát sinh) có nghĩa là sinh khởi.
Nivisatīti punappunaṃ pavattivasena patiṭṭhāti.
“Nivisati” means becomes established by repeatedly occurring.
Nivisati có nghĩa là được thiết lập do sự diễn tiến lặp đi lặp lại.
Uppajjamānā kattha uppajjati, nivisamānā kattha nivisatīti sambandho.
The connection is: where does it arise when it arises? Where does it become established when it becomes established?
Khi sanh khởi, nó sanh khởi ở đâu; khi an trú, nó an trú ở đâu, đây là sự liên kết.
Yaṃ loke piyarūpaṃ sātarūpanti yaṃ lokasmiṃ piyasabhāvañceva madhurasabhāvañca.
“Yaṃ loke piyarūpaṃ sātarūpaṃ” means whatever is lovely and delightful in the world.
Thứ gì trong đời là sắc khả ái, sắc khả hỷ có nghĩa là bất cứ thứ gì trong thế gian có bản chất đáng yêu và bản chất ngọt ngào.
Cakkhu loketiādīsu lokasmiñhi cakkhuādīsu mamattena abhiniviṭṭhā sattā sampattiyaṃ patiṭṭhitā attano cakkhuṃ ādāsādīsu nimittaggahaṇānusārena vippasannaṃ pañcapasādaṃ suvaṇṇavimāne ugghāṭitamaṇisīhapañjaraṃ viya maññanti, sotaṃ rajatapanāḷikaṃ viya pāmaṅgasuttakaṃ viya ca maññanti, tuṅganāsāti laddhavohāraṃ ghānaṃ vaṭṭetvā ṭhapitaharitālavaṭṭiṃ viya maññanti, jivhaṃ rattakambalapaṭalaṃ viya mudusiniddhamadhurarasadaṃ maññanti, kāyaṃ sālalaṭṭhiṃ viya suvaṇṇatoraṇaṃ viya ca maññanti, manaṃ aññesaṃ manena asadisaṃ uḷāraṃ maññanti, rūpaṃ suvaṇṇakaṇikārapupphādivaṇṇaṃ viya, saddaṃ mattakaravīkakokilamandadhamitamaṇivaṃsanigghosaṃ viya, attanā paṭiladdhāni catusamuṭṭhānikagandhārammaṇādīni ‘‘kassaññassa evarūpāni atthī’’ti maññanti, tesaṃ evaṃ maññamānānaṃ tāni cakkhādīni piyarūpāni ceva sātarūpāni ca honti.
Regarding “cakkhu loke” and so on: indeed, beings who are attached to the eye and so forth in the world with a sense of possessiveness, and who are established in prosperity, consider their own eye—the fivefold sensitive matter (pañcapasāda) which is exceedingly clear by following the perception of reflections in mirrors and so on—to be like a jewel-studded lion-cage opened in a golden palace; they consider the ear to be like a silver tube or a carpenter's line; they consider the nose, known as the prominent nose, to be like a stick of orpiment (haritāla) rolled and placed; they consider the tongue to be like a soft, smooth, sweet-tasting red woolen blanket; they consider the body to be like a sālalaṭṭhi (a type of tree) or a golden archway; they consider the mind to be noble, unlike the minds of others; they consider visible objects (rūpa) to be like the color of golden kanikāra flowers and so on; they consider sounds to be like the gentle hum of a drunken karavīka bird, a cuckoo, or a jewel-studded flute; and they think, "Who else has such objects of smell, taste, touch, and mental phenomena, which arise from the four causes, as I have?" For those who think in this way, these eyes and so on become both lovely and delightful.
Trong các câu Mắt trong đời v.v..., thật vậy, các chúng sanh đã chú tâm vào mắt v.v... trong thế gian với lòng yêu mến, được thiết lập trong sự thành tựu, họ xem mắt của mình, tức là năm loại tịnh sắc rất trong sáng theo cách nắm bắt hình ảnh trong gương v.v..., giống như cửa sổ sư tử bằng ngọc được mở ra trong cung điện bằng vàng; họ xem tai giống như ống dẫn bằng bạc và giống như sợi dây con dọi; họ xem mũi, vốn được gọi là mũi cao, giống như một thỏi hùng hoàng được vo tròn và đặt xuống; họ xem lưỡi, vốn mang lại vị ngọt ngào, mềm mại và mịn màng, giống như một tấm thảm len màu đỏ; họ xem thân giống như cây sala non và giống như cổng vòm bằng vàng; họ xem tâm là cao quý, không giống với tâm của người khác; họ xem sắc giống như màu sắc của hoa huỳnh anh bằng vàng v.v...; họ xem tiếng giống như âm thanh của sáo ngọc được thổi nhẹ nhàng, tiếng chim cu và chim karavīka say mật; họ nghĩ rằng: “Ai khác có được những đối tượng như hương thơm do bốn nguồn sanh v.v... mà mình đã có được?” Đối với những người nghĩ như vậy, những thứ mắt v.v... đó trở thành sắc khả ái và sắc khả hỷ.
Atha nesaṃ tattha anuppannā ceva taṇhā uppajjati, uppannā ca punappunaṃ pavattivasena nivisati.
Then, craving that has not yet arisen in them arises there, and craving that has arisen becomes established there by repeatedly occurring.
Khi ấy, đối với họ, ái dục chưa sanh khởi thì sanh khởi ở đó, và ái dục đã sanh khởi thì an trú do sự diễn tiến lặp đi lặp lại.
Tasmā thero ‘‘cakkhu loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā uppajjamānā uppajjatī’’tiādimāha.
Therefore, the Elder said, "The eye in the world is lovely and delightful; it is there that this craving arises when it arises," and so on.
Vì vậy, Trưởng lão đã nói: “Mắt trong đời là sắc khả ái, sắc khả hỷ, khi ái dục này sanh khởi, nó sanh khởi ở đây” v.v...
Tattha uppajjamānāti yadā uppajjati, tadā ettha uppajjatīti attho.
Therein, “uppajjamānā” means when it arises, it arises here; this is the meaning.
Ở đây, khi sanh khởi có nghĩa là khi nó sanh khởi, nó sanh khởi ở đây.
Tasmā taṃ dukkhanirodhaṃ dassento samudayanirodhena dassetuṃ evamāha.
Therefore, to show that cessation of suffering, he stated it by means of the cessation of the origin.
Do đó, để chỉ ra sự diệt khổ ấy, Ngài đã nói như vậy để chỉ ra bằng sự diệt của tập.
Sīhasamānavuttino hi tathāgatā, te dukkhaṃ nirodhentā dukkhanirodhañca dassentā hetumhi paṭipajjanti, na phale.
For the Tathāgatas, whose conduct is like that of a lion, when they bring suffering to cessation and demonstrate the cessation of suffering, they proceed with the cause, not with the result.
Thật vậy, các đấng Như Lai có cách hành xử giống như sư tử, khi các Ngài diệt khổ và chỉ ra sự diệt khổ, các Ngài thực hành trên nhân, không phải trên quả.
Suvānavuttino pana aññatitthiyā, te dukkhaṃ nirodhentā dukkhanirodhañca dassentā attakilamathānuyogena ceva tasseva ca desanāya phale paṭipajjanti, na hetumhīti.
But other sectarians, whose conduct is like that of a dog, when they bring suffering to cessation and demonstrate the cessation of suffering, they proceed with the result by means of self-mortification and the teaching thereof, not with the cause.
Còn các ngoại đạo có cách hành xử giống như loài chó, khi họ diệt khổ và chỉ ra sự diệt khổ, họ thực hành trên quả bằng khổ hạnh ép xác và bằng việc thuyết giảng về chính điều đó, chứ không phải trên nhân.
Sīhasamānavuttitāya satthā hetumhi paṭipajjanto ‘‘yo tassāyevā’’tiādimāha.
Because of the Teacher's lion-like conduct, he proceeds with the cause, saying, “yo tassāyeva” (which is that itself), and so on.
Do cách hành xử giống như sư tử, bậc Đạo Sư, khi thực hành trên nhân, đã nói: “Sự diệt tận không dư tàn của chính ái dục ấy” v.v...
Dhammasenāpatipi satthārā vuttakkamenevāha.
The Dhamma-senāpati (General of the Dhamma) also spoke in the same order as taught by the Teacher.
Vị Thống Soái Chánh Pháp cũng nói theo trình tự mà bậc Đạo Sư đã nói.
Tattha tassāyeva taṇhāyāti yā sā taṇhā ‘‘ponobhavikā’’ti vatvā kāmataṇhādivasena vibhattā uppattinivesanavasena ca heṭṭhā pakāsitā, tassāyeva taṇhāya.
Therein, “tassāyeva taṇhāya” means that craving itself, which was described as "leading to renewed existence" (ponobhavikā) and distinguished as craving for sensuality and so on, and which was explained below in terms of its arising and establishment—that craving itself.
Ở đây, của chính ái dục ấy có nghĩa là của chính ái dục ấy, tức là ái dục đã được nói là “đưa đến tái sanh”, được phân loại theo dục ái v.v..., và đã được giải thích ở phần trước theo phương diện nơi sanh khởi và nơi an trú.
Asesavirāganirodhoti virāgo vuccati maggo, ‘‘virāgā vimuccatī’’ti (ma. ni. 1.245; saṃ. ni. 3.12; mahāva. 23) hi vuttaṃ.
“Asesavirāganirodho” means the path is called virāga (dispassion), for it is said, "Through dispassion, one is liberated."
Sự diệt tận không dư tàn của ái dục (Asesavirāganirodho): Ly tham (virāga) được gọi là đạo, vì có câu nói rằng “nhờ ly tham mà được giải thoát” (M. i. 167; S. iii. 51; Vin. i. 14).
Virāgena nirodho virāganirodho, anusayasamugghātato aseso virāganirodho asesavirāganirodho.
Cessation through dispassion is virāganirodha; complete cessation through dispassion is asesavirāganirodha, due to the eradication of underlying tendencies (anusaya).
Sự diệt do ly tham là virāganirodho; sự diệt tận không dư tàn của ái dục do ly tham từ việc nhổ sạch các tùy miên là asesavirāganirodho.
Atha vā virāgoti hi pahānaṃ vuccati, tasmā aseso virāgo aseso nirodhoti evampettha yojanā daṭṭhabbā.
Alternatively, virāga is said to be abandonment; therefore, complete dispassion is complete cessation—this is how the connection should be understood here.
Hoặc, virāga được gọi là sự từ bỏ, do đó, sự ly tham không dư tàn là sự diệt tận không dư tàn, nên hiểu sự kết hợp ở đây là như vậy.
Atthato pana sabbāneva panetāni asesavirāganirodhotiādīni nibbānasseva vevacanāni.
In terms of meaning, all these, such as "the complete fading away and cessation," are indeed synonyms for Nibbāna.
Tuy nhiên, về mặt ý nghĩa, tất cả những từ này như asesavirāganirodho v.v... đều là các danh từ đồng nghĩa của Niết-bàn.
Paramatthato hi dukkhanirodhaṃ ariyasaccanti nibbānaṃ vuccati.
Indeed, in the ultimate sense, Nibbāna is called "the noble truth of the cessation of suffering."
Thật vậy, về mặt chân đế, Niết-bàn được gọi là Thánh đế về sự diệt khổ.
Yasmā pana taṃ āgamma taṇhā asesā virajjati nirujjhati, tasmā taṃ ‘‘tassāyeva taṇhāya asesavirāganirodho’’ti vuccati.
Since, by relying on it, craving completely fades away and ceases, therefore it is called "the complete fading away and cessation of that very craving."
Tuy nhiên, vì nương vào đó mà ái dục ly tham không dư tàn, diệt tận, nên nó được gọi là “sự diệt tận không dư tàn của chính ái dục ấy”.
Nibbānañca āgamma taṇhā cajīyati paṭinissajjīyati muccati na allīyati, kāmaguṇālayesu cettha ekopi ālayo natthi, tasmā nibbānaṃ cāgo paṭinissaggo mutti anālayoti vuccati.
And relying on Nibbāna, craving is abandoned, relinquished, freed, and does not cling; and in this Nibbāna, there is not even a single dwelling place among the dwelling places of sense pleasures. Therefore, Nibbāna is called relinquishment, abandonment, liberation, non-attachment.
Và nương vào Niết-bàn, ái dục được từ bỏ, xả ly, giải thoát, không dính mắc, và trong đó không có một nơi nương náu nào trong các nơi nương náu của dục lạc, do đó Niết-bàn được gọi là sự từ bỏ, sự xả ly, sự giải thoát, sự không nương náu.
Ekameva hi nibbānaṃ, nāmāni panassa sabbasaṅkhatānaṃ nāmapaṭipakkhavasena anekāni honti.
Nibbāna is indeed one, but its names are many, in opposition to the names of all conditioned things.
Thật vậy, Niết-bàn chỉ có một, nhưng tên gọi của nó lại có nhiều, theo phương diện đối lập với tên gọi của tất cả các pháp hữu vi.
Seyyathidaṃ – asesavirāgo asesanirodho cāgo paṭinissaggo mutti anālayo rāgakkhayo dosakkhayo mohakkhayo taṇhākkhayo anuppādo appavattaṃ animittaṃ appaṇihitaṃ anāyūhanaṃ appaṭisandhi anupapatti agati ajātaṃ ajaraṃ abyādhi amataṃ asokaṃ aparidevaṃ anupāyāsaṃ asaṃkiliṭṭhantiādīni.
These are: complete fading away, complete cessation, relinquishment, abandonment, liberation, non-attachment, destruction of lust, destruction of hatred, destruction of delusion, destruction of craving, non-arising, non-continuance, signless, desireless, non-exertion, non-relinking, non-rebirth, non-going, unborn, unaging, unailing, deathless, sorrowless, lamentationless, despairless, uncorrupted, and so on.
Chẳng hạn như: ly tham không dư tàn, diệt tận không dư tàn, từ bỏ, xả ly, giải thoát, không nương náu, đoạn tận tham, đoạn tận sân, đoạn tận si, đoạn tận ái, không sanh, không diễn tiến, vô tướng, vô nguyện, không tạo tác, không tái sanh, không sinh khởi, không đi đến, không sanh, không già, không bệnh, bất tử, không sầu, không bi, không khổ não, không ô nhiễm v.v...
Idāni maggena chinnāya nibbānaṃ āgamma appavattippattāyapi ca taṇhāya yesu vatthūsu tassā uppatti dassitā, tattheva abhāvaṃ dassetuṃ sā kho panesātiādimāha.
Now, to show the non-existence of craving in those very objects where its arising was shown, even though it has attained non-continuance by means of the path and relying on Nibbāna, the Elder said, "That craving, indeed..." and so on.
Bây giờ, để chỉ ra sự vắng mặt của ái dục ngay tại những đối tượng mà sự sanh khởi của nó đã được chỉ ra, dù ái dục đã bị cắt đứt bởi đạo và đã đạt đến trạng thái không diễn tiến nhờ nương vào Niết-bàn, ngài nói: Nhưng ái dục ấy v.v...
Tattha yathā puriso khette jātaṃ tittakālābuvalliṃ disvā aggato paṭṭhāya mūlaṃ pariyesitvā chindeyya, sā anupubbena milāyitvā appaññattiṃ gaccheyya, tato tasmiṃ khette tittakālābu niruddhā pahīnāti vucceyya, evameva khette tittakālābu viya cakkhādīsu taṇhā.
Just as a man, seeing a bitter gourd creeper grown in a field, might search for its root from the top and cut it, and it would gradually wither and become unidentifiable, and then it would be said that the bitter gourd in that field has ceased and been abandoned; in the same way, craving in the eye and so on is like the bitter gourd in the field.
Ở đây, cũng như một người, khi thấy một dây bầu đắng mọc trong ruộng, sẽ tìm gốc từ ngọn rồi chặt đứt nó, dây bầu đó sẽ dần dần héo úa và biến mất, khi đó người ta nói rằng bầu đắng trong ruộng đó đã diệt, đã được đoạn trừ; cũng vậy, ái dục trong mắt v.v... giống như dây bầu đắng trong ruộng.
Sā ariyamaggena mūlacchinnā nibbānaṃ āgamma appavattiṃ gacchati.
That craving, having its root cut by the Noble Path, attains non-continuance by relying on Nibbāna.
Nó, khi bị cắt đứt gốc rễ bởi Thánh đạo, sẽ đi đến trạng thái không diễn tiến nhờ nương vào Niết-bàn.
Evaṃ gatā pana tesu vatthūsu khette tittakālābu viya na paññāyati.
Having thus ceased, it is not perceived in those objects, just like the bitter gourd in the field.
Khi đã đi đến trạng thái như vậy, nó không còn được nhận biết trong những đối tượng đó, giống như dây bầu đắng trong ruộng.
Yathā ca aṭavito core ānetvā nagarassa dakkhiṇadvāre ghāteyyuṃ, tato aṭaviyaṃ corā matāti vā māritāti vā vucceyyuṃ, evameva aṭaviyaṃ corā viya yā cakkhādīsu taṇhā, sā dakkhiṇadvāre corā viya nibbānaṃ āgamma niruddhattā nibbāne niruddhā.
And just as if thieves were brought from the forest and executed at the southern gate of the city, and then it would be said that the thieves in the forest are dead or have been killed; in the same way, craving in the eye and so on is like the thieves in the forest, and having ceased by relying on Nibbāna, like the thieves at the southern gate, it has ceased in Nibbāna.
Và cũng như người ta bắt những tên cướp từ trong rừng về và giết chúng ở cổng phía nam của thành phố, khi đó người ta nói rằng những tên cướp trong rừng đã chết hoặc đã bị giết; cũng vậy, ái dục trong mắt v.v... giống như những tên cướp trong rừng, nó đã diệt trong Niết-bàn vì đã được diệt nhờ nương vào Niết-bàn, giống như những tên cướp ở cổng phía nam.
Evaṃ niruddhā pana tesu vatthūsu aṭaviyaṃ corā viya na paññāyati.
Having thus ceased, it is not perceived in those objects, just like the thieves in the forest.
Khi đã được diệt như vậy, nó không còn được nhận biết trong những đối tượng đó, giống như những tên cướp trong rừng.
Tenassā tattheva nirodhaṃ dassento ‘‘cakkhu loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā pahīyamānā pahīyatī’’tiādimāha.
Therefore, showing its cessation right there, he said, "The eye is dear and pleasing in the world; there, that craving, being abandoned, is abandoned," and so on.
Do đó, để chỉ ra sự diệt của nó ngay tại đó, ngài nói: “Mắt trong đời là sắc khả ái, sắc khả hỷ, khi ái dục này được đoạn trừ, nó được đoạn trừ ở đây” v.v...
Atha vā taṇhuppādavatthussa pariññātattā pariññātavatthusmiṃ puna na uppajjanato anuppādanirodhavasena taṇhuppādavatthusmiṃyeva nirujjhatīti vuccati.
Alternatively, it is said that craving ceases in the very objects of its arising by way of non-arising-cessation, because the objects of craving's arising have been fully understood, and it does not arise again in a fully understood object.
Hoặc, vì đối tượng sanh khởi của ái dục đã được liễu tri, và vì nó không sanh khởi lại trong đối tượng đã được liễu tri, nên được nói rằng nó diệt ngay trong đối tượng sanh khởi của ái dục theo phương diện diệt do không sanh khởi.
Ettha ca uppajjanapaṭipakkhavasena pahīyatīti vuttaṃ, nivisanapaṭipakkhavasena nirujjhatīti.
Here, "abandoned" is said by way of being the opposite of arising, and "ceases" by way of being the opposite of establishing itself.
Và ở đây, từ “được đoạn trừ” (pahīyati) được nói theo phương diện đối lập với sự sanh khởi, và từ “diệt” (nirujjhati) được nói theo phương diện đối lập với sự an trú.
Idāni aṅgamattameva maggo aṅgavinimutto natthīti dassento sammādiṭṭhi…pe… sammāsamādhītiādimāha.
Now, showing that the path is merely a collection of factors and there is nothing apart from its factors, he said, "Right View... and so on... Right Concentration."
Bây giờ, để chỉ ra rằng chỉ có các chi phần mới là đạo, không có đạo nào tách rời khỏi các chi phần, ngài nói sammādiṭṭhi… cho đến… sammāsamādhi v.v...
Tattha sammā dassanalakkhaṇā sammādiṭṭhi. Sammā abhiniropanalakkhaṇo sammāsaṅkappo.
Among these, Right View has the characteristic of seeing correctly. Right Intention has the characteristic of applying correctly.
Trong đó, sammādiṭṭhi có đặc tính thấy đúng. Sammāsaṅkappo có đặc tính hướng đến đúng.
Sammā pariggahalakkhaṇā sammāvācā.
Right Speech has the characteristic of grasping correctly.
Sammāvācā có đặc tính thâu nhiếp đúng.
Sammā samuṭṭhāpanalakkhaṇo sammākammanto.
Right Action has the characteristic of originating correctly.
Sammākammanto có đặc tính khởi lên đúng.
Sammā vodāpanalakkhaṇo sammāājīvo.
Right Livelihood has the characteristic of purifying correctly.
Sammāājīvo có đặc tính thanh lọc đúng.
Sammā paggahalakkhaṇo sammāvāyāmo.
Right Effort has the characteristic of exerting correctly.
Sammāvāyāmo có đặc tính nâng đỡ đúng.
Sammā upaṭṭhānalakkhaṇā sammāsati.
Right Mindfulness has the characteristic of establishing correctly.
Sammāsati có đặc tính an trú đúng.
Sammā samādhānalakkhaṇo sammāsamādhi.
Right Concentration has the characteristic of unifying correctly.
Sammāsamādhi có đặc tính định tĩnh đúng.
Tesu ekekassa tīṇi tīṇi kiccāni honti.
Each of these has three functions.
Trong số đó, mỗi một chi phần có ba phận sự.
Seyyathidaṃ – sammādiṭṭhi tāva aññehipi attano paccanīkakilesehi saddhiṃ micchādiṭṭhiṃ pajahati, nirodhañca ārammaṇaṃ karoti, sampayuttadhamme ca passati tappaṭicchādakamohavidhamanavasena asammohato.
For example, Right View, first of all, abandons wrong view together with its own other opposing defilements, including delusion and so on that are co-existent. It also makes Nibbāna its object, and due to non-delusion, by dispelling the delusion that conceals Nibbāna, it sees the associated phenomena.
Ví như – trước hết, sammādiṭṭhi từ bỏ micchādiṭṭhi cùng với các phiền não đối nghịch khác của nó, lấy sự diệt làm đối tượng, và thấy các pháp tương ưng do không si mê qua việc xua tan si mê che lấp đối tượng ấy.
Sammāsaṅkappādayopi tatheva micchāsaṅkappādīni ca pajahanti, nibbānañca ārammaṇaṃ karonti.
Right Intention and the others likewise abandon wrong intention and so on, and they make Nibbāna their object.
Sammāsaṅkappa v.v... cũng như vậy, từ bỏ micchāsaṅkappa v.v... và lấy Nibbāna làm đối tượng.
Visesato panettha sammāsaṅkappo sahajātadhamme sammā abhiniropeti, sammāvācā sammā pariggaṇhāti, sammākammanto sammā samuṭṭhāpeti, sammāājīvo sammā vodāpeti, sammāvāyāmo sammā paggaṇhāti, sammāsati sammā upaṭṭhāpeti, sammāsamādhi sammā samādahati.
Specifically, among these, Right Intention rightly directs co-arising phenomena; Right Speech rightly comprehends; Right Action rightly generates; Right Livelihood rightly purifies; Right Effort rightly exerts; Right Mindfulness rightly establishes; Right Concentration rightly concentrates.
Đặc biệt ở đây, sammāsaṅkappa hướng các pháp đồng sanh đến đúng, sammāvācā thâu nhiếp đúng, sammākammanto khởi lên đúng, sammāājīvo thanh lọc đúng, sammāvāyāmo nâng đỡ đúng, sammāsati an trú đúng, sammāsamādhi định tĩnh đúng.
Apicesā sammādiṭṭhi nāma pubbabhāge nānākkhaṇā nānārammaṇā hoti, maggakāle ekakkhaṇā ekārammaṇā.
Furthermore, this Right View, in its preliminary stage, has various moments and various objects, but at the moment of the Path, it has one moment and one object.
Hơn nữa, sammādiṭṭhi này trong giai đoạn đầu có nhiều sát-na khác nhau, nhiều đối tượng khác nhau; vào lúc đạo sanh, nó có một sát-na, một đối tượng.
Kiccato pana ‘‘dukkhe ñāṇa’’ntiādīni cattāri nāmāni labhati.
As for its function, it obtains four names such as ‘knowledge of suffering’.
Về phương diện phận sự, nó có bốn tên gọi là “trí về khổ” v.v...
Sammāsaṅkappādayopi pubbabhāge nānākkhaṇā nānārammaṇā honti, maggakāle ekakkhaṇā ekārammaṇā.
Right Intention and the others, in their preliminary stage, also have various moments and various objects, but at the moment of the Path, they have one moment and one object.
Sammāsaṅkappa v.v... trong giai đoạn đầu cũng có nhiều sát-na khác nhau, nhiều đối tượng khác nhau; vào lúc đạo sanh, chúng có một sát-na, một đối tượng.
Tesu sammāsaṅkappo kiccato nekkhammasaṅkappotiādīni tīṇi nāmāni labhati.
Among these, Right Intention, as for its function, obtains three names such as ‘intention of renunciation’.
Trong số đó, sammāsaṅkappa, về phương diện phận sự, có ba tên gọi là nekkhammasaṅkappa v.v...
Sammāvācādayo tayo pubbabhāge viratiyopi honti cetanāyopi, maggakkhaṇe pana viratiyoyeva.
Right Speech and the other two, in their preliminary stage, are also abstinences and volitions, but at the moment of the Path, they are only abstinences.
Ba chi phần sammāvācā v.v... trong giai đoạn đầu vừa là sự kiêng cữ vừa là tác ý, nhưng vào sát-na đạo sanh, chúng chỉ là sự kiêng cữ.
Sammāvāyāmo sammāsatīti idampi dvayaṃ kiccato sammappadhānasatipaṭṭhānavasena cattāri nāmāni labhati.
This pair, Right Effort and Right Mindfulness, as for their function, obtains four names by way of Right Endeavours and Foundations of Mindfulness.
Cặp đôi này, sammāvāyāmo và sammāsati, về phương diện phận sự, có bốn tên gọi theo cách của sammappadhāna và satipaṭṭhāna.
Sammāsamādhi pana pubbabhāgepi maggakkhaṇepi sammāsamādhiyeva.
Right Concentration, however, is Right Concentration itself both in the preliminary stage and at the moment of the Path.
Còn sammāsamādhi thì trong giai đoạn đầu cũng như vào sát-na đạo sanh, vẫn chỉ là sammāsamādhi.
Iti imesu aṭṭhasu dhammesu bhagavatā nibbānādhigamāya paṭipannassa yogino bahūpakārattā paṭhamaṃ sammādiṭṭhi desitā.
Thus, among these eight factors, Right View is taught first because it is very beneficial to the meditator who is practising for the attainment of Nibbāna by the Blessed One.
Như vậy, trong tám pháp này, Đức Thế Tôn đã thuyết giảng sammādiṭṭhi trước tiên vì nó rất hữu ích cho hành giả đang thực hành để chứng ngộ Nibbāna.
Ayañhi ‘‘paññāpajjoto paññāsattha’’nti (dha. sa. 16, 20, 29) ca vuttā.
Indeed, it is also called ‘the lamp of wisdom’ and ‘the weapon of wisdom’.
Thật vậy, nó được gọi là “paññāpajjoto, ánh sáng trí tuệ” và “paññāsattha, vũ khí trí tuệ”.
Tasmā etāya pubbabhāge vipassanāñāṇasaṅkhātāya sammādiṭṭhiyā avijjandhakāraṃ vidhamitvā kilesacore ghātento khemena yogāvacaro nibbānaṃ pāpuṇāti.
Therefore, by dispelling the darkness of ignorance with this Right View, which is called insight-knowledge in the preliminary stage, and by destroying the defilement-thieves, the meditator attains Nibbāna safely.
Do đó, hành giả, sau khi xua tan bóng tối vô minh và diệt trừ bọn giặc phiền não bằng sammādiṭṭhi này, được gọi là trí tuệ vipassanā trong giai đoạn đầu, sẽ đạt đến Nibbāna một cách an ổn.
Tasmā paṭhamaṃ sammādiṭṭhi desitā.
Therefore, Right View is taught first.
Vì vậy, sammādiṭṭhi được thuyết giảng trước tiên.
Sammāsaṅkappo pana tassā bahūpakāro.
Right Intention, however, is very beneficial to it.
Còn sammāsaṅkappa thì rất hữu ích cho sammādiṭṭhi ấy.
Tasmā tadanantaraṃ vutto.
Therefore, it is mentioned immediately after.
Do đó, nó được nói đến ngay sau đó.
Yathā hi heraññiko hatthena parivattetvā parivattetvā cakkhunā kahāpaṇaṃ olokento ‘‘ayaṃ kūṭo ayaṃ cheko’’ti jānāti, evaṃ yogāvacaropi pubbabhāge vitakkena vitakketvā vitakketvā vipassanāpaññāya olokayamāno ‘‘ime dhammā kāmāvacarā, ime rūpāvacarādayo’’ti jānāti.
Just as a money-changer, by turning a coin over and over with his hand and examining it with his eye, knows, ‘This is counterfeit, this is genuine,’ so too a meditator, in the preliminary stage, by repeatedly reflecting with thought and examining with insight-wisdom, knows, ‘These phenomena are of the sense-sphere, these are of the form-sphere,’ and so on.
Ví như người đổi tiền, sau khi lật qua lật lại đồng kahāpaṇa bằng tay và nhìn bằng mắt, biết được “đồng này giả, đồng này thật”; cũng vậy, hành giả trong giai đoạn đầu, sau khi tầm cầu liên tục bằng vitakka và nhìn bằng trí tuệ vipassanā, biết được “các pháp này thuộc cõi dục, các pháp này thuộc cõi sắc v.v...”
Yathā vā pana purisena koṭiyaṃ gahetvā parivattetvā parivattetvā dinnaṃ mahārukkhaṃ tacchako vāsiyā tacchetvā kamme upaneti, evaṃ vitakkena vitakketvā vitakketvā dinnadhamme yogāvacaro paññāya ‘‘ime dhammā kāmāvacarā, ime rūpāvacarā’’tiādinā nayena paricchinditvā kamme upaneti.
Or, just as a carpenter, having been given a large log by a man who has held it by the end and turned it over and over, cuts it with an axe and applies it to his work, so too a meditator, having been given phenomena by repeatedly reflecting with thought, discerns them with wisdom, saying, ‘These phenomena are of the sense-sphere, these are of the form-sphere,’ and so on, and applies them to the work of insight.
Hoặc ví như người thợ mộc, sau khi đẽo bằng rìu khúc gỗ lớn đã được một người khác cầm ở đầu lật qua lật lại, rồi đem dùng vào việc; cũng vậy, hành giả, sau khi phân định các pháp đã được tầm cầu liên tục bằng vitakka theo cách “các pháp này thuộc cõi dục, các pháp này thuộc cõi sắc” v.v... bằng trí tuệ, rồi đem dùng vào việc (tu tập).
Tasmā sammāsaṅkappo sammādiṭṭhānantaraṃ vutto.
Therefore, Right Intention is mentioned immediately after Right View.
Do đó, sammāsaṅkappa được nói đến ngay sau sammādiṭṭhi.
Sammādiṭṭhiniddese ‘‘dukkhe ñāṇa’’ntiādinā catusaccakammaṭṭhānaṃ dassitaṃ.
In the exposition of Sammādiṭṭhi (Right View), the meditation on the Four Noble Truths is shown by the phrase 'knowledge of suffering' and so on.
Trong phần giải về sammādiṭṭhi, đề mục thiền về Tứ Thánh Đế đã được chỉ ra bằng câu “trí về khổ” v.v...
Tattha purimāni dve saccāni vaṭṭaṃ, pacchimāni dve vivaṭṭaṃ.
Among those four Noble Truths, the first two are Saṃsāra (the round of existence), and the latter two are the cessation of Saṃsāra.
Trong đó, hai đế đầu là luân hồi, hai đế sau là thoát ly luân hồi.
Tesu bhikkhuno vaṭṭe kammaṭṭhānābhiniveso hoti, vivaṭṭe natthi abhiniveso.
Among these, a bhikkhu's (monk's) absorption in the meditation object is with the two truths of Saṃsāra; there is no absorption in the two truths of the cessation of Saṃsāra.
Trong số đó, vị tỳ khưu có sự chú tâm vào đề mục thiền về luân hồi, còn về thoát ly luân hồi thì không có sự chú tâm.
Purimāni hi dve saccāni ‘‘pañcakkhandhā dukkhaṃ, taṇhā samudayo’’ti evaṃ saṅkhepena ca, ‘‘katame pañcakkhandhā?
For the first two truths, the practitioner performs the meditation by learning them from a teacher, both concisely, saying, "The five aggregates are suffering; craving is the origin," and extensively, saying, "What are the five aggregates? The form aggregate," and so on, repeatedly reciting them.
Thật vậy, đối với hai đế đầu, hành giả thực hành công việc (thiền) bằng cách học hỏi từ vị thầy cả một cách tóm tắt, như “năm uẩn là khổ, ái là tập khởi”,
Rūpakkhandho’’tiādinā nayena vitthārena ca ācariyasantike uggaṇhitvā vācāya punappunaṃ parivattento yogāvacaro kammaṃ karoti.
For the first two truths, the practitioner performs the meditation by learning them from a teacher, both concisely, saying, "The five aggregates are suffering; craving is the origin," and extensively, saying, "What are the five aggregates? The form aggregate," and so on, repeatedly reciting them.
và một cách chi tiết theo phương pháp “năm uẩn là gì? Sắc uẩn” v.v..., rồi lặp đi lặp lại bằng lời nói.
Itaresu pana dvīsu saccesu ‘‘nirodhasaccaṃ iṭṭhaṃ kantaṃ manāpaṃ, maggasaccaṃ iṭṭhaṃ kantaṃ manāpa’’nti evaṃ savaneneva kammaṃ karoti.
But regarding the other two truths, he performs the task by merely hearing, "The truth of cessation is desirable, pleasing, agreeable; the truth of the path is desirable, pleasing, agreeable."
Còn đối với hai đế còn lại, vị ấy thực hành công việc chỉ bằng cách nghe rằng “diệt đế là đáng mong muốn, đáng ưa thích, đáng hài lòng; đạo đế là đáng mong muốn, đáng ưa thích, đáng hài lòng”.
So evaṃ kammaṃ karonto cattāri saccāni ekapaṭivedhena paṭivijjhati, ekābhisamayena abhisameti.
Performing the task in this way, he penetrates the four truths with a single penetration, he fully comprehends them with a single full comprehension.
Khi thực hành công việc như vậy, vị ấy thâm nhập bốn đế bằng một sự thâm nhập duy nhất, liễu ngộ bằng một sự liễu ngộ duy nhất.
Dukkhaṃ pariññāpaṭivedhena paṭivijjhati, samudayaṃ pahānapaṭivedhena paṭivijjhati.
He penetrates suffering with the penetration of full understanding, he penetrates the origin with the penetration of abandonment.
Vị ấy thâm nhập khổ bằng sự thâm nhập của liễu tri, thâm nhập tập khởi bằng sự thâm nhập của đoạn tận.
Nirodhaṃ sacchikiriyāpaṭivedhena paṭivijjhati, maggaṃ bhāvanāpaṭivedhena paṭivijjhati.
He penetrates cessation with the penetration of realization, he penetrates the path with the penetration of development.
Vị ấy thâm nhập sự diệt bằng sự thâm nhập của chứng ngộ, thâm nhập đạo bằng sự thâm nhập của tu tập.
Dukkhaṃ pariññābhisamayena…pe… maggaṃ bhāvanābhisamayena abhisameti.
He fully comprehends suffering with the full comprehension of full understanding... and so on... he fully comprehends the path with the full comprehension of development.
Vị ấy liễu ngộ khổ bằng sự liễu ngộ của liễu tri... cho đến... liễu ngộ đạo bằng sự liễu ngộ của tu tập.
Evamassa pubbabhāge dvīsu saccesu uggahaparipucchāsavanadhāraṇasammasanapaṭivedho hoti, dvīsu savanapaṭivedhoyeva.
Thus, in his preliminary stage, there is penetration of learning, questioning, hearing, retaining, and contemplating regarding the two truths (of suffering and origin); regarding the other two (cessation and path), there is only penetration of hearing.
Như vậy, đối với vị ấy, trong giai đoạn đầu, đối với hai đế có sự thâm nhập qua học hỏi, hỏi han, nghe, ghi nhớ, và quán xét; đối với hai đế kia, chỉ có sự thâm nhập qua nghe.
Aparabhāge tīsu kiccato paṭivedho hoti nirodhe ārammaṇapaṭivedho.
In the later stage, there is penetration by function regarding three (suffering, origin, path), and penetration by object regarding cessation.
Trong giai đoạn sau, đối với ba đế có sự thâm nhập qua phận sự; đối với diệt đế có sự thâm nhập qua đối tượng.
Tattha sabbampi paṭivedhañāṇaṃ lokuttaraṃ, savanadhāraṇasammasanañāṇaṃ lokiyaṃ kāmāvacaraṃ.
Therein, all knowledge of penetration is supramundane (lokuttara), while the knowledge of hearing, retaining, and contemplating is mundane (lokiya) and pertains to the sense-sphere (kāmāvacara).
Trong đó, tất cả trí tuệ thâm nhập đều là siêu thế; trí tuệ nghe, ghi nhớ, quán xét là thế gian, thuộc cõi dục.
Paccavekkhaṇā pana pattasaccassa hoti, ayañca ādikammiko.
However, reviewing knowledge (paccavekkhaṇā-ñāṇa) belongs to one who has attained the truths, and this practitioner is a beginner.
Còn sự quán xét lại thì xảy ra đối với người đã chứng đạt thánh đế, và vị này là người sơ cơ.
Tasmā sā idha na vuttā.
Therefore, it is not mentioned here.
Do đó, nó không được nói đến ở đây.
Imassa ca bhikkhuno pubbe pariggahato ‘‘dukkhaṃ parijānāmi, samudayaṃ pajahāmi, nirodhaṃ sacchikaromi, maggaṃ bhāvemī’’ti ābhogasamannāhāramanasikārapaccavekkhaṇā natthi, pariggahato paṭṭhāya hoti.
And for this bhikkhu, prior to comprehension, there is no advertence, attention, mental application, or reviewing, thinking, "I fully understand suffering, I abandon the origin, I realize cessation, I develop the path"; it arises only from the moment of comprehension onwards.
Và đối với vị Tỳ-khưu này, trước khi nắm giữ (các pháp Tứ Thánh Đế) bằng trí tuệ không lầm lẫn, không có sự chú tâm, sự quán xét, sự tư duy (với ý nghĩ): “Ta biết rõ khổ, ta đoạn trừ tập, ta chứng ngộ diệt, ta tu tập đạo.” Điều này chỉ có từ khi nắm giữ (các pháp Tứ Thánh Đế) trở đi.
Aparabhāge pana dukkhaṃ pariññātameva hoti…pe… maggo bhāvitova hoti.
But in the later stage, suffering is already fully understood... and so on... the path is already developed.
Nhưng sau đó, khổ đã được biết rõ…pe… đạo đã được tu tập.
Tattha dve saccāni duddasattā gambhīrāni, dve gambhīrattā duddasāni.
Among these, two truths (suffering and origin) are profound due to being difficult to see, and two (cessation and path) are difficult to see due to being profound.
Trong đó, hai sự thật (khổ và tập) thì khó thấy vì sâu xa, hai sự thật (diệt và đạo) thì khó thấy vì sâu xa.
Dukkhasaccañhi uppattito pākaṭaṃ, khāṇukaṇṭakappahārādīsu ‘‘aho dukkha’’nti vattabbatampi āpajjati.
The truth of suffering is manifest in its arising; in situations like being struck by a stump or a thorn, one might even exclaim, "Oh, suffering!"
Khổ đế thì hiển lộ qua sự phát sinh, đến nỗi khi bị gai đâm hay vấp phải gốc cây, người ta phải thốt lên: “Ôi, khổ quá!”
Samudayasaccaṃ khāditukāmatābhuñjitukāmatādivasena uppattito pākaṭaṃ.
The truth of origin is manifest in its arising, in terms of desires to eat, to consume, and so on.
Tập đế thì hiển lộ qua sự phát sinh dưới dạng ước muốn ăn uống, v.v.
Lakkhaṇapaṭivedhato pana ubhayampi gambhīraṃ.
However, both are profound in terms of penetrating their characteristics.
Tuy nhiên, cả hai (khổ và tập) đều sâu xa khi được thấu hiểu qua đặc tính của chúng.
Iti tāni duddasattā gambhīrāni.
Thus, these are profound due to being difficult to see.
Do đó, chúng sâu xa vì khó thấy.
Itaresaṃ pana dvinnaṃ dassanatthāya payogo bhavaggaggahaṇatthaṃ hatthapasāraṇaṃ viya, avīciphusanatthaṃ pādapasāraṇaṃ viya, satadhā bhinnassa vālassa koṭiyā koṭipaṭipādanaṃ viya ca hoti.
But the effort to see the other two is like stretching out a hand to grasp the highest existence, or stretching out a foot to touch Avīci hell, or trying to touch the tip of a hair that has been split a hundred times.
Còn đối với hai sự thật kia (diệt và đạo), sự nỗ lực để thấy chúng giống như việc vươn tay để nắm lấy đỉnh của cõi hữu, hay duỗi chân để chạm đến cõi Vô gián, hoặc như việc đặt đầu mút của một sợi lông bị chẻ thành trăm mảnh vào đúng đầu mút kia.
Iti tāni gambhīrattā duddasāni.
Thus, these are difficult to see due to being profound.
Do đó, chúng khó thấy vì sâu xa.
Evaṃ duddasattā gambhīresu gambhīrattā ca duddasesu catūsu saccesu uggahādivasena pubbabhāgañāṇuppattiṃ sandhāya idaṃ ‘‘dukkhe ñāṇa’’ntiādi vuttaṃ.
Therefore, referring to the arising of preliminary knowledge through learning and so on, regarding these four truths—which are profound due to being difficult to see, and difficult to see due to being profound—this statement "knowledge of suffering" and so on, was made.
Như vậy, khi nói “trí tuệ về khổ,” v.v., là để chỉ sự phát sinh của các tuệ thuộc giai đoạn sơ khởi, như sự thâu tóm, v.v., trong bốn sự thật vừa khó thấy vì sâu xa, vừa sâu xa vì khó thấy.
Paṭivedhakkhaṇe pana ekameva taṃ ñāṇaṃ hoti.
However, at the moment of penetration, that knowledge is just one.
Nhưng vào khoảnh khắc thấu hiểu, trí tuệ ấy chỉ là một.
Apare panāhu – catubbidhaṃ saccesu ñāṇaṃ sutamayañāṇaṃ vavatthānañāṇaṃ sammasanañāṇaṃ abhisamayañāṇanti.
Others say that knowledge of the truths is fourfold: knowledge from hearing, knowledge of discernment, knowledge of contemplation, and knowledge of full comprehension.
Tuy nhiên, những người khác lại nói rằng có bốn loại trí tuệ về các sự thật: trí tuệ do nghe (sutamayañāṇa), trí tuệ phân biệt (vavatthānañāṇa), trí tuệ quán xét (sammasanañāṇa), và trí tuệ chứng ngộ (abhisamayañāṇa).
Tattha katamaṃ sutamayañāṇaṃ?
Among these, what is knowledge from hearing?
Vậy, trí tuệ do nghe là gì?
Saṃkhittena vā vitthārena vā cattāri saccāni sutvā jānāti ‘‘idaṃ dukkhaṃ, ayaṃ samudayo, ayaṃ nirodho, ayaṃ maggo’’ti.
Having heard the four truths concisely or extensively, one knows, "This is suffering, this is the origin, this is cessation, this is the path."
Là khi nghe về Tứ Thánh Đế một cách tóm tắt hay chi tiết, người ấy biết: “Đây là khổ, đây là tập, đây là diệt, đây là đạo.”
Idaṃ sutamayañāṇaṃ.
This is knowledge from hearing.
Đây là trí tuệ do nghe.
Katamaṃ vavatthānañāṇaṃ?
What is knowledge of discernment?
Trí tuệ phân biệt là gì?
So sutānaṃ atthaṃ upaparikkhati dhammato ca lakkhaṇato ca, ‘‘ime dhammā imasmiṃ sacce pariyāpannā, imassa saccassa idaṃ lakkhaṇa’’nti sanniṭṭhānaṃ karoti.
That person who has heard examines the meaning in terms of the nature and characteristics of the Dhamma, and determines, "These phenomena are included in this truth; this is the characteristic of this truth."
Người ấy quán xét ý nghĩa của những gì đã nghe, cả về bản chất lẫn đặc tính, và quyết định: “Những pháp này thuộc về sự thật này, đặc tính của sự thật này là như thế này.”
Idaṃ vavatthānañāṇaṃ.
This is knowledge of discernment.
Đây là trí tuệ phân biệt.
Katamaṃ sammasanañāṇaṃ?
What is knowledge of contemplation?
Trí tuệ quán xét là gì?
So evaṃ yathānupubbaṃ cattāri saccāni vavatthapetvā atha dukkhameva gahetvā yāva gotrabhuñāṇaṃ aniccato dukkhato anattato sammasati.
Having thus distinguished the four truths in due order, he then takes only suffering and comprehends it as impermanent, as suffering, and as non-self, up to the gotrabhuñāṇa.
Sau khi phân biệt Tứ Thánh Đế theo thứ tự như vậy, người ấy chỉ lấy khổ đế làm đối tượng và quán xét nó là vô thường, khổ, vô ngã cho đến trí chuyển tộc (gotrabhuñāṇa).
Idaṃ sammasanañāṇaṃ.
This is sammasanañāṇa.
Đây là trí tuệ quán xét.
Katamaṃ abhisamayañāṇaṃ?
What is abhisamayañāṇa?
Trí tuệ chứng ngộ là gì?
Lokuttaramaggakkhaṇe ekena ñāṇena cattāri saccāni apubbaṃ acarimaṃ abhisameti ‘‘dukkhaṃ pariññābhisamayena, samudayaṃ pahānābhisamayena, nirodhaṃ sacchikiriyābhisamayena maggaṃ bhāvanābhisamayena abhisametī’’ti.
At the moment of the supramundane path, with a single knowledge, one penetrates the four truths simultaneously, without prior or subsequent sequence, thus: ‘Suffering is penetrated by comprehension, the origin by abandonment, cessation by realization, and the path by development.’
Vào khoảnh khắc của đạo siêu thế, với một trí tuệ duy nhất, người ấy chứng ngộ Tứ Thánh Đế một cách đồng thời, không trước không sau: “Chứng ngộ khổ bằng cách biết rõ, chứng ngộ tập bằng cách đoạn trừ, chứng ngộ diệt bằng cách chứng đạt, chứng ngộ đạo bằng cách tu tập.”
Idaṃ abhisamayañāṇanti.
This is abhisamayañāṇa.
Đây là trí tuệ chứng ngộ.
Sammāsaṅkappaniddese kāmato nissaṭoti nekkhammasaṅkappo.
In the explanation of Right Intention, that which is free from sensuality is nekkhamma-saṅkappa.
Trong phần giải thích về Chánh Tư Duy (sammāsaṅkappa), tư duy thoát ly khỏi dục là tư duy xuất ly (nekkhammasaṅkappo).
Byāpādato nissaṭoti abyāpādasaṅkappo.
That which is free from ill-will is abyāpāda-saṅkappa.
Tư duy thoát ly khỏi ác ý là tư duy không ác ý (abyāpādasaṅkappo).
Vihiṃsāya nissaṭoti avihiṃsāsaṅkappo.
That which is free from harmfulness is avihiṃsā-saṅkappa.
Tư duy thoát ly khỏi hại mình hại người là tư duy không hại mình hại người (avihiṃsāsaṅkappo).
Tattha nekkhammavitakko kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati, abyāpādavitakko byāpādavitakkassa, avihiṃsāvitakko vihiṃsāvitakkassa.
Here, the thought of renunciation arises by striking down and cutting off the thought of sensuality; the thought of non-ill-will arises by striking down and cutting off the thought of ill-will; the thought of non-harmfulness arises by striking down and cutting off the thought of harmfulness.
Trong đó, tầm xuất ly (nekkhammavitakko) phát sinh bằng cách diệt trừ và cắt đứt gốc rễ của tầm dục (kāmavitakko); tầm không ác ý (abyāpādavitakko) diệt trừ và cắt đứt gốc rễ của tầm ác ý (byāpādavitakko); tầm không hại mình hại người (avihiṃsāvitakko) diệt trừ và cắt đứt gốc rễ của tầm hại mình hại người (vihiṃsāvitakko).
Tathā nekkhammaabyāpādaavihiṃsāvitakkā kāmabyāpādavihiṃsāvitakkānaṃ paccanīkā hutvā uppajjanti.
Similarly, the thoughts of renunciation, non-ill-will, and non-harmfulness arise as antagonists to the thoughts of sensuality, ill-will, and harmfulness.
Tương tự, các tầm xuất ly, không ác ý, không hại mình hại người phát sinh như những đối nghịch của các tầm dục, ác ý, hại mình hại người.
Tattha yogāvacaro kāmavitakkassa padaghātanatthaṃ kāmavitakkaṃ vā sammasati aññaṃ vā pana kiñci saṅkhāraṃ.
Here, the meditator, in order to strike down the thought of sensuality, contemplates either the thought of sensuality itself or some other formation.
Trong đó, hành giả (yogāvacaro) quán xét tầm dục (kāmavitakko) hoặc bất kỳ hành (saṅkhāra) nào khác để diệt trừ gốc rễ của tầm dục.
Athassa vipassanākkhaṇe vipassanāsampayutto saṅkappo tadaṅgavasena kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati, vipassanaṃ ussukkāpetvā maggaṃ pāpeti.
Then, at the moment of insight, the intention associated with insight arises, striking down and cutting off the thought of sensuality by way of temporary suppression, stimulating insight and leading to the path.
Sau đó, vào khoảnh khắc của tuệ quán (vipassanā), tư duy (saṅkappo) tương ưng với tuệ quán phát sinh, diệt trừ và cắt đứt gốc rễ của tầm dục theo cách đoạn phần (tadaṅgavasena), thúc đẩy tuệ quán để đạt đến đạo.
Athassa maggakkhaṇe maggasampayutto saṅkappo samucchedavasena kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati.
Then, at the moment of the path, the intention associated with the path arises, striking down and cutting off the thought of sensuality by way of eradication.
Sau đó, vào khoảnh khắc của đạo, tư duy tương ưng với đạo phát sinh, diệt trừ và cắt đứt gốc rễ của tầm dục theo cách đoạn diệt (samucchedavasena).
Byāpādavitakkassapi padaghātanatthaṃ byāpādavitakkaṃ vā aññaṃ vā saṅkhāraṃ, vihiṃsāvitakkassa padaghātanatthaṃ vihiṃsāvitakkaṃ vā aññaṃ vā saṅkhāraṃ sammasati.
Similarly, in order to strike down the thought of ill-will, he contemplates either the thought of ill-will or some other formation; and in order to strike down the thought of harmfulness, he contemplates either the thought of harmfulness or some other formation.
Tương tự, để diệt trừ gốc rễ của tầm ác ý (byāpādavitakko), người ấy quán xét tầm ác ý hoặc một hành khác; để diệt trừ gốc rễ của tầm hại mình hại người (vihiṃsāvitakko), người ấy quán xét tầm hại mình hại người hoặc một hành khác.
Athassa vipassanākkhaṇeti sabbaṃ purimanayeneva yojetabbaṃ.
Then, at the moment of insight, and so on, everything should be connected in the same way as before.
Sau đó, vào khoảnh khắc của tuệ quán, tất cả đều phải được kết nối theo cách tương tự như đã nói ở trên.
Kāmavitakkādīnaṃ pana tiṇṇampi pāḷiyaṃ vibhattesu aṭṭhatiṃsārammaṇesu ekakammaṭṭhānampi apaccanīkaṃ nāma natthi.
However, among the thirty-eight objects enumerated in the Pāḷi for these three—sensual thoughts and so on—there is not a single meditation subject that is not an antagonist.
Tuy nhiên, trong số ba loại tầm (kāmavitakka, v.v.) được phân loại trong kinh tạng, không có một đối tượng thiền định nào trong số ba mươi tám đối tượng thiền định (trừ không gian và ánh sáng) mà không phải là đối nghịch.
Ekantato pana kāmavitakkassa tāva asubhesu paṭhamajjhānameva paccanīkaṃ, byāpādavitakkassa mettāya tikacatukkajjhānāni, vihiṃsaāvitakkassa karuṇāya tikacatukkajjhānāni.
But specifically, the first jhāna, which occurs with the asubha meditation subjects, is the antagonist to sensual thought; the three or four jhānas of mettā are antagonists to ill-will; and the three or four jhānas of karuṇā are antagonists to harmfulness.
Nhưng một cách tuyệt đối, đối với tầm dục (kāmavitakko), sơ thiền (paṭhamajjhāna) phát sinh trong các quán bất tịnh (asubha) là đối nghịch; đối với tầm ác ý (byāpādavitakko), tam thiền (tikajjhāna) và tứ thiền (catukkajjhāna) phát sinh trong tâm từ (mettā) là đối nghịch; đối với tầm hại mình hại người (vihiṃsāvitakko), tam thiền và tứ thiền phát sinh trong tâm bi (karuṇā) là đối nghịch.
Tasmā asubhaparikammaṃ katvā jhānaṃ samāpannassa samāpattikkhaṇe jhānasampayutto vitakko vikkhambhanavasena kāmavitakkassa paccanīko hutvā uppajjati, jhānaṃ pādakaṃ katvā vipassanaṃ paṭṭhapentassa vipassanākkhaṇe vipassanāsampayutto saṅkappo tadaṅgavasena kāmavitakkassa paccanīko hutvā uppajjati, vipassanaṃ ussukkāpetvā maggaṃ pāpentassa maggakkhaṇe maggasampayutto saṅkappo samucchedavasena kāmavitakkassa paccanīko hutvā uppajjati.
Therefore, for one who has performed the preliminary work of asubha and attained jhāna, at the moment of attainment, the vitakka associated with jhāna arises as an antagonist to sensual thought by way of suppression; for one who makes jhāna the foundation and establishes insight, at the moment of insight, the saṅkappa associated with insight arises as an antagonist to sensual thought by way of temporary suppression; for one who stimulates insight and leads to the path, at the moment of the path, the saṅkappa associated with the path arises as an antagonist to sensual thought by way of eradication.
Do đó, đối với người đã thực hành quán bất tịnh và nhập thiền, vào khoảnh khắc nhập thiền, tầm (vitakko) tương ưng với thiền phát sinh, trở thành đối nghịch của tầm dục bằng cách trấn áp (vikkhambhanavasena); đối với người đã lấy thiền làm nền tảng và bắt đầu tuệ quán (vipassanā), vào khoảnh khắc của tuệ quán, tư duy (saṅkappo) tương ưng với tuệ quán phát sinh, trở thành đối nghịch của tầm dục bằng cách đoạn phần (tadaṅgavasena); đối với người đã thúc đẩy tuệ quán và đạt đến đạo, vào khoảnh khắc của đạo, tư duy tương ưng với đạo phát sinh, trở thành đối nghịch của tầm dục bằng cách đoạn diệt (samucchedavasena).
Evaṃ uppanno nekkhammasaṅkappoti vuccatīti veditabbo.
It should be understood that an intention arising in this way is called nekkhamma-saṅkappa.
Nên biết rằng tư duy xuất ly (nekkhammasaṅkappo) phát sinh như vậy.
Mettāya pana parikammaṃ katvā, karuṇāya parikammaṃ katvā jhānaṃ samāpannassāti sabbaṃ purimanayeneva yojetabbaṃ.
Similarly, for one who has performed the preliminary work of mettā, or performed the preliminary work of karuṇā, and attained jhāna, everything should be connected in the same way as before.
Tuy nhiên, đối với người đã thực hành tâm từ và nhập thiền, đã thực hành tâm bi và nhập thiền, tất cả đều phải được kết nối theo cách tương tự như đã nói ở trên.
Evaṃ uppanno abyāpādasaṅkappoti vuccati, avihiṃsāsaṅkappoti vuccatīti veditabbo.
It should be understood that an intention arising in this way is called abyāpāda-saṅkappa, and avihiṃsā-saṅkappa.
Nên biết rằng tư duy không ác ý (abyāpādasaṅkappo) và tư duy không hại mình hại người (avihiṃsāsaṅkappo) phát sinh như vậy.
Evamete nekkhammasaṅkappādayo vipassanājhānavasena uppattīnaṃ nānattā pubbabhāge nānā, maggakkhaṇe pana imesu tīsu ṭhānesu uppannassa akusalasaṅkappassa padacchedato anuppattisādhanavasena maggaṅgaṃ pūrayamāno ekova kusalasaṅkappo uppajjati.
Thus, these nekkhamma-saṅkappa and so on are distinct in the preliminary stage due to the diversity of their arising by way of insight and jhāna; but at the moment of the path, only one wholesome intention arises, fulfilling the path factor by eradicating and preventing the recurrence of unwholesome intentions that arose in these three instances.
Như vậy, các tư duy xuất ly, v.v., là khác nhau trong giai đoạn sơ khởi do sự khác biệt trong sự phát sinh của chúng tùy theo thiền tuệ. Nhưng vào khoảnh khắc của đạo, chỉ có một tư duy thiện (kusalasaṅkappo) duy nhất phát sinh, hoàn thiện chi đạo bằng cách cắt đứt gốc rễ của các tư duy bất thiện (akusalasaṅkappo) phát sinh trong ba trường hợp này (dục, ác ý, hại mình hại người) để chúng không còn tái sinh nữa.
Ayaṃ sammāsaṅkappo nāma.
This is called Right Intention (sammāsaṅkappa).
Đây được gọi là Chánh Tư Duy (sammāsaṅkappo).
Sammāājīvaniddese idhāti imasmiṃ sāsane.
In the explanation of Right Livelihood: Here means in this Dispensation.
Trong phần giải thích về Chánh Mạng (sammāājīva), “ở đây” (idha) có nghĩa là trong giáo pháp này.
Ariyasāvakoti ariyassa buddhassa sāvako.
An Ariyan disciple means a disciple of the Ariyan Buddha.
“Thánh đệ tử” (ariyasāvako) là đệ tử của Đức Phật, bậc Thánh.
Micchāājīvaṃ pahāyāti pāpakaṃ ājīvaṃ pajahitvā.
Having abandoned wrong livelihood means having given up evil livelihood.
“Từ bỏ tà mạng” (micchāājīvaṃ pahāyā) có nghĩa là từ bỏ cách sống sai trái.
Sammāājīvenāti buddhappasatthena kusalaājīvena.
By right livelihood means by blameless livelihood praised by the Buddha.
Với chánh mạng là với thiện mạng được đức Phật tán thán.
Jīvikaṃ kappetīti jīvitappavattiṃ pavatteti.
Maintains his life means sustains his life.
Nuôi mạng là làm cho sự sống tiếp diễn.
Idhāpi yasmā aññeneva cittena kāyadvāravītikkamā viramati, aññeneva vacīdvāravītikkamā, tasmā pubbabhāge nānākkhaṇesu uppajjati, maggakkhaṇe pana dvīsu dvāresu sattannaṃ kammapathānaṃ vasena uppannāya micchāājīvadussīlyacetanāya padacchedato anuppattisādhanavasena maggaṅgaṃ pūrayamānā ekāva sammāājīvasaṅkhātā kusalaveramaṇi uppajjati.
Here too, because one abstains from transgressions of the bodily door with one mind, and from transgressions of the verbal door with another, therefore, in the preliminary stage, they arise at different moments. But at the moment of the Path, only one wholesome abstinence, called Right Livelihood, arises, fulfilling the Path factor by cutting off the root of the immoral volition of wrong livelihood, which arises in terms of the seven courses of action through the two doors, and thereby preventing its arising.
Ở đây cũng vậy, vì người ấy từ bỏ sự vi phạm qua thân môn bằng một tâm khác, từ bỏ sự vi phạm qua khẩu môn bằng một tâm khác, cho nên trong giai đoạn đầu, chúng sanh khởi ở những sát-na khác nhau; nhưng trong sát-na đạo, chỉ có một thiện chế ngự duy nhất, được gọi là chánh mạng, sanh khởi, làm viên mãn đạo chi theo cách thành tựu sự không sanh khởi bằng việc đoạn trừ tận gốc tác ý tà mạng bất thiện giới đã sanh khởi trong hai môn theo bảy nghiệp lộ.
Ayaṃ sammāājīvo nāma.
This is called Right Livelihood.
Đây được gọi là chánh mạng.
Sammāvāyāmaniddese idha bhikkhūti imasmiṃ sāsane paṭipannako bhikkhu.
In the explanation of Right Effort: Here a bhikkhu means a bhikkhu who practices in this Dispensation.
Trong phần giải về chánh tinh tấn, này các Tỷ-kheo, ở đây là vị Tỷ-kheo đang thực hành trong giáo pháp này.
Anuppannānanti anibbattānaṃ.
Of unarisen means of those not yet produced.
Chưa sanh là chưa khởi lên.
Pāpakānanti lāmakānaṃ.
Of evil means of wretched (things).
Ác là xấu xa.
Akusalānaṃ dhammānanti akosallasambhūtānaṃ dhammānaṃ.
Of unwholesome states means of states born of unskillfulness.
Bất thiện pháp là các pháp sanh từ sự không khéo léo.
Anuppādāyāti na uppādanatthāya.
For their non-arising means for not causing them to arise.
Để không sanh khởi là với mục đích không làm cho sanh khởi.
Chandaṃ janetīti kattukamyatāsaṅkhātaṃ kusalacchandaṃ janeti uppādeti.
He generates desire means he generates wholesome desire, which is called the wish to act, he produces it.
Sanh khởi ý muốn là sanh khởi, làm phát sanh thiện dục được gọi là lòng mong muốn làm.
Vāyamatīti payogaṃ janeti parakkamaṃ karoti.
He endeavors means he generates exertion, he makes supreme effort.
Tinh tấn là sanh khởi sự nỗ lực, thực hiện sự cố gắng.
Vīriyaṃ ārabhatīti kāyikaṃ cetasikaṃ vīriyaṃ karoti.
He arouses energy means he exerts physical and mental energy.
Nỗ lực tinh tấn là thực hiện tinh tấn thuộc thân và thuộc tâm.
Cittaṃ paggaṇhātīti teneva sahajātavīriyena cittaṃ ukkhipati.
He exerts his mind means he uplifts his mind with that co-arisen energy.
Nâng đỡ tâm là nâng tâm lên bằng chính tinh tấn đồng sanh đó.
Padahatīti padhānavīriyaṃ karoti.
He strives means he makes strenuous effort.
Cố gắng là thực hiện tinh tấn nỗ lực.
Paṭipāṭiyā panetāni cattāripi padāni āsevanābhāvanābahulīkammasātaccakiriyāhi yojetabbāni.
These four terms should be connected in order with repeated practice, development, frequent action, and continuous action.
Tuy nhiên, bốn thuật ngữ này nên được áp dụng tuần tự với các hành động thực hành, tu tập, làm cho sung mãn, và làm một cách liên tục.
Uppannānanti anuppannānanti avattabbataṃ āpannānaṃ.
Of arisen means of those that have reached the state of not being described as unarisen.
Đã sanh là đã đến trạng thái không thể nói là "chưa sanh".
Pahānāyāti pajahanatthāya.
For their abandonment means for giving them up.
Để đoạn trừ là với mục đích đoạn trừ.
Anuppannānaṃ kusalānaṃ dhammānanti anibbattānaṃ kosallasambhūtānaṃ dhammānaṃ.
Of unarisen wholesome states means of wholesome states not yet produced, born of skillfulness.
Các thiện pháp chưa sanh là các pháp sanh từ sự khéo léo chưa khởi lên.
Uppādāyāti uppādanatthāya.
For their arising means for causing them to arise.
Để sanh khởi là với mục đích làm cho sanh khởi.
Uppannānanti nibbattānaṃ.
Of arisen means of those that have been produced.
Đã sanh là đã khởi lên.
Ṭhitiyāti ṭhitatthāya.
For their continuance means for their remaining.
Để an trú là với mục đích an trú.
Asammosāyāti anassanatthaṃ.
For their non-disappearance means for them not to perish.
Để không quên lãng là để không mất đi.
Bhiyyobhāvāyāti punappunaṃ bhāvāya.
For their increase means for their repeated existence.
Để tăng trưởng là để phát triển lặp đi lặp lại.
Vepullāyāti vipulabhāvāya.
For their growth means for their expansive existence.
Để quảng đại là để trở nên rộng lớn.
Bhāvanāyāti vaḍḍhiyā.
For their development means for their growth.
Để tu tập là để phát triển.
Pāripūriyāti paripūraṇatthāya.
For their perfection means for their complete fulfillment.
Để viên mãn là với mục đích làm cho trọn vẹn.
‘‘Cattārome, āvuso, sammappadhānā; Katame cattāro?
“There are these four right efforts, friend. Which four? Here, friend, a bhikkhu makes an effort, thinking: ‘May unarisen evil unwholesome states not arise in me, for their arising would be for my harm.’ He makes an effort, thinking: ‘May arisen evil unwholesome states be abandoned in me, for their not being abandoned would be for my harm.’ He makes an effort, thinking: ‘May unarisen wholesome states arise in me, for their not arising would be for my harm.’ He makes an effort, thinking: ‘May arisen wholesome states not cease in me, for their ceasing would be for my harm.’”
"Này chư hiền, có bốn chánh cần này. Thế nào là bốn?
Idhāvuso, bhikkhu ‘anuppannā me pāpakā akusalā dhammā uppajjamānā anatthāya saṃvatteyyu’nti ātappaṃ karoti, ‘uppannā me pāpakā akusalā dhammā appahīyamānā anatthāya saṃvatteyyu’nti ātappaṃ karoti, ‘anuppannā me kusalā dhammā anuppajjamānā anatthāya saṃvatteyyu’nti ātappaṃ karoti, ‘uppannā me kusalā dhammā nirujjhamānā anatthāya saṃvatteyyu’nti ātappaṃ karotī’’ti (saṃ. ni. 2.145);
“There are these four right efforts, friend. Which four? Here, friend, a bhikkhu makes an effort, thinking: ‘May unarisen evil unwholesome states not arise in me, for their arising would be for my harm.’ He makes an effort, thinking: ‘May arisen evil unwholesome states be abandoned in me, for their not being abandoned would be for my harm.’ He makes an effort, thinking: ‘May unarisen wholesome states arise in me, for their not arising would be for my harm.’ He makes an effort, thinking: ‘May arisen wholesome states not cease in me, for their ceasing would be for my harm.’”
Này chư hiền, ở đây, Tỷ-kheo nỗ lực với ý nghĩ 'mong rằng các ác bất thiện pháp chưa sanh nơi ta, khi sanh lên, sẽ không đưa đến bất lợi'; nỗ lực với ý nghĩ 'mong rằng các ác bất thiện pháp đã sanh nơi ta, khi chưa được đoạn trừ, sẽ không đưa đến bất lợi'; nỗ lực với ý nghĩ 'mong rằng các thiện pháp chưa sanh nơi ta, khi không sanh lên, sẽ không đưa đến bất lợi'; nỗ lực với ý nghĩ 'mong rằng các thiện pháp đã sanh nơi ta, khi diệt đi, sẽ không đưa đến bất lợi'."
Tattha ekaccassa vattaganthadhutaṅgasamādhivipassanānavakammabhavānaṃ aññataravasena kilesā na samudācaranti.
Therein, for some individual, defilements do not occur by way of one of the following: practice of duties, learning the Dhamma, observing dhutaṅga, developing samādhi, cultivating vipassanā, performing new meritorious deeds, or being born in a Brahma realm.
Trong đó, đối với một số người, các phiền não không biểu hiện do một trong các lý do sau: bổn phận, học pháp, đầu đà, định, tuệ, công việc xây dựng mới, hoặc do cảnh giới (sanh).
Kathaṃ?
How is this?
Như thế nào?
Ekacco hi vattasampanno hoti, asīti khandhakavattāni cuddasa mahāvattāni cetiyaṅgaṇabodhiyaṅgaṇapānīyamāḷakauposathāgāraāgantukagamikavattāni ca karontasseva kilesā okāsaṃ na labhanti.
Some bhikkhu is endowed with observances. For that bhikkhu, while performing the eighty Khandhaka observances, the fourteen great observances, and the observances related to the cetiya enclosure, the Bodhi tree enclosure, the water pavilion, the Uposatha hall, and for arriving and departing guests, defilements do not find an opportunity to arise.
Có người đầy đủ bổn phận; khi người ấy đang thực hành tám mươi bổn phận trong các thiên, mười bốn đại bổn phận, và các bổn phận tại sân tháp, sân bồ-đề, nhà nước uống, nhà trai giới, cho khách đến và cho người đi, các phiền não không có cơ hội phát sanh.
Aparabhāge panassa vattāni vissajjetvā bhinnavattassa carato ayonisomanasikāraṃ sativossaggañca āgamma uppajjanti.
But later, when he has abandoned the observances and is living with broken observances, defilements arise in him due to unwise attention and laxity of mindfulness.
Nhưng về sau, khi người ấy từ bỏ các bổn phận và sống với bổn phận bị phá vỡ, chúng sanh khởi do tác ý không như lý và thất niệm.
Evampi asamudācāravasena anuppannā uppajjanti nāma.
Thus, too, defilements that had not arisen previously, arise by way of non-occurrence.
Như vậy, những pháp chưa sanh theo nghĩa chưa biểu hiện được gọi là sanh khởi.
Ekacco ganthayutto hoti, ekampi nikāyaṃ gaṇhāti dvepi tayopi cattāropi pañcapi.
Some bhikkhu is engaged in studies; he learns one Nikāya, or two, or three, or four, or five.
Có người chuyên tâm học pháp, học một bộ Nikāya, hai, ba, bốn, hoặc cả năm bộ.
Tassa tepiṭakaṃ buddhavacanaṃ atthavasena pāḷivasena anusandhivasena pubbāparavasena gaṇhantassa sajjhāyantassa cintentassa vācentassa desentassa pakāsentassa kilesā okāsaṃ na labhanti.
For that bhikkhu, while learning, reciting, contemplating, teaching, expounding, or proclaiming the Tepiṭaka Buddha's word by way of meaning, by way of Pāḷi, by way of connection, and by way of prior and subsequent context, defilements do not find an opportunity.
Khi người ấy học, tụng đọc, suy tư, giảng dạy, thuyết giảng, và làm sáng tỏ lời Phật dạy trong Tam Tạng theo nghĩa, theo văn, theo sự liên kết, theo trước sau, các phiền não không có cơ hội phát sanh.
Aparabhāge panassa ganthakammaṃ pahāya kusītassa carato ayonisomanasikārasativossagge āgamma uppajjanti.
But later, when he has abandoned his studies and is living idly, defilements arise in him due to unwise attention and laxity of mindfulness.
Nhưng về sau, khi người ấy từ bỏ việc học pháp và sống lười biếng, chúng sanh khởi do tác ý không như lý và thất niệm.
Evampi asamudācāravasena anuppannā uppajjanti nāma.
Thus, too, defilements that had not arisen previously, arise by way of non-occurrence.
Như vậy, những pháp chưa sanh theo nghĩa chưa biểu hiện được gọi là sanh khởi.
Kathaṃ ananubhūtārammaṇavasena?
How do they arise by way of an unexperienced object?
Thế nào là theo nghĩa đối tượng chưa từng được kinh nghiệm?
Idhekacco ananubhūtapubbaṃ manāpikādibhedaṃ ārammaṇaṃ labhati, tassa tattha ayonisomanasikārasativossagge āgamma rāgādayo kilesā uppajjanti.
Here, some individual obtains an object, such as a pleasing one, that he has not experienced before. Then, in relation to that object, defilements such as lust arise in him due to unwise attention and laxity of mindfulness.
Ở đây, có người gặp một đối tượng thuộc loại khả ái, v.v., mà trước đây chưa từng kinh nghiệm; nơi người ấy, các phiền não như tham, v.v., sanh khởi do tác ý không như lý và thất niệm đối với đối tượng đó.
Evaṃ ananubhūtārammaṇavasena anuppannā uppajjanti nāma.
Thus, defilements that had not arisen previously, arise by way of an unexperienced object.
Như vậy, do đối tượng chưa từng được kinh nghiệm, các pháp chưa sanh được gọi là sanh khởi.
Evaṃ anuppannānaṃ akusalānaṃ uppāde sati attano anatthaṃ passitvā tesaṃ anuppādāya satipaṭṭhānabhāvanānuyogena paṭhamaṃ sammappadhānaṃ bhāveti, uppannesu pana tesu tesaṃ appahānato attano anatthaṃ passitvā tesaṃ pahānāya dutiyaṃ tatheva sammappadhānaṃ bhāveti.
Thus, when unwholesome states that had not arisen previously arise, seeing his own detriment, he cultivates the first Right Exertion with diligence in the development of mindfulness in order to prevent their arising. But when they have arisen, seeing his own detriment due to their non-abandonment, he cultivates the second Right Exertion in the same way, in order to abandon them.
Như vậy, khi các pháp bất thiện chưa sanh khởi lên, thấy được sự bất lợi cho bản thân, vị ấy tu tập chánh tinh tấn thứ nhất bằng cách nỗ lực tu tập niệm xứ để chúng không sanh khởi. Hơn nữa, khi chúng đã sanh khởi, thấy được sự bất lợi cho bản thân do không đoạn trừ chúng, vị ấy tu tập chánh tinh tấn thứ hai cũng theo cách đó để đoạn trừ chúng.
Anuppannā kusalā dhammāti samathavipassanā ceva maggo ca.
“Wholesome states that have not arisen” are samatha-vipassanā and the Path.
Các pháp thiện chưa sanh là samatha-vipassanā (chỉ-quán) và đạo.
Tesaṃ anuppāde attano anatthaṃ passitvā tesaṃ uppādanatthāya tatheva tatiyaṃ sammappadhānaṃ bhāveti.
When these have not arisen, seeing his own detriment, he cultivates the third Right Exertion in the same way in order to bring them about.
Thấy được sự bất lợi cho bản thân khi chúng chưa sanh, vị ấy tu tập chánh tinh tấn thứ ba cũng theo cách đó để làm cho chúng sanh khởi.
Uppannā kusalā dhammāti samathavipassanāva.
“Wholesome states that have arisen” are samatha-vipassanā.
Các pháp thiện đã sanh chỉ là samatha-vipassanā.
Maggo pana sakiṃ uppajjitvā nirujjhamāno anatthāya saṃvattanako nāma natthi.
However, a path that arises once and then ceases, becoming a cause for harm, does not exist.
Hơn nữa, đạo, sau khi sanh khởi một lần rồi diệt, không được gọi là thứ dẫn đến bất lợi.
So hi phalassa paccayaṃ datvāva nirujjhati.
Indeed, that path ceases only after giving its condition to the fruit.
Bởi vì nó diệt đi sau khi đã trao duyên cho quả.
Tāsaṃ samathavipassanānaṃ nirodhato attano anatthaṃ passitvā tāsaṃ ṭhitiyā tatheva catutthaṃ sammappadhānaṃ bhāveti.
Seeing the harm to oneself from the cessation of those samatha and vipassanā, one develops the fourth right exertion for their continuance.
Thấy được sự bất lợi cho bản thân do sự diệt đi của samatha-vipassanā ấy, vị ấy tu tập chánh tinh tấn thứ tư cũng theo cách đó để chúng được an trú.
Lokuttaramaggakkhaṇe pana ekameva vīriyaṃ.
However, at the moment of the supramundane path, there is only one effort.
Còn trong sát-na đạo siêu thế, chỉ có một tinh tấn duy nhất.
Ye evaṃ anuppannā uppajjeyyuṃ, te yathā neva uppajjanti, evaṃ tesaṃ anuppannānaṃ anuppādakiccaṃ, uppannānañca pahānakiccaṃ sādheti.
Thus, it accomplishes the task of non-arising for those unarisen wholesome states that would otherwise arise, so that they do not arise, and the task of abandoning those unwholesome states that have arisen.
Những pháp nào chưa sanh mà có thể sanh khởi, vị ấy hoàn thành phận sự làm cho những pháp chưa sanh ấy không sanh khởi, và phận sự đoạn trừ những pháp đã sanh, theo cách mà chúng sẽ không bao giờ sanh khởi.
Uppannāti cettha catubbidhaṃ uppannaṃ vattamānuppannaṃ bhūtāpagatuppannaṃ okāsakatuppannaṃ bhūmiladdhuppannanti.
Here, arisen (uppannā) is fourfold: presently arisen, past-ceased-arisen, opportunity-made-arisen, and foundation-obtained-arisen.
Và ở đây, đã sanh có bốn loại: đã sanh trong hiện tại, đã sanh rồi qua đi, đã sanh do có cơ hội, và đã sanh do đạt được cảnh giới.
Tattha sabbampi uppādajarābhaṅgasamaṅgisaṅkhātaṃ vattamānuppannaṃ nāma.
Among these, all phenomena endowed with arising, aging, and dissolution are called presently arisen.
Trong đó, tất cả những gì được gọi là có đủ sanh, già, diệt thì được gọi là đã sanh trong hiện tại.
Ārammaṇarasaṃ anubhavitvā niruddhaṃ anubhūtāpagatasaṅkhātaṃ kusalākusalaṃ uppādādittayamanuppatvā niruddhaṃ bhutvāpagatasaṅkhātaṃ sesasaṅkhatañca bhūtāpagatuppannaṃ nāma.
Wholesome and unwholesome kamma that has experienced the taste of an object and ceased, described as having experienced and departed; and other conditioned phenomena that have reached the three moments of arising and so forth and ceased, described as having been and departed, are called past-ceased-arisen.
Pháp thiện và bất thiện đã diệt sau khi kinh nghiệm vị của đối tượng, được gọi là đã kinh nghiệm rồi qua đi; và pháp hữu vi còn lại đã diệt sau khi trải qua ba giai đoạn sanh v.v., được gọi là đã có rồi qua đi, thì được gọi là đã sanh rồi qua đi.
‘‘Yānissa tāni pubbe katāni kammānī’’ti evamādinā (ma. ni. 3.248) nayena vuttaṃ kammaṃ atītampi samānaṃ aññaṃ vipākaṃ paṭibāhitvā attano vipākassa okāsaṃ katvā ṭhitattā tathā katokāsañca vipākaṃ anuppannampi samānaṃ evaṃ kate okāse ekantena uppajjanato okāsakatuppannaṃ nāma.
Kamma spoken of in the manner of "those deeds he formerly did," even though past, having set aside other results and made an opportunity for its own result, thus having made an opportunity, and its result, even though unarisen, definitely arising in the opportunity thus made, is called opportunity-made-arisen.
Nghiệp được nói đến qua phương pháp như "Những nghiệp nào của người ấy đã được làm từ trước" v.v., dù đã là quá khứ, nhưng do nó ngăn cản quả khác và tạo cơ hội cho quả của chính nó, và quả đã được tạo cơ hội như vậy, dù chưa sanh, nhưng chắc chắn sẽ sanh khởi khi cơ hội đã được tạo ra, nên được gọi là đã sanh do có cơ hội.
Tāsu tāsu bhūmīsu asamūhataṃ akusalaṃ bhūmiladdhuppannaṃ nāma.
Unwholesome states that have not been uprooted in those various planes of existence are called foundation-obtained-arisen (bhūmiladdhuppanna).
Pháp bất thiện chưa được nhổ bỏ trong các cảnh giới này khác thì được gọi là đã sanh do đạt được cảnh giới.
Ettha ca bhūmiyā bhūmiladdhassa ca nānattaṃ veditabbaṃ – bhūmīti hi vipassanāya ārammaṇabhūtā tebhūmakā pañcakkhandhā.
Here, the distinction between the foundation (bhūmi) and that which has obtained the foundation (bhūmiladdha) should be understood: foundation refers to the five aggregates of the three planes of existence, which are the objects of vipassanā.
Và ở đây, cần phải biết sự khác biệt giữa cảnh giới (bhūmi) và cái đạt được cảnh giới (bhūmiladdha) – cảnh giới là năm uẩn trong ba cõi, là đối tượng của vipassanā.
Bhūmiladdhaṃ nāma tesu khandhesu uppattirahaṃ kilesajātaṃ.
That which has obtained the foundation refers to the class of defilements fit to arise in those aggregates.
Cái đạt được cảnh giới là tập hợp phiền não có khả năng sanh khởi trong các uẩn ấy.
Tena hi sā bhūmiladdhā nāma hotīti tasmā bhūmiladdhanti vuccati.
Because that foundation is obtained by those defilements, it is called "bhūmiladdha."
Bởi vì cảnh giới ấy được gọi là đã được đạt đến bởi nó, cho nên nó được gọi là cái đạt được cảnh giới.
Sā ca kho na ārammaṇavasena.
And that foundation is not obtained in the sense of being an object.
Và điều đó không phải theo phương diện đối tượng.
Ārammaṇavasena hi sabbepi atītānāgate pariññātepi ca khīṇāsavānaṃ khandhe ārabbha kilesā uppajjanti.
For, in the sense of being an object, defilements arise even with respect to the aggregates of Arahants, which are past and future, and have been fully understood.
Bởi vì theo phương diện đối tượng, phiền não sanh khởi khi lấy các uẩn của bậc Vô Lậu làm đối tượng, dù tất cả chúng là quá khứ, vị lai hay đã được liễu tri.
Yadi ca taṃ bhūmiladdhaṃ nāma siyā, tassa appaheyyato na koci bhavamūlaṃ pajaheyya.
If that class of defilements were called "bhūmiladdha," then no one would abandon the root of existence, because it would be unabandonable.
Và nếu đó được gọi là cái đạt được cảnh giới, thì do không thể đoạn trừ nó, không ai có thể từ bỏ được gốc rễ của hữu.
Vatthuvasena pana bhūmiladdhaṃ veditabbaṃ.
However, "bhūmiladdha" should be understood in the sense of a basis.
Nhưng cần phải hiểu cái đạt được cảnh giới theo phương diện vật (vatthu).
Yattha yattha hi vipassanāya apariññātā khandhā uppajjanti, tattha tattha uppādato pabhuti tesu vaṭṭamūlaṃ kilesajātaṃ anuseti.
Wherever aggregates not fully understood by vipassanā arise, there, from the moment of their arising, the class of defilements, which is the root of the cycle of existence, lies dormant in them.
Bởi vì, ở bất cứ nơi đâu các uẩn chưa được liễu tri bởi vipassanā sanh khởi, thì ở đó, tập hợp phiền não là gốc rễ của vòng luân hồi ngủ ngầm trong chúng từ lúc sanh khởi.
Taṃ appahīnaṭṭhena bhūmiladdhanti veditabbaṃ.
That class of defilements should be understood as "bhūmiladdha" due to its unabandoned state.
Cần phải hiểu rằng nó là cái đạt được cảnh giới theo nghĩa là chưa được đoạn trừ.
Tattha ca yassa yesu khandhesu appahīnaṭṭhena anusayitā kilesā, tassa te eva khandhā tesaṃ kilesānaṃ vatthu, na aññesaṃ santakā khandhā.
Among these, for a person in whose aggregates defilements lie dormant as unabandoned, those very aggregates are the basis for those defilements, not the aggregates belonging to others.
Và trong đó, đối với người nào mà các phiền não ngủ ngầm trong các uẩn nào theo nghĩa là chưa được đoạn trừ, thì chính các uẩn đó là vật của các phiền não ấy, chứ không phải các uẩn thuộc về người khác.
Atītakkhandhesu ca appahīnānusayitānaṃ kilesānaṃ atītakkhandhāva vatthu, na itare.
And for defilements that lie dormant as unabandoned in past aggregates, the past aggregates themselves are the basis, not the others.
Và đối với các phiền não ngủ ngầm chưa được đoạn trừ trong các uẩn quá khứ, thì chính các uẩn quá khứ là vật, chứ không phải các uẩn khác.
Esa nayo anāgatādīsu.
The same method applies to future aggregates and so forth.
Phương pháp này cũng áp dụng cho các uẩn vị lai v.v.
Tathā kāmāvacarakkhandhesu appahīnānusayitānaṃ kilesānaṃ kāmāvacarakkhandhā eva vatthu, na itare.
Similarly, for defilements that lie dormant as unabandoned in aggregates of the sensuous realm, the aggregates of the sensuous realm themselves are the basis, not the others.
Tương tự, đối với các phiền não ngủ ngầm chưa được đoạn trừ trong các uẩn cõi Dục, thì chính các uẩn cõi Dục là vật, chứ không phải các uẩn khác.
Esa nayo rūpārūpāvacaresu.
The same method applies to the fine-material and immaterial realms.
Phương pháp này cũng áp dụng cho các uẩn cõi Sắc và Vô Sắc.
Sotāpannādīsu pana yassa yassa ariyapuggalassa khandhesu taṃ taṃ vaṭṭamūlaṃ kilesajātaṃ tena tena maggena pahīnaṃ, tassa tassa te te khandhā pahīnānaṃ tesaṃ tesaṃ vaṭṭamūlakānaṃ kilesānaṃ avatthuto bhūmīti saṅkhaṃ na labhanti.
However, in the case of stream-enterers and so forth, for whichever noble person, in whose aggregates that particular class of defilements, the root of the cycle of existence, has been abandoned by that particular path, for that person, those aggregates do not attain the designation of "foundation" as they are not a basis for those abandoned defilements, which are the root of the cycle of existence.
Còn đối với các bậc Tu-đà-hoàn v.v., đối với bậc Thánh nhân nào mà tập hợp phiền não là gốc rễ của vòng luân hồi trong các uẩn đã được đoạn trừ bởi đạo tương ứng, thì các uẩn của vị ấy không được gọi là cảnh giới (bhūmi) vì chúng không còn là vật cho các phiền não gốc rễ của vòng luân hồi đã được đoạn trừ ấy.
Puthujjanassa sabbaso vaṭṭamūlakilesānaṃ appahīnattā yaṃkiñci kariyamānaṃ kammaṃ kusalamakusalaṃ vā hoti, iccassa kammakilesapaccayāva vaṭṭaṃ vaṭṭati, tassa tasseva taṃ vaṭṭamūlaṃ rūpakkhandheyeva, na vedanādīsu.
For an ordinary person, since the defilements that are the root of the cycle of existence are entirely unabandoned, whatever kamma, wholesome or unwholesome, is performed, for him, the cycle of existence revolves solely due to kamma and defilements as conditions.
Đối với phàm phu, do các phiền não gốc rễ của vòng luân hồi hoàn toàn chưa được đoạn trừ, bất kỳ nghiệp nào được làm, dù thiện hay bất thiện, đều phát sanh; do đó, vòng luân hồi của người ấy xoay vần chỉ do duyên nghiệp và phiền não. Không nên nói rằng gốc rễ của vòng luân hồi ấy chỉ có trong sắc uẩn, chứ không có trong thọ uẩn v.v.
Viññāṇakkhandheyeva vā, na rūpakkhandhādīsūti na vattabbaṃ.
It should not be said that for that very person, that root of the cycle of existence is only in the aggregate of form, and not in feeling and so forth, or only in the aggregate of consciousness, and not in the aggregate of form and so forth.
hoặc chỉ có trong thức uẩn, chứ không có trong sắc uẩn v.v.
Avisesena pañcasupi khandhesu anusayitattā.
Because it lies dormant in all five aggregates without distinction.
Vì nó ngủ ngầm trong cả năm uẩn một cách không phân biệt.
Kathaṃ?
How?
Như thế nào?
Pathavīrasādi viya rukkhe.
Like the sap of the earth in a tree.
Giống như vị đất v.v. trong cây.
Yathā hi mahārukkhe pathavītalaṃ adhiṭṭhāya pathavīrasañca āporasañca nissāya tappaccayā mūlakhandhasākhāpasākhāpallavapalāsapupphaphalehi vaḍḍhitvā nabhaṃ pūretvā yāva kappāvasānā bījaparamparāya rukkhapaveṇiṃ santānayamāne ṭhite taṃ pathavīrasādimūleyeva, na khandhādīsu.
Just as a great tree, standing on the surface of the earth, relying on the essence of the earth and the essence of water, grows through these conditions with its roots, trunk, branches, sub-branches, shoots, leaves, flowers, and fruits, filling the sky and maintaining its lineage through a succession of seeds until the end of a world-cycle, that essence of the earth and so on is in the roots alone, not in the trunk and other parts.
Giống như một cây lớn, đứng vững trên mặt đất, nương vào vị đất và vị nước, nhờ duyên đó mà phát triển với rễ, thân, cành lớn, cành nhỏ, chồi, lá, hoa, quả, vươn cao chiếm cả bầu trời, và duy trì dòng giống cây qua các thế hệ hạt giống cho đến hết kiếp; khi đó, không thể nói rằng vị đất v.v. ấy chỉ có trong rễ, chứ không có trong thân cây v.v.
Phaleyeva vā, na mūlādīsūti na vattabbaṃ.
Nor should it be said that it is only in the fruits, and not in the roots and other parts.
hoặc chỉ có trong quả, chứ không có trong rễ v.v.
Avisesena sabbesu mūlādīsu anugatattāti.
Because it pervades all, the roots and so on, without distinction.
Vì nó thấm nhuần trong tất cả rễ v.v. một cách không phân biệt.
Yathā pana tasseva rukkhassa pupphaphalādīsu nibbinno koci puriso catūsu disāsu maṇḍūkakaṇṭakaṃ nāma visakaṇṭakaṃ ākoṭeyya, atha so rukkho tena visasamphassena phuṭṭho pathavīrasaāporasānaṃ pariyādinnattā appasavadhammataṃ āgamma puna santānaṃ nibbattetuṃ na sakkuṇeyya, evameva khandhappavattiyaṃ nibbinno kulaputto tassa purisassa catūsu disāsu rukkhe visayojanaṃ viya attano santāne catumaggabhāvanaṃ ārabhati.
However, just as if a certain person, disgusted with the flowers and fruits of that same tree, were to drive a poisonous thorn called a maṇḍūkakaṇṭaka into it in the four directions, then that tree, afflicted by the touch of that poison, would be unable to produce further growth, having exhausted the essence of the earth and water, and thus having the nature of not flourishing; even so, a noble son, disgusted with the continuation of the aggregates, undertakes the development of the four paths in his own continuum, just as that person applies poison to the tree in the four directions.
Nhưng, giống như một người nào đó, chán ngán hoa quả v.v. của chính cây đó, có thể đóng một loại gai độc gọi là gai cóc vào cây từ bốn phía, rồi cây đó, bị nhiễm độc, do vị đất và vị nước bị cạn kiệt, sẽ trở nên không thể sinh sôi và không thể tạo ra dòng dõi mới; cũng vậy, một thiện nam tử, chán ngán sự diễn tiến của các uẩn, bắt đầu tu tập bốn đạo trong dòng tâm của mình, giống như người kia tẩm độc vào cây từ bốn phía.
Athassa so khandhasantāno tena catumaggavisasamphassena sabbaso vaṭṭamūlakilesānaṃ pariyādinnattā kiriyasabhāvamattaṃ upagatakāyakammādisabbakammappabhedo hutvā āyatiṃ punabbhavānabhinibbattanadhammataṃ āgamma bhavantarasantānaṃ nibbattetuṃ na sakkoti, kevalaṃ carimaviññāṇanirodhena nirindhano viya jātavedo anupādāno parinibbāyati.
Then, due to the touch of that poison, which is the four paths, that continuum of aggregates, having completely exhausted the root defilements of the cycle of existence, becomes merely the nature of kamma-producing consciousness (kiriya-citta), having all types of kamma such as bodily kamma, and is unable to produce a continuum of another existence in the future, having attained the nature of not giving rise to further rebirth. It simply attains parinibbāna, like a fire without fuel, without clinging.
Khi đó, dòng uẩn của vị ấy, do sự tiếp xúc với chất độc của bốn đạo, do các phiền não gốc rễ của vòng luân hồi đã hoàn toàn bị cạn kiệt, trở thành các loại nghiệp như thân nghiệp v.v. chỉ còn là trạng thái duy tác, và do đạt đến trạng thái không tái sanh trong tương lai, không thể tạo ra dòng dõi ở kiếp sau, mà chỉ đơn thuần, với sự diệt của thức cuối cùng, vị ấy nhập Vô Dư Niết-bàn, không còn chất đốt, giống như ngọn lửa không còn nhiên liệu.
Evaṃ bhūmiyā bhūmiladdhassa ca nānattaṃ veditabbaṃ.
Thus, the distinction between bhūmi and bhūmiladdha should be understood.
Như vậy, cần phải biết sự khác biệt giữa cảnh giới và cái đạt được cảnh giới.
Aparampi catubbidhaṃ uppannaṃ samudācāruppannaṃ ārammaṇādhiggahituppannaṃ avikkhambhituppannaṃ asamūhatuppannanti.
Furthermore, there are four kinds of uppanna: samudācāruppanna, ārammaṇādhiggahituppanna, avikkhambhituppanna, and asamūhatuppanna.
Lại nữa, có bốn loại đã sanh khác: đã sanh do biểu hiện, đã sanh do đối tượng được nắm bắt, đã sanh do chưa được chế ngự, và đã sanh do chưa được nhổ bỏ.
Tattha vattamānuppannameva samudācāruppannaṃ.
Among these, samudācāruppanna is simply the uppanna that is currently arisen.
Trong đó, chính cái đã sanh trong hiện tại là đã sanh do biểu hiện.
Cakkhādīnaṃ pana āpāthagate ārammaṇe pubbabhāge anuppajjamānampi kilesajātaṃ ārammaṇassa adhiggahitattā eva aparabhāge ekantena uppattito ārammaṇādhiggahituppannanti vuccati.
But a collection of defilements, even if not yet arisen in the prior phase when an object has come into the range of the eye and other senses, is called ārammaṇādhiggahituppanna because it is grasped by the object, and therefore will certainly arise in the later phase.
Hơn nữa, khi đối tượng đi vào tầm hoạt động của mắt v.v., dù tập hợp phiền não chưa sanh khởi trong giai đoạn đầu, nhưng do đối tượng đã được nắm bắt, nó chắc chắn sẽ sanh khởi trong giai đoạn sau, nên được gọi là đã sanh do đối tượng được nắm bắt.
Samathavipassanānaṃ aññataravasena avikkhambhitaṃ kilesajātaṃ cittasantatimanārūḷhampi uppattinivārakassa hetuno abhāvā avikkhambhituppannaṃ nāma.
A collection of defilements that has not been suppressed by either samatha or vipassanā, even if it has not yet entered the mental continuum, is called avikkhambhituppanna due to the absence of a cause preventing its arising.
Tập hợp phiền não chưa được chế ngự bằng một trong hai phương pháp samatha hoặc vipassanā, dù chưa khởi lên trong dòng tâm, nhưng do không có nhân ngăn cản sự sanh khởi, nên được gọi là đã sanh do chưa được chế ngự.
Samathavipassanāvasena pana vikkhambhitampi ariyamaggena asamūhatattā uppattidhammataṃ anatītattā asamūhatuppannanti vuccati.
However, even if suppressed by samatha or vipassanā, a collection of defilements is called asamūhatuppanna because it has not been eradicated by the noble path and has not transcended the nature of arising.
Vả lại, phiền não dù đã được trấn áp bằng sức mạnh của samatha và vipassanā, nhưng vì chưa được nhổ bật gốc rễ bởi Thánh đạo, vì chưa vượt qua được pháp tánh của sự sanh khởi, nên được gọi là asamūhatuppanna (sanh khởi do chưa bị nhổ bật gốc rễ).
Tividhampi cetaṃ ārammaṇādhiggahitāvikkhambhitāsamūhatuppannaṃ bhūmiladdheneva saṅgahaṃ gacchatīti veditabbaṃ.
It should be understood that these three kinds of uppanna — ārammaṇādhiggahita, avikkhambhita, and asamūhata — are included within bhūmiladdha.
Và nên biết rằng, cả ba loại sanh khởi này – ārammaṇādhiggahita (sanh khởi do đối tượng chi phối), avikkhambhita (sanh khởi do chưa bị trấn áp), và asamūhata (sanh khởi do chưa bị nhổ bật gốc rễ) – đều được bao gồm trong bhūmiladdha (sanh khởi do đạt được cảnh giới).
Iccetasmiṃ vuttappabhede uppanne yadetaṃ vattamānabhūtāpagatokāsakatasamudācārasaṅkhātaṃ uppannaṃ, taṃ amaggavajjhattā kenaci maggañāṇena pahātabbaṃ na hoti.
Among these described kinds of uppanna, that which is called vattamāna-bhūtapagata-okāsakata-samudācāra uppanna is not to be abandoned by any path-knowledge, because it is not subject to abandonment by the path.
Trong các loại sanh khởi đã được nói đến như vậy, loại sanh khởi được gọi là samudācāra (sanh khởi do biểu hiện), bao gồm vattamāna (hiện tại), bhūtāpagata (đã qua), và okāsakata (được tạo cơ hội), không phải là đối tượng cần được đoạn trừ bởi bất kỳ trí tuệ đạo nào, vì nó không phải là đối tượng bị đạo đoạn trừ.
Yaṃ panetaṃ bhūmiladdhārammaṇādhiggahitāvikkhambhitāsamūhatasaṅkhātaṃ uppannaṃ, tassa taṃ uppannabhāvaṃ nāsayamānaṃ yasmā taṃ taṃ lokiyalokuttarañāṇaṃ uppajjati, tasmā taṃ sabbampi pahātabbaṃ hotīti.
But that which is called bhūmiladdha-ārammaṇādhiggahita-avikkhambhita-asamūhata uppanna — since that mundane and supramundane knowledge arises, destroying its nature of being uppanna — all of that is to be abandoned.
Còn loại sanh khởi được gọi là bhūmiladdha (sanh khởi do đạt được cảnh giới), ārammaṇādhiggahita (sanh khởi do đối tượng chi phối), avikkhambhita (sanh khởi do chưa bị trấn áp), và asamūhata (sanh khởi do chưa bị nhổ bật gốc rễ), vì trí tuệ hiệp thế và siêu thế tương ứng sanh lên để hủy diệt trạng thái sanh khởi đó của nó, nên tất cả chúng đều là đối tượng cần được đoạn trừ.
Evaṃ ye maggo kilese pajahati, te sandhāya ‘‘uppannāna’’ntiādi vuttaṃ.
Thus, it is with reference to the paths that abandon defilements that "of the arisen" and so on is stated.
Như vậy, câu “uppannānaṃ” (đối với những phiền não đã sanh) v.v... được nói ra là nhắm đến những phiền não mà đạo đoạn trừ.
Atha maggakkhaṇe kathaṃ anuppannānaṃ kusalānaṃ uppādāya bhāvanā hoti, kathañca uppannānaṃ ṭhitiyāti?
Then, at the moment of the path, how is there development for the arising of unarisen wholesome states, and how for the persistence of arisen ones?
Vậy, trong sát-na đạo, sự tu tập để làm sanh khởi các pháp thiện chưa sanh khởi, và sự tu tập để làm an trú các pháp thiện đã sanh khởi diễn ra như thế nào?
Maggappavattiyā eva.
By the very occurrence of the path.
Chính nhờ sự diễn tiến của đạo.
Maggo hi pavattamāno pubbe anuppannapubbattā anuppanno nāma vuccati.
For the path, when it is occurring, is called "unarisen" because it has not arisen before.
Bởi vì, đạo khi đang diễn tiến, do trước đây chưa từng sanh khởi, nên được gọi là chưa sanh khởi (anuppanna).
Anāgatapubbañhi ṭhānaṃ āgantvā ananubhūtapubbaṃ vā ārammaṇaṃ anubhavitvā vattāro bhavanti ‘‘anāgataṭṭhānaṃ āgatamha, ananubhūtaṃ ārammaṇaṃ anubhavāmā’’ti.
Indeed, people say, "We have come to a place we have not been to before, we are experiencing an object we have not experienced before," having come to a place not previously arrived at, or having experienced an object not previously experienced.
Thật vậy, những người đến một nơi chưa từng đến, hoặc trải nghiệm một đối tượng chưa từng trải nghiệm, thường nói rằng: “Chúng tôi đã đến một nơi chưa từng đến, chúng tôi đang trải nghiệm một đối tượng chưa từng trải nghiệm.”
Yāvassa pavatti, ayameva ṭhiti nāmāti ṭhitiyā bhāvetītipi vattuṃ vaṭṭati.
And it is proper to say that "as long as it occurs, this is called persistence," and thus one develops for persistence.
Chừng nào sự diễn tiến của nó còn, thì đây chính là sự an trú (ṭhiti), do đó cũng có thể nói rằng vị ấy tu tập để an trú.
Evametassa bhikkhuno idaṃ lokuttaramaggakkhaṇe ekameva vīriyaṃ ‘‘anuppannānaṃ pāpakānaṃ akusalānaṃ dhammānaṃ anuppādāyā’’tiādīni cattāri nāmāni labhati.
In this way, for that bhikkhu, this one effort at the moment of the supramundane path receives four names, such as "for the non-arising of unarisen evil, unwholesome states."
Như vậy, đối với vị tỳ khưu này, chỉ một tinh tấn duy nhất trong sát-na đạo siêu thế này lại nhận được bốn tên gọi là “để không cho các pháp ác, bất thiện chưa sanh được sanh khởi” v.v...
Ayaṃ lokuttaramaggakkhaṇe sammappadhānakathā.
This is the discourse on sammappadhāna at the moment of the supramundane path.
Đây là phần trình bày về Chánh Cần trong sát-na đạo siêu thế.
Evamettha lokiyalokuttaramissakā sammappadhānā niddiṭṭhāti.
Thus, here, sammappadhāna that are mixed with mundane and supramundane are described.
Như vậy, ở đây, các Chánh Cần được trình bày là sự pha trộn giữa hiệp thế và siêu thế.
Sammāsatiniddese kāyeti rūpakāye.
In the explanation of Right Mindfulness, " kāya" refers to the rūpakāya.
Trong phần giải về Chánh Niệm, kāye (trong thân) có nghĩa là trong sắc thân.
Rūpakāyo hi idha aṅgapaccaṅgānaṃ kesādīnañca dhammānaṃ samūhaṭṭhena hatthikāyarathakāyādayo viya kāyoti adhippeto.
Indeed, here, the rūpakāya is intended as "kāya" in the sense of a collection of major and minor limbs and of phenomena such as hairs, just like an elephant's body or a chariot's body.
Bởi vì sắc thân ở đây, do ý nghĩa là sự tập hợp của các pháp như các chi phần lớn nhỏ và tóc v.v..., được hiểu là thân (kāya), giống như thân voi, thân xe v.v...
Yathā ca samūhaṭṭhena, evaṃ kucchitānaṃ āyaṭṭhena.
And just as it is in the sense of a collection, so too it is in the sense of being the source of repulsive things.
Và cũng như do ý nghĩa là sự tập hợp, nó còn có ý nghĩa là nơi phát sanh của những thứ đáng ghê tởm.
Kucchitānañhi paramajegucchānaṃ so āyotipi kāyo.
Indeed, that body is also "kāya" in the sense of being the source of extremely repulsive things.
Bởi vì nó là nơi phát sanh (āya) của những thứ đáng ghê tởm, vô cùng đáng ghê tởm, nên cũng là thân (kāya).
Āyoti uppattideso.
" Āya" means place of origin.
Āya có nghĩa là nơi sanh khởi.
Tatrāyaṃ vacanattho – āyanti tatoti āyo.
Here is the etymology: "They come into it, therefore it is āya."
Ở đây, cách giải thích từ ngữ là: “Āyanti tato” (chúng đến từ đó), nên là “āyo” (nơi phát sanh).
Ke āyanti?
Who come into it?
Những gì đến?
Kucchitā kesādayo.
The repulsive hairs and so forth.
Những thứ đáng ghê tởm như tóc v.v...
Iti kucchitānaṃ āyoti kāyo.
Thus, it is "kāya" as the source of repulsive things.
Do đó, “kucchitānaṃ āyo” (nơi phát sanh của những thứ đáng ghê tởm), nên là “kāyo” (thân).
Kāyānupassīti kāyaṃ anupassanasīlo, kāyaṃ vā anupassamāno.
" Kāyānupassī" means one who is accustomed to contemplating the body, or one who contemplates the body.
Kāyānupassī (quán thân) có nghĩa là người có thói quen quán chiếu thân, hoặc người đang quán chiếu thân.
Kāyeti ca vatvāpi puna kāyānupassīti dutiyaṃ kāyaggahaṇaṃ asammissato vavatthānaghanavinibbhogādidassanatthaṃ katanti veditabbaṃ.
It should be understood that even after saying "in the body" (kāye), the second mention of "body" (kāyānupassī) is made to show the distinct demarcation and the detailed analysis of the aggregate, and so forth.
Và nên biết rằng, sau khi đã nói kāye (trong thân), việc dùng từ “kāya” lần thứ hai trong kāyānupassī được thực hiện nhằm mục đích chỉ ra sự phân định không lẫn lộn, sự phân rã khối đặc, v.v...
Tena na kāye vedanānupassī cittadhammānupassī vā, atha kho kāyānupassīyevāti kāyasaṅkhāte vatthusmiṃ kāyānupassanākārasseva dassanena asammissato vavatthānaṃ dassitaṃ hoti.
By this, it is shown that one does not contemplate feelings or mind-states in the body, but rather contemplates the body itself, thereby showing the distinct demarcation by presenting only the aspect of body-contemplation in the object called "body."
Do đó, vị ấy không phải là người quán thọ, quán tâm, hay quán pháp trong thân, mà chính là người quán thân. Như vậy, bằng cách chỉ ra sự quán chiếu chính tự thân trong đối tượng được gọi là thân, sự phân định không lẫn lộn đã được chỉ rõ.
Tathā na kāye aṅgapaccaṅgavinimuttaekadhammānupassī, nāpi kesalomādivinimuttaitthipurisānupassī.
Similarly, one does not contemplate a single phenomenon separate from the major and minor limbs in the body, nor does one contemplate a man or woman separate from hairs, body-hairs, and so forth.
Tương tự, vị ấy không phải là người quán một pháp duy nhất tách rời khỏi các chi phần lớn nhỏ trong thân, cũng không phải là người quán người nam hay người nữ tách rời khỏi tóc, lông v.v...
Yopi cettha kesalomādiko bhūtupādāyasamūhasaṅkhāto kāyo, tatthāpi na bhūtupādāyavinimuttaekadhammānupassī, atha kho rathasambhārānupassako viya aṅgapaccaṅgasamūhānupassī, nagarāvayavānupassako viya kesalomādisamūhānupassī, kadalikkhandhapattavaṭṭivinibhujjako viya rittamuṭṭhiviniveṭhako viya ca bhūtupādāyasamūhānupassīyevāti samūhavaseneva kāyasaṅkhātassa vatthuno nānappakārato dassanena ghanavinibbhogo dassito hoti.
Even the body here, which is a collection of primary elements and derivatives like hairs and body-hairs, is not contemplated as a single phenomenon separate from the primary elements and derivatives; rather, just as one contemplates the components of a chariot, one contemplates the collection of major and minor limbs; just as one contemplates the parts of a city, one contemplates the collection of hairs, body-hairs, and so forth; and just as one peels the layers of a banana trunk or unravels an empty fist, one contemplates the collection of primary elements and derivatives. Thus, by showing the object called "body" in various ways, primarily as an aggregate, the detailed analysis of the aggregate is shown.
Và ngay cả đối với thân này, được gọi là sự tập hợp của các đại và các pháp do đại tạo thành như tóc, lông v.v..., vị ấy cũng không phải là người quán một pháp duy nhất tách rời khỏi các đại và các pháp do đại tạo thành; mà đúng hơn, vị ấy chính là người quán sự tập hợp của các chi phần lớn nhỏ như người xem xét các bộ phận của cỗ xe, là người quán sự tập hợp của tóc, lông v.v... như người xem xét các thành phần của một thành phố, và là người quán sự tập hợp của các đại và các pháp do đại tạo thành như người bóc tách từng lớp bẹ của thân cây chuối hay như người mở một nắm tay rỗng. Như vậy, bằng cách quán chiếu đối tượng được gọi là thân theo nhiều cách khác nhau chỉ thuần túy là sự tập hợp, sự phân rã khối đặc đã được chỉ rõ.
Na hettha yathāvuttasamūhavinimutto kāyo vā itthī vā puriso vā añño vā koci dhammo dissati, yathāvuttadhammasamūhamatteyeva pana tathā tathā sattā micchābhinivesaṃ karonti.
For here, no body, woman, man, or any other phenomenon separate from the aforementioned aggregate is seen; rather, beings mistakenly conceive in various ways only in the mere aggregate of the aforementioned phenomena.
Bởi vì ở đây, không có thân, người nữ, người nam, hay bất kỳ pháp nào khác được thấy tách rời khỏi sự tập hợp đã nói; mà chúng sanh chỉ chấp thủ sai lầm theo những cách như vậy đối với chính sự tập hợp của các pháp đã nói mà thôi.
Tenāhu porāṇā –
Therefore, the ancients said:
Vì thế, các bậc cổ nhân đã nói:
Ghanavinibbhogādidassanatthanti vuttaṃ.
It was said, "to show the detailed analysis of the aggregate, and so forth."
Đã nói: “nhằm mục đích chỉ ra sự phân rã khối đặc, v.v...”
Ādisaddena cettha ayampi attho veditabbo – ayañhi etasmiṃ kāye kāyānupassīyeva, na aññadhammānupassī.
By the word "and so forth" here, this meaning should also be understood: this person contemplates the body in this body, not other phenomena.
Và với từ “v.v...” (ādi), cũng nên hiểu thêm ý nghĩa này: vị ấy chỉ quán thân trong thân này, chứ không quán các pháp khác.
Kiṃ vuttaṃ hoti?
What is meant?
Điều này có nghĩa là gì?
Yathā anudakabhūtāyapi marīciyā udakānupassino honti, na evaṃ aniccadukkhānattāsubhabhūteyeva imasmiṃ kāye niccasukhattasubhabhāvānupassī, atha kho kāyānupassī
Just as people perceive water in a mirage, which is not water, so too, in this body, which is impermanent, suffering, non-self, and unattractive, one does not perceive permanence, happiness, self, or attractiveness; rather, one contemplates the body.
Giống như có những người quán nước trong ảo ảnh vốn không phải là nước, vị ấy không phải là người quán tính thường, lạc, ngã, tịnh trong thân này vốn thực sự là vô thường, khổ, vô ngã, bất tịnh; mà đúng hơn, vị ấy là người quán thân,
Aniccadukkhānattāsubhākārasamūhānupassīyevāti vuttaṃ hoti.
It is said that one contemplates the aggregate of impermanent, suffering, non-self, and unattractive aspects.
có nghĩa là, vị ấy chính là người quán sự tập hợp của các khía cạnh vô thường, khổ, vô ngã, bất tịnh.
Atha vā yvāyaṃ mahāsatipaṭṭhāne ‘‘idha, bhikkhave, bhikkhu araññagato vā rukkhamūlagato vā…pe… so satova assasatī’’tiādinā (dī. ni. 2.374; ma. ni. 1.107) nayena assāsapassāsādi cuṇṇakajātaaṭṭhikapariyosāno kāyo vutto, yo ca parato satipaṭṭhānakathāyaṃ ‘‘idhekacco pathavīkāyaṃ aniccato anupassati, āpokāyaṃ, tejokāyaṃ, vāyokāyaṃ, kesakāyaṃ, lomakāyaṃ, chavikāyaṃ, cammakāyaṃ, maṃsakāyaṃ, ruhirakāyaṃ, nhārukāyaṃ, aṭṭhikāyaṃ, aṭṭhimiñjakāya’’nti (paṭi. ma. 3.35) kāyo vutto, tassa sabbassa imasmiṃyeva kāye anupassanato kāye kāyānupassīti evampi attho daṭṭhabbo.
Alternatively, the body described in the Mahāsatipaṭṭhāna Sutta, beginning with "Here, bhikkhus, a bhikkhu gone to the forest or to the root of a tree... he breathes in mindfully" and ending with the minutest bone fragments (breathings-in and out, etc.), and the body described later in the Satipaṭṭhāna-kathā as "Here, some contemplate the earth element as impermanent, the water element, the fire element, the air element, the hair element, the body-hair element, the skin element, the hide element, the flesh element, the blood element, the sinew element, the bone element, the bone-marrow element," all of this body is contemplated in this very body; thus, this meaning of "contemplating the body in the body" should also be understood.
Hoặc là, trong kinh Đại Niệm Xứ, thân được nói đến theo phương pháp bắt đầu bằng “Này các Tỳ khưu, ở đây, vị Tỳ khưu đi đến khu rừng, hoặc đi đến gốc cây... vị ấy thở vào chánh niệm...” v.v..., từ hơi thở vào ra cho đến cuối cùng là xương biến thành bột; và sau đó, trong phần thuyết về niệm xứ, thân lại được nói đến: “Ở đây, có người quán địa đại là vô thường, quán thủy đại, hỏa đại, phong đại, thân tóc, thân lông, thân da, thân bì, thân thịt, thân máu, thân gân, thân xương, thân tủy xương,” do quán chiếu tất cả các thân đó ngay trong chính thân này, nên cũng nên hiểu ý nghĩa là “kāye kāyānupassī” (quán thân trong thân).
Atha vā kāye ahanti vā mamanti vā evaṃ gahetabbassa kassaci ananupassanato tassa tasseva pana kesalomādikassa nānādhammasamūhassa anupassanato kāye kesādidhammasamūhasaṅkhātakāyānupassīti evamattho daṭṭhabbo.
Alternatively, since one does not contemplate anything in the body as "I" or "mine," but rather contemplates the various aggregates of phenomena such as hairs and body-hairs, the meaning should be understood as "contemplating the body, which is the aggregate of phenomena like hairs, in the body."
Hoặc là, do không quán chiếu bất cứ điều gì có thể chấp thủ là “ta” hay “của ta” trong thân, mà chỉ quán chiếu chính sự tập hợp của các pháp đa dạng như tóc, lông v.v..., nên ý nghĩa cần được hiểu là: trong thân, vị ấy là người quán thân được gọi là sự tập hợp của các pháp như tóc v.v...
Apica ‘‘imasmiṃ kāye aniccato anupassati, no niccato’’tiādinā anukkamena parato āgatanayassa sabbasseva aniccalakkhaṇādino ākārasamūhasaṅkhātassa kāyassa anupassanatopi kāye kāyānupassīti evampi attho daṭṭhabbo.
Furthermore, the meaning of "contemplating the body in the body" should also be understood from the contemplation of the entire body, which is the aggregate of aspects such as the impermanent characteristic, as described later in sequence, beginning with "one contemplates this body as impermanent, not as permanent."
Hơn nữa, do quán chiếu toàn bộ thân được gọi là sự tập hợp của các khía cạnh như đặc tính vô thường v.v..., theo phương pháp được trình bày tiếp theo một cách tuần tự: “vị ấy quán thân này là vô thường, không phải là thường” v.v..., nên cũng cần hiểu ý nghĩa là “kāye kāyānupassī” (quán thân trong thân).
Ayaṃ pana catusatipaṭṭhānasādhāraṇo attho.
This, however, is a meaning common to all four Satipaṭṭhānas.
Tuy nhiên, đây là ý nghĩa chung cho cả bốn niệm xứ.
Kāye kāyānupassīti assāsapassāsakāyādike bahudhā vutte kāye ekekakāyānupassī.
"Kāye kāyānupassī" (contemplating the body in the body) means contemplating one or another of the various types of body, such as the body of in-breaths and out-breaths, as explained in many ways.
Kāye kāyānupassī (quán thân trong thân): trong các thân được nói đến một cách đa dạng như thân hơi thở vào ra v.v..., vị ấy là người quán chiếu từng thân một.
Viharatīti catūsu iriyāpathavihāresu aññataravihārasamāyogaparidīpanametaṃ, ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā apatamānaṃ attānaṃ harati pavattetīti attho.
"Viharati" (dwells) indicates the association with one of the four postures (iriyāpatha-vihāra); the meaning is that one carries on and maintains oneself, cutting off the discomfort of one posture with another posture, not allowing oneself to fall or perish.
Viharati (trú): đây là sự chỉ rõ sự gắn liền với một trong bốn loại trú bằng oai nghi. Có nghĩa là, vị ấy duy trì, làm cho tự thân mình tiếp diễn mà không gục ngã, bằng cách cắt đứt sự đau nhức của một oai nghi này bằng một oai nghi khác.
Ātāpīti kāyapariggāhakavīriyasamāyogaparidīpanametaṃ.
"Ātāpī" (ardent) indicates the association with energy (vīriya) that comprehends the body.
Ātāpī (nhiệt tâm): đây là sự chỉ rõ sự gắn liền với tinh tấn, yếu tố nắm bắt thân.
So hi yasmā tasmiṃ samaye yaṃ taṃ vīriyaṃ tīsu bhavesu kilesānaṃ ātāpanato ātāpoti vuccati, tena samannāgato hoti, tasmā ‘‘ātāpī’’ti vuccati.
Indeed, because the energy at that time is called "ātāpa" (ardor) due to its burning up of defilements in the three planes of existence, and one is endowed with it, therefore one is called "ātāpī".
Bởi vì, vào thời điểm đó, vị ấy được trang bị tinh tấn, mà tinh tấn đó được gọi là ātāpa (sự nhiệt tâm) do nó làm thiêu đốt các phiền não trong ba cõi, nên vị ấy được gọi là “ātāpī” (người nhiệt tâm).
Sampajānoti kāyapariggāhakena sampajaññasaṅkhātena ñāṇena samannāgato.
"Sampajāno" (clearly comprehending) means endowed with the knowledge called clear comprehension (sampajañña) that comprehends the body.
Sampajāno (tỉnh giác): được trang bị trí tuệ, được gọi là tỉnh giác, yếu tố nắm bắt thân.
Satimāti kāyapariggāhikāya satiyā samannāgato.
"Satimā" (mindful) means endowed with mindfulness (sati) that comprehends the body.
Satimā (chánh niệm): được trang bị niệm, yếu tố nắm bắt thân.
Ayaṃ pana yasmā satiyā ārammaṇaṃ pariggahetvā paññāya anupassati.
This person, being mindful, apprehends the object and contemplates with wisdom.
Vả lại, vị ấy, sau khi dùng niệm để nắm bắt đối tượng, liền dùng trí tuệ để quán chiếu.
Na hi sativirahitassa anupassanā nāma atthi.
For there is no contemplation for one devoid of mindfulness.
Bởi vì, đối với người thiếu niệm, không thể có sự quán chiếu.
Tenevāha – ‘‘satiñca khvāhaṃ, bhikkhave, sabbatthikaṃ vadāmī’’ti (saṃ. ni. 5.234).
That is why it is said: "Mindfulness, bhikkhus, I declare to be essential everywhere."
Vì thế, Ngài đã nói – “Này các Tỳ-khưu, Ta tuyên bố rằng niệm là điều cần thiết trong mọi trường hợp.”
Tasmā ettha ‘‘kāye kāyānupassī viharatī’’ti ettāvatā kāyānupassanāsatipaṭṭhānakammaṭṭhānaṃ vuttaṃ hoti.
Therefore, here, by "kāye kāyānupassī viharati," the meditation subject of mindfulness of the body is stated.
Do đó, ở đây, chỉ với câu “trú quán thân trên thân” là đề mục niệm xứ quán thân đã được nói đến.
Atha vā yasmā anātāpino antosaṅkhepo antarāyakaro hoti, asampajāno upāyapariggahe anupāyaparivajjane ca sammuyhati, muṭṭhassati upāyāpariccāge anupāyāpariggahe ca asamattho hoti, tenassa taṃ kammaṭṭhānaṃ na sampajjati, tasmā yesaṃ dhammānaṃ ānubhāvena taṃ sampajjati, tesaṃ dassanatthaṃ ‘‘ātāpī sampajāno satimā’’ti idaṃ vuttanti veditabbaṃ.
Alternatively, since for one who is not ardent, inner contraction is an obstacle; one who is not clearly comprehending becomes confused in apprehending the right means and avoiding the wrong means; and one who is unmindful is incapable of abandoning the right means and apprehending the wrong means, their meditation subject does not succeed. Therefore, to show the qualities by the power of which it succeeds, "ātāpī sampajāno satimā" is stated.
Hoặc là, vì rằng đối với người không có tinh tấn, sự co rút nội tâm sẽ gây ra trở ngại; người không có tỉnh giác sẽ mê mờ trong việc nắm bắt phương pháp và từ bỏ phi phương pháp; người thất niệm sẽ không có khả năng trong việc không từ bỏ phương pháp và không nắm bắt phi phương pháp, do đó đề mục của người ấy không thành tựu. Vì vậy, để chỉ ra các pháp mà nhờ vào năng lực của chúng, đề mục ấy được thành tựu, cần hiểu rằng câu “tinh cần, tỉnh giác, chánh niệm” đã được nói đến.
Iti kāyānupassanāsatipaṭṭhānaṃ sampayogaṅgañca dassetvā idāni pahānaṅgaṃ dassetuṃ vineyya loke abhijjhādomanassanti vuttaṃ.
Having thus shown the Satipaṭṭhāna of contemplation of the body and its associated factors, now, to show the factor of abandonment, "vineyya loke abhijjhādomanassaṃ" (removing covetousness and displeasure in the world) is stated.
Như vậy, sau khi đã chỉ ra niệm xứ quán thân và các chi tương ưng, bây giờ để chỉ ra chi phần đoạn trừ, câu nhiếp phục tham ưu ở đời đã được nói đến.
Tattha vineyyāti tadaṅgavinayena vā vikkhambhanavinayena vā vinayitvā.
Here, "vineyya" (having removed) means having eliminated either by temporary suppression (tadaṅgavinaya) or by suppression through counteraction (vikkhambhanavinaya).
Trong đó, nhiếp phục có nghĩa là đã nhiếp phục bằng sự nhiếp phục nhất thời (tadaṅgavinaya) hoặc bằng sự nhiếp phục do đè nén (vikkhambhanavinaya).
Loketi yvāyaṃ kāyo pubbe pariggahito, sveva idha lujjanapalujjanaṭṭhena loko nāma.
"Loke" (in the world): that very body, which was previously apprehended, is here called "world" in the sense of decay and disintegration.
Ở đời có nghĩa là chính thân này đã được nắm bắt trước đây, ở đây được gọi là đời (loka) với ý nghĩa là hoại diệt và tan rã.
Tasmiṃ loke abhijjhaṃ domanassañca pajahitvāti attho.
The meaning is, having abandoned covetousness and displeasure in that world.
Nghĩa là, đã từ bỏ tham và ưu trong đời ấy.
Yasmā panassa na kāyamatteyeva abhijjhādomanassaṃ pahīyati, vedanādīsupi pahīyatiyeva, tasmā ‘‘pañcapi upādānakkhandhā loko’’ti (vibha. 362) vibhaṅge vuttaṃ.
However, since covetousness and displeasure are not abandoned only in the body, but are also abandoned in feelings and so on, it is stated in the Vibhaṅga: "The five aggregates of clinging are the world."
Tuy nhiên, vì rằng không chỉ tham và ưu đối với thân được từ bỏ, mà chúng cũng được từ bỏ trong các thọ v.v., do đó trong bộ Phân Tích (Vibhaṅga) có nói: “Năm uẩn thủ là đời.”
Lokasaṅkhātattāyeva tesaṃ dhammānaṃ atthuddhāravasenetaṃ vuttanti veditabbaṃ.
It should be understood that this is stated by way of extracting the meaning of those phenomena, precisely because they are designated as "world."
Cần hiểu rằng điều này được nói theo cách trích dẫn ý nghĩa của các pháp ấy, chính vì chúng được gọi là đời.
Yaṃ panāha – ‘‘tattha katamo loko (vibha. 538), sveva kāyo loko’’ti ayamevettha attho.
And what is said: "What is the world there? That very body is the world" – this is the meaning here.
Còn điều được nói rằng – “Trong đó, thế nào là đời, chính thân này là đời,” đây chính là ý nghĩa ở đây.
Abhijjhādomanassanti ca samāsetvā vuttaṃ.
"Abhijjhādomanassaṃ" (covetousness and displeasure) is stated as a compound.
Và câu tham ưu được nói gộp lại.
Saṃyuttaṅguttarapāṭhantaresu pana visuṃ katvā paṭhanti.
However, in other passages of the Saṃyutta and Aṅguttara Nikāyas, they are recited separately.
Tuy nhiên, trong các bản kinh khác của Tương Ưng Bộ và Tăng Chi Bộ, người ta đọc tách rời.
Sā pana abhijjhāyanti patthayanti etāya, sayaṃ vā abhijjhāyati, abhijjhāyanamattameva vā esāti abhijjhā.
"Abhijjhā" (covetousness) is that by which one desires, or one desires oneself, or it is merely the act of desiring.
Tham (abhijjhā) đó là: người ta tham muốn bởi nó, hoặc tự nó tham muốn, hoặc nó chỉ là sự tham muốn mà thôi, nên gọi là tham.
Yasmā panettha abhijjhāgahaṇena kāmacchando, domanassagahaṇena byāpādo saṅgahaṃ gacchati, tasmā nīvaraṇapariyāpannabalavadhammadvayadassanena nīvaraṇappahānaṃ vuttaṃ hotīti veditabbaṃ.
Since here, by the apprehension of covetousness, sensual desire (kāmacchanda) is included, and by the apprehension of displeasure, ill-will (byāpāda) is included, it should be understood that the abandonment of hindrances (nīvaraṇa) is stated by showing these two strong phenomena included in the hindrances.
Vì rằng ở đây, qua việc đề cập đến tham (abhijjhā), dục tham (kāmacchanda) được bao gồm; qua việc đề cập đến ưu (domanassa), sân (byāpāda) được bao gồm, do đó, cần hiểu rằng sự đoạn trừ các triền cái đã được nói đến bằng cách chỉ ra hai pháp mạnh mẽ thuộc về triền cái.
Visesena panettha abhijjhāvinayena kāyasampattimūlakassa anurodhassa, domanassavinayena kāyavipattimūlakassa virodhassa, abhijjhāvinayena ca kāye abhiratiyā, domanassavinayena kāyabhāvanāya anabhiratiyā, abhijjhāvinayena kāye abhūtānaṃ subhasukhabhāvādīnaṃ pakkhepassa, domanassavinayena kāye bhūtānaṃ asubhāsukhabhāvādīnaṃ apanayanassa pahānaṃ vuttaṃ.
Specifically here, by the removal of covetousness, the abandonment of attachment (anurodha) rooted in the body's prosperity, and by the removal of displeasure, the abandonment of aversion (virodha) rooted in the body's misfortune, are stated. Also, by the removal of covetousness, the abandonment of delight in the body, and by the removal of displeasure, the abandonment of non-delight in the cultivation of the body, are stated. By the removal of covetousness, the abandonment of projecting non-existent qualities like beauty and pleasure onto the body, and by the removal of displeasure, the abandonment of removing existent qualities like impurity and suffering from the body, are stated.
Tuy nhiên, một cách đặc biệt, ở đây, việc đoạn trừ sự thuận theo (anurodha) bắt nguồn từ sự thành tựu của thân được nói đến qua việc nhiếp phục tham; việc đoạn trừ sự chống đối (virodha) bắt nguồn từ sự bất toàn của thân được nói đến qua việc nhiếp phục ưu. Và qua việc nhiếp phục tham, sự hoan hỷ trong thân được đoạn trừ; qua việc nhiếp phục ưu, sự không hoan hỷ trong việc tu tập về thân được đoạn trừ. Qua việc nhiếp phục tham, sự gán ghép những điều không có thật như tịnh, lạc v.v. vào thân được đoạn trừ; qua việc nhiếp phục ưu, sự loại bỏ những điều có thật như bất tịnh, khổ v.v. trong thân được đoạn trừ.
Tena yogāvacarassa yogānubhāvo yogasamatthatā ca dīpitā hoti.
Thereby, the yogī's power of practice and capacity for practice are illuminated.
Qua đó, năng lực tu tập và khả năng tu tập của hành giả được làm sáng tỏ.
Yogānubhāvo hi esa, yadayaṃ anurodhavirodhavippamutto aratiratisaho abhūtapakkhepabhūtāpanayanavirahito ca hoti.
For this is the power of practice: to be free from attachment and aversion, to endure both delight and non-delight, and to be free from projecting non-existent qualities and removing existent ones.
Vì rằng đây chính là năng lực tu tập, khi hành giả thoát khỏi sự thuận theo và chống đối, chịu đựng được sự không hoan hỷ và hoan hỷ, và không còn gán ghép điều không thật và loại bỏ điều có thật.
Anurodhavirodhavippamutto cesa aratiratisaho abhūtaṃ apakkhipanto bhūtañca anapanento yogasamattho hotīti.
And when one is free from attachment and aversion, endures both delight and non-delight, does not project non-existent qualities, and does not remove existent ones, then one is capable of practice.
Và hành giả này, khi thoát khỏi sự thuận theo và chống đối, chịu đựng được sự không hoan hỷ và hoan hỷ, không gán ghép điều không thật và không loại bỏ điều có thật, thì trở nên có khả năng tu tập.
Aparo nayo – ‘‘kāye kāyānupassī’’ti ettha anupassanāya kammaṭṭhānaṃ vuttaṃ.
Another method: in "kāye kāyānupassī," the meditation subject of contemplation is stated.
Một phương pháp khác – Trong câu “quán thân trên thân”, đề mục được nói đến qua sự quán chiếu.
‘‘Viharatī’’ti ettha vuttavihārena kammaṭṭhānikassa kāyapariharaṇaṃ.
In "Viharati" (dwells), the dwelling spoken of here is the maintenance of the body by one who practices kammaṭṭhāna through the prescribed deportments.
Trong câu “trú”, sự duy trì thân của người thực hành đề mục được nói đến qua sự an trú đã được đề cập.
‘‘Ātāpī’’tiādīsu ātāpena sammappadhānaṃ, satisampajaññena sabbatthakakammaṭṭhānaṃ, kammaṭṭhānapariharaṇūpāyo vā.
In "ātāpī" and so on, ātāpa refers to sammappadhāna (right exertion), and satisampajañña (mindfulness and clear comprehension) refers to sabbatthaka kammaṭṭhāna (all-round meditation objects), or it is the means of maintaining the kammaṭṭhāna.
Trong các từ “tinh cần” v.v., chánh tinh cần được nói đến qua sự tinh cần (ātāpa), đề mục cần thiết trong mọi trường hợp được nói đến qua niệm và tỉnh giác, hoặc đó là phương pháp duy trì đề mục.
Satiyā vā kāyānupassanāvasena paṭiladdhasamatho, sampajaññena vipassanā, abhijjhādomanassavinayena bhāvanāphalaṃ vuttanti veditabbaṃ.
Or, it should be understood that samatha (tranquillity) is attained by mindfulness in the way of kāyānupassanā (contemplation of the body), vipassanā (insight) by clear comprehension, and the fruit of development by the removal of covetousness and distress.
Hoặc cần hiểu rằng, qua niệm, định (samatha) đã đạt được nhờ quán thân được nói đến; qua tỉnh giác, tuệ (vipassanā) được nói đến; qua việc nhiếp phục tham ưu, quả của sự tu tập được nói đến.
Vedanāsu vedanānupassītiādīsu ca vedanādīnaṃ puna vacane payojanaṃ kāyānupassanāyaṃ vuttanayeneva yathāyogaṃ yojetvā veditabbaṃ.
In "vedanāsu vedanānupassī" (contemplating feelings in feelings) and so on, the purpose of repeating feelings and so forth should be understood by applying it appropriately in the same way as described for kāyānupassanā.
Trong các câu “quán thọ trên các thọ” v.v., mục đích của việc lặp lại các thọ v.v. cần được hiểu bằng cách áp dụng tương ứng theo phương pháp đã được nói trong phần quán thân.
Ayaṃ pana asādhāraṇattho – sukhādīsu anekappabhedāsu vedanāsu visuṃ visuṃ aniccādito ekekavedanānupassīti, sarāgādike soḷasappabhede citte visuṃ visuṃ aniccādito ekekacittānupassīti, kāyavedanācittāni ṭhapetvā sesatebhūmakadhammesu visuṃ visuṃ aniccādito ekekadhammānupassīti, satipaṭṭhānasuttante (dī. ni. 2.382; ma. ni. 1.115) vuttanayena nīvaraṇādidhammānupassīti vā.
This is the special meaning: contemplating each feeling separately as impermanent and so on, among feelings of various kinds such as pleasure; contemplating each mind separately as impermanent and so on, among the sixteen kinds of mind such as with passion; contemplating each phenomenon separately as impermanent and so on, among the remaining three-realm phenomena apart from body, feelings, and mind; or contemplating phenomena such as hindrances in the manner taught in the Satipaṭṭhāna Sutta.
Tuy nhiên, đây là ý nghĩa đặc thù – trong các thọ có nhiều loại khác nhau như lạc v.v., là người quán từng thọ một theo vô thường v.v.; trong tâm có mười sáu loại khác nhau như tâm có tham v.v., là người quán từng tâm một theo vô thường v.v.; sau khi đặt qua một bên thân, thọ và tâm, trong các pháp tam giới còn lại, là người quán từng pháp một theo vô thường v.v., hoặc là người quán các pháp như triền cái v.v. theo phương pháp đã được nói trong Kinh Niệm Xứ.
Ettha ca ‘‘kāye’’ti ekavacanaṃ sarīrassa ekattā, ‘‘citte’’ti ekavacanaṃ cittassa sabhāvabhedābhāvato jātiggahaṇena katanti veditabbaṃ.
Here, the singular number "kāye" (in the body) is due to the body being one, and the singular number "citte" (in the mind) is understood to be made by taking the class, due to the mind having no difference in its nature.
Và ở đây, cần hiểu rằng số ít “trên thân” (kāye) được dùng vì thân thể là một thể thống nhất, còn số ít “trên tâm” (citte) được dùng theo cách chỉ chung chủng loại vì tâm không có sự khác biệt về bản chất.
Yathā ca vedanādayo anupassitabbā, tathā anupassanto vedanāsu vedanānupassī, citte cittānupassī, dhammesu dhammānupassīti veditabbo.
And just as feelings and so forth are to be contemplated, so too one who contemplates them should be understood as contemplating feelings in feelings, mind in mind, and phenomena in phenomena.
Và như thế nào các thọ v.v. cần được quán chiếu, người đang quán chiếu như vậy cần được biết là người quán thọ trên các thọ, người quán tâm trên tâm, người quán pháp trên các pháp.
Kathaṃ tāva vedanā anupassitabbā?
How, then, are feelings to be contemplated?
Vậy, các thọ cần được quán chiếu như thế nào?
Sukhā tāva vedanā dukkhato, dukkhā vedanā sallato, adukkhamasukhā vedanā aniccato anupassitabbā.
Pleasant feelings are to be contemplated as suffering, painful feelings as a dart, and neither-pleasant-nor-painful feelings as impermanent.
Trước hết, thọ lạc cần được quán chiếu là khổ, thọ khổ là mũi tên, thọ không khổ không lạc là vô thường.
Yathāha –
As it is said:
Như có lời dạy rằng –
Sabbā eva cetā dukkhatopi anupassitabbā.
All these feelings should also be contemplated as suffering.
Tất cả chúng cũng cần được quán chiếu là khổ.
Vuttañhetaṃ ‘‘yaṃkiñci vedayitaṃ, sabbaṃ taṃ dukkhasminti vadāmī’’ti (saṃ. ni. 4.259).
For it has been said: "Whatever is felt, all that I declare to be suffering."
Vì có lời dạy rằng: “Bất cứ điều gì được cảm thọ, Ta nói rằng tất cả đều nằm trong khổ.”
Sukhadukkhatopi ca anupassitabbā.
And they should also be contemplated as pleasant and painful.
Và chúng cũng cần được quán chiếu là lạc và khổ.
Yathāha – ‘‘sukhā vedanā ṭhitisukhā vipariṇāmadukkhā.
As it is said: "Pleasant feeling is pleasant in its persistence, painful in its change.
Như có lời dạy rằng: “Thọ lạc thì an lạc khi tồn tại, đau khổ khi biến hoại.
Dukkhā vedanā ṭhitidukkhā vipariṇāmasukhā.
Painful feeling is painful in its persistence, pleasant in its change.
Thọ khổ thì đau khổ khi tồn tại, an lạc khi biến hoại.
Adukkhamasukhā vedanā ñāṇasukhā aññāṇadukkhā’’ti (ma. ni. 1.465).
Neither-pleasant-nor-painful feeling is pleasant with knowledge, painful without knowledge."
Thọ không khổ không lạc thì an lạc khi có trí tuệ, đau khổ khi không có trí tuệ.”
Apica aniccādisattaanupassanāvasenāpi anupassitabbā.
Furthermore, they should also be contemplated by way of the seven contemplations such as impermanence.
Hơn nữa, chúng cũng cần được quán chiếu theo bảy pháp quán như vô thường v.v.
Cittadhammesupi cittaṃ tāva ārammaṇādhipatisahajātabhūmikammavipākakiriyādinānattabhedānaṃ aniccādisattaanupassanānaṃ sarāgādisoḷasabhedānañca vasena anupassitabbaṃ, dhammā salakkhaṇasāmaññalakkhaṇānaṃ suññatādhammassa aniccādisattaanupassanānaṃ santāsantādīnañca vasena anupassitabbā.
Among mind-phenomena, the mind should first be contemplated by way of the various differences such as object, predominance, concomitance, realm, kamma, result, and action, and by way of the seven contemplations such as impermanence, and the sixteen kinds such as with passion. Phenomena should be contemplated by way of their specific characteristics and general characteristics, by way of the phenomenon of emptiness, by way of the seven contemplations such as impermanence, and by way of existence and non-existence.
Trong các pháp thuộc về tâm, trước hết tâm cần được quán chiếu theo các sự khác biệt đa dạng như đối tượng, chủ đạo, đồng sanh, cõi, nghiệp, quả, duy tác v.v., theo bảy pháp quán như vô thường v.v., và theo mười sáu loại như tâm có tham v.v.; các pháp cần được quán chiếu theo tự tướng và cộng tướng, theo pháp tánh không, theo bảy pháp quán như vô thường v.v., và theo sự hiện hữu, không hiện hữu v.v.
Kāmañcettha yassa kāyasaṅkhāte loke abhijjhādomanassaṃ pahīnaṃ, tassa vedanādilokesupi taṃ pahīnameva, nānāpuggalavasena pana nānākkhaṇikasatipaṭṭhānabhāvanāvasena ca sabbattha vuttaṃ.
Although for one whose covetousness and distress have been abandoned in the world of the body, they are also abandoned in the worlds of feelings and so on, it is stated everywhere due to different individuals and due to the development of mindfulness in different moments.
Mặc dù ở đây, đối với người nào mà tham ưu trong thế giới gọi là thân đã được đoạn trừ, thì tham ưu đó trong các thế giới thọ v.v. cũng đã được đoạn trừ, nhưng nó được nói đến ở mọi nơi theo phương diện các cá nhân khác nhau và theo phương diện sự tu tập niệm xứ trong các khoảnh khắc khác nhau.
Yato vā ekattha pahīnaṃ, sesesupi pahīnaṃ hoti.
Or, because what is abandoned in one is also abandoned in the others,
Hoặc là, vì khi được đoạn trừ ở một nơi, nó cũng được đoạn trừ ở những nơi còn lại.
Tenevassa tattha pahānadassanatthampi evaṃ vuttanti veditabbaṃ.
it should be understood that it is stated thus even to show its abandonment there.
Cần hiểu rằng, chính vì lý do đó mà nó được nói như vậy, cũng là để chỉ ra sự đoạn trừ ở những nơi đó.
Iti ime cattāro satipaṭṭhānā pubbabhāge nānācittesu labbhanti.
Thus, these four foundations of mindfulness are found in different minds in the preliminary stage.
Như vậy, bốn niệm xứ này, trong giai đoạn đầu, có thể đạt được trong các tâm khác nhau.
Aññeneva hi cittena kāyaṃ pariggaṇhāti, aññena vedanaṃ, aññena cittaṃ, aññena dhamme pariggaṇhāti.
For one comprehends the body with one mind, feelings with another, mind with another, and phenomena with another.
Vì rằng, người ta nắm bắt thân bằng một tâm khác, nắm bắt thọ bằng một tâm khác, nắm bắt tâm bằng một tâm khác, và nắm bắt các pháp bằng một tâm khác.
Lokuttaramaggakkhaṇe pana ekacitteyeva labbhanti.
However, at the moment of the supramundane path, they are found in a single mind.
Tuy nhiên, trong khoảnh khắc của đạo siêu thế, chúng có thể đạt được trong cùng một tâm.
Ādito hi kāyaṃ pariggaṇhitvā āgatassa vipassanāsampayuttā sati kāyānupassanā nāma, tāya satiyā samannāgato puggalo kāyānupassī nāma.
For the person who has come having first comprehended the body, the mindfulness associated with vipassanā is called kāyānupassanā, and the person endowed with that mindfulness is called kāyānupassī.
Thật vậy, đối với người đã đến sau khi nắm bắt thân từ đầu, niệm tương ưng với tuệ quán được gọi là quán thân, và người được trang bị với niệm đó được gọi là người quán thân.
Vipassanaṃ ussukkāpetvā ariyamaggaṃ pattassa maggakkhaṇe maggasampayuttā sati kāyānupassanā nāma, tāya satiyā samannāgato puggalo kāyānupassī nāma.
For the person who has aroused vipassanā and attained the Noble Path, at the moment of the path, the mindfulness associated with the path is called kāyānupassanā, and the person endowed with that mindfulness is called kāyānupassī.
Đối với người đã nỗ lực tu tập vipassanā và đắc Thánh đạo, niệm tương ưng với đạo trong khoảnh khắc đạo được gọi là kāyānupassanā (quán thân); cá nhân có được niệm ấy được gọi là kāyānupassī (người quán thân).
Vedanaṃ pariggaṇhitvā cittaṃ pariggaṇhitvā dhamme pariggaṇhitvā āgatassa vipassanāsampayuttā sati dhammānupassanā nāma, tāya satiyā samannāgato puggalo dhammānupassī nāma.
For the person who has come having comprehended feelings, having comprehended mind, having comprehended phenomena, the mindfulness associated with vipassanā is called dhammānupassanā, and the person endowed with that mindfulness is called dhammānupassī.
Đối với người đã nắm bắt thọ, nắm bắt tâm, nắm bắt các pháp mà đến, niệm tương ưng với vipassanā được gọi là dhammānupassanā (quán pháp); cá nhân có được niệm ấy được gọi là dhammānupassī (người quán pháp).
Vipassanaṃ ussukkāpetvā ariyamaggaṃ pattassa maggakkhaṇe maggasampayuttā sati dhammānupassanā nāma, tāya satiyā samannāgato puggalo dhammānupassī nāma.
For a person who has exerted themselves in vipassanā and attained the Noble Path, the mindfulness associated with the path at the moment of the path is called dhammānupassanā. A person endowed with that mindfulness is called a dhammānupassī.
Đối với người đã nỗ lực tu tập vipassanā và đắc Thánh đạo, niệm tương ưng với đạo trong khoảnh khắc đạo được gọi là dhammānupassanā (quán pháp); cá nhân có được niệm ấy được gọi là dhammānupassī (người quán pháp).
Evaṃ tāva desanā puggale tiṭṭhati.
Thus, first of all, the teaching stands with reference to the individual.
Như vậy, trước hết, bài pháp đứng trên phương diện cá nhân.
Kāye pana ‘‘subha’’nti vipallāsappahānā kāyapariggāhikā sati maggena samijjhatīti kāyānupassanā nāma.
But in the case of the body, the mindfulness that comprehends the body, which abandons the perversion of 'beautiful' (subha), is perfected by the path; therefore, it is called kāyānupassanā.
Còn trên phương diện các pháp, niệm nắm bắt thân, có tác dụng từ bỏ sự điên đảo cho rằng trong thân có "cái đẹp", được thành tựu bởi đạo, nên được gọi là kāyānupassanā (quán thân).
Vedanāya ‘‘sukhā’’ti vipallāsappahānā vedanāpariggāhikā sati maggena samijjhatīti vedanānupassanā nāma.
In the case of feeling, the mindfulness that comprehends feeling, which abandons the perversion of 'pleasant' (sukha), is perfected by the path; therefore, it is called vedanānupassanā.
Niệm nắm bắt thọ, có tác dụng từ bỏ sự điên đảo cho rằng trong thọ có "lạc", được thành tựu bởi đạo, nên được gọi là vedanānupassanā (quán thọ).
Citte ‘‘nicca’’nti vipallāsappahānā cittapariggāhikā sati maggena samijjhatīti cittānupassanā nāma.
In the case of mind, the mindfulness that comprehends mind, which abandons the perversion of 'permanent' (nicca), is perfected by the path; therefore, it is called cittānupassanā.
Niệm nắm bắt tâm, có tác dụng từ bỏ sự điên đảo cho rằng trong tâm có "thường", được thành tựu bởi đạo, nên được gọi là cittānupassanā (quán tâm).
Dhammesu ‘‘attā’’ti vipallāsappahānā dhammapariggāhikā sati maggena samijjhatīti dhammānupassanā nāma.
In the case of phenomena, the mindfulness that comprehends phenomena, which abandons the perversion of 'self' (attā), is perfected by the path; therefore, it is called dhammānupassanā.
Niệm nắm bắt các pháp, có tác dụng từ bỏ sự điên đảo cho rằng trong các pháp có "tự ngã", được thành tựu bởi đạo, nên được gọi là dhammānupassanā (quán pháp).
Iti ekāva maggasampayuttā sati catukiccasādhakattena cattāri nāmāni labhati.
Thus, the single mindfulness associated with the path obtains four names due to its accomplishment of four functions.
Như vậy, chỉ một niệm duy nhất tương ưng với đạo, do hoàn thành bốn phận sự, đã nhận được bốn tên gọi.
Tena vuttaṃ ‘‘lokuttaramaggakkhaṇe pana ekacitteyeva labbhantī’’ti.
Therefore, it is said, "But at the moment of the supramundane path, they are obtained in one and the same mind."
Do đó, đã nói rằng "còn trong khoảnh khắc đạo siêu thế, chúng được thành tựu chỉ trong một tâm duy nhất".
Sammāsamādhiniddese vivicceva kāmehīti kāmehi viviccitvā vinā hutvā apakkamitvā.
In the exposition of right concentration, "quite secluded from sense-desires" (vivicceva kāmehī) means having become secluded from sense-desires, having become free, having departed.
Trong phần giải thích về Chánh định, vivicceva kāmehi (ly dục) có nghĩa là đã ly, đã tách rời, đã tránh xa khỏi các dục.
Yo panāyamettha evakāro, so niyamatthoti veditabbo.
And the particle eva here should be understood as having the meaning of restriction.
Còn từ eva ở đây nên được hiểu theo nghĩa xác định.
Yasmā ca niyamattho, tasmā paṭhamajjhānaṃ upasampajja viharaṇasamaye avijjamānānampi kāmānaṃ tassa paṭhamajjhānassa paṭipakkhabhāvaṃ kāmapariccāgeneva cassa adhigamaṃ dīpeti.
And because it has the meaning of restriction, it indicates both that sense-desires are opposed to that first jhāna, even though they are not present at the time of abiding having entered upon the first jhāna, and that its attainment is solely through the abandonment of sense-desires.
Và vì nó có nghĩa xác định, nên nó chỉ ra rằng các dục, dù không hiện hữu vào thời điểm an trú sau khi đã chứng đắc sơ thiền, vẫn là đối nghịch với sơ thiền ấy, và việc chứng đắc sơ thiền chỉ có thể đạt được qua việc từ bỏ các dục.
Kathaṃ?
How?
Làm thế nào?
‘‘Vivicceva kāmehī’’ti evañhi niyame kayiramāne idaṃ paññāyati – nūnimassa jhānassa kāmā paṭipakkhabhūtā, yesu sati idaṃ na pavattati, andhakāre sati padīpobhāso viya, tesaṃ pariccāgeneva cassa adhigamo hoti orimatīrapariccāgena pārimatīrassa viya.
When the restriction is made thus: "quite secluded from sense-desires," this is understood: surely sense-desires are opposed to this jhāna, in the presence of which it does not arise, just as the light of a lamp does not arise in the presence of darkness; and its attainment is solely through their abandonment, just as the far shore is attained through the abandonment of the near shore.
Khi sự xác định được thực hiện như vậy qua câu "ly dục", điều này trở nên rõ ràng: chắc chắn các dục là đối nghịch với thiền này; khi chúng có mặt thì thiền này không thể khởi sinh, giống như ánh sáng đèn không thể có mặt khi bóng tối tồn tại; và việc chứng đắc thiền này chỉ có thể có được qua việc từ bỏ chúng, giống như việc đến được bờ bên kia chỉ có thể có được qua việc rời bỏ bờ bên này.
Tasmā niyamaṃ karotīti.
Therefore, it makes the restriction.
Do đó, nó tạo ra sự xác định.
Tattha siyā, kasmā panesa pubbapadeyeva vutto, na uttarapade, kiṃ akusalehi dhammehi aviviccāpi jhānaṃ upasampajja vihareyyāti?
Here, one might ask, why is this particle mentioned only in the first phrase and not in the second? Would one then abide having entered upon jhāna even without being secluded from unwholesome states?
Ở đây, có thể có câu hỏi: tại sao từ này lại chỉ được nói ở vế trước mà không ở vế sau? Phải chăng người ta có thể an trú sau khi chứng đắc thiền mà không cần ly các pháp bất thiện?
Na kho panetaṃ evaṃ daṭṭhabbaṃ.
This should not be understood in that way.
Tuy nhiên, không nên hiểu như vậy.
Taṃnissaraṇato hi pubbapade esa vutto.
For it is mentioned in the first phrase because it is the escape from them.
Thực ra, từ này được nói ở vế trước vì đó là sự xuất ly khỏi chúng.
Kāmadhātusamatikkamanato hi kāmarāgapaṭipakkhato ca idaṃ jhānaṃ kāmānameva nissaraṇaṃ.
For this jhāna is indeed an escape from sense-desires, because it transcends the sense-sphere and is opposed to sensual lust.
Bởi vì vượt qua cõi dục và vì là đối nghịch với dục ái, thiền này chính là sự xuất ly khỏi các dục.
Yathāha – ‘‘kāmānametaṃ nissaraṇaṃ yadidaṃ nekkhamma’’nti (itivu. 72).
As it is said: "This is the escape from sense-desires, namely renunciation (nekkhamma)."
Như đã nói: "Sự xuất ly khỏi các dục chính là nekkhamma (sự xuất gia, sự từ bỏ)".
Uttarapadepi pana yathā ‘‘idheva, bhikkhave, samaṇo, idha dutiyo samaṇo’’ti (ma. ni. 1.139; a. ni. 4.241) ettha evakāro ānetvā vuccati, evaṃ vattabbo.
But in the second phrase too, it should be stated by bringing the particle eva from such passages as "Here, bhikkhus, is a recluse; here is a second recluse."
Hơn nữa, ở vế sau, từ eva cũng nên được mang đến và nói, giống như trong câu "Này các Tỳ khưu, chỉ ở đây có sa-môn, ở đây có sa-môn thứ hai".
Na hi sakkā ito aññehipi nīvaraṇasaṅkhātehi akusalehi dhammehi avivicca jhānaṃ upasampajja viharituṃ.
For it is not possible to abide having entered upon jhāna without being secluded from other unwholesome states, which are called hindrances.
Vì không thể an trú sau khi chứng đắc thiền mà không ly khỏi các pháp bất thiện khác được gọi là các triền cái.
Tasmā ‘‘vivicceva kāmehi vivicceva akusalehi dhammehī’’ti evaṃ padadvayepi esa daṭṭhabbo.
Therefore, this particle should be understood in both phrases as "quite secluded from sense-desires, quite secluded from unwholesome states."
Do đó, nên hiểu rằng từ này có ở cả hai vế: "ly dục, ly các pháp bất thiện".
Padadvayepi ca kiñcāpi viviccāti iminā sādhāraṇavacanena tadaṅgavikkhambhanasamucchedapaṭippassaddhinissaraṇavivekā cittakāyaupadhivivekā ca saṅgahaṃ gacchanti, tathāpi pubbabhāge kāyavivekacittavivekavikkhambhanavivekā daṭṭhabbā, lokuttaramaggakkhaṇe kāyavivekacittavivekasamucchedavivekapaṭippassaddhivivekanissaraṇavivekā.
And in both phrases, although the common word "secluded" (vivicca) encompasses the vivekas of suppression by substitution, cutting off, tranquilization, and escape, as well as physical seclusion, mental seclusion, and seclusion from defilements, nevertheless, in the preliminary stage, physical seclusion, mental seclusion, and seclusion by suppression should be understood; and at the moment of the supramundane path, physical seclusion, mental seclusion, seclusion by cutting off, seclusion by tranquilization, and seclusion by escape.
Và trong cả hai vế, mặc dù từ chung "ly" (vivicca) bao gồm cả tadaṅgaviveka (ly bằng chi phần đối nghịch), vikkhambhanaviveka (ly bằng sự trấn áp), samucchedaviveka (ly bằng sự đoạn tận), paṭippassaddhiviveka (ly bằng sự an tịnh), nissaraṇaviveka (ly bằng sự xuất ly), cũng như cittaviveka (tâm ly), kāyaviveka (thân ly), và upadhiviveka (ly khỏi các sanh y), tuy nhiên, trong giai đoạn chuẩn bị, nên hiểu là có kāyaviveka, cittaviveka và vikkhambhanaviveka; trong khoảnh khắc đạo siêu thế, có kāyaviveka, cittaviveka, samucchedaviveka, paṭippassaddhiviveka và nissaraṇaviveka.
Kāmehīti iminā pana padena ye ca mahāniddese ‘‘katame vatthukāmā manāpikā rūpā’’tiādinā (mahāni. 1) nayena vatthukāmā vuttā, ye ca tattheva vibhaṅge ca ‘‘chando kāmo, rāgo kāmo, chandarāgo kāmo, saṅkappo kāmo, rāgo kāmo, saṅkapparāgo kāmo’’ti (mahāni. 1; vibha. 564) evaṃ kilesakāmā vuttā, te sabbepi saṅgahitā icceva daṭṭhabbā.
By the word "from sense-desires" (kāmehi), all the object-sense-desires mentioned in the Mahāniddesa in the manner of "what are the pleasing forms that are object-sense-desires?" and so on, and all the defilement-sense-desires mentioned there and in the Vibhaṅga as "desire is a sense-desire, lust is a sense-desire, desirous lust is a sense-desire, intention is a sense-desire, lust is a sense-desire, intentional lust is a sense-desire," should be understood as encompassed.
Bằng từ kāmehi (các dục), nên hiểu rằng nó bao gồm cả hai loại: các vật dục (vatthukāma) đã được nói đến trong Mahāniddesa theo cách "Thế nào là vật dục? Các sắc khả ái...", và các phiền não dục (kilesakāma) đã được nói đến ở cùng nơi và trong Vibhaṅga là "Dục là chanda (ý muốn), dục là rāga (tham ái), dục là chandarāga (tham muốn), dục là saṅkappa (tư duy), dục là rāga (tham ái), dục là saṅkapparāga (tư duy tham ái)".
Evañhi sati vivicceva kāmehīti vatthukāmehipi viviccevāti attho yujjati.
When this is the case, the meaning "quite secluded from object-sense-desires" is appropriate for "quite secluded from sense-desires."
Vì khi hiểu như vậy, ý nghĩa của câu "vivicceva kāmehi" (ly dục) là "ly khỏi cả các vật dục" mới trở nên hợp lý.
Tena kāyaviveko vutto hoti.
By this, physical seclusion is stated.
Qua đó, kāyaviveka (thân ly) được nói đến.
Vivicca akusalehi dhammehīti kilesakāmehi sabbākusalehi vā viviccāti attho yujjati.
The meaning "secluded from defilement-sense-desires or from all unwholesome states" is appropriate for "secluded from unwholesome states" (vivicca akusalehi dhammehī).
Vivicca akusalehi dhammehi (ly các pháp bất thiện) có nghĩa là ly khỏi các phiền não dục hoặc ly khỏi tất cả các pháp bất thiện.
Tena cittaviveko vutto hoti.
By this, mental seclusion is stated.
Qua đó, cittaviveka (tâm ly) được nói đến.
Purimena cettha vatthukāmehi vivekavacanato eva kāmasukhapariccāgo, dutiyena kilesakāmehi vivekavacanato nekkhammasukhapariggaho vibhāvito hoti.
Here, by the former, the abandonment of sensual pleasure, due to the statement of seclusion from objective sensuality, and by the latter, the acquisition of the pleasure of renunciation, due to the statement of seclusion from defiling sensuality, is made clear.
Trong đó, vế trước, do nói về sự ly khỏi các vật dục, đã làm rõ sự từ bỏ dục lạc; vế sau, do nói về sự ly khỏi các phiền não dục, đã làm rõ sự nắm bắt lạc của sự xuất ly.
Evaṃ vatthukāmakilesakāmavivekavacanatoyeva ca etesaṃ paṭhamena saṃkilesavatthuppahānaṃ, dutiyena saṃkilesappahānaṃ.
And thus, due to the statement of seclusion from objective sensuality and defiling sensuality, by the former of these, the abandonment of the basis of defilement, and by the latter, the abandonment of defilement itself, is made clear.
Như vậy, chính do việc nói về sự ly khỏi vật dục và phiền não dục mà vế thứ nhất chỉ ra sự từ bỏ nền tảng của phiền não, và vế thứ hai chỉ ra sự từ bỏ chính phiền não.
Paṭhamena lolabhāvassa hetupariccāgo, dutiyena bālabhāvassa.
By the former, the abandonment of the cause of greed, and by the latter, the cause of foolishness.
Vế thứ nhất là sự từ bỏ nguyên nhân của trạng thái tham lam, vế thứ hai là sự từ bỏ nguyên nhân của trạng thái ngu si.
Paṭhamena ca payogasuddhi, dutiyena āsayaposanaṃ vibhāvitaṃ hotīti viññātabbaṃ.
And by the former, the purity of effort, and by the latter, the cultivation of intention, is made clear; thus it should be understood.
Và nên hiểu rằng, vế thứ nhất làm rõ sự trong sạch trong hành động, vế thứ hai làm rõ sự nuôi dưỡng ý hướng trong sạch.
Esa tāva nayo kāmehīti ettha vuttakāmesu vatthukāmapakkhe.
This is the method for the objective sensuality aspect among the sensuality mentioned in "from sensuality" (kāmehi).
Trước hết, đó là phương pháp trong trường hợp các dục được nói đến trong từ "kāmehi" là vật dục.
Kilesakāmapakkhe pana chandoti ca rāgoti ca evamādīhi anekabhedo kāmacchandova kāmoti adhippeto.
However, in the aspect of defiling sensuality, "sensuality" (kāma) is intended to mean kāmacchanda (sensual desire) itself, which has many distinctions such as "desire" (chanda) and "lust" (rāga).
Còn trong trường hợp phiền não dục, chính dục tham (kāmacchanda) với nhiều loại khác nhau như chanda (ý muốn), rāga (tham ái), v.v., được hiểu là "dục".
So ca akusalapariyāpannopi samāno ‘‘tattha katame kāmā, chando kāmo’’tiādinā (vibha. 564) nayena vibhaṅge upari jhānaṅgapaṭipakkhato visuṃ vutto, kilesakāmattā vā purimapade vutto, akusalapariyāpannattā dutiyapade.
Although it is included among unwholesome things, it is stated separately in the Vibhaṅga as being opposed to the jhāna factors, in the manner of "What are sensuality? Desire is sensuality." Or, because it is defiling sensuality, it is mentioned in the first phrase; because it is included among unwholesome things, it is mentioned in the second phrase.
Và dục tham đó, dù thuộc về bất thiện, nhưng trong Vibhaṅga, nó được nói riêng biệt vì là đối nghịch với các thiền chi ở phần sau, theo cách "Ở đây, thế nào là các dục? Dục là chanda..."; hoặc được nói ở vế trước vì là phiền não dục, và ở vế sau vì thuộc về bất thiện.
Anekabhedato cassa kāmatoti avatvā kāmehīti vuttaṃ.
And because it has many distinctions, it is said "from sensuality" (kāmehīti) instead of "from sensuality" (kāmatoti).
Và do có nhiều loại khác nhau, nên không nói là "kāmato" mà nói là "kāmehi".
Aññesampi ca dhammānaṃ akusalabhāve vijjamāne ‘‘tattha katame akusalā dhammā, kāmacchando’’tiādinā (vibha. 564) nayena vibhaṅge upari jhānaṅgapaccanīkapaṭipakkhabhāvadassanato nīvaraṇāneva vuttāni.
Even though other phenomena are also unwholesome, only the hindrances (nīvaraṇa) are mentioned in the Vibhaṅga, in the manner of "What are unwholesome phenomena? Sensual desire" (kāmacchando), because they are seen as the opposing factors to the jhāna factors mentioned above.
Và dù các pháp khác cũng có tính chất bất thiện, nhưng trong Vibhaṅga, chỉ có các triền cái được đề cập, theo cách "Ở đây, thế nào là các pháp bất thiện? Dục tham...", vì chúng được chỉ ra là đối nghịch và là kẻ thù của các thiền chi ở phần sau.
Nīvaraṇāni hi jhānaṅgapaccanīkāni, tesaṃ jhānaṅgāneva paṭipakkhāni viddhaṃsakāni vināsakānīti vuttaṃ hoti.
For the hindrances are indeed opposed to the jhāna factors, and the jhāna factors themselves are their opponents, their destroyers, their annihilators; thus it is said.
Điều này có nghĩa là: các triền cái là kẻ thù của các thiền chi, và chính các thiền chi là đối nghịch, là kẻ hủy diệt, là kẻ tiêu diệt chúng.
Tathā hi ‘‘samādhi kāmacchandassa paṭipakkho, pīti byāpādassa, vitakko thinamiddhassa, sukhaṃ uddhaccakukkuccassa, vicāro vicikicchāyā’’ti peṭake vuttaṃ.
Thus, it is stated in the Peṭaka: "Concentration is the opponent of sensual desire, joy of ill-will, initial application of sloth and torpor, happiness of restlessness and remorse, sustained application of doubt."
Thật vậy, trong Peṭaka đã nói: "Định là đối nghịch của dục tham, hỷ là đối nghịch của sân, tầm là đối nghịch của hôn trầm-thụy miên, lạc là đối nghịch của trạo cử-hối quá, tứ là đối nghịch của hoài nghi".
Evamettha ‘‘vivicceva kāmehī’’ti iminā kāmacchandassa vikkhambhanaviveko vutto hoti.
Thus, here, by "secluded from sensuality" (vivicceva kāmehīti), the suppression-seclusion (vikkhambhanaviveka) of sensual desire is stated.
Như vậy, ở đây, bằng câu "vivicceva kāmehi", sự ly bằng cách trấn áp (vikkhambhanaviveka) đối với dục tham được nói đến.
‘‘Vivicca akusalehi dhammehī’’ti iminā pañcannampi nīvaraṇānaṃ.
By "secluded from unwholesome phenomena" (vivicca akusalehi dhammehīti), that of all five hindrances.
Bằng câu "vivicca akusalehi dhammehi", sự ly bằng cách trấn áp đối với cả năm triền cái được nói đến.
Agahitaggahaṇena pana paṭhamena kāmacchandassa, dutiyena sesanīvaraṇānaṃ.
Furthermore, by taking what was not taken, by the first, that of sensual desire, and by the second, that of the remaining hindrances.
Hoặc, theo cách phân chia (agahitaggahaṇena), vế thứ nhất nói về dục tham, vế thứ hai nói về các triền cái còn lại.
Tathā paṭhamena tīsu akusalamūlesu pañcakāmaguṇabhedavisayassa lobhassa, dutiyena āghātavatthubhedādivisayānaṃ dosamohānaṃ.
Similarly, by the first, that of greed, which has the five strands of sensuality as its object within the three roots of unwholesomeness; by the second, that of hatred and delusion, which have the nine types of objects of resentment and so forth as their objects.
Tương tự, trong ba bất thiện căn, vế thứ nhất nói về tham có đối tượng là năm loại dục trần, vế thứ hai nói về sân và si có đối tượng là các loại sự vật gây phẫn nộ, v.v.
Oghādīsu vā dhammesu paṭhamena kāmoghakāmayogakāmāsavakāmupādānaabhijjhākāyagantha kāmarāgasaññojanānaṃ, dutiyena avasesaoghayogāsavaupādānaganthasaṃyojanānaṃ.
Or, among phenomena such as floods (ogha), by the first, that of the flood of sensuality (kāmogha), the yoke of sensuality (kāmayoga), the canker of sensuality (kāmāsava), the clinging to sensuality (kāmupādāna), covetousness (abhijjhā), the bodily fetter of sensuality (kāyagantha), and the fetter of sensual lust (kāmarāgasaññojana); by the second, that of the remaining floods, yokes, cankers, clingings, fetters, and bonds.
Hoặc trong các pháp như bộc lậu (ogha), v.v., vế thứ nhất nói về dục bộc, dục phược, dục lậu, dục thủ, tham thân kết, dục ái kết; vế thứ hai nói về các bộc lậu, phược, lậu, thủ, kết, và triền còn lại.
Paṭhamena taṇhāya taṃsampayuttakānañca, dutiyena avijjāya taṃsampayuttakānañca.
By the first, that of craving and its associated phenomena; by the second, that of ignorance and its associated phenomena.
Với từ đầu tiên (là) ái và các pháp tương ưng với nó, với từ thứ hai (là) vô minh và các pháp tương ưng với nó.
Apica paṭhamena lobhasampayuttaaṭṭhacittuppādānaṃ, dutiyena sesānaṃ catunnaṃ akusalacittuppādānaṃ vikkhambhanaviveko vutto hotīti veditabbo.
Furthermore, by the first, the suppression-seclusion of the eight consciousnesses associated with greed, and by the second, that of the remaining four unwholesome consciousnesses, should be understood.
Hơn nữa, cần phải hiểu rằng với từ đầu tiên, sự viễn ly bằng cách trấn áp tám tâm sở phát sinh tương ưng với tham được nói đến; với từ thứ hai, (sự viễn ly bằng cách trấn áp) bốn tâm sở bất thiện còn lại được nói đến.
Ettāvatā ca paṭhamassa jhānassa pahānaṅgaṃ dassetvā idāni sampayogaṅgaṃ dassetuṃ savitakkaṃ savicārantiādi vuttaṃ.
Having thus shown the factor of abandonment of the first jhāna, now to show the factor of association, "with initial application and sustained application" (savitakkaṃ savicāraṃ) and so forth is stated.
Và đến đây, sau khi đã chỉ ra chi phần từ bỏ của thiền thứ nhất, bây giờ để chỉ ra chi phần tương ưng, câu savitakkaṃ savicāra (có tầm có tứ) và các câu tiếp theo được nói đến.
Tattha ārammaṇe cittassa abhiniropanalakkhaṇo vitakko.
Among these, initial application (vitakka) is characterized by the directing of the mind onto the object.
Trong đó, vitakka (tầm) có đặc tính là sự hướng tâm đến đối tượng.
Ārammaṇānumajjanalakkhaṇo vicāro.
Sustained application (vicāra) is characterized by the repeatedly pondering of the object.
Vicāra (tứ) có đặc tính là sự khảo sát đối tượng.
Santepi ca nesaṃ katthaci avippayoge oḷārikaṭṭhena pubbaṅgamaṭṭhena ca ghaṇḍābhighāto viya cetaso paṭhamābhinipāto vitakko, sukhumaṭṭhena anumajjanasabhāvena ca ghaṇḍānuravo viya anuppabandho vicāro.
Even though they are inseparable in some instances, initial application is the mind's first impingement on the object, like the striking of a bell, due to its grossness and its nature as a forerunner; sustained application is the continuous dwelling, like the reverberation of a bell, due to its subtlety and its nature of repeatedly pondering.
Và mặc dù ở một số nơi chúng không tách rời, nhưng do tính chất thô thiển và đi trước, sự tác động đầu tiên của tâm, giống như tiếng chuông khi gõ, là vitakka; do tính chất vi tế và bản chất khảo sát theo sau, sự tiếp nối không gián đoạn, giống như tiếng vang của chuông, là vicāra.
Vipphāravā cettha vitakko paṭhamuppattikāle paripphandanabhūto cittassa, ākāse uppatitukāmassa pakkhino pakkhavikkhepo viya, padumābhimukhapāto viya ca gandhānubandhacetaso bhamarassa.
Here, initial application is the mind's expansive, fluttering state at the time of its first arising, like the flapping of a bird's wings wishing to fly into the sky, or like a bee with a mind intent on fragrance falling towards a lotus.
Trong đó, vitakka có sự lan tỏa, là sự rung động của tâm vào lúc khởi sinh ban đầu, giống như sự đập cánh của con chim muốn bay lên trời, và giống như sự lao đến hoa sen của con ong có tâm theo đuổi mùi hương.
Santavutti vicāro nātiparipphandanabhūto cittassa, ākāse uppatitassa pakkhino pakkhappasāraṇaṃ viya, paribbhamanaṃ viya ca padumābhimukhapatitassa bhamarassa padumassa uparibhāge.
Sustained application is the mind's calm activity, not excessively fluttering, like the spreading of a bird's wings after it has flown into the sky, or like a bee that has fallen towards a lotus hovering above the lotus.
Vicāra có sự vận hành tĩnh lặng, không quá rung động của tâm, giống như sự giang cánh của con chim đã bay lên trời, và giống như sự bay lượn trên hoa sen của con ong đã lao đến hoa sen.
Dukanipātaṭṭhakathāyaṃ pana ‘‘ākāse gacchato mahāsakuṇassa ubhohi pakkhehi vātaṃ gahetvā pakkhe sannisīdāpetvā gamanaṃ viya ārammaṇe cetaso abhiniropanabhāvena pavatto vitakko, vātaggahaṇatthaṃ pakkhe phandāpayamānassa gamanaṃ viya anumajjanabhāvena pavatto vicāro’’ti vuttaṃ.
In the Dukanipāta Aṭṭhakathā, it is said: "Vitakka is the mental factor that arises by way of directing the mind to the object, like a great bird flying in the sky, taking the wind with both wings, and then gliding without flapping. Vicāra is the mental factor that arises by way of repeatedly examining the object, like a bird flapping its wings to catch the wind while flying."
Tuy nhiên, trong Chú giải Dukanipāta có nói: “Vitakka là sự vận hành do bản chất hướng tâm đến đối tượng, giống như sự di chuyển của con chim lớn bay trên trời, sau khi dùng cả hai cánh để đón gió rồi duỗi thẳng cánh ra; vicāra là sự vận hành do bản chất khảo sát theo sau, giống như sự di chuyển của con chim đang đập cánh để đón gió”.
Taṃ anuppabandhena pavattiyaṃ yujjati.
That simile is appropriate when it occurs continuously in the object, in the context of upacāra-appanā.
Điều đó phù hợp với sự vận hành không gián đoạn.
So pana tesaṃ viseso paṭhamadutiyajjhānesu pākaṭo hoti.
However, the distinction between them becomes evident in the first and second jhānas.
Và sự khác biệt đó của chúng trở nên rõ ràng trong thiền thứ nhất và thiền thứ hai.
Apica malaggahitaṃ kaṃsabhājanaṃ ekena hatthena daḷhaṃ gahetvā itarena hatthena cuṇṇatelavālaṇḍupakena parimajjantassa daḷhaggahaṇahattho viya vitakko, parimajjanahattho viya vicāro.
Moreover, vitakka is like the hand firmly grasping a bronze vessel stained with grime, while vicāra is like the other hand scrubbing it with a mixture of powder, oil, and a brush.
Hơn nữa, vitakka giống như bàn tay giữ chặt của người đang dùng một tay giữ chặt chiếc bát đồng bị dính bẩn và dùng tay kia chà xát bằng bột, dầu và bàn chải; vicāra giống như bàn tay chà xát.
Tathā kumbhakārassa daṇḍappahārena cakkaṃ bhamayitvā bhājanaṃ karontassa uppīḷanahattho viya vitakko, ito cito ca saṃsaraṇahattho viya vicāro.
Similarly, vitakka is like the hand pressing down for a potter who spins the wheel with a stick to make a pot, while vicāra is like the hand moving here and there.
Tương tự, vitakka giống như bàn tay ấn xuống của người thợ gốm đang làm một cái bình sau khi đã làm cho bàn xoay quay bằng cách đẩy cây gậy; vicāra giống như bàn tay di chuyển qua lại.
Tathā maṇḍalaṃ karontassa majjhe sannirujjhitvā ṭhitakaṇṭako viya abhiniropano vitakko, bahi paribbhamanakaṇṭako viya anumajjano vicāro.
Likewise, vitakka is the directing of the mind, like a pin fixed in the center for drawing a circle, while vicāra is the repeated examination, like the pin revolving around the outside.
Tương tự, vitakka là sự hướng tâm, giống như cái compa được cắm cố định ở giữa của người đang vẽ một vòng tròn; vicāra là sự khảo sát, giống như cái compa quay xung quanh bên ngoài.
Iti iminā ca vitakkena iminā ca vicārena saha vattati rukkho viya pupphena phalena cāti idaṃ jhānaṃ ‘‘savitakkaṃ savicāra’’nti vuccati.
Thus, because this jhāna occurs together with this vitakka and this vicāra, like a tree with its flowers and fruits, this jhāna is called "with vitakka, with vicāra."
Vì vậy, thiền này vận hành cùng với vitakka này và vicāra này, giống như cây có hoa và quả, nên được gọi là “savitakkaṃ savicāra” (có tầm có tứ).
Vivekajanti ettha vivitti viveko, nīvaraṇavigamoti attho.
Here, vivekaja means vivitti or viveka, which is the absence of the nīvaraṇas (hindrances).
Vivekaja (do ly dục sinh): Ở đây, sự tách biệt là viveka (ly), có nghĩa là sự vắng mặt của các triền cái.
Vivittoti vā viveko, nīvaraṇavivitto jhānasampayuttadhammarāsīti attho.
Or, viveka means that which is free from the nīvaraṇas, i.e., the aggregate of mental factors associated with jhāna that are free from the nīvaraṇas.
Hoặc, sự tách biệt là viveka, có nghĩa là tập hợp các pháp tương ưng với thiền đã tách khỏi các triền cái.
Tasmā vivekā, tasmiṃ vā viveke jātanti vivekajaṃ.
Therefore, it is "born of seclusion" (vivekaja) because it arises from seclusion, or in that seclusion.
Do đó, nó sinh ra từ sự ly (viveka), hoặc sinh ra trong sự ly đó, nên gọi là vivekaja.
Pītisukhanti ettha pīṇayatīti pīti, sā sampiyāyanalakkhaṇā.
Here, pītisukha: pīti is that which gladdens; it has the characteristic of delighting in the object.
Pītisukha (hỷ lạc): Ở đây, cái làm cho vui thích là pīti (hỷ), nó có đặc tính là sự yêu mến.
Sā panesā khuddikā pīti, khaṇikā pīti, okkantikā pīti, ubbegā pīti, pharaṇā pītīti pañcavidhā hoti.
This pīti is of five kinds: minor pīti, momentary pīti, showering pīti, uplifting pīti, and pervading pīti.
Và pīti này có năm loại: khuddikā pīti (hỷ nhỏ), khaṇikā pīti (hỷ chốc lát), okkantikā pīti (hỷ lan tỏa từng đợt), ubbegā pīti (hỷ bay bổng), và pharaṇā pīti (hỷ tràn ngập).
Tattha khuddikā pīti sarīre lomahaṃsanamattameva kātuṃ sakkoti.
Among these, minor pīti can only cause goosebumps on the body.
Trong số đó, khuddikā pīti chỉ có thể làm cho lông trên cơ thể dựng đứng.
Khaṇikā pīti khaṇe khaṇe vijjuppādasadisā hoti.
Momentary pīti is like flashes of lightning occurring moment by moment.
Khaṇikā pīti giống như tia chớp lóe lên từng khoảnh khắc.
Okkantikā pīti samuddatīraṃ vīci viya kāyaṃ okkamitvā okkamitvā bhijjati.
Showering pīti breaks forth repeatedly, pervading the body like waves crashing on the seashore.
Okkantikā pīti tràn ngập thân thể rồi tan đi, giống như sóng vỗ vào bờ biển.
Ubbegā pīti balavatī hoti kāyaṃ uddhaggaṃ katvā ākāse laṅghāpanappamāṇappattā.
Uplifting pīti is powerful, capable of raising the body into the air.
Ubbegā pīti rất mạnh mẽ, đạt đến mức có thể làm cho cơ thể bay bổng lên không trung.
Pharaṇā pīti atibalavatī hoti.
Pervading pīti is exceedingly powerful.
Pharaṇā pīti cực kỳ mạnh mẽ.
Tāya hi uppannāya sakalasarīraṃ dhamitvā pūritavatthi viya mahatā udakoghena pakkhandapabbatakucchi viya ca anupariphuṭaṃ hoti.
When it arises, the entire body is completely pervaded, like a blown-up bladder or a mountain cave filled with a great deluge of water.
Khi nó phát sinh, toàn bộ cơ thể trở nên tràn ngập, giống như một cái bong bóng được thổi đầy hơi, hoặc giống như một hang núi bị một dòng nước lớn tràn vào.
Sā panesā pañcavidhā pīti gabbhaṃ gaṇhantī paripākaṃ gacchantī duvidhaṃ passaddhiṃ paripūreti kāyapassaddhiñca cittapassaddhiñca.
This fivefold pīti, when conceived and matured, perfects two kinds of tranquility: bodily tranquility (kāyapassaddhi) and mental tranquility (cittapassaddhi).
Và năm loại pīti này, khi được thai nghén và đi đến chín muồi, sẽ làm viên mãn hai loại passaddhi (tịnh): kāyapassaddhi (thân tịnh) và cittapassaddhi (tâm tịnh).
Passaddhi gabbhaṃ gaṇhantī paripākaṃ gacchantī duvidhampi sukhaṃ paripūreti kāyikañca cetasikañca.
Tranquility, when conceived and matured, perfects two kinds of happiness: bodily happiness (kāyika sukha) and mental happiness (cetasika sukha).
Passaddhi, khi được thai nghén và đi đến chín muồi, sẽ làm viên mãn cả hai loại sukha (lạc): kāyika (thân lạc) và cetasika (tâm lạc).
Sukhaṃ gabbhaṃ gaṇhantaṃ paripākaṃ gacchantaṃ tividhaṃ samādhiṃ paripūreti – khaṇikasamādhiṃ, upacārasamādhiṃ, appanāsamādhiñcāti.
Happiness, when conceived and matured, perfects three kinds of concentration (samādhi): momentary concentration (khaṇikasamādhi), access concentration (upacārasamādhi), and absorption concentration (appanāsamādhi).
Sukha, khi được thai nghén và đi đến chín muồi, sẽ làm viên mãn ba loại samādhi (định): khaṇikasamādhi (sát-na định), upacārasamādhi (cận hành định), và appanāsamādhi (an chỉ định).
Tāsu ca yā appanāsamādhissa mūlaṃ hutvā vaḍḍhamānā samādhisampayogaṃ gatā pharaṇā pīti, ayaṃ imasmiṃ atthe adhippetā pītīti.
Among these, the pervading pīti which becomes the root of appanāsamādhi, develops, and attains association with samādhi, is the pīti intended in this context.
Trong số đó, pharaṇā pīti, vốn là gốc rễ của appanāsamādhi, phát triển và đi đến sự tương ưng với định, chính là pīti được nói đến trong ngữ cảnh này.
Itaraṃ pana sukhayatīti sukhaṃ, yassuppajjati, taṃ sukhitaṃ karotīti attho.
The other, happiness (sukha), is that which makes happy; it means that it makes a person happy when it arises in them.
Phần còn lại, cái làm cho an lạc là sukha (lạc), nghĩa là nó làm cho người mà nó phát sinh được an lạc.
Sukhanaṃ vā sukhaṃ, suṭṭhu vā khādati, khaṇati ca kāyacittābādhanti sukhaṃ, somanassavedanāyetaṃ nāmaṃ.
Or, sukha is the state of being happy; or it thoroughly consumes and digs out bodily and mental afflictions, hence sukha; this is a name for pleasant feeling (somanassavedanā).
Hoặc, sự an lạc là sukha; hoặc, nó ăn mòn, đào bới sự đau khổ của thân và tâm một cách tốt đẹp, nên gọi là sukha; đây là tên gọi của thọ hỷ (somanassavedanā).
Taṃ sātalakkhaṇaṃ.
It has the characteristic of pleasantness.
Nó có đặc tính là sự ngọt ngào.
Santepi ca nesaṃ katthaci avippayoge iṭṭhārammaṇapaṭilābhatuṭṭhi pīti, paṭiladdharasānubhavanaṃ sukhaṃ.
Even though they are not separated in some instances, pīti is the delight in obtaining a desirable object, and sukha is the experience of the taste of what has been obtained.
Và mặc dù ở một số nơi chúng không tách rời, nhưng sự vui mừng khi có được đối tượng mong muốn là pīti; sự hưởng thụ hương vị của cái đã có được là sukha.
Yattha pīti, tattha sukhaṃ.
Where there is pīti, there is sukha.
Nơi nào có pīti, nơi đó có sukha.
Yattha sukhaṃ, tattha na niyamato pīti.
Where there is sukha, pīti is not necessarily present.
Nơi nào có sukha, không nhất thiết phải có pīti.
Saṅkhārakkhandhasaṅgahitā pīti, vedanākkhandhasaṅgahitaṃ sukhaṃ.
Pīti is included in the aggregate of mental formations (saṅkhārakkhandha), while sukha is included in the aggregate of feeling (vedanākkhandha).
Pīti được bao gồm trong hành uẩn (saṅkhārakkhandha), sukha được bao gồm trong thọ uẩn (vedanākkhandha).
Kantārakhinnassa vanantudakadassanasavanesu viya pīti, vanacchāyāpavesanaudakaparibhogesu viya sukhaṃ.
It is like the pīti of a weary traveler seeing water in a forest or hearing about it, and the sukha of entering the forest shade and consuming the water.
Pīti giống như việc nhìn thấy và nghe nói về rừng và nước của người mệt mỏi trong sa mạc; sukha giống như việc đi vào bóng mát của rừng và sử dụng nước.
Tasmiṃ tasmiṃ samaye pākaṭabhāvato cetaṃ vuttanti veditabbaṃ.
It should be understood that this is stated due to their prominence at different times.
Và cần phải hiểu rằng điều này được nói đến do sự nổi bật của chúng vào những thời điểm tương ứng.
Iti ayañca pīti idañca sukhaṃ assa jhānassa, asmiṃ vā jhāne atthīti idaṃ jhānaṃ ‘‘pītisukha’’nti vuccati.
Thus, because this pīti and this sukha are in this jhāna, or belong to this jhāna, this jhāna is called " pītisukha."
Vì vậy, pīti này và sukha này thuộc về thiền này, hoặc có trong thiền này, nên thiền này được gọi là “pītisukha”.
Atha vā pīti ca sukhañca pītisukhaṃ dhammavinayādayo viya.
Alternatively, pīti and sukha together form pītisukha, like dhammavinaya (Dhamma and Vinaya) and so forth.
Hoặc là, pīti và sukha là pītisukha, giống như dhammavinaya (pháp và luật).
Vivekajaṃ pītisukhaṃ assa jhānassa, asmiṃ vā jhāne atthīti evampi vivekajaṃ pītisukhaṃ.
Joy and happiness born of seclusion belong to this jhāna, or are present in this jhāna; thus, it is also joy and happiness born of seclusion.
Pītisukha do ly dục sinh thuộc về thiền này, hoặc có trong thiền này, nên cũng là vivekajaṃ pītisukhaṃ.
Yatheva hi jhānaṃ, evaṃ pītisukhampettha vivekajameva hoti.
For just as the jhāna itself is born of seclusion, so too are the joy and happiness here born of seclusion.
Vì giống như thiền, pītisukha ở đây cũng do ly dục sinh.
Tañcassa atthīti tasmā alopasamāsaṃ katvā ekapadeneva ‘‘vivekajaṃpītisukha’’ntipi vattuṃ yujjati.
And since that (joy and happiness) are present in it, it is therefore appropriate to say "joy and happiness born of seclusion" as a single compound word, forming an alopa-samāsa.
Và nó có điều đó, do đó, sau khi tạo thành một hợp từ không lược bỏ (alopasamāsa), cũng có thể nói bằng một từ duy nhất là “vivekajaṃpītisukha”.
Paṭhamanti gaṇanānupubbatā paṭhamaṃ, paṭhamaṃ uppannantipi paṭhamaṃ.
First (paṭhamaṃ) means first in numerical order, or first as that which arises first.
Paṭhama (thứ nhất): Là thứ nhất theo thứ tự đếm, cũng là thứ nhất vì nó phát sinh đầu tiên.
Jhānanti duvidhaṃ jhānaṃ ārammaṇūpanijjhānañca lakkhaṇūpanijjhānañca.
Jhāna is twofold: jhāna as absorption in the object (ārammaṇūpanijjhāna) and jhāna as absorption in characteristics (lakkhaṇūpanijjhāna).
Jhāna (thiền): Jhāna có hai loại: ārammaṇūpanijjhāna (sự quán chiếu đối tượng) và lakkhaṇūpanijjhāna (sự quán chiếu đặc tính).
Tattha aṭṭha samāpattiyo pathavīkasiṇādiārammaṇaṃ upanijjhāyantīti ‘‘ārammaṇūpanijjhāna’’nti saṅkhyaṃ gatā.
Among these, the eight attainments are called "absorption in the object" because they absorb in objects such as the earth kasiṇa.
Trong đó, tám tầng thiền định được gọi là “ārammaṇūpanijjhāna” vì chúng quán chiếu các đối tượng như pathavīkasiṇa (biến xứ đất), v.v.
Vipassanāmaggaphalāni pana lakkhaṇūpanijjhānaṃ nāma.
Insight, path, and fruition are called absorption in characteristics.
Còn vipassanā (minh sát), magga (đạo) và phala (quả) được gọi là lakkhaṇūpanijjhāna.
Tattha vipassanā aniccādilakkhaṇassa upanijjhānato lakkhaṇūpanijjhānaṃ, vipassanāya katakiccassa maggena ijjhanato maggo lakkhaṇūpanijjhānaṃ, phalaṃ pana nirodhasaccaṃ tathalakkhaṇaṃ upanijjhāyatīti lakkhaṇūpanijjhānaṃ.
Among these, insight is absorption in characteristics because it absorbs in characteristics such as impermanence; the path is absorption in characteristics because the task accomplished by insight is fulfilled by the path; fruition, however, is absorption in characteristics because it absorbs in the characteristic of the truth of cessation (nirodhasacca).
Trong đó, vipassanā là lakkhaṇūpanijjhāna do sự quán chiếu các đặc tính như vô thường, v.v.; magga là lakkhaṇūpanijjhāna do sự thành tựu qua đạo lộ những gì đã được thực hiện bởi vipassanā; còn phala là lakkhaṇūpanijjhāna vì nó quán chiếu Diệt đế (nirodhasacca) có đặc tính như vậy.
Tesu idha pubbabhāge ārammaṇūpanijjhānaṃ, lokuttaramaggakkhaṇe lakkhaṇūpanijjhānaṃ adhippetaṃ, tasmā ārammaṇūpanijjhānato lakkhaṇūpanijjhānato paccanīkajjhāpanato ca ‘‘jhāna’’nti veditabbaṃ.
Among these, here, in the preliminary stage, absorption in the object is intended, while at the moment of the supramundane path, absorption in characteristics is intended; therefore, "jhāna" should be understood as absorption in the object, absorption in characteristics, and the burning up of adversaries.
Trong số đó, ở đây, trong giai đoạn tiền đạo, ārammaṇūpanijjhāna được nói đến; trong khoảnh khắc của đạo siêu thế, lakkhaṇūpanijjhāna được nói đến. Do đó, cần phải hiểu là “jhāna” do sự quán chiếu đối tượng, sự quán chiếu đặc tính, và sự thiêu đốt các pháp đối nghịch.
Upasampajjāti upagantvā, pāpuṇitvāti vuttaṃ hoti.
Having entered (upasampajjā) means having approached, having attained.
Upasampajja (đạt đến): Có nghĩa là đã đến gần, đã đạt được.
Upasampādayitvā vā, nipphādetvāti vuttaṃ hoti.
Or, having brought to completion, having accomplished.
Hoặc, sau khi làm cho thành tựu, có nghĩa là đã hoàn thành.
Viharatīti tadanurūpena iriyāpathavihārena iriyati, vuttappakārajhānasamaṅgī hutvā attabhāvassa vuttiṃ abhinipphādeti.
Dwells (viharatī) means he conducts himself with a mode of deportment (iriyāpathavihāra) suitable for that, being endowed with the jhāna of the aforementioned kind, he brings about the continuity of his existence.
Viharatī (trú) có nghĩa là sống với oai nghi tương ứng, sau khi đã thành tựu thiền định theo cách đã nói, vị ấy hoàn thiện sự tồn tại của tự thân.
Vitakkavicārānaṃ vūpasamāti ettha vitakkassa ca vicārassa cāti imesaṃ dvinnaṃ vūpasamā samatikkamā, dutiyajjhānakkhaṇe apātubhāvāti vuttaṃ hoti.
With the stilling of vitakka and vicāra (vitakkavicārānaṃ vūpasamā) means with the stilling of these two, vitakka and vicāra, with their transcendence, meaning their non-appearance at the moment of the second jhāna.
Vitakkavicārānaṃ vūpasamā (do sự an tịnh của tầm và tứ): Ở đây, có nghĩa là do sự an tịnh, do sự vượt qua của hai pháp này, tức là của tầm và của tứ; do chúng không xuất hiện trong khoảnh khắc của thiền thứ hai.
Tattha kiñcāpi dutiyajjhāne sabbepi paṭhamajjhānadhammā na santi, aññeyeva hi paṭhamajjhāne phassādayo, aññe idhāti.
Although all the factors of the first jhāna are not present in the second jhāna, for the contact and other factors in the first jhāna are different from those here.
Ở đó, mặc dù trong thiền thứ hai, tất cả các pháp của thiền thứ nhất đều không tồn tại, vì các pháp như xúc trong thiền thứ nhất là khác, và ở đây chúng là khác.
Oḷārikassa pana oḷārikassa aṅgassa samatikkamā paṭhamajjhānato paresaṃ dutiyajjhānādīnaṃ adhigamo hotīti dassanatthaṃ ‘‘vitakkavicārānaṃ vūpasamā’’ti evaṃ vuttanti veditabbaṃ.
However, it should be understood that "with the stilling of vitakka and vicāra" is said to show that the attainment of the second jhāna and so forth, which come after the first jhāna, occurs through the transcendence of the grosser and grosser factors.
Tuy nhiên, cần hiểu rằng việc chứng đắc các thiền sau, từ thiền thứ hai trở đi, sau thiền thứ nhất, xảy ra do sự vượt qua các chi phần thô thiển, và để chỉ ra điều này, câu "do sự an tịnh của tầm và tứ" đã được nói đến.
Ajjhattanti idha niyakajjhattaṃ adhippetaṃ, tasmā attani jātaṃ, attasantāne nibbattanti attho.
Internal (ajjhattaṃ) here refers to one's own internal state; therefore, the meaning is that which is born in oneself, that which arises in one's own continuum.
Ajjhattaṃ (nội): Ở đây, nó chỉ đến nội tâm của chính mình, do đó, ý nghĩa là sinh khởi trong tự thân, phát sinh trong dòng tâm thức của chính mình.
Sampasādananti sampasādanaṃ vuccati saddhā.
Sampasādana (clarity) refers to saddhā (faith).
Sampasādanaṃ (sự trong sạch): Sự trong sạch được gọi là tín.
Sampasādanayogato jhānampi sampasādanaṃ nīlavaṇṇayogato nīlavatthaṃ viya.
Due to its association with sampasādana, jhāna is also called sampasādana, just as a blue cloth is called blue due to its association with the blue color.
Do sự kết hợp với sự trong sạch, thiền cũng được gọi là sự trong sạch, giống như tấm vải màu xanh do sự kết hợp với màu xanh.
Yasmā vā taṃ jhānaṃ sampasādanasamannāgatattā vitakkavicārakkhobhavūpasamanena ca ceto sampasādayati, tasmāpi sampasādananti vuttaṃ.
Or, because that jhāna, being endowed with sampasādana and by stilling the agitation of vitakka and vicāra, clarifies the mind, it is therefore also called sampasādana.
Hoặc vì thiền đó, do được trang bị sự trong sạch và do sự an tịnh của sự xáo động từ tầm và tứ, làm cho tâm trở nên trong sạch, nên nó cũng được gọi là sự trong sạch.
Imasmiñca atthavikappe sampasādanaṃ cetasoti evaṃ padasambandho veditabbo, purimasmiṃ pana atthavikappe cetasoti etaṃ ekodibhāvena saddhiṃ yojetabbaṃ.
In this interpretation of the meaning, the word connection should be understood as "clarity of mind" (sampasādanaṃ cetaso); in the former interpretation, however, "of mind" (cetaso) should be connected with "one-pointedness" (ekodibhāvena).
Và trong cách giải thích ý nghĩa này, cần hiểu mối liên hệ của các từ là "sự trong sạch của tâm"; còn trong cách giải thích ý nghĩa trước, từ "của tâm" (cetaso) nên được kết hợp với "sự phát triển nhất tâm" (ekodibhāva).
Tatrāyaṃ atthayojanā – eko udetīti ekodi, vitakkavicārehi anajjhārūḷhattā aggo seṭṭho hutvā udetīti attho.
Here is the explanation of the meaning: one (eko) arises (udeti), hence ekodi (one-pointedness); the meaning is that it arises as excellent, supreme, because it is not overwhelmed by vitakka and vicāra.
Ở đó, đây là cách kết hợp ý nghĩa: "sinh khởi một cách duy nhất" là ekodi; ý nghĩa là sinh khởi một cách cao tột, ưu việt, do không bị tầm và tứ chi phối.
Seṭṭhopi hi loke ekoti vuccati.
Indeed, even what is supreme is called "one" in the world.
Vì người ưu việt cũng được gọi là "duy nhất" (eko) trong đời.
Vitakkavicāravirahito vā eko asahāyo hutvā itipi vattuṃ vaṭṭati.
Or, it is also appropriate to say that it is "one," without a companion, being devoid of vitakka and vicāra.
Hoặc cũng có thể nói rằng, do không có tầm và tứ, nó sinh khởi một mình, không có bạn đồng hành.
Atha vā sampayuttadhamme udāyatīti udi, uṭṭhapetīti attho.
Alternatively, it causes the associated phenomena to arise (udāyati), meaning it establishes them.
Hoặc, "làm cho sinh khởi" (udāyati) các pháp tương ưng, ý nghĩa là "làm cho phát sinh" (uṭṭhapeti).
Seṭṭhaṭṭhena eko ca so udi cāti ekodi.
It is one (eko) in the sense of being supreme, and it causes to arise (udi), thus ekodi.
Vừa là "duy nhất" (eko) theo nghĩa ưu việt, vừa là "làm cho sinh khởi" (udi), nên gọi là ekodi.
Samādhissetaṃ adhivacanaṃ.
This is a designation for samādhi.
Đây là một tên gọi khác của định.
Iti imaṃ ekodiṃ bhāveti vaḍḍhetīti idaṃ dutiyaṃ jhānaṃ ekodibhāvaṃ.
Thus, this second jhāna is ekodibhāvaṃ (one-pointedness) because it develops and increases this ekodi.
Vì vậy, thiền thứ hai này "làm cho phát triển, làm cho tăng trưởng" (bhāveti vaḍḍheti) cái ekodi này, nên được gọi là ekodibhāvaṃ (sự phát triển nhất tâm).
So panāyaṃ ekodi yasmā cetaso, na sattassa na jīvassa.
But this ekodi belongs to the mind (cetaso), not to a being (sattassa) or a soul (jīvassa).
Và ekodi này là của tâm, không phải của chúng sinh, không phải của sinh mạng.
Tasmā etaṃ ‘‘cetaso ekodibhāva’’nti vuttaṃ.
Therefore, it is said to be "the one-pointedness of the mind."
Do đó, nó được gọi là "sự phát triển nhất tâm của tâm" (cetaso ekodibhāvaṃ).
Nanu cāyaṃ saddhā paṭhamajjhānepi atthi, ayañca ekodināmako samādhi.
But is not this saddhā present even in the first jhāna, and is not this samādhi called ekodi?
Chẳng phải tín này cũng có trong thiền thứ nhất sao, và cả định có tên là ekodi này nữa?
Atha kasmā idameva ‘‘sampasādanaṃ cetaso ekodibhāva’’nti ca vuttanti?
Then why is only this (second jhāna) referred to as "clarity of mind and one-pointedness"?
Vậy tại sao chỉ ở đây mới được gọi là "sự trong sạch, sự phát triển nhất tâm của tâm"?
Vuccate – aduñhi paṭhamajjhānaṃ vitakkavicārakkhobhena vīcitaraṅgasamākulamiva jalaṃ na suppasannaṃ hoti, tasmā satiyāpi saddhāya ‘‘sampasādana’’nti na vuttaṃ.
It is said: That first jhāna is not perfectly clear, like water agitated by waves due to the disturbance of vitakka and vicāra; therefore, even though saddhā is present, it is not called "clarity."
Xin trả lời: Thiền thứ nhất đó, do sự xáo động của tầm và tứ, giống như nước bị khuấy động bởi sóng gợn, không hoàn toàn trong sạch, do đó, mặc dù có tín, nó không được gọi là "sự trong sạch".
Na suppasannattāyeva cettha samādhipi na suṭṭhu pākaṭo.
And because it is not perfectly clear, samādhi is also not very manifest here.
Và chính vì không hoàn toàn trong sạch, nên định ở đó cũng không thật sự rõ ràng.
Tasmā ‘‘ekodibhāva’’ntipi na vuttaṃ.
Therefore, even ‘ekodibhāva’ was not stated.
Do đó, nó cũng không được gọi là "sự phát triển nhất tâm".
Imasmiṃ pana jhāne vitakkavicārapalibodhābhāvena laddhokāsā balavatī saddhā, balavasaddhāsahāyapaṭilābheneva ca samādhipi pākaṭo, tasmā idameva evaṃ vuttanti veditabbaṃ.
However, in this jhāna, due to the absence of the impediments of vitakka and vicāra, faith, having found its opportunity, becomes strong; and by the acquisition of strong faith as an ally, samādhi also becomes manifest. Therefore, it should be understood that only this* was stated in this manner.
Nhưng trong thiền này, do không có sự cản trở của tầm và tứ, tín có cơ hội trở nên mạnh mẽ, và chính nhờ có được sự hỗ trợ của tín mạnh mẽ, định cũng trở nên rõ ràng, do đó, cần hiểu rằng chỉ ở đây mới được gọi như vậy.
Avitakkaṃ avicāranti bhāvanāya pahīnattā etasmiṃ, etassa vā vitakko natthīti avitakkaṃ.
Avitakkaṃ avicāraṃ (without vitakka, without vicāra) means that in this jhāna, or for this jhāna, vitakka is absent due to its abandonment through development.
Avitakkaṃ avicāraṃ (không tầm, không tứ): Trong thiền này, hoặc đối với thiền này, không có tầm do đã được đoạn trừ bằng sự tu tập, nên gọi là không tầm.
Imināva nayena avicāraṃ.
In the same manner, it is avicāra.
Theo cách tương tự, là không tứ.
Etthāha – ‘‘nanu ca ‘vitakkavicārānaṃ vūpasamā’ti imināpi ayamattho siddho.
Here it is asked: “Is not this meaning already established by the phrase ‘due to the subsiding of vitakka and vicāra’?
Ở đây, có người hỏi: "Chẳng phải ý nghĩa này đã được xác định bởi câu 'do sự an tịnh của tầm và tứ' rồi sao?
Atha kasmā puna vuttaṃ ‘avitakkaṃ avicāra’nti’’?
Then why is it stated again as ‘avitakkaṃ avicāraṃ’?”
Vậy tại sao lại nói thêm 'không tầm, không tứ'?"
Vuccate – evametaṃ, siddhovāyamattho, na panetaṃ tadatthadīpakaṃ, nanu avocumha ‘‘oḷārikassa pana oḷārikassa aṅgassa samatikkamā paṭhamajjhānato paresaṃ dutiyajjhānādīnaṃ samadhigamo hotīti dassanatthaṃ vitakkavicārānaṃ vūpasamāti evaṃ vutta’’nti.
It is said: It is so; this meaning is indeed established, but that phrase does not clarify that meaning. Did we not say, “It was stated as ‘the subsiding of vitakka and vicāra’ to show that the attainment of the second jhāna and so on, after the first jhāna, occurs through the transcending of grosser and grosser factors”?
Xin trả lời: Đúng vậy, ý nghĩa đó đã được xác định, nhưng câu đó không phải để làm rõ ý nghĩa ấy. Chẳng phải chúng tôi đã nói: "Việc chứng đắc các thiền sau, từ thiền thứ hai trở đi, sau thiền thứ nhất, xảy ra do sự vượt qua các chi phần thô thiển, và để chỉ ra điều này, câu 'do sự an tịnh của tầm và tứ' đã được nói đến" hay sao?
Apica vitakkavicārānaṃ vūpasamā idaṃ sampasādanaṃ, na kilesakālussiyassa.
Furthermore, this purification (sampasādana) is due to the subsiding of vitakka and vicāra, not due to the agitation of defilements.
Hơn nữa, do sự an tịnh của tầm và tứ mà có sự trong sạch này, chứ không phải do sự an tịnh của sự ô nhiễm từ phiền não.
Vitakkavicārānañca vūpasamā ekodibhāvaṃ, na upacārajjhānamiva nīvaraṇappahānā, na paṭhamajjhānamiva ca aṅgapātubhāvāti evaṃ sampasādanaekodibhāvānaṃ hetuparidīpakamidaṃ vacanaṃ.
And this one-pointedness (ekodibhāva) is due to the subsiding of vitakka and vicāra, not due to the abandonment of hindrances like in access concentration (upacāra-jhāna), nor due to the manifestation of factors like in the first jhāna. Thus, this statement clarifies the cause of purification and one-pointedness.
Và do sự an tịnh của tầm và tứ mà có sự phát triển nhất tâm, chứ không phải do sự đoạn trừ các triền cái như thiền cận định, và cũng không phải do sự xuất hiện của các chi phần như thiền thứ nhất. Như vậy, câu này làm rõ nguyên nhân của sự trong sạch và sự phát triển nhất tâm.
Tathā vitakkavicārānaṃ vūpasamā idaṃ avitakkaavicāraṃ, na tatiyacatutthajjhānāni viya cakkhuviññāṇādīni viya ca abhāvāti evaṃ avitakkaavicārabhāvassa hetuparidīpakañca.
Likewise, this state of being without vitakka and vicāra (avitakka-avicāra) is due to the subsiding of vitakka and vicāra, not due to their non-existence like in the third and fourth jhāna, or like eye-consciousness and so on. Thus, it also clarifies the cause of the state of being avitakka-avicāra.
Tương tự, do sự an tịnh của tầm và tứ mà có trạng thái không tầm, không tứ này, chứ không phải do sự vắng mặt (của chúng) như trong thiền thứ ba, thứ tư, hoặc như trong nhãn thức v.v. Như vậy, nó cũng làm rõ nguyên nhân của trạng thái không tầm, không tứ.
Na vitakkavicārābhāvamattaparidīpakaṃ, vitakkavicārābhāvamattaparidīpakameva pana ‘‘avitakkaṃ avicāra’’nti idaṃ vacanaṃ.
It does not merely clarify the non-existence of vitakka and vicāra; rather, the statement “avitakkaṃ avicāraṃ” merely clarifies the non-existence of vitakka and vicāra.
Nó không chỉ đơn thuần làm rõ sự vắng mặt của tầm và tứ. Chính câu "không tầm, không tứ" mới là câu chỉ đơn thuần làm rõ sự vắng mặt của tầm và tứ.
Tasmā purimaṃ vatvāpi puna vattabbamevāti.
Therefore, even after stating the former, it must be stated again.
Do đó, sau khi đã nói câu trước, câu sau vẫn cần phải được nói đến.
Samādhijanti paṭhamajjhānasamādhito, sampayuttasamādhito vā jātanti attho.
Samādhijaṃ means born from the samādhi of the first jhāna, or born from the associated samādhi.
Samādhijaṃ (do định sinh): Ý nghĩa là sinh từ định của thiền thứ nhất, hoặc từ định tương ưng.
Tattha kiñcāpi paṭhamajjhānampi sampayuttasamādhito jātaṃ, atha kho ayameva samādhi ‘‘samādhī’’ti vattabbataṃ arahati vitakkavicārakkhobhavirahena ativiya acalattā suppasannattā ca.
Although the samādhi of the first jhāna is also born from associated samādhi, this samādhi alone is worthy of being called “samādhi” because it is exceedingly unshakeable and perfectly clear, being free from the agitation of vitakka and vicāra.
Ở đó, mặc dù thiền thứ nhất cũng sinh từ định tương ưng, nhưng chính định này mới xứng đáng được gọi là "định", vì nó vô cùng bất động và hoàn toàn trong sạch do không có sự xáo động của tầm và tứ.
Tasmā imassa vaṇṇabhaṇanatthaṃ idameva ‘‘samādhija’’nti vuttaṃ.
Therefore, to praise its excellence, only this* is called “samādhijaṃ”.
Do đó, để tán thán nó, chỉ ở đây mới được gọi là "do định sinh".
Pītisukhanti idaṃ vuttanayameva.
Pītisukhaṃ (joy and happiness) is as explained previously.
Pītisukhaṃ (hỷ lạc): Điều này đã được giải thích theo cách đã nói.
Dutiyanti gaṇanānupubbatā dutiyaṃ, idaṃ dutiyaṃ uppannantipi dutiyaṃ.
Dutiyaṃ (second) means second in numerical order, and also second because it is the second to arise.
Dutiyaṃ (thứ hai): Là thứ hai theo thứ tự đếm; hoặc là thứ hai vì nó sinh khởi thứ hai.
Pītiyā ca virāgāti virāgo nāma vuttappakārāya pītiyā jigucchanaṃ vā samatikkamo vā, ubhinnaṃ pana antarā casaddo sampiṇḍanattho, so vūpasamaṃ vā sampiṇḍeti vitakkavicāravūpasamaṃ vā.
Pītiyā ca virāgā (from the fading of joy): Virāga means either disgust with joy of the described kind, or its transcendence. The word ‘ca’ between the two terms (pīti and virāga) has the meaning of combining. It combines either subsiding or the subsiding of vitakka and vicāra.
Pītiyā ca virāgā (do ly hỷ): Ly tham (virāga) ở đây có nghĩa là sự nhàm chán hoặc sự vượt qua đối với hỷ đã được nói đến. Từ "ca" (và) ở giữa hai từ có ý nghĩa tổng hợp, nó tổng hợp sự an tịnh hoặc tổng hợp sự an tịnh của tầm và tứ.
Tattha yadā vūpasamameva sampiṇḍeti, tadā pītiyā virāgā ca, kiñca bhiyyo vūpasamā cāti evaṃ yojanā veditabbā.
Therein, when it combines only subsiding, then the phrasing should be understood as: “from the fading of joy, and furthermore, from its subsiding.”
Ở đó, khi nó chỉ tổng hợp sự an tịnh, thì cần hiểu cách kết hợp là: do ly hỷ, và hơn nữa, do sự an tịnh.
Imissā ca yojanāya virāgo jigucchanattho hoti, tasmā pītiyā jigucchanā ca samatikkamā cāti ayamattho daṭṭhabbo.
And in this phrasing, virāga means disgust. Therefore, the meaning should be understood as: “from disgust with joy, and from its transcendence.”
Và trong cách kết hợp này, "ly tham" (virāga) có nghĩa là nhàm chán, do đó, cần hiểu ý nghĩa là: do sự nhàm chán và sự vượt qua đối với hỷ.
Yadā pana vitakkavicāravūpasamaṃ sampiṇḍeti, tadā pītiyā ca virāgā, kiñca bhiyyo vitakkavicārānañca vūpasamāti evaṃ yojanā veditabbā.
However, when it combines the subsiding of vitakka and vicāra, then the phrasing should be understood as: “from the fading of joy, and furthermore, from the subsiding of vitakka and vicāra.”
Còn khi nó tổng hợp sự an tịnh của tầm và tứ, thì cần hiểu cách kết hợp là: do ly hỷ, và hơn nữa, do sự an tịnh của tầm và tứ.
Imissā ca yojanāya virāgo samatikkamanattho hoti, tasmā pītiyā ca samatikkamā, vitakkavicārānañca vūpasamāti ayamattho daṭṭhabbo.
And in this phrasing, virāga means transcendence. Therefore, the meaning should be understood as: “from the transcendence of joy, and from the subsiding of vitakka and vicāra.”
Và trong cách kết hợp này, "ly tham" (virāga) có nghĩa là vượt qua, do đó, cần hiểu ý nghĩa là: do sự vượt qua đối với hỷ, và do sự an tịnh của tầm và tứ.
Kāmañcete vitakkavicārā dutiyajjhāneyeva vūpasantā, imassa pana jhānassa maggaparidīpanatthaṃ vaṇṇabhaṇanatthañcetaṃ vuttaṃ.
Although these vitakka and vicāra have indeed subsided in the second jhāna itself, this statement is made to clarify the path to this jhāna and to praise its excellence.
Mặc dù tầm và tứ này đã được an tịnh ngay trong thiền thứ hai, nhưng điều này được nói đến để chỉ rõ con đường và để tán thán thiền này.
Vitakkavicārānaṃ vūpasamāti hi vutte idaṃ paññāyati ‘‘nūna vitakkavicāravūpasamo maggo imassa jhānassā’’ti.
For when it is said, “due to the subsiding of vitakka and vicāra,” it is understood that “surely the subsiding of vitakka and vicāra is the path to this jhāna.”
Vì khi nói "do sự an tịnh của tầm và tứ", điều này được hiểu rằng "chắc chắn sự an tịnh của tầm và tứ là con đường của thiền này".
Yathā ca tatiye ariyamagge appahīnānampi sakkāyadiṭṭhādīnaṃ ‘‘pañcannaṃ orambhāgiyānaṃ saṃyojanānaṃ pahānā’’ti (dī. ni. 1.373; ma. ni. 2.133; saṃ. ni. 5.184; a. ni. 3.88) evaṃ pahānaṃ vuccamānaṃ vaṇṇabhaṇanaṃ hoti, tadadhigamāya ussukkānaṃ ussāhajanakaṃ, evameva idha avūpasantānampi vitakkavicārānaṃ vūpasamo vuccamāno vaṇṇabhaṇanaṃ hoti.
Just as in the third noble path (Anāgāmi-magga), even for those who have not abandoned sakkāya-diṭṭhi and so on, when the abandonment is spoken of as “the abandonment of the five lower fetters,” it becomes a praise, an inspiration for those striving for its attainment; in the same way, here, the subsiding of vitakka and vicāra, even though they have not yet completely subsided, when spoken of, becomes a praise.
Và giống như trong Thánh đạo thứ ba, việc nói về sự đoạn trừ các pháp chưa bị đoạn trừ như thân kiến v.v. qua câu "do đoạn trừ năm hạ phần kiết sử" là một sự tán thán, tạo ra sự nỗ lực cho những người đang phấn đấu để chứng đắc nó, cũng vậy, ở đây, việc nói về sự an tịnh của tầm và tứ, mặc dù chúng đã được an tịnh, cũng là một sự tán thán.
Tenāyamattho vutto ‘‘pītiyā ca samatikkamā vitakkavicārānañca vūpasamā’’ti.
Therefore, this meaning is stated: "due to the transcending of rapture and the cessation of initial and sustained application."
Do đó, ý nghĩa này được nói đến là "do sự vượt qua đối với hỷ và do sự an tịnh của tầm và tứ".
Tattha chaḷaṅgupekkhā ca brahmavihārupekkhā ca bojjhaṅgupekkhā ca tatramajjhattupekkhā ca jhānupekkhā ca pārisuddhupekkhā ca atthato ekā, tatramajjhattupekkhāva hoti.
Among these, chaḷaṅgupekkhā, brahmavihārupekkhā, bojjhaṅgupekkhā, tatramajjhattupekkhā, jhānupekkhā, and pārisuddhupekkhā are essentially one, being none other than tatramajjhattupekkhā.
Trong đó, chaḷaṅgupekkhā, brahmavihārupekkhā, bojjhaṅgupekkhā, tatramajjhattupekkhā, jhānupekkhā, và pārisuddhupekkhā, về mặt bản chất chỉ là một, chính là tatramajjhattupekkhā.
Tena tena avatthābhedena panassāyaṃ bhedo.
However, this distinction arises due to differences in their respective circumstances.
Tuy nhiên, sự phân biệt này của nó là do sự khác biệt của từng trạng thái.
Ekassāpi sato sattassa kumārayuvattherasenāpatirājādivasena bhedo viya, tasmā tāsu yattha chaḷaṅgupekkhā, na tattha bojjhaṅgupekkhādayo.
It is like the distinctions of a single being as a child, youth, elder, general, or king; therefore, it should be understood that where there is chaḷaṅgupekkhā, there are no bojjhaṅgupekkhā and so on.
Giống như sự phân biệt của cùng một chúng sinh qua các giai đoạn là thiếu niên, thanh niên, trưởng lão, tướng quân, vua chúa v.v., vì vậy, trong số chúng, ở đâu có chaḷaṅgupekkhā, ở đó không có bojjhaṅgupekkhā v.v.
Yattha vā pana bojjhaṅgupekkhā, na tattha chaḷaṅgupekkhādayo hontīti veditabbā.
And where there is bojjhaṅgupekkhā, there are no chaḷaṅgupekkhā and so on.
Hoặc ở đâu có bojjhaṅgupekkhā, ở đó không có chaḷaṅgupekkhā v.v., cần phải hiểu như vậy.
Yathā cetāsaṃ atthato ekībhāvo, evaṃ saṅkhārupekkhāvipassanupekkhānampi.
Just as these six are essentially one, so too are saṅkhārupekkhā and vipassanupekkhā.
Cũng như những tâm xả này về bản chất là một, saṅkhārupekkhā và vipassanupekkhā cũng vậy.
Paññā eva hi sā, kiccavasena dvidhā bhinnā.
Indeed, it is wisdom itself, divided into two according to its functions.
Vì nó chính là trí tuệ, được phân chia thành hai theo chức năng.
Yathā hi purisassa sāyaṃ gehaṃ paviṭṭhaṃ sappaṃ ajapadadaṇḍaṃ gahetvā pariyesamānassa taṃ thusakoṭṭhake nipannaṃ disvā ‘‘sappo nu kho, no’’ti avalokentassa sovatthikattayaṃ disvā nibbematikassa ‘‘sappo, na sappo’’ti vicinane majjhattatā uppajjati, evameva yā āraddhavipassakassa vipassanāñāṇena lakkhaṇattaye diṭṭhe saṅkhārānaṃ aniccabhāvādivicinane majjhattatā uppajjati, ayaṃ vipassanupekkhā.
Just as when a man, searching with a goat-foot-shaped stick for a snake that has entered his house in the evening, sees it lying in a pile of husks, and looking closely, seeing three auspicious marks, becomes free from doubt, and then indifference arises in his deliberation, "Is it a snake or not a snake?" -- in the same way, when a meditator who has commenced vipassanā sees the three characteristics with vipassanā-ñāṇa, the indifference that arises in his deliberation about the impermanence (anicca) and so on of the saṅkhāras, this is called vipassanā-upekkhā.
Ví như một người đàn ông, khi tìm kiếm con rắn đã vào nhà vào buổi tối bằng cây gậy có đầu chạc, thấy nó nằm trong đống trấu, khi nhìn xem "có phải là rắn hay không", thấy ba đường vằn trên cổ và hết nghi ngờ, thì sự trung bình trong việc thẩm xét "là rắn, không phải rắn" sinh khởi; cũng vậy, đối với người đã bắt đầu thực hành minh sát, khi ba tướng được thấy bằng trí minh sát, sự trung bình trong việc thẩm xét tính vô thường v.v. của các hành sinh khởi, đây là vipassanupekkhā.
Yathā pana tassa purisassa ajapadadaṇḍena gāḷhaṃ sappaṃ gahetvā ‘‘kintāhaṃ imaṃ sappaṃ aviheṭhento attānañca iminā aḍaṃsāpento muñceyya’’nti muñcanākārameva pariyesato gahaṇe majjhattatā hoti, evameva yā lakkhaṇattayassa diṭṭhattā āditte viya tayo bhave passato saṅkhāragahaṇe majjhattatā, ayaṃ saṅkhārupekkhā.
However, just as for that man, having firmly caught the snake with the goat-foot-shaped stick, and searching only for a way to release it, thinking, "How can I release this snake without harming it and without being bitten by it myself?", there is indifference in holding it; in the same way, the indifference in grasping the saṅkhāras, seeing the three existences as if ablaze due to having seen the three characteristics, this is saṅkhārupekkhā.
Vả lại, ví như người đàn ông ấy, sau khi dùng cây gậy có đầu chạc bắt chặt con rắn, khi tìm kiếm cách thả nó ra "làm sao ta có thể thả con rắn này mà không làm hại nó và cũng không để nó cắn mình", thì có sự trung bình trong việc bắt giữ; cũng vậy, do đã thấy ba tướng, khi nhìn ba cõi như đang bốc cháy, có sự trung bình trong việc nắm bắt các hành, đây là saṅkhārupekkhā.
Iti vipassanupekkhāya siddhāya saṅkhārupekkhāpi siddhāva hoti.
Thus, when vipassanā-upekkhā is accomplished, saṅkhārupekkhā is also accomplished.
Như vậy, khi vipassanupekkhā đã thành tựu, saṅkhārupekkhā cũng đã thành tựu.
Iminā panesā vicinanagahaṇesu majjhattasaṅkhātena kiccena dvidhā bhinnāti.
But this (upekkhā) is distinguished into two by its function, which is called indifference in deliberation and grasping.
Tuy nhiên, nó được phân chia thành hai do chức năng này, được gọi là sự trung bình trong việc thẩm xét và nắm bắt.
Vīriyupekkhā pana vedanupekkhā ca aññamaññañca avasesāhi ca atthato bhinnā evāti.
Vīriyupekkhā and vedanupekkhā, however, are different from each other and from the remaining (upekkhās) in terms of their essence.
Còn vīriyupekkhā và vedanupekkhā thì về bản chất khác nhau, cả với nhau và với các loại còn lại.
Āha cettha –
Here it is said:
Về điều này, có nói rằng –
Iti imāsu upekkhāsu jhānupekkhā idha adhippetā.
Among these upekkhās, jhāna-upekkhā is intended here.
Như vậy, trong các loại upekkhā này, jhānupekkhā được ngụ ý ở đây.
Sā majjhattalakkhaṇā.
It has the characteristic of indifference (majjhattatā).
Nó có đặc tính trung bình.
Etthāha – ‘‘nanu cāyaṃ atthato tatramajjhattupekkhāva hoti, sā ca paṭhamadutiyajjhānesupi atthi, tasmā tatrapi ‘upekkhako ca viharatī’ti evamayaṃ vattabbā siyā, sā kasmā na vuttā’’ti?
Here it is asked: “Is this not essentially tatramajjhattatā-upekkhā, and since that is present even in the first and second jhānas, should it not also be said there, ‘He dwells with upekkhā’? Why was it not stated?”
Ở đây, có người hỏi: "Chẳng phải tâm xả này về bản chất chính là tatramajjhattupekkhā sao? Và nó cũng có trong thiền thứ nhất và thứ hai, do đó, ở đó cũng nên nói rằng 'và an trú với tâm xả'. Tại sao lại không được nói như vậy?"
Aparibyattakiccato.
Because its function is not manifest.
Vì chức năng chưa rõ ràng.
Aparibyattañhi tassa tattha kiccaṃ vitakkādīhi abhibhūtattā, idha panāyaṃ vitakkavicārapītīhi anabhibhūtattā ukkhittasirā viya hutvā paribyattakiccā jātā, tasmā vuttāti.
For its function there is not manifest, being overwhelmed by vitakka and so on; but here, not being overwhelmed by vitakka, vicāra, and pīti, it becomes manifest in its function, like one who lifts their head, therefore it is stated.
Thật vậy, chức năng của nó ở đó chưa rõ ràng vì bị tầm v.v. lấn át, nhưng ở đây, do không bị tầm, tứ, và hỷ lấn át, nó trở nên như ngẩng cao đầu và có chức năng rõ ràng, vì vậy mới được nói đến.
Idāni sato ca sampajānoti ettha saratīti sato.
Now, in sato ca sampajāno (mindful and clearly comprehending), 'sato' means remembering.
Bây giờ, trong câu chánh niệm và tỉnh giác, người ghi nhớ là người chánh niệm.
Sampajānātīti sampajāno.
'Sampajāno' means clearly comprehending.
Người biết rõ là người tỉnh giác.
Iti puggalena sati ca sampajaññañca vuttaṃ.
Thus, by the individual, both sati (mindfulness) and sampajañña (clear comprehension) are spoken of.
Như vậy, chánh niệm và tỉnh giác được nói đến thông qua người thực hành.
Tattha saraṇalakkhaṇā sati.
Among these, sati has the characteristic of remembering.
Trong đó, chánh niệm có đặc tính ghi nhớ.
Asammohalakkhaṇaṃ sampajaññaṃ.
Sampajañña has the characteristic of non-delusion.
Tỉnh giác có đặc tính không si mê.
Tattha kiñcāpi idaṃ satisampajaññaṃ purimajjhānesupi atthi, muṭṭhassatissa hi asampajānassa upacāramattampi na sampajjati, pageva appanā.
Although this sati and sampajañña are present in the earlier jhānas as well—for one who is unmindful and lacks clear comprehension, not even access concentration (upacāra) is attained, let alone absorption (appanā)—
Trong đó, mặc dù chánh niệm và tỉnh giác này cũng có trong các tầng thiền trước – vì người thất niệm, không tỉnh giác thì ngay cả cận định cũng không thành tựu, huống chi là an chỉ định.
Oḷārikattā pana tesaṃ jhānānaṃ bhūmiyaṃ viya purisassa cittassa gati sukhā hoti, abyattaṃ tattha satisampajaññakiccaṃ.
yet, due to the coarseness of those jhānas, the movement of the mind is pleasant, like a man walking on flat ground, and the function of sati and sampajañña there is not manifest.
Tuy nhiên, do các tầng thiền đó thô thiển, sự vận hành của tâm được dễ dàng như một người đi trên mặt đất, chức năng của chánh niệm và tỉnh giác ở đó không rõ ràng.
Oḷārikaṅgappahānena pana sukhumattā imassa jhānassa purisassa khuradhārāyaṃ viya satisampajaññakiccapariggahitā eva cittassa gati icchitabbāti idheva vuttaṃ.
However, due to the subtlety of this jhāna, through the abandoning of coarse factors, the movement of the mind, grasped by the function of sati and sampajañña, is to be desired as if a man walking on a razor's edge; therefore, it is stated only here.
Nhưng do sự vi tế của tầng thiền này sau khi đã từ bỏ các chi thô thiển, sự vận hành của tâm phải được mong đợi là chỉ được duy trì bởi chức năng của chánh niệm và tỉnh giác, giống như một người đi trên lưỡi dao cạo, vì vậy nó chỉ được nói đến ở đây.
Kiñca bhiyyo – yathā dhenupago vaccho dhenuto apanīto arakkhiyamāno punadeva dhenuṃ upagacchati, evamidaṃ tatiyajjhānasukhaṃ pītito apanītampi satisampajaññārakkhena arakkhiyamānaṃ punadeva pītiṃ upagaccheyya, pītisampayuttameva siyā.
What is more, just as a calf accustomed to its mother, when separated from its mother and not guarded, returns to its mother; in the same way, this third jhāna pleasure, even when separated from pīti, if not guarded by the protection of sati and sampajañña, might return to pīti, and would be associated with pīti.
Hơn nữa, cũng như con bê con theo mẹ, khi bị tách khỏi mẹ, nếu không được canh chừng, nó sẽ lại tìm về với mẹ; cũng vậy, lạc của thiền thứ ba này, dù đã tách khỏi hỷ, nếu không được bảo vệ bởi sự canh chừng của chánh niệm và tỉnh giác, nó có thể sẽ lại tìm về với hỷ, trở thành tương ưng với hỷ.
Sukhe vāpi sattā sārajjanti, idañca atimadhuraṃ sukhaṃ tato paraṃ sukhābhāvā.
Or beings delight in pleasure, and this pleasure is exceedingly sweet, there being no pleasure superior to it.
Vả lại, chúng sanh thường đắm say trong lạc, và đây là lạc vô cùng ngọt ngào, vì không có lạc nào vượt hơn thế nữa.
Satisampajaññānubhāvena panettha sukhe asārajjanā hoti, no aññathāti imampi atthavisesaṃ dassetuṃ idaṃ idheva vuttanti veditabbaṃ.
But here, through the power of sati and sampajañña, there is no clinging to pleasure, not otherwise; this special meaning is also to be understood as being shown by stating it only here.
Nhờ năng lực của chánh niệm và tỉnh giác mà có sự không đắm say trong lạc ở đây, chứ không phải bằng cách nào khác. Cần phải hiểu rằng, để chỉ rõ ý nghĩa đặc biệt này, điều này đã được nói đến chính ở đây.
Idāni yaṃ taṃ ariyā ācikkhanti upekkhako satimā sukhavihārīti ettha yaṃjhānahetu yaṃjhānakāraṇā taṃ tatiyajjhānasamaṅgipuggalaṃ buddhādayo ariyā ācikkhanti desenti paññapenti paṭṭhapenti vivaranti vibhajanti uttānīkaronti pakāsenti, pasaṃsantīti adhippāyo.
Now, regarding the statement, “which the Noble Ones declare: ‘He is equanimous, mindful, abiding in comfort’”, for which jhāna-cause, for which jhāna-reason, the Noble Ones, such as the Buddhas, explain, teach, declare, establish, reveal, analyze, make clear, proclaim, and praise that individual endowed with the third jhāna. This is the intention.
Bây giờ, trong câu yaṃ taṃ ariyā ācikkhanti upekkhako satimā sukhavihārī (trạng thái mà các bậc Thánh gọi là 'xả, niệm, lạc trú'), do nhân là tầng thiền ấy, do duyên là tầng thiền ấy, mà các bậc Thánh như chư Phật gọi, thuyết, tuyên bố, thiết lập, khai mở, phân tích, làm cho rõ ràng, và xiển dương người đã thành tựu thiền thứ ba ấy. Ý muốn nói là các ngài tán thán.
Kinti?
How then?
Như thế nào?
Upekkhako satimā sukhavihārīti.
“He is equanimous, mindful, abiding in comfort.”
Là ‘xả, niệm, lạc trú’.
Taṃ tatiyaṃ jhānaṃ upasampajja viharatīti evamettha yojanā veditabbā.
Thus, in this context, the connection should be understood as: “He dwells having attained that third jhāna.”
Cần phải hiểu cách kết hợp ở đây là: “Vị ấy chứng và trú thiền thứ ba ấy.”
Kasmā pana taṃ te evaṃ pasaṃsantīti?
But why do they praise him thus?
Vậy tại sao các ngài lại tán thán vị ấy như vậy?
Pasaṃsārahato.
Because he is worthy of praise.
Vì vị ấy xứng đáng được tán thán.
Ayañhi yasmā atimadhurasukhe sukhapāramippattepi tatiyajjhāne upekkhako, na tattha sukhābhisaṅgena ākaḍḍhīyati.
For this individual, being equanimous in the third jhāna, which is exceedingly sweet happiness and has reached the culmination of happiness, is not drawn by attachment to that happiness.
Bởi vì, vị ấy có tâm xả ngay cả trong thiền thứ ba, vốn là đỉnh cao của lạc, một lạc vô cùng ngọt ngào; vị ấy không bị lôi cuốn bởi sự dính mắc vào lạc ở đó.
Yathā ca pīti na uppajjati, evaṃ upaṭṭhitassatitāya satimā.
And he is mindful, because his mindfulness is established in such a way that rapture does not arise.
Và vị ấy có chánh niệm do niệm đã được an lập để hỷ không sanh khởi.
Yasmā ca ariyakantaṃ ariyajanasevitameva ca asaṃkiliṭṭhaṃ sukhaṃ nāmakāyena paṭisaṃvedeti, tasmā pasaṃsāraho hoti.
And because he experiences with his mental body a happiness that is dear to the Noble Ones, served by the Noble Ones, and undefiled, he is therefore worthy of praise.
Và bởi vì vị ấy cảm thọ bằng danh thân một thứ lạc không ô nhiễm, được các bậc Thánh ưa thích và thực hành, nên vị ấy xứng đáng được tán thán.
Iti pasaṃsārahato naṃ ariyā te evaṃ pasaṃsārahahetubhūte guṇe pakāsentā ‘‘upekkhako satimā sukhavihārī’’ti evaṃ pasaṃsantīti veditabbaṃ.
Thus, it should be understood that the Noble Ones, proclaiming these qualities which are reasons for praise, praise him as “equanimous, mindful, abiding in comfort” because he is worthy of praise.
Vì vậy, cần phải hiểu rằng, do vị ấy xứng đáng được tán thán, các bậc Thánh, khi tuyên dương những phẩm chất là nguyên nhân xứng đáng được tán thán ấy, đã tán thán vị ấy rằng: ‘xả, niệm, lạc trú’.
Tatiyanti gaṇanānupubbatā tatiyaṃ, tatiyaṃ uppannantipi tatiyaṃ.
“Third” means third in numerical order, and also third because it has arisen as the third.
Thứ ba: là thứ ba theo thứ tự đếm; cũng là thứ ba vì là tầng thiền sanh khởi lần thứ ba.
Sukhassa ca pahānā dukkhassa ca pahānāti kāyikasukhassa ca kāyikadukkhassa ca pahānā.
“Through the abandoning of pleasure and the abandoning of pain” means through the abandoning of bodily pleasure and bodily pain.
Sukhassa ca pahānā dukkhassa ca pahānā (do xả lạc, do xả khổ) là do xả lạc thuộc thân và khổ thuộc thân.
Pubbevāti tañca kho pubbeva, na catutthajjhānakkhaṇe.
“Even before” means that abandoning occurs even before, not at the moment of the fourth jhāna.
Pubbevā (trước đó) là việc xả bỏ ấy đã xảy ra trước đó, chứ không phải trong khoảnh khắc của thiền thứ tư.
Somanassadomanassānaṃ atthaṅgamāti cetasikasukhassa cetasikadukkhassa cāti imesampi dvinnaṃ pubbeva atthaṅgamā, pahānā icceva vuttaṃ hoti.
“Through the disappearance of joy and sorrow” means that the disappearance of these two, mental pleasure and mental pain, also occurs even before; it is simply stated as abandoning.
Somanassadomanassānaṃ atthaṅgamā (do diệt hỷ và ưu) là do sự diệt tận, tức là sự xả bỏ, của hai pháp này, là lạc thuộc tâm và khổ thuộc tâm, cũng đã xảy ra trước đó.
Kadā pana nesaṃ pahānaṃ hoti?
But when does their abandoning occur?
Vậy khi nào sự xả bỏ chúng xảy ra?
Catunnaṃ jhānānaṃ upacārakkhaṇe.
At the proximate moment (upacāra-moment) of the four jhāna's.
Trong khoảnh khắc cận định của bốn tầng thiền.
Somanassañhi catutthassa jhānassa upacārakkhaṇeyeva pahīyati, dukkhadomanassasukhāni paṭhamadutiyatatiyānaṃ upacārakkhaṇesu.
Joy, indeed, is abandoned only at the proximate moment of the fourth jhāna, while pain, sorrow, and pleasure are abandoned at the proximate moments of the first, second, and third jhāna's respectively.
Hỷ được xả bỏ ngay trong khoảnh khắc cận định của thiền thứ tư; còn khổ, ưu, và lạc được xả bỏ trong các khoảnh khắc cận định của thiền thứ nhất, thứ hai, và thứ ba.
Evametesaṃ pahānakkamena avuttānaṃ indriyavibhaṅge (vibha. 219 ādayo) pana indriyānaṃ uddesakkameneva idhāpi vuttānaṃ sukhadukkhasomanassadomanassānaṃ pahānaṃ veditabbaṃ.
Thus, the abandoning of pleasure, pain, joy, and sorrow, which are not stated in the order of their abandoning here, but are stated here in the order of their enumeration in the Indriya-vibhaṅga, should be understood.
Như vậy, cần phải hiểu sự xả bỏ của lạc, khổ, hỷ, ưu, những pháp được nói đến ở đây theo thứ tự đề mục của các quyền trong Indriyavibhaṅga (Phân Tích về Quyền), chứ không phải theo thứ tự xả bỏ của chúng.
Yadi panetāni tassa tassa jhānassa upacārakkhaṇeyeva pahīyanti, atha kasmā ‘‘kattha cuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati?
If these are abandoned only at the proximate moment of each jhāna, then why is it said that "Where, bhikkhus, does the faculty of pain, having arisen, cease without remainder?
Nếu những thọ này được xả bỏ ngay trong khoảnh khắc cận định của mỗi tầng thiền tương ứng, vậy tại sao trong kinh lại nói sự đoạn diệt của chúng xảy ra ngay trong các tầng thiền, như trong câu: "Ở đâu khổ quyền đã sanh được đoạn diệt không còn dư tàn?
Idha, bhikkhave, bhikkhu vivicceva kāmehi…pe… paṭhamajjhānaṃ upasampajja viharati.
Here, bhikkhus, a bhikkhu, quite secluded from sensual pleasures… he enters upon and abides in the first jhāna.
Này các Tỳ khưu, ở đây, Tỳ khưu ly dục...v.v... chứng và trú thiền thứ nhất.
Ettha cuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati.
Here, the faculty of pain, having arisen, ceases without remainder.
Ở đó, khổ quyền đã sanh được đoạn diệt không còn dư tàn.
Kattha cuppannaṃ domanassindriyaṃ, sukhindriyaṃ, somanassindriyaṃ aparisesaṃ nirujjhati?
Where does the faculty of sorrow, the faculty of pleasure, the faculty of joy, having arisen, cease without remainder?
Ở đâu ưu quyền, lạc quyền, hỷ quyền đã sanh được đoạn diệt không còn dư tàn?
Idha, bhikkhave, bhikkhu sukhassa ca pahānā…pe… catutthaṃ jhānaṃ upasampajja viharati.
Here, bhikkhus, through the abandoning of pleasure… he enters upon and abides in the fourth jhāna.
Này các Tỳ khưu, ở đây, Tỳ khưu do xả lạc...v.v... chứng và trú thiền thứ tư.
Ettha cuppannaṃ somanassindriyaṃ aparisesaṃ nirujjhatī’’ti (saṃ. ni. 5.510) evaṃ jhānesveva nirodho vuttoti?
Here, the faculty of joy, having arisen, ceases without remainder" — why is cessation stated only in the jhāna's?
Ở đó, hỷ quyền đã sanh được đoạn diệt không còn dư tàn"?
Atisayanirodhattā.
Because it is an extraordinary cessation.
Vì đó là sự đoạn diệt vượt trội.
Atisayanirodho hi tesaṃ paṭhamajjhānādīsu, na nirodhoyeva.
For their extraordinary cessation occurs in the first jhāna and so forth, not merely cessation.
Sự đoạn diệt vượt trội của chúng xảy ra trong thiền thứ nhất v.v..., chứ không phải chỉ là sự đoạn diệt đơn thuần.
Nirodhoyeva pana upacārakkhaṇe, nātisayanirodho.
But mere cessation occurs at the proximate moment, not extraordinary cessation.
Sự đoạn diệt đơn thuần xảy ra trong khoảnh khắc cận định, không phải là sự đoạn diệt vượt trội.
Tathā hi nānāvajjane paṭhamajjhānūpacāre niruddhassāpi dukkhindriyassa ḍaṃsamakasādisamphassena vā visamāsanūpatāpena vā siyā uppatti, na tveva antoappanāyaṃ.
Thus, even though the faculty of pain has ceased in the proximate concentration of the first jhāna, which has various types of advertence, it might arise due to the touch of gnats, mosquitoes, etc., or due to discomfort from an uneven seat, but not within absorption (appanā).
Thật vậy, trong cận định của thiền thứ nhất với các tác ý khác nhau, dù khổ quyền đã được đoạn diệt, nó vẫn có thể sanh khởi do sự xúc chạm của ruồi, muỗi, v.v... hoặc do sự khó chịu của tư thế ngồi không thoải mái, nhưng chắc chắn không thể sanh khởi trong trạng thái an chỉ định.
Upacāre vā niruddhampetaṃ na suṭṭhu niruddhaṃ hoti paṭipakkhena avihatattā.
Or, even if it has ceased in proximate concentration, it is not truly ceased because it has not been overcome by its opposite.
Hoặc, dù đã được đoạn diệt trong cận định, nó vẫn chưa được đoạn diệt hoàn toàn vì chưa bị đối trị bởi pháp đối nghịch.
Antoappanāyaṃ pana pītipharaṇena sabbo kāyo sukhokkanto hoti, sukhokkantakāyassa ca suṭṭhu niruddhaṃ hoti dukkhindriyaṃ paṭipakkhena vihatattā.
However, within absorption, the entire body is pervaded by pleasure through the suffusion of rapture, and for one whose body is pervaded by pleasure, the faculty of pain is truly ceased, having been overcome by its opposite.
Nhưng trong trạng thái an chỉ định, toàn thân được thấm nhuần bởi lạc do sự lan tỏa của hỷ, và đối với người có thân thấm nhuần lạc, khổ quyền được đoạn diệt hoàn toàn vì đã bị đối trị bởi pháp đối nghịch.
Nānāvajjaneyeva ca dutiyajjhānūpacāre pahīnassāpi domanassindriyassa, yasmā etaṃ vitakkavicārapaccayepi kāyakilamathe cittūpaghāte ca sati uppajjati, vitakkavicārābhāve neva uppajjati.
And even though the faculty of sorrow has been abandoned in the proximate concentration of the second jhāna, which has various types of advertence, it may arise when there is physical fatigue or mental distress due to vitakka and vicāra, but it does not arise in the absence of vitakka and vicāra.
Và trong cận định của thiền thứ hai với các tác ý khác nhau, dù ưu quyền đã được xả bỏ, nhưng vì nó sanh khởi khi có sự mệt mỏi của thân và sự tổn hại của tâm, vốn là duyên của tầm và tứ, nên khi không có tầm và tứ, nó không sanh khởi.
Yattha pana uppajjati, tattha vitakkavicārabhāve.
But where it does arise, it is in the presence of vitakka and vicāra.
Ở đâu nó sanh khởi, ở đó có sự hiện hữu của tầm và tứ.
Appahīnāyeva ca dutiyajjhānūpacāre vitakkavicārāti tatthassa siyā uppatti, natveva dutiyajjhāne pahīnapaccayattā.
And since vitakka and vicāra are not yet abandoned in the proximate concentration of the second jhāna, its arising there might be possible, but not in the second jhāna itself, because its causes have been abandoned.
Và vì tầm và tứ chưa được xả bỏ trong cận định của thiền thứ hai, nên ưu quyền có thể sanh khởi ở đó, nhưng chắc chắn không thể sanh khởi trong thiền thứ hai vì các duyên của nó đã được xả bỏ.
Tathā tatiyajjhānūpacāre pahīnassāpi sukhindriyassa pītisamuṭṭhānapaṇītarūpaphuṭṭhakāyassa siyā uppatti, natveva tatiyajjhāne.
Similarly, even though the faculty of pleasure has been abandoned in the access concentration of the third jhāna, it might arise for one whose body is pervaded by exalted form arisen from rapture, but certainly not in the third jhāna itself.
Tương tự, trong cận định của thiền thứ ba, dù lạc quyền đã được xả bỏ, nhưng đối với người có thân được thấm nhuần bởi sắc pháp vi tế do hỷ sanh, nó vẫn có thể sanh khởi, nhưng chắc chắn không thể sanh khởi trong thiền thứ ba.
Tatiyajjhāne hi sukhassa paccayabhūtā pīti sabbaso niruddhā hoti.
For in the third jhāna, rapture, which is the condition for pleasure, is completely ceased.
Bởi vì trong thiền thứ ba, hỷ, là duyên của lạc, đã được đoạn diệt hoàn toàn.
Tathā catutthajjhānūpacāre pahīnassāpi somanassindriyassa āsannattā, appanāppattāya upekkhāya abhāvena sammā anatikkantattā ca siyā uppatti, natveva catutthajjhāne.
Similarly, even though the faculty of joy has been abandoned in the access concentration of the fourth jhāna, it might arise due to its proximity and due to the absence of equanimity that has attained absorption, and because it has not been fully transcended, but certainly not in the fourth jhāna itself.
Tương tự, trong cận định của thiền thứ tư, dù hỷ quyền đã được xả bỏ, nhưng do sự gần gũi (với thiền thứ ba), do chưa có xả đã đạt đến an chỉ định, và do chưa được vượt qua một cách đúng đắn, nó vẫn có thể sanh khởi, nhưng chắc chắn không thể sanh khởi trong thiền thứ tư.
Tasmā eva ca ‘‘etthuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhatī’’ti tattha tattha aparisesaggahaṇaṃ katanti.
And for this very reason, the phrase "the faculty of suffering arisen here ceases without remainder" is used in various places to signify cessation without remainder.
Chính vì vậy, ở mỗi nơi, việc sử dụng từ "không còn dư tàn" đã được thực hiện, như trong câu "ở đó, khổ quyền đã sanh được đoạn diệt không còn dư tàn".
Etthāha – ‘‘athevaṃ tassa tassa jhānassūpacāre pahīnāpi etā vedanā idha kasmā samāharī’’ti?
Here, the questioner asks: "If these feelings are abandoned in the access concentration of each jhāna, then why are they all brought together here?"
Ở đây có câu hỏi: "Nếu những thọ này đã được xả bỏ trong cận định của mỗi tầng thiền tương ứng, tại sao chúng lại được tập hợp lại ở đây?"
Sukhaggahaṇatthaṃ.
For ease of comprehension.
Để dễ nắm bắt được lạc.
Yā hi ayaṃ ‘‘adukkhamasukha’’nti ettha adukkhamasukhā vedanā vuttā, sā sukhumā dubbiññeyyā na sakkā sukhena gahetuṃ, tasmā yathā nāma duṭṭhassa yathā tathā vā upasaṅkamitvā gahetuṃ asakkuṇeyyassa goṇassa gahaṇatthaṃ gopo ekasmiṃ vaje sabbā gāvo samāharati, athekekaṃ nīharanto paṭipāṭiyā āgataṃ ‘‘ayaṃ so gaṇhatha na’’nti tampi gāhāpeti, evamevaṃ sukhaggahaṇatthaṃ sabbāpi etā samāhari.
For the feeling of neither-pain-nor-pleasure mentioned here as "neither painful nor pleasant" is subtle and difficult to discern; it cannot be easily grasped. Therefore, just as a cowherd gathers all the cows into one pen to catch a wild bull that cannot be approached and caught easily by any means, and then, leading them out one by one, points to the one that comes in sequence, saying, "This is the one, catch it!", and has it caught; in the same way, to make it easy to grasp, all these feelings were brought together.
Thật vậy, thọ bất khổ bất lạc được nói đến trong câu "bất khổ bất lạc" rất vi tế, khó nhận biết, không thể dễ dàng nắm bắt. Do đó, cũng như người chăn bò, để bắt một con bò hung dữ không thể tiếp cận và bắt một cách tùy tiện, người ấy lùa tất cả bò vào một chuồng, sau đó khi dắt từng con ra, con bò hung dữ cũng theo thứ tự đi ra, người ấy liền nói "Đây là nó, hãy bắt lấy nó" và bảo người khác bắt lấy nó; cũng vậy, để dễ nắm bắt được lạc, tất cả những thọ này đã được tập hợp lại.
Evañhi samāhaṭā etā dassetvā ‘‘yaṃ neva sukhaṃ, na dukkhaṃ, na somanassaṃ, na domanassaṃ, ayaṃ adukkhamasukhāvedanā’’ti sakkā hoti esā gāhayituṃ.
Only by thus presenting these gathered feelings can one be made to understand: "That which is neither pleasure nor pain, neither joy nor sorrow, this is the feeling of neither-pain-nor-pleasure."
Bởi vì, sau khi đã trình bày những thọ được tập hợp như vậy, người ta có thể làm cho người khác nắm bắt được thọ này bằng cách nói: "Pháp nào không phải lạc, không phải khổ, không phải hỷ, không phải ưu, đó chính là thọ bất khổ bất lạc."
Apica adukkhamasukhāya cetovimuttiyā paccayadassanatthañcāpi etā vuttāti veditabbā.
Furthermore, it should be understood that these feelings are mentioned also to show the conditions for the liberation of mind through neither-pain-nor-pleasure (adukkhamasukhā cetovimutti).
Hơn nữa, cần phải hiểu rằng những thọ này được nói đến cũng là để chỉ ra các duyên của tâm giải thoát bất khổ bất lạc.
Sukhadukkhappahānādayo hi tassā paccayā.
Indeed, the abandonment of pleasure and pain, and so on, are its conditions.
Quả vậy, việc từ bỏ lạc và khổ, v.v., là các duyên của thiền ấy.
Yathāha – ‘‘cattāro kho, āvuso, paccayā adukkhamasukhāya cetovimuttiyā samāpattiyā.
As it is said: "There are, friends, four conditions for the attainment of the liberation of mind through neither-pain-nor-pleasure.
Như đã nói: "Này hiền giả, có bốn duyên để chứng đạt tâm giải thoát không khổ không lạc.
Idhāvuso, bhikkhu sukhassa ca pahānā…pe… catutthaṃ jhānaṃ upasampajja viharati.
Here, friends, a bhikkhu, abandoning pleasure…pe… abides having entered the fourth jhāna.
Này hiền giả, ở đây, vị tỳ khưu do từ bỏ lạc... ... đạt và an trú thiền thứ tư.
Ime kho āvuso, cattāro paccayā adukkhamasukhāya cetovimuttiyā samāpattiyā’’ti (ma. ni. 1.458).
These, friends, are the four conditions for the attainment of the liberation of mind through neither-pain-nor-pleasure."
Này hiền giả, đây là bốn duyên để chứng đạt tâm giải thoát không khổ không lạc."
Yathā vā aññattha pahīnāpi sakkāyadiṭṭhiādayo tatiyamaggassa vaṇṇabhaṇanatthaṃ tattha pahīnāti vuttā, evaṃ vaṇṇabhaṇanatthampetassa jhānassetā idha vuttātipi veditabbā.
Or, just as wrong views (sakkāyadiṭṭhi) and so on, though abandoned elsewhere, are mentioned as abandoned in the third path (Anāgāmi-magga) to extol its virtues, so too, these are mentioned here to extol the virtues of this jhāna.
Hoặc, cũng nên hiểu rằng, giống như ở nơi khác, các pháp như thân kiến v.v. đã được từ bỏ (ở đạo Tu-đà-hoàn) lại được nói là đã được từ bỏ ở đạo thứ ba (đạo A-na-hàm) để tán thán đạo ấy, cũng vậy, các thọ này được nói ở đây là để tán thán thiền này.
Paccayaghātena vā ettha rāgadosānaṃ atidūrabhāvaṃ dassetumpetā vuttāti veditabbā.
Or, it should be understood that these are mentioned here to show the extreme remoteness of greed and hatred through the destruction of their conditions.
Hoặc, cũng nên hiểu rằng, chúng được nói ở đây để chỉ ra rằng tham và sân ở rất xa do đã diệt trừ các duyên của chúng.
Etāsu hi sukhaṃ somanassassa paccayo, somanassaṃ rāgassa, dukkhaṃ domanassassa, domanassaṃ dosassa.
For among these, pleasure is a condition for joy, joy for greed; pain is a condition for sorrow, sorrow for hatred.
Quả vậy, trong các thọ này, lạc là duyên của hỷ, hỷ là duyên của tham; khổ là duyên của ưu, ưu là duyên của sân.
Sukhādighātena ca sappaccayā rāgadosā hatāti atidūre hontīti.
And by the destruction of pleasure and so on, greed and hatred with their conditions are destroyed, thus they become extremely remote.
Và do diệt trừ lạc v.v., tham và sân cùng với các duyên của chúng bị tiêu diệt, nên chúng ở rất xa.
Adukkhamasukhanti dukkhābhāvena adukkhaṃ.
Neither-pain-nor-pleasure (Adukkhamasukha) means not painful due to the absence of pain.
Không khổ không lạc (adukkhamasukhaṃ): là không khổ (adukkhaṃ) do không có khổ.
Sukhābhāvena asukhaṃ.
And not pleasant due to the absence of pleasure.
Là không lạc (asukhaṃ) do không có lạc.
Etenettha dukkhasukhapaṭipakkhabhūtaṃ tatiyavedanaṃ dīpeti, na dukkhasukhābhāvamattaṃ.
By this, it indicates the third feeling, which is the opposite of pain and pleasure, not merely the absence of pain and pleasure.
Qua đó, ở đây, ngài chỉ ra thọ thứ ba, là đối nghịch của khổ và lạc, chứ không chỉ đơn thuần là sự vắng mặt của khổ và lạc.
Tatiyavedanā nāma adukkhamasukhā, upekkhātipi vuccati.
The third feeling is called neither-pain-nor-pleasure, and also upekkhā (equanimity).
Thọ thứ ba được gọi là không khổ không lạc, cũng được gọi là xả (upekkhā).
Sā iṭṭhāniṭṭhaviparītānubhavanalakkhaṇā.
Its characteristic is the experience of what is neither agreeable nor disagreeable, but neutral.
Thọ ấy có đặc tính là cảm nhận đối tượng khác với đối tượng khả hỷ và bất khả hỷ (tức đối tượng trung tính).
Upekkhāsatipārisuddhinti upekkhāya janitasatipārisuddhiṃ.
Purity of mindfulness due to equanimity (Upekkhāsatipārisuddhi) means the purity of mindfulness generated by equanimity.
Xả niệm thanh tịnh (upekkhāsatipārisuddhiṃ): là sự thanh tịnh của niệm được sinh ra bởi xả.
Imasmiñhi jhāne suparisuddhā sati, yā ca tassā satiyā pārisuddhi, sā upekkhāya katā, na aññena.
For in this jhāna, mindfulness is perfectly pure, and the purity of that mindfulness is brought about by equanimity, not by anything else.
Quả vậy, trong thiền này, niệm rất thanh tịnh, và sự thanh tịnh của niệm ấy được tạo ra bởi xả, chứ không phải bởi pháp nào khác.
Tasmā etaṃ ‘‘upekkhāsatipārisuddhi’’nti vuccati.
Therefore, this is called "purity of mindfulness due to equanimity."
Do đó, nó được gọi là "xả niệm thanh tịnh".
Yāya ca upekkhāya ettha satiyā pārisuddhi hoti, sā atthato tatramajjhattatāti veditabbā.
And the equanimity by which mindfulness becomes pure here is, in essence, tatramajjhattatā (equanimity of mind).
Và nên hiểu rằng, xả mà nhờ đó có sự thanh tịnh của niệm ở đây, về mặt ý nghĩa chính là sự trung lập (tatramajjhattatā).
Na kevalañcettha tāya satiyeva parisuddhā, apica kho sabbepi sampayuttadhammā, satisīsena pana desanā vuttā.
Not only is mindfulness pure here by that equanimity, but all conascent phenomena are also pure, but the teaching is stated with mindfulness as the principal factor.
Và không chỉ có niệm được thanh tịnh bởi xả ở đây, mà tất cả các pháp tương ưng cũng vậy, nhưng bài thuyết giảng được trình bày với niệm làm đầu.
Tattha kiñcāpi ayaṃ upekkhā heṭṭhāpi tīsu jhānesu vijjati, yathā pana divā sūriyappabhābhibhavā sommabhāvena ca attano upakārakattena vā sabhāgāya rattiyā alābhā divā vijjamānāpi candalekhā aparisuddhā hoti apariyodātā, evamayampi tatramajjhattupekkhācandalekhā vitakkādipaccanīkadhammatejābhibhavā sabhāgāya ca upekkhāvedanārattiyā alābhā vijjamānāpi paṭhamajjhānādibhede aparisuddhā hoti.
Among these, although this equanimity exists in the three lower jhāna also, just as the moonlight, though present during the day, is impure and not clear due to being overpowered by the sun's radiance, or due to its mildness, or due to not obtaining the congenial night that is beneficial to it; similarly, this moonlight of tatramajjhattatā-upekkhā, though present in the first jhāna and so on, is impure due to being overpowered by the power of opposing phenomena like vitakka (initial application) and so on, and due to not obtaining the congenial night of the feeling of equanimity.
Trong đó, mặc dù xả này cũng có mặt trong ba tầng thiền dưới, nhưng giống như vầng trăng khuyết vào ban ngày, dù có mặt nhưng không thanh tịnh, không trong sáng do bị ánh sáng mặt trời lấn át và do không có được ban đêm, là điều kiện tương hợp và hỗ trợ cho sự mát dịu của nó, cũng vậy, vầng trăng xả trung lập (tatramajjhatt'upekkhā) này, dù có mặt trong các tầng thiền như thiền thứ nhất v.v., cũng không thanh tịnh do bị sức mạnh của các pháp đối nghịch như tầm (vitakka) v.v. lấn át và do không có được ban đêm là thọ xả tương hợp.
Tassā ca aparisuddhāya divā aparisuddhacandalekhāya pabhā viya sahajātāpi satiādayo aparisuddhāva honti.
And when that equanimity is impure, just as the light of an impure moonbeam during the day, so too are mindfulness and other co-arising factors impure.
Và do sự không thanh tịnh của xả ấy, các pháp đồng sinh như niệm v.v. cũng không thanh tịnh, giống như ánh sáng của vầng trăng không thanh tịnh vào ban ngày.
Tasmā tesu ekampi ‘‘upekkhāsatipārisuddhi’’nti na vuttaṃ.
Therefore, not even one of those jhānas is called "purity of equanimity and mindfulness" (upekkhāsatipārisuddhi).
Do đó, không có tầng thiền nào trong số đó được gọi là "xả niệm thanh tịnh".
Idha pana vitakkādipaccanīkatejābhibhavābhāvā sabhāgāya ca upekkhāvedanārattiyā paṭilābhā ayaṃ tatramajjhattupekkhācandalekhā ativiya parisuddhā.
But here, due to the absence of being overwhelmed by the power of opposing factors like vitakka, and due to the attainment of a kindred night of equanimity-feeling, this equanimity of mental equipoise (tatramajjhattatā-upekkhā) is exceedingly pure.
Nhưng ở đây, do không bị sức mạnh của các pháp đối nghịch như tầm v.v. lấn át và do đã có được ban đêm là thọ xả tương hợp, nên vầng trăng xả trung lập này vô cùng thanh tịnh.
Tassā parisuddhattā parisuddhacandalekhāya pabhā viya sahajātāpi satiādayo parisuddhā honti pariyodātā.
Because it is pure, just like the light of a pure moonbeam, mindfulness and other co-arising factors are also pure and cleansed.
Do sự thanh tịnh của nó, các pháp đồng sinh như niệm v.v. cũng trở nên thanh tịnh, trong sáng, giống như ánh sáng của vầng trăng thanh tịnh.
Tasmā idameva ‘‘upekkhāsatipārisuddhi’’nti vuttanti veditabbaṃ.
Therefore, it should be understood that only this is called "purity of equanimity and mindfulness" (upekkhāsatipārisuddhi).
Do đó, nên hiểu rằng chỉ có tầng thiền này mới được gọi là "xả niệm thanh tịnh".
Catutthanti gaṇanānupubbatā catutthaṃ, catutthaṃ uppannantipi catutthaṃ.
Fourth means fourth in numerical order, and also fourth because it arises as the fourth.
Thứ tư (catutthaṃ): là thứ tư theo thứ tự đếm; cũng là thứ tư vì nó sinh khởi lần thứ tư.
Imāni cattāri jhānāni pubbabhāgepi nānā, maggakkhaṇepi.
These four jhānas are distinct even in the preliminary stage and also at the moment of the path.
Bốn tầng thiền này khác nhau cả trong giai đoạn chuẩn bị và cả trong khoảnh khắc đạo.
Pubbabhāge samāpattivasena nānā, maggakkhaṇe nānāmaggavasena.
In the preliminary stage, they are distinct by way of attainment (samāpatti); at the moment of the path, by way of different paths.
Trong giai đoạn chuẩn bị, chúng khác nhau tùy theo định chứng; trong khoảnh khắc đạo, chúng khác nhau tùy theo các đạo khác nhau.
Ekassa hi paṭhamamaggo paṭhamajjhāniko hoti, dutiyamaggādayopi paṭhamajjhānikā vā dutiyādīsu aññatarajjhānikā vā.
For one person, the first path is associated with the first jhāna; the second and subsequent paths may also be associated with the first jhāna or with any of the second and so forth.
Đối với một người, đạo thứ nhất có thể thuộc thiền thứ nhất, và các đạo thứ hai v.v. cũng có thể thuộc thiền thứ nhất hoặc thuộc một trong các thiền thứ hai v.v.
Ekassa paṭhamamaggo dutiyādīnaṃ aññatarajjhāniko hoti, dutiyādayopi dutiyādīnaṃ aññatarajjhānikā vā paṭhamajjhānikā vā.
For another, the first path is associated with one of the second and subsequent jhānas; the second and subsequent paths may also be associated with one of the second and subsequent jhānas or with the first jhāna.
Đối với một người khác, đạo thứ nhất có thể thuộc một trong các thiền thứ hai v.v., và các đạo thứ hai v.v. cũng có thể thuộc một trong các thiền thứ hai v.v. hoặc thuộc thiền thứ nhất.
Evaṃ cattāropi maggā jhānavasena sadisā vā asadisā vā ekaccasadisā vā honti.
Thus, all four paths may be similar, dissimilar, or partially similar in terms of jhāna.
Như vậy, cả bốn đạo, tùy theo thiền, có thể giống nhau, khác nhau, hoặc một phần giống nhau.
Ayaṃ panassa viseso pādakajjhānaniyamena hoti.
This distinction, however, occurs by the rule of the foundational jhāna.
Nhưng sự khác biệt này được quy định bởi thiền nền tảng (pādakajjhāna).
Paṭhamajjhānalābhino hi paṭhamajjhānā vuṭṭhāya vipassantassa uppannamaggo paṭhamajjhāniko hoti, maggaṅgabojjhaṅgāni panettha paripuṇṇāneva honti.
For one who has attained the first jhāna, the path that arises after emerging from the first jhāna and practicing vipassanā is associated with the first jhāna, and in this case, the path factors and enlightenment factors are complete.
Quả vậy, đối với người đã đắc thiền thứ nhất, sau khi xuất khỏi thiền thứ nhất và thực hành minh sát, đạo sinh khởi sẽ thuộc thiền thứ nhất; ở đây, các đạo chi và giác chi đều đầy đủ.
Dutiyajjhānato vuṭṭhāya vipassantassa uppanno dutiyajjhāniko hoti, maggaṅgāni panettha satta honti.
For one who emerges from the second jhāna and practices vipassanā, the path that arises is associated with the second jhāna, but in this case, there are seven path factors.
Đối với người xuất khỏi thiền thứ hai và thực hành minh sát, đạo sinh khởi sẽ thuộc thiền thứ hai; ở đây có bảy đạo chi.
Tatiyajjhānato vuṭṭhāya vipassantassa uppanno tatiyajjhāniko, maggaṅgāni panettha satta, bojjhaṅgāni cha honti.
For one who emerges from the third jhāna and practices vipassanā, the path that arises is associated with the third jhāna, and in this case, there are seven path factors and six enlightenment factors.
Đối với người xuất khỏi thiền thứ ba và thực hành minh sát, đạo sinh khởi sẽ thuộc thiền thứ ba; ở đây có bảy đạo chi và sáu giác chi.
Esa nayo catutthajjhānato paṭṭhāya yāva nevasaññānāsaññāyatanā.
This method applies from the fourth jhāna up to the sphere of neither perception nor non-perception.
Phương pháp này áp dụng từ thiền thứ tư cho đến Phi tưởng phi phi tưởng xứ.
Āruppe catukkapañcakajjhānaṃ uppajjati, tañca kho lokuttaraṃ, na lokiyanti vuttaṃ.
In the immaterial spheres (āruppa), the fourfold or fivefold jhāna arises, and that is supramundane, not mundane, as stated.
Trong các cõi Vô sắc, thiền tứ và thiền ngũ sinh khởi, và đó là thiền siêu thế, không phải thiền thế gian, như đã nói.
Ettha kathanti?
How is this so here?
Ở đây, như thế nào?
Etthapi paṭhamajjhānādīsu yato vuṭṭhāya sotāpattimaggaṃ paṭilabhitvā arūpasamāpattiṃ bhāvetvā yo āruppe uppanno, taṃjhānikāva tassa tattha tayo maggā uppajjanti.
Here too, after emerging from any of the first jhāna and so forth, having attained the Sotāpatti-magga, and having developed the immaterial attainments, for the person who arises in the immaterial spheres, his three higher paths there arise associated with that same jhāna.
Cũng ở đây, người nào sau khi xuất khỏi một trong các thiền thứ nhất v.v., chứng đắc đạo Tu-đà-hoàn, rồi tu tập định Vô sắc và sinh vào cõi Vô sắc, thì ba đạo (cao hơn) của người ấy sinh khởi ở đó cũng thuộc cùng loại thiền ấy.
Evaṃ pādakajjhānameva niyameti.
Thus, only the foundational jhāna determines it.
Như vậy, chính thiền nền tảng quy định.
Keci pana therā ‘‘vipassanāya ārammaṇabhūtā khandhā niyamentī’’ti vadanti.
However, some elders say, "The aggregates that are the objects of vipassanā determine it."
Tuy nhiên, một số vị trưởng lão nói rằng "các uẩn làm đối tượng của minh sát quy định".
Keci ‘‘puggalajjhāsayo niyametī’’ti vadanti.
Some say, "The individual's disposition determines it."
Một số nói rằng "khuynh hướng của cá nhân quy định".
Keci ‘‘vuṭṭhānagāminī vipassanā niyametī’’ti vadanti.
Some say, "The vipassanā leading to emergence determines it."
Một số nói rằng "minh sát dẫn đến xuất khởi (vuṭṭhānagāminī vipassanā) quy định".
Tatrāyaṃ anupubbikathā – vipassanāniyamena hi sukkhavipassakassa uppannamaggopi, samāpattilābhino jhānaṃ pādakaṃ akatvā uppannamaggopi, paṭhamajjhānaṃ pādakaṃ katvā pakiṇṇakasaṅkhāre sammasitvā uppāditamaggopi paṭhamajjhānikova hoti, sabbesu satta bojjhaṅgāni aṭṭha maggaṅgāni pañca jhānaṅgāni honti.
Among these, this is the sequential explanation: By the determination of vipassanā, the path that arises for a dry-insight practitioner (sukkhavipassaka), or the path that arises for an attainer of samāpatti without making jhāna its foundation, or the path that arises after making the first jhāna its foundation and contemplating the mixed formations, is associated with the first jhāna. In all these, there are five jhāna factors, eight path factors, and seven enlightenment factors.
Trong đó, đây là trình tự giải thích: Theo sự quy định của minh sát, đạo sinh khởi của người thực hành thuần minh sát (sukkhavipassaka), đạo sinh khởi của người đắc định chứng nhưng không lấy thiền làm nền tảng, và đạo được tạo ra sau khi lấy thiền thứ nhất làm nền tảng và quán xét các hành tạp loạn (pakiṇṇakasaṅkhāra), đều thuộc thiền thứ nhất; trong tất cả các trường hợp này, có bảy giác chi, tám đạo chi và năm thiền chi.
Tesañhi pubbabhāgavipassanā somanassasahagatāpi upekkhāsahagatāpi hutvā vuṭṭhānakāle saṅkhārupekkhābhāvaṃ pattā somanassasahagatāva hoti.
For them, the preliminary vipassanā, whether accompanied by joy or accompanied by equanimity, becomes accompanied by joy when it reaches the state of equanimity towards formations (saṅkhārupekkhā) at the time of emergence.
Quả vậy, đối với họ, minh sát trong giai đoạn chuẩn bị, dù đi kèm với hỷ hay xả, khi đến thời điểm xuất khởi, sau khi đã đạt đến trạng thái xả đối với các hành (saṅkhārupekkhā), nó chỉ đi kèm với hỷ.
Pañcakanaye dutiyatatiyacatutthajjhānāni pādakāni katvā uppāditamaggesu yathākkameneva jhānaṃ caturaṅgikaṃ tivaṅgikaṃ duvaṅgikañca hoti, sabbesu pana satta maggaṅgāni honti, catutthe cha bojjhaṅgāni.
In the fivefold system, in the paths produced by making the second, third, and fourth jhānas the foundation, the jhāna has, in respective order, four factors, three factors, and two factors. In all of them, however, there are seven path factors, and in the fourth, there are six enlightenment factors.
Theo hệ thống năm thiền, trong các đạo được tạo ra sau khi lấy thiền thứ hai, thứ ba và thứ tư làm nền tảng, thiền tương ứng có bốn chi, ba chi và hai chi; nhưng trong tất cả các trường hợp, có bảy đạo chi, và trong thiền thứ tư có sáu giác chi.
Ayaṃ viseso pādakajjhānaniyamena ceva vipassanāniyamena ca hoti.
This distinction occurs by the determination of both the foundational jhāna and vipassanā.
Sự khác biệt này xảy ra do sự quy định của cả thiền nền tảng và minh sát.
Tesampi hi pubbabhāgavipassanā somanassasahagatāpi upekkhāsahagatāpi hoti, vuṭṭhānagāminī somanassasahagatāva.
For them too, the preliminary vipassanā may be accompanied by joy or by equanimity, but the vipassanā leading to emergence is always accompanied by joy.
Quả vậy, đối với họ, minh sát trong giai đoạn chuẩn bị cũng đi kèm với hỷ hoặc xả, nhưng minh sát dẫn đến xuất khởi chỉ đi kèm với hỷ.
Pañcamajjhānaṃ pādakaṃ katvā nibbattitamagge pana upekkhācittekaggatāvasena dve jhānaṅgāni, bojjhaṅgamaggaṅgāni cha satta ceva.
In the path produced by making the fifth jhāna the foundation, there are two jhāna factors by way of equanimity and one-pointedness of mind, and six enlightenment factors and seven path factors.
Tuy nhiên, trong đạo được tạo ra sau khi lấy thiền thứ năm làm nền tảng, có hai thiền chi là xả và nhất tâm; có sáu giác chi và bảy đạo chi.
Ayampi viseso ubhayaniyamavasena hoti.
This distinction also occurs by way of both determinations.
Sự khác biệt này cũng xảy ra do sự quy định của cả hai yếu tố (thiền nền tảng và minh sát).
Imasmiñhi naye pubbabhāgavipassanā somanassasahagatā vā upekkhāsahagatā vā hoti, vuṭṭhānagāminī upekkhāsahagatāva hoti.
In this method, the preliminary vipassanā may be accompanied by joy or by equanimity, but the vipassanā leading to emergence is always accompanied by equanimity.
Quả vậy, trong trường hợp này, minh sát trong giai đoạn chuẩn bị đi kèm với hỷ hoặc xả, nhưng minh sát dẫn đến xuất khởi chỉ đi kèm với xả.
Arūpajjhānāni pādakāni katvā uppāditamaggepi eseva nayo.
And in the path produced by making the immaterial jhānas the basis, the same method applies.
Trong đạo được tạo ra sau khi lấy các thiền Vô sắc làm nền tảng, phương pháp cũng tương tự.
Idha pana catukkanaye avitakkavicāramattassa dutiyajjhānassa abhāvā taṃ apanetvā sesānaṃ vasena yojetabbaṃ.
Here, however, in the fourfold system, due to the absence of the second jhāna which is merely avicāra (without vitakka but with vicāra), that should be removed, and the remaining ones should be applied.
Tuy nhiên, ở đây, trong hệ thống bốn thiền, do không có thiền thứ hai chỉ có tầm và tứ, nên cần loại bỏ thiền đó và áp dụng cho các thiền còn lại.
Evaṃ pādakajjhānato vuṭṭhāya ye keci saṅkhāre sammasitvā nibbattitamaggassa āsannapadese vuṭṭhitasamāpatti attanā sadisabhāvaṃ karoti bhūmivaṇṇo viya godhāvaṇṇassa.
Thus, having emerged from the foundational jhāna and contemplated whatever saṅkhāras, the attainment from which one emerged, in the vicinity of the path thus generated, becomes similar to itself, just as the color of the earth resembles the color of a monitor lizard.
Như vậy, sau khi xuất khỏi thiền nền tảng, quán xét bất kỳ các pháp hữu vi nào, định mà vị ấy đã xuất khỏi, ở nơi gần kề của đạo đã được phát sinh, làm cho (đạo) có trạng thái giống với chính nó, giống như màu sắc của đất (làm cho) màu sắc của con kỳ đà (trở nên tương tự).
Ayaṃ vuccati sammāsamādhīti yā imesu catūsu jhānesu ekaggatā, ayaṃ pubbabhāge lokiyo, aparabhāge lokuttaro sammāsamādhi nāma vuccati.
This is called Right Concentration — the one-pointedness of mind in these four jhānas is called sammāsamādhi, which is worldly (lokiya) in its preliminary stage and supramundane (lokuttara) in its later stage.
Đây được gọi là Chánh Định: Nhất tâm trong bốn thiền này, đây được gọi là Chánh Định, ở giai đoạn đầu là hiệp thế, ở giai đoạn sau là siêu thế.
Evaṃ lokiyalokuttaravasena dhammasenāpati maggasaccaṃ deseti.
Thus, the Dhamma-General teaches the Noble Truth of the Path in terms of worldly and supramundane.
Như vậy, vị Pháp Tướng quân thuyết giảng Thánh đế về Đạo theo phương diện hiệp thế và siêu thế.
Tattha lokiyamagge sabbāneva maggaṅgāni yathānurūpaṃ chasu ārammaṇesu aññatarārammaṇāni honti.
Among these, in the worldly path, all the path factors have one of the six objects as their object, as appropriate.
Trong đó, ở đạo hiệp thế, tất cả các đạo chi đều có một trong sáu đối tượng làm cảnh tùy theo sự tương ứng.
Lokuttaramagge pana catusaccappaṭivedhāya pavattassa ariyasāvakassa nibbānārammaṇaṃ avijjānusayasamugghātakaṃ paññācakkhu sammādiṭṭhi, tathā sampannadiṭṭhissa taṃsampayutto tividhamicchāsaṅkappasamugghātako cetaso nibbānapadābhiniropano sammāsaṅkappo, tathā passantassa vitakkentassa ca taṃsampayuttāva catubbidhavacīduccaritasamugghātikā micchāvācāya virati sammāvācā, tathā viramantassa taṃsampayuttāva tividhamicchākammantasamucchedikā micchākammantā virati sammākammanto, tesaṃyeva cassa vācākammantānaṃ vodānabhūtā taṃsampayuttāva kuhanādisamucchedikā micchāājīvā virati sammāājīvo, tassāyevassa sammāvācākammantājīvasaṅkhātāya sīlabhūmiyaṃ patiṭṭhamānassa tadanurūpo taṃsampayuttova kosajjasamucchedako, anuppannuppannānaṃ akusalakusalānaṃ anuppādappahānuppādaṭṭhitisādhako ca vīriyārambho sammāvāyāmo, evaṃ vāyamantassa taṃsampayuttova micchāsativiniddhunako, kāyādīsu kāyānupassanādisādhako ca cetaso asammoso sammāsati.
In the supramundane path, however, for the noble disciple practicing for the penetration of the Four Noble Truths, sammādiṭṭhi is the eye of wisdom, having Nibbāna as its object, eradicating the latent tendency of ignorance; for one endowed with such right view, sammāsaṅkappa is the mental projection towards the state of Nibbāna, associated with that, eradicating the three kinds of wrong thoughts; for one thus seeing and thinking, sammāvācā is abstinence from wrong speech, associated with that, eradicating the four kinds of verbal misconduct; for one thus abstaining, sammākammanto is abstinence from wrong action, associated with that, eradicating the three kinds of wrong bodily action; and for them, sammāājīvo is abstinence from wrong livelihood, associated with that, being the purification of their speech and action, eradicating deceit and so forth; for one established in this ground of morality, consisting of right speech, action, and livelihood, sammāvāyāmo is the exertion of effort, associated with that, corresponding to that, eradicating idleness, and accomplishing the non-arising, abandonment, arising, and establishment of unarisen and arisen wholesome and unwholesome states; for one thus striving, sammāsati is the non-forgetfulness of mind, associated with that, dispelling wrong mindfulness, and accomplishing the contemplation of the body, etc., in the body, etc.
Còn trong đạo siêu thế, đối với vị Thánh đệ tử đang thực hành để thấu triệt Tứ Thánh Đế, tuệ nhãn có Niết-bàn làm đối tượng, có khả năng nhổ bật vô minh tùy miên là Chánh Kiến; đối với vị đã thành tựu chánh kiến như vậy, sự hướng tâm về cảnh Niết-bàn tương ưng với nó, có khả năng nhổ bật ba loại tà tư duy là Chánh Tư Duy; đối với vị đang thấy và đang tư duy như vậy, sự từ bỏ tà ngữ tương ưng với nó, có khả năng nhổ bật bốn loại ác hạnh về lời nói là Chánh Ngữ; đối với vị đang từ bỏ như vậy, sự từ bỏ tà nghiệp tương ưng với nó, có khả năng đoạn trừ ba loại tà nghiệp là Chánh Nghiệp; sự từ bỏ tà mạng tương ưng với nó, là sự thanh tịnh của chính các nghiệp về lời nói và thân của vị ấy, có khả năng đoạn trừ sự giả dối v.v. là Chánh Mạng; đối với vị ấy đang an trú trên nền tảng giới hạnh bao gồm chánh ngữ, chánh nghiệp, chánh mạng, sự tinh tấn khởi lên tương ưng với nó, có khả năng đoạn trừ sự lười biếng, và có khả năng thành tựu việc không cho sanh khởi các pháp bất thiện chưa sanh, đoạn trừ các pháp bất thiện đã sanh, làm sanh khởi các pháp thiện chưa sanh và duy trì các pháp thiện đã sanh là Chánh Tinh Tấn; đối với vị đang tinh tấn như vậy, sự không quên của tâm tương ưng với nó, có khả năng rũ bỏ tà niệm, và có khả năng thành tựu quán thân trên thân v.v. là Chánh Niệm.
Evaṃ anuttarāya satiyā suvihitacittārakkhassa taṃsampayuttāva micchāsamādhividdhaṃsikā cittekaggatā sammāsamādhi.
Thus, for one whose mind is well-guarded by unsurpassed mindfulness, sammāsamādhi is the one-pointedness of mind, associated with that, destroying wrong concentration.
Như vậy, đối với vị có tâm được bảo hộ tốt đẹp bởi niệm vô thượng, sự nhất tâm tương ưng với nó, có khả năng phá hủy tà định là Chánh Định.
Esa lokuttaro ariyo aṭṭhaṅgiko maggo.
This is the supramundane, noble, eightfold path.
Đây là Bát Chánh Đạo, siêu thế, cao thượng.
Yo saha lokiyena maggena dukkhanirodhagāminipaṭipadāti saṅkhyaṃ gato, so kho panesa maggo sammādiṭṭhisaṅkappānaṃ vijjāya sesadhammānaṃ caraṇena saṅgahitattā vijjā ceva caraṇañca.
This path, which together with the worldly path is designated as the practice leading to the cessation of suffering, is indeed both knowledge (vijjā) and conduct (caraṇa), being comprised of knowledge through sammādiṭṭhi and sammāsaṅkappa, and of conduct through the remaining factors.
Con đường nào cùng với đạo hiệp thế được gọi là con đường đưa đến sự diệt khổ, con đường ấy chính là minh và hạnh, vì chánh kiến và chánh tư duy được bao hàm bởi minh, các pháp còn lại được bao hàm bởi hạnh.
Tathā tesaṃ dvinnaṃ vipassanāyānena itaresaṃ samathayānena saṅgahitattā samatho ceva vipassanā ca.
Likewise, it is both serenity (samatha) and insight (vipassanā), being comprised of insight through the vehicle of vipassanā for those two (right view and right thought), and of serenity through the vehicle of samatha for the others.
Tương tự, vì hai pháp ấy được bao hàm bởi cỗ xe minh sát, các pháp khác được bao hàm bởi cỗ xe chỉ tịnh, nên đó chính là chỉ và quán.
Tesaṃ dvinnaṃ paññākkhandhena tadanantarānaṃ tiṇṇaṃ sīlakkhandhena avasesānaṃ tiṇṇaṃ samādhikkhandhena adhipaññāadhisīlaadhicittasikkhāhi ca saṅgahitattā khandhattayañceva sikkhattayañca hoti.
It is also the three aggregates (khandhattaya) and the three trainings (sikkhāttaya), being comprised of the aggregate of wisdom (paññākkhandha) for those two, the aggregate of morality (sīlakkhandha) for the next three, and the aggregate of concentration (samādhikkhandha) for the remaining three, and by the trainings of higher wisdom (adhipaññā), higher morality (adhisīla), and higher mind (adhicitta).
Vì hai pháp ấy được bao hàm bởi tuệ uẩn, ba pháp kế tiếp được bao hàm bởi giới uẩn, ba pháp còn lại được bao hàm bởi định uẩn, và vì được bao hàm bởi tăng thượng tuệ học, tăng thượng giới học và tăng thượng tâm học, nên đó chính là ba uẩn và ba học.
Yena samannāgato ariyasāvako dassanasamatthehi cakkhūhi gamanasamatthehi ca pādehi samannāgato addhiko viya vijjācaraṇasampanno hutvā vipassanāyānena kāmasukhallikānuyogaṃ samathayānena attakilamathānuyoganti antadvayaṃ parivajjetvā majjhimapaṭipadaṃ paṭipanno paññākkhandhena mohakkhandhaṃ, sīlakkhandhena dosakkhandhaṃ, samādhikkhandhena ca lobhakkhandhaṃ padālento adhipaññāsikkhāya paññāsampadaṃ, adhisīlasikkhāya sīlasampadaṃ, adhicittasikkhāya samādhisampadanti tisso sampattiyo patvā amataṃ nibbānaṃ sacchikaroti.
The noble disciple, endowed with the eightfold path, which is called the path leading to the cessation of suffering together with the mundane path, having become accomplished in knowledge and conduct, like a traveler endowed with eyes capable of seeing and feet capable of walking, avoids the two extremes—the indulgence in sensual pleasures by the vehicle of vipassanā, and self-mortification by the vehicle of samatha—and practices the Middle Path. He shatters the aggregate of delusion with the aggregate of wisdom, the aggregate of hatred with the aggregate of virtue, and the aggregate of greed with the aggregate of concentration. Having attained the three accomplishments—the accomplishment of wisdom through the training in higher wisdom, the accomplishment of virtue through the training in higher virtue, and the accomplishment of concentration through the training in higher mind—he realizes the deathless Nibbāna.
Khi vị Thánh đệ tử được trang bị con đường này, giống như người đi đường được trang bị đôi mắt có khả năng thấy và đôi chân có khả năng đi, trở nên thành tựu minh và hạnh, bằng cỗ xe minh sát tránh xa cực đoan hưởng thụ dục lạc, bằng cỗ xe chỉ tịnh tránh xa cực đoan khổ hạnh ép xác, thực hành con đường trung đạo, dùng tuệ uẩn để phá tan si uẩn, dùng giới uẩn để phá tan sân uẩn, và dùng định uẩn để phá tan tham uẩn, bằng tăng thượng tuệ học đạt đến tuệ thành tựu, bằng tăng thượng giới học đạt đến giới thành tựu, bằng tăng thượng tâm học đạt đến định thành tựu, vị ấy chứng ngộ Niết-bàn bất tử sau khi đã đạt được ba sự thành tựu.
Ādimajjhapariyosānakalyāṇaṃ sattatiṃsabodhipakkhiyadhammaratanavicittaṃ sammattaniyāmasaṅkhātaṃ ariyabhūmiṃ okkanto hotīti.
He has entered the noble stage, which is beautiful in the beginning, middle, and end, adorned with the thirty-seven factors of enlightenment, the jewels of Dhamma, and designated as the fixed course of rightness.
Vị ấy được xem là đã bước vào thánh địa, được gọi là chánh tánh quyết định, tốt đẹp ở đoạn đầu, đoạn giữa và đoạn cuối, được trang hoàng bởi những bảo châu pháp là ba mươi bảy phẩm trợ Bồ-đề.
Apica pavattimācikkhanto bhagavā sahetukaṃ ācikkhi, nivattiñca saupāyaṃ.
Furthermore, when the Blessed One taught occurrence, he taught it with its cause, and when he taught non-occurrence, he taught it with its means.
Hơn nữa, khi Đức Thế Tôn giảng về sự diễn tiến (của khổ), Ngài đã giảng cùng với nguyên nhân của nó; và (khi giảng về) sự chấm dứt, (Ngài đã giảng) cùng với phương tiện (để đạt được).
Iti pavattinivattitadubhayahetūnaṃ etapparamato cattāreva vuttāni.
Thus, only four are taught, because they correspond to occurrence, non-occurrence, and their respective causes.
Do đó, vì giới hạn chỉ nằm trong sự diễn tiến, sự chấm dứt, và nguyên nhân của cả hai, nên chỉ có bốn Thánh đế được nói đến.
Tathā pariññeyyapahātabbasacchikātabbabhāvetabbānaṃ, taṇhāvatthutaṇhātaṇhānirodhataṇhānirodhūpāyānaṃ, ālayaālayarāmatāālayasamugghātaālayasamugghātūpāyānañca vasenāpi cattāreva vuttānīti.
Similarly, only four are taught by way of what is to be fully understood, what is to be abandoned, what is to be realized, and what is to be developed; by way of the basis of craving, craving, the cessation of craving, and the means to the cessation of craving; and by way of attachment, delight in attachment, the uprooting of attachment, and the means to the uprooting of attachment.
Tương tự, cũng nên hiểu rằng chỉ có bốn Thánh đế được nói đến theo phương diện của các pháp cần được liễu tri, cần được đoạn tận, cần được chứng ngộ, cần được tu tập; theo phương diện của nền tảng của ái, ái, sự diệt ái, và phương tiện diệt ái; và theo phương diện của nơi nương tựa, sự vui thích trong nơi nương tựa, sự nhổ bật nơi nương tựa, và phương tiện nhổ bật nơi nương tựa.
Ettha ca oḷārikattā sabbasattasādhāraṇattā ca suviññeyyanti dukkhasaccaṃ paṭhamaṃ vuttaṃ.
Among these, the Truth of Suffering is taught first because it is gross and common to all beings, and thus easily understood.
Trong đó, Thánh đế về Khổ được nói đến đầu tiên vì nó thô thiển, phổ biến cho tất cả chúng sanh, và do đó dễ nhận biết.
Tasseva hetudassanatthaṃ tadanantaraṃ samudayasaccaṃ, hetunirodhā phalanirodhoti ñāpanatthaṃ tato nirodhasaccaṃ, tadadhigamūpāyadassanatthaṃ ante maggasaccaṃ.
Immediately after that, the Truth of the Origin is taught to show its cause; then the Truth of Cessation is taught to make known that the cessation of the cause leads to the cessation of the result; and finally, the Truth of the Path is taught to show the means to its attainment.
Để chỉ ra nguyên nhân của nó, Thánh đế về Tập được nói đến ngay sau đó; để cho biết rằng do nhân diệt nên quả diệt, Thánh đế về Diệt được nói đến sau đó; và để chỉ ra phương tiện chứng ngộ nó, Thánh đế về Đạo được nói đến cuối cùng.
Bhavasukhassādagadhitānaṃ vā sattānaṃ saṃvegajananatthaṃ paṭhamaṃ dukkhamāha.
Alternatively, the Truth of Suffering is taught first to arouse a sense of urgency in beings who are infatuated with the taste of worldly happiness.
Hoặc, để làm phát sinh sự nhàm chán cho các chúng sanh đang tham đắm vị ngọt của lạc thú trong các cõi hữu, Ngài đã nói về khổ trước tiên.
Taṃ neva akataṃ āgacchati, na issaranimmānādito hoti, ito pana hotīti ñāpanatthaṃ tadanantaraṃ samudayaṃ.
Immediately after that, the Truth of the Origin is taught to make known that suffering does not arise uncaused, nor from a creator god, but rather from craving.
Để cho biết rằng khổ ấy không phải tự nhiên đến, không phải do Phạm thiên tạo ra v.v., mà là do nguyên nhân này, Ngài đã nói về Tập ngay sau đó.
Tato sahetukena dukkhena abhibhūtattā saṃviggamānasānaṃ dukkhanissaraṇagavesīnaṃ nissaraṇadassanena assāsajananatthaṃ nirodhaṃ.
Then, the Truth of Cessation is taught to inspire confidence in those whose minds are agitated by suffering with its cause and who seek an escape from suffering, by showing them the escape.
Sau đó, đối với những chúng sanh đang kinh sợ, đang tìm kiếm sự thoát khỏi khổ, vì đã bị cái khổ có nhân sanh áp đảo, Ngài thuyết về sự diệt để làm phát sanh sự an ổn bằng cách chỉ ra con đường thoát ly.
Tato nirodhādhigamanatthaṃ nirodhasampāpakaṃ magganti ayametesaṃ kamo.
Then, the Path, which leads to the attainment of cessation, is taught for the sake of attaining cessation. This is their order.
Sau đó, để đạt đến sự diệt, Ngài thuyết về con đường dẫn đến sự diệt. Đây là thứ tự của các chân lý này.
Etesu pana bhāro viya dukkhasaccaṃ daṭṭhabbaṃ, bhārādānamiva samudayasaccaṃ, bhāranikkhepanamiva nirodhasaccaṃ, bhāranikkhepanūpāyo viya maggasaccaṃ.
Among these, the Truth of Suffering should be seen as a burden, the Truth of the Origin as the taking up of a burden, the Truth of Cessation as the laying down of a burden, and the Truth of the Path as the means to lay down a burden.
Trong các chân lý này, khổ đế nên được xem như gánh nặng, tập đế như việc mang lấy gánh nặng, diệt đế như việc đặt gánh nặng xuống, và đạo đế như phương pháp đặt gánh nặng xuống.
Rogo viya vā dukkhasaccaṃ, roganidānamiva samudayasaccaṃ, rogavūpasamo viya nirodhasaccaṃ, bhesajjamiva maggasaccaṃ.
Or, the Truth of Suffering is like a disease, the Truth of the Origin is like the cause of a disease, the Truth of Cessation is like the recovery from a disease, and the Truth of the Path is like medicine.
Hoặc, khổ đế nên được xem như bệnh tật, tập đế như nguyên nhân của bệnh tật, diệt đế như sự chấm dứt bệnh tật, và đạo đế như thuốc chữa bệnh.
Dubbhikkhamiva vā dukkhasaccaṃ, dubbuṭṭhi viya samudayasaccaṃ, subhikkhamiva nirodhasaccaṃ, suvuṭṭhi viya maggasaccaṃ.
Or, the noble truth of suffering is like a famine; the noble truth of the origin of suffering is like a drought; the noble truth of the cessation of suffering is like abundance; the noble truth of the path is like good rainfall.
Hoặc, khổ đế như nạn đói, tập đế như hạn hán, diệt đế như sự sung túc, và đạo đế như mưa thuận gió hòa.
Apica verīveramūlaverasamugghātaverasamugghātūpāyehi, visarukkharukkhamūlamūlūpacchedatadupacchedūpāyehi, bhayabhayamūlanibbhayatadadhigamūpāyehi, orimatīramahoghapārimatīrataṃsampāpakavāyāmehi ca yojetvāpetāni upamāto veditabbānīti.
Furthermore, these* should be understood by way of simile, connecting them with (1) an enemy, the root of enmity, the eradication of enmity, and the means of eradicating enmity; (2) a poisonous tree, the root of the poisonous tree, the cutting off of the root, and the means of cutting it off; (3) fear, the root of fear, fearlessness, and the attainment of fearlessness; and (4) the near shore, the great flood, the far shore, and the effort to reach that far shore.
Hơn nữa, các chân lý này cũng nên được hiểu qua các ví dụ bằng cách liên kết chúng với: kẻ thù, nguồn gốc của kẻ thù, sự diệt trừ kẻ thù, và phương pháp diệt trừ kẻ thù; cây độc, gốc rễ của cây độc, sự chặt đứt gốc rễ, và phương pháp chặt đứt gốc rễ; sự sợ hãi, nguồn gốc của sự sợ hãi, sự không sợ hãi, và phương pháp đạt đến sự không sợ hãi; bờ bên này, dòng lũ lớn, bờ bên kia, và sự nỗ lực để đến được bờ bên kia.
Nirodhasuññāni vā tīṇi, nirodho ca sesattayasuñño.
Or, the three are empty of cessation, and cessation is empty of the other three.
Hoặc, ba chân lý (khổ, tập, đạo) trống không về sự diệt, và sự diệt thì trống không về ba chân lý còn lại.
Phalasuñño vā ettha hetu samudaye dukkhassa abhāvato, magge ca nirodhassa, na phalena sagabbho pakativādīnaṃ pakati viya.
Or, here, the cause is empty of effect, because suffering is absent in the origin, and cessation is absent in the path, not being pregnant with effect like the primordial matter (pakati) of the naturalists.
Hoặc, ở đây, nhân trống không về quả, vì trong tập đế không có khổ đế, và trong đạo đế không có diệt đế; nó không chứa đựng quả trong mình như tự tính (pakati) của các nhà tự tính luận (pakativādī).
Hetusuññañca phalaṃ dukkhasamudayānaṃ nirodhamaggānañca asamavāyā, na hetusamavetaṃ hetuphalaṃ samavāyavādīnaṃ dviaṇukādi viya.
And the effect is empty of cause, because suffering and its origin, and cessation and the path, are not co-existent, nor is the cause and effect co-inherent like the two-atom aggregate (dvianuka) of the co-inherence theorists.
Và quả trống không về nhân, vì khổ và tập, diệt và đạo không cùng tồn tại; quả-nhân không phải là thứ kết hợp với nhân như nhị nguyên tử (dviaṇuka) của các nhà kết hợp luận (samavāyavādī).
Tenetaṃ vuccati –
Therefore, it is said:
Do đó, có lời dạy rằng:
‘‘Taṃ kiṃ maññasi, ānanda, katamaṃ nu kho dukkarataraṃ vā durabhisambhavataraṃ vā, yo dūratova sukhumena tāḷacchiggaḷena asanaṃ atipāteyya poṅkhānupoṅkhaṃ avirādhitaṃ, yo vā sattadhā bhinnassa vālassa koṭiyā koṭiṃ paṭivijjheyyāti?
“What do you think, Ānanda, which is more difficult or harder to achieve: one who from afar shoots an arrow through a fine keyhole, shaft after shaft, without missing, or one who pierces the tip of a hair split seven times with the tip of another hair?” “This, Venerable Sir, is indeed more difficult and harder to achieve: one who pierces the tip of a hair split seven times with the tip of another hair.” “Yet, Ānanda, those who penetrate thus penetrate something even more difficult to penetrate, namely, those who truly penetrate ‘This is suffering’…pe… ‘This is the path leading to the cessation of suffering’.”
“Này Ānanda, ông nghĩ thế nào, điều nào là khó làm hơn, khó thực hiện hơn: người có thể bắn một mũi tên từ xa xuyên qua một lỗ nhỏ trên lá thốt nốt, mũi này nối tiếp mũi kia không sai trật, hay người có thể dùng đầu của một sợi lông đã được chẻ bảy lần để bắn trúng đầu của một sợi lông khác?”
Etadeva, bhante, dukkaratarañceva durabhisambhavatarañca; Yo vā sattadhā bhinnassa vālassa koṭiyā koṭiṃ paṭivijjheyyāti; Atha kho te, ānanda, duppaṭivijjhataraṃ paṭivijjhanti, ye ‘idaṃ dukkha’nti yathābhūtaṃ paṭivijjhanti…pe… ‘ayaṃ dukkhanirodhagāminī paṭipadā’ti yathābhūtaṃ paṭivijjhantī’’ti (saṃ. ni. 5.1115);
“What do you think, Ānanda, which is more difficult or harder to achieve: one who from afar shoots an arrow through a fine keyhole, shaft after shaft, without missing, or one who pierces the tip of a hair split seven times with the tip of another hair?” “This, Venerable Sir, is indeed more difficult and harder to achieve: one who pierces the tip of a hair split seven times with the tip of another hair.” “Yet, Ānanda, those who penetrate thus penetrate something even more difficult to penetrate, namely, those who truly penetrate ‘This is suffering’…pe… ‘This is the path leading to the cessation of suffering’.”
“Bạch Thế Tôn, điều này khó làm hơn và khó thực hiện hơn: người có thể dùng đầu của một sợi lông đã được chẻ bảy lần để bắn trúng đầu của một sợi lông khác. Này Ānanda, thế nhưng, những người liễu tri đúng như thật rằng ‘Đây là khổ’... cho đến... ‘Đây là con đường đưa đến sự diệt khổ’ thì họ còn liễu tri được một điều khó hơn thế nữa.”
Visabhāgāni salakkhaṇavavatthānato.
They are dissimilar by the distinction of their individual characteristics.
Chúng khác biệt nhau về phương diện phân định tự tướng.
Purimāni ca dve sabhāgāni duravagāhatthena gambhīrattā lokiyattā sāsavattā ca, visabhāgāni phalahetubhedato pariññeyyapahātabbato ca.
And the first two are similar due to their profundity in being difficult to fathom, being mundane, and being associated with defilements (sāsava); they are dissimilar due to the distinction of effect and cause, and by being subject to full understanding and abandonment.
Hai chân lý đầu tiên tương đồng với nhau vì sâu xa khó thấu hiểu, thuộc về thế gian, và có lậu hoặc; chúng khác biệt nhau về phương diện phân chia quả và nhân, và về phương diện cần được liễu tri và cần được đoạn trừ.
Pacchimānipi dve sabhāgāni gambhīrattena duravagāhattā lokuttarattā anāsavattā ca, visabhāgāni visayavisayībhedato sacchikātabbabhāvetabbato ca.
The latter two are also similar due to their profundity in being difficult to fathom, being supramundane, and being unassociated with defilements (anāsava); they are dissimilar due to the distinction of object and subject, and by being subject to realization and development.
Hai chân lý sau cùng cũng tương đồng với nhau vì sâu xa khó thấu hiểu, thuộc về siêu thế, và vô lậu; chúng khác biệt nhau về phương diện phân chia đối tượng và chủ thể, và về phương diện cần được chứng ngộ và cần được tu tập.
Paṭhamatatiyāni cāpi sabhāgāni phalāpadesato, visabhāgāni saṅkhatāsaṅkhatato.
The first and third are also similar by being designated as effects; they are dissimilar by being conditioned and unconditioned.
Chân lý thứ nhất và thứ ba cũng tương đồng với nhau về phương diện được gọi là quả; chúng khác biệt nhau về phương diện hữu vi và vô vi.
Dutiyacatutthāni cāpi sabhāgāni hetuapadesato, visabhāgāni ekantakusalākusalato.
The second and fourth are also similar by being designated as causes; they are dissimilar by being exclusively unwholesome and wholesome.
Chân lý thứ hai và thứ tư cũng tương đồng với nhau về phương diện được gọi là nhân; chúng khác biệt nhau về phương diện hoàn toàn thiện và bất thiện.
Paṭhamacatutthāni cāpi sabhāgāni saṅkhatato, visabhāgāni lokiyalokuttarato.
The first and fourth are also similar by being conditioned; they are dissimilar by being mundane and supramundane.
Chân lý thứ nhất và thứ tư cũng tương đồng với nhau về phương diện hữu vi; chúng khác biệt nhau về phương diện thế gian và siêu thế.
Dutiyatatiyāni cāpi sabhāgāni nevasekkhanāsekkhabhāvato, visabhāgāni sārammaṇānārammaṇato.
The second and third are also similar by being neither trainees nor perfected ones; they are dissimilar by being with an object and without an object.
Chân lý thứ hai và thứ ba cũng tương đồng với nhau về phương diện là pháp của bậc phi hữu học và phi vô học; chúng khác biệt nhau về phương diện có đối tượng và không có đối tượng.
Sabbameva cettha dukkhaṃ ekavidhaṃ pavattibhāvato, duvidhaṃ nāmarūpato, tividhaṃ kāmarūpārūpūpapattibhavabhedato, catubbidhaṃ catuāhārabhedato, pañcavidhaṃ pañcupādānakkhandhabhedato.
Herein, all suffering is of one kind by way of existence; of two kinds by way of name-and-form; of three kinds by way of the divisions of existence in the sensual realm, form realm, and formless realm; of four kinds by way of the four nutriments; of five kinds by way of the five aggregates of clinging.
Ở đây, tất cả khổ là một loại theo phương diện là sự hiện hữu; hai loại theo phương diện danh và sắc; ba loại theo sự phân chia về sanh hữu trong cõi Dục, cõi Sắc và cõi Vô Sắc; bốn loại theo sự phân chia về bốn loại vật thực; năm loại theo sự phân chia về năm thủ uẩn.
Samudayopi ekavidho pavattakabhāvato, duvidho diṭṭhisampayuttāsampayuttato, tividho kāmabhavavibhavataṇhābhedato, catubbidho catumaggappaheyyato, pañcavidho rūpābhinandanādibhedato, chabbidho chataṇhākāyabhedato.
The origin is also of one kind by way of being the cause of arising; of two kinds by way of being associated with wrong view or not associated with wrong view; of three kinds by way of the divisions of craving for sensual pleasures, craving for existence, and craving for non-existence; of four kinds by being abandoned by the four paths; of five kinds by way of the divisions such as delighting in form; of six kinds by way of the six bodies of craving.
Tập đế cũng là một loại theo phương diện là tác nhân tạo ra sự hiện hữu; hai loại theo phương diện tương ưng và bất tương ưng với tà kiến; ba loại theo sự phân chia về ái dục, ái hữu và ái phi hữu; bốn loại theo phương diện bị bốn đạo đoạn trừ; năm loại theo sự phân chia về sự hoan hỷ trong sắc v.v...; sáu loại theo sự phân chia về sáu thân ái.
Nirodhopi ekavidho asaṅkhatadhātubhāvato, pariyāyato pana duvidho saupādisesaanupādisesato, tividho bhavattayavūpasamato, catubbidho catumaggādhigamanīyato, pañcavidho pañcābhinandanavūpasamato, chabbidho chataṇhākāyakkhayabhedato.
Cessation (Nirodha) is also onefold, due to its nature as the unconditioned element (asaṅkhatadhātu). Figuratively, however, it is twofold, as Nibbāna with residue (saupādisesa) and Nibbāna without residue (anupādisesa); threefold, due to the appeasement of the three existences; fourfold, due to being attainable by the four paths; fivefold, due to the appeasement of delight in the five sense objects; and sixfold, due to the destruction of the six craving-bodies.
Diệt đế cũng là một loại theo phương diện là giới vô vi; nhưng theo nghĩa diễn giải, nó có hai loại là hữu dư y và vô dư y; ba loại theo phương diện là sự dập tắt ba cõi; bốn loại theo phương diện được bốn đạo chứng đắc; năm loại theo phương diện là sự dập tắt năm sự hoan hỷ; sáu loại theo sự phân chia về sự đoạn tận sáu thân ái.
Maggopi ekavidho bhāvetabbato, duvidho samathavipassanābhedato, dassanabhāvanābhedato vā, tividho khandhattayabhedato.
The path (Magga) is also onefold, due to being developed; twofold, due to the distinction of tranquility (samatha) and insight (vipassanā), or due to the distinction of insight (dassana) and development (bhāvanā); threefold, due to the distinction of the three aggregates.
Đạo đế cũng là một loại theo phương diện cần được tu tập; hai loại theo sự phân chia về chỉ và quán, hoặc theo sự phân chia về kiến đạo và tu đạo; ba loại theo sự phân chia về ba uẩn.
Ayañhi sappadesattā nagaraṃ viya rajjena nippadesehi tīhi khandhehi saṅgahito.
This, indeed, due to its having parts, is encompassed by the three aggregates, which are without parts, like a city by a kingdom.
Thật vậy, vì có các thành phần, nên đạo đế này được bao gồm bởi ba uẩn không có thành phần, cũng như một thành phố được bao gồm bởi một vương quốc.
Yathāha –
As it is said:
Như có lời dạy:
‘‘Na kho, āvuso visākha, ariyena aṭṭhaṅgikena maggena tayo khandhā saṅgahitā, tīhi ca kho, āvuso visākha, khandhehi ariyo aṭṭhaṅgiko maggo saṅgahito.
“Indeed, friend Visākha, the three aggregates are not encompassed by the Noble Eightfold Path; rather, friend Visākha, the Noble Eightfold Path is encompassed by the three aggregates.
“Này hiền hữu Visākha, ba uẩn không được bao gồm bởi Bát Thánh Đạo, mà Bát Thánh Đạo, này hiền hữu Visākha, được bao gồm bởi ba uẩn.
Yā, cāvuso visākha, sammāvācā yo ca sammākammanto yo ca sammāājīvo, ime dhammā sīlakkhandhe saṅgahitā.
Whatever is right speech, right action, and right livelihood, friend Visākha—these qualities are encompassed in the aggregate of morality (sīlakkhandha).
Này hiền hữu Visākha, chánh ngữ, chánh nghiệp và chánh mạng, những pháp này được bao gồm trong giới uẩn.
Yo ca sammāvāyāmo yā ca sammāsati yo ca sammāsamādhi, ime dhammā samādhikkhandhe saṅgahitā.
Whatever is right effort, right mindfulness, and right concentration—these qualities are encompassed in the aggregate of concentration (samādhikkhandha).
Chánh tinh tấn, chánh niệm và chánh định, những pháp này được bao gồm trong định uẩn.
Yā ca sammādiṭṭhi yo ca sammāsaṅkappo, ime dhammā paññākkhandhe saṅgahitā’’ti (ma. ni. 1.462).
Whatever is right view and right intention—these qualities are encompassed in the aggregate of wisdom (paññākkhandha).”
Chánh kiến và chánh tư duy, những pháp này được bao gồm trong tuệ uẩn.”
Apica sabbāneva saccāni ekavidhāni avitathattā, abhiññeyyattā vā.
Furthermore, all truths are onefold, due to being unfailing, or due to being knowable by direct knowledge.
Hơn nữa, tất cả các chân lý là một loại vì không sai lạc, hoặc vì cần được thắng tri.
Duvidhāni lokiyalokuttarato, saṅkhatāsaṅkhatato vā.
They are twofold, as mundane and supramundane, or as conditioned and unconditioned.
Hai loại theo phương diện thế gian và siêu thế, hoặc hữu vi và vô vi.
Tividhāni dassanabhāvanāhi pahātabbato appahātabbato nevapahātabbanāpahātabbato ca.
They are threefold, as to be abandoned by insight (dassana) and development (bhāvanā), not to be abandoned, and neither to be abandoned nor not to be abandoned.
Ba loại theo phương diện cần được đoạn trừ bởi kiến đạo và tu đạo, không cần đoạn trừ, và vừa không cần đoạn trừ vừa không phải không cần đoạn trừ.
Catubbidhāni pariññeyyapahātabbasacchikātabbabhāvetabbatoti.
They are fourfold, as to be fully understood, to be abandoned, to be realized, and to be developed.
Bốn loại theo phương diện cần được liễu tri, cần được đoạn trừ, cần được chứng ngộ, và cần được tu tập.