Atthato pana evaṃ-saddo tāva upamūpadesasampahaṃsanagarahaṇavacanasampaṭiggahākāranidassanāvadhāraṇādianekatthappabhedo.
In terms of meaning, however, the word evaṃ has many different meanings, such as simile, instruction, praise, censure, acceptance of speech, manner, demonstration, and affirmation.
Tuy nhiên, về mặt ý nghĩa, từ evaṃ có nhiều nghĩa khác nhau như so sánh, hướng dẫn, tán thán, khiển trách, chấp nhận lời nói, cách thức, ví dụ, và xác định.
Tathāhesa – ‘‘evaṃ jātena maccena kattabbaṃ kusalaṃ bahu’’nti evamādīsu (dha. pa. 53) upamāyaṃ āgato.
For instance, it appears in simile in passages like “Thus by a mortal who is born should much merit be done.”
Chẳng hạn, nó xuất hiện với nghĩa so sánh trong các câu như: "Một người sinh ra như vậy phải làm nhiều điều thiện" và các ví dụ khác.
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In instruction, in passages like “Thus you should go forward, thus you should go back.”
Với nghĩa hướng dẫn trong các câu như: "Ngươi phải đi tới như vậy, ngươi phải đi lui như vậy" và các ví dụ khác.
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In praise, in passages like “So it is, Blessed One, so it is, Sugata.”
Với nghĩa tán thán trong các câu như: "Thật vậy, bạch Thế Tôn! Thật vậy, bạch Thiện Thệ!" và các ví dụ khác.
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In censure, in passages like “In this very way, this outcast praises that shaven-headed ascetic in any and every way.”
Với nghĩa khiển trách trong các câu như: "Thật vậy, người phụ nữ thấp hèn này, trong bất cứ trường hợp nào, cũng tán dương vị Sa-môn đầu trọc đó" và các ví dụ khác.
‘‘Evaṃ bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (ma. ni. 1.1) vacanasampaṭiggahe.
In acceptance of speech, in passages like “Those bhikkhus replied to the Blessed One, saying, ‘Yes, venerable sir.’”
Với nghĩa chấp nhận lời nói trong các câu như: "Bạch Thế Tôn, các Tỳ-kheo đó vâng lời Thế Tôn" và các ví dụ khác.
‘‘Evaṃ byākho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In manner, in passages like “In this manner, venerable sir, I understand the Dhamma taught by the Blessed One.”
Với nghĩa cách thức trong các câu như: "Bạch Thế Tôn, tôi hiểu pháp do Thế Tôn thuyết giảng theo cách này" và các ví dụ khác.
‘‘Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama, upasaṅkamitvā mama vacanena samaṇaṃ, ānandaṃ, appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha – ‘subho māṇavo todeyyaputto, bhavantaṃ ānandaṃ, appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’ti, evañca vadehi sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’’tiādīsu (dī. ni. 1.445) nidassane.
In demonstration, in passages like “Come, young man, go to the ascetic Ānanda and, on my behalf, ask the ascetic Ānanda about his freedom from illness and affliction, his lightness, strength, and comfortable living, saying: ‘The young man Subha, son of Todeyya, asks the venerable Ānanda about his freedom from illness and affliction, his lightness, strength, and comfortable living,’ and say this: ‘It would be good if the venerable Ānanda would go to the residence of the young man Subha, son of Todeyya, out of compassion.’”
Với nghĩa ví dụ trong các câu như: "Này thanh niên, hãy đi đến chỗ Sa-môn Ānanda, sau khi đến, hãy thay lời ta hỏi thăm Sa-môn Ānanda về sức khỏe, bệnh tật, sự nhẹ nhàng, sức mạnh, và sự an lạc: ‘Thanh niên Subha, con trai của Todeyya, hỏi thăm Tôn giả Ānanda về sức khỏe, bệnh tật, sự nhẹ nhàng, sức mạnh, và sự an lạc.’ Và hãy nói như vậy: ‘Thật tốt nếu Tôn giả Ānanda đến tư gia của thanh niên Subha, con trai của Todeyya, vì lòng từ bi’" và các ví dụ khác.
‘‘Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vāti?
“What do you think, Kālāmas, are these things wholesome or unwholesome?
Với nghĩa xác định trong các câu như: "Các Kālāma, các ngươi nghĩ sao, những pháp này là thiện hay bất thiện?
Akusalā, bhante.
Unwholesome, venerable sir.
Bất thiện, bạch Thế Tôn.
Sāvajjā vā anavajjā vāti?
Are they blameworthy or blameless?
Có lỗi hay không có lỗi?
Sāvajjā, bhante.
Blameworthy, venerable sir.
Có lỗi, bạch Thế Tôn.
Viññugarahitā vā viññuppasatthā vāti?
Are they censured by the wise or praised by the wise?
Bị người trí khiển trách hay được người trí tán thán?
Viññugarahitā, bhante.
Censured by the wise, venerable sir.
Bị người trí khiển trách, bạch Thế Tôn.
Samattā samādinnā ahitāya dukkhāya saṃvattanti no vā, kathaṃ vo ettha hotīti?
When undertaken and observed, do they lead to harm and suffering, or not, or what is your opinion on this matter?
Nếu được thực hành và chấp nhận, chúng có dẫn đến bất lợi và khổ đau không, hay không? Các ngươi nghĩ sao về điều này?
Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’tiādīsu (a. ni. 3.66) avadhāraṇe.
When undertaken and observed, venerable sir, they lead to harm and suffering; this is our opinion on this matter.” In these and similar passages, it is in affirmation.
Bạch Thế Tôn, nếu được thực hành và chấp nhận, chúng dẫn đến bất lợi và khổ đau, chúng tôi nghĩ về điều này như vậy" và các ví dụ khác.
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
Here, it should be seen in the senses of manner, demonstration, and affirmation.
Ở đây, nó nên được hiểu theo nghĩa cách thức, ví dụ và xác định.
Avadhāraṇaṭṭhena ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.219-223) evaṃ bhagavatā, ‘‘āyasmā ānando atthakusalo dhammakusalo byañjanakusalo niruttikusalo pubbāparakusalo’’ti (a. ni. 5.169) evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukamyataṃ janeti ‘‘evaṃ me sutaṃ, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
By the word ‘evaṃ’ in the sense of determination, showing his own power of retention, which is befitting of his praised state, as stated by the Blessed One: “‘This one, O monks, is the chief of my monk disciples who are learned, that is, Ānanda; of those with good sense, of those with mindfulness, of those with resolution, and of attendants, that is, Ānanda,’” and by the General of the Dhamma: “The venerable Ānanda is skilled in the meaning, skilled in the Dhamma, skilled in the phrasing, skilled in the etymology, and skilled in what comes before and after,” he generates in beings the desire to hear, thinking: “Thus it was heard by me, and that, whether in meaning or in phrasing, is neither deficient nor excessive; it should be seen just so, and not otherwise.”
Với ý nghĩa xác định, (Tôn giả Ānanda) thể hiện sức mạnh ghi nhớ của mình phù hợp với lời tán thán của Đức Thế Tôn: "Này các Tỳ-khưu, trong số các đệ tử Tỳ-khưu đa văn của Ta, người đứng đầu là Ānanda; trong số những người có trí tuệ, có niệm, có nghị lực, và là người hầu cận, người đứng đầu là Ānanda" và lời tán thán của Pháp Tướng quân (Tôn giả Sāriputta): "Tôn giả Ānanda thiện xảo về ý nghĩa, thiện xảo về giáo pháp, thiện xảo về văn tự, thiện xảo về ngữ pháp, thiện xảo về trước sau," để phát khởi ý muốn lắng nghe nơi chúng sinh (bằng cách nói): "Như vầy tôi đã nghe, và điều được ghi nhớ ấy không thiếu không thừa về ý nghĩa hay văn tự, nó phải được hiểu đúng như vậy, không khác."
Me-saddo tīsu atthesu dissati.
The word me is found in three senses.
Từ me được thấy trong ba nghĩa.
Tathā hissa ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (su. ni. 81) mayāti attho.
For, in such phrases as, “Food obtained by reciting verses is not to be eaten by me,” its meaning is ‘by me’.
Quả thật, trong các trường hợp như "Gāthābhigītaṃ me abhojaneyya" (Tôi không nên thọ dụng những gì được ca tụng bằng kệ), v.v., nó có nghĩa là "mayā" (bởi tôi).
‘‘Sādhu me, bhante bhagavā, saṃkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88) mayhanti attho.
In such phrases as, “Venerable sir, may the Blessed One teach me the Dhamma in brief,” its meaning is ‘to me’.
Trong các trường hợp như "Sādhu me, bhante bhagavā, saṃkhittena dhammaṃ desetū" (Bạch Thế Tôn, xin Thế Tôn thuyết pháp vắn tắt cho con), v.v., nó có nghĩa là "mayhaṃ" (cho tôi).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In such phrases as, “Monks, be heirs to my Dhamma,” its meaning is ‘my’.
Trong các trường hợp như "Dhammadāyādā me, bhikkhave, bhavathā" (Này các Tỳ-khưu, hãy trở thành những người thừa kế Pháp của Ta), v.v., nó có nghĩa là "mama" (của tôi).
Idha pana ‘‘mayā suta’’nti ca ‘‘mama suta’’nti ca atthadvaye yujjati.
Here, however, it is suitable in the two senses of “heard by me” and “my hearing.”
Ở đây, từ "me" có thể được dùng trong hai nghĩa: "mayā sutaṃ" (tôi đã nghe) và "mama sutaṃ" (điều tôi đã nghe).
Sutanti ayaṃ suta-saddo saupasaggo ca anupasaggo ca gamana-vissuta-kilinna-upacitānuyoga-sotaviññeyya-sotadvārānusāraviññātādianekatthappabhedo.
The word suta (heard), both with and without a prefix, has various meanings, such as going, renowned, moistened, accumulated, application, cognizable by the ear, known by following the ear-door, and others.
Từ suta (đã nghe) này, dù có tiền tố hay không có tiền tố, có nhiều nghĩa khác nhau như đi, nổi tiếng, dính ướt, tích lũy, thực hành, nhận thức bằng tai, được biết do theo dõi qua cửa tai, v.v.
Tathā hissa ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
For, in such phrases as, “Gone forth with the army,” its meaning is ‘going’.
Quả thật, trong các trường hợp như "senāya pasuto" (đã đi với quân đội), v.v., nó có nghĩa là "gacchanto" (đã đi).
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho, ‘‘avassutā avassutassāti’’ādīsu (pāci. 657) kilinnā kilinnassāti attho.
In such phrases as, “Of one who sees the renowned Dhamma,” its meaning is ‘renowned Dhamma’; in such phrases as, “The moistened for the moistened,” its meaning is ‘the stained for the stained’.
Trong các trường hợp như "Sutadhammassa passato" (của người đã nghe Pháp, đã thấy), v.v., nó có nghĩa là "vissutadhammassa" (của người có Pháp nổi tiếng); trong các trường hợp như "avassutā avassutassa" (người nữ dính ướt cho người nam dính ướt), v.v., nó có nghĩa là "kilinnā kilinnassa" (người nữ dính ướt cho người nam dính ướt).
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In such phrases as, “Much merit has been accumulated by you,” its meaning is ‘accumulated’.
Trong các trường hợp như "Tumhehi puññaṃ pasutaṃ anappaka" (Các ngươi đã tích lũy công đức không ít), v.v., nó có nghĩa là "upacitaṃ" (đã tích lũy).
‘‘Ye jhānapasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In such phrases as, “Those wise ones who are applied to jhāna,” its meaning is ‘devoted to jhāna’.
Trong các trường hợp như "Ye jhānapasutā dhīrā" (Những bậc trí tuệ đã thực hành thiền định), v.v., nó có nghĩa là "jhānānuyuttā" (đã thực hành thiền định).
‘‘Diṭṭhaṃ sutaṃ muta’’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In such phrases as, “Seen, heard, sensed,” its meaning is ‘cognizable by the ear’.
Trong các trường hợp như "Diṭṭhaṃ sutaṃ mutaṃ" (đã thấy, đã nghe, đã biết), v.v., nó có nghĩa là "sotaviññeyyaṃ" (có thể nhận thức bằng tai).
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In such phrases as, “A bearer of what is heard, a collector of what is heard,” its meaning is ‘a bearer of what is known by following the ear-door’.
Trong các trường hợp như "Sutadharo sutasannicayo" (người ghi nhớ điều đã nghe, người tích lũy điều đã nghe), v.v., nó có nghĩa là "sotadvārānusāraviññātadharo" (người ghi nhớ điều đã biết do theo dõi qua cửa tai).
Idha panassa sotadvārānusārena ‘‘upadhārita’’nti vā ‘‘upadhāraṇa’’nti vāti attho.
Here, however, its meaning is ‘retained’ or ‘retention’ by way of following the ear-door.
Ở đây, nó có nghĩa là "upadhāritaṃ" (đã ghi nhớ) hoặc "upadhāraṇaṃ" (sự ghi nhớ) do theo dõi qua cửa tai.
Me-saddassa hi mayāti atthe sati ‘‘evaṃ mayā sutaṃ sotadvārānusārena upadhārita’’nti yujjati.
For, when the word ‘me’ has the meaning of ‘by me,’ it is fitting as, “Thus it was heard, retained by me by following the ear-door.”
Quả thật, khi từ "me" có nghĩa là "mayā", thì nó phù hợp với "evaṃ mayā sutaṃ sotadvārānusārena upadhāritaṃ" (như vầy tôi đã nghe, đã ghi nhớ do theo dõi qua cửa tai).
Mamāti atthe sati ‘‘evaṃ mama sutaṃ sotadvārānusārena upadhāraṇa’’nti yujjati.
When it has the meaning of ‘my,’ it is fitting as, “Thus is my hearing, my retention by following the ear-door.”
Khi có nghĩa là "mama", thì nó phù hợp với "evaṃ mama sutaṃ sotadvārānusārena upadhāraṇaṃ" (như vầy là sự ghi nhớ của tôi do theo dõi qua cửa tai).
Evametesu tīsu padesu evanti sotaviññāṇādiviññāṇakiccanidassanaṃ.
Thus, in these three terms, evaṃ is a demonstration of the function of consciousness, beginning with ear-consciousness.
Trong ba từ này, evaṃ là sự biểu thị chức năng nhận thức của nhĩ thức và các thức khác.
Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ.
Me is a demonstration of the person endowed with that said consciousness.
Me là sự biểu thị người có đầy đủ nhận thức đã nói.
Sutanti assavanabhāvappaṭikkhepato anūnānadhikāviparītaggahaṇanidassanaṃ.
Suta is a demonstration of grasping without deficiency, excess, or error, by rejecting the state of not hearing.
Sutaṃ là sự biểu thị sự nắm bắt không thiếu, không thừa, không sai lệch, bằng cách phủ nhận tình trạng không được nghe.
Tathā evanti tassā sotadvārānusārena pavattāya viññāṇavīthiyā nānappakārena ārammaṇe pavattibhāvappakāsanaṃ.
Likewise, evaṃ is the declaration of the state of occurrence in the object in various ways of that cognitive process which has arisen by following the ear-door.
Cũng vậy, evaṃ là sự công bố về sự vận hành của lộ trình nhận thức qua cửa tai theo nhiều cách khác nhau trên đối tượng.
Meti attappakāsanaṃ.
Me is the declaration of the self.
Me là sự công bố về bản thân.
Sutanti dhammappakāsanaṃ.
Suta is the declaration of the Dhamma.
Sutaṃ là sự công bố về Pháp.
Ayañhettha saṅkhepo ‘‘nānappakārena ārammaṇe pavattāya viññāṇavīthiyā mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo suto’’ti.
And here, this is the summary: “By means of the cognitive process that has occurred in the object in various ways, nothing else was done by me, but this was done: this Dhamma was heard.”
Tóm lại ở đây là: "Với lộ trình nhận thức đã vận hành trên đối tượng theo nhiều cách khác nhau, tôi không làm điều gì khác, nhưng điều này đã được làm, Pháp này đã được nghe."
Tathā evanti ca meti ca taṃ taṃ upādāya vattabbato upādāpaññatti.
Likewise, evaṃ and me are relational concepts, since they must be spoken of in dependence on this or that.
Cũng vậy, evaṃ và me là những khái niệm nương tựa (upādāpaññatti) vì chúng được nói ra dựa trên các yếu tố tương ứng.
Sutanti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Suta is a comparative concept, since it must be spoken of in comparison to things seen and so on.
Sutaṃ là khái niệm so sánh (upanidhāpaññatti) vì nó được nói ra dựa trên sự so sánh với "đã thấy" (diṭṭha) và các giác quan khác.
Ettha ca evanti vacanena asammohaṃ dīpeti.
And herein, by the word evaṃ, he shows non-delusion.
Và ở đây, bằng từ evaṃ, (Tôn giả Ānanda) biểu thị sự không mê lầm.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti.
For a deluded person is not capable of penetrating in various ways.
Quả thật, người mê lầm không có khả năng thấu hiểu nhiều phương diện khác nhau.
Sutanti vacanena sutassa asammosaṃ dīpeti.
By the word suta, he shows non-forgetfulness of what was heard.
Bằng từ sutaṃ, (Tôn giả Ānanda) biểu thị sự không quên điều đã nghe.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantarena mayā sutanti paṭijānāti.
For one whose hearing has been forgotten does not, after a time, profess, “It was heard by me.”
Quả thật, người mà điều đã nghe bị quên đi, sau một thời gian sẽ không thể xác nhận rằng "tôi đã nghe."
Iccassa asammohena paññāsiddhi, asammosena pana satisiddhi.
Thus, for him, the accomplishment of wisdom is through non-delusion, while the accomplishment of mindfulness is through non-forgetfulness.
Như vậy, nhờ sự không mê lầm mà trí tuệ được thành tựu, còn nhờ sự không quên mà niệm được thành tựu.
Tattha paññā pubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā, satipubbaṅgamāya paññāya atthapaṭivedhasamatthatā, tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthato dhammabhaṇḍāgārikattasiddhi.
Therein, with mindfulness preceded by wisdom, there is the ability to retain the phrasing; with wisdom preceded by mindfulness, there is the ability to penetrate the meaning. Through the connection with the ability in both, and due to the ability to preserve the treasury of the Dhamma, which is complete in meaning and phrasing, there is the accomplishment of being the Treasurer of the Dhamma.
Trong đó, nhờ niệm được dẫn dắt bởi trí tuệ mà có khả năng nắm giữ văn tự; nhờ trí tuệ được dẫn dắt bởi niệm mà có khả năng thấu hiểu ý nghĩa. Nhờ sự kết hợp của cả hai khả năng ấy, mà có khả năng bảo hộ kho tàng Pháp đầy đủ cả ý nghĩa và văn tự, do đó thành tựu vị trí Thủ kho Pháp Bảo.
Aparo nayo – evanti vacanena yoniso manasikāraṃ dīpeti, ayoniso manasikaroto hi nānappakārapaṭivedhābhāvato.
Another method: by the word evaṃ, he shows wise attention, because one who practices unwise attention lacks the penetration in various ways.
Một phương pháp khác: Bằng từ evaṃ, (Tôn giả Ānanda) biểu thị sự tác ý đúng đắn (yoniso manasikāra), bởi vì người không tác ý đúng đắn thì không có khả năng thấu hiểu nhiều phương diện khác nhau.
Sutanti vacanena avikkhepaṃ dīpeti, vikkhittacittassa savanābhāvato.
By the word suta, he shows non-distraction, because one with a distracted mind is unable to hear.
Bằng từ sutaṃ, (Tôn giả Ānanda) biểu thị sự không tán loạn (avikkhepa), bởi vì người có tâm tán loạn thì không thể nghe được.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Indeed, a person with a distracted mind, even when spoken to with all completeness, says, “It was not heard by me, please speak again.”
Quả thật, một người có tâm tán loạn, dù được thuyết giảng tất cả những điều tốt đẹp, vẫn nói: "Tôi chưa nghe, xin hãy nói lại."
Yoniso manasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti, sammā apaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Herein, by wise attention, he establishes right aspiration of the self and merit made in the past, because these are absent for one whose self is wrongly directed or who has not made merit in the past.
Và ở đây, nhờ tác ý đúng đắn mà (Tôn giả Ānanda) đã thành tựu sự tự định hướng đúng đắn và công đức đã làm từ trước, bởi vì người không tự định hướng đúng đắn hoặc người chưa làm công đức từ trước thì không có được điều đó.
Avikkhepena pana saddhammassavanaṃ sappurisūpanissayañca sādheti.
And by non-distraction, he establishes the hearing of the true Dhamma and resorting to good persons.
Còn nhờ sự không tán loạn mà (Tôn giả Ānanda) đã thành tựu việc lắng nghe Chánh Pháp và sự nương tựa vào bậc thiện trí.
Na hi vikkhittacitto sotuṃ sakkoti, na ca sappurise anupassayamānassa savanaṃ atthīti.
For a distracted person is not able to hear, and for one who does not attend upon good persons, there is no hearing.
Quả thật, người có tâm tán loạn thì không thể nghe được, và người không nương tựa vào bậc thiện trí thì không có sự lắng nghe.
Aparo nayo – yasmā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddesoti vuttaṃ.
Another way: Because by “thus” it is said that for whichever continuity of consciousness there is the grasping of various meanings and expressions due to its functioning in various modes, for that there is a description of various modes.
Một cách khác – bởi vì evaṃ (như vầy) được nói là sự chỉ dẫn về các phương thức đa dạng cho dòng tâm thức của người nào mà nhờ sự vận hành đa dạng, có thể nắm bắt được nhiều nghĩa và biểu đạt khác nhau.
So ca evaṃ bhaddako ākāro na sammā appaṇihitattano pubbe akatapuññassa vā hoti, tasmā evanti iminā bhaddakena ākārena pacchimacakkadvayasampattiṃ attano dīpeti, sutanti savanayogena purimacakkadvayasampattiṃ.
And since such a good mode does not occur for one whose self is not rightly directed or for one who has not made merit in the past, therefore, by “thus,” with this good mode, he indicates his own accomplishment in the latter pair of wheels; by “heard,” through the application of hearing, the accomplishment in the former pair of wheels.
Và dáng vẻ tốt đẹp như vậy không thể có ở người không có sự chú tâm đúng đắn hoặc người chưa từng tạo phước trong quá khứ. Do đó, với dáng vẻ tốt đẹp này, evaṃ (như vầy) biểu thị sự thành tựu của hai bánh xe sau cùng của tự thân, còn sutaṃ (tôi nghe) biểu thị sự thành tựu của hai bánh xe trước cùng qua sự lắng nghe.
Na hi appatirūpadese vasato sappurisūpanissayavirahitassa vā savanaṃ atthi.
For there is no hearing for one who lives in an unsuitable place or who is without the support of true persons.
Thật vậy, không có sự lắng nghe đối với người sống ở nơi không phù hợp hoặc người không có sự nương tựa vào bậc thiện trí.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhi siddhā hoti.
Thus, through his accomplishment in the latter pair of wheels, the purity of his intention is accomplished.
Như vậy, nhờ sự thành tựu của hai bánh xe sau cùng, sự thanh tịnh về ý định (āsaya-suddhi) được thành tựu.
Purimacakkadvayasiddhiyā payogasuddhi.
Through the accomplishment in the former pair of wheels, the purity of his application.
Nhờ sự thành tựu của hai bánh xe trước cùng, sự thanh tịnh về nỗ lực (payoga-suddhi) được thành tựu.
Tāya ca āsayasuddhiyā adhigamabyattisiddhi, payogasuddhiyā āgamabyattisiddhi.
And by that purity of intention, there is accomplishment in the skill of realization; by the purity of application, there is accomplishment in the skill of the scriptures.
Và nhờ sự thanh tịnh về ý định ấy, sự thành tựu về trí tuệ chứng đắc (adhigama-byatti) được thành tựu; nhờ sự thanh tịnh về nỗ lực, sự thành tựu về trí tuệ học hỏi (āgama-byatti) được thành tựu.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggaṃ viya sūriyassa udayato yonisomanasikāro viya ca kusalakammassa arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento evaṃ me sutantiādimāha.
Thus, the speech of one whose application and intention are pure, who is accomplished in the scriptures and realization, is worthy of being the forerunner of the Blessed One's speech, just as the dawn is for the rising of the sun, and just as wise attention is for wholesome karma. Therefore, placing the introduction in its proper context, he said, “Thus have I heard,” and so on.
Như vậy, lời nói của một người có ý định và nỗ lực thanh tịnh, thành tựu cả trí tuệ học hỏi và trí tuệ chứng đắc, xứng đáng là phần mở đầu cho lời dạy của Đức Thế Tôn, giống như rạng đông là phần mở đầu cho mặt trời mọc, và sự tác ý đúng đắn (yonisomanasikāra) là phần mở đầu cho nghiệp thiện. Do đó, để đặt ra phần dẫn nhập đúng chỗ, Ngài đã nói “ Evaṃ me sutaṃ” (Như vầy tôi nghe) và phần tiếp theo.
Aparo nayo – evanti iminā nānappakārapaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another way: By this word “thus,” which indicates the penetration of various kinds, he indicates the existence of his own accomplishment in the analytical knowledge of meaning and perspicuity.
Một cách khác – với từ ngữ evaṃ (như vầy) biểu thị sự thâm nhập đa dạng, Ngài biểu thị sự hiện hữu của sự thành tựu về trí tuệ phân tích nghĩa (attha-paṭisambhidā) và trí tuệ phân tích biện tài (paṭibhāna-paṭisambhidā) của mình.
Sutanti iminā sotabbabhedapaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ.
By this word “heard,” which indicates the penetration of the various kinds of things to be heard, the existence of his accomplishment in the analytical knowledge of the Dhamma and language.
Với từ ngữ sutaṃ (tôi nghe) biểu thị sự thâm nhập các loại pháp cần nghe, Ngài biểu thị sự hiện hữu của sự thành tựu về trí tuệ phân tích pháp (dhamma-paṭisambhidā) và trí tuệ phân tích ngôn ngữ (nirutti-paṭisambhidā).
Evanti ca idaṃ yonisomanasikāradīpakaṃ vacanaṃ bhāsamāno – ‘‘ete mayā dhammā manasānupekkhitā diṭṭhiyā suppaṭividdhā’’ti dīpeti.
And in speaking this word “thus,” which indicates wise attention, he indicates, “These dhammas have been contemplated by me with the mind, well-penetrated with vision.”
Và khi nói từ ngữ evaṃ (như vầy) này, biểu thị sự tác ý đúng đắn (yonisomanasikāra), Ngài biểu thị rằng: “Những pháp này đã được tôi quán sát bằng ý và được thâm nhập một cách hoàn hảo bằng chánh kiến.”
Sutanti idaṃ savanayogadīpakaṃ vacanaṃ bhāsamāno – ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
In speaking this word “heard,” which indicates the application of hearing, he indicates, “Many dhammas have been heard by me, borne in mind, and practiced with speech.”
Khi nói từ ngữ sutaṃ (tôi nghe) này, biểu thị sự nỗ lực lắng nghe, Ngài biểu thị rằng: “Nhiều pháp đã được tôi lắng nghe, ghi nhớ và thực hành bằng lời nói.”
Tadubhayenapi atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both of these, while indicating the completeness of the meaning and the letter, he generates reverence for hearing.
Với cả hai điều đó, Ngài biểu thị sự đầy đủ về nghĩa và biểu đạt, và tạo ra sự chú tâm vào việc lắng nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti ādaraṃ janetvā sakkaccaṃ dhammo sotabboti.
For one who does not listen with reverence to the Dhamma that is complete in meaning and letter is excluded from great benefit; thus, having generated reverence, the Dhamma should be listened to attentively.
Thật vậy, người không lắng nghe pháp đầy đủ về nghĩa và biểu đạt một cách cung kính sẽ bị loại trừ khỏi lợi ích lớn lao. Vì vậy, sau khi tạo ra sự chú tâm, pháp cần được lắng nghe một cách cung kính.
‘‘Evaṃ me suta’’nti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammaṃ attano adahanto asappurisabhūmiṃ atikkamati, sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati.
Moreover, by this whole phrase “Thus have I heard,” the venerable Ānanda, by not attributing the Dhamma proclaimed by the Tathāgata to himself, transcends the domain of untrue persons; by professing his discipleship, he enters the domain of true persons.
Hơn nữa, với toàn bộ lời nói “Evaṃ me sutaṃ” (Như vầy tôi nghe) này, Tôn giả Ānanda đã vượt qua cảnh giới của kẻ bất thiện khi không nhận pháp do Đức Như Lai thuyết giảng là của mình, và bước vào cảnh giới của bậc thiện trí khi tự nhận là đệ tử.
Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti.
Similarly, he raises his mind from the false Dhamma; he establishes his mind in the true Dhamma.
Tương tự, Ngài làm cho tâm thoát khỏi tà pháp và thiết lập tâm vào chánh pháp.
‘‘Kevalaṃ sutamevetaṃ mayā tasseva pana bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
By indicating, “This was merely heard by me, it is the word of that Blessed One himself,” he absolves himself, points to the Teacher, establishes it as the Victor's word, and establishes the guideline of the Dhamma.
Khi biểu thị rằng “Đây chỉ là lời tôi đã nghe từ chính Đức Thế Tôn,” Ngài tự giải thoát, chỉ rõ Bậc Đạo Sư, tôn vinh lời Phật, và thiết lập đường lối của Pháp (Dhamma-netti).
Apica ‘‘evaṃ me suta’’nti attanā uppāditabhāvaṃ appaṭijānanto purimavacanaṃ vivaranto ‘‘sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa vacanaṃ, na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kattabbā’’ti sabbadevamanussānaṃ imasmiṃ dhamme assaddhiyaṃ vināseti, saddhāsampadaṃ uppādetīti.
Furthermore, by saying “Thus have I heard,” not professing it to have been produced by himself, but clarifying the previous statement, he says, “This is the word of that Blessed One—who is expert in the four kinds of fearlessness, who possesses the ten powers, who stands in the pre-eminent position, who roars the lion’s roar, who is the highest of all beings, the lord of the Dhamma, the king of the Dhamma, the sovereign of the Dhamma, the lamp of the Dhamma, the refuge of the Dhamma, the supreme universal monarch of the good Dhamma, the Perfectly Enlightened One—this word was received by me directly from him. There should be no doubt or uncertainty here regarding the meaning, the Dhamma, the phrase, or the letter.” Thus, for all devas and humans, he dispels faithlessness in this Dhamma and produces the accomplishment of faith.
Hơn nữa, khi nói “Evaṃ me sutaṃ” (Như vầy tôi nghe), không tự nhận mình là người đã tạo ra, mà là người đang giải thích lời nói trước đó, Ngài nói: “Lời này tôi đã trực tiếp nhận từ Đức Thế Tôn, bậc đã thành thạo với bốn sự vô úy, bậc nắm giữ mười lực, bậc đứng ở vị trí tối thượng, bậc cất tiếng rống sư tử, bậc tối thượng trong tất cả chúng sinh, bậc Pháp Chủ, bậc Pháp Vương, bậc Pháp Tôn, bậc Pháp Đăng, bậc Pháp Quy, bậc Chuyển Luân Thánh Vương của Chánh Pháp, bậc Chánh Đẳng Giác. Không có bất kỳ sự nghi ngờ hay do dự nào về nghĩa, về pháp, về từ ngữ hay về biểu đạt ở đây.” Như vậy, Ngài đã tiêu diệt sự bất tín của tất cả chư thiên và loài người đối với Pháp này, và tạo ra sự thành tựu về đức tin.
Tenetaṃ vuccati –
Therefore it is said:
Vì thế, người ta nói rằng:
Tathā hissa ‘‘appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho.
Indeed, its meaning is conjunction in such passages as, “Perhaps we might go tomorrow, taking into account the right time and the opportunity.”
Được thấy trong sự tụ hội, khoảnh khắc, thời gian, tập hợp, nguyên nhân, quan điểm,
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo.
Its meaning is moment in such passages as, “Monks, there is but one moment and time for living the holy life.”
Trong sự đạt được, sự từ bỏ, và sự thâm nhập.
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
Its meaning is time in such passages as, “a hot time, a sweltering time.”
Thật vậy, trong các trường hợp như “Appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā” (Có lẽ ngày mai chúng ta sẽ đến, tùy theo thời gian và cơ hội), ý nghĩa là sự tụ hội (samavāya).
‘‘Mahāsamayo pavanasmi’’ntiādīsu samūho.
Its meaning is collection in such passages as, “There was a great gathering in the woods.”
Trong các trường hợp như “Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā” (Này các Tỳ-kheo, chỉ có một khoảnh khắc và thời điểm cho việc sống Phạm hạnh), ý nghĩa là khoảnh khắc (khaṇa).
‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati, ‘bhaddāli, nāma bhikkhu satthusāsane sikkhāya na paripūrakārī’ti, ayampi kho te, bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
Its meaning is cause in such passages as, “Bhaddāli, this cause was also not penetrated by you: ‘The Blessed One is dwelling in Sāvatthī, and the Blessed One will know of me that “The monk named Bhaddāli is not a fulfiller of the training in the Teacher’s Dispensation.”’ This cause, Bhaddāli, was also not penetrated by you.”
Trong các trường hợp như “Uṇhasamayo pariḷāhasamayo” (Mùa nóng, mùa oi bức), ý nghĩa là thời gian (kāla).
‘‘Tena kho pana samayena uggāhamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
Its meaning is view in such passages as, “At that time the wanderer Uggāhamāna, son of Samaṇamuṇḍikā, was dwelling in Mallikā’s park at the single-hall debate ground with the tinduka-tree enclosure.”
Trong các trường hợp như “Mahāsamayo pavanasmi” (Đại hội tại khu rừng), ý nghĩa là tập hợp (samūha).
Ādīsu (saṃ. ni. 1.129) paṭilābho.
In such passages, its meaning is attainment.
“Diṭṭhe dhamme ca yo attho, yo cattho samparāyiko;
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (ma. ni. 1.24) pahānaṃ.
Its meaning is abandoning in such passages as, “Through the full understanding of conceit, he made an end of suffering.”
Atthābhisamayā dhīro, paṇḍitoti pavuccatī”ti –
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. ma. 3.1) paṭivedho.
Its meaning is penetration in such passages as, “The meaning of suffering is affliction, conditionedness, torment, change, and what is to be fully understood.”
Trong các trường hợp như trên, ý nghĩa là sự đạt được (paṭilābha).
Idha panassa kālo attho.
Here, however, its meaning is time.
Trong các trường hợp như “Sammā mānābhisamayā antamakāsi dukkhassā” (Nhờ sự thấu hiểu đúng đắn về kiêu mạn, đã chấm dứt khổ đau), ý nghĩa là sự từ bỏ (pahāna).
Tena saṃvacchara-utu-māsaḍḍhamāsa-ratti-diva-pubbaṇha-majjhanhika-sāyanha- paṭhamamajjhimapacchimayāma-muhuttādīsu kālappabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
By this, he indicates “one time” among the times which are divisions of time, such as year, season, month, half-month, night, day, morning, midday, evening, the first, middle, and last watches, and a moment.
Trong các trường hợp như “Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho” (Khổ có nghĩa là bị áp bức, có nghĩa là được tạo tác, có nghĩa là bị thiêu đốt, có nghĩa là biến đổi, có nghĩa là sự thấu hiểu), ý nghĩa là sự thâm nhập (paṭivedha).
Tattha kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yamhi yamhi saṃvacchare utumhi māse pakkhe rattibhāge divasabhāge vā vuttaṃ, sabbaṃ taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Therein, although among these times such as years, whichever sutta was spoken in whichever year, season, month, fortnight, part of the night, or part of the day, all that was well-known to the Elder and well-established by his wisdom.
Ở đây, ý nghĩa của nó là thời gian (kāla).
Yasmā pana ‘‘evaṃ me sutaṃ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vā’’ti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
But because if it were said, “Thus it was heard by me in such-and-such a year, in such-and-such a season, in such-and-such a month, in such-and-such a fortnight, in such-and-such a part of the night, or in such-and-such a part of the day,” it could not be easily remembered, recited, or taught, and much would have to be said. Therefore, having combined that meaning into a single phrase, he said, “at one time.”
Do đó, nó biểu thị “một thời” trong số các thời điểm là các loại thời gian như năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, buổi trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v.
Ye vā ime gabbhokkantisamayo jātisamayo saṃvegasamayo abhinikkhamanasamayo dukkarakārikasamayo māravijayasamayo abhisambodhisamayo diṭṭhadhammasukhavihārasamayo desanāsamayo parinibbānasamayoti evamādayo bhagavato devamanussesu ativiya suppakāsā anekakālappabhedā eva samayā, tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Or, there are these various divisions of time that are extremely well-known among devas and humans, such as the time of conception, the time of birth, the time of spiritual urgency, the time of renunciation, the time of ascetic practice, the time of conquering Māra, the time of full enlightenment, the time of dwelling in happiness in the present life, the time of teaching, and the time of final Nibbāna. Among these times, he indicates “one time,” designated as the time of teaching.
Mặc dù trong số các thời điểm như năm, v.v., bất kỳ bài kinh nào được nói vào năm nào, mùa nào, tháng nào, nửa tháng nào, phần đêm nào, hay phần ngày nào, tất cả đều được vị Trưởng lão biết rõ và phân định rõ ràng bằng trí tuệ.
Yo cāyaṃ ñāṇakaruṇākiccasamayesu aruṇākiccasamayo, attahitaparahitapaṭipattisamayesu parahitapaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammikathāsamayo, desanāpaṭipattisamayesu desanāsamayo, tesupi samayesu aññataraṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
And this which, among the occasions for the work of wisdom and the work of compassion, is the occasion for the work of compassion; which, among the occasions for the practice of one's own welfare and the welfare of others, is the occasion for the practice of the welfare of others; which, among the occasions for the two duties towards those assembled, is the occasion for a Dhamma talk; and which, among the occasions for teaching and for practice, is the occasion for teaching—referring to one of these occasions, he said, "at one time."
Trong các thời điểm của hoạt động trí tuệ và hoạt động từ bi, đây là thời điểm của hoạt động từ bi; trong các thời điểm thực hành lợi ích cho bản thân và lợi ích cho người khác, đây là thời điểm thực hành lợi ích cho người khác; trong các thời điểm của hai việc cần làm đối với những người đã tập hợp, đây là thời điểm thuyết pháp; trong các thời điểm thuyết pháp và thực hành, đây là thời điểm thuyết pháp. Đức Phật đã nói “một thời” là để chỉ một trong các thời điểm đó.
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacara’’nti ca ito aññesu suttapadesu ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī’’ti ca bhummavacanena niddeso kato, vinaye ca ‘‘tena samayena buddho bhagavā’’ti karaṇavacanena, tathā akatvā ‘‘ekaṃ samaya’’nti upayogavacananiddeso katoti.
Why is it that here the specification with the accusative case, "ekaṃ samayaṃ," is made, and not as it is done in the Abhidhamma with the locative case, as in "yasmiṃ samaye kāmāvacaraṃ," and in other sutta passages as in "yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehi," and in the Vinaya with the instrumental case, as in "tena samayena buddho bhagavā"?
Tại sao ở đây, không dùng cách diễn đạt bằng định sở cách (bhummavacana) như trong Abhidhamma: “Vào lúc nào, các pháp thuộc cõi Dục…” và trong các bài kinh khác: “Này các Tỳ-khưu, vào lúc nào một Tỳ-khưu ly dục…”; cũng không dùng cách diễn đạt bằng công cụ cách (karaṇavacana) như trong Luật (Vinaya): “Vào lúc ấy, Đức Phật Thế Tôn…”, mà lại dùng cách diễn đạt bằng đối cách (upayogavacana) “ekaṃ samayaṃ” (một thời)?
Tattha tathā idha ca aññathā atthasambhavato.
Because there, it is so, and here, it is otherwise, due to the possibility of a different meaning.
Vì ở đó và ở đây có sự khác biệt về ý nghĩa.
Tattha hi abhidhamme ito aññesu suttapadesu ca adhikaraṇattho bhāvenabhāvalakkhaṇattho ca sambhavati.
For there, in the Abhidhamma and in other sutta passages, the meaning of location and the meaning of bhāvena-bhāvalakkhaṇa are possible.
Thật vậy, trong Abhidhamma và trong các bài kinh khác ngoài bài này, ý nghĩa của định sở cách (adhikaraṇa) và ý nghĩa của biểu tướng sự tồn tại (bhāvenabhāvalakkhaṇa) đều có thể xảy ra.
Adhikaraṇañhi kālattho ca samūhattho ca samayo, tattha vuttānaṃ phassādidhammānaṃ khaṇasamavāyahetusaṅkhātassa ca samayassa bhāvena tesaṃ bhāvo lakkhīyati, tasmā tadatthajotanatthaṃ tattha bhummavacananiddeso kato.
Indeed, the time (samayo) has the meaning of a temporal point and the meaning of a collection; it is the basis for the dhammas such as contact, etc., mentioned there, and their existence is indicated by the existence of that time, which is designated as the moment, the conjunction, and the cause. Therefore, to illuminate that meaning, the specification with the locative case is made there.
Thời điểm (samaya) là ý nghĩa của thời gian và ý nghĩa của tập hợp (samūha). Ở đó, sự tồn tại của các pháp như xúc (phassa) đã được đề cập được biểu thị bằng sự tồn tại của thời điểm (samaya) được gọi là nhân duyên đồng thời (khaṇasamavāyahetu). Do đó, để làm rõ ý nghĩa đó, ở đó đã dùng cách diễn đạt bằng định sở cách.
Ukkaṭṭhāyaṃ viharatīti ettha ukkāti dīpikā, tañca nagaraṃ ‘‘maṅgaladivaso sukhaṇo sunakkhattaṃ mā atikkamī’’ti rattimpi ukkāsu ṭhitāsu māpitattā ukkaṭṭhāti vuccati.
In "was dwelling at Ukkaṭṭhā," 'ukkā' means a torch. And that town is called Ukkaṭṭhā because it was built while torches were kept standing even at night so that "the auspicious day, the favorable moment, the good constellation might not be missed."
Trong “ Ukkaṭṭhāyaṃ viharatī” (trú tại Ukkaṭṭhā), “ukkā” có nghĩa là ngọn đuốc. Thành phố đó được gọi là Ukkaṭṭhā vì nó được xây dựng khi các ngọn đuốc được thắp sáng vào ban đêm để không bỏ lỡ “ngày lành, giờ tốt, sao tốt”.
Daṇḍadīpikāsu jāletvā dhārīyamānāsu māpitattāti vuttaṃ hoti, tassaṃ ukkaṭṭhāyaṃ.
This means it was built while torches on poles were lit and held up. At that Ukkaṭṭhā.
Điều đó có nghĩa là nó được xây dựng khi các ngọn đuốc được thắp sáng và giữ trên các cột. Trong thành phố Ukkaṭṭhā đó.
Samīpatthe cetaṃ bhummavacanaṃ.
And this is a locative case in the sense of proximity.
Đây là định sở cách với ý nghĩa gần kề.
Viharatīti avisesena iriyāpathadibbabrahmaariyavihāresu aññataravihārasamaṅgiparidīpanametaṃ.
"Was dwelling" is a general indication of being endowed with one of the modes of abiding, namely, postural, divine, brahma, or noble abiding.
“ Viharatī” (trú) là để chỉ sự đầy đủ một trong các tư thế oai nghi, các trú xứ Phạm thiên, các trú xứ Thánh, một cách không phân biệt.
Idha pana ṭhānagamananisinnasayanappabhedesu riyāpathesu aññatarairiyāpathasamāyogaparidīpanaṃ.
Here, however, it indicates being engaged in one of the postures, among the various postures of standing, walking, sitting, and lying down.
Ở đây, nó chỉ sự kết hợp với một trong các tư thế oai nghi như đứng, đi, ngồi, nằm.
Tena ṭhitopi gacchantopi nisinnopi sayānopi bhagavā viharaticceva veditabbo.
Therefore, it should be understood that the Blessed One "is dwelling" whether standing, walking, sitting, or lying down.
Do đó, cần phải hiểu rằng Đức Thế Tôn trú dù Ngài đang đứng, đang đi, đang ngồi hay đang nằm.
So hi bhagavā ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā aparipatantaṃ attabhāvaṃ harati pavatteti, tasmā viharatīti vuccati.
For that Blessed One relieves the strain of one posture with another posture, and carries on, or maintains, his non-collapsing physical frame. Therefore, he is said to "dwell."
Thật vậy, Đức Thế Tôn đã phá bỏ sự khó chịu của một tư thế oai nghi bằng một tư thế oai nghi khác, duy trì và tiếp tục thân thể của mình không bị suy yếu. Do đó, Ngài được gọi là “viharatī”.
Subhagavaneti ettha subhagattā subhagaṃ, sundarasirikattā sundarakāmattā cāti vuttaṃ hoti.
In "in the Subhaga Grove," it is "Subhaga" because it is beautiful; this means it is because of its splendid beauty and because it fulfills beautiful wishes.
Trong “ Subhagavane” (trong rừng Subhaga), nó được gọi là Subhaga vì có vẻ đẹp, tức là có vẻ đẹp lộng lẫy và có những ước muốn tốt đẹp.
Tassa hi vanassa sirisampattiyā manussā annapānādīni ādāya divasaṃ tattheva chaṇasamajjaussave karontā bhogasukhaṃ anubhonti, sundarasundare cettha kāme patthenti ‘‘puttaṃ labhāma, dhītaraṃ labhāmā’’ti, tesaṃ taṃ tatheva hoti, evaṃ taṃ sundarasirikattā sundarakāmattā ca subhagaṃ.
For, due to the splendor of that grove, people, taking food and drink, etc., spend the day there making festivals, gatherings, and celebrations, enjoying the pleasure of wealth. And they wish for beautiful things there, such as, "May we obtain a son, may we obtain a daughter," and it happens for them just so. Thus, it is "Subhaga" because of its splendid beauty and because it fulfills beautiful wishes.
Thật vậy, nhờ vẻ đẹp lộng lẫy của khu rừng đó, mọi người mang thức ăn, đồ uống và các thứ khác đến đó để tổ chức các lễ hội và vui chơi, tận hưởng hạnh phúc vật chất. Ở đây, họ ước muốn những điều tốt đẹp: “Mong chúng tôi có con trai, mong chúng tôi có con gái”, và điều ước của họ thành hiện thực. Như vậy, khu rừng đó là Subhaga vì có vẻ đẹp lộng lẫy và có những ước muốn tốt đẹp.
Apica bahujanakantatāyapi subhagaṃ.
Moreover, it is "Subhaga" also because it is dear to many people.
Hơn nữa, nó cũng là Subhaga vì được nhiều người yêu thích.
Vanayatīti vanaṃ, attasampadāya sattānaṃ bhattiṃ kāreti, attani sinehaṃ uppādetīti attho.
It endears, thus it is a "grove" (vana); by its own splendor, it causes beings to feel devotion, it gives rise to affection for itself—this is the meaning.
Nó được gọi là vana (rừng) vì nó làm phát sinh sự yêu thích của chúng sinh đối với sự hoàn hảo của chính nó, tức là nó làm phát sinh tình yêu đối với chính nó.
Vanute iti vā vanaṃ, nānāvidhakusuma-gandhasammodamattakokilādivihaṅgamābhirutehi mandamālutacalitarukkhasākhāviṭapapallavapalāsehi ca ‘‘etha maṃ paribhuñjathā’’ti sabbapāṇino yācati viyāti attho.
Or, it is a "grove" (vana) because it requests; with the calls of cuckoos and other birds intoxicated by the mingled scents of various flowers, and with the branches, boughs, twigs, and leaves of the trees swaying in the gentle breeze, it is as if it begs all living beings, "Come, enjoy me"—this is the meaning.
Hoặc nó được gọi là vana vì nó mời gọi tất cả chúng sinh, như thể nó đang cầu xin: “Hãy đến và tận hưởng tôi”, với tiếng hót líu lo của các loài chim như chim cu gáy, say sưa với hương thơm của các loài hoa đa dạng, và với những cành cây, nhánh cây, lá non, lá già rung rinh bởi làn gió nhẹ.
Subhagañca taṃ vanañcāti subhagavanaṃ.
It is both beautiful and a grove, hence "Subhagavana."
Là Subhaga và cũng là vana, nên gọi là Subhagavana.
Tasmiṃ subhagavane.
In that Subhaga Grove.
Trong rừng Subhaga đó.
Vanañca nāma ropimaṃ, sayaṃjātanti duvidhaṃ.
And groves are of two kinds: planted and self-grown.
Rừng có hai loại: rừng trồng và rừng tự nhiên.
Tattha veḷuvanajetavanādīni ropimāni.
Among these, the Veḷuvana, Jetavana, and so on are planted groves.
Trong đó, Veḷuvana, Jetavana, v.v. là rừng trồng.
Andhavanamahāvanaañjanavanādīni sayaṃ jātāni.
The Andhavana, Mahāvana, Añjanavana, and so on are self-grown.
Andhavana, Mahāvana, Añjanavana, v.v. là rừng tự nhiên.
Idampi sayaṃjātanti veditabbaṃ.
This one, too, should be known as self-grown.
Rừng này cũng cần được biết là rừng tự nhiên.
Yo koci rukkhopi.
And any tree whatsoever.
Bất cứ cây nào.
Yathāha ‘‘atha kho taṃ, bhikkhave, māluvabījaṃ aññatarasmiṃ sālamūle nipateyyā’’ti (ma. ni. 1.469).
As was said: "Then, bhikkhus, that māluvā seed might fall at the base of some sāla tree."
Như đã nói: ‘‘Này các Tỳ-khưu, hạt cây māluva ấy sẽ rơi xuống gốc cây sāla nào đó.’’
Idha pana vanappatijeṭṭhakarukkho adhippeto.
Here, however, a tree that is the chief of forest trees is intended.
Ở đây, từ đó được ám chỉ là cây lớn nhất trong rừng.
Rājasaddo panassa tameva jeṭṭhakabhāvaṃ sādheti.
The word ‘rāja,’ however, establishes that very state of its being the chief.
Còn từ "rājā" (vua) chứng minh chính cái trạng thái là lớn nhất của nó.
Yathāha ‘‘suppatiṭṭhitassa kho brāhmaṇa dhammika nigrodharājassā’’ti (a. ni. 6.54).
As was said: "…of the well-established, righteous king of banyan trees, O brahmin."
Như đã nói: ‘‘Này Bà-la-môn, của cây nigrodha-rājā (vua bàng) hợp pháp, đã được an lập vững chắc.’’
Tattha dvedhā samāso, sālānaṃ rājātipi sālarājā, sālo ca so jeṭṭhakaṭṭhena rājā ca itipi sālarājā.
There, the compound is twofold: sālarājā as "king of sāla trees," and also sālarājā as "it is a sāla tree and it is a king in the sense of being the chief."
Ở đó có hai cách hợp từ: là vua của các cây sāla nên cũng gọi là sālarājā; và cây sāla ấy, vì là lớn nhất nên cũng là vua, nên cũng gọi là sālarājā.
Mūlanti samīpaṃ.
Mūlaṁ means vicinity.
Mūla (gốc) nghĩa là gần.
Ayañhi mūlasaddo, ‘‘mūlāni uddhareyya, antamaso usiranāḷimattānipī’’tiādīsu (a. ni. 4.195) mūlamūle dissati.
Indeed, this word 'mūla' is seen in the sense of the main root in passages such as, "one should pull out the roots, even if they are only the size of a stalk of usīra grass."
Thật vậy, từ mūla này được thấy trong nghĩa gốc rễ ở các chỗ như: ‘‘Nên nhổ rễ, dù chỉ là những cọng cỏ usīra nhỏ nhất.’’
‘‘Lobho akusalamūla’’ntiādīsu (dī. ni. 3.305) asādhāraṇahetumhi.
In passages such as "Greed is an unwholesome root," it is seen in the sense of a non-common cause.
Trong các chỗ như: ‘‘Tham ái là gốc rễ của bất thiện,’’ thì nó có nghĩa là nguyên nhân đặc biệt.
‘‘Yāva majjhanhike kāle chāyā pharati, nivāte paṇṇāni patanti, ettāvatā rukkhamūla’’ntiādīsu samīpe.
In passages such as "The base of a tree is as far as the shadow spreads at noon, and where the leaves fall when there is no wind," it is seen in the sense of vicinity.
Trong các chỗ như: ‘‘Bóng cây che phủ đến giữa trưa, lá rụng khi không có gió, đó là gốc cây,’’ thì nó có nghĩa là gần.
Idha pana samīpe adhippeto, tasmā sālarājassa samīpeti evamettha attho daṭṭhabbo.
Here, however, 'vicinity' is intended; therefore, the meaning should be understood here as "in the vicinity of the king sāla tree."
Ở đây, từ đó được ám chỉ là gần, do đó, ý nghĩa ở đây nên được hiểu là gần cây sālarājā.
Nanu avocumha ‘‘samīpatthe cetaṃ bhummavacana’’nti.
Have we not already said, "This locative case has the meaning of vicinity"?
Chẳng phải chúng ta đã nói rằng ‘‘đó là cách dùng ngữ pháp chỉ sự gần’’ sao?
Tasmā yathā gaṅgāyamunādīnaṃ samīpe goyūthāni carantāni ‘‘gaṅgāya caranti, yamunāya carantī’’ti vuccanti, evamidhāpi yadidaṃ ukkaṭṭhāya samīpe subhagavanaṃ sālarājamūlaṃ, tattha viharanto vuccati ‘‘ukkaṭṭhāyaṃ viharati subhagavane sālarājamūle’’ti.
Therefore, just as herds of cattle grazing in the vicinity of the Ganges, Yamunā, and so on are said to be "grazing on the Ganges, grazing on the Yamunā," so too here, while dwelling at the base of the king sāla tree in the Subhaga forest, which is in the vicinity of Ukkaṭṭhā, he is said to be "dwelling in Ukkaṭṭhā, at the base of the king sāla tree in the Subhaga forest."
Do đó, giống như những đàn bò đang ăn cỏ gần sông Gangā, Yamunā, v.v., được gọi là ‘‘đang ăn cỏ trên sông Gangā, đang ăn cỏ trên sông Yamunā,’’ thì ở đây cũng vậy, khi Thế Tôn an trú tại rừng Subhaga, gốc cây sālarājā, gần Ukkaṭṭhā, Ngài được nói là ‘‘an trú tại Ukkaṭṭhā, trong rừng Subhaga, tại gốc cây sālarājā.’’
Gocaragāmanidassanatthañhissa ukkaṭṭhāvacanaṃ, pabbajitānurūpanivāsaṭṭhānanidassanatthaṃ sesavacanaṃ.
The mention of Ukkaṭṭhā is for the purpose of indicating the alms-round village, and the remaining words are for indicating a dwelling place suitable for the renunciate life.
Việc đề cập đến Ukkaṭṭhā là để chỉ nơi Ngài đi khất thực, còn các lời khác là để chỉ nơi an trú phù hợp với bậc xuất gia.
Tattha ukkaṭṭhākittanena āyasmā ānando bhagavato gahaṭṭhānuggahakaraṇaṃ dasseti, subhagavanādikittanena pabbajitānuggahakaraṇaṃ.
By mentioning Ukkaṭṭhā, the venerable Ānanda shows the Blessed One’s act of supporting the householders; by mentioning the Subhaga forest and so on, he shows the act of supporting the renunciates.
Ở đó, việc đề cập đến Ukkaṭṭhā cho thấy Tôn giả Ānanda đã giúp đỡ các gia chủ của Thế Tôn, còn việc đề cập đến rừng Subhaga, v.v., cho thấy sự giúp đỡ các bậc xuất gia.
Tathā purimena paccayaggahaṇato attakilamathānuyogavivajjanaṃ, pacchimena vatthukāmappahānato kāmasukhallikānuyogavivajjanupāyadassanaṃ.
Similarly, by the former, he shows the avoidance of the practice of self-mortification, through the acceptance of requisites; by the latter, he shows the way to avoid the practice of indulgence in sensual pleasures, through the abandoning of objects of sensual pleasure.
Tương tự, với lời đầu, do nhận được các yếu tố cần thiết, Ngài tránh xa sự khổ hạnh tự hành; với lời sau, do từ bỏ các dục vật, Ngài chỉ ra phương tiện để tránh xa sự đam mê dục lạc.
Purimena ca dhammadesanābhiyogaṃ, pacchimena vivekādhimuttiṃ.
And by the former, the application to teaching the Dhamma; by the latter, the inclination towards seclusion.
Với lời đầu, Ngài siêng năng thuyết pháp; với lời sau, Ngài hướng đến sự độc cư.
Purimena karuṇāya upagamanaṃ, pacchimena paññāya apagamanaṃ.
By the former, approaching through compassion; by the latter, departing through wisdom.
Với lời đầu, Ngài tiếp cận bằng lòng bi; với lời sau, Ngài rời đi bằng trí tuệ.
Purimena sattānaṃ hitasukhanipphādanādhimuttataṃ, pacchimena parahitasukhakaraṇe nirupalepanaṃ.
By the former, the resolve to accomplish the welfare and happiness of beings; by the latter, being unstained in the act of bringing about the welfare and happiness of others.
Với lời đầu, Ngài quyết tâm mang lại lợi ích và hạnh phúc cho chúng sinh; với lời sau, Ngài không bị nhiễm ô khi làm lợi ích và hạnh phúc cho người khác.
Purimena dhammikasukhāpariccāganimittaṃ phāsuvihāraṃ, pacchimena uttarimanussadhammānuyoganimittaṃ.
By the former, a comfortable abiding as a sign of not abandoning righteous happiness; by the latter, as a sign of practicing the higher human states.
Với lời đầu, Ngài an trú thoải mái để không từ bỏ hạnh phúc hợp pháp; với lời sau, Ngài an trú để siêng năng thực hành các pháp siêu nhân.
Purimena manussānaṃ upakārabahulataṃ, pacchimena devānaṃ.
By the former, the great benefit to humans; by the latter, to devas.
Với lời đầu, Ngài mang lại nhiều lợi ích cho loài người; với lời sau, Ngài mang lại nhiều lợi ích cho chư thiên.
Purimena loke jātassa loke saṃvaḍḍhabhāvaṃ, pacchimena lokena anupalittataṃ.
By the former, being born in the world and having grown up in the world; by the latter, being unsullied by the world.
Với lời đầu, Ngài sinh ra trong thế gian và lớn lên trong thế gian; với lời sau, Ngài không bị thế gian làm ô nhiễm.
Purimena ‘‘ekapuggalo, bhikkhave, loke uppajjamāno uppajjati bahujanahitāya bahujanasukhāya lokānukampāya atthāya hitāya sukhāya devamanussānaṃ.
By the former, the accomplishment of the purpose for which the Blessed One arose, in accordance with the saying: “One person, bhikkhus, arising in the world, arises for the welfare of the multitude, for the happiness of the multitude, out of compassion for the world, for the good, welfare, and happiness of devas and humans.
Với lời đầu, Ngài hoàn thành mục đích mà Thế Tôn đã xuất hiện, theo lời dạy: ‘‘Này các Tỳ-khưu, một cá nhân xuất hiện trong thế gian, xuất hiện vì lợi ích của nhiều người, vì hạnh phúc của nhiều người, vì lòng từ bi đối với thế gian, vì lợi ích, vì hạnh phúc của chư thiên và loài người.
Katamo ekapuggalo, tathāgato arahaṃ sammāsambuddho’’ti (a. ni. 1.170) vacanato yadatthaṃ bhagavā uppanno, tadatthaparinipphādanaṃ, pacchimena yattha uppanno, tadanurūpavihāraṃ.
Who is that one person? The Tathāgata, the Arahant, the Perfectly Enlightened One”; by the latter, abiding in a way appropriate to where he arose.
Cá nhân nào là một? Đó là Như Lai, bậc A-la-hán, Chánh Đẳng Giác;’’ với lời sau, Ngài an trú phù hợp với nơi Ngài đã xuất hiện.
Bhagavā hi paṭhamaṃ lumbinivane, dutiyaṃ bodhimaṇḍeti lokiyalokuttarāya uppattiyā vaneyeva uppanno, tenassa vaneyeva vihāraṃ dassetīti evamādinā nayenettha atthayojanā veditabbā.
For the Blessed One arose in a forest, first in the Lumbinī grove, second at the seat of Awakening, through his mundane and supramundane arising; therefore, he shows his abiding in a forest. In this way and so on, the application of the meaning here should be understood.
Thật vậy, Thế Tôn lần đầu xuất hiện tại rừng Lumbinī, lần thứ hai tại Bồ Đề Đạo Tràng, tức là Ngài xuất hiện trong rừng với sự xuất hiện thế gian và siêu thế. Do đó, Ngài cho thấy sự an trú của Ngài cũng ở trong rừng. Theo cách này, ý nghĩa của lời dạy này nên được hiểu.
Tatrāti desakālaparidīpanaṃ.
Tatra is an indication of place and time.
Tattha (ở đó) là để chỉ thời gian và địa điểm.
Tañhi yaṃ samayaṃ viharati, tatra samaye.
For it indicates that at the time he was dwelling, it was "at that time."
Nó chỉ ra rằng vào thời điểm Ngài an trú, là vào thời điểm đó.
Yasmiñca sālarājamūle viharati, tatra sālarājamūleti dīpeti.
And at which base of the king sāla tree he was dwelling, it was "at that base of the king sāla tree."
Và tại gốc cây sālarājā mà Ngài an trú, là tại gốc cây sālarājā đó.
Bhāsitabbayutte vā desakāle dīpeti.
Or it indicates the appropriate place and time for what was to be spoken.
Hoặc nó chỉ ra thời gian và địa điểm thích hợp để thuyết pháp.
Na hi bhagavā ayutte dese kāle vā dhammaṃ bhāsati.
For the Blessed One does not speak the Dhamma at an inappropriate place or time.
Vì Thế Tôn không thuyết pháp ở một nơi hoặc thời điểm không thích hợp.
‘‘Akālo kho tāva bāhiyā’’ti (udā. 10) ādicettha sādhakaṃ.
And here, the proof is "It is not the right time, Bāhiya," and so on.
Lời dạy ‘‘Này Bāhiya, bây giờ chưa phải lúc’’ là bằng chứng cho điều này.
Khoti padapūraṇamatte avadhāraṇe ādikālatthe vā nipāto.
Kho is a particle used merely to fill out the meter, or in the sense of emphasis, or in the sense of an initial time.
Kho là một từ không biến cách dùng để lấp đầy câu, để nhấn mạnh, hoặc để chỉ thời điểm ban đầu.
Bhagavāti lokagarudīpanaṃ.
Bhagavā indicates one who is a teacher revered by the world.
Bhagavā (Thế Tôn) là để chỉ bậc thầy được thế gian tôn kính.
Bhikkhūti kathāsavanayuttapuggalavacanaṃ.
Bhikkhū is a term for persons suitable for hearing the discourse.
Bhikkhū (các Tỳ-khưu) là từ chỉ những người thích hợp để nghe pháp.
Apicettha, ‘‘bhikkhakoti bhikkhu, bhikkhācariyaṃ ajjhupagatoti bhikkhū’’tiādinā (pārā. 45) nayena vacanattho veditabbo.
Furthermore, here the meaning of the word should be understood according to the method of, "He is a bhikkhu because he begs; he is a bhikkhu because he has undertaken the practice of alms-gathering," and so on.
Hơn nữa, ở đây, ý nghĩa của từ nên được hiểu theo cách như: ‘‘Bhikkhu là người khất thực, là người đã đi khất thực.’’
Āmantesīti ālapi abhāsi sambodhesīti ayamettha attho.
Āmantesi means here that he addressed, he spoke, he made them understand.
Āmantesī có nghĩa là nói chuyện, phát biểu, đánh thức sự hiểu biết.
Aññatra pana ñāpanepi hoti.
Elsewhere, however, it is also used in the sense of informing.
Ở những chỗ khác, nó cũng có nghĩa là làm cho biết.
Yathāha ‘‘āmantayāmi vo, bhikkhave, paṭivedayāmi vo, bhikkhave’’ti.
As was said: "I inform you, bhikkhus; I declare to you, bhikkhus."
Như đã nói: ‘‘Này các Tỳ-khưu, Ta nhắc nhở các ông, Ta báo cho các ông biết.’’
Pakkosanepi.
Also in the sense of summoning.
Cũng có nghĩa là gọi.
Yathāha ‘‘ehi tvaṃ bhikkhu mama vacanena sāriputtaṃ āmantehī’’ti (a. ni. 9.11).
As was said: "Come, bhikkhu, address Sāriputta with my words."
Như đã nói: ‘‘Này Tỳ-khưu, hãy đến và theo lời Ta, hãy gọi Sāriputta.’’
Bhikkhavoti āmantanākāradīpanaṃ.
Bhikkhavo indicates the manner of addressing.
Bhikkhavo là để chỉ cách thức gọi.
Tañca bhikkhanasīlatādiguṇayogasiddhattā vuttaṃ.
And this is said because it is accomplished through connection with the qualities of being habitually mendicant and so on.
Và điều đó được nói ra vì sự thành tựu của các đức tính như thói quen khất thực.
Bhikkhanasīlatāguṇayuttopi hi bhikkhu bhikkhanadhammatāguṇayuttopi.
For one who is endowed with the quality of being habitually mendicant is also a bhikkhu; one who is endowed with the quality of the nature of mendicancy also.
Thật vậy, bhikkhu là người có đức tính quen khất thực, cũng là người có đức tính khất thực.
Bhikkhane sādhukāritāguṇayuttopīti saddavidū maññanti.
Also one endowed with the quality of performing well in mendicancy, so the grammarians think.
Các nhà ngữ pháp cho rằng đó là người có đức tính khéo léo trong việc khất thực.
Tena ca nesaṃ bhikkhanasīlatādiguṇayogasiddhena vacanena hīnādhikajanasevitaṃ vuttiṃ pakāsento uddhatadīnabhāvaniggahaṃ karoti.
And by that term, which is established through their connection with the qualities of being habitually mendicant and so on, by revealing a livelihood followed by inferior and superior people, he suppresses the state of being arrogant and dejected.
Và bằng lời nói được thành tựu bởi các đức tính như thói quen khất thực, Ngài công bố cách sống được những người thấp kém và cao thượng thực hành, qua đó chế ngự trạng thái ngạo mạn và ti tiện.
Bhikkhavoti iminā ca karuṇāvipphārasommahadayanayananipātapubbaṅgamena vacanena te attano mukhābhimukhe karoti.
And with this word "Bhikkhavo," which is preceded by a gaze of the eyes from a serene heart suffused with compassion, he makes them turn their faces toward him.
Và bằng lời nói ‘‘Bhikkhavo’’ này, đi trước bởi ánh mắt dịu dàng và trái tim tràn đầy từ bi, Ngài khiến họ hướng về phía mình.
Teneva ca kathetukamyatādīpakena vacanena nesaṃ sotukamyataṃ janeti.
And with that very word, which indicates the desire to speak, he generates in them the desire to listen.
Và bằng lời nói chỉ sự mong muốn thuyết giảng, Ngài khơi dậy lòng mong muốn lắng nghe của họ.
Teneva ca sambodhanaṭṭhena sādhukaṃ savanamanasikārepi ne niyojeti.
And with that same word, which has the meaning of addressing, he also enjoins them to careful listening and attention.
Và bằng ý nghĩa của sự kêu gọi, Ngài cũng khuyến khích họ chú tâm lắng nghe một cách cẩn thận.
Sādhukasavanamanasikārāyattā hi sāsanasampatti.
For the attainment of the Dispensation is dependent on careful listening and attention.
Vì sự thành tựu của giáo pháp phụ thuộc vào sự lắng nghe và chú tâm cẩn thận.
Aparesupi devamanussesu vijjamānesu kasmā bhikkhūyeva āmantesīti ce.
If it is asked: "When other devas and humans were present, why did he address only the bhikkhus?"
Nếu hỏi: Tại sao Thế Tôn lại gọi các Tỳ-khưu trước khi thuyết pháp, mà không thuyết pháp ngay lập tức, trong khi có các chư thiên và loài người khác?
Jeṭṭhaseṭṭhāsannasadāsannihitabhāvato.
Because they are the eldest, the best, and always near and present.
Vì họ là những người cao quý nhất, ưu việt nhất, gần gũi nhất và luôn hiện diện.
Sabbaparisasādhāraṇā hi bhagavato dhammadesanā.
For the Blessed One's teaching of the Dhamma is common to all assemblies.
Thật vậy, giáo pháp của Thế Tôn là chung cho tất cả các hội chúng.
Parisāya ca jeṭṭhā bhikkhū, paṭhamuppannattā.
And in the assembly, the bhikkhus are the eldest, because they arose first.
Và trong hội chúng, các Tỳ-khưu là những người cao quý nhất, vì họ là những người xuất hiện đầu tiên.
Seṭṭhā, anagāriyabhāvaṃ ādiṃ katvā satthucariyānuvidhāyakattā sakalasāsanapaṭiggāhakattā ca.
They are the best, because, beginning with the state of homelessness, they follow the teacher’s conduct and are the recipients of the entire Dispensation.
Họ là những người ưu việt nhất, bắt đầu từ việc sống đời không gia đình, noi theo hạnh của Bậc Đạo Sư và là những người tiếp nhận toàn bộ giáo pháp.
Āsannā, tattha nisinnesu satthusantikattā.
They are near, because among those seated there, they are in the Teacher's presence.
Họ là những người gần gũi nhất, vì họ ngồi gần Bậc Đạo Sư.
Sadāsannihitā, satthusantikāvacarattāti.
They are always present, because they frequent the Teacher's presence.
Họ luôn hiện diện, vì họ là những người thường xuyên ở gần Bậc Đạo Sư.
Apica te dhammadesanāya bhājanaṃ, yathānusiṭṭhaṃ paṭipattisabbhāvato.
Moreover, they are vessels for the teaching of the Dhamma, because of the existence of the practice as instructed.
Hơn nữa, họ là những người xứng đáng với giáo pháp, vì họ thực hành đúng theo những gì được chỉ dạy.
Visesato ca ekacce bhikkhūyeva sandhāya ayaṃ desanātipi te eva āmantesi.
And specifically, this teaching was also intended for certain bhikkhus alone, so he addressed them only.
Đặc biệt, Ngài cũng gọi các Tỳ-khưu vì giáo pháp này được thuyết giảng dành riêng cho một số Tỳ-khưu.
Tattha siyā – kimatthaṃ pana bhagavā dhammaṃ desento paṭhamaṃ bhikkhū āmantesi, na dhammameva desetīti.
There, it might be asked: "For what reason does the Blessed One, when teaching the Dhamma, first address the bhikkhus and not just teach the Dhamma?"
Ở đây, có thể có câu hỏi: Tại sao Thế Tôn khi thuyết pháp lại gọi các Tỳ-khưu trước, mà không thuyết pháp ngay lập tức?
Satijananatthaṃ.
For the purpose of arousing mindfulness.
Để khơi dậy chánh niệm.
Bhikkhū hi aññaṃ cintentāpi vikkhittacittāpi dhammaṃ paccavekkhantāpi kammaṭṭhānaṃ manasikarontāpi nisinnā honti, te anāmantetvā dhamme desiyamāne – ‘‘ayaṃ desanā kinnidānā kiṃpaccayā katamāya aṭṭhuppattiyā desitā’’ti sallakkhetuṃ asakkontā duggahitaṃ vā gaṇheyyuṃ, na vā gaṇheyyuṃ.
For bhikkhus may be sitting while thinking of something else, with distracted minds, reflecting on the Dhamma, or attending to a meditation subject. If the Dhamma were taught without addressing them, being unable to determine, "What is the reason for this teaching, what is its cause, due to what occasion was it taught?" they might either grasp it wrongly or not grasp it at all.
Thật vậy, các Tỳ-khưu ngồi đó có thể đang suy nghĩ về điều khác, hoặc tâm bị phân tán, hoặc đang quán xét pháp, hoặc đang chú tâm vào đề mục thiền định. Nếu thuyết pháp mà không gọi họ trước, họ có thể không thể nhận ra ‘‘giáo pháp này có nguyên nhân gì, có duyên gì, được thuyết giảng trong hoàn cảnh nào,’’ và có thể hiểu sai hoặc không hiểu gì cả.
Tena nesaṃ satijananatthaṃ bhagavā paṭhamaṃ āmantetvā pacchā dhammaṃ deseti.
Therefore, for the purpose of arousing mindfulness in them, the Blessed One first addresses them and then teaches the Dhamma.
Vì vậy, để khơi dậy chánh niệm cho họ, Thế Tôn gọi họ trước, sau đó mới thuyết pháp.
Bhadanteti gāravavacanametaṃ, satthuno paṭivacanadānaṃ vā, apicettha bhikkhavoti vadamāno bhagavā te bhikkhū ālapati.
Bhadante: This is a term of respect, or it is the giving of a reply to the Teacher; moreover, here, the Blessed One, saying "Bhikkhus," addresses those bhikkhus.
Bhadante là lời kính trọng, hoặc là lời đáp lại của các đệ tử đối với Đức Bổn Sư. Hơn nữa, ở đây, khi nói "Bhikkhavo", Đức Thế Tôn gọi các Tỳ-kheo đó.
Bhadanteti vadamānā te bhagavantaṃ paccālapanti.
Saying "Bhadante," they respond to the Blessed One.
Các Tỳ-kheo đó nói "Bhadante" để đáp lại Đức Thế Tôn.
Tathā bhikkhavoti bhagavā ābhāsati.
Thus, "Bhikkhus" is how the Blessed One speaks.
Đức Thế Tôn nói "Bhikkhavo".
Bhadanteti te paccābhāsanti.
"Bhadante" is how they speak back.
Họ đáp lại "Bhadante".
Bhikkhavoti paṭivacanaṃ dāpeti, bhadanteti paṭivacanaṃ denti.
With "Bhikkhus," he prompts a response; with "Bhadante," they give a response.
Ngài khiến họ đáp lại bằng "Bhikkhavo", họ đáp lại bằng "Bhadante".
Te bhikkhūti ye bhagavā āmantesi.
Those bhikkhus means those whom the Blessed One addressed.
Te bhikkhū (các Tỳ-kheo đó) là những Tỳ-kheo mà Đức Thế Tôn đã gọi.
Bhagavato paccassosunti bhagavato āmantanaṃ paṭiassosuṃ, abhimukhā hutvā suṇiṃsu sampaṭicchiṃsu paṭiggahesunti attho.
They responded to the Blessed One means they replied to the Blessed One’s address; the meaning is that they, having turned their attention, listened, assented, and accepted.
Bhagavato paccassosuṃ có nghĩa là họ đã lắng nghe lời gọi của Đức Thế Tôn, đã lắng nghe với thái độ hướng về Ngài, đã chấp nhận và tiếp nhận.
Bhagavā etadavocāti bhagavā etaṃ idāni vattabbaṃ sakalaṃ suttaṃ avoca.
The Blessed One said this means the Blessed One spoke this entire sutta that is now to be spoken.
Bhagavā etadavocā có nghĩa là Đức Thế Tôn đã nói toàn bộ bài kinh sắp được trình bày này.
Ettāvatā ca yaṃ āyasmatā ānandena kamalakuvalayujjalavimalasādurasasalilāya pokkharaṇiyā sukhāvataraṇatthaṃ nimmalasilātalaracanavilāsasobhitaratanasopānaṃ vippakiṇṇamuttātalasadisavālikākiṇṇapaṇḍarabhūmibhāgaṃ titthaṃ viya suvibhattabhittivicitravedikāparikkhittassa nakkhattapathaṃ phusitukāmatāya viya, vijambhitasamussayassa pāsādavarassa sukhārohaṇatthaṃ dantamaya-saṇhamuduphalaka-kañcanalatāvinaddha- maṇigaṇappabhāsamudayujjalasobhaṃ sopānaṃ viya, suvaṇṇavalayānūpurādisaṅghaṭṭanasaddasammissitakathitahasitamadhurassaragehajanavicaritassa uḷāraissariyavibhavasobhitassa mahāgharassa sukhappavesanatthaṃ suvaṇṇarajatamaṇimuttāpavāḷādijutivissaravijjotita-suppatiṭṭhitavisāladvārabāhaṃ mahādvāraṃ viya ca atthabyañjanasampannassa buddhānaṃ desanāñāṇagambhīrabhāvasaṃsūcakassa imassa suttassa sukhāvagāhaṇatthaṃ kāladesadesakavatthuparisāpadesapaṭimaṇḍitaṃ nidānaṃ bhāsitaṃ, tassa atthavaṇṇanā samattā.
Thus far, the commentary on the meaning of the introduction has been completed—the introduction which was spoken by the Venerable Ānanda, embellished with references to time, place, speaker, topic, and assembly, for the easy comprehension of this sutta, which is endowed with meaning and phrasing and indicative of the profound nature of the Buddhas’ knowledge of teaching. This introduction is like a landing place with a white ground covered in sand that resembles a surface of scattered pearls, and with bejeweled steps resplendent with the grace of being fashioned from slabs of immaculate stone, constructed for easy descent into a pond whose clear, sweet, and delicious water is radiant with red, blue, and white lotuses. And it is like a staircase of brilliant splendor, owing to the effulgence arising from a multitude of gems, interwoven with golden vines on planks of smooth and soft ivory, constructed for the easy ascent of a great palace of magnificent height that seems to want to touch the path of the stars. And it is like a great gate with large, well-established doorposts, illuminated by the radiance emanating from gold, silver, gems, pearls, coral, and so on, constructed for easy entry into a great house resplendent with the glory of great wealth and power, frequented by household members whose sweet-sounding voices, talk, and laughter mingle with the sounds of the clashing of gold bracelets, anklets, and the like.
Cho đến đây, phần giải thích ý nghĩa của phần dẫn nhập đã hoàn tất. Phần dẫn nhập này được Tôn giả Ānanda trình bày, được trang hoàng bằng thời gian, địa điểm, người thuyết giảng, đối tượng và hội chúng, nhằm giúp dễ dàng thấu hiểu bài kinh này—một bài kinh phong phú về ý nghĩa và văn tự, biểu thị sự sâu sắc trong trí tuệ thuyết pháp của chư Phật—giống như một bến nước có cầu thang đá quý được sắp đặt tinh xảo, nền đất trắng trải đầy cát mịn như những hạt ngọc trai rải rác, giúp dễ dàng xuống hồ sen có nước trong sạch, ngọt ngào, lấp lánh với những bông sen đỏ, sen xanh, sen trắng; giống như một chiếc cầu thang làm bằng ngà voi, ván gỗ mềm mại, được trang trí bằng dây vàng và lấp lánh ánh sáng từ vô số ngọc quý, giúp dễ dàng lên một tòa lâu đài vĩ đại với vẻ đẹp lộng lẫy như muốn chạm tới quỹ đạo của các vì sao; và giống như một cánh cổng lớn có trụ cổng vững chắc, rộng lớn, rực rỡ ánh vàng, bạc, ngọc, châu báu, san hô, v.v., giúp dễ dàng vào một ngôi nhà lớn lộng lẫy với sự giàu sang vĩ đại, nơi những người trong nhà đi lại với tiếng nói, tiếng cười ngọt ngào hòa lẫn tiếng vòng vàng, vòng chân va chạm vào nhau.
Idāni ‘‘sabbadhammamūlapariyāyaṃ vo’’tiādinā nayena bhagavatā nikkhittassa suttassa vaṇṇanāya okāso anuppatto.
Now, the occasion has arrived for the commentary on the sutta expounded by the Blessed One in the manner beginning with, "I will teach you the discourse on the root of all dhammas."
Bây giờ, đã đến lúc giải thích bài kinh mà Đức Thế Tôn đã trình bày theo cách thức như ‘‘Ta sẽ thuyết giảng cho các Tỳ-kheo về căn bản của mọi pháp’’ và những điều tương tự.
Sā panesā suttavaṇṇanā yasmā suttanikkhepaṃ vicāretvā vuccamānā pākaṭā hoti, tasmā suttanikkhepaṃ tāva vicārayissāma.
And since that commentary on the sutta becomes clear when it is spoken after having examined the exposition of the sutta, we shall, therefore, first examine the exposition of the sutta.
Tuy nhiên, sự giải thích bài kinh này sẽ trở nên rõ ràng khi xem xét cách trình bày bài kinh, vì vậy chúng ta sẽ xem xét cách trình bày bài kinh trước.
Cattāro hi suttanikkhepā attajjhāsayo parajjhāsayo pucchāvasiko aṭṭhuppattikoti.
There are, indeed, four expositions of suttas: that based on one's own inclination, that based on another's inclination, that based on a question, and that based on a particular reason.
Thật vậy, có bốn cách trình bày bài kinh: do ý muốn của chính mình, do ý muốn của người khác, do câu hỏi, và do sự kiện phát sinh.
Tattha yāni suttāni bhagavā parehi anajjhiṭṭho kevalaṃ attano ajjhāsayeneva kathesi.
Among these, there are the suttas which the Blessed One taught, unprompted by others, solely out of his own inclination.
Trong đó, những bài kinh mà Đức Thế Tôn thuyết giảng hoàn toàn do ý muốn của chính Ngài mà không có ai thỉnh cầu.
Seyyathidaṃ, ākaṅkheyyasuttaṃ, vatthasuttaṃ, mahāsatipaṭṭhānasuttaṃ, mahāsaḷāyatanavibhaṅgasuttaṃ, ariyavaṃsasuttaṃ, sammappadhānasuttantahārako, iddhipādaindriyabalabojjhaṅgamaggaṅgasuttantahārakoti evamādīni.
These are such as the Ākaṅkheyya Sutta, Vattha Sutta, Mahāsatipaṭṭhāna Sutta, Mahāsaḷāyatanavibhaṅga Sutta, Ariyavaṃsa Sutta, the collection of suttas on the right strivings, and the collection of suttas on the bases of spiritual power, faculties, powers, enlightenment factors, and path factors, and so on.
Chẳng hạn như kinh Ākaṅkheyya, kinh Vatthasutta, kinh Mahāsatipaṭṭhāna, kinh Mahāsaḷāyatanavibhaṅga, kinh Ariyavaṃsa, những bài kinh về Chánh tinh tấn (Sammappadhāna), những bài kinh về Tứ như ý túc, Ngũ căn, Ngũ lực, Thất giác chi, Bát chánh đạo, v.v.
Tesaṃ attajjhāsayo nikkhepo.
Of these, the exposition is based on his own inclination.
Cách trình bày của những bài kinh đó là do ý muốn của chính mình.
Yāni pana ‘‘paripakkā kho rāhulassa vimuttiparipācanīyā dhammā, yaṃnūnāhaṃ rāhulaṃ uttari āsavānaṃ khaye vineyya’’nti (saṃ. ni. 4.121) evaṃ paresaṃ ajjhāsayaṃ khantiṃ manaṃ abhinīhāraṃ bujjhanabhāvañca avekkhitvā parajjhāsayavasena kathitāni.
But there are those which were taught based on another's inclination, after observing others' inclination, disposition, resolve, and capacity for understanding, as when it was said, "Rāhula's dhammas that ripen for release are now mature. Let me now further instruct Rāhula in the destruction of the taints."
Còn những bài kinh được thuyết giảng do ý muốn của người khác, sau khi Đức Thế Tôn xem xét ý muốn, sự chấp nhận, sự mong muốn và khả năng thấu hiểu của họ, như: ‘‘Này Rāhula, các pháp làm cho sự giải thoát trở nên chín muồi đã chín muồi rồi. Vậy Ta hãy huấn luyện Rāhula thêm nữa về sự đoạn trừ các lậu hoặc.’’
Seyyathidaṃ, cūḷarāhulovādasuttaṃ, mahārāhulovādasuttaṃ, dhammacakkappavattanaṃ, dhātuvibhaṅgasuttanti evamādīni.
These are such as the Cūḷarāhulovāda Sutta, Mahārāhulovāda Sutta, Dhammacakkappavattana Sutta, Dhātuvibhaṅga Sutta, and so on.
Chẳng hạn như kinh Cūḷarāhulovāda, kinh Mahārāhulovāda, kinh Chuyển Pháp Luân (Dhammacakkappavattana), kinh Dhātuvibhaṅga, v.v.
Tesaṃ parajjhāsayo nikkhepo.
Of these, the exposition is based on another's inclination.
Cách trình bày của những bài kinh đó là do ý muốn của người khác.
Bhagavantaṃ pana upasaṅkamitvā catasso parisā cattāro vaṇṇā nāgā supaṇṇā gandhabbā asurā yakkhā mahārājāno tāvatiṃsādayo devā mahābrahmāti evamādayo ‘‘bojjhaṅgā bojjhaṅgā’’ti, bhante, vuccanti.
Then there are those who approached the Blessed One—the four assemblies, the four castes, nāgas, supaṇṇas, gandhabbas, asuras, yakkhas, the Great Kings, devas such as those of Tāvatiṃsa, and Mahābrahmās, and so on—
Còn những bài kinh được thuyết giảng khi các hội chúng bốn chúng, bốn giai cấp, các Nāga, Supaṇṇa, Gandhabba, Asura, Yakkha, các Đại Thiên vương, các chư Thiên cõi Tāvatiṃsa, Đại Phạm Thiên, v.v., đến gần Đức Thế Tôn và hỏi: ‘‘Bạch Thế Tôn, người ta gọi là ‘Bojjhaṅga, Bojjhaṅga’ (các chi phần giác ngộ, các chi phần giác ngộ).’’
‘‘Nīvaraṇā nīvaraṇā’’ti, bhante, vuccanti.
and ask questions, saying, "Venerable sir, they are called 'enlightenment factors, enlightenment factors.'" "Venerable sir, they are called 'hindrances, hindrances.'"
‘‘Bạch Thế Tôn, người ta gọi là ‘Nīvaraṇa, Nīvaraṇa’ (các triền cái, các triền cái).’’
Ime nu kho, bhante, pañcupādānakkhandhā.
"Venerable sir, are these the five aggregates of clinging?"
‘‘Bạch Thế Tôn, đây có phải là năm Upa-dāna-kkhandha (năm thủ uẩn) không?’’
‘‘Kiṃ sūdha vittaṃ purisassa seṭṭha’’ntiādinā (su. ni. 183) nayena pañhaṃ pucchanti.
Or in the manner of, "What is the best wealth for a person here?"
Họ hỏi các câu hỏi theo cách thức như ‘‘Tài sản nào là tối thượng của con người ở đây?’’ và những điều tương tự.
Evaṃ puṭṭhena bhagavatā yāni kathitāni bojjhaṅgasaṃyuttādīni.
Those suttas, such as the Bojjhaṅga Saṃyutta, that were taught by the Blessed One when asked in this way,
Những bài kinh như Bojjhaṅgasaṃyutta, v.v., được Đức Thế Tôn thuyết giảng khi được hỏi như vậy.
Yāni vā panaññānipi devatāsaṃyutta-mārasaṃyutta-brahmasaṃyutta-sakkapañha-cūḷavedalla-mahāvedalla-sāmaññaphala- āḷavaka-sūciloma-kharalomasuttādīni, tesaṃ pucchāvasiko nikkhepo.
or others such as the Devatā Saṃyutta, Māra Saṃyutta, Brahma Saṃyutta, Sakkapañha Sutta, Cūḷavedalla Sutta, Mahāvedalla Sutta, Sāmaññaphala Sutta, Āḷavaka Sutta, Sūciloma Sutta, and Kharaloma Sutta—of these, the exposition is based on a question.
Hoặc những bài kinh khác như Devatāsaṃyutta, Mārasaṃyutta, Brahmasaṃyutta, Sakkapañha, Cūḷavedalla, Mahāvedalla, Sāmaññaphala, Āḷavaka, Sūciloma, Kharaloma, v.v., thì cách trình bày của chúng là do câu hỏi.
Evamimesu catūsu nikkhepesu imassa suttassa aṭṭhuppattiko nikkhepo.
Among these four expositions, the exposition of this sutta is based on a particular reason.
Trong số bốn cách trình bày này, bài kinh này được trình bày theo cách thức do sự kiện phát sinh.
Aṭṭhuppattiyañhi idaṃ bhagavatā nikkhittaṃ.
For this was expounded by the Blessed One based on a particular reason.
Thật vậy, Đức Thế Tôn đã trình bày bài kinh này do một sự kiện phát sinh.
Katarāya aṭṭhuppattiyā?
Due to what particular reason?
Do sự kiện phát sinh nào?
Pariyattiṃ nissāya uppanne māne.
Due to conceit that arose dependent on the scriptural learning.
Do sự kiêu mạn phát sinh dựa trên Pariyatti (sự học hỏi giáo pháp).
Pañcasatā kira brāhmaṇā tiṇṇaṃ vedānaṃ pāragū aparabhāge bhagavato dhammadesanaṃ sutvā kāmesu ādīnavaṃ nekkhamme ca ānisaṃsaṃ sampassamānā bhagavato santike pabbajitvā nacirasseva sabbaṃ buddhavacanaṃ uggaṇhitvā pariyattiṃ nissāya mānaṃ uppādesuṃ ‘‘yaṃ yaṃ bhagavā katheti, taṃ taṃ mayaṃ khippameva jānāma, bhagavā hi tīṇi liṅgāni cattāri padāni satta vibhattiyo muñcitvā na kiñci katheti, evaṃ kathite ca amhākaṃ gaṇṭhipadaṃ nāma natthī’’ti.
It is said that five hundred brahmins, masters of the three Vedas, later heard the Blessed One’s teaching of the Dhamma. Seeing the danger in sensual pleasures and the benefit in renunciation, they went forth in the presence of the Blessed One. Before long, having mastered the entire word of the Buddha, they developed conceit based on their scriptural learning, thinking, "Whatever the Blessed One says, we understand it quickly. The Blessed One says nothing beyond the three genders, four types of words, and seven cases, and when he speaks thus, there is no difficult term for us."
Nghe nói, có năm trăm vị Bà-la-môn thông thạo ba bộ Veda, sau này, khi nghe Đức Thế Tôn thuyết giảng Giáo Pháp, thấy được sự nguy hiểm trong các dục và lợi ích trong sự xuất ly, họ đã xuất gia dưới sự hướng dẫn của Đức Thế Tôn. Chẳng bao lâu sau, họ đã học thuộc lòng toàn bộ lời Phật dạy và do dựa vào Pariyatti, họ đã phát sinh sự kiêu mạn, nói rằng: ‘‘Bất cứ điều gì Đức Thế Tôn thuyết giảng, chúng tôi đều nhanh chóng hiểu. Đức Thế Tôn không thuyết giảng điều gì mà không có ba giống, bốn loại từ, và bảy cách chia động từ. Khi được thuyết giảng như vậy, chúng tôi không có bất kỳ từ khó hiểu nào.’’
Te bhagavati agāravā hutvā tato paṭṭhāya bhagavato upaṭṭhānampi dhammassavanampi abhiṇhaṃ na gacchanti.
Becoming disrespectful toward the Blessed One, from then on they did not regularly go to attend upon the Blessed One or to listen to the Dhamma.
Vì không kính trọng Đức Thế Tôn, từ đó trở đi, họ không còn thường xuyên đến để hầu hạ Đức Thế Tôn hay nghe Pháp nữa.
Bhagavā tesaṃ taṃ cittacāraṃ ñatvā ‘‘abhabbā ime imaṃ mānakhilaṃ anupahacca maggaṃ vā phalaṃ vā sacchikātu’’nti tesaṃ sutapariyattiṃ nissāya uppannaṃ mānaṃ aṭṭhuppattiṃ katvā desanākusalo bhagavā mānabhañjanatthaṃ sabbadhammamūlapariyāyanti desanaṃ ārabhi.
The Blessed One, knowing the state of their minds, thought, "These men are incapable of realizing the path or the fruit without having destroyed this stake of conceit." Making the conceit that arose in them dependent on their learning from the scriptures the particular reason, the Blessed One, skilled in teaching, began the discourse "The Root of All Dhammas" in order to shatter their conceit.
Đức Thế Tôn biết được tâm niệm đó của họ và nghĩ: ‘‘Những người này không thể chứng đắc Đạo hay Quả nếu không nhổ bỏ được cái chướng ngại kiêu mạn này.’’ Vì vậy, Đức Thế Tôn, bậc thiện xảo trong thuyết giảng, đã lấy sự kiêu mạn phát sinh từ sự học hỏi giáo pháp của họ làm duyên khởi để bắt đầu thuyết giảng Sabbadhammamūlapariyāya (Căn bản của mọi pháp) nhằm phá tan sự kiêu mạn.
Tattha sabbadhammamūlapariyāyanti sabbesaṃ dhammānaṃ mūlapariyāyaṃ.
Therein, The Root of All Dhammas means the discourse on the root of all dhammas.
Trong đó, Sabbadhammamūlapariyāya có nghĩa là căn bản của tất cả các pháp.
Sabbesanti anavasesānaṃ.
Of all means of those without remainder.
Sabbesaṃ có nghĩa là không còn sót lại.
Anavasesavācako hi ayaṃ sabba-saddo.
Indeed, this word sabba denotes "without remainder."
Thật vậy, từ sabba này là từ chỉ sự không còn sót lại.
So yena yena sambandhaṃ gacchati, tassa tassa anavasesataṃ dīpeti.
With whatever it is connected, it indicates that thing's completeness.
Nó biểu thị sự không còn sót lại của bất cứ điều gì mà nó liên kết.
Yathā, ‘‘sabbaṃ rūpaṃ aniccaṃ sabbā vedanā aniccā sabbasakkāyapariyāpannesu dhammesū’’ti.
For example, "All form is impermanent," "All feeling is impermanent," and "in all dhammas included in the personal identity."
Ví dụ, ‘‘Tất cả sắc đều vô thường, tất cả thọ đều vô thường, trong tất cả các pháp thuộc về thân kiến (sakkāya),’’ v.v.
Dhamma-saddo panāyaṃ pariyatti-sacca-samādhi-paññā-pakati-sabhāvasuññatā-puññāpatti-ñeyyādīsu dissati.
Now, this word dhamma is found in the sense of scriptural learning, truth, concentration, wisdom, nature, intrinsic nature, emptiness, merit, offense, the knowable, and so on.
Còn từ dhamma này được thấy trong các nghĩa như Pariyatti (giáo pháp học), Sacca (chân lý), Samādhi (định), Paññā (tuệ), Pakati (bản chất), Sabhāva (tự tánh), Suññatā (tánh không), Puññāpatti (sự thành tựu phước đức), Ñeyya (đối tượng của trí tuệ), v.v.
‘‘Idha bhikkhu dhammaṃ pariyāpuṇāti suttaṃ geyya’’ntiādīsu (a. ni. 5.73) hi dhammasaddo pariyattiyaṃ vattati.
Indeed, in passages such as, "Here, a bhikkhu learns the Dhamma: suttas, geyyas..." the word dhamma is used in the sense of scriptural learning.
Thật vậy, từ Dhamma trong các câu như ‘‘Ở đây, Tỳ-kheo học thuộc lòng giáo pháp, kinh, kệ,’’ v.v., được dùng với nghĩa Pariyatti (giáo pháp học).
‘‘Diṭṭhadhammo viditadhammo’’tiādīsu (dī. ni. 1.299) saccesu.
In passages such as, "one who has seen the Dhamma, one who has known the Dhamma," it is used in the sense of the truths.
Trong các câu như ‘‘đã thấy pháp, đã biết pháp,’’ v.v., được dùng với nghĩa các chân lý.
‘‘Evaṃ dhammā te bhagavanto’’tiādīsu samādhimhi.
In passages such as, "Such were the dhammas of those Blessed Ones," it is used in the sense of concentration.
Trong các câu như ‘‘Các Đức Thế Tôn đó có pháp như vậy,’’ v.v., được dùng với nghĩa Samādhi (định).
‘‘Jātidhammā jarādhammā, atho maraṇadhammino’’tiādīsu pakatiyaṃ.
In such texts as, “Subject to birth, subject to aging, and also subject to death,” it is in the sense of nature.
Trong các trường hợp như: "Có bản chất sinh, có bản chất già, và có bản chất chết",* bản chất tự nhiên (pakati).
‘‘Kusalā dhammā’’tiādīsu (dha. sa. 1.tikamātikā) sabhāve.
In such texts as, “Wholesome dhammas,” it is in the sense of intrinsic nature.
Trong các trường hợp như: "Các pháp thiện (kusalā dhammā)",* tự tánh (sabhāva).
‘‘Tasmiṃ kho pana samaye dhammā hontī’’tiādīsu (dha. sa. 121) suññatāyaṃ.
In such texts as, “At that particular time, there are dhammas,” it is in the sense of voidness.
Trong các trường hợp như: "Vào thời điểm đó, các pháp hiện hữu",* tánh không (suññatā).
‘‘Dhammo suciṇṇo sukhamāvahātī’’tiādīsu (jā. 1.10.102) puññe.
In such texts as, “Dhamma well-practiced brings happiness,” it is in the sense of merit.
Trong các trường hợp như: "Pháp được thực hành tốt đẹp mang lại hạnh phúc",* công đức (puñña).
‘‘Dve aniyatā dhammā’’tiādīsu (pārā. 443) āpattiyaṃ.
In such texts as, “The two indeterminate dhammas,” it is in the sense of an offense.
Trong các trường hợp như: "Hai pháp bất định",* giới luật (āpatti).
‘‘Sabbe dhammā sabbākārena buddhassa bhagavato ñāṇamukhe āpāthaṃ āgacchantī’’tiādīsu ñeyye.
In such texts as, “All dhammas in all their aspects come into the range of the Blessed One the Buddha’s sphere of knowledge,” it is in the sense of the knowable.
Trong các trường hợp như: "Tất cả các pháp, bằng mọi phương cách, đều đi vào tầm nhận thức của trí tuệ Thế Tôn, Đức Phật",* đối tượng của trí tuệ (ñeyya).
Idha panāyaṃ sabhāve vattati.
Here, however, it is used in the sense of intrinsic nature.
Ở đây, từ này được dùng với nghĩa tự tánh (sabhāva).
Tatrāyaṃ vacanattho – attano lakkhaṇaṃ dhārentīti dhammā.
In that context, this is the etymological explanation: They are dhammas because they bear their own characteristic.
Trong đó, ý nghĩa của từ này là: "Những gì duy trì đặc tính của chính nó, đó là dhammā (các pháp)."
Mūla-saddo vitthārito eva.
The word root has already been explained in detail.
Từ Mūla đã được giải thích chi tiết.
Idha panāyaṃ asādhāraṇahetumhi daṭṭhabbo.
Here, however, it should be understood in the sense of an uncommon cause.
Ở đây, từ này phải được hiểu là nguyên nhân không chung (asādhāraṇahetu).
Pariyāyasaddo ‘‘madhupiṇḍikapariyāyoti naṃ dhārehī’’tiādīsu (ma. ni. 1.205) desanāyaṃ vattati.
The word discourse is used in the sense of a teaching in such texts as, “Remember it as the Discourse on the Honeyball.”
Từ Pariyāya được dùng với nghĩa giáo pháp (desanā) trong các trường hợp như: "Hãy ghi nhớ nó là Madhupiṇḍika-pariyāya (Bài giảng về Cục mật ong)".
‘‘Atthi khvesa brāhmaṇa, pariyāyo, yena maṃ pariyāyena sammā vadamāno vadeyya akiriyavādo samaṇo gotamo’’tiādīsu (pārā. 3) kāraṇe.
In such texts as, “Brahmin, there is a reason, a reason whereby one speaking rightly of me could say, ‘The ascetic Gotama is a proponent of non-action,’” it is used in the sense of a reason.
Với nghĩa nguyên nhân (kāraṇa) trong các trường hợp như: "Này Bà-la-môn, có một nguyên nhân mà nhờ đó, người nói đúng về Ta có thể nói: 'Sa-môn Gotama là người chủ trương không hành động'".
‘‘Kassa nu kho, ānanda, ajja pariyāyo bhikkhuniyo ovaditu’’ntiādīsu (ma. ni. 3.398) vāre.
In such texts as, “Ānanda, whose turn is it today to instruct the bhikkhunīs?” it is used in the sense of a turn.
Với nghĩa lượt (vāra) trong các trường hợp như: "Này Ānanda, hôm nay đến lượt ai giáo huấn các tỳ-khưu-ni?".
Idha pana kāraṇepi desanāyampi vattati.
Here, however, it is used in the sense of a reason and also a teaching.
Ở đây, nó được dùng với cả nghĩa nguyên nhân (kāraṇa) và giáo pháp (desanā).
Tasmā ‘‘sabbadhammamūlapariyāya’’nti ettha sabbesaṃ dhammānaṃ asādhāraṇahetusaññitaṃ kāraṇanti vā sabbesaṃ dhammānaṃ kāraṇadesananti vā evaṃ attho daṭṭhabbo.
Therefore, in the phrase “the discourse on the root of all dhammas,” the meaning should be understood as either “the reason, designated as the uncommon cause, for all dhammas,” or “the teaching on the reason for all dhammas.”
Do đó, trong "sabbadhammamūlapariyāya", ý nghĩa phải được hiểu là "nguyên nhân được gọi là nguyên nhân không chung của tất cả các pháp" hoặc "giáo pháp về nguyên nhân của tất cả các pháp".
Neyyatthattā cassa suttassa, na catubhūmakāpi sabhāvadhammā sabbadhammāti veditabbā.
And because the meaning of this sutta is one that needs to be inferred, it should not be understood that “all dhammas” refers to the intrinsic natures of things in all four planes.
Và vì kinh này có ý nghĩa cần được hiểu (neyyattha), không phải tất cả các pháp tự tánh thuộc bốn cõi đều được gọi là "tất cả các pháp".
Sakkāyapariyāpannā pana tebhūmakā dhammāva anavasesato veditabbā, ayamettha adhippāyoti.
Rather, it should be understood to refer, without remainder, only to the dhammas of the three planes that are included within the personal identity group; this is the intended meaning here.
Thay vào đó, các pháp thuộc ba cõi nằm trong thân kiến (sakkāya) phải được hiểu là "tất cả các pháp" một cách không sót, đây là ý định ở đây.
Voti ayaṃ vo-saddo paccattaupayogakaraṇasampadānasāmivacanapadapūraṇesu dissati.
Vo: This word vo is seen in the senses of the nominative, objective, instrumental, dative, genitive, and as a particle for filling out a line.
Từ Vo này, tức là từ vo, được thấy dùng trong các nghĩa chủ cách, đối cách, công cụ cách, tặng cách, sở hữu cách và bổ từ.
‘‘Kacci pana vo, anuruddhā, samaggā sammodamānā’’tiādīsu (ma. ni. 1.326) hi paccatte dissati.
For in such texts as, “Anuruddhās, are you all living in harmony and concord?” it is seen in the nominative sense.
Thật vậy, nó được thấy dùng trong chủ cách trong các trường hợp như: "Này các Tỳ-khưu Anuruddha, các ông có hòa hợp, hoan hỷ không?".
‘‘Gacchatha, bhikkhave, paṇāmemi vo’’tiādīsu (ma. ni. 2.157) upayoge.
In such texts as, “Go, monks, I am dismissing you,” it is used in the objective sense.
Trong đối cách trong các trường hợp như: "Này các Tỳ-khưu, hãy đi, Ta sẽ đuổi các ông".
‘‘Na vo mama santike vatthabba’’ntiādīsu (ma. ni. 2.157) karaṇe.
In such texts as, “You are not to stay in my presence,” it is used in the instrumental sense.
Trong công cụ cách trong các trường hợp như: "Các ông không nên ở gần Ta".
‘‘Vanapatthapariyāyaṃ vo, bhikkhave, desessāmī’’tiādīsu (ma. ni. 1.190) sampadāne.
In such texts as, “Monks, I will teach you the Discourse on the Forest Thicket,” it is used in the dative sense.
Trong tặng cách trong các trường hợp như: "Này các Tỳ-khưu, Ta sẽ thuyết cho các ông bài kinh Vanapattha-pariyāya".
‘‘Sabbesaṃ vo, sāriputta, subhāsita’’ntiādīsu (ma. ni. 1.345) sāmivacane.
In such texts as, “Sāriputta, all of your statements are well-spoken,” it is used in the genitive sense.
Trong sở hữu cách trong các trường hợp như: "Này Sāriputta, tất cả lời nói của các ông đều là thiện thuyết".
‘‘Ye hi vo ariyā parisuddhakāyakammantā’’tiādīsu (ma. ni. 1.35) padapūraṇamatte.
In such texts as, “Those noble ones who have purified bodily actions,” it is used merely to fill out the line.
Chỉ là bổ từ trong các trường hợp như: "Này các Tỳ-khưu, những bậc Thánh có thân nghiệp thanh tịnh".
Idha panāyaṃ sampadāne daṭṭhabbo.
Here, however, it should be understood in the dative sense.
Ở đây, từ này phải được hiểu là tặng cách.
Bhikkhaveti patissavena abhimukhībhūtānaṃ punālapanaṃ.
Bhikkhave is a repeated address to those who have already faced him in response.
Bhikkhave là lời gọi lại các Tỳ-khưu đã chấp thuận và đang đối diện.
Desessāmīti desanāpaṭijānanaṃ.
I will teach is an affirmation of the teaching.
Desessāmi là lời hứa sẽ thuyết giảng.
Idaṃ vuttaṃ hoti, bhikkhave, sabbadhammānaṃ mūlakāraṇaṃ tumhākaṃ desessāmi, dutiyena nayena kāraṇadesanaṃ tumhākaṃ desessāmīti.
This is what is meant: Monks, I will teach you the root-cause of all dhammas; or, in the second way of interpretation, I will teach you the teaching on the cause.
Điều này có nghĩa là: "Này các Tỳ-khưu, Ta sẽ thuyết giảng cho các ông nguyên nhân gốc rễ của tất cả các pháp; theo cách thứ hai, Ta sẽ thuyết giảng cho các ông giáo pháp về nguyên nhân."
Taṃ suṇāthāti tamatthaṃ taṃ kāraṇaṃ taṃ desanaṃ mayā vuccamānaṃ suṇātha.
Listen to that means: listen to that meaning, that cause, that teaching being spoken by me.
Taṃ suṇāthā: "Hãy lắng nghe điều đó, nguyên nhân đó, giáo pháp đó do Ta thuyết giảng."
Sādhukaṃ manasi karothāti ettha pana sādhukaṃ sādhūti ekatthametaṃ.
And here, in apply your minds well, sādhukaṃ and sādhu have the same meaning.
Trong Sādhukaṃ manasi karothā thì sādhukaṃ và sādhu có cùng một nghĩa.
Ayañca sādhu saddo āyācanasampaṭicchanasampahaṃsanasundaradaḷhīkammādīsu dissati.
This word sādhu is seen in the senses of requesting, accepting, applauding, being good, making firm, and so on.
Và từ sādhu này được thấy dùng trong các nghĩa thỉnh cầu, chấp thuận, hoan hỷ, tốt đẹp, củng cố, v.v.
‘‘Sādhu me bhante bhagavā, saṃkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.95) hi āyācane dissati.
For in such texts as, “Venerable sir, may the Blessed One please teach me the Dhamma in brief,” it is seen in the sense of requesting.
Thật vậy, nó được thấy dùng trong thỉnh cầu trong các trường hợp như: "Bạch Thế Tôn, xin Thế Tôn hãy thuyết pháp cho con một cách tóm tắt".
‘‘Sādhu, bhanteti kho so bhikkhu bhagavato bhāsitaṃ abhinanditvā anumoditvā’’tiādīsu (ma. ni. 3.86) sampaṭicchane.
In such texts as, “Saying, ‘Very well, venerable sir,’ that bhikkhu rejoiced and delighted in the Blessed One’s words,” it is used in the sense of accepting.
Trong chấp thuận trong các trường hợp như: "Này Tỳ-khưu đó, sau khi hoan hỷ và tán thán lời Đức Phật dạy, nói: 'Lành thay, bạch Thế Tôn'".
‘‘Sādhu, sādhu sāriputtā’’tiādīsu (dī. ni. 3.349) sampahaṃsane.
In such texts as, “Excellent, excellent, Sāriputta,” it is used in the sense of applauding.
Trong hoan hỷ trong các trường hợp như: "Lành thay, lành thay, Sāriputta!".
Ādīsu (jā. 2.18.101) sundare.
In such texts as this, it is in the sense of being good.
Trong các trường hợp như vậy,* tốt đẹp.
‘‘Tena hi, brāhmaṇa, sādhukaṃ suṇāhī’’tiādīsu (a. ni. 5.192) sādhukasaddoyeva daḷhīkamme, āṇattiyantipi vuccati.
In such texts as, “In that case, Brahmin, listen well,” the word sādhukaṃ itself is used in the sense of making firm; it is also said to be in the sense of a command.
Trong các trường hợp như: "Vậy thì, này Bà-la-môn, hãy lắng nghe kỹ", từ sādhukaṃ được dùng với nghĩa củng cố, và cũng được gọi là mệnh lệnh.
Idhāpi ayaṃ ettheva daḷhīkamme ca āṇattiyañca attho veditabbo.
Here, too, its meaning should be understood in these senses of making firm and of a command.
Ở đây, từ này cũng phải được hiểu với nghĩa củng cố và mệnh lệnh.
Sundaratthepi vattati.
It is also used in the sense of being good.
Nó cũng được dùng với nghĩa tốt đẹp.
Daḷhīkaraṇatthena hi daḷhamimaṃ dhammaṃ suṇātha suggahitaṃ gaṇhantā.
For in the sense of making firm, it means: listen to this Dhamma steadfastly, grasping it well.
Thật vậy, với nghĩa củng cố, nó có nghĩa: "Hãy lắng nghe pháp này một cách vững chắc, nắm giữ một cách tốt đẹp."
Āṇattiatthena mama āṇattiyā suṇātha.
In the sense of a command, it means: listen by my command.
Với nghĩa mệnh lệnh, nó có nghĩa: "Hãy lắng nghe theo mệnh lệnh của Ta."
Sundaratthena sundaramimaṃ bhaddakaṃ dhammaṃ suṇāthāti evaṃ dīpitaṃ hoti.
In the sense of being good, it indicates: listen to this good, excellent Dhamma.
Với nghĩa tốt đẹp, nó có nghĩa: "Hãy lắng nghe pháp tốt đẹp, thiện lành này."
Manasi karothāti āvajjetha, samannāharathāti attho, avikkhittacittā hutvā nisāmetha citte karothāti adhippāyo.
Apply your minds means: pay attention, bring your minds to bear; the intention is: listen with undistracted minds, place it in your minds.
Manasi karothā có nghĩa là "hãy chú ý, hãy hướng tâm", tức là "hãy lắng nghe với tâm không tán loạn, hãy ghi vào tâm".
Idānettha taṃ suṇāthāti sotindriyavikkhepavāraṇametaṃ.
Now, in this context, listen to that is to prevent the distraction of the ear-faculty.
Bây giờ, ở đây, taṃ suṇāthā là để ngăn chặn sự tán loạn của nhĩ căn.
Sādhukaṃ manasi karothāti manasikāre daḷhīkammaniyojanena manindriyavikkhepavāraṇaṃ.
Apply your minds well is to prevent the distraction of the mind-faculty by enjoining firmness in mental application.
Sādhukaṃ manasi karothā là để ngăn chặn sự tán loạn của ý căn bằng cách ra lệnh củng cố sự chú ý.
Purimañcettha byañjanavipallāsaggāhavāraṇaṃ, pacchimaṃ atthavipallāsaggāhavāraṇaṃ.
And the former prevents grasping the phrasing erroneously, while the latter prevents grasping the meaning erroneously.
Cái trước là để ngăn chặn sự hiểu sai về văn tự, cái sau là để ngăn chặn sự hiểu sai về ý nghĩa.
Purimena ca dhammassavane niyojeti, pacchimena sutānaṃ dhammānaṃ dhāraṇūpaparikkhādīsu.
And the former enjoins one to the hearing of the Dhamma, while the latter enjoins one to the retaining, examining, etc., of the dhammas that have been heard.
Cái trước ra lệnh lắng nghe pháp, cái sau ra lệnh ghi nhớ và xem xét các pháp đã nghe.
Purimena ca sabyañjano ayaṃ dhammo, tasmā savanīyoti dīpeti.
And the former indicates: This Dhamma has phrasing, therefore it should be heard.
Cái trước chỉ ra rằng pháp này có văn tự, do đó đáng nghe.
Pacchimena sāttho, tasmā manasi kātabboti.
The latter indicates: It has meaning, therefore it should be borne in mind.
Cái sau chỉ ra rằng pháp này có ý nghĩa, do đó đáng được ghi nhớ.
Sādhukapadaṃ vā ubhayapadehi yojetvā yasmā ayaṃ dhammo dhammagambhīro desanāgambhīro ca, tasmā suṇātha sādhukaṃ, yasmā atthagambhīro paṭivedhagambhīro ca, tasmā sādhukaṃ manasi karothāti evaṃ yojanā veditabbā.
Alternatively, the word sādhukaṃ should be connected with both phrases, so that the construction is understood thus: Because this Dhamma is profound in its phrasing and profound in its teaching, therefore listen well; and because it is profound in its meaning and profound in its penetration, therefore apply your minds well.
Hoặc có thể kết hợp từ sādhuka với cả hai từ, và hiểu rằng: "Vì pháp này sâu sắc về văn tự và sâu sắc về giáo pháp, nên hãy lắng nghe kỹ; vì pháp này sâu sắc về ý nghĩa và sâu sắc về sự thâm nhập, nên hãy chú ý kỹ."
Evaṃ vutte ussāhajātā hutvā evaṃ bhanteti kho te bhikkhū bhagavato paccassosuṃ satthu vacanaṃ sampaṭicchiṃsu, paṭiggahesunti vuttaṃ hoti.
When this was said, filled with enthusiasm, those bhikkhus replied to the Blessed One, “Yes, venerable sir,” accepting the Teacher’s word, it is said that they received it.
Khi được nói như vậy, các Tỳ-khưu đó đã trở nên phấn khởi và "Thưa Thế Tôn, vâng," các Tỳ-khưu đó đã đáp lại Đức Phật, tức là họ đã chấp nhận và tiếp nhận lời của Bậc Đạo Sư.
Atha nesaṃ bhagavā etadavoca etaṃ idāni vattabbaṃ idha bhikkhavotiādikaṃ sakalaṃ suttaṃ avoca.
Then the Blessed One said this to them; he spoke this entire sutta that is now to be spoken, beginning with Here, bhikkhus.
Sau đó, Đức Phật đã nói với họ điều này, tức là Ngài đã nói toàn bộ bài kinh từ "Này các Tỳ-khưu, ở đây" trở đi.
Tattha idhāti desāpadese nipāto.
Therein, here is a particle indicating a specific place.
Trong đó, idha là một giới từ chỉ nơi chốn.
Svāyaṃ katthaci lokaṃ upādāya vuccati.
And it is sometimes spoken in reference to the world.
Giới từ này đôi khi được dùng liên quan đến thế gian.
Yathāha – ‘‘idha tathāgato loke uppajjatī’’ti (dī. ni. 1.190).
As was said: “Here, a Tathāgata arises in the world.”
Như đã nói: "Ở đây, Như Lai xuất hiện trên thế gian."
Katthaci sāsanaṃ.
Sometimes, in reference to the Dispensation.
Đôi khi liên quan đến giáo pháp.
Yathāha – ‘‘idheva, bhikkhave, samaṇo, idha dutiyo samaṇo’’ti (a. ni. 4.241).
As was said: “Here, bhikkhus, is an ascetic; here, a second ascetic.”
Như đã nói: "Này các Tỳ-khưu, chỉ ở đây có Sa-môn, ở đây có Sa-môn thứ hai."
Katthaci okāsaṃ.
Sometimes, in reference to a location.
Đôi khi liên quan đến nơi chốn.
Yathāha –
As was said:
Như đã nói:
2. Bhikkhaveti yathāpaṭiññātaṃ desanaṃ desetuṃ puna bhikkhū ālapati.
Bhikkhus: He addresses the bhikkhus again in order to deliver the teaching as he had promised.
Bhikkhave: Đức Phật lại gọi các Tỳ-khưu để thuyết giảng giáo pháp đã hứa.
Ubhayenāpi, bhikkhave, imasmiṃ loketi vuttaṃ hoti.
By both, bhikkhus, ‘in this world’ is meant.
Này chư Tỳ-khưu, điều này có nghĩa là ‘trong thế giới này’ bằng cả hai phương diện.
Assutavā puthujjanoti ettha pana āgamādhigamābhāvā ñeyyo assutavā iti.
But here, in the phrase an uninstructed ordinary person, one should be known as 'uninstructed' due to the absence of textual learning and realization.
Còn ở đây, trong cụm từ kẻ phàm phu không học hỏi (assutavā puthujjano), cần phải biết rằng kẻ không học hỏi (assutavā) là do không có sự học hỏi (āgama) và không có sự chứng đắc (adhigama).
Yassa hi khandhadhātuāyatanasaccapaccayākārasatipaṭṭhānādīsu uggahaparipucchāvinicchayarahitattā maññanāpaṭisedhako neva āgamo, paṭipattiyā adhigantabbassa anadhigatattā neva adhigamo atthi.
Indeed, for whom there is no textual learning that refutes conceit, because of being devoid of learning, questioning, and determining in matters of aggregates, elements, sense bases, truths, dependent origination, foundations of mindfulness, and so on; and for whom there is no realization, because of not having realized what is to be realized through practice,
Thật vậy, đối với người nào, do không có sự tiếp thu, tìm hiểu và phân tích về các uẩn, giới, xứ, sự thật, duyên khởi, niệm xứ, v.v., nên không có sự học hỏi (āgama) để bài trừ các tà kiến, và cũng không có sự chứng đắc (adhigama) vì chưa chứng đắc những gì cần phải chứng đắc thông qua sự thực hành (paṭipatti).
So āgamādhigamābhāvā ñeyyo assutavā iti.
he should be known as 'uninstructed' due to the absence of textual learning and realization.
Người ấy, do không có sự học hỏi và chứng đắc, nên được biết là kẻ không học hỏi (assutavā).
Svāyaṃ –
And he is:
Người ấy –
So hi puthūnaṃ nānappakārānaṃ kilesādīnaṃ jananādīhi kāraṇehi puthujjano.
He is an ordinary person (puthujjana) for reasons such as generating many (puthu) and various defilements and so on.
Thật vậy, người ấy là phàm phu (puthujjano) do các nguyên nhân như sinh ra nhiều loại phiền não (kilesa) khác nhau (puthūnaṃ nānappakārānaṃ).
Yathāha – puthu kilese janentīti puthujjanā, puthu avihatasakkāyadiṭṭhikāti puthujjanā, puthu satthārānaṃ mukhamullokikāti puthujjanā, puthu sabbagatīhi avuṭṭhitāti puthujjanā, puthu nānābhisaṅkhāre abhisaṅkharontīti puthujjanā, puthu nānāoghehi vuyhantīti puthujjanā, puthu nānāsantāpehi santappantīti puthujjanā, puthu nānāpariḷāhehi paridayhantīti puthujjanā, puthu pañcasu kāmaguṇesu rattā giddhā gadhitā mucchitā ajjhosannā laggā lagitā palibuddhāti puthujjanā, puthu pañcahi nīvaraṇehi āvuṭā nivutā ovutā pihitā paṭicchannā paṭikujjitāti puthujjanāti (mahāni. 51).
As it is said: "They generate many defilements, thus they are 'ordinary people'; they have many identity-views that are not abandoned, thus they are 'ordinary people'; they look up to the faces of many teachers, thus they are 'ordinary people'; they have not emerged from all destinations, thus they are 'ordinary people'; they form various formations, thus they are 'ordinary people'; they are swept away by various floods, thus they are 'ordinary people'; they are tormented by various torments, thus they are 'ordinary people'; they are consumed by various fevers, thus they are 'ordinary people'; they are impassioned, greedy, infatuated, besotted, attached, clinging, stuck, and bound to the five cords of sensual pleasure, thus they are 'ordinary people'; they are obstructed, hindered, covered, concealed, veiled, and shrouded by the five hindrances, thus they are 'ordinary people'."
Như đã nói: “Những người sinh ra nhiều phiền não (kilesa) là phàm phu; những người có tà kiến thân kiến (sakkāyadiṭṭhi) chưa bị diệt trừ là phàm phu; những người ngước nhìn mặt nhiều bậc Đạo sư khác nhau là phàm phu; những người chưa thoát khỏi mọi nẻo luân hồi là phàm phu; những người tạo ra nhiều loại hành (saṅkhāra) khác nhau là phàm phu; những người bị trôi giạt trong nhiều dòng nước lũ (ogha) khác nhau là phàm phu; những người bị thiêu đốt bởi nhiều sự khổ đau (santāpa) khác nhau là phàm phu; những người bị nung nấu bởi nhiều sự nóng bức (pariḷāha) khác nhau là phàm phu; những người bị tham đắm, dính mắc, mê muội, chìm đắm, bám víu, ràng buộc vào năm dục lạc (kāmaguṇa) khác nhau là phàm phu; những người bị năm triền cái (nīvaraṇa) che lấp, bao phủ, bọc kín, bưng bít, che giấu, lật úp là phàm phu” (Mahāniddesa 51).
Puthūnaṃ vā gaṇanapathamatītānaṃ ariyadhammaparammukhānaṃ nīcadhammasamācārānaṃ janānaṃ antogadhattāpi puthujjanā.
Alternatively, they are 'ordinary people' because they are included among the many—innumerable—people who are turned away from the noble Dhamma and practice lowly dhammas.
Hoặc cũng là phàm phu (puthujjanā) do nằm trong số đông những người đã vượt quá sự tính đếm, quay lưng lại với Pháp của bậc Thánh (ariyadhamma), và có hành vi theo pháp thấp kém (nīcadhammasamācārānaṃ).
Puthu vā ayaṃ, visuṃyeva saṅkhaṃ gato, visaṃsaṭṭho sīlasutādiguṇayuttehi ariyehi janotipi puthujjano.
Or, this person is counted as separate (puthu), distinct, and unmixed with the noble ones endowed with virtues such as morality and learning; thus, he is an 'ordinary person'.
Hoặc chúng sinh này (ayaṃ jano) là phàm phu (puthujjano) vì riêng biệt, được tính là khác, không hòa lẫn với các bậc Thánh (ariya) có các đức tính như giới (sīla), tuệ (suta), v.v.
Evametehi ‘‘assutavā puthujjano’’ti dvīhipi padehi yete –
Thus, by these two phrases, "an uninstructed ordinary person," of those who—
Như vậy, với cả hai từ ‘‘kẻ phàm phu không học hỏi (assutavā puthujjano)’’ này, cần phải hiểu rằng hai loại phàm phu được nói đến –
Dve puthujjanā vuttā.
two ordinary people were spoken of.
Hai loại phàm phu được nói đến.
Tesu andhaputhujjano vutto hotīti veditabbo.
Among them, it should be understood that the blind ordinary person is spoken of.
Trong số đó, cần phải hiểu rằng phàm phu mù quáng được nói đến.
Ariyānaṃ adassāvītiādīsu ariyāti ārakattā kilesehi, anaye nairiyanato, aye iriyanato, sadevakena ca lokena araṇīyato buddhā ca paccekabuddhā ca buddhasāvakā ca vuccanti, buddhā eva vā idha ariyā.
In the phrase one who has not seen the noble ones, and so on, noble ones refers to Buddhas, Paccekabuddhas, and the disciples of the Buddha, because they are far (āraka) from defilements, because they do not fare (na iriyanato) in what is improper, because they fare (iriyanato) in what is proper, and because they are worthy of veneration (araṇīyato) by the world with its devas. Or, here, only the Buddhas are the noble ones.
Trong các cụm từ như không thấy các bậc Thánh (ariyānaṃ adassāvī), v.v., các bậc Thánh (ariyā) được gọi là chư Phật, chư Độc Giác Phật (Paccekabuddha), và các đệ tử của Phật (buddhasāvaka), do các Ngài xa lìa phiền não (kilesa), không đi vào đường bất thiện, đi vào đường thiện, và được chư thiên cùng thế gian cung kính; hoặc ở đây, chỉ chư Phật là bậc Thánh.
Yathāha ‘‘sadevake, bhikkhave, loke…pe… tathāgato ariyoti vuccatī’’ti (saṃ. ni. 5.1098).
As it is said: "Bhikkhus, in the world with its devas... the Tathāgata is called 'noble'."
Như đã nói: “Này chư Tỳ-khưu, trong thế gian cùng với chư thiên… (v.v.)… Như Lai được gọi là bậc Thánh” (Saṃyutta Nikāya 5.1098).
Sappurisāti ettha pana paccekabuddhā tathāgatasāvakā ca ‘‘sappurisā’’ti veditabbā.
But here, in the term good persons, it should be understood that Paccekabuddhas and the disciples of the Tathāgata are the "good persons."
Còn ở đây, trong cụm từ những bậc Thiện sĩ (sappurisā), cần phải hiểu rằng chư Độc Giác Phật và các đệ tử của Như Lai được gọi là “Thiện sĩ”.
Te hi lokuttaraguṇayogena sobhanā purisāti sappurisā.
For they are excellent persons due to their possession of supramundane qualities; thus they are good persons.
Vì các Ngài là những người tốt đẹp (sobhanā purisā) do có các đức tính siêu thế (lokuttaraguṇa), nên được gọi là Thiện sĩ (sappurisā).
Sabbeva vā ete dvedhāpi vuttā.
Or, all of them are spoken of in both ways.
Hoặc tất cả các Ngài đều được nói đến bằng cả hai cách.
Buddhāpi hi ariyā ca sappurisā ca, paccekabuddhā buddhasāvakāpi.
For Buddhas are both noble ones and good persons, as are Paccekabuddhas and the disciples of the Buddha.
Chư Phật cũng là bậc Thánh và Thiện sĩ, chư Độc Giác Phật và các đệ tử của Phật cũng vậy.
Yathāha –
As it is said:
Như đã nói –
Kalyāṇamitto daḷhabhatti ca hotīti ettāvatā hi buddhasāvako vutto, kataññutādīhi paccekabuddhā buddhāti.
Indeed, by the words "is a good friend and has firm devotion," a disciple of the Buddha is referred to; by qualities such as gratitude, Paccekabuddhas and Buddhas are referred to.
Chỉ với câu “có bạn lành và có lòng tin kiên cố” là nói về đệ tử của Phật, còn với “biết ơn, v.v.” là nói về chư Độc Giác Phật và chư Phật.
Idāni yo tesaṃ ariyānaṃ adassanasīlo, na ca dassane sādhukārī, so ariyānaṃ adassāvīti veditabbo.
Now, one who is not in the habit of seeing those noble ones, and who does not delight in seeing them, should be understood as one who has not seen the noble ones.
Bây giờ, người nào có thói quen không thấy các bậc Thánh ấy, và không hoan hỷ trong việc thấy, người ấy được biết là không thấy các bậc Thánh (ariyānaṃ adassāvī).
So ca cakkhunā adassāvī ñāṇena adassāvīti duvidho, tesu ñāṇena adassāvī idha adhippeto.
And this person is twofold: one who has not seen with the eye, and one who has not seen with knowledge. Of these, the one who has not seen with knowledge is intended here.
Người ấy có hai loại: không thấy bằng mắt và không thấy bằng tuệ. Trong số đó, ở đây, người không thấy bằng tuệ là điều được đề cập.
Maṃsacakkhunā hi dibbacakkhunā vā ariyā diṭṭhāpi adiṭṭhāva honti.
For even if noble ones are seen with the physical eye or the divine eye, they are still considered as not seen,
Thật vậy, dù các bậc Thánh có được thấy bằng mắt thịt hay mắt thiên nhãn, thì họ vẫn như không được thấy.
Tesaṃ cakkhūnaṃ vaṇṇamattaggahaṇato, na ariyabhāvagocarato.
because those eyes grasp only their appearance, not the domain of their noble state.
Vì chỉ nắm bắt được vẻ bề ngoài của các Ngài, chứ không phải đối tượng của trạng thái Thánh.
Soṇasiṅgālādayopi ca cakkhunā ariye passanti.
Even dogs, jackals, and so on, see noble ones with the eye,
Ngay cả chó sói, chó rừng, v.v., cũng thấy các bậc Thánh bằng mắt.
Na ca te ariyānaṃ dassāvino.
but they are not seers of the noble ones.
Nhưng chúng không phải là những người thấy các bậc Thánh.
Tatridaṃ vatthu – cittalapabbatavāsino kira khīṇāsavattherassa upaṭṭhāko vuḍḍhapabbajito ekadivasaṃ therena saddhiṃ piṇḍāya caritvā therassa pattacīvaraṃ gahetvā piṭṭhito āgacchanto theraṃ pucchi ‘‘ariyā nāma, bhante, kīdisā’’ti.
In this regard, there is this story: The attendant of a khīṇāsava elder who lived on Cittala mountain, a man ordained in old age, once went on alms-round with the elder. Taking the elder's bowl and robe and following behind, he asked the elder, "Venerable sir, what are noble ones like?"
Ở đây có câu chuyện này: Nghe nói, một vị tỳ-khưu lớn tuổi, thị giả của vị Trưởng lão A-la-hán trú tại núi Cittala, một ngày nọ, sau khi đi khất thực cùng Trưởng lão, đã cầm y bát của Trưởng lão đi phía sau và hỏi Trưởng lão: “Bạch Ngài, các bậc Thánh là những người như thế nào?”
Thero āha ‘‘idhekacco mahallako ariyānaṃ pattacīvaraṃ gahetvā vattapaṭipattiṃ katvā sahacarantopi neva ariye jānāti, evaṃ dujjānā, āvuso, ariyā’’ti.
The elder replied, "Here, my good man, a certain elderly man, even while carrying the bowl and robe of noble ones, performing his duties, and travelling together with them, does not know the noble ones. So difficult to know, friend, are the noble ones."
Trưởng lão nói: “Ở đây, một số người lớn tuổi, dù cầm y bát của các bậc Thánh, thực hành bổn phận và sống cùng các Ngài, nhưng vẫn không biết các bậc Thánh. Này hiền giả, các bậc Thánh khó biết như vậy đó.”
Evaṃ vuttepi so neva aññāsi.
Even when this was said, he still did not understand.
Dù được nói như vậy, người ấy vẫn không hiểu.
Tasmā na cakkhunā dassanaṃ dassanaṃ, ñāṇena dassanameva dassanaṃ.
Therefore, seeing with the eye is not true seeing; only seeing with knowledge is true seeing.
Do đó, thấy bằng mắt không phải là thấy, chỉ thấy bằng tuệ mới là thấy.
Yathāha ‘‘kiṃ te, vakkali, iminā pūtikāyena diṭṭhena, yo kho, vakkali, dhammaṃ passati, so maṃ passatī’’ti (saṃ. ni. 3.87).
As it is said: "What is there for you, Vakkali, in seeing this foul body? Whoever, Vakkali, sees the Dhamma, sees me."
Như đã nói: “Này Vakkali, thân thể thối rữa này có ích gì cho ngươi khi được thấy? Này Vakkali, ai thấy Pháp là thấy Ta” (Saṃyutta Nikāya 3.87).
Tasmā cakkhunā passantopi ñāṇena ariyehi diṭṭhaṃ aniccādilakkhaṇaṃ apassanto ariyādhigatañca dhammaṃ anadhigacchanto ariyakaradhammānaṃ ariyabhāvassa ca adiṭṭhattā ‘‘ariyānaṃ adassāvī’’ti veditabbo.
Therefore, even though seeing them with the eye, one who does not see with knowledge the characteristic of impermanence, etc., seen by the noble ones, and who does not realize the Dhamma realized by the noble ones, should be understood as "one who has not seen the noble ones" because of not having seen the dhammas that make one noble and the state of nobility itself.
Do đó, dù thấy bằng mắt, nhưng nếu không thấy các đặc tính vô thường, v.v., mà các bậc Thánh đã thấy bằng tuệ, và không chứng đắc Pháp mà các bậc Thánh đã chứng đắc, thì người ấy được biết là “không thấy các bậc Thánh” vì chưa thấy các pháp làm nên bậc Thánh và trạng thái Thánh.
Ayañhi saṃvaravinayo pahānavinayoti duvidho vinayo.
This discipline is twofold: the discipline of restraint and the discipline of abandoning.
Thật vậy, giới luật (vinaya) này có hai loại: giới luật phòng hộ (saṃvaravinaya) và giới luật đoạn trừ (pahānavinaya).
Ettha ca duvidhepi vinaye ekameko vinayo pañcadhā bhijjati.
And within these two kinds of discipline, each one is divided in five ways.
Trong hai loại giới luật này, mỗi loại lại được chia thành năm phần.
Saṃvaravinayopi hi sīlasaṃvaro satisaṃvaro ñāṇasaṃvaro khantisaṃvaro vīriyasaṃvaroti pañcavidho.
The discipline of restraint is fivefold: restraint by morality, restraint by mindfulness, restraint by knowledge, restraint by patience, and restraint by energy.
Giới luật phòng hộ (Saṃvaravinaya) cũng có năm loại: phòng hộ bằng giới (sīlasaṃvara), phòng hộ bằng niệm (satisaṃvara), phòng hộ bằng tuệ (ñāṇasaṃvara), phòng hộ bằng nhẫn nhục (khantisaṃvara), và phòng hộ bằng tinh tấn (vīriyasaṃvara).
Pahānavinayopi tadaṅgapahānaṃ vikkhambhanapahānaṃ samucchedapahānaṃ paṭippassaddhipahānaṃ nissaraṇapahānanti pañcavidho.
The discipline of abandoning is also fivefold: abandoning by substitution of opposites, abandoning by suppression, abandoning by cutting off, abandoning by tranquillization, and abandoning by escape.
Giới luật đoạn trừ (Pahānavinaya) cũng có năm loại: đoạn trừ từng phần (tadaṅgapahāna), đoạn trừ bằng cách trấn áp (vikkhambhanapahāna), đoạn trừ tận gốc (samucchedapahāna), đoạn trừ bằng cách an tịnh (paṭippassaddhipahāna), và đoạn trừ bằng cách thoát ly (nissaraṇapahāna).
Ayaṃ ñāṇasaṃvaro.
This is restraint by knowledge.
Đây là phòng hộ bằng tuệ (ñāṇasaṃvaro).
‘‘Khamo hoti sītassa uṇhassā’’ti (ma. ni. 1.23; a. ni. 4.114; 6.58) ayaṃ khantisaṃvaro.
"He is patient with cold and heat" — this is restraint by patience.
“Người ấy có thể chịu đựng được cái lạnh, cái nóng” (Majjhima Nikāya 1.23; Aṅguttara Nikāya 4.114; 6.58) – đây là phòng hộ bằng nhẫn nhục (khantisaṃvaro).
‘‘Uppannaṃ kāmavitakkaṃ nādhivāsetī’’ti (ma. ni. 1.26; a. ni. 4.114; 6.58) ayaṃ vīriyasaṃvaro.
"He does not tolerate a sensual thought that has arisen" — this is restraint by energy.
“Người ấy không chấp nhận những tư duy dục lạc đã khởi lên” (Majjhima Nikāya 1.26; Aṅguttara Nikāya 4.114; 6.58) – đây là phòng hộ bằng tinh tấn (vīriyasaṃvaro).
Sabbopi cāyaṃ saṃvaro yathāsakaṃ saṃvaritabbānaṃ vinetabbānañca kāyaduccaritādīnaṃ saṃvaraṇato ‘‘saṃvaro’’, vinayanato ‘‘vinayo’’ti vuccati.
And all this restraint is called "restraint" (saṃvara) from its restraining of things to be restrained, such as bodily misconduct, each in its own way; and it is called "discipline" (vinaya) from its disciplining of them.
Tất cả sự phòng hộ này đều được gọi là “phòng hộ (saṃvaro)” vì nó phòng hộ các ác hạnh thân, v.v., cần được phòng hộ và rèn luyện theo từng phần; và được gọi là “giới luật (vinayo)” vì nó rèn luyện.
Evaṃ tāva saṃvaravinayo pañcadhā bhijjatīti veditabbo.
Thus, it should first be understood that the discipline of restraint is divided in five ways.
Như vậy, cần phải biết rằng giới luật phòng hộ được chia thành năm phần.
Tathā yaṃ nāmarūpaparicchedādīsu vipassanāñāṇesu paṭipakkhabhāvato dīpālokeneva tamassa, tena tena vipassanāñāṇena tassa tassa anatthassa pahānaṃ.
Similarly, that which, in the insight knowledges such as the determination of mind and matter, is the abandoning of each respective unwholesome state by each respective insight knowledge, due to being its opposite, like the abandoning of darkness by the light of a lamp,
Cũng vậy, sự đoạn trừ những điều bất lợi đó bằng từng tuệ quán (vipassanāñāṇa) tương ứng, giống như ánh sáng đèn diệt bóng tối, do đối nghịch với các tuệ quán trong việc phân biệt danh sắc, v.v.
Seyyathidaṃ, nāmarūpavavatthānena sakkāyadiṭṭhiyā, paccayapariggahena ahetuvisamahetudiṭṭhīnaṃ, tasseva aparabhāgena kaṅkhāvitaraṇena kathaṃkathībhāvassa, kalāpasammasanena ‘‘ahaṃ mamā’’ti gāhassa, maggāmaggavavatthānena amagge maggasaññāya, udayadassanena ucchedadiṭṭhiyā, vayadassanena sassatadiṭṭhiyā, bhayadassanena sabhaye abhayasaññāya, ādīnavadassanena assādasaññāya, nibbidānupassanāya abhiratisaññāya, muccitukamyatāñāṇena amuccitukamyatāya, upekkhāñāṇena anupekkhāya, anulomena dhammaṭṭhitiyaṃ nibbāne ca paṭilomabhāvassa, gotrabhunā saṅkhāranimittaggāhassa pahānaṃ, etaṃ tadaṅgapahānaṃnāma.
That is to say, the abandonment of personality-view (sakkāyadiṭṭhi) through the determination of name-and-form; of the views of causelessness and dissimilar cause through the grasping of conditions; of the state of being perplexed through the overcoming of doubt in a later phase; of the grasping of 'I' and 'mine' through comprehension by groups; of the perception of the path in what is not the path through the determination of path and not-path; of the annihilationist view through the seeing of arising; of the eternalist view through the seeing of passing away; of the perception of safety in what is dangerous through the seeing of fear; of the perception of gratification through the seeing of danger; of the perception of delight through insight into disenchantment; of the lack of desire to be freed through the knowledge of the desire for deliverance; of non-equanimity through the knowledge of equanimity; of the state of being contrary to the stability of the Dhamma and Nibbāna through conformity; the abandonment of grasping the sign of formations through the change-of-lineage knowledge—this is called abandonment by substitution of opposites (tadaṅgapahāna).
Đó là, sự đoạn trừ tà kiến thân kiến (sakkāyadiṭṭhi) bằng sự phân định danh sắc; sự đoạn trừ các tà kiến vô nhân và tà kiến dị nhân bằng sự thâu tóm các duyên; sự đoạn trừ trạng thái hoài nghi bằng sự vượt qua hoài nghi ở giai đoạn sau của chính tri kiến đó; sự đoạn trừ sự chấp thủ “ta và của ta” bằng sự quán xét các nhóm (kalāpa); sự đoạn trừ nhận thức về con đường là không phải con đường bằng sự phân định đúng sai con đường; sự đoạn trừ tà kiến đoạn diệt bằng sự thấy sự sinh khởi; sự đoạn trừ tà kiến thường còn bằng sự thấy sự hoại diệt; sự đoạn trừ nhận thức về sự không sợ hãi trong những gì đáng sợ bằng sự thấy sự nguy hiểm; sự đoạn trừ nhận thức về sự thích thú bằng sự thấy sự tai hại; sự đoạn trừ nhận thức về sự thích thú bằng sự quán niệm sự nhàm chán; sự đoạn trừ sự không muốn giải thoát bằng trí tuệ muốn giải thoát; sự đoạn trừ sự không xả ly bằng trí tuệ xả ly; sự đoạn trừ trạng thái nghịch chiều trong sự an trú pháp và Niết Bàn bằng sự thuận chiều; sự đoạn trừ sự chấp thủ tướng các hành (saṅkhāranimitta) bằng trí chuyển tộc (gotrabhu). Đây được gọi là Đoạn trừ từng phần (Tadaṅgapahāna).
Yaṃ catunnaṃ ariyamaggānaṃ bhāvitattā taṃtaṃmaggavato attano attano santāne ‘‘diṭṭhigatānaṃ pahānāyā’’tiādinā (dha. sa. 277) nayena vuttassa samudayapakkhikassa kilesagaṇassa accantaṃ appavattibhāvena pahānaṃ, idaṃ samucchedapahānaṃ nāma.
The abandonment of the host of defilements belonging to the side of arising, spoken of in the manner of "for the abandonment of views", etc., which occurs in the mental continuum of one possessing each respective path, due to the cultivation of the four noble paths, in such a way that they never arise again—this is called abandonment by cutting off (samucchedapahāna).
Còn sự đoạn trừ hoàn toàn không cho sinh khởi trở lại của nhóm phiền não thuộc về tập đế, được nói đến theo cách “để đoạn trừ các tà kiến” (dha. sa. 277) v.v., trong dòng tâm thức của người đã đạt đạo tương ứng, do sự phát triển của bốn Thánh đạo, đây được gọi là Đoạn trừ tận gốc (Samucchedapahāna).
Yaṃ pana phalakkhaṇe paṭippassaddhattaṃ kilesānaṃ, etaṃ paṭippassaddhipahānaṃ nāma.
But the tranquillization of the defilements at the moment of fruition—this is called abandonment by tranquillization (paṭippassaddhipahāna).
Còn sự tịch diệt các phiền não trong khoảnh khắc quả, đây được gọi là Đoạn trừ bằng cách an tịnh (Paṭippassaddhipahāna).
Yaṃ sabbasaṅkhatanissaṭattā pahīnasabbasaṅkhataṃ nibbānaṃ etaṃ nissaraṇapahānaṃ nāma.
Nibbāna, which is devoid of all things conditioned because it has escaped from all things conditioned—this is called abandonment by escape (nissaraṇapahāna).
Còn Niết Bàn, là sự loại bỏ tất cả các pháp hữu vi do đã thoát ly khỏi tất cả các pháp hữu vi, đây được gọi là Đoạn trừ bằng cách thoát ly (Nissaraṇapahāna).
Sabbampi cetaṃ pahānaṃ yasmā cāgaṭṭhena pahānaṃ, vinayanaṭṭhena vinayo, tasmā ‘‘pahānavinayo’’ti vuccati.
And since all this abandoning is abandoning (pahāna) in the sense of relinquishing, and discipline (vinayo) in the sense of removing, it is therefore called 'the discipline of abandoning' (pahānavinayo).
Tất cả sự đoạn trừ này được gọi là “Đoạn trừ và Điều phục” (pahānavinayo) vì nó là sự đoạn trừ theo nghĩa từ bỏ, và là sự điều phục theo nghĩa loại bỏ.
Taṃtaṃpahānavato vā tassa tassa vinayassa sambhavatopetaṃ ‘‘pahānavinayo’’ti vuccati.
Or, because this and that discipline arises for one who has this and that abandonment, it is called 'the discipline of abandoning'.
Hoặc nó được gọi là “Đoạn trừ và Điều phục” vì sự hiện hữu của sự điều phục đó tùy thuộc vào sự đoạn trừ tương ứng.
Evaṃ pahānavinayopi pañcadhā bhijjatīti veditabbo.
Thus, the discipline of abandoning should be understood as being divided in five ways.
Như vậy, sự đoạn trừ và điều phục (pahānavinayo) cũng được hiểu là chia thành năm loại.
Evamayaṃ saṅkhepato duvidho, bhedato ca dasavidho vinayo bhinnasaṃvarattā pahātabbassa ca appahīnattā yasmā etassa assutavato puthujjanassa natthi, tasmā abhāvato tassa ayaṃ avinītoti vuccatīti.
In this way, this discipline is twofold in brief, and tenfold by division. Because his restraint is broken and what should be abandoned is not abandoned, this discipline is absent in that uninstructed worldling. Therefore, due to its absence, he is called 'undisciplined'.
Như vậy, giới luật này tóm tắt có hai loại, và phân loại thì có mười loại. Vì sự phòng hộ bị phá vỡ và những gì cần đoạn trừ chưa được đoạn trừ, mà phàm phu vô văn này không có giới luật, nên do không có, người này được gọi là vô giới (avinīto).
Esa nayo sappurisānaṃ adassāvī sappurisadhammassa akovido sappurisadhamme avinītoti etthapi.
This same method applies to the phrases: "one who does not see good persons, is not skilled in the Dhamma of good persons, is not disciplined in the Dhamma of good persons."
Nguyên tắc này cũng áp dụng cho “ không thấy các bậc chân nhân, không thông thạo pháp của các bậc chân nhân, không được điều phục trong pháp của các bậc chân nhân”.
Ninnānākaraṇañhi etaṃ atthato.
For in meaning, there is no difference in this.
Thật vậy, về mặt ý nghĩa, đây không phải là sự khác biệt.
Yathāha ‘‘yeva te ariyā, teva te sappurisā.
As it is said: "Those who are noble ones, they are the good persons.
Như đã nói: “Những ai là các bậc Thánh (Ariya), chính họ là các bậc chân nhân (Sappurisa).
Yeva te sappurisā, teva te ariyā.
Those who are good persons, they are the noble ones.
Những ai là các bậc chân nhân, chính họ là các bậc Thánh.
Yo eva so ariyānaṃ dhammo, so eva so sappurisānaṃ dhammo.
That which is the Dhamma of the noble ones, that is the Dhamma of good persons.
Pháp nào là pháp của các bậc Thánh, chính pháp đó là pháp của các bậc chân nhân.
Yo eva so sappurisānaṃ dhammo, so eva so ariyānaṃ dhammo.
That which is the Dhamma of good persons, that is the Dhamma of the noble ones.
Pháp nào là pháp của các bậc chân nhân, chính pháp đó là pháp của các bậc Thánh.
Yeva te ariyavinayā, teva te sappurisavinayā.
Those which are the disciplines of the noble ones, they are the disciplines of good persons.
Giới luật nào là giới luật của các bậc Thánh, chính giới luật đó là giới luật của các bậc chân nhân.
Yeva te sappurisavinayā, teva te ariyavinayā.
Those which are the disciplines of good persons, they are the disciplines of the noble ones.
Giới luật nào là giới luật của các bậc chân nhân, chính giới luật đó là giới luật của các bậc Thánh.
Ariyeti vā sappuriseti vā, ariyadhammeti vā sappurisadhammeti vā, ariyavinayeti vā sappurisavinayeti vā esese eke ekatthe same samabhāge tajjāte taññevā’’ti.
Whether one says 'noble one' or 'good person,' or 'Dhamma of the noble ones' or 'Dhamma of good persons,' or 'discipline of the noble ones' or 'discipline of good persons,' it is all one and the same, of one meaning, equal, of equal portion, of the same nature, the very same."
Dù là ‘Thánh’ hay ‘chân nhân’, dù là ‘pháp của Thánh’ hay ‘pháp của chân nhân’, dù là ‘giới luật của Thánh’ hay ‘giới luật của chân nhân’, tất cả những điều này đều là một, cùng nghĩa, tương đương, đồng đẳng, cùng bản chất, và chính là điều đó.”
‘‘Kasmā pana bhagavā sabbadhammamūlapariyāyaṃ vo, bhikkhave, desessāmī’’ti vatvā taṃ adesetvāva ‘‘idha, bhikkhave, assutavā puthujjano ariyānaṃ adassāvī’’ti evaṃ puthujjanaṃ niddisīti?
But why did the Blessed One, after saying, "Bhikkhus, I will teach you the discourse on the root of all things," not teach it but instead point out the worldling, saying, "Here, bhikkhus, an uninstructed worldling, who does not see noble ones"?
“Vì sao Thế Tôn lại nói: ‘Này các Tỳ-khưu, Ta sẽ thuyết giảng cho các ông Tóm lược về căn bản của tất cả các pháp’, nhưng lại không thuyết giảng điều đó mà lại chỉ rõ phàm phu như thế này: ‘Này các Tỳ-khưu, ở đây, phàm phu vô văn, không thấy các bậc Thánh’?”
Puggalādhiṭṭhānāya dhammadesanāya tamatthaṃ āvikātuṃ.
To make that meaning clear through a teaching established on a person.
Để làm sáng tỏ ý nghĩa đó bằng cách thuyết pháp dựa trên cá nhân (puggalādhiṭṭhānā dhammadesanā).
Bhagavato hi dhammādhiṭṭhānā dhammadesanā, dhammādhiṭṭhānā puggaladesanā, puggalādhiṭṭhānā puggaladesanā, puggalādhiṭṭhānā dhammadesanāti dhammapuggalavaseneva tāva catubbidhā desanā.
For the Blessed One's teachings are of four kinds based on Dhamma and persons: a teaching of Dhamma established on Dhamma, a teaching of a person established on Dhamma, a teaching of a person established on a person, and a teaching of Dhamma established on a person.
Vì lời dạy của Thế Tôn có bốn loại: lời dạy dựa trên pháp về pháp, lời dạy dựa trên pháp về cá nhân, lời dạy dựa trên cá nhân về cá nhân, và lời dạy dựa trên cá nhân về pháp.
Tattha, ‘‘tisso imā, bhikkhave, vedanā.
Among these, "Bhikkhus, there are these three feelings.
Trong đó,
Katamā tisso?
What three?
“Này các Tỳ-khưu, có ba loại cảm thọ này.
Sukhā vedanā dukkhā vedanā adukkhamasukhā vedanā.
Pleasant feeling, painful feeling, neither-painful-nor-pleasant feeling.
Thế nào là ba loại?
Imā kho, bhikkhave, tisso vedanā’’ti (saṃ. ni. 4.250) evarūpī dhammādhiṭṭhānā dhammadesanā veditabbā.
These, bhikkhus, are the three feelings"—a teaching of this type should be understood as a teaching of Dhamma established on Dhamma.
Thọ lạc, thọ khổ, thọ không khổ không lạc. Này các Tỳ-khưu, đây là ba loại cảm thọ.” (Saṃ. Ni. 4.250) Lời dạy như vậy được hiểu là lời dạy dựa trên pháp về pháp.
‘‘Cha dhātuyo ayaṃ putiso cha phassāyatano aṭṭhārasa manopavicāro caturādhiṭṭhāno’’ti (ma. ni. 3.343) evarūpī dhammādhiṭṭhānā puggaladesanā.
"This person consists of six elements, has six bases for contact, eighteen mental examinations, and four foundations"—a teaching of this type is a teaching of a person established on Dhamma.
“Người này có sáu giới, sáu xứ xúc, mười tám ý tư duy, bốn sự y chỉ.” (Ma. Ni. 3.343) Lời dạy như vậy là lời dạy dựa trên pháp về cá nhân.
‘‘Tayome, bhikkhave, puggalā santo saṃvijjamānā lokasmiṃ.
"Bhikkhus, there are these three persons existing, present in the world.
“Này các Tỳ-khưu, có ba hạng người hiện hữu trên đời.
Katame tayo?
What three?
Thế nào là ba hạng?
Andho ekacakkhu dvicakkhu.
The blind, the one-eyed, and the two-eyed.
Người mù, người một mắt, người hai mắt.
Katamo ca, bhikkhave, puggalo andho’’ti?
And which, bhikkhus, is the blind person?"—
Này các Tỳ-khưu, thế nào là người mù?”
(A. ni. 3.29) evarūpī puggalādhiṭṭhānā puggaladesanā.
a teaching of this type is a teaching of a person established on a person.
(A. Ni. 3.29) Lời dạy như vậy là lời dạy dựa trên cá nhân về cá nhân.
‘‘Katamañca, bhikkhave, duggatibhayaṃ?
"And what, bhikkhus, is the fear of a bad destination?
“Này các Tỳ-khưu, thế nào là sự sợ hãi ác thú?
Idha, bhikkhave, ekacco iti paṭisañcikkhati, kāyaduccaritassa kho pāpako vipāko abhisamparāyaṃ…pe… suddhamattānaṃ pariharati.
Here, bhikkhus, someone reflects thus: 'The result of bodily misconduct in the next life is bad...' ... he keeps himself pure.
Ở đây, này các Tỳ-khưu, có người suy xét như sau: ‘Quả báo của thân ác hạnh là xấu xa trong đời sau… (v.v.)… giữ gìn tự ngã thanh tịnh.’
Idaṃ vuccati, bhikkhave, duggatibhaya’’nti (a. ni. 4.121) evarūpī puggalādhiṭṭhānā dhammadesanā.
This, bhikkhus, is called the fear of a bad destination"—a teaching of this type is a teaching of Dhamma established on a person.
Này các Tỳ-khưu, điều này được gọi là sự sợ hãi ác thú.” (A. Ni. 4.121) Lời dạy như vậy là lời dạy dựa trên cá nhân về pháp.
Evaṃ puthujjanaṃ niddisitvā idāni tassa pathavīādīsu vatthūsu sabbasakkāyadhammajanitaṃ maññanaṃ dassento, pathaviṃ pathavitotiādimāha.
Having thus pointed out the worldling, now, showing his conceiving which is generated by all things pertaining to individuality in things such as earth, he said, "earth as earth," etc.
Sau khi đã chỉ rõ phàm phu như vậy, bây giờ để chỉ ra sự nhận thức do tất cả các pháp thuộc thân kiến (sakkāyadhamma) sinh ra trong các đối tượng như địa đại, Thế Tôn đã nói: “ đất là đất” v.v.
Tattha lakkhaṇapathavī sasambhārapathavī ārammaṇapathavī sammutipathavīti catubbidhā pathavī.
Therein, earth is of four kinds: earth as a characteristic, earth with its components, earth as an object, and earth by convention.
Trong đó, địa đại có bốn loại: địa đại theo đặc tính, địa đại có các thành phần, địa đại là đối tượng, địa đại theo quy ước.
Tāsu ‘‘katamā ca, āvuso, ajjhattikā pathavīdhātu?
Among these, earth as a characteristic is that which is mentioned in texts such as, "And what, friends, is the internal earth element? That which is internal, personal, hard, and solid." Earth with its components is that which is mentioned in texts such as, "Should he dig the earth or have it dug." The twenty parts, such as head hairs, and the external ones, such as iron and copper.
Trong số đó, “Này chư hiền, thế nào là địa đại nội tại? Đó là bất cứ cái gì bên trong, thuộc về cá nhân, cứng rắn, thô ráp” (Vibha. 173) v.v., được nói đến là địa đại theo đặc tính.
Yaṃ ajjhattaṃ paccattaṃ kakkhaḷaṃ kharigata’’ntiādīsu (vibha. 173) vuttā lakkhaṇapathavī. ‘‘Pathaviṃ khaṇeyya vā khaṇāpeyya vā’’tiādīsu (pāci. 85) vuttā sasambhārapathavī. Ye ca kesādayo vīsati koṭṭhāsā, ayolohādayo ca bāhirā.
The earth element by characteristic is what is spoken of in such passages as: "Whatever internally, personally, is hardness, rigidity." The earth element with its components is what is spoken of in such passages as: "Should one dig the earth or cause it to be dug." And this also includes the twenty parts such as head hair, and external things such as iron and copper.
“Đào đất hoặc sai người đào đất” (Pāci. 85) v.v., được nói đến là địa đại có các thành phần. Đó là hai mươi thành phần như tóc, lông, v.v., và các thành phần bên ngoài như sắt, thép, v.v.
Sā hi vaṇṇādīhi sambhārehi saddhiṃ pathavīti sasambhārapathavī.
For that, along with its components such as color, is 'earth', thus it is 'earth with its components'.
Vì nó là đất cùng với các thành phần như màu sắc, v.v., nên nó là địa đại có các thành phần.
‘‘Pathavīkasiṇameko sañjānātī’’tiādīsu (dī. ni. 3.360) āgatā pana ārammaṇapathavī, nimittapathavītipi vuccati.
But that which appears in texts such as, "One perceives the earth kasina"—this is earth as an object; it is also called earth as a sign.
Còn “Một người nhận biết địa đại biến xứ” (Dī. Ni. 3.360) v.v., được nói đến là địa đại là đối tượng, cũng được gọi là địa đại tướng.
Pathavīkasiṇajjhānalābhī devaloke nibbatto āgamanavasena pathavīdevatāti nāmaṃ labhati.
One who has obtained the earth-kasina jhāna, having been reborn in a deva-world, receives the name 'earth-deity' by way of arrival.
Người đạt được thiền địa đại biến xứ, tái sinh ở cõi trời, theo cách đến, được gọi là địa đại thiên nữ.
Ayaṃ sammutipathavīti veditabbā.
This should be known as earth by convention.
Đây được hiểu là địa đại theo quy ước.
Sā sabbāpi idha labbhati.
All of these are applicable here.
Tất cả những điều này đều được chấp nhận ở đây.
Tāsu yaṃkañci pathaviṃ ayaṃ puthujjano pathavito sañjānāti, pathavīti sañjānāti, pathavībhāgena sañjānāti, lokavohāraṃ gahetvā saññāvipallāsena sañjānāti pathavīti.
Among these, this worldling perceives any kind of earth as earth; he perceives it as 'earth'; he perceives it by way of the earth-aspect; based on worldly convention, he perceives with a perversion of perception that it is 'earth'.
Trong số đó, bất kỳ loại đất nào mà phàm phu này nhận biết là đất, nhận biết là đất, nhận biết theo phần của đất, nhận biết là đất do sự sai lầm trong nhận thức khi chấp nhận cách dùng thông thường của thế gian.
Evaṃ pathavībhāgaṃ amuñcantoyeva vā etaṃ ‘‘sattoti vā sattassā’’ti vā ādinā nayena sañjānāti.
Or, while not abandoning the earth-aspect, he perceives it in a way such as 'it is a being' or 'it belongs to a being'.
Hoặc người này nhận biết điều này theo cách “là chúng sinh hoặc của chúng sinh” v.v., mà không bỏ đi phần của đất.
Kasmā evaṃ sañjānātīti na vattabbaṃ.
It should not be asked why he perceives thus.
Không nên hỏi vì sao lại nhận biết như vậy.
Ummattako viya hi puthujjano.
For a worldling is like a madman.
Vì phàm phu giống như người điên.
So yaṃkiñci yena kenaci ākārena gaṇhāti.
He grasps anything in any way whatsoever.
Người đó chấp thủ bất cứ điều gì bằng bất cứ cách nào.
Ariyānaṃ adassāvitādibhedameva vā ettha kāraṇaṃ.
Or, the very fact of not having seen the Noble Ones, and so on, is the reason here.
Hoặc nguyên nhân ở đây là sự không thấy các bậc Thánh, v.v.
Yaṃ vā parato ‘‘apariññātaṃ tassā’’ti vadantena bhagavatāva vuttaṃ.
Or, it is what was stated by the Blessed One himself when he said later, "It is not fully understood by him."
Hoặc nguyên nhân đó đã được Thế Tôn nói sau rằng: “Nó không được biết đến.”
Pathaviṃ pathavito saññatvāti so taṃ pathaviṃ evaṃ viparītasaññāya sañjānitvā, ‘‘saññānidānā hi papañcasaṅkhā’’ti (su. ni. 880) vacanato aparabhāge thāmapattehi taṇhāmānadiṭṭhipapañcehi idha maññanānāmena vuttehi maññati kappeti vikappeti, nānappakārato aññathā gaṇhāti.
Having perceived earth as earth: Having perceived that earth with such a distorted perception, because of the saying, "Proliferating concepts have perception as their source," in the latter part he conceives, imagines, and variously conceptualizes with the proliferations of craving, conceit, and wrong views—which have gained strength and are here called ‘conceivings’—he grasps it otherwise in various ways.
Nhận thức đất là đất – người ấy nhận thức đất đó bằng nhận thức sai lầm như vậy, rồi, theo lời dạy “Các pháp hý luận có nhân là tưởng” (Su. Ni. 880), về sau, với các pháp hý luận tham ái, kiêu mạn, tà kiến đã trở nên mạnh mẽ, được gọi ở đây bằng tên nhận thức, người ấy nhận thức, suy nghĩ, suy nghĩ đủ loại, chấp thủ một cách khác biệt theo nhiều cách.
Tena vuttaṃ ‘‘pathaviṃ maññatī’’ti.
Therefore it is said, "he conceives earth."
Vì thế, đã nói rằng “nhận thức đất”.
Evaṃ maññato cassa tā maññanā oḷārikanayena dassetuṃ ‘‘yā ayaṃ kesā lomā’’tiādinā nayena vīsatibhedā ajjhattikā pathavī vuttā.
In order to show those conceivings of one who thus conceives, in a gross manner, the twenty-fold internal earth element has been stated in the way beginning, "which is the hair of the head, body hair."
Để chỉ ra các nhận thức đó của người nhận thức như vậy một cách thô thiển, đã nói đến đất nội phần có hai mươi loại, theo cách “tóc, lông, v.v.”.
Yā cāyaṃ vibhaṅge ‘‘tattha katamā bāhirā pathavīdhātu?
And that which in the Vibhaṅga is stated as: "Therein, which is the external earth element?
Và đất ngoại phần đã được nói trong phân tích (Vibhaṅga) như sau: “Ở đó, thế nào là địa đại ngoại phần?
Yaṃ bāhiraṃ kakkhaḷaṃ kharigataṃ kakkhaḷattaṃ kakkhaḷabhāvo bahiddhā anupādinnaṃ.
That which is external, hard, solidified, hardness, the state of hardness, external, not taken as one's own.
Là cái gì cứng, thô, tính cứng, trạng thái cứng bên ngoài không bị chấp thủ.
Seyyathidaṃ, ayo lohaṃ tipu sīsaṃ sajjhaṃ muttā maṇi veḷuriyaṃ saṅkho silā pavāḷaṃ rajataṃ jātarūpaṃ lohitaṅko masāragallaṃ tiṇaṃ kaṭṭhaṃ sakkharā kaṭhalaṃ bhūmi pāsāṇo pabbato’’ti (vibha. 173) evaṃ bāhirā pathavī vuttā.
That is: iron, copper, tin, lead, silver, pearl, gem, beryl, conch, stone, coral, silver, gold, ruby, garnet, grass, wood, gravel, potsherd, earth, rock, mountain." Thus the external earth element is stated.
Ví dụ như: sắt, đồng, thiếc, chì, bạc, ngọc trai, ngọc, lưu ly, ốc xà cừ, đá, san hô, vàng, kim cương, mã não, cỏ, gỗ, sỏi, gạch vụn, đất, đá tảng, núi” (Vibha. 173).
Yā ca ajjhattārammaṇattike nimittapathavī, taṃ gahetvā ayamatthayojanā vuccati.
And taking the sign of earth in the triad of internal objects, this application of meaning is stated.
Và nhận thức này được áp dụng bằng cách lấy đất nimitta (tướng) được nói trong bộ ba về cảnh nội phần.
Pathaviṃ maññatīti tīhi maññanāhi ahaṃ pathavīti maññati, mama pathavīti maññati, paro pathavīti maññati, parassa pathavīti maññati, atha vā ajjhattikaṃ pathaviṃ taṇhāmaññanāya maññati, mānamaññanāya maññati, diṭṭhimaññanāya maññati.
He conceives earth: He conceives with three kinds of conceiving: he conceives "I am earth," he conceives "earth is mine," he conceives "another is earth," he conceives "earth belongs to another." Or else, he conceives the internal earth element with the conceiving of craving, he conceives with the conceiving of conceit, he conceives with the conceiving of wrong views.
Nhận thức đất – người ấy nhận thức “ta là đất”, “đất là của ta”, “người khác là đất”, “đất là của người khác” bằng ba loại nhận thức. Hoặc người ấy nhận thức đất nội phần bằng nhận thức tham ái, nhận thức kiêu mạn, nhận thức tà kiến.
Ayañhi kesādīsu chandarāgaṃ janeti kese assādeti abhinandati abhivadati ajjhosāya tiṭṭhati.
This person generates desire and passion for hair of the head, etc.; he delights in, rejoices in, speaks about, and clings tenaciously to the hair of the head.
Người này sinh ra tham ái đối với tóc, v.v., thưởng thức tóc, hoan hỷ, tán thán, sống với sự chấp thủ.
Lome, nakhe, dante, tacaṃ, aññataraṃ vā pana rajjanīyavatthuṃ.
Or to body hair, nails, teeth, skin, or some other desirable object.
Đối với lông, móng, răng, da, hoặc bất kỳ vật gì đáng tham luyến khác.
Evaṃ ajjhattikaṃ pathaviṃ taṇhāmaññanāya maññati.
Thus he conceives the internal earth element with the conceiving of craving.
Như vậy, người ấy nhận thức đất nội phần bằng nhận thức tham ái.
Iti me kesā siyuṃ anāgatamaddhānaṃ.
"May my hair be like this in the future."
“Tóc của ta sẽ như thế này trong tương lai.”
Iti lomātiādinā vā pana nayena tattha nandiṃ samannāneti.
Or, in the way beginning "May my body hair be like this," he brings forth delight in it.
Hoặc người ấy tìm thấy sự hoan hỷ ở đó theo cách “lông, v.v.”.
‘‘Imināhaṃ sīlena vā…pe… brahmacariyena vā evaṃ siniddhamudusukhumanīlakeso bhavissāmī’’tiādinā vā pana nayena appaṭiladdhānaṃ paṭilābhāya cittaṃ paṇidahati.
Or, in the way beginning, "By this virtue or… holy life, may I have such smooth, soft, fine, black hair," he directs his mind to the attainment of what has not yet been attained.
Hoặc người ấy hướng tâm đến việc đạt được những gì chưa có, theo cách “Với giới này… hoặc với phạm hạnh này, ta sẽ có mái tóc mềm mại, mượt mà, đen nhánh như vậy,” v.v.
Evampi ajjhattikaṃ pathaviṃ taṇhāmaññanāya maññati.
In this way, too, he conceives the internal earth element with the conceiving of craving.
Như vậy, người ấy cũng nhận thức đất nội phần bằng nhận thức tham ái.
Tathā attano kesādīnaṃ sampattiṃ vā vipattiṃ vā nissāya mānaṃ janeti, ‘‘seyyohamasmīti vā sadisohamasmīti vā hīnohamasmīti vā’’ti.
Likewise, based on the perfection or imperfection of his own hair, etc., he generates conceit, thinking, "I am superior," or "I am equal," or "I am inferior."
Tương tự, người ấy sinh ra kiêu mạn dựa trên sự thành công hay thất bại của tóc, v.v. của mình, “ta hơn người”, “ta bằng người”, hoặc “ta kém người”.
Evaṃ ajjhattikaṃ pathaviṃ mānamaññanāya maññati.
Thus he conceives the internal earth element with the conceiving of conceit.
Như vậy, người ấy nhận thức đất nội phần bằng nhận thức kiêu mạn.
‘‘Taṃ jīvaṃ taṃ sarīra’’nti (ma. ni. 2.187) āgatanayena pana kesaṃ ‘‘jīvo’’ti abhinivisati.
In the way that has come down as, "What is soul, that is the body," he resolves that the hair is "soul."
Theo cách được nói trong kinh “Cái đó là sinh mạng, cái đó là thân” (Ma. Ni. 2.187), người ấy chấp thủ tóc là “sinh mạng”.
Esa nayo lomādīsu.
This method applies to body hair and so on.
Cách này cũng áp dụng cho lông, v.v.
Evaṃ ajjhattikaṃ pathaviṃ diṭṭhimaññanāya maññati.
Thus he conceives the internal earth element with the conceiving of wrong views.
Như vậy, người ấy nhận thức đất nội phần bằng nhận thức tà kiến.
Atha vā ‘‘yā ceva kho panāvuso, ajjhattikā pathavīdhātu, yā ca bāhirā pathavīdhātu, pathavīdhāturevesā, taṃ netaṃ mamā’’ti (ma. ni. 1.302) imissā pavattiyā paccanīkanayena kesādibhedaṃ pathaviṃ etaṃ mama esohamasmi eso me attāti abhinivisati.
Or else, in a way contrary to the process, "Venerable sir, both the internal earth element and the external earth element are just the earth element. That is not mine," he resolves about the earth element, which is differentiated as hair of the head, etc., that "This is mine, this I am, this is my self."
Hoặc, theo cách đối nghịch với sự diễn tiến này, “Này các hiền giả, địa đại nội phần và địa đại ngoại phần, đó chỉ là địa đại, nó không phải của tôi” (Ma. Ni. 1.302), người ấy chấp thủ đất có các loại như tóc, v.v. là “cái này là của tôi, cái này là tôi, cái này là tự ngã của tôi”.
Evampi ajjhattikaṃ pathaviṃ diṭṭhimaññanāya maññati.
In this way, too, he conceives the internal earth element with the conceiving of wrong views.
Như vậy, người ấy cũng nhận thức đất nội phần bằng nhận thức tà kiến.
Evaṃ tāva ajjhattikaṃ pathaviṃ tīhi maññanāhi maññati.
Thus, for a start, he conceives the internal earth element with the three kinds of conceiving.
Như vậy, trước hết, người ấy nhận thức đất nội phần bằng ba loại nhận thức.
Yathā ca ajjhattikaṃ evaṃ bāhirampi.
And just as with the internal, so it is with the external.
Cũng như nội phần, ngoại phần cũng vậy.
‘‘Ayañhi ayalohādīsu chandarāgaṃ janeti.
This person generates desire and passion for iron, copper, etc.
“Người này sinh ra tham ái đối với sắt, đồng, v.v.
Ayalohādīni assādeti abhinandati abhivadati ajjhosāya tiṭṭhati.
He delights in, rejoices in, speaks about, and clings tenaciously to iron, copper, etc.
Thưởng thức sắt, đồng, v.v., hoan hỷ, tán thán, sống với sự chấp thủ.
Mama ayo mama lohantiādinā nayena ayādīni mamāyati rakkhati gopayati, evaṃ bāhiraṃ pathaviṃ taṇhāmaññanāya maññati.
By the method of "my iron, my copper," and so on, he regards iron, etc., as his own, he protects it, he guards it. Thus he conceives the external earth element with the conceiving of craving.
Người ấy sở hữu sắt, đồng, v.v. theo cách ‘sắt của ta, đồng của ta’, giữ gìn, bảo vệ. Như vậy, người ấy nhận thức đất ngoại phần bằng nhận thức tham ái.
Iti me ayalohādayo siyuṃ anāgatamaddhānanti vā panettha nandiṃ samannāneti, imināhaṃ sīlena vā vatena vā tapena vā brahmacariyena vā evaṃ sampannaayalohādiupakaraṇo bhavissāmī’’ti appaṭiladdhassa paṭilābhāya cittaṃ paṇidahati.
Or he brings forth delight in it thinking, "May I have such iron, copper, etc., in the future," and he directs his mind to the attainment of what has not yet been attained, thinking, "By this virtue, or observance, or austerity, or holy life, may I be one who has such perfect equipment of iron, copper, etc."
Hoặc người ấy tìm thấy sự hoan hỷ ở đó theo cách ‘sắt, đồng, v.v. của ta sẽ như thế này trong tương lai’, người ấy hướng tâm đến việc đạt được những gì chưa có, theo cách ‘Với giới này, hoặc với hạnh này, hoặc với khổ hạnh này, hoặc với phạm hạnh này, ta sẽ có các vật dụng như sắt, đồng, v.v. được đầy đủ như vậy’.”
Evampi bāhiraṃ pathaviṃ taṇhāmaññanāya maññati.
In this way, too, he conceives the external earth element with the conceiving of craving.
Như vậy, người ấy cũng nhận thức đất ngoại phần bằng nhận thức tham ái.
Tathā attano ayalohādīnaṃ sampattiṃ vā vipattiṃ vā nissāya mānaṃ janeti ‘‘imināhaṃ seyyosmīti vā, sadisosmīti vā hīnosmīti vā’’ti (vibha. 832) evaṃ bāhiraṃ pathaviṃ mānamaññanāya maññati.
Likewise, based on the perfection or imperfection of his own iron, copper, etc., he generates conceit, "By this I am superior, or equal, or inferior." Thus he conceives the external earth element with the conceiving of conceit.
Tương tự, người ấy sinh ra kiêu mạn dựa trên sự thành công hay thất bại của sắt, đồng, v.v. của mình, “ta hơn người này, hoặc ta bằng người này, hoặc ta kém người này” (Vibha. 832). Như vậy, người ấy nhận thức đất ngoại phần bằng nhận thức kiêu mạn.
Aye jīvasaññī hutvā pana ayaṃ ‘‘jīvo’’ti abhinivisati.
Having a perception of a living being in iron, he resolves that iron is "a living being."
Tuy nhiên, khi nhận thức về sinh mạng trong sắt, người ấy chấp thủ “cái này là sinh mạng”.
Esa nayo lohādīsu.
This is the method for copper and so on.
Cách này cũng áp dụng cho đồng, v.v.
Evaṃ bāhiraṃ pathaviṃ diṭṭhimaññanāya maññati.
Thus he conceives the external earth element with the conceiving of wrong views.
Như vậy, người ấy nhận thức đất ngoại phần bằng nhận thức tà kiến.
Atha vā ‘‘idhekacco pathavīkasiṇaṃ attato samanupassati.
Or else, in the very way stated in the Paṭisambhidāmagga, "Here, someone regards the earth kasiṇa as self.
Hoặc, “Ở đây, một số người quán sát địa biến xứ là tự ngã.
Yaṃ pathavīkasiṇaṃ, so ahaṃ.
‘What the earth kasiṇa is, that I am.
Địa biến xứ là ta.
Yo ahaṃ, taṃ pathavīkasiṇanti pathavīkasiṇañca attañca advayaṃ samanupassatī’’ti (paṭi. ma. 1.131) paṭisambhidāyaṃ vuttanayeneva nimittapathaviṃ ‘‘attā’’ti abhinivisati.
What I am, that is the earth kasiṇa.’ Thus he regards the earth kasiṇa and the self as non-dual," he resolves that the sign of earth is "self."
Ta là địa biến xứ. Người ấy quán sát địa biến xứ và tự ngã là không hai” (Paṭi. Ma. 1.131). Theo cách đã nói trong Paṭisambhidā, người ấy chấp thủ đất nimitta là “tự ngã”.
Evaṃ bāhiraṃ pathaviṃ diṭṭhimaññanāya maññati.
Thus he conceives the external earth element with the conceiving of wrong views.
Như vậy, người ấy nhận thức đất ngoại phần bằng nhận thức tà kiến.
Evampi bāhiraṃ pathaviṃ tīhi maññanāhi maññati.
In this way too, he conceives the external earth element with the three kinds of conceiving.
Như vậy, người ấy cũng nhận thức đất ngoại phần bằng ba loại nhận thức.
Evaṃ tāva ‘‘pathaviṃ maññatī’’ti ettha tissopi maññanā veditabbā.
Thus, for a start, in "he conceives earth," all three conceivings should be understood.
Như vậy, trước hết, ba loại nhận thức cần được biết ở đây trong “nhận thức đất”.
Ito paraṃ saṅkhepeneva kathayissāma.
Hereafter, we will speak only in brief.
Từ đây trở đi, chúng ta sẽ nói tóm tắt.
Atha vā yvāyaṃ ‘‘kathaṃ rūpasmiṃ attānaṃ samanupassati?
Or else, "How does one regard the self in form?
Hoặc, ý nghĩa đã được nói về điều này: “Làm thế nào người ấy quán sát tự ngã trong sắc?
Idhekacco vedanaṃ… saññaṃ… saṅkhāre… viññāṇaṃ attato samanupassati, tassa evaṃ hoti, ayaṃ kho me attā, so kho pana me attā imasmiṃ rūpeti evaṃ rūpasmiṃ vā attānaṃ samanupassatī’’ti (paṭi. ma. 1.131) etassa atthanayo vutto, eteneva nayena vedanādidhamme attato gahetvā tato ajjhattikabāhirāsu pathavīsu yaṃkiñci pathaviṃ tassokāsabhāvena parikappetvā so kho pana me ayaṃ attā imissā pathaviyāti maññanto pathaviyā maññati, ayamassa diṭṭhimaññanā.
Here, someone regards feeling… perception… formations… consciousness as self. It occurs to him, 'This indeed is my self, and that self of mine is in this form.' Thus he regards the self in form"—by this very method, having taken mental phenomena such as feeling as self, and then having imagined any kind of earth among the internal and external earth elements as its location, one who conceives, 'That self of mine is in this earth,' conceives 'in earth.' This is his conceiving through wrong views.
Ở đây, một số người quán sát thọ… tưởng… hành… thức là tự ngã. Người ấy có suy nghĩ như vậy: ‘Đây là tự ngã của ta, và tự ngã đó của ta ở trong sắc này’. Như vậy, người ấy quán sát tự ngã trong sắc.” (Paṭi. Ma. 1.131). Theo cách này, sau khi chấp thủ các pháp như thọ, v.v. là tự ngã, rồi tưởng tượng bất kỳ loại đất nào trong đất nội phần và ngoại phần là nơi chốn của tự ngã đó, người ấy nhận thức “tự ngã đó của ta ở trong đất này”. Đây là nhận thức tà kiến của người ấy.
Tasmiṃyeva panassa attani sinehaṃ tabbatthukañca mānaṃ uppādayato taṇhāmānamaññanāpi veditabbā.
The conceivings of craving and conceit should be understood for him who generates affection for that very self and conceit based on it.
Và nhận thức tham ái và kiêu mạn cũng cần được biết, khi người ấy sinh ra sự yêu thích đối với tự ngã đó và kiêu mạn có căn cứ vào tự ngã đó.
Yadā pana teneva nayena so kho panassa attā pathaviyāti maññati, tadā diṭṭhimaññanā eva yujjati.
But when, by that same method, he conceives 'that self of his is in the earth,' then only the conceiving of wrong views is fitting.
Tuy nhiên, khi người ấy nhận thức “tự ngã đó của người khác ở trong đất” theo cùng một cách, thì chỉ có nhận thức tà kiến là phù hợp.
Itarāyopi pana icchanti.
But others desire the other two as well.
Nhưng các vị thầy khác cũng chấp nhận những loại nhận thức còn lại.
Pathavito maññatīti ettha pana pathavitoti nissakkavacanaṃ.
In the phrase conceives from earth, the word from earth is in the ablative case, indicating separation.
Trong nhận thức từ đất, từ từ đất là cách nói ở xuất xứ.
Tasmā saupakaraṇassa attano vā parassa vā yathāvuttappabhedato pathavito uppattiṃ vā niggamanaṃ vā pathavito vā añño attāti maññamāno pathavito maññatīti veditabbo, ayamassa diṭṭhimaññanā.
Therefore, one who conceives of the origin or departure of oneself or another with their belongings from the earth as afore-described, or conceives that the self is other than the earth, should be understood as conceiving 'from earth.' This is his conceiving through wrong views.
Vì vậy, người ấy cần được hiểu là nhận thức từ đất, khi người ấy nhận thức sự phát sinh hay xuất phát của tự ngã hoặc của người khác với các vật dụng theo các loại đã nói là từ đất, hoặc nhận thức rằng có một tự ngã khác biệt với đất. Đây là nhận thức tà kiến của người ấy.
Tasmiṃyeva panassa diṭṭhimaññanāya maññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmānamaññanāpi veditabbā.
Furthermore, for one who, in that very object conceived through the conceiving of view, gives rise to affection and conceit, the conceivings of craving and conceit should also be understood.
Và trong chính đối tượng mà người đó nhận thức bằng tà kiến, khi ái dục và kiêu mạn phát sinh, thì sự nhận thức do ái dục và kiêu mạn (taṇhāmānamaññanā) cũng cần phải được hiểu.
Apare āhu pathavīkasiṇaṃ parittaṃ bhāvetvā tato aññaṃ appamāṇaṃ attānaṃ gahetvā pathavito bahiddhāpi me attāti maññamāno pathavito maññatīti.
Others say: having developed the limited earth kasiṇa, and then taking another, immeasurable self, one who conceives "my self is also outside the earth" conceives from earth.
Những người khác nói rằng, sau khi tu tập một địa biến xứ (pathavīkasiṇa) nhỏ, rồi lấy một tự ngã vô lượng khác từ đó, và nhận thức rằng ‘tự ngã của tôi cũng ở bên ngoài đất’, thì người đó nhận thức từ đất.
Pathaviṃ abhinandatīti vuttappakārameva pathaviṃ taṇhādīhi abhinandati, assādeti, parāmasati cāti vuttaṃ hoti.
“One delights in earth” means that one delights in, savors, and grasps the earth in the aforesaid manner with craving and so on.
“Hoan hỷ đất” (Pathaviṃ abhinandatī) có nghĩa là người đó hoan hỷ, nếm trải, và chấp thủ đất bằng ái dục, v.v., theo cách đã được nói.
‘‘Pathaviṃ maññatī’’ti eteneva etasmiṃ atthe siddhe kasmā etaṃ vuttanti ce.
If it is asked, "Since this meaning is already established by 'one conceives earth,' why is this stated?"
Nếu nói rằng: “Với ý nghĩa này đã được thiết lập bởi ‘nhận thức đất’, tại sao điều này lại được nói đến?”
Avicāritametaṃ porāṇehi.
This was not considered by the ancients.
Điều này không được các vị cổ đức xem xét.
Ayaṃ pana attano mati, desanāvilāsato vā ādīnavadassanato vā.
But this is one's own opinion: it is due to the elegance of the teaching or to show the danger.
Tuy nhiên, đây là ý kiến của riêng tôi, hoặc là do sự đa dạng trong cách giảng dạy, hoặc là do sự thấy rõ mối nguy hiểm.
Yassā hi dhammadhātuyā suppaṭividdhattā nānānayavicitradesanāvilāsasampanno, ayaṃ sā bhagavatā suppaṭividdhā.
For, by the thorough penetration of a certain Dhamma-element, one is endowed with the elegant style of a teaching that is varied with numerous methods; this has been thoroughly penetrated by the Blessed One.
Vì Pháp giới (dhammadhātu) mà Đức Phật đã thấu triệt hoàn toàn, nên Ngài có khả năng giảng dạy đa dạng và phong phú.
Tasmā pubbe maññanāvasena kilesuppattiṃ dassetvā idāni abhinandanāvasena dassento desanāvilāsato vā idamāha.
Therefore, having previously shown the arising of defilements by way of conceiving, He now says this either due to the elegance of the teaching, showing it by way of delighting,
Vì vậy, trước tiên, Đức Phật đã chỉ ra sự phát sinh phiền não dưới dạng nhận thức, và bây giờ Ngài nói điều này dưới dạng hoan hỷ, hoặc là do sự đa dạng trong cách giảng dạy.
Yo vā pathaviṃ maññati, pathaviyā maññati, pathavito maññati, pathaviṃ meti maññati, so yasmā na sakkoti pathavīnissitaṃ taṇhaṃ vā diṭṭhiṃ vā pahātuṃ, tasmā pathaviṃ abhinandatiyeva.
or, whoever conceives earth, conceives in earth, conceives from earth, conceives 'earth is mine,' because he is unable to abandon the craving or view dependent on earth, he therefore delights in earth.
Hoặc là, người nào nhận thức đất, nhận thức trong đất, nhận thức từ đất, nhận thức đất là của tôi, người đó không thể từ bỏ ái dục hay tà kiến dựa vào đất, do đó người đó hoan hỷ đất.
Yo ca pathaviṃ abhinandati, dukkhaṃ so abhinandati, dukkhañca ādīnavoti ādīnavadassanatopi idamāha.
And whoever delights in earth, delights in suffering, and suffering is a danger; thus, He also said this to show the danger.
Và người nào hoan hỷ đất, người đó hoan hỷ khổ. Khổ là mối nguy hiểm. Ngài cũng nói điều này từ góc độ thấy rõ mối nguy hiểm.
Vuttañcetaṃ bhagavatā ‘‘yo, bhikkhave, pathavīdhātuṃ abhinandati, dukkhaṃ so abhinandati, yo dukkhaṃ abhinandati, aparimutto so dukkhasmāti vadāmī’’ti.
And this has been stated by the Blessed One: "Bhikkhus, whoever delights in the earth element, he delights in suffering. Whoever delights in suffering is not freed from suffering, I say."
Và Đức Thế Tôn đã nói điều này: “Này các Tỳ-khưu, người nào hoan hỷ địa đại, người đó hoan hỷ khổ. Người nào hoan hỷ khổ, Ta nói rằng người đó chưa thoát khỏi khổ.”
Evaṃ pathavīvatthukaṃ maññanaṃ abhinandanañca vatvā idāni yena kāraṇena so maññati, abhinandati ca, taṃ kāraṇaṃ āvikaronto āha taṃ kissa hetu, apariññātaṃ tassāti vadāmīti.
Having thus spoken of conceiving and delighting with earth as their object, now, revealing the reason why one conceives and delights, He said: “What is the reason for that? It is uncomprehended by him, I say.”
Sau khi nói về sự nhận thức và sự hoan hỷ liên quan đến đất, bây giờ Đức Phật nói về nguyên nhân mà người đó nhận thức và hoan hỷ, bằng cách tuyên bố: “Vì sao lại thế? Ta nói rằng điều đó chưa được người ấy thấu triệt.”
Tassattho, so puthujjano taṃ pathaviṃ kissa hetu maññati, kena kāraṇena maññati, abhinandatīti ce.
Its meaning is: If it is asked, "For what reason does that ordinary person conceive that earth? For what cause does he conceive and delight in it?"
Ý nghĩa của câu đó là: “Nếu hỏi tại sao phàm phu đó lại nhận thức và hoan hỷ đất, nguyên nhân là gì?”
Apariññātaṃ tassāti vadāmīti, yasmā taṃ vatthu tassa apariññātaṃ, tasmāti vuttaṃ hoti.
"It is uncomprehended by him, I say," means: because that object is uncomprehended by him, therefore it is so stated.
Thì câu trả lời là: “Ta nói rằng điều đó chưa được người ấy thấu triệt.” Nghĩa là, vì đối tượng đó chưa được người ấy thấu triệt, nên mới như vậy.
Yo hi pathaviṃ parijānāti, so tīhi pariññāhi parijānāti ñātapariññāya tīraṇapariññāya pahānapariññāyāti.
For one who fully comprehends earth does so with three kinds of full comprehension: ñāta-pariññā, tīraṇa-pariññā, and pahāna-pariññā.
Người nào thấu triệt đất, người đó thấu triệt bằng ba sự thấu triệt: thấu triệt bằng tri thức (ñātapariññā), thấu triệt bằng sự xem xét (tīraṇapariññā), và thấu triệt bằng sự đoạn trừ (pahānapariññā).
Tattha katamā ñātapariññā.
Therein, what is ñāta-pariññā?
Trong đó, thế nào là thấu triệt bằng tri thức?
Pathavīdhātuṃ parijānāti, ayaṃ pathavīdhātu ajjhattikā, ayaṃ bāhirā, idamassā lakkhaṇaṃ, imāni rasapaccupaṭṭhānapadaṭṭhānānīti, ayaṃ ñātapariññā. Katamā tīraṇapariññā?
One fully comprehends the earth element thus: "This earth element is internal, this is external, this is its characteristic, these are its function, manifestation, and proximate cause." This is ñāta-pariññā. What is tīraṇa-pariññā?
Thấu triệt địa đại, rằng “đây là địa đại nội tại, đây là địa đại bên ngoài, đây là đặc tính của nó, đây là vị, sự biểu hiện và nhân gần của nó”, đây là thấu triệt bằng tri thức. Thế nào là thấu triệt bằng sự xem xét? Sau khi biết như vậy, người đó xem xét địa đại là vô thường, khổ, bệnh, v.v., theo bốn mươi hai khía cạnh, đây là thấu triệt bằng sự xem xét. Thế nào là thấu triệt bằng sự đoạn trừ?
Evaṃ ñātaṃ katvā pathavīdhātuṃ tīreti aniccato dukkhato rogatoti dvācattālīsāya ākārehi, ayaṃ tīraṇapariññā. Katamā pahānapariññā?
Having thus known it, one judges the earth element as impermanent, as suffering, as disease, in forty-two ways. This is tīraṇa-pariññā. What is pahāna-pariññā?
Sau khi xem xét như vậy, người đó đoạn trừ tham ái (chandarāga) đối với địa đại bằng Thánh Đạo tối thượng, đây là thấu triệt bằng sự đoạn trừ.
Evaṃ tīrayitvā aggamaggena pathavīdhātuyā chandarāgaṃ pajahati, ayaṃ pahānapariññā.
Having thus judged it, one abandons lustful desire for the earth element with the highest path. This is pahāna-pariññā.
Sau khi đã thẩm định như vậy, bằng con đường tối thượng, vị ấy đoạn trừ tham ái đối với địa đại. Đây là đoạn trừ liễu tri (Pahānapariññā).
Nāmarūpavavatthānaṃ vā ñātapariññā.
Or, the determination of mentality-materiality is ñāta-pariññā.
Hoặc là, sự phân biệt danh sắc là thấu triệt bằng tri thức.
Kalāpasammasanādianulomapariyosānā tīraṇapariññā.
That which begins with the comprehension of groups and culminates in conformity knowledge is tīraṇa-pariññā.
Sự xem xét theo từng nhóm (kalāpasammasana) và các trí thuận thứ (anuloma) là thấu triệt bằng sự xem xét.
Ariyamagge ñāṇaṃ pahānapariññāti.
The knowledge in the noble path is pahāna-pariññā.
Trí tuệ trong Thánh Đạo là thấu triệt bằng sự đoạn trừ.
Yo pathaviṃ parijānāti, so imāhi tīhi pariññāhi parijānāti, assa ca puthujjanassa tā pariññāyo natthi, tasmā apariññātattā pathaviṃ maññati ca abhinandati cāti.
Whoever fully comprehends earth does so with these three kinds of full comprehension. But for this ordinary person, those comprehensions do not exist; therefore, due to it being uncomprehended, he conceives and delights in earth.
Người nào thấu triệt đất, người đó thấu triệt bằng ba sự thấu triệt này. Còn phàm phu đó không có những sự thấu triệt ấy, do đó, vì chưa thấu triệt, người đó nhận thức và hoan hỷ đất.
Tenāha bhagavā – idha, bhikkhave, assutavā puthujjano…pe… pathaviṃ maññati, pathaviyā maññati, pathavito maññati, pathaviṃ meti maññati, pathaviṃ abhinandati.
Therefore, the Blessed One said: "Here, bhikkhus, an uninstructed ordinary person... conceives earth, conceives in earth, conceives from earth, conceives 'earth is mine,' and delights in earth.
Vì vậy, Đức Thế Tôn đã nói: “Ở đây, này các Tỳ-khưu, phàm phu không được nghe… v.v… nhận thức đất, nhận thức trong đất, nhận thức từ đất, nhận thức đất là của tôi, hoan hỷ đất.
Taṃ kissa hetu?
What is the reason for that?
Vì sao lại thế?
Apariññātaṃ tassāti vadāmī’’ti.
It is uncomprehended by him, I say."
Ta nói rằng điều đó chưa được người ấy thấu triệt.”
Āpaṃ āpatoti etthāpi lakkhaṇasasambhārārammaṇasammutivasena catubbidho āpo.
In “water as water”, too, water is fourfold: by way of characteristic, by way of its composite form, by way of object, and by way of convention.
Trong câu “nước từ nước” (āpaṃ āpato), thủy đại cũng có bốn loại theo đặc tính, cấu thành, đối tượng và quy ước.
Tesu ‘‘tattha, katamā ajjhattikā āpodhātu.
Among these, what is stated in passages such as "Therein, what is the internal water element? That which is internal, personal, which is water, watery, cohesion, the cohesive nature of matter, internal, taken up," is the water of characteristic. What is stated in passages such as "One learning the water kasiṇa takes up the sign in water," is the water of composite form. Everything else is just as stated in the section on earth.
Trong số đó, thủy đại được nói đến trong các câu như: “Trong đó, thế nào là thủy đại nội tại?
Yaṃ ajjhattaṃ paccattaṃ āpo āpogataṃ, sineho sinehagataṃ bandhanattaṃ rūpassa ajjhattaṃ upādinna’’ntiādīsu (vibha. 174) vutto lakkhaṇaāpo. ‘‘Āpokasiṇaṃ uggaṇhanto āpasmiṃ nimittaṃ gaṇhātī’’tiādīsu vutto sasambhārāpo. Sesaṃ sabbaṃ pathaviyaṃ vuttasadisameva.
The water element by characteristic is what is spoken of in such passages as: "Whatever internally, personally, is water, the watery element, moisture, the moist element, the binding quality of material form, internally, appropriated." The water element with its components is what is spoken of in such passages as: "When undertaking the water kasina, one apprehends the sign in water." The rest is all just like what was said for the earth element.
Cái gì là nước, thuộc về nước, là chất lỏng, thuộc về chất lỏng, là sự kết dính của sắc pháp nội tại, đã được chấp thủ”, v.v., là thủy đại theo đặc tính (lakkhaṇaāpo). Thủy đại được nói đến trong các câu như: “Người tu tập thủy biến xứ (āpokasiṇa) nắm bắt tướng (nimitta) trong nước”, v.v., là thủy đại theo cấu thành (sasambhārāpo). Tất cả những phần còn lại đều tương tự như đã nói về địa đại.
Kevalaṃ yojanānaye pana ‘‘pittaṃ semha’’ntiādinā nayena vuttā dvādasabhedā ajjhattikā āpodhātu, ‘‘tattha, katamā bāhirā āpodhātu?
However, in the method of application, the internal water element with its twelve divisions stated in the way beginning with "bile, phlegm" should be known, as well as the external water element stated thus: "Therein, what is the external water element? That which is external, which is water, watery, cohesion, the cohesive nature of matter, external, not taken up.
Chỉ khác ở cách áp dụng, thủy đại nội tại có mười hai loại được nói đến theo cách như “mật, đờm”, v.v. Và thủy đại bên ngoài được nói đến như: “Trong đó, thế nào là thủy đại bên ngoài?
Yaṃ bāhiraṃ āpo āpogataṃ, sineho sinehagataṃ bandhanattaṃ rūpassa bahiddhā anupādinnaṃ.
Whatever externally is water, the watery element, moisture, the moist element, the binding quality of material form, externally, unappropriated.
Cái gì là nước, thuộc về nước, là chất lỏng, thuộc về chất lỏng, là sự kết dính của sắc pháp bên ngoài, không chấp thủ.
Seyyathidaṃ, mūlaraso khandharaso tacaraso pattaraso puppharaso phalaraso khīraṃ dadhi sappi navanītaṃ telaṃ madhu phāṇitaṃ bhummāni vā udakāni antalikkhāni vā’’ti (vibha. 174) evaṃ vuttā ca bāhirā āpodhātu veditabbā, yo ca ajjhattārammaṇattike nimittaāpo.
That is to say: root-sap, trunk-sap, bark-sap, leaf-sap, flower-sap, fruit-sap, milk, curds, ghee, fresh butter, oil, honey, molasses, and waters on the earth or in the sky," and the sign of water in the triad of internal objects.
Ví dụ như, nhựa rễ, nhựa thân, nhựa vỏ, nhựa lá, nhựa hoa, nhựa quả, sữa, sữa đông, bơ, bơ tươi, dầu, mật, mật mía, hoặc nước dưới đất, hoặc nước trên trời”, v.v., cần phải được hiểu. Và thủy đại là tướng (nimittaāpo) trong bộ ba đối tượng nội tại.
Tejaṃ tejatoti imasmiṃ tejovārepi vuttanayeneva vitthāro veditabbo.
In this section on fire, “fire as fire”, the detailed explanation should be understood in the same way as stated.
Trong phần hỏa đại này, “lửa từ lửa” (tejaṃ tejato), chi tiết cũng cần được hiểu theo cách đã nói.
Yojanānaye panettha ‘‘yena ca santappati, yena ca jīrīyati, yena ca pariḍayhati, yena ca asitapītakhāyitasāyitaṃ sammā pariṇāmaṃ gacchatī’’ti (vibha. 175) evaṃ vuttā catuppabhedā ajjhattikā tejodhātu.
Here, in the method of application, the internal fire element with its four divisions is stated thus: "that by which one is warmed, that by which one ages, that by which one is burned up, and that by which what is eaten, drunk, chewed, and tasted gets properly digested."
Trong cách áp dụng ở đây, hỏa đại nội tại có bốn loại được nói đến như: “nhờ đó mà được sưởi ấm, nhờ đó mà già đi, nhờ đó mà bị thiêu đốt, và nhờ đó mà thức ăn, đồ uống, đồ nhai, đồ nếm được tiêu hóa đúng cách”, v.v.
‘‘Tattha katamā bāhirā tejodhātu?
"Therein, what is the external fire element?
“Trong đó, thế nào là hỏa đại bên ngoài?
Yaṃ bāhiraṃ tejo tejogataṃ usmā usmāgataṃ usumaṃ usumagataṃ bahiddhā anupādinnaṃ.
That which is external, which is fire, fiery, heat, thermal, warmth, warm, external, not taken up.
Cái gì là lửa, thuộc về lửa, là hơi nóng, thuộc về hơi nóng, là sự ấm áp, thuộc về sự ấm áp, bên ngoài không chấp thủ.
Seyyathidaṃ, kaṭṭhaggi palālaggi tiṇaggi gomayaggi thusaggi saṅkāraggi indaggi aggisantāpo sūriyasantāpo kaṭṭhasannicayasantāpo tiṇasannicayasantāpo dhaññasannicayasantāpo bhaṇḍasannicayasantāpo’’ti (vibha. 175) evaṃ vuttā ca bāhirā tejodhātu veditabbā.
That is to say: a wood fire, a splinter fire, a grass fire, a cow-dung fire, a chaff fire, a rubbish fire, a lightning fire, the heat of fire, the heat of the sun, the heat from a pile of wood, the heat from a pile of grass, the heat from a pile of grain, the heat from a pile of goods," and the external fire element thus stated should be known.
Ví dụ như, lửa củi, lửa rơm, lửa cỏ, lửa phân bò, lửa trấu, lửa rác, lửa sét, hơi nóng từ lửa, hơi nóng từ mặt trời, hơi nóng từ đống củi, hơi nóng từ đống cỏ, hơi nóng từ đống lúa, hơi nóng từ đống hàng hóa”, v.v., hỏa đại bên ngoài được nói đến như vậy cần phải được hiểu.
Vāyaṃ vāyatoti imassa vāyavārassāpi yojanānaye pana ‘‘uddhaṅgamā vātā adhogamā vātā kucchisayā vātā koṭṭhāsayā vātā aṅgamaṅgānusārino vātā satthakavātā khurakavātā uppalakavātā assāso passāso’’ti evaṃ vuttā ajjhattikā vāyodhātu.
For this section on air, “air as air”, in the method of application, the internal air element is stated thus: "upward-going winds, downward-going winds, winds in the belly, winds in the bowels, winds that course through the limbs, dagger-like winds, razor-like winds, expelling winds, in-breaths, and out-breaths."
Trong cách áp dụng của phong đại này, “gió từ gió” (vāyaṃ vāyato), phong đại nội tại được nói đến như: “gió đi lên, gió đi xuống, gió trong bụng, gió trong ruột, gió lưu chuyển khắp các chi, gió dao, gió dao cạo, gió hoa súng, hơi thở vào, hơi thở ra”.
‘‘Tattha katamā bāhirā vāyodhātu?
"Therein, what is the external air element?
“Trong đó, thế nào là phong đại bên ngoài?
Yaṃ bāhiraṃ vāyo vāyogataṃ thambhitattaṃ rūpassa bahiddhā anupādinnaṃ.
That which is external, which is air, airy, the stiffness of matter, external, not taken up.
Cái gì là gió, thuộc về gió, là sự cứng chắc của sắc pháp bên ngoài, không chấp thủ.
Seyyathidaṃ, puratthimā vātā pacchimā vātā uttarā vātā dakkhiṇā vātā sarajā vātā arajā vātā sītā vātā uṇhā vātā parittā vātā adhimattā vātā kāḷavātā verambhavātā pakkhavātā supaṇṇavātā tālavaṇṭavātā vidhūpanavātā’’ti (vibha. 176) evaṃ vuttā ca bāhirā vāyodhātu veditabbā.
That is to say: easterly winds, westerly winds, northerly winds, southerly winds, dusty winds, dust-free winds, cold winds, hot winds, gentle winds, strong winds, the black wind, stormy winds, wing-winds, hawk-winds, palm-fan winds, fanning winds," and the external air element thus stated should be known.
Ví dụ như, gió đông, gió tây, gió bắc, gió nam, gió bụi, gió không bụi, gió lạnh, gió nóng, gió nhẹ, gió mạnh, gió đen, gió bão, gió cánh, gió đại bàng, gió quạt, gió thổi”, v.v., phong đại bên ngoài được nói đến như vậy cần phải được hiểu.
Sesaṃ vuttanayamevāti.
The remainder is just as has been stated.
Phần còn lại cũng theo cách đã nói.
Ettāvatā ca yvāyaṃ –
And by this much:
Với chừng mực này, và điều này—
Evaṃ nettiyaṃ lakkhaṇo nāma hāro vutto, tassa vasena yasmā catūsu bhūtesu gahitesu upādārūpampi gahitameva bhavati, rūpalakkhaṇaṃ anatītattā.
Thus, in the Nettipakaraṇa, the method (hāra) named Lakkhaṇa is stated. By means of that, since when the four great elements are grasped, derived materiality is also grasped, because it does not transcend the characteristic of materiality.
Phương pháp Lakkhaṇa (đặc tính) đã được nói đến trong Netti theo cách này. Vì khi bốn đại chủng được nắm giữ, thì các sắc y sinh (upādārūpa) cũng được nắm giữ, do không vượt quá đặc tính của sắc.
Yañca bhūtopādārūpaṃ so rūpakkhandho.
And that which is the primary elements and derived materiality is the materiality aggregate.
Và sắc đại chủng cùng sắc y sinh đó chính là sắc uẩn (rūpakkhandha).
Tasmā ‘‘assutavā puthujjano pathaviṃ āpaṃ tejaṃ vāyaṃ maññatī’’ti vadantena atthato rūpaṃ attato samanupassatītipi vuttaṃ hoti.
Therefore, by saying, "the uninstructed ordinary person conceives earth, water, fire, wind," it is also said in meaning that he observes materiality as self.
Do đó, khi nói “Kẻ phàm phu vô văn nghĩ rằng đất, nước, lửa, gió là Ta”, thì trên thực tế cũng có nghĩa là người đó xem sắc là tự ngã.
‘‘Pathaviyā āpasmiṃ tejasmiṃ vāyasmiṃ maññatī’’ti vadantena rūpasmiṃ vā attānaṃ samanupassatīti vuttampi hoti.
By saying, "he conceives in earth, in water, in fire, in wind," it is also said that he observes the self in materiality.
Khi nói “nghĩ rằng Ta ở trong đất, trong nước, trong lửa, trong gió”, thì cũng có nghĩa là người đó xem tự ngã ở trong sắc.
‘‘Pathavito āpato tejato vāyato maññatī’’ti vadantena rūpato añño attāti siddhattā rūpavantaṃ vā attānaṃ attani vā rūpaṃ samanupassatītipi vuttaṃ hoti.
By saying, "he conceives from earth, from water, from fire, from wind," since it is established that the self is other than materiality, it is also said that he observes the self as possessing materiality or materiality in the self.
Khi nói “nghĩ rằng Ta khác với đất, nước, lửa, gió”, thì do đã xác lập rằng tự ngã khác với sắc, cũng có nghĩa là người đó xem tự ngã có sắc, hoặc sắc ở trong tự ngã.
Evametā catasso rūpavatthukā sakkāyadiṭṭhimaññanā veditabbā.
Thus, these four conceivings of identity-view having materiality as their object should be understood.
Bốn quan niệm về tà kiến thân kiến (sakkāyadiṭṭhi) dựa trên sắc này cần được hiểu.
Tattha ekā ucchedadiṭṭhi, tisso sassatadiṭṭhiyoti dveva diṭṭhiyo hontīti ayampi atthaviseso veditabbo.
Therein, one is the annihilationist view, and three are eternalist views; thus there are only two views. This specific meaning should also be understood.
Trong đó, một là đoạn kiến (ucchedadiṭṭhi), ba là thường kiến (sassatadiṭṭhi). Vậy chỉ có hai loại tà kiến, đây cũng là một điểm đặc biệt về ý nghĩa cần được hiểu.
3. Evaṃ rūpamukhena saṅkhāravatthukaṃ maññanaṃ vatvā idāni ye saṅkhāre upādāya sattā paññapīyanti, tesu saṅkhāresu sattesupi yasmā puthujjano maññanaṃ karoti, tasmā te satte niddisanto bhūte bhūtato sañjānātītiādimāha.
3. Having thus explained the conceiving that has formations as its object by way of materiality, now, since the ordinary person conceives with respect to both the formations on account of which beings are designated, and those beings themselves, he points to those beings, saying, “he perceives beings as beings,” and so on.
3. Sau khi nói về quan niệm dựa trên các hành (saṅkhāra) thông qua sắc, bây giờ, vì kẻ phàm phu có quan niệm về các chúng sinh dựa trên các hành này, nên đức Phật đã nói “ Bhūte bhūtato sañjānāti” (nhận biết các chúng sinh là chúng sinh) và các câu tiếp theo, để chỉ ra các chúng sinh đó.
Tatthāyaṃ bhūtasaddo pañcakkhandhaamanussadhātuvijjamānakhīṇāsavasattarukkhādīsu dissati.
Therein, this word bhūta is seen in the contexts of the five aggregates, non-human beings, elements, what is existent, the arahant, beings, trees, and so on.
Ở đây, từ bhūta (chúng sinh) được thấy dùng trong các trường hợp như ngũ uẩn, phi nhân, giới, hiện hữu, bậc A-la-hán, chúng sinh, cây cối, v.v.
‘‘Bhūtamidanti, bhikkhave, samanupassathā’’tiādīsu (ma. ni. 1.401) hi ayaṃ pañcakkhandhesu dissati.
For in passages such as, “Monks, you should observe this as having come into being,” it is seen in the sense of the five aggregates.
Thật vậy, trong các câu như “Này các tỳ khưu, hãy quán sát điều này là hiện hữu (bhūta)” (Ma. Ni. 1.401), từ này được thấy dùng cho ngũ uẩn.
‘‘Yānīdha bhūtāni samāgatānī’’ti (su. ni. 224) ettha amanussesu.
In, “Whatever beings have gathered here,” it is in the sense of non-human beings.
Trong “Yānīdha bhūtāni samāgatānī” (Su. Ni. 224), từ này dùng cho phi nhân.
‘‘Cattāro kho, bhikkhu, mahābhūtā hetū’’ti (ma. ni. 3.86) ettha dhātūsu.
In, “Monk, these four great elements are the cause,” it is in the sense of elements.
Trong “Này tỳ khưu, bốn đại chủng (mahābhūta) là nguyên nhân” (Ma. Ni. 3.86), từ này dùng cho các giới (dhātu).
‘‘Bhūtasmiṃ pācittiya’’ntiādīsu (pāci. 69) vijjamāne.
In passages such as, “A pācittiya offense for what is factual,” it is in the sense of what is existent.
Trong “Bhūtasmiṃ pācittiya” và các câu tương tự (Pāci. 69), từ này dùng cho điều hiện hữu.
‘‘Yo ca kālaghaso bhūto’’ti (jā. 1.10.190) ettha khīṇāsave.
In, “The one who, having come into being, consumes time,” it is in the sense of an arahant.
Trong “Yo ca kālaghaso bhūto” (Jā. 1.10.190), từ này dùng cho bậc A-la-hán.
‘‘Sabbeva nikkhipissanti bhūtā loke samussaya’’nti (dī. ni. 2.220) ettha sattesu.
In, “All beings in the world will lay down the body,” it is in the sense of beings.
Trong “Sabbeva nikkhipissanti bhūtā loke samussaya” (Dī. Ni. 2.220), từ này dùng cho chúng sinh.
‘‘Bhūtagāmapātabyatāyā’’ti (pāci. 90) ettha rukkhādīsu.
In, “For damaging a plant,” it is in the sense of trees and so on.
Trong “Bhūtagāmapātabyatāyā” (Pāci. 90), từ này dùng cho cây cối, v.v.
Idha panāyaṃ sattesu vattati, no ca kho avisesena.
Here, however, it applies to beings, but not without distinction.
Nhưng ở đây, từ này được dùng cho chúng sinh, không phải một cách chung chung.
Cātumahārājikānaṃ hi heṭṭhā sattā idha bhūtāti adhippetā.
For here, beings below the realm of the Four Great Kings are intended as ‘beings’.
Thật vậy, các chúng sinh dưới cõi Tứ Đại Thiên Vương được hiểu là bhūta ở đây.
Tattha bhūte bhūtato sañjānātītiādi vuttanayameva.
Therein, “he perceives beings as beings,” and so on, is just as has been explained.
Ở đây, “ Bhūte bhūtato sañjānāti” (nhận biết các chúng sinh là chúng sinh) và các câu tiếp theo cũng theo cách đã nói.
Bhūte maññatītiādīsu pana tissopi maññanā yojetabbā.
In “he conceives beings,” etc., however, all three kinds of conceiving should be applied.
Tuy nhiên, trong “ Bhūte maññati” (nghĩ về các chúng sinh) và các câu tiếp theo, cả ba loại quan niệm (maññanā) cần được áp dụng.
Kathaṃ?
How?
Như thế nào?
Ayañhi ‘‘so passati gahapatiṃ vā gahapatiputtaṃ vā pañcahi kāmaguṇehi samappitaṃ samaṅgibhūta’’nti (a. ni. 7.50) vuttanayena bhūte subhā sukhitāti gahetvā rajjati, disvāpi ne rajjati, sutvāpi, ghāyitvāpi, sāyitvāpi, phusitvāpi, ñatvāpi.
This person, in the way stated, "he sees a householder or a householder's son, endowed and furnished with the five cords of sensual pleasure," takes beings to be beautiful and happy and becomes impassioned. And he becomes impassioned upon seeing them, upon hearing, smelling, tasting, touching, or knowing them.
Kẻ phàm phu này, theo cách đã nói trong “Người ấy thấy một gia chủ hoặc con trai gia chủ đang hưởng thụ năm dục lạc, hoàn toàn đầy đủ” (A. Ni. 7.50), cho rằng các chúng sinh là tốt đẹp, hạnh phúc, và do đó, bị tham ái. Dù thấy, nghe, ngửi, nếm, chạm, hay biết, người ấy vẫn bị tham ái.
Evaṃ bhūte taṇhāmaññanāya maññati.
Thus he conceives beings with the conceiving of craving.
Như vậy, người ấy có quan niệm về các chúng sinh bằng quan niệm tham ái (taṇhāmaññanā).
‘‘Aho vatāhaṃ khattiyamahāsālānaṃ vā sahabyataṃ upapajjeyya’’ntiādinā (dī. ni. 3.337) vā pana nayena appaṭiladdhassa paṭilābhāya cittaṃ paṇidahati, evampi bhūte taṇhāmaññanāya maññati.
Or else, in the way of, “Oh, that I might be reborn in the company of wealthy khattiyas,” and so on, he directs his mind to attaining what has not been attained. In this way too he conceives beings with the conceiving of craving.
Hoặc, theo cách đã nói trong “Ôi! Ước gì ta được sinh vào cõi của các đại gia tộc Sát đế lợi” và các câu tương tự (Dī. Ni. 3.337), người ấy đặt tâm nguyện để đạt được điều chưa đạt, như vậy cũng là có quan niệm về các chúng sinh bằng quan niệm tham ái.
Attano pana bhūtānañca sampattivipattiṃ nissāya attānaṃ vā seyyaṃ dahati.
Relying on his own and beings' fortune and misfortune, he places himself as superior.
Tuy nhiên, dựa vào sự thành tựu và thất bại của bản thân và của các chúng sinh, người ấy tự cho mình là hơn.
Bhūtesu ca yaṃkiñci bhūtaṃ hīnaṃ attānaṃ vā hīnaṃ, yaṃkiñci bhūtaṃ seyyaṃ.
And among beings, some being is inferior, or he himself is inferior, and some being is superior.
Và trong các chúng sinh, chúng sinh nào thấp kém thì người ấy tự cho mình thấp kém, chúng sinh nào cao quý thì người ấy tự cho mình cao quý.
Attānaṃ vā bhūtena, bhūtaṃ vā attanā sadisaṃ dahati.
Or he places himself as equal to a being, or a being as equal to himself.
Người ấy tự cho mình ngang bằng với chúng sinh, hoặc chúng sinh ngang bằng với mình.
Yathāha ‘‘idhekacco jātiyā vā…pe… aññataraññatarena vatthunā pubbakālaṃ parehi sadisaṃ attānaṃ dahati.
As it is said: "Here, someone, on the basis of birth... or some other thing, in a former time places himself as equal to others.
Như đã nói: “Ở đây, một số người, về chủng tộc hoặc… (lược bỏ)… vì một lý do nào đó, vào thời gian trước, tự cho mình ngang bằng với người khác.
Aparakālaṃ attānaṃ seyyaṃ dahati.
In a later time, he places himself as superior.
Vào thời gian sau, tự cho mình là hơn.
Pare hīne dahati, yo evarūpo māno …pe… ayaṃ vuccati mānātimāno’’ti (vibha. 876-880).
He places others as inferior. Whatever conceit of this sort... this is called conceit and excessive conceit."
Họ cho người khác là thấp kém. Loại kiêu mạn như vậy… (lược bỏ)… được gọi là kiêu mạn quá mức (mānātimāna)” (Vibhā. 876-880).
Evaṃ bhūte mānamaññanāya maññati.
Thus he conceives beings with the conceiving of conceit.
Như vậy, người ấy có quan niệm về các chúng sinh bằng quan niệm kiêu mạn (mānamaññanā).
Bhūte pana ‘‘niccā dhuvā sassatā avipariṇāmadhammā’’ti vā ‘‘sabbe sattā sabbe pāṇā sabbe bhūtā sabbe jīvā avasā abalā avīriyā niyatisaṅgatibhāvapariṇatā chasvevābhijātīsu sukhadukkhaṃ paṭisaṃvedentī’’ti (dī. ni. 1.168) vā maññamāno diṭṭhimaññanāya maññati.
Or else, conceiving that beings are “permanent, stable, eternal, not subject to change,” or that “all beings, all living things, all creatures, all souls are without power, without strength, without energy, determined by fate, circumstance, and nature, they experience pleasure and pain in the six classes of birth,” he conceives with the conceiving of views.
Tuy nhiên, khi nghĩ về các chúng sinh là “thường còn, vững bền, vĩnh cửu, không biến đổi” hoặc “tất cả chúng sinh, tất cả loài hữu tình, tất cả loài hiện hữu, tất cả sinh vật đều vô chủ, yếu ớt, không có nỗ lực, bị chi phối bởi định mệnh, hội tụ, và biến chuyển theo sáu loại sinh, cảm nhận khổ và lạc” (Dī. Ni. 1.168), người ấy có quan niệm bằng tà kiến (diṭṭhimaññanā).
Evaṃ bhūte tīhi maññanāhi maññati.
In this way he conceives beings with the three kinds of conceiving.
Như vậy, người ấy có quan niệm về các chúng sinh bằng ba loại quan niệm này.
Kathaṃ bhūtesu maññati? Tesu tesu bhūtesu attano upapattiṃ vā sukhuppattiṃ vā ākaṅkhati.
How does he conceive in beings? He longs for his own rebirth or the arising of pleasure in those various beings.
Làm thế nào để nghĩ về các chúng sinh? Người ấy mong cầu sự tái sinh hoặc sự phát sinh hạnh phúc trong các chúng sinh đó.
Evaṃ tāva taṇhāmaññanāya bhūtesu maññati.
Thus, in the first place, he conceives in beings with the conceiving of craving.
Như vậy, trước hết, người ấy có quan niệm về các chúng sinh bằng quan niệm tham ái.
Bhūtesu vā upapattiṃ ākaṅkhamāno dānaṃ deti, sīlaṃ samādiyati, uposathakammaṃ karoti.
Or, longing for rebirth among beings, he gives gifts, undertakes the moral precepts, and performs the Uposatha observance.
Hoặc, khi mong cầu sự tái sinh trong các chúng sinh, người ấy bố thí, giữ giới, thực hành trai giới.
Evampi bhūtesu taṇhāmaññanāya maññati.
In this way too, he conceives in beings with the conceiving of craving.
Như vậy cũng là có quan niệm về các chúng sinh bằng quan niệm tham ái.
Bhūte pana samūhaggāhena gahetvā tattha ekacce bhūte seyyato dahati, ekacce sadisato vā hīnato vāti.
But taking beings collectively, he places some beings as superior, and some as equal or inferior.
Tuy nhiên, khi nắm giữ các chúng sinh theo nhóm, người ấy cho một số chúng sinh là cao quý hơn, một số là ngang bằng hoặc thấp kém.
Evaṃ bhūtesu mānamaññanāya maññati.
In this way, he conceives in beings with the conceiving of conceit.
Như vậy, người ấy có quan niệm về các chúng sinh bằng quan niệm kiêu mạn.
Tathā ekacce bhūte niccā dhuvāti maññati.
Likewise, he conceives some beings to be permanent and stable.
Tương tự, người ấy cho một số chúng sinh là thường còn, vững bền.
Ekacce aniccā adhuvāti, ahampi bhūtesu aññatarosmīti vā maññati.
He conceives some to be impermanent and unstable, or he conceives, “I too am one among beings.”
Một số là vô thường, không vững bền, hoặc nghĩ rằng “ta cũng là một trong số các chúng sinh đó”.
Evaṃ bhūtesu diṭṭhimaññanāya maññati.
In this way, he conceives in beings with the conceiving of views.
Như vậy, người ấy có quan niệm về các chúng sinh bằng quan niệm tà kiến.
Bhūtato maññatīti ettha pana saupakaraṇassa attano vā parassa vā yato kutoci bhūtato uppattiṃ maññamāno bhūtato maññatīti veditabbo, ayamassa diṭṭhimaññanā.
In “he conceives from beings,” however, it should be understood that one conceives from beings when one conceives of the arising of oneself with one’s requisites, or of another, from some being or other. This is his conceiving of views.
Ở đây, trong “ Bhūtato maññati” (nghĩ từ chúng sinh), cần hiểu rằng người ấy có quan niệm từ chúng sinh khi nghĩ về sự phát sinh của mình hoặc người khác, từ bất cứ chúng sinh nào có đầy đủ phương tiện; đây là quan niệm tà kiến của người ấy.
Tasmiṃyeva panassa diṭṭhimaññanāya maññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmānamaññanāpi veditabbā.
But for him, in that very object conceived with the conceiving of views, as attachment and conceit arise, the conceivings of craving and conceit should also be understood.
Và trong đối tượng mà người ấy đã có quan niệm tà kiến, khi phát sinh tình cảm và kiêu mạn, thì quan niệm tham ái và kiêu mạn cũng cần được hiểu.
Bhūte meti maññatīti ettha pana ekā taṇhāmaññanāva labbhati.
In “he conceives ‘beings are mine’,” however, only the one conceiving of craving is found.
Ở đây, trong “ Bhūte meti maññati” (nghĩ rằng các chúng sinh là của tôi), chỉ có một quan niệm tham ái được chấp nhận.
Sā cāyaṃ ‘‘mama puttā, mama dhītā, mama ajeḷakā, kukkuṭasūkarā, hatthigavassavaḷavā’’ti evamādinā nayena mamāyato pavattatīti veditabbā.
And it should be understood that this proceeds by way of making things one's own, in such ways as, "my sons, my daughters, my goats and sheep, my chickens and pigs, my elephants, cattle, horses, and mares."
Và quan niệm này được hiểu là phát sinh từ sự chấp thủ của người ấy theo cách như “con trai của tôi, con gái của tôi, dê của tôi, gà, heo, voi, bò, ngựa cái”.
Bhūte abhinandatīti etaṃ vuttanayameva.
“He delights in beings” is just as has been explained.
“ Bhūte abhinandati” (hoan hỷ trong các chúng sinh) cũng theo cách đã nói.
Apariññātaṃ tassāti ettha pana ye saṅkhāre upādāya bhūtānaṃ paññatti, tesaṃ apariññātattā bhūtā apariññātā hontīti veditabbā.
In “That is not fully understood by him,” however, it should be understood that because the formations on account of which beings are designated are not fully understood, beings are not fully understood.
Ở đây, trong “ Apariññātaṃ tassā” (chưa được hiểu rõ), cần hiểu rằng vì các hành mà dựa vào đó chúng sinh được đặt tên chưa được hiểu rõ, nên các chúng sinh cũng chưa được hiểu rõ.
Yojanā pana vuttanayeneva kātabbā.
The application, however, should be done in the way already stated.
Việc áp dụng cũng nên được thực hiện theo cách đã nói.
Evaṃ saṅkhepato saṅkhāravasena ca sattavasena ca maññanāvatthuṃ dassetvā idāni bhūmivisesādinā bhedena vitthāratopi taṃ dassento deve devatotiādimāha.
Having thus shown in brief the object of conceiving by way of formations and by way of beings, now, showing it in detail with the distinction of specific planes and so on, he said, as to devas, from devas, etc.
Như vậy, sau khi trình bày tóm tắt đối tượng của quan niệm theo hành và theo chúng sinh, bây giờ, để trình bày chi tiết hơn theo sự phân biệt về các cõi, v.v., đức Phật đã nói “ Deve devato” (chư thiên là chư thiên) và các câu tiếp theo.
Tattha dibbanti pañcahi kāmaguṇehi attano vā iddhiyāti devā, kīḷanti jotenti cāti attho.
Therein, devas are so called because they revel (dibbanti) with the five cords of sensual pleasure or with their own psychic power; the meaning is that they play (kīḷanti) and shine (jotenti).
Ở đây, devā (chư thiên) là những người vui chơi, tỏa sáng với năm dục lạc của mình hoặc với thần thông của mình, đó là ý nghĩa.
Te tividhā sammutidevā upapattidevā visuddhidevāti.
They are of three kinds: conventional devas, devas by rebirth, and devas by purity.
Họ có ba loại: Sammutidevā (chư thiên quy ước), Upapattidevā (chư thiên tái sinh), Visuddhidevā (chư thiên thanh tịnh).
Sammutidevā nāma rājāno deviyo rājakumārā.
Conventional devas are kings, queens, and princes.
Sammutidevā là các vị vua, hoàng hậu, hoàng tử.
Upapattidevā nāma cātumahārājike deve upādāya tatuttaridevā.
Devas by rebirth are the devas starting from those of the Cātumahārājika realm and those above them.
Upapattidevā là các vị thiên từ cõi Tứ Đại Thiên Vương trở lên.
Visuddhidevā nāma arahanto khīṇāsavā.
Devas by purity are the arahants, the destroyers of the cankers.
Visuddhidevā là các bậc A-la-hán, những người đã đoạn tận lậu hoặc.
Idha pana upapattidevā daṭṭhabbā, no ca kho avisesena.
Here, however, devas by rebirth should be understood, but not without distinction.
Nhưng ở đây, cần hiểu là các Upapattidevā, không phải một cách chung chung.
Paranimmitavasavattidevaloke māraṃ saparisaṃ ṭhapetvā sesā cha kāmāvacarā idha devāti adhippetā.
Here, devas are intended to be the remaining six classes of sense-sphere devas, excluding Māra with his retinue in the Paranimmitavasavatti deva world.
Ngoại trừ Māra và tùy tùng của hắn trong cõi trời Paranimmitavasavatti, sáu cõi dục giới còn lại được hiểu là chư thiên ở đây.
Tattha sabbā atthavaṇṇanā bhūtavāre vuttanayeneva veditabbā.
Therein, the entire explanation of the meaning should be understood in the same way as was stated in the section on beings.
Ở đây, tất cả các giải thích ý nghĩa đều phải được hiểu theo cách đã nói trong phần về Bhūta.
Pajāpatinti ettha pana māro pajāpatīti veditabbo.
Pajāpati: Here, Māra should be understood as Pajāpati.
Ở đây, trong từ Pajāpati, Māra phải được hiểu là Pajāpati.
Keci pana ‘‘tesaṃ tesaṃ devānaṃ adhipatīnaṃ mahārājādīnametaṃ adhivacana’’nti vadanti.
But some say, “This is a designation for the rulers of those various devas, such as the Great Kings and so on.”
Một số người nói rằng: “Đây là tên gọi của các vị thần có quyền lực như các vị Đại Thiên vương, v.v.”
Taṃ devaggahaṇeneva tesaṃ gahitattā ayuttanti mahāaṭṭhakathāyaṃ paṭikkhittaṃ, māroyeva pana sattasaṅkhātāya pajāya adhipatibhāvena idha pajāpatīti adhippeto.
That is rejected in the Mahā-aṭṭhakathā as inappropriate, because they are already included by the term ‘devas’. Rather, it is Māra who is intended here as Pajāpati, due to his being the lord of the creatures known as beings.
Điều đó đã bị bác bỏ trong Mahāaṭṭhakathā vì không hợp lý, bởi vì những vị đó đã được bao gồm trong từ ‘deva’ (chư thiên). Ở đây, Pajāpati được hiểu là Māra, với ý nghĩa là chúa tể của chúng sinh, tức là Pajā.
So kuhiṃ vasati?
Where does he dwell?
Vậy hắn ta sống ở đâu?
Paranimmitavasavattidevaloke.
In the devaloka of Paranimmitavasavatti.
Ở cõi trời Paranimmitavasavatti.
Tatra hi vasavattirājā rajjaṃ kāreti.
For there, King Vasavatti holds dominion.
Ở đó, Vua Vasavatti cai trị vương quốc.
Māro ekasmiṃ padese attano parisāya issariyaṃ pavattento rajjapaccante dāmarikarājaputto viya vasatīti vadanti.
They say that Māra, exercising sovereignty over his retinue in one region, dwells like a rebellious prince in a border province.
Người ta nói rằng Māra sống như một hoàng tử nổi loạn ở vùng biên giới của vương quốc, thực hiện quyền lực của mình đối với đoàn tùy tùng của mình ở một nơi.
Māraggahaṇeneva cettha māraparisāyapi gahaṇaṃ veditabbaṃ.
And here, by the term Māra, the inclusion of Māra's retinue should also be understood.
Ở đây, việc đề cập đến Māra cũng phải được hiểu là bao gồm cả đoàn tùy tùng của Māra.
Yojanānayo cettha pajāpatiṃ vaṇṇavantaṃ dīghāyukaṃ sukhabahulaṃ disvā vā sutvā vā rajjanto taṇhāmaññanāya maññati.
And here, the application of the method is that one who is impassioned upon seeing or hearing that Pajāpati is beautiful, long-lived, and abounding in happiness, conceives through craving-conceiving.
Cách giải thích ở đây là: khi thấy hoặc nghe về Pajāpati có sắc đẹp, tuổi thọ dài lâu, và nhiều hạnh phúc, người ta khởi lên sự ham muốn và tưởng tượng về Pajāpati với sự tưởng tượng của tham ái (taṇhāmaññanā).
‘‘Aho vatāhaṃ pajāpatino sahabyataṃ upapajjeyya’’ntiādinā vā pana nayena appaṭiladdhassa paṭilābhāya cittaṃ paṇidahantopi pajāpatiṃ taṇhāmaññanāya maññati.
Or, by the method beginning, “Oh, may I be reborn in the company of Pajāpati!”, one who directs their mind to attain what has not been attained also conceives of Pajāpati through craving-conceiving.
Hoặc, một người chưa đạt được địa vị đó, nhưng lại đặt tâm nguyện để đạt được nó, chẳng hạn như: “Ôi! Ước gì tôi được làm bạn với Pajāpati!”, người đó cũng tưởng tượng về Pajāpati với sự tưởng tượng của tham ái (taṇhāmaññanā).
Pajāpatibhāvaṃ pana patto samāno ahamasmi pajānamissaro adhipatīti mānaṃ janento pajāpatiṃ mānamaññanāya maññati.
But one who has attained the state of Pajāpati, generating the conceit, “I am the lord and master of creatures,” conceives of Pajāpati through conceit-conceiving.
Tuy nhiên, khi đã đạt được địa vị Pajāpati, một người lại tưởng tượng về Pajāpati với sự tưởng tượng của kiêu mạn (mānamaññanā), khi khởi lên ý nghĩ: “Ta là chủ tể, là chúa tể của chúng sinh.”
‘‘Pajāpati nicco dhuvo’’ti vā ‘‘ucchijjissati vinassissatī’’ti vā ‘‘avaso abalo avīriyo niyatisaṅgatibhāvapariṇato chasvevābhijātīsu sukhadukkhaṃ paṭisaṃvedetī’’ti vā maññamāno pana pajāpatiṃ diṭṭhimaññanāya maññatīti veditabbo.
But one who conceives, “Pajāpati is permanent, stable,” or “he will be annihilated, he will perish,” or “he is without power, without strength, without energy, subject to fate, association, and nature, experiencing pleasure and pain in only six classes of birth,” should be understood to conceive of Pajāpati through view-conceiving.
Và khi suy nghĩ rằng: “Pajāpati là thường còn, vĩnh cửu,” hoặc “Pajāpati sẽ bị hủy diệt, sẽ biến mất,” hoặc “Pajāpati là vô chủ, yếu ớt, không có nghị lực, bị chi phối bởi định mệnh và sự kết hợp, chịu đựng khổ lạc trong sáu loại sinh,” thì người đó tưởng tượng về Pajāpati với sự tưởng tượng của tà kiến (diṭṭhimaññanā).
Pajāpatisminti ettha pana ekā diṭṭhimaññanāva yujjati.
In Pajāpati: Here, however, only one, view-conceiving, is applicable.
Tuy nhiên, trong từ Pajāpatismiṃ (trong Pajāpati), chỉ có một loại tà kiến tưởng tượng (diṭṭhimaññanā) là phù hợp.
Tassā evaṃ pavatti veditabbā.
Its occurrence should be understood as follows.
Sự diễn tiến của nó phải được hiểu như sau:
Idhekacco ‘‘pajāpatismiṃ ye ca dhammā saṃvijjanti, sabbe te niccā dhuvā sassatā avipariṇāmadhammā’’ti maññati.
Here, someone conceives, “Whatever Dhammas exist in Pajāpati, all of them are permanent, stable, eternal, and not subject to change.”
Ở đây, một số người nghĩ rằng: “Những gì tồn tại trong Pajāpati, tất cả đều là thường còn, vĩnh cửu, trường tồn, không thay đổi.”
Atha vā ‘‘pajāpatismiṃ natthi pāpaṃ, na tasmiṃ pāpakāni kammāni upalabbhantī’’ti maññati.
Or they conceive, “In Pajāpati there is no evil; no evil kammas are found in him.”
Hoặc, “Trong Pajāpati không có điều ác, không có hành động ác nào được tìm thấy trong đó,” người đó nghĩ như vậy.
Pajāpatitoti ettha tissopi maññanā labbhanti.
From Pajāpati: Here, all three kinds of conceiving are possible.
Trong từ Pajāpatito (từ Pajāpati), cả ba loại tưởng tượng đều có thể xảy ra.
Kathaṃ?
How so?
Làm sao vậy?
Idhekacco saupakaraṇassa attano vā parassa vā pajāpatito uppattiṃ vā niggamanaṃ vā maññati, ayamassa diṭṭhimaññanā.
Here, someone conceives of the arising or issuance from Pajāpati of oneself or another, along with their belongings; this is their view-conceiving.
Ở đây, một số người tưởng tượng về sự phát sinh hoặc xuất hiện của bản thân hoặc người khác cùng với các công cụ từ Pajāpati; đây là tưởng tượng của tà kiến (diṭṭhimaññanā) của người đó.
Tasmiṃyeva panassa diṭṭhimaññanāya maññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmānamaññanāpi veditabbā.
But craving-conceiving and conceit-conceiving should be understood for one who generates affection and conceit for that very object conceived through view-conceiving.
Trong cùng đối tượng mà người đó tưởng tượng với tà kiến, khi người đó khởi lên tình cảm và kiêu mạn, thì đó cũng phải được hiểu là tưởng tượng của tham ái và kiêu mạn (taṇhāmānamaññanā).
Pajāpatiṃ meti ettha pana ekā taṇhāmaññanāva labbhati.
Pajāpati is mine: Here, only one, craving-conceiving, is found.
Tuy nhiên, trong từ Pajāpatiṃ me (Pajāpati của tôi), chỉ có một loại tưởng tượng của tham ái (taṇhāmaññanā) là có thể xảy ra.
Sā cāyaṃ ‘‘pajāpati mama satthā mama sāmī’’tiādinā nayena mamāyato pavattatīti veditabbā.
And it should be understood that this occurs for one who holds the sense of ‘mine’ in the manner of, “Pajāpati is my teacher, my master,” and so on.
Và điều này phải được hiểu là phát sinh từ một người có tâm sở hữu, theo cách như: “Pajāpati là bậc Đạo sư của tôi, là chủ của tôi,” v.v.
Sesaṃ vuttanayameva.
The rest is just as has been stated.
Phần còn lại tương tự như cách đã nói.
Brahmaṃ brahmatoti ettha brūhito tehi tehi guṇavisesehīti brahmā. Apica brahmāti mahābrahmāpi vuccati, tathāgatopi brāhmaṇopi mātāpitaropi seṭṭhampi.
Brahmā, from Brahmā: Here, because of being augmented by various special qualities, he is Brahmā. Moreover, ‘Brahmā’ can refer to Mahābrahmā, as well as the Tathāgata, a brahmin, parents, and that which is excellent.
Trong từ Brahmaṃ Brahmato (Phạm Thiên từ Phạm Thiên), Brahmā được gọi là người đã được tăng trưởng bởi những phẩm chất đặc biệt đó. Hơn nữa, Brahmā cũng được gọi là Mahābrahmā (Đại Phạm Thiên), cũng như Tathāgata (Như Lai), Brāhmaṇa (Bà-la-môn), cha mẹ, và người tối thượng.
‘‘Sahasso brahmā dvisahasso brahmā’’tiādīsu (ma. ni. 3.165-166) hi mahābrahmā brahmāti vuccati.
For in passages such as, “The thousand-fold Brahmā, the two-thousand-fold Brahmā,” Mahābrahmā is called Brahmā.
Trong các đoạn như: “Brahmā ngàn cõi, Brahmā hai ngàn cõi,” (Ma. Ni. 3.165-166) thì Mahābrahmā được gọi là Brahmā.
‘‘Brahmāti kho, bhikkhave, tathāgatassetaṃ adhivacana’’nti ettha tathāgato.
In the passage, “Brahmā, bhikkhus, is a designation for the Tathāgata,” it refers to the Tathāgata.
Trong đoạn: “Này các tỳ-khưu, Brahmā là một tên gọi của Tathāgata,” thì đó là Tathāgata.
Ettha mātāpitaro.
Here, it refers to parents.
Ở đây là cha mẹ.
‘‘Brahmacakkaṃ pavattetī’’ti (ma. ni. 1.148; a. ni. 5.11) ettha seṭṭhaṃ.
In, “He sets the Brahmā wheel in motion,” it refers to that which is excellent.
Trong đoạn: “Làm chuyển vận bánh xe Phạm Thiên,” thì đó là điều tối thượng.
Idha pana paṭhamābhinibbatto kappāyuko brahmā adhippeto.
Here, however, the Brahmā who is first to arise and has a lifespan of a kappa is intended.
Ở đây, ý muốn nói đến vị Phạm Thiên đầu tiên xuất hiện, có tuổi thọ bằng một kiếp.
Taggahaṇeneva ca brahmapurohitabrahmapārisajjāpi gahitāti veditabbā.
And it should be understood that by this term, the Brahmapurohitas and the Brahmapārisajjas are also included.
Và phải hiểu rằng, việc đề cập đến vị đó cũng bao gồm cả các Phạm Thiên Purohita và Phạm Thiên Pārisajja.
Atthavaṇṇanā panettha pajāpativāre vuttanayeneva veditabbā.
Here, the explanation of the meaning should be understood in the same way as was stated in the section on Pajāpati.
Và ở đây, việc giải thích ý nghĩa phải được hiểu theo cách đã nói trong phần về Pajāpati.
Abhibhūvāre abhibhavīti abhibhū. Kiṃ abhibhavi?
In the section on Abhibhū: He has overcome; thus he is Abhibhū (the Overlord).
Trong phần về Abhibhū, người Abhibhū là người đã vượt trội. Vượt trội điều gì?
Cattāro khandhe arūpino.
What has he overcome?
Bốn uẩn vô sắc.
Asaññabhavassetaṃ adhivacanaṃ.
The four formless aggregates.
Đây là tên gọi của cõi Asaññabhava (Vô tưởng hữu).
Asaññasattā devā vehapphalehi saddhiṃ ekatalāyeva ekasmiṃ okāse yena iriyāpathena nibbattā, teneva yāvatāyukaṃ tiṭṭhanti cittakammarūpasadisā hutvā.
This is a designation for the sphere of non-percipient beings. The non-percipient devas are on the same plane as the Vehapphalas, in one location. For as long as their lifespan lasts, they remain in the very same posture in which they were born, like painted figures.
Các vị Asaññasattā devā (Vô tưởng chúng sinh) cùng với các vị Vehapphalā sống trong cùng một tầng cõi, ở cùng một không gian, và họ duy trì tư thế mà họ đã tái sinh cho đến hết tuổi thọ, giống như những hình vẽ.
Te idha sabbepi abhibhūvacanena gahitā.
Here, all of them are included by the word Abhibhū.
Tất cả họ ở đây đều được bao gồm trong từ Abhibhū.
Keci abhibhū nāma sahasso brahmāti evamādinā nayena tattha tattha adhipatibrahmānaṃ vaṇṇayanti.
Some explain that Abhibhū refers to the ruling Brahmās in various realms, in the manner of, “The thousand-fold Brahmā,” and so on.
Một số người mô tả các vị Phạm Thiên có quyền năng ở mỗi cõi, theo cách như: Abhibhū là Phạm Thiên ngàn cõi, v.v.
Brahmaggahaṇeneva pana tassa gahitattā ayuttametanti veditabbaṃ.
But since that one is already included by the term Brahmā, this should be understood as inappropriate.
Tuy nhiên, điều này phải được hiểu là không hợp lý, vì vị đó đã được bao gồm trong từ ‘Brahmā’.
Yojanānayo cettha abhibhū vaṇṇavā dīghāyukoti sutvā tattha chandarāgaṃ uppādento abhibhuṃ taṇhāmaññanāya maññati.
And here, the application of the method is that, upon hearing, “Abhibhū is beautiful and long-lived,” one who generates sensual desire for that being conceives of Abhibhū through craving-conceiving.
Cách giải thích ở đây là: khi nghe về Abhibhū có sắc đẹp, tuổi thọ dài lâu, người ta khởi lên sự ham muốn và tưởng tượng về Abhibhū với sự tưởng tượng của tham ái (taṇhāmaññanā).
‘‘Aho vatāhaṃ abhibhuno sahabyataṃ upapajjeyya’’ntiādinā pana nayena appaṭiladdhassa paṭilābhāya cittaṃ paṇidahantopi abhibhuṃ taṇhāmaññanāya maññati.
Or, by the method beginning, “Oh, may I be reborn in the company of Abhibhū!”, one who directs their mind to attain what has not been attained also conceives of Abhibhū through craving-conceiving.
Hoặc, một người chưa đạt được địa vị đó, nhưng lại đặt tâm nguyện để đạt được nó, chẳng hạn như: “Ôi! Ước gì tôi được làm bạn với Abhibhū!”, người đó cũng tưởng tượng về Abhibhū với sự tưởng tượng của tham ái (taṇhāmaññanā).
Attānaṃ hīnato abhibhuṃ seyyato dahanto pana abhibhuṃ mānamaññanāya maññati.
But one who places oneself as inferior and Abhibhū as superior conceives of Abhibhū through conceit-conceiving.
Tuy nhiên, một người coi mình là thấp kém và coi Abhibhū là cao quý hơn, thì người đó tưởng tượng về Abhibhū với sự tưởng tượng của kiêu mạn (mānamaññanā).
‘‘Abhibhū nicco dhuvo’’tiādinā nayena parāmasanto abhibhuṃ diṭṭhimaññanāya maññatīti veditabbo.
It should be understood that one who grasps in the manner of, “Abhibhū is permanent, stable,” and so on, conceives of Abhibhū through view-conceiving.
Và khi suy nghĩ rằng: “Abhibhū là thường còn, vĩnh cửu,” v.v., thì người đó tưởng tượng về Abhibhū với sự tưởng tượng của tà kiến (diṭṭhimaññanā).
Sesaṃ pajāpativāre vuttanayameva.
The rest is just as was stated in the section on Pajāpati.
Phần còn lại tương tự như cách đã nói trong phần về Pajāpati.
4. Evaṃ bhagavā paṭipāṭiyā devaloke dassentopi abhibhūvacanena asaññabhavaṃ dassetvā idāni yasmā ayaṃ vaṭṭakathā, suddhāvāsā ca vivaṭṭapakkhe ṭhitā, anāgāmikhīṇāsavā eva hi te devā.
4. Thus the Blessed One, having shown the devalokas in sequence and having shown the sphere of non-percipient beings by the word Abhibhū, now—because this is a discourse on the cycle of rebirth, and the Suddhāvāsas stand on the side of that which escapes the cycle, for those devas are exclusively non-returners and arahants.
4. Như vậy, Đức Thế Tôn đã tuần tự chỉ ra các cõi trời, và sau khi chỉ ra cõi Vô tưởng hữu (asaññabhava) bằng từ Abhibhū, bây giờ, vì đây là một câu chuyện về luân hồi (vaṭṭakathā), và các cõi Tịnh Cư (suddhāvāsā) thì đứng về phía giải thoát (vivaṭṭapakkha), vì các vị trời ở đó đều là những vị Bất lai (anāgāmī) và A-la-hán (khīṇāsava).
Yasmā vā katipayakappasahassāyukā te devā, buddhuppādakāleyeva honti.
Or because those devas have a lifespan of only several thousand kappas and exist only during the time of a Buddha's appearance.
Hoặc, vì các vị trời đó có tuổi thọ vài ngàn kiếp, họ chỉ xuất hiện vào thời kỳ Đức Phật ra đời.
Buddhā pana asaṅkheyepi kappe na uppajjanti, tadā suññāpi sā bhūmi hoti.
But Buddhas do not arise even for an incalculable number of kappas, and at that time, that plane is empty.
Nhưng các vị Phật thì không xuất hiện trong vô số kiếp, nên khi đó cõi đó cũng trống rỗng.
Rañño khandhāvāraṭṭhānaṃ viya hi buddhānaṃ suddhāvāsabhavo.
For the Suddhāvāsa sphere is like a king's encampment for the Buddhas.
Cõi Tịnh Cư của các vị Phật giống như nơi đóng quân của một vị vua.
Te teneva ca kāraṇena viññāṇaṭṭhitisattāvāsavasenapi na gahitā, sabbakālikā pana imā maññanā.
And for that very reason, they are not included in the stations of consciousness or the abodes of beings; but these conceivings are perennial.
Và vì lý do đó, chúng không được bao gồm trong các trú xứ của thức (viññāṇaṭṭhiti) và các trú xứ của chúng sinh (sattāvāsa), nhưng những tưởng tượng này là vĩnh cửu.
Tasmā tāsaṃ sadāvijjamānabhūmiṃ dassento suddhāvāse atikkamitvā, ākāsānañcāyatanantiādimāha.
Therefore, showing their ever-existing plane, having passed beyond the Suddhāvāsa realms, he said, 'the base of infinite space', and so on.
Do đó, để chỉ ra cảnh giới luôn hiện hữu của những tưởng tri đó, Đức Phật đã vượt qua các Tịnh Cư Thiên và nói về không vô biên xứ (ākāsānañcāyatana) và các cảnh giới tương tự.
Tattha ākāsānañcāyatananti tabbhūmikā cattāro kusalavipākakiriyā khandhā.
Therein, 'the base of infinite space' refers to the four wholesome, resultant, and functional aggregates belonging to that plane.
Trong đó, không vô biên xứ (ākāsānañcāyatana) là bốn uẩn thiện, quả và hành thuộc cảnh giới đó.
Te ca tatrūpapannāyeva daṭṭhabbā bhavaparicchedakathā ayanti katvā.
And they should be seen as belonging only to those reborn there, because this is a discourse defining the planes of existence.
Và những uẩn đó phải được hiểu là chỉ những gì tái sinh trong cảnh giới đó, vì đây là lời thuyết minh về sự phân định các cõi tồn tại.
Esa nayo viññāṇañcāyatanādīsu.
This is the method for 'the base of infinite consciousness' and so on.
Nguyên tắc này cũng áp dụng cho thức vô biên xứ (viññāṇañcāyatana) và các cảnh giới khác.
Atthayojanā pana catūsupi etesu vāresu abhibhūvāre vuttanayeneva veditabbā.
The application of meaning in all four of these sections, however, should be understood in the way stated in the section on Abhibhū.
Tuy nhiên, cách giải thích ý nghĩa trong cả bốn trường hợp này phải được hiểu theo phương pháp đã nói trong trường hợp Abhibhū.
Mānamaññanā cettha pajāpativāre vuttanayenāpi yujjati.
And here, the conceiving through conceit is also suitable in the way stated in the section on Pajāpati.
Ở đây, tưởng tri ngã mạn cũng phù hợp với phương pháp đã nói trong trường hợp Pajāpati.
Tattha diṭṭhanti maṃsacakkhunāpi diṭṭhaṃ, dibbacakkhunāpi diṭṭhaṃ.
Therein, 'the seen' is what is seen with the physical eye and also what is seen with the divine eye.
Trong đó, cái thấy (diṭṭhaṃ) là cái được thấy bằng nhục nhãn, và cũng là cái được thấy bằng thiên nhãn.
Rūpāyatanassetaṃ adhivacanaṃ.
This is a designation for the visible-form base.
Đây là tên gọi của sắc xứ.
Tattha diṭṭhaṃ maññatīti diṭṭhaṃ tīhi maññanāhi maññati.
Therein, 'conceives the seen' means one conceives the seen through the three kinds of conceiving.
Trong đó, cho cái thấy là cái thấy (diṭṭhaṃ maññati) nghĩa là cho cái thấy là cái thấy bằng ba loại tưởng tri.
Rūpāyatanaṃ subhasaññāya sukhasaññāya ca passanto tattha chandarāgaṃ janeti, taṃ assādeti abhinandati.
Perceiving the visible-form base with a perception of beauty and a perception of pleasure, one generates sensual desire for it, savors it, and delights in it.
Khi thấy sắc xứ với tưởng là đẹp và tưởng là lạc, người đó sinh ra dục ái, tận hưởng và hoan hỷ với nó.
Vuttampi hetaṃ bhagavatā ‘‘itthirūpe, bhikkhave, sattā rattā giddhā gadhitā mucchitā ajjhosannā, te dīgharattaṃ socanti itthirūpavasānugā’’ti (a. ni. 5.55).
For this was said by the Blessed One: "Monks, beings are impassioned, greedy, infatuated, besotted, and attached to the form of a woman; following the sway of a woman's form, they grieve for a long time."
Điều này cũng đã được Đức Thế Tôn nói: “Này các Tỳ-kheo, các chúng sinh bị tham ái, bị mê đắm, bị trói buộc, bị chìm đắm trong sắc tướng phụ nữ, họ phải sầu khổ trong một thời gian dài vì bị sắc tướng phụ nữ chi phối.”
Evaṃ diṭṭhaṃ taṇhāmaññanāya maññati.
In this way, one conceives the seen through the conceiving of craving.
Như vậy, người đó cho cái thấy là cái thấy bằng tưởng tri tham ái.
‘‘Iti me rūpaṃ siyā anāgatamaddhānanti vā panettha nandiṃ samannāneti, rūpasampadaṃ vā pana ākaṅkhamāno dānaṃ detī’’ti vitthāro.
Or one brings delight to it, thinking, "May such be my form in the future," or desiring perfection of form, one gives alms—this is the detailed explanation.
Và ở đây, người đó hoan hỷ với ý nghĩ “mong rằng sắc tướng của ta sẽ như thế này trong tương lai”, hoặc mong muốn có được sắc tướng tốt đẹp nên bố thí.
Evampi diṭṭhaṃ taṇhāmaññanāya maññati.
In this way too, one conceives the seen through the conceiving of craving.
Như vậy, người đó cũng cho cái thấy là cái thấy bằng tưởng tri tham ái.
Attano pana parassa ca rūpasampattiṃ vipattiṃ nissāya mānaṃ janeti.
Furthermore, depending on the perfection or imperfection of one's own or another's form, one generates conceit.
Tuy nhiên, người đó sinh ngã mạn dựa trên sự tốt đẹp hay sự xấu xa của sắc tướng của mình và của người khác.
‘‘Imināhaṃ seyyosmī’’ti vā ‘‘sadisosmī’’ti vā ‘‘hīnosmī’’ti vāti evaṃ diṭṭhaṃ mānamaññanāya maññati.
"By this I am superior," or "I am equal," or "I am inferior"—in this way, one conceives the seen through the conceiving of conceit.
Với ý nghĩ “ta hơn người này”, hoặc “ta bằng người này”, hoặc “ta kém người này”, như vậy, người đó cho cái thấy là cái thấy bằng tưởng tri ngã mạn.
Rūpāyatanaṃ pana niccaṃ dhuvaṃ sassatanti maññati, attānaṃ attaniyanti maññati, maṅgalaṃ amaṅgalanti maññati, evaṃ diṭṭhaṃ diṭṭhimaññanāya maññati.
Moreover, one conceives the visible-form base as permanent, stable, and eternal; one conceives it as self or what belongs to self; one conceives something as auspicious or inauspicious—in this way, one conceives the seen through the conceiving of views.
Người đó lại cho rằng sắc xứ là thường, kiên cố, vĩnh cửu; cho rằng mình là tự ngã, là của mình; cho rằng cái tốt là xấu và cái xấu là tốt; như vậy, người đó cho cái thấy là cái thấy bằng tưởng tri tà kiến.
Evaṃ diṭṭhaṃ tīhi maññanāhi maññati.
Thus one conceives the seen through the three kinds of conceiving.
Như vậy, người đó cho cái thấy là cái thấy bằng ba loại tưởng tri.
Kathaṃ diṭṭhasmiṃ maññati?
How does one conceive in the seen?
Thế nào là cho cái thấy là cái thấy trong cái thấy?
Rūpasmiṃ attānaṃ samanupassananayena maññanto diṭṭhasmiṃ maññati.
One conceives in the seen by conceiving in the manner of contemplating self in form.
Khi người đó nhận thấy tự ngã trong sắc tướng theo cách nhận thấy, người đó cho cái thấy là cái thấy trong cái thấy.
Yathā vā dhane dhaññe.
Or it is like in the case of wealth and grain.
Cũng như trong tài sản và ngũ cốc.
Evaṃ rūpasmiṃ rāgādayoti maññantopi diṭṭhasmiṃ maññati.
In this way, one who conceives "in form, there are lust and so on" also conceives in the seen.
Như vậy, khi nhận thấy tham ái, v.v., trong sắc tướng, người đó cũng cho cái thấy là cái thấy trong cái thấy.
Ayamassa diṭṭhimaññanā.
This is one's conceiving of views.
Đây là tưởng tri tà kiến của người đó.
Tasmiññeva panassa diṭṭhimaññanāya maññite vatthusmiṃ sinehaṃ mānañca uppādayato taṇhāmānamaññanāpi veditabbā.
Furthermore, for one who generates affection and conceit in that very object conceived through the conceiving of views, the conceiving of craving and conceit should also be understood.
Và đối với người đó, khi sinh ra sự yêu thích và ngã mạn dựa trên đối tượng đã được nhận thấy bằng tưởng tri tà kiến đó, thì tưởng tri tham ái và ngã mạn cũng phải được hiểu.
Evaṃ diṭṭhasmiṃ maññati.
In this way, one conceives in the seen.
Như vậy, người đó cho cái thấy là cái thấy trong cái thấy.
Sesaṃ pathavīvāre vuttanayeneva veditabbaṃ.
The remainder should be understood in the manner stated in the section on earth.
Phần còn lại phải được hiểu theo phương pháp đã nói trong trường hợp đất.
Ekattanti iminā hi samāpannakavāraṃ dasseti.
Indeed, by 'oneness', he indicates the section on the attained.
Với từ đồng nhất (ekattaṃ), Đức Phật chỉ ra trường hợp nhập định.
Nānattanti iminā asamāpannakavāraṃ.
By 'diversity', he indicates the section on the unattained.
Với từ khác biệt (nānattaṃ), Ngài chỉ ra trường hợp không nhập định.
Tesaṃ ayaṃ vacanattho ekabhāvo ekattaṃ. Nānābhāvo nānattanti.
This is their etymology: the state of being one is oneness. The state of being diverse is diversity.
Ý nghĩa của những từ này là: trạng thái một là đồng nhất (ekattaṃ). Trạng thái khác biệt là khác biệt (nānattaṃ).
Yojanā panettha samāpannakavāraṃ catūhi khandhehi, asamāpannakavārañca pañcahi khandhehi bhinditvā ‘‘rūpaṃ attato samanupassatī’’tiādinā sāsananayena pathavīvārādīsu vuttena ca aṭṭhakathānayena yathānurūpaṃ vīmaṃsitvā veditabbā.
The application here should be understood by dividing the section on the attained by the four aggregates, and the section on the unattained by the five aggregates, and then investigating it appropriately according to the method of the teaching, such as "one contemplates form as self," and according to the method of the commentary stated in the sections on earth and so on.
Ở đây, cách giải thích phải được hiểu bằng cách phân chia trường hợp nhập định thành bốn uẩn, và trường hợp không nhập định thành năm uẩn, và suy xét theo giáo lý như “nhận thấy sắc là tự ngã”, v.v., và theo phương pháp chú giải đã nói trong trường hợp đất, v.v., một cách phù hợp.
Keci pana ekattanti ekattanayaṃ vadanti nānattanti nānattanayaṃ.
Some, however, say that 'oneness' refers to the method of oneness and 'diversity' refers to the method of diversity.
Một số người lại nói rằng đồng nhất (ekattaṃ) là phương pháp đồng nhất, khác biệt (nānattaṃ) là phương pháp khác biệt.
Apare ‘‘ekattasaññī attā hoti arogo paraṃ maraṇā, nānattasaññī attā hotī’’ti evaṃ diṭṭhābhinivesaṃ.
Others refer to the adherence to a view such as, "The self with a perception of oneness is without illness after death; the self with a perception of diversity is..."
Những người khác lại nói rằng đó là sự chấp thủ tà kiến như: “Tự ngã có tưởng đồng nhất sẽ không bệnh hoạn sau khi chết, tự ngã có tưởng khác biệt sẽ không bệnh hoạn sau khi chết.”
Taṃ sabbaṃ idha nādhippetattā ayuttameva hoti.
All of that, not being intended here, is indeed unsuitable.
Tất cả những điều đó đều không phù hợp vì không được đề cập ở đây.
Evaṃ sabbaṃ sakkāyaṃ dvidhā dassetvā idāni tameva ekadhā sampiṇḍetvā dassento sabbaṃ sabbatotiādimāha.
Having thus shown the entire personality-belief in two ways, now, in order to show it summarized in one way, he said, 'all as all', and so on.
Sau khi đã chỉ ra tất cả sắc thân (sakkāya) theo hai cách, bây giờ Đức Phật lại tóm tắt và chỉ ra điều đó theo một cách duy nhất, và nói rằng: tất cả từ tất cả (sabbaṃ sabbato), v.v.
Yojanānayo panettha sabbaṃ assādento sabbaṃ taṇhāmaññanāya maññati.
The method of application here is that one who savors all, conceives all through the conceiving of craving.
Ở đây, phương pháp giải thích phải được hiểu là: khi tận hưởng tất cả, người đó cho tất cả là tất cả bằng tưởng tri tham ái.
‘‘Mayā ete sattā nimmitā’’tiādinā nayena attanā nimmitaṃ maññanto sabbaṃ mānamaññanāya maññati.
One who conceives what has been created by oneself in the manner of "these beings were created by me," and so on, conceives all through the conceiving of conceit.
Khi cho rằng “những chúng sinh này do ta tạo ra” theo cách đó, người đó cho tất cả là tất cả bằng tưởng tri ngã mạn.
‘‘Sabbaṃ pubbekatakammahetu, sabbaṃ issaranimmānahetu, sabbaṃ ahetuapaccayā, sabbaṃ atthi, sabbaṃ natthī’’tiādinā nayena maññanto sabbaṃ diṭṭhimaññanāya maññatīti veditabbo.
It should be understood that one who conceives in the manner of "everything is due to past kamma," "everything is due to creation by a lord," "everything is without cause or condition," "everything exists," "everything does not exist," and so on, conceives all through the conceiving of views.
Khi cho rằng “tất cả là do nghiệp đã làm từ trước, tất cả là do sự tạo hóa của thần linh, tất cả là do không có nguyên nhân và điều kiện, tất cả là có, tất cả là không” theo cách đó, người đó cho tất cả là tất cả bằng tưởng tri tà kiến.
Kathaṃ sabbasmiṃ maññati?
How does one conceive in all?
Thế nào là cho tất cả là tất cả trong tất cả?
Idhekacco evaṃdiṭṭhiko hoti ‘‘mahā me attā’’ti.
Here, a certain person holds the view, "My self is great."
Ở đây, một số người có tà kiến như: “Tự ngã của ta thật vĩ đại.”
So sabbalokasannivāsaṃ tassokāsabhāvena parikappetvā so kho pana me ayaṃ attā sabbasminti maññati, ayamassa diṭṭhimaññanā.
He imagines the entire inhabited world as its location and conceives, "This self of mine is in everything." This is his conceiving of views.
Người đó tưởng tượng tất cả chúng sinh trong thế gian là nơi trú ngụ của tự ngã vĩ đại đó, và cho rằng “tự ngã này của ta ở trong tất cả”; đây là tưởng tri tà kiến của người đó.
Tasmiṃyeva panassa attani sinehaṃ tabbatthukañca mānaṃ uppādayato taṇhāmānamaññanāpi veditabbā.
Furthermore, for one who generates affection for that very self and conceit based on it, the conceiving of craving and conceit should also be understood.
Và đối với người đó, khi sinh ra sự yêu thích trong tự ngã đó và ngã mạn liên quan đến đối tượng đó, thì tưởng tri tham ái và ngã mạn cũng phải được hiểu.
Sesaṃ pathavīvāre vuttanayeneva veditabbaṃ.
The remainder should be understood in the manner stated in the section on earth.
Phần còn lại phải được hiểu theo phương pháp đã nói trong trường hợp đất.
Evaṃ sabbaṃ sakkāyaṃ ekadhā dassetvā idāni aparenapi nayena taṃ ekadhā dassento nibbānaṃ nibbānatoti āha.
Having thus shown the entire personality-belief in one way, now, in order to show it in one way by another method, he said, 'Nibbāna as Nibbāna'.
Sau khi đã chỉ ra tất cả sắc thân (sakkāya) theo một cách duy nhất, bây giờ Đức Phật lại chỉ ra điều đó theo một cách khác, và nói rằng: Niết-bàn từ Niết-bàn (nibbānaṃ nibbānato).
Tattha nibbānanti ‘‘yato kho, bho, ayaṃ attā pañcahi kāmaguṇehi samappito samaṅgibhūto paricāreti.
Therein, by 'Nibbāna' should be understood the supreme Nibbāna-in-this-very-life which is presented in five ways, according to the method beginning, "Venerable sir, it is insofar as this self enjoys itself, being endowed and provided with the five cords of sensual pleasure..."
Trong đó, Niết-bàn (nibbānaṃ) phải được hiểu là Niết-bàn tối thượng được thấy trong đời này, được nói đến theo năm cách như: “Này các bạn, khi tự ngã này được trang bị và đầy đủ năm dục lạc, nó tận hưởng. Này các bạn, cho đến chừng đó, tự ngã này đã đạt đến Niết-bàn tối thượng được thấy trong đời này.”
Ettāvatā kho, bho, ayaṃ attā paramadiṭṭhadhammanibbānaṃ patto hotī’’tiādinā nayena pañcadhā āgataṃ paramadiṭṭhadhammanibbānaṃ veditabbaṃ.
"...To that extent, venerable sir, this self has attained the supreme Nibbāna-in-this-very-life."
Trong đó, khi tận hưởng Niết-bàn, người đó cho Niết-bàn là Niết-bàn bằng tưởng tri tham ái.
Tattha nibbānaṃ assādento taṇhāmaññanāya maññati.
Therein, one who savors that Nibbāna conceives it through the conceiving of craving.
Khi sinh ngã mạn bằng Niết-bàn đó rằng “ta đã đạt đến Niết-bàn”, người đó cho Niết-bàn là Niết-bàn bằng tưởng tri ngã mạn.
Tena nibbānena ‘‘ahamasmi nibbānaṃ patto’’ti mānaṃ janento mānamaññanāya maññati.
One who generates conceit, "I have attained Nibbāna" by means of that Nibbāna, conceives it through the conceiving of conceit.
Khi cho rằng cái không phải Niết-bàn là Niết-bàn, là thường, v.v., người đó cho Niết-bàn là Niết-bàn bằng tưởng tri tà kiến.
Anibbānaṃyeva samānaṃ taṃ nibbānato niccādito ca gaṇhanto diṭṭhimaññanāya maññatīti veditabbo.
It should be understood that one who grasps that which, while not being Nibbāna, as Nibbāna and as permanent, etc., conceives it through the conceiving of views.
Như vậy, điều đó phải được hiểu.
Nibbānato pana aññaṃ attānaṃ gahetvā so kho pana me ayaṃ attā imasmiṃ nibbāneti maññanto nibbānasmiṃ maññati, ayamassa diṭṭhimaññanā.
Furthermore, having taken a self as other than Nibbāna, one conceives in Nibbāna, thinking, "This self of mine is in this Nibbāna." This is one's conceiving of views.
Tuy nhiên, khi chấp thủ một tự ngã khác với Niết-bàn và cho rằng “tự ngã này của ta ở trong Niết-bàn đó”, người đó cho Niết-bàn là Niết-bàn trong Niết-bàn; đây là tưởng tri tà kiến của người đó.
Tasmiṃyeva panassa attani sinehaṃ tabbatthukañca mānaṃ uppādayato taṇhāmānamaññanāpi veditabbā.
Furthermore, for one who generates affection for that very self and conceit based on it, the conceiving of craving and conceit should also be understood.
Và đối với người đó, khi sinh ra sự yêu thích trong tự ngã đó và ngã mạn liên quan đến đối tượng đó, thì tưởng tri tham ái và ngã mạn cũng phải được hiểu.
Esa nayo nibbānato maññanāyapi.
This is also the method for conceiving from Nibbāna.
Nguyên tắc này cũng áp dụng cho tưởng tri từ Niết-bàn.
Tatrapi hi nibbānato aññaṃ attānaṃ gahetvā ‘‘idaṃ nibbānaṃ, ayaṃ attā, so kho pana me ayaṃ attā ito nibbānato añño’’ti maññanto nibbānato maññati, ayamassa diṭṭhimaññanā.
Therein, too, having taken a self other than nibbāna, conceiving 'this is nibbāna, this is self, but this self of mine is other than this nibbāna,' one conceives 'from nibbāna'; this is one's conceiving through wrong view (diṭṭhimaññanā).
Trong trường hợp đó, một người chấp thủ tự ngã khác với Nibbāna, nghĩ rằng: “Đây là Nibbāna, đây là tự ngã, và tự ngã này của ta khác với Nibbāna này,” thì người ấy suy nghĩ về Nibbāna* khác với nó. Đây là sự suy nghĩ sai lầm về quan điểm (diṭṭhimaññanā) của người ấy.
Tasmiṃyeva panassa attani sinehaṃ tabbatthukañca mānaṃ uppādayato taṇhāmānamaññanāpi veditabbā.
And for one who arouses affection for that very self and conceit based on it, the conceivings of craving and conceit (taṇhāmānamaññanā) should also be understood.
Và khi người ấy phát sinh sự yêu thích đối với tự ngã đó và sự kiêu mạn dựa trên đối tượng đó, thì cũng cần phải hiểu đó là sự suy nghĩ sai lầm do tham ái và kiêu mạn (taṇhāmānamaññanā).
‘‘Aho sukhaṃ mama nibbāna’’nti maññanto pana nibbānaṃ meti maññatīti veditabbo.
But one who conceives, "Oh, how blissful is my nibbāna!" should be understood as conceiving, "nibbāna is mine."
Còn người nào nghĩ rằng: “Ôi, Nibbāna của ta thật là an lạc,” thì cần phải hiểu rằng người ấy nghĩ Nibbāna là của mình.
Sesaṃ vuttanayameva.
The remainder is in the same way as has been stated.
Phần còn lại cũng theo cách đã nói.
Ayaṃ panettha anugīti –
This is the summary verse here –
Đây là bài kệ tổng hợp ở đây:
7. Evaṃ bhagavā pathavīādīsu vatthūsu sabbasakkāyadhammamūlabhūtaṃ puthujjanassa pavattiṃ dassetvā idāni tesveva vatthūsu sekkhassa pavattiṃ dassento yopi so, bhikkhave, bhikkhu sekkhotiādimāha.
7. Thus the Blessed One, having shown the process of the ordinary person in things such as earth, which is the root of all phenomena of the identity-group, now, wishing to show the process of the learner in those very same things, said, "And also that bhikkhu, O bhikkhus, who is a learner," and so on.
7. Như vậy, Đức Thế Tôn đã chỉ ra sự tồn tại của người phàm phu, là gốc rễ của tất cả các pháp sắc thân (sakkāyadhamma) trong các đối tượng như địa đại. Giờ đây, Ngài muốn chỉ ra sự tồn tại của bậc Hữu học (sekkhassa) trong các đối tượng đó, nên Ngài đã nói lời mở đầu: "Này các Tỳ-khưu, vị Tỳ-khưu nào là bậc Hữu học (yopi so, bhikkhave, bhikkhu sekkho)..."
Tattha yoti uddesavacanaṃ.
Therein, "And also that" (yo pi so) is an introductory statement.
Trong đó, từ "yo" là từ chỉ định (uddesavacana).
Soti niddesavacanaṃ.
"He" (so) is a referential statement.
Từ "so" là từ giải thích (niddesavacana).
Pikāro sampiṇḍanattho ayampi dhammo aniyatotiādīsu viya.
The particle "pi" (also) is for the purpose of inclusion, as in phrases like "this phenomenon is also undetermined."
Chữ "pi" có nghĩa là tổng hợp, như trong các trường hợp "dhammo aniyato" (pháp này cũng không cố định) và tương tự.
Tena ca ārammaṇasabhāgena puggalaṃ sampiṇḍeti, no puggalasabhāgena, heṭṭhato hi puggalā diṭṭhivipannā, idha diṭṭhisampannā, na tesaṃ sabhāgatā atthi.
And by this, it includes the person by way of the object being similar, not by the nature of the person being similar, for the persons in the preceding section are corrupt in view, whereas here they are accomplished in view; there is no similarity in their nature.
Và với chữ đó, Ngài tổng hợp các cá nhân theo sự tương đồng về đối tượng (ārammaṇasabhāgena), chứ không phải theo sự tương đồng về cá nhân (puggalasabhāgena). Bởi vì, ở phần dưới, các cá nhân là những người có tà kiến (diṭṭhivipannā), còn ở đây, họ là những người có chánh kiến (diṭṭhisampannā), nên không có sự tương đồng về bản chất giữa họ.
Ārammaṇaṃ pana heṭṭhā puggalānampi tadeva, imesampi tadevāti.
The object, however, is the same for the persons in the preceding section and for these persons here.
Tuy nhiên, đối tượng (ārammaṇa) của các cá nhân ở phần dưới cũng là đó, và đối tượng của các vị này cũng là đó.
Tena vuttaṃ ‘‘ārammaṇasabhāgena puggalaṃ sampiṇḍeti no puggalasabhāgenā’’ti.
Therefore it was said, "it includes the person by way of the object being similar, not by the nature of the person being similar."
Vì vậy, đã nói rằng: "Ngài tổng hợp các cá nhân theo sự tương đồng về đối tượng, chứ không phải theo sự tương đồng về cá nhân."
Yopi soti iminā pana sakalena vacanena idāni vattabbaṃ sekkhaṃ dassetīti veditabbo.
But it should be understood that by this entire phrase "And also that" he indicates the learner who is now to be discussed.
Và cần phải hiểu rằng, với toàn bộ câu "yopi so" này, Ngài chỉ ra bậc Hữu học sẽ được nói đến bây giờ.
Bhikkhave, bhikkhūti idaṃ vuttanayameva.
"O bhikkhus, a bhikkhu"—this is in the same way as has been explained.
"Này các Tỳ-khưu, Tỳ-khưu" (Bhikkhave, bhikkhū) cũng theo cách đã nói.
Sekkhoti kenaṭṭhena sekkho?
Learner (sekkha)—in what sense is he a learner?
Bậc Hữu học (Sekkho) có nghĩa là gì?
Sekkhadhammappaṭilābhato sekkho. Vuttañhetaṃ ‘‘kittāvatā nu kho, bhante, sekkho hotīti?
From the attainment of the states of a learner, he is a learner. For this has been said: "To what extent, venerable sir, is one a learner?
Vì đã đạt được các pháp của bậc Hữu học (sekkhadhamma), nên gọi là Hữu học (sekkhā). Điều này đã được nói: "Bạch Thế Tôn, đến mức độ nào thì gọi là bậc Hữu học? Này các Tỳ-khưu, ở đây, một Tỳ-khưu thành tựu chánh kiến của bậc Hữu học... (v.v.)... thành tựu chánh định của bậc Hữu học. Này các Tỳ-khưu, đến mức độ đó thì Tỳ-khưu được gọi là bậc Hữu học."
Idha, bhikkhave, bhikkhu sekkhāya sammādiṭṭhiyā samannāgato hoti…pe… sekkhena sammāsamādhinā samannāgato hoti.
Here, O bhikkhus, a bhikkhu is endowed with the learner's right view... and so on... endowed with the learner's right concentration.
Ở đây, này các Tỳ-khưu, một Tỳ-khưu thành tựu chánh kiến của bậc Hữu học... (v.v.)... thành tựu chánh định của bậc Hữu học.
Ettāvatā kho bhikkhu, sekkho hotī’’ti (saṃ. ni. 5.13).
To this extent, O bhikkhus, one is a learner."
Này các Tỳ-khưu, đến mức độ đó thì Tỳ-khưu được gọi là bậc Hữu học (Saṃ. Ni. 5.13).
Apica sikkhatītipi sekkho.
Moreover, he is a learner because he trains (sikkhati).
Hơn nữa, vì đang học (sikkhati) nên cũng gọi là Hữu học (sekkhā).
Vuttañhetaṃ ‘‘sikkhatīti kho bhikkhu tasmā sekkhoti vuccati.
For this has been said: "He trains, O bhikkhus, therefore he is called a learner.
Điều này đã được nói: "Này Tỳ-khưu, vì đang học (sikkhati), nên được gọi là Hữu học (sekkhā)."
Kiñca sikkhati?
And what does he train in?
Và học gì?
Adhisīlampi sikkhati, adhicittampi sikkhati, adhipaññampi sikkhati, sikkhatīti kho bhikkhu tasmā sekkhoti vuccatī’’ti (a. ni. 3.86).
He trains in the higher virtue, he trains in the higher mind, he trains in the higher wisdom. He trains, O bhikkhus, therefore he is called a learner."
Học giới tăng thượng (adhisīla), học tâm tăng thượng (adhicitta), học tuệ tăng thượng (adhipaññā). Này Tỳ-khưu, vì đang học (sikkhati), nên được gọi là Hữu học (sekkhā)" (A. Ni. 3.86).
Appattaṃ mānasaṃ etenāti appattamānaso.
"One whose mind has not reached the goal" (appattamānaso) is so called because the mind (mānasa) has not yet been reached by him.
Appattamānaso có nghĩa là người chưa đạt được tâm (mānasa) đó.
Mānasanti rāgopi cittampi arahattampi.
Mind (mānasa) can mean passion, consciousness, or arahantship.
Mānasa có thể là tham ái (rāga), tâm (citta) hoặc A-la-hán quả (arahatta).
‘‘Antalikkhacaro pāso, yvāyaṃ carati mānaso’’ti (mahāva. 33; saṃ. ni. 1.151) ettha hi rāgo mānasaṃ.
For in the passage "The snare that moves in space, that which moves with the mind (mānaso)," passion is meant by mānasa.
Trong câu "Antalikkhacaro pāso, yvāyaṃ carati mānaso" (Mahāva. 33; Saṃ. Ni. 1.151), mānasa là tham ái.
‘‘Cittaṃ mano mānasa’’nti (dha. sa. 65) ettha cittaṃ.
In "Consciousness, mind, mentality (cittaṃ mano mānasaṃ)," consciousness is meant.
Trong câu "Cittaṃ mano mānasaṃ" (Dha. Sa. 65), mānasa là tâm.
‘‘Appattamānaso sekkho, kālaṃ kayirā janesutā’’ti (saṃ. ni. 1.159) ettha arahattaṃ.
In "The learner whose mind has not reached the goal (appattamānaso), should he die, O Janesuta," arahantship is meant.
Trong câu "Appattamānaso sekkho, kālaṃ kayirā janesutā" (Saṃ. Ni. 1.159), mānasa là A-la-hán quả.
Idhāpi arahattameva adhippetaṃ.
Here, too, arahantship itself is intended.
Ở đây, A-la-hán quả là ý nghĩa được đề cập.
Tena appattārahattoti vuttaṃ hoti.
Therefore, it means "one who has not attained arahantship."
Do đó, có nghĩa là người chưa đạt được A-la-hán quả (appattārahatto).
Anuttaranti seṭṭhaṃ, asadisanti attho.
"Unsurpassed" (anuttaraṃ) means supreme, incomparable.
Anuttara có nghĩa là tối thượng, vô song.
Catūhi yogehi khemaṃ ananuyuttanti yogakkhemaṃ, arahattameva adhippetaṃ.
"Security from the yokes" (yogakkhemaṃ) means security from the four yokes, where one is not yoked; arahantship itself is intended.
Yogakkhemaṃ có nghĩa là an toàn khỏi bốn loại ràng buộc (yoga), không bị ràng buộc bởi chúng; A-la-hán quả là ý nghĩa được đề cập.
Patthayamānoti dve patthanā taṇhāpatthanā ca, chandapatthanā ca.
"Aspiring" (patthayamāno)—there are two kinds of aspiration: aspiration of craving and aspiration of wholesome desire (chanda).
Patthayamāno có hai loại ước muốn: ước muốn do tham ái (taṇhāpatthanā) và ước muốn do ý muốn (chandapatthanā).
‘‘Patthayamānassa hi pajappitāni, pavedhitaṃ vāpi pakappitesū’’ti (su. ni. 908) ettha taṇhāpatthanā.
In the passage "For one who is aspiring, there are imaginings, or agitation concerning what is conceived," aspiration of craving is meant.
Trong câu "Patthayamānassa hi pajappitāni, pavedhitaṃ vāpi pakappitesu" (Su. Ni. 908), đó là ước muốn do tham ái.
Ettha kattukamyatā kusalacchandapatthanā.
Here, the wholesome desire to act is the aspiration of wholesome desire.
Ở đây, đó là ước muốn thiện lành do ý muốn làm (kattukamyatā kusalacchandapatthanā).
Ayameva idhādhippetā.
This very one is intended here.
Đây chính là điều được đề cập ở đây.
Tena patthayamānoti taṃ yogakkhemaṃ pattukāmo adhigantukāmo tanninno tappoṇo tappabbhāroti veditabbo.
Therefore, by "aspiring" it should be understood as: desiring to attain that security from the yokes, wishing to realize it, being inclined towards it, bent on it, heading for it.
Do đó, patthayamāno cần được hiểu là người mong muốn đạt được, muốn chứng đắc sự an toàn đó, hướng về nó, nghiêng về nó, thiên về nó.
Viharatīti aññaṃ iriyāpathadukkhaṃ aññena iriyāpathena vicchinditvā aparipatantaṃ kāyaṃ harati.
"Dwells" (viharati) means he carries on the body, which would otherwise perish, by dispelling the suffering of one posture with another posture.
Viharatī có nghĩa là vị ấy duy trì thân thể không bị suy yếu, bằng cách chấm dứt một loại khổ đau do tư thế này bằng một tư thế khác.
Atha vā ‘‘sabbe saṅkhārā aniccāti adhimuccanto saddhāya viharatī’’tiādināpi niddesanayenettha attho daṭṭhabbo.
Or, the meaning here should be seen according to the expository method such as: "Being convinced that 'all conditioned things are impermanent,' he dwells with faith."
Hoặc, ý nghĩa ở đây cần được hiểu theo cách giải thích như trong "adhimuccanto sabbasaṅkhārā aniccāti saddhāya viharati" (tin tưởng rằng tất cả các pháp hữu vi là vô thường, và sống với niềm tin đó) và tương tự.
Pathaviṃ pathavito abhijānātīti pathaviṃ pathavībhāvena abhijānāti, na puthujjano viya sabbākāraviparītāya saññāya sañjānāti.
"He directly knows earth as earth" (pathaviṃ pathavito abhijānāti) means he directly knows earth in its state as earth; he does not perceive it with a perception that is perverted in all ways like an ordinary person does.
Pathaviṃ pathavito abhijānātī có nghĩa là vị ấy nhận biết địa đại theo bản chất của địa đại, chứ không phải nhận biết bằng nhận thức sai lầm hoàn toàn như người phàm phu.
Apica kho abhivisiṭṭhena ñāṇena jānāti, evaṃ pathavīti etaṃ pathavībhāvaṃ adhimuccanto eva naṃ aniccātipi dukkhātipi anattātipi evaṃ abhijānātīti vuttaṃ hoti.
Moreover, he knows it with a distinguished knowledge; thus, being convinced of its state as earth, he directly knows it as impermanent, as suffering, and as not-self. This is what is meant.
Hơn nữa, vị ấy nhận biết bằng trí tuệ đặc biệt (abhivisiṭṭhena ñāṇena). Như vậy, khi tin tưởng vào bản chất địa đại này, vị ấy nhận biết nó là vô thường, là khổ, là vô ngã. Đó là điều đã được nói.
Evañca naṃ abhiññatvā pathaviṃ mā maññīti vuttaṃ hoti.
And having thus directly known it, it is said, "he should not conceive earth."
Và khi đã nhận biết như vậy, thì có nghĩa là đừng chấp thủ địa đại.
Maññatīti maññi. Ayaṃ pana maññī ca na maññī ca na vattabboti.
One who conceives is a "conceiver" (maññi). But this one cannot be said to be either a conceiver or a non-conceiver.
Maññi có nghĩa là chấp thủ (maññatīti). Tuy nhiên, không nên nói rằng đây là chấp thủ hay không chấp thủ.
Etasmiñhi atthe idaṃ padaṃ nipātetvā vuttanti veditabbaṃ.
It should be understood that this word has been specially formed and stated in this sense.
Cần phải hiểu rằng từ này được sử dụng trong ngữ cảnh đó.
Ko panettha adhippāyoti.
What is the intention here?
Vậy ý nghĩa ở đây là gì?
Vuccate, puthujjano tāva sabbamaññanānaṃ appahīnattā maññatīti vutto.
It is said: An ordinary person, since all conceivings are unabandoned, is called one who "conceives."
Được nói rằng, người phàm phu được gọi là chấp thủ vì chưa đoạn trừ tất cả các chấp thủ.
Khīṇāsavo pahīnattā na maññatīti.
One who has destroyed the corruptions (khīṇāsava), since they are abandoned, is called one who "does not conceive."
Bậc A-la-hán không chấp thủ vì đã đoạn trừ chúng.
Sekkhassa pana diṭṭhimaññanā pahīnā, itarā pana tanubhāvaṃ gatā, tena so maññatītipi na vattabbo puthujjano viya, na maññatītipi na vattabbo khīṇāsavo viyāti.
But for a learner, conceiving through wrong view is abandoned, while the others have become attenuated; therefore, he cannot be said to "conceive" like an ordinary person, nor can he be said to "not conceive" like one who has destroyed the corruptions.
Đối với bậc Hữu học (sekha), tà kiến về sự tưởng tượng (diṭṭhimaññanā) đã được đoạn trừ, nhưng các tưởng tượng khác thì đã trở nên mỏng manh. Do đó, không thể nói rằng vị ấy tưởng tượng như một phàm nhân, cũng không thể nói rằng vị ấy không tưởng tượng như một bậc A-la-hán (khīṇāsava).
8. Evaṃ pathavīādīsu vatthūsu sekkhassa pavattiṃ dassetvā idāni khīṇāsavassa pavattiṃ dassento yopi so, bhikkhave, bhikkhu arahantiādimāha.
8. Having thus shown the occurrence in a learner (sekha) regarding objects such as earth, etc., now, to show the occurrence in one whose cankers are destroyed, he said, "And, monks, that bhikkhu who is an arahant..." and so on.
8. Như vậy, sau khi đã trình bày sự hành xử của vị học nhân trong các đối tượng như đất, v.v., bây giờ, để trình bày sự hành xử của vị A-la-hán, Đức Phật đã nói: Yopi so, bhikkhave, bhikkhu araha (Này các Tỳ-khưu, vị Tỳ-khưu A-la-hán đó) và tiếp theo.
Tattha yopīti pi-saddo sampiṇḍanattho.
Therein, in "And that..." the particle pi has the meaning of inclusion.
Trong đó, yopī (cũng vậy) – từ “pi” (cũng) có nghĩa là tổng hợp.
Tena idha ubhayasabhāgatāpi labbhatīti dasseti.
By this, he shows that here, the commonality of both is obtained.
Với từ đó, ở đây cũng có được sự tương đồng của cả hai (người và đối tượng).
Sekkho hi khīṇāsavena ariyapuggalattā sabhāgo, tena puggalasabhāgatā labbhati, ārammaṇasabhāgatā pana vuttanayā eva.
Indeed, the learner (sekha) is similar to one whose cankers are destroyed due to being a noble person (ariyapuggala); by this, the similarity of persons is obtained. The similarity of objects, however, is just as has been explained.
Thật vậy, vị học nhân tương đồng với vị A-la-hán vì là bậc Thánh nhân; do đó, có được sự tương đồng về người. Còn sự tương đồng về đối tượng thì đã được nói đến rồi.
Arahanti ārakakileso, dūrakileso pahīnakilesoti attho.
Arahant means one for whom the defilements are far (āraka-kileso), one for whom the defilements are distant (dūra-kileso), one whose defilements are abandoned.
Araha (A-la-hán) có nghĩa là vị có các phiền não đã được loại bỏ xa, các phiền não đã được dẹp bỏ, đã được đoạn trừ.
Vuttañcetaṃ bhagavatā ‘‘kathañca, bhikkhave, bhikkhu arahaṃ hoti?
And this was said by the Blessed One: "And how, monks, is a bhikkhu an arahant?
Điều này đã được Đức Thế Tôn nói rằng: “Này các Tỳ-khưu, thế nào một Tỳ-khưu là A-la-hán?
Ārakāssa honti pāpakā akusalā dhammā saṃkilesikā ponobbhavikā sadarā dukkhavipākā āyatiṃ jātijarāmaraṇiyā.
For him, evil, unwholesome states—defiling, leading to renewed existence, troublesome, resulting in suffering, and leading in the future to birth, aging, and death—are far away (ārakā).
Các pháp bất thiện, ô nhiễm, tái sinh, có khổ, có quả khổ, đưa đến sinh, già, chết trong tương lai của vị ấy đã được loại bỏ xa. Này các Tỳ-khưu, một Tỳ-khưu là A-la-hán như vậy đó.”
Evaṃ kho, bhikkhave, bhikkhu arahaṃ hotī’’ti.(Ma. ni. 1.434) khīṇāsavoti cattāro āsavā kāmāsavo…pe… avijjāsavo, ime cattāro āsavā arahato khīṇā pahīnā samucchinnā paṭippassaddhā, abhabbuppattikā ñāṇagginā daḍḍhā, tena vuccati khīṇāsavoti.
It is in this way, monks, that a bhikkhu is an arahant." One whose cankers are destroyed (khīṇāsavo): The four cankers are the canker of sensual pleasure... and so on... the canker of ignorance. For the arahant, these four cankers are destroyed, abandoned, cut off at the root, pacified, rendered incapable of arising, and burned by the fire of knowledge. Therefore, he is called 'one whose cankers are destroyed'.
Khīṇāsavo (vị đã đoạn tận các lậu hoặc) có nghĩa là: bốn lậu hoặc là dục lậu, ...v.v..., vô minh lậu. Bốn lậu hoặc này đối với vị A-la-hán đã được đoạn tận, đã được loại bỏ, đã được diệt trừ hoàn toàn, đã được an tịnh, không còn khả năng tái sinh, đã bị thiêu cháy bởi lửa trí tuệ. Do đó, vị ấy được gọi là Khīṇāsava.
Ohitabhāroti tayo bhārā khandhabhāro kilesabhāro abhisaṅkhārabhāroti, tassime tayo bhārā ohitā oropitā nikkhittā pātitā, tena vuccati ohitabhāroti.
Has laid down the burden (ohitabhāro): There are three burdens: the burden of the aggregates, the burden of the defilements, and the burden of formations. For him, these three burdens are laid down, set down, put aside, dropped. Therefore, he is called ohitabhāro.
Ohitabhāro (đã đặt xuống gánh nặng) có nghĩa là: có ba gánh nặng là gánh nặng uẩn, gánh nặng phiền não, gánh nặng hành. Đối với vị ấy, ba gánh nặng này đã được đặt xuống, đã được gỡ bỏ, đã được loại bỏ, đã được vứt bỏ. Do đó, vị ấy được gọi là ohitabhāro.
Anuppattasadatthoti anuppatto sadatthaṃ, sakatthanti vuttaṃ hoti.
Has attained his own goal (anuppattasadattho) means he has attained his own goal (sadatthaṃ). It is said to mean 'one's own goal' (sak'atthaṃ).
Anuppattasadattho (đã đạt được mục đích chân thật của mình) có nghĩa là đã đạt được mục đích chân thật của mình, tức là mục đích của chính mình.
Kakārassāyaṃ dakāro kato, sadatthoti ca arahattaṃ veditabbaṃ.
Here, the letter 'k' has been changed to 'd'. And by sadattha, arahantship should be understood.
Chữ “ka” ở đây đã được đổi thành “da”, và “sadattha” cần được hiểu là quả vị A-la-hán.
Tañhi attupanibandhanaṭṭhena attānaṃ avijahanaṭṭhena attano paramatthaṭṭhena ca attano attho sakatthoti vuccati.
For that, because of its nature of being connected to oneself, of not abandoning oneself, and being one's own ultimate goal, is called 'one's own goal' (sak'attha).
Thật vậy, quả vị đó được gọi là mục đích của chính mình (sakattho) bởi vì nó gắn liền với tự ngã, không rời bỏ tự ngã, và là mục đích tối thượng của tự ngã.
Parikkhīṇabhavasaṃyojanoti bhavasaṃyojanānīti dasa saṃyojanāni kāmarāgasaṃyojanaṃ paṭighamānadiṭṭhivicikicchāsīlabbataparāmāsabhavarāgaissāmacchariyasaṃyojanaṃ avijjāsaṃyojanaṃ.
Whose fetter of existence is completely destroyed (parikkhīṇabhavasaṃyojano): The fetters of existence are the ten fetters: the fetter of sensual lust, the fetters of aversion, conceit, views, doubt, adherence to rules and observances, lust for existence, jealousy, avarice, and the fetter of ignorance.
Parikkhīṇabhavasaṃyojano (đã đoạn tận các kiết sử tái sinh) có nghĩa là: bhavasaṃyojanāni (các kiết sử tái sinh) là mười kiết sử: dục ái kiết sử, sân kiết sử, mạn kiết sử, tà kiến kiết sử, hoài nghi kiết sử, giới cấm thủ kiết sử, hữu ái kiết sử, tật đố kiết sử, xan tham kiết sử, vô minh kiết sử.
Imāni hi satte bhavesu saṃyojenti upanibandhanti, bhavaṃ vā bhavena saṃyojenti, tasmā ‘‘bhavasaṃyojanānī’’ti vuccanti.
Since these fetter and bind beings to existences, or they fetter one existence to another, they are called 'fetters of existence'.
Những kiết sử này trói buộc chúng sinh vào các cõi sống (bhava), hoặc chúng trói buộc một cõi sống với một cõi sống khác. Do đó, chúng được gọi là “bhavasaṃyojanāni” (các kiết sử tái sinh).
Imāni bhavasaṃyojanāni arahato parikkhīṇāni pahīnāni ñāṇagginā daḍḍhāni, tena vuccati ‘‘parikkhīṇabhavasaṃyojano’’ti.
For the arahant, these fetters of existence are completely destroyed, abandoned, and burned by the fire of knowledge. Therefore, he is called 'one whose fetter of existence is completely destroyed'.
Những kiết sử tái sinh này đối với vị A-la-hán đã được đoạn tận, đã được loại bỏ, đã bị thiêu cháy bởi lửa trí tuệ. Do đó, vị ấy được gọi là “parikkhīṇabhavasaṃyojano”.
Sammadaññā vimuttoti ettha sammadaññāti sammā aññāya.
Rightly liberated through final knowledge (sammadaññā vimutto): Here, sammadaññā means 'having rightly known'.
Sammadaññā vimutto (đã giải thoát nhờ chánh trí) – trong đây, sammadaññā có nghĩa là đã biết một cách chân chánh.
Kiṃ vuttaṃ hoti – khandhānaṃ khandhaṭṭhaṃ, āyatanānaṃ āyatanaṭṭhaṃ, dhātūnaṃ dhātuṭṭhaṃ, dukkhassa pīḷanaṭṭhaṃ, samudayassa pabhavaṭṭhaṃ, nirodhassa santaṭṭhaṃ, maggassa dassanaṭṭhaṃ, sabbe saṅkhārā aniccāti evamādiṃ vā bhedaṃ sammā yathābhūtaṃ aññāya jānitvā tīrayitvā tulayitvā vibhāvetvā vibhūtaṃ katvāti.
What is meant? Having rightly known as it really is—the meaning of the aggregates as aggregates, the meaning of the sense bases as sense bases, the meaning of the elements as elements; the oppressive meaning of suffering, the originating meaning of the origin, the peaceful meaning of cessation, the seeing meaning of the path; or the distinction that 'all formations are impermanent', and so on—having known, discerned, weighed, made manifest, and clarified it.
Điều gì đã được nói đến? Đó là: đã biết một cách chân chánh, đúng như thật, đã xem xét, đã cân nhắc, đã làm cho rõ ràng, đã làm cho hiển lộ sự thật về bản chất của các uẩn, bản chất của các xứ, bản chất của các giới, bản chất của sự khổ là bị bức bách, bản chất của nguyên nhân là phát sinh, bản chất của sự diệt là an tịnh, bản chất của đạo là thấy rõ, hoặc sự phân biệt như “tất cả các hành là vô thường”, v.v.
Vimuttoti dve vimuttiyo cittassa ca vimutti nibbānañca.
Liberated (vimutto): There are two liberations: the liberation of the mind and Nibbāna.
Vimutto (đã giải thoát) có hai loại giải thoát: giải thoát tâm (cittavimutti) và Niết-bàn.
Arahā sabbakilesehi vimuttacittattā cittavimuttiyāpi vimutto.
The arahant, because his mind is liberated from all defilements, is liberated by the liberation of the mind.
Vị A-la-hán đã giải thoát tâm khỏi tất cả các phiền não, nên vị ấy đã giải thoát bằng giải thoát tâm.
Nibbānaṃ adhimuttattā nibbānepi vimutto.
Because he is intent on Nibbāna, he is liberated in Nibbāna.
Vị ấy cũng đã giải thoát trong Niết-bàn vì đã hướng tâm đến Niết-bàn.
Tena vuccati ‘‘sammadaññā vimutto’’ti.
Therefore, he is called 'rightly liberated through final knowledge'.
Do đó, vị ấy được gọi là “sammadaññā vimutto”.
Pariññātaṃ tassāti tassa arahato taṃ maññanāvatthu tīhi pariññāhi pariññātaṃ.
It has been fully understood by him means: For that arahant, that object of conceiving has been fully understood by the three kinds of full understanding (pariññā).
Pariññātaṃ tassā (đã được liễu tri đối với vị đó) có nghĩa là: đối tượng của sự tưởng tri đó đối với vị A-la-hán đã được liễu tri bằng ba sự liễu tri.
Tasmā so taṃ vatthuṃ na maññati, taṃ vā maññanaṃ na maññatīti vuttaṃ hoti, sesaṃ vuttanayameva.
Therefore, it is said that he does not conceive that object, or he does not conceive that conceiving. The rest is in accordance with the method already stated.
Do đó, vị ấy không tưởng tri đối tượng đó, hoặc không tưởng tri sự tưởng tri đó. Phần còn lại cũng theo cách đã nói.
Nibbānavāre pana khayā rāgassātiādayo tayo vārā vuttā.
In the section on Nibbāna, however, the three sections beginning with "through the destruction of lust" have been stated.
Trong nhóm Niết-bàn, ba nhóm đã được nói đến là khayā rāgassā (do sự diệt tận tham ái), v.v.
Te pathavīvārādīsupi vitthāretabbā.
They should also be elaborated in the sections on earth and so on.
Những nhóm này cũng cần được giải thích rộng rãi trong các nhóm như nhóm đất, v.v.
Ayañca pariññātavāro nibbānavārepi vitthāretabbo.
And this section on full understanding should also be elaborated in the section on Nibbāna.
Và nhóm Pariññāta này cũng cần được giải thích rộng rãi trong nhóm Niết-bàn.
Vitthārentena ca pariññātaṃ tassāti sabbapadehi yojetvā puna khayā rāgassa vītarāgattāti yojetabbaṃ.
And when elaborating, after connecting "it has been fully understood by him" with all the terms, it should then be connected with "through the destruction of lust, being free from lust".
Khi giải thích rộng rãi, cần kết hợp “pariññātaṃ tassā” (đã được liễu tri đối với vị đó) với tất cả các từ, rồi lại kết hợp với “khayā rāgassa vītarāgattā” (do sự diệt tận tham ái, vị ấy không còn tham ái).
Esa nayo itaresu.
This is the method in the other cases as well.
Phương pháp này cũng tương tự đối với các nhóm khác.
Desanā pana ekattha vuttaṃ sabbattha vuttameva hotīti saṃkhittā.
The teaching, however, is abbreviated, because what is stated in one place is indeed stated everywhere.
Tuy nhiên, bài giảng đã được tóm tắt vì điều đã được nói ở một chỗ thì cũng được xem là đã được nói ở tất cả các chỗ.
Khayā rāgassa vītarāgattāti ettha ca yasmā bāhirako kāmesu vītarāgo, na khayā rāgassa vītarāgo.
And here, in "through the destruction of lust, being free from lust": since an outsider is free from lust in regard to sensual pleasures, he is not free from lust through the destruction of lust.
Trong khayā rāgassa vītarāgattā (do sự diệt tận tham ái, vị ấy không còn tham ái) này, vì người ngoại đạo không còn tham ái đối với các dục lạc, nhưng không phải là do sự diệt tận tham ái mà không còn tham ái.
Arahā pana khayā yeva, tasmā vuttaṃ ‘‘khayā rāgassa vītarāgattā’’ti.
An arahant, however, is free from lust precisely through its destruction. Therefore it is said, "through the destruction of lust, being free from lust".
Còn vị A-la-hán thì chính là do sự diệt tận. Do đó, đã nói rằng “khayā rāgassa vītarāgattā”.
Esa nayo dosamohesupi.
This same method applies to hatred and delusion.
Phương pháp này cũng tương tự đối với sân và si.
Yathā ca ‘‘pariññātaṃ tassāti vadāmī’’ti vuttepi pariññātattā so taṃ vatthuṃ taṃ vā maññanaṃ na maññatīti attho hoti, evamidhāpi vītarāgattā so taṃ vatthuṃ taṃ vā maññanaṃ na maññatīti daṭṭhabbo.
And just as when it is said, "I say, 'It has been fully understood by him'," the meaning is that because it has been fully understood, he does not conceive that object or that conceiving, so too here it should be understood that because he is free from lust, he does not conceive that object or that conceiving.
Giống như khi nói “pariññātaṃ tassāti vadāmī” (Tôi nói rằng điều đó đã được liễu tri đối với vị đó), ý nghĩa là do đã được liễu tri, vị ấy không tưởng tri đối tượng đó hoặc không tưởng tri sự tưởng tri đó; thì ở đây cũng vậy, cần hiểu rằng do không còn tham ái, vị ấy không tưởng tri đối tượng đó hoặc không tưởng tri sự tưởng tri đó.
Ettha ca pariññātaṃ tassāti ayaṃ vāro maggabhāvanāpāripūridassanatthaṃ vutto.
Herein, this section, "it has been fully understood by him," is stated to show the completion of the development of the path.
Ở đây, nhóm “pariññātaṃ tassā” này đã được nói đến để trình bày sự hoàn thiện của việc tu tập đạo.
Itare pana phalasacchikiriyāpāripūridassanatthanti veditabbā.
The others, however, should be understood as being stated to show the completion of the realization of the fruit.
Còn các nhóm khác thì cần được hiểu là để trình bày sự hoàn thiện của việc chứng đắc quả.
Dvīhi vā kāraṇehi arahā na maññati vatthussa ca pariññātattā akusalamūlānañca samucchinnattā.
Alternatively, an arahant does not conceive for two reasons: because the object has been fully understood and because the unwholesome roots have been cut off.
Hoặc vị A-la-hán không tưởng tri bởi hai lý do: do đối tượng đã được liễu tri và do các căn bất thiện đã được đoạn trừ hoàn toàn.
Tenassa pariññātavārena vatthuno vatthupariññaṃ dīpeti, itarehi akusalamūlasamucchedanti.
Therefore, by the section on full understanding, he indicates the full understanding of the object, and by the others, the cutting off of the unwholesome roots.
Do đó, với nhóm Pariññāta, Đức Phật trình bày sự liễu tri đối tượng của vị A-la-hán; còn với các nhóm khác, Ngài trình bày sự đoạn trừ hoàn toàn các căn bất thiện.
Tattha pacchimesu tīsu vāresu ayaṃ viseso veditabbo, tīsu hi vāresu rāge ādīnavaṃ disvā dukkhānupassī viharanto appaṇihitavimokkhena vimutto khayā rāgassa vītarāgo hoti.
Therein, in the last three sections, this distinction should be understood: in the three sections, one who, seeing the danger in lust, dwells contemplating suffering, is liberated by the desireless liberation (appaṇihita-vimokkha) and becomes free from lust through the destruction of lust.
Trong đó, cần biết sự khác biệt này trong ba nhóm cuối: trong ba nhóm này, vị nào thấy được sự nguy hiểm trong tham ái, sống quán chiếu khổ, giải thoát bằng vô nguyện giải thoát, thì vị ấy không còn tham ái do sự diệt tận tham ái.
Dose ādīnavaṃ disvā aniccānupassī viharanto animittavimokkhena vimutto khayā dosassa vītadoso hoti.
One who, seeing the danger in hatred, dwells contemplating impermanence, is liberated by the signless liberation (animitta-vimokkha) and becomes free from hatred through the destruction of hatred.
Vị nào thấy được sự nguy hiểm trong sân hận, sống quán chiếu vô thường, giải thoát bằng vô tướng giải thoát, thì vị ấy không còn sân hận do sự diệt tận sân hận.
Mohe ādīnavaṃ disvā anattānupassī viharanto suññatavimokkhena vimutto khayā mohassa vītamoho hotīti.
One who, seeing the danger in delusion, dwells contemplating not-self, is liberated by the emptiness liberation (suññata-vimokkha) and becomes free from delusion through the destruction of delusion.
Vị nào thấy được sự nguy hiểm trong si mê, sống quán chiếu vô ngã, giải thoát bằng không giải thoát, thì vị ấy không còn si mê do sự diệt tận si mê.
Evaṃ sante na eko tīhi vimokkhehi vimuccatīti dve vārā na vattabbā siyunti ce, taṃ na.
If this is so, does it mean that one person is not liberated by the three liberations, and thus two sections should not have been stated? Not so.
Nếu nói rằng, như vậy thì một người không thể giải thoát bằng ba loại giải thoát, nên hai nhóm đó không nên được nói đến, thì điều đó không đúng.
Aniyamitattā.
Because it is not specified.
Vì không bị giới hạn.
Aniyamena hi vuttaṃ ‘‘yopi so, bhikkhave, bhikkhu araha’’nti.
For it has been stated without specification: "And, monks, that bhikkhu who is an arahant..."
Thật vậy, đã nói rằng “Này các Tỳ-khưu, vị Tỳ-khưu A-la-hán đó” một cách không giới hạn.
Na pana vuttaṃ appaṇihitavimokkhena vā vimutto, itarena vāti, tasmā yaṃ arahato yujjati, taṃ sabbaṃ vattabbamevāti.
It is not said, "liberated by the desireless liberation," or by another. Therefore, whatever is applicable to an arahant, all of that should be stated.
Chứ không nói rằng vị ấy giải thoát bằng vô nguyện giải thoát hay bằng loại giải thoát khác. Do đó, tất cả những gì phù hợp với vị A-la-hán đều cần được nói đến.
Avisesena vā yo koci arahā samānepi rāgādikkhaye vipariṇāmadukkhassa pariññātattā khayā rāgassa vītarāgoti vuccati, dukkhadukkhassa pariññātattā khayā dosassa vītadosoti.
Or, in a general sense, any arahant, though the destruction of lust and so on is the same, is called ‘freed from lust through the destruction of lust’ because of having fully understood the suffering due to change (vipariṇāma-dukkha); and ‘freed from aversion through the destruction of aversion’ because of having fully understood suffering that is suffering (dukkha-dukkha).
Hoặc, một A-la-hán bất kỳ, dù đã diệt trừ tham ái, v.v., được gọi là vītarāga (ly tham) vì đã thấu triệt vipariṇāmadukkha (khổ biến hoại) do sự diệt tận tham ái; được gọi là vītadosa (ly sân) vì đã thấu triệt dukkhadukkha (khổ khổ) do sự diệt tận sân hận.
Saṅkhāradukkhassa pariññātattā khayā mohassa vītamohoti.
Because of having fully understood the suffering of formations (saṅkhāra-dukkha), he is called ‘freed from delusion through the destruction of delusion’.
Được gọi là vītamoha (ly si) vì đã thấu triệt saṅkhāradukkha (khổ hành) do sự diệt tận si mê.
Iṭṭhārammaṇassa vā pariññātattā khayā rāgassa vītarāgo.
Or, because of having fully understood a desirable object, he is ‘freed from lust through the destruction of lust’.
Hoặc, được gọi là vītarāga vì đã thấu triệt đối tượng khả ái (iṭṭhārammaṇa) do sự diệt tận tham ái.
Aniṭṭhārammaṇassa pariññātattā khayā dosassa vītadoso.
Because of having fully understood an undesirable object, he is ‘freed from aversion through the destruction of aversion’.
Được gọi là vītadosa vì đã thấu triệt đối tượng bất khả ái (aniṭṭhārammaṇa) do sự diệt tận sân hận.
Majjhattārammaṇassa pariññātattā khayā mohassa vītamoho.
Because of having fully understood a neutral object, he is ‘freed from delusion through the destruction of delusion’.
Được gọi là vītamoha vì đã thấu triệt đối tượng trung tính (majjhattārammaṇa) do sự diệt tận si mê.
Sukhāya vā vedanāya rāgānusayassa samucchinnattā khayā rāgassa vītarāgo, itarāsu paṭighamohānusayānaṃ samucchinnattā vītadoso vītamoho cāti.
Or, because the underlying tendency to lust has been utterly cut off in regard to pleasant feeling, he is ‘freed from lust through the destruction of lust’; and because the underlying tendencies to aversion and delusion have been utterly cut off in regard to the other feelings, he is ‘freed from aversion’ and ‘freed from delusion’.
Hoặc, được gọi là vītarāga vì đã đoạn tận tùy miên tham ái đối với thọ lạc (sukhā vedanā); được gọi là vītadosa và vītamoha vì đã đoạn tận tùy miên sân hận và si mê đối với các thọ khác.
Tasmā taṃ visesaṃ dassento āha ‘‘khayā rāgassa vītarāgattā…pe… vītamohattā’’ti.
Therefore, to show that distinction, he said, “because of being freed from lust through the destruction of lust… and so on… because of being freed from delusion.”
Do đó, để chỉ rõ sự đặc biệt ấy, Đức Phật đã dạy: “Do sự diệt tận tham ái nên ly tham… v.v… ly si.”
12. Evaṃ pathavīādīsu vatthūsu khīṇāsavassa pavattiṃ dassetvā idāni attano pavattiṃ dassento tathāgatopi, bhikkhavetiādimāha.
12. Having thus shown the way of being for one whose cankers are destroyed in regard to objects such as earth, now, to show his own way of being, he began with “A Tathāgata too, monks…”
Như vậy, sau khi chỉ rõ sự hành trì của bậc Khīṇāsava trên các đối tượng như đất, v.v., bây giờ, để chỉ rõ sự hành trì của chính mình, Đức Thế Tôn đã dạy câu mở đầu: “Này các tỳ khưu, Như Lai cũng vậy.”
Tattha tathāgatoti aṭṭhahi kāraṇehi bhagavā tathāgatoti vuccati – tathā āgatoti tathāgato, tathā gatoti tathāgato, tathalakkhaṇaṃ āgatoti tathāgato, tathadhamme yāthāvato abhisambuddhoti tathāgato, tathadassitāya tathāgato, tathāvāditāya tathāgato, tathākāritāya tathāgato, abhibhavanaṭṭhena tathāgatoti.
Therein, the Blessed One is called a Tathāgata for eight reasons: He is a Tathāgata because he has ‘thus come’ (tathā āgato), a Tathāgata because he has ‘thus gone’ (tathā gato), a Tathāgata because he has arrived at the true characteristic (tathalakkhaṇaṃ āgato), a Tathāgata because he has fully awakened to the true Dhamma as it really is (tathadhamme yāthāvato abhisambuddho), a Tathāgata because of seeing what is true (tathadassitāya), a Tathāgata because of speaking what is true (tathāvāditāya), a Tathāgata because of doing what is true (tathākāritāya), and a Tathāgata in the sense of overcoming.
Trong đó, Đức Thế Tôn được gọi là Tathāgata (Như Lai) bởi tám lý do: Ngài đến như vậy (tathā āgato) nên là Tathāgata; Ngài đi như vậy (tathā gato) nên là Tathāgata; Ngài đạt đến tướng chân thật (tathalakkhaṇaṃ āgato) nên là Tathāgata; Ngài đã giác ngộ các pháp chân thật (tathadhamme yāthāvato abhisambuddho) nên là Tathāgata; Ngài thấy như vậy (tathadassitāya) nên là Tathāgata; Ngài nói như vậy (tathāvāditāya) nên là Tathāgata; Ngài làm như vậy (tathākāritāya) nên là Tathāgata; Ngài chiến thắng (abhibhavanaṭṭhena) nên là Tathāgata.
Kathaṃ bhagavā tathā āgatoti tathāgato?
How is the Blessed One a Tathāgata because he has ‘thus come’?
Đức Thế Tôn đến như thế nào mà được gọi là Tathāgata?
Yathā sabbalokahitāya ussukkamāpannā purimakā sammāsambuddhā āgatā, yathā vipassī bhagavā āgato, yathā sikhī bhagavā, yathā vessabhū bhagavā, yathā kakusandho bhagavā, yathā koṇāgamano bhagavā, yathā kassapo bhagavā āgatoti.
Just as the former Perfectly Enlightened Ones came, having striven for the welfare of the whole world—just as the Blessed One Vipassī came, just as the Blessed One Sikhī, just as the Blessed One Vessabhū, just as the Blessed One Kakusandha, just as the Blessed One Koṇāgamana, just as the Blessed One Kassapa came.
Như các vị Chánh Đẳng Giác đời trước đã đến, những vị đã nỗ lực vì lợi ích của tất cả chúng sanh; như Đức Thế Tôn Vipassī đã đến, như Đức Thế Tôn Sikhī, như Đức Thế Tôn Vessabhū, như Đức Thế Tôn Kakusandha, như Đức Thế Tôn Koṇāgamana, như Đức Thế Tôn Kassapa đã đến.
Kiṃ vuttaṃ hoti?
What is meant by this?
Điều đó có nghĩa là gì?
Yena abhinīhārena ete bhagavanto āgatā, teneva amhākampi bhagavā āgato.
Our Blessed One also came by that very same aspiration by which those Blessed Ones came.
Đức Thế Tôn của chúng ta đã đến với cùng một sự phát nguyện như những vị Thế Tôn ấy.
Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā dānapāramiṃ pūretvā, sīlanekkhammapaññāvīriyakhantisaccaadhiṭṭhānamettāupekkhāpāramiṃ pūretvā, imā dasa pāramiyo, dasa upapāramiyo, dasa paramatthapāramiyoti, samatiṃsa pāramiyo pūretvā, aṅgapariccāgaṃ nayanadhanarajjaputtadārapariccāganti ime pañca mahāpariccāge pariccajitvā pubbayogapubbacariyadhammakkhānañātatthacariyādayo pūretvā, buddhicariyāya koṭiṃ patvā āgato, tathā amhākampi bhagavā āgato.
Or, just as the Blessed One Vipassī… and so on… just as the Blessed One Kassapa came, having fulfilled the perfection of giving; having fulfilled the perfections of virtue, renunciation, wisdom, energy, patience, truthfulness, resolution, loving-kindness, and equanimity; having fulfilled these ten perfections, ten subsidiary perfections, and ten ultimate perfections, thus thirty perfections in total; having made the five great renunciations—the renunciation of limbs, eyes, wealth, kingdom, wife and children; having fulfilled the practice of the past, past conduct, teaching the Dhamma, conduct for the welfare of relatives, and so on; having reached the pinnacle of conduct for enlightenment—so too our Blessed One came.
Hoặc, như Đức Thế Tôn Vipassī… v.v… như Đức Thế Tôn Kassapa đã hoàn mãn ba mươi pāramī (ba-la-mật) – mười pāramī, mười upapāramī (phụ ba-la-mật), mười paramatthapāramī (tối thượng ba-la-mật) – sau khi đã hoàn thành pāramī bố thí, pāramī trì giới, pāramī xuất ly, pāramī trí tuệ, pāramī tinh tấn, pāramī nhẫn nại, pāramī chân thật, pāramī kiên định, pāramī từ bi, pāramī xả; sau khi đã thực hiện năm đại thí xả là xả bỏ các chi phần cơ thể, mắt, tài sản, vương quốc, con cái và vợ; sau khi đã hoàn thành các hạnh như pubbayoga (sự tinh tấn trước đây), pubbacariyā (hạnh tu trước đây), dhammakkhāna (sự thuyết pháp), ñātatthacariyā (hạnh lợi ích cho bà con), v.v.; và sau khi đã đạt đến đỉnh cao của Buddhicariyā (hạnh của một vị Phật), Đức Thế Tôn của chúng ta cũng đã đến như vậy.
Kathaṃ tathā gatoti tathāgato.
How is he a Tathāgata because he has ‘thus gone’?
Đức Thế Tôn đi như thế nào mà được gọi là Tathāgata?
Yathā sampatijāto vipassī bhagavā gato…pe… kassapo bhagavā gato.
Just as the Blessed One Vipassī went when just born… and so on… just as the Blessed One Kassapa went.
Như Đức Thế Tôn Vipassī vừa mới đản sanh đã đi… v.v… Đức Thế Tôn Kassapa đã đi.
Kathañca so gatoti, so hi sampatijātova samehi pādehi pathaviyaṃ patiṭṭhāya uttarābhimukho sattapadavītihārena gato.
And how did he go? Just after birth, he stood on the earth with even feet, faced north, and went forward seven steps.
Và Ngài đã đi như thế nào? Ngài vừa mới đản sanh đã đứng vững trên mặt đất bằng đôi chân bằng phẳng, đi về phía bắc bảy bước chân.
Yathāha – sampatijāto, ānanda, bodhisatto samehi pādehi pathaviyaṃ patiṭṭhahitvā uttarābhimukho sattapadavītihārena gacchati setamhi chatte anudhārīyamāne, sabbā ca disā anuviloketi, āsabhiñca vācaṃ bhāsati ‘‘aggohamasmi lokassa, jeṭṭhohamasmi lokassa, seṭṭhohamasmi lokassa, ayamantimā jāti, natthi dāni punabbhavo’’ti (ma. ni. 3.207).
As it is said: “Ānanda, as soon as he is born, the Bodhisatta, having stood on the earth with even feet, walks seven steps facing north, while a white parasol is held over him. He surveys all the directions and utters a bull-like utterance: ‘I am the chief in the world, I am the eldest in the world, I am the best in the world. This is my last birth. There is now no further becoming.’”
Như đã nói: “Này Ānanda, Bồ Tát vừa mới đản sanh, đứng vững trên mặt đất bằng đôi chân bằng phẳng, đi về phía bắc bảy bước chân, trong khi lọng trắng được che, Ngài nhìn khắp các phương và nói lời hùng tráng: ‘Ta là bậc tối thượng của thế gian, Ta là bậc tối cao của thế gian, Ta là bậc cao quý nhất của thế gian. Đây là lần sanh cuối cùng, không còn tái sanh nữa.’”
Tañcassa gamanaṃ tathaṃ ahosi avitathaṃ anekesaṃ visesādhigamānaṃ pubbanimittabhāvena.
And that going of his was true and unfailing, being a prior sign of many special attainments.
Và sự đi của Ngài là chân thật, không sai khác, vì là điềm báo trước cho nhiều thành tựu đặc biệt.
Yañhi so sampatijātova samehi pādehi patiṭṭhahi, idamassa caturiddhipādapaṭilābhassa pubbanimittaṃ.
For his standing with even feet just after birth was a prior sign of his attainment of the four bases of spiritual power.
Việc Ngài vừa mới đản sanh đã đứng vững trên đôi chân bằng phẳng là điềm báo trước cho sự thành tựu bốn thần túc (iddhipāda).
Uttarābhimukhabhāvo pana sabbalokuttarabhāvassa pubbanimittaṃ.
His facing north was a prior sign of his state of being supreme in all the world.
Việc Ngài hướng về phía bắc là điềm báo trước cho sự siêu việt tất cả thế gian.
Sattapadavītihāro sattabojjhaṅgaratanapaṭilābhassa.
His taking seven steps was a prior sign of his attainment of the seven jewels of the enlightenment factors.
Bảy bước chân là điềm báo trước cho sự thành tựu bảy giác chi (bojjhaṅga) quý báu.
‘‘Suvaṇṇadaṇḍā vītipatanti cāmarā’’ti (su. ni. 693) ettha vutto cāmarukkhepo sabbatitthiyanimmathanassa.
The lifting of the chowrie, mentioned in the line “golden-handled chowries are waved,” was a prior sign of his subduing of all sectarians.
Việc phất trần được nhắc đến trong câu “Suvaṇṇadaṇḍā vītipatanti cāmarā” là điềm báo trước cho sự đánh bại tất cả các ngoại đạo.
Setacchattadhāraṇaṃ arahattavimuttivaravimalasetacchattapaṭilābhassa.
The holding of the white parasol was a prior sign of his attainment of the excellent, immaculate white parasol of the liberation of Arahantship.
Việc đội lọng trắng là điềm báo trước cho sự thành tựu lọng trắng quý báu, thanh tịnh của giải thoát A-la-hán.
Sabbadisānuvilokanaṃ sabbaññutānāvaraṇañāṇapaṭilābhassa.
His surveying of all directions was a prior sign of his attainment of the unobstructed knowledge of omniscience.
Việc nhìn khắp các phương là điềm báo trước cho sự thành tựu trí tuệ toàn tri không chướng ngại.
Āsabhīvācābhāsanaṃ appaṭivattiyavaradhammacakkappavattanassa pubbanimittaṃ.
His uttering a bull-like utterance was a prior sign of his setting in motion the excellent, irreversible Wheel of Dhamma.
Việc nói lời hùng tráng là điềm báo trước cho sự chuyển Pháp luân tối thượng không thể đảo ngược.
Tathā ayaṃ bhagavāpi gato.
In the same way, this Blessed One also went.
Đức Thế Tôn này cũng đã đi như vậy.
Tañcassa gamanaṃ tathaṃ ahosi avitathaṃ tesaññeva visesādhigamānaṃ pubbanimittabhāvena.
And that going of his was true and unfailing, being a prior sign of those very same special attainments.
Và sự đi của Ngài cũng là chân thật, không sai khác, vì là điềm báo trước cho chính những thành tựu đặc biệt ấy.
Tenāhu porāṇā –
Therefore the ancients have said:
Vì thế, các bậc cổ nhân đã nói:
Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā, ayampi bhagavā tatheva nekkhammena kāmacchandaṃ pahāya gato.
Or, just as the Blessed One Vipassī… and so on… just as the Blessed One Kassapa, so too this Blessed One went in the same way, having abandoned sensual desire through renunciation.
Hoặc, như Đức Thế Tôn Vipassī… v.v… như Đức Thế Tôn Kassapa, Đức Thế Tôn này cũng đã đi như vậy, bằng cách rời bỏ dục ái (kāmacchanda) nhờ xuất ly (nekkhamma).
Abyāpādena byāpādaṃ, ālokasaññāya thinamiddhaṃ, avikkhepena uddhaccakukkuccaṃ, dhammavavatthānena vicikicchaṃ pahāya, ñāṇena avijjaṃ padāletvā, pāmojjena aratiṃ vinodetvā, paṭhamajjhānena nīvaraṇakavāṭaṃ ugghāṭetvā, dutiyajjhānena vitakkavicāradhūmaṃ vūpasametvā, tatiyajjhānena pītiṃ virājetvā, catutthajjhānena sukhadukkhaṃ pahāya, ākāsānañcāyatanasamāpattiyā rūpasaññāpaṭighasaññānānattasaññāyo samatikkamitvā, viññāṇañcāyatanasamāpattiyā ākāsānañcāyatanasaññaṃ, ākiñcaññāyatanasamāpattiyā viññāṇañcāyatanasaññaṃ, nevasaññānāsaññāyatanasamāpattiyā ākiñcaññāyatanasaññaṃ samatikkamitvā gato.
Having abandoned ill will through non-ill will, sloth and torpor through the perception of light, restlessness and worry through non-distraction, and doubt through the determination of phenomena; having shattered ignorance with knowledge, dispelled discontent with joy, opened the gate of the hindrances with the first jhāna, quieted the smoke of applied and sustained thought with the second jhāna, become dispassionate towards rapture with the third jhāna, and abandoned pleasure and pain with the fourth jhāna; having transcended the perceptions of form, the perceptions of sensory impact, and the perceptions of diversity with the attainment of the base of the infinity of space; having transcended the perception of the base of the infinity of space with the attainment of the base of the infinity of consciousness; having transcended the perception of the base of the infinity of consciousness with the attainment of the base of nothingness; and having transcended the perception of the base of nothingness with the attainment of the base of neither perception nor non-perception, he went.
Ngài đã đi bằng cách từ bỏ sân hận (byāpāda) nhờ vô sân (abyāpāda), từ bỏ hôn trầm thụy miên (thinamiddha) nhờ tưởng ánh sáng (ālokasaññā), từ bỏ trạo cử hối hận (uddhaccakukkucca) nhờ không phóng dật (avikkhepa), từ bỏ nghi ngờ (vicikicchā) nhờ sự phân biệt pháp (dhammavavatthāna), phá tan vô minh (avijjā) bằng trí tuệ (ñāṇa), xua tan sự bất lạc (arati) bằng hỷ lạc (pāmojja); mở cánh cửa chướng ngại (nīvaraṇa) bằng sơ thiền, làm lắng dịu khói tầm tứ (vitakkavicāra) bằng nhị thiền, làm phai nhạt hỷ (pīti) bằng tam thiền, từ bỏ khổ lạc bằng tứ thiền; vượt qua tưởng sắc (rūpasaññā), tưởng phản kháng (paṭighasaññā), tưởng sai biệt (nānattasaññā) bằng thiền định không vô biên xứ (ākāsānañcāyatanasamāpatti); vượt qua tưởng không vô biên xứ bằng thiền định thức vô biên xứ (viññāṇañcāyatanasamāpatti); vượt qua tưởng thức vô biên xứ bằng thiền định vô sở hữu xứ (ākiñcaññāyatanasamāpatti); vượt qua tưởng vô sở hữu xứ bằng thiền định phi tưởng phi phi tưởng xứ (nevasaññānāsaññāyatanasamāpatti).
Aniccānupassanāya niccasaññaṃ pahāya, dukkhānupassanāya sukhasaññaṃ, anattānupassanāya attasaññaṃ, nibbidānupassanāya nandiṃ, virāgānupassanāya rāgaṃ, nirodhānupassanāya samudayaṃ, paṭinissaggānupassanāya ādānaṃ, khayānupassanāya ghanasaññaṃ, vayānupassanāya āyūhanaṃ, vipariṇāmānupassanāya dhuvasaññaṃ, animittānupassanāya nimittaṃ, appaṇihitānupassanāya paṇidhiṃ, suññatānupassanāya abhinivesaṃ, adhipaññādhammavipassanāya sārādānābhinivesaṃ, yathābhūtañāṇadassanena sammohābhinivesaṃ, ādīnavānupassanāya ālayābhinivesaṃ, paṭisaṅkhānupassanāya appaṭisaṅkhaṃ, vivaṭṭānupassanāya saṃyogābhinivesaṃ, sotāpattimaggena diṭṭhekaṭṭhe kilese bhañjitvā, sakadāgāmimaggena oḷārike kilese pahāya, anāgāmimaggena aṇusahagate kilese samugghāṭetvā, arahattamaggena sabbakilese samucchinditvā gato.
By contemplation of impermanence, having abandoned the perception of permanence; by contemplation of suffering, the perception of pleasure; by contemplation of not-self, the perception of self; by contemplation of disenchantment, delight; by contemplation of dispassion, passion; by contemplation of cessation, arising; by contemplation of relinquishment, grasping; by contemplation of destruction, the perception of solidity; by contemplation of decay, accumulation; by contemplation of change, the perception of stability; by contemplation of the signless, the sign; by contemplation of the desireless, desire; by contemplation of emptiness, adherence; by contemplation of insight into phenomena through higher wisdom, the adherence of grasping at a core; by the knowledge and vision of things as they truly are, the adherence of delusion; by contemplation of danger, the adherence of attachment; by contemplation of reflection, non-reflection; by contemplation of turning away, the adherence of fetters; with the path of stream-entry, having shattered the defilements that are of the same group as wrong view; with the path of a once-returner, having abandoned the gross defilements; with the path of a non-returner, having uprooted the subtle defilements; with the path of Arahantship, having cut off all defilements, he has gone.
Với quán niệm về vô thường (aniccānupassanā), Ngài đã từ bỏ tưởng thường (niccasaññā); với quán niệm về khổ (dukkhānupassanā), Ngài đã từ bỏ tưởng lạc (sukhasaññā); với quán niệm về vô ngã (anattānupassanā), Ngài đã từ bỏ tưởng ngã (attasaññā); với quán niệm về yếm ly (nibbidānupassanā), Ngài đã từ bỏ sự hoan hỷ (nandi); với quán niệm về ly tham (virāgānupassanā), Ngài đã từ bỏ tham ái (rāga); với quán niệm về đoạn diệt (nirodhānupassanā), Ngài đã từ bỏ sự tập khởi (samudaya); với quán niệm về sự xả bỏ (paṭinissaggānupassanā), Ngài đã từ bỏ sự chấp thủ (ādāna); với quán niệm về sự hủy diệt (khayānupassanā), Ngài đã từ bỏ tưởng kiên cố (ghanasaññā); với quán niệm về sự hoại diệt (vayānupassanā), Ngài đã từ bỏ sự tích lũy (āyūhana); với quán niệm về sự biến đổi (vipariṇāmānupassanā), Ngài đã từ bỏ tưởng thường hằng (dhuvasaññā); với quán niệm về vô tướng (animittānupassanā), Ngài đã từ bỏ tướng (nimitta); với quán niệm về vô nguyện (appaṇihitānupassanā), Ngài đã từ bỏ sự mong cầu (paṇidhi); với quán niệm về không (suññatānupassanā), Ngài đã từ bỏ sự chấp trước (abhinivesa); với quán niệm về các pháp bằng tuệ quán tối thượng (adhipaññādhammavipassanā), Ngài đã từ bỏ sự chấp trước vào việc nắm giữ tinh túy (sārādānābhinivesa); với sự thấy biết đúng như thật (yathābhūtañāṇadassana), Ngài đã từ bỏ sự chấp trước vào sự si mê (sammohābhinivesa); với quán niệm về sự nguy hiểm (ādīnavānupassanā), Ngài đã từ bỏ sự chấp trước vào sự trú ngụ (ālayābhinivesa); với quán niệm về sự quán xét (paṭisaṅkhānupassanā), Ngài đã từ bỏ sự không quán xét (appaṭisaṅkha); với quán niệm về sự thoát ly (vivaṭṭānupassanā), Ngài đã từ bỏ sự chấp trước vào sự ràng buộc (saṃyogābhinivesa); Ngài đã phá hủy các phiền não cố hữu (diṭṭhekaṭṭhe kilese) bằng đạo Tu-đà-hoàn (sotāpattimagga), đã từ bỏ các phiền não thô thiển (oḷārike kilese) bằng đạo Tư-đà-hàm (sakadāgāmimagga), đã nhổ tận gốc các phiền não vi tế (aṇusahagate kilese) bằng đạo A-na-hàm (anāgāmimagga), và đã đoạn tận tất cả phiền não (sabbakilese) bằng đạo A-la-hán (arahattamagga) – Ngài đã đi đến.
Evampi tathā gatoti tathāgato.
In this way too, "thus gone"; therefore, he is the Tathāgata.
Vì vậy, Ngài là Như Lai (Tathāgata) vì Ngài đã đi như vậy (tathā gato).
Kathaṃ tathalakkhaṇaṃ āgatoti tathāgato.
How has he come to the true characteristic? Thus he is the Tathāgata.
Làm thế nào Ngài đã đến với các đặc tính chân thật (tathalakkhaṇa) nên được gọi là Như Lai (Tathāgata)?
Pathavīdhātuyā kakkhaḷattalakkhaṇaṃ tathaṃ avitathaṃ.
The characteristic of hardness in the earth element is true, not untrue.
Đặc tính cứng rắn (kakkhaḷattalakkhaṇa) của địa đại (pathavīdhātu) là chân thật, không sai khác.
Āpodhātuyā paggharaṇalakkhaṇaṃ.
The characteristic of flowing in the water element.
Đặc tính chảy tràn (paggharaṇalakkhaṇa) của thủy đại (āpodhātu).
Tejodhātuyā uṇhattalakkhaṇaṃ.
The characteristic of heat in the fire element.
Đặc tính nóng ấm (uṇhattalakkhaṇa) của hỏa đại (tejodhātu).
Vāyodhātuyā vitthambhanalakkhaṇaṃ.
The characteristic of supporting in the wind element.
Đặc tính trương phồng (vitthambhanalakkhaṇa) của phong đại (vāyodhātu).
Ākāsadhātuyā asamphuṭṭhalakkhaṇaṃ.
The characteristic of being untouched in the space element.
Đặc tính không xúc chạm (asamphuṭṭhalakkhaṇa) của không đại (ākāsadhātu).
Viññāṇadhātuyā vijānanalakkhaṇaṃ.
The characteristic of cognizing in the consciousness element.
Đặc tính nhận biết (vijānanalakkhaṇa) của thức đại (viññāṇadhātu).
Vitakkassa abhiniropanalakkhaṇaṃ.
For initial application, the characteristic of directing onto.
Đặc tính đặt tâm vào (abhiniropanalakkhaṇa) của tầm (vitakka).
Vicārassa anumajjanalakkhaṇaṃ.
For sustained application, the characteristic of examining.
Đặc tính duy trì (anumajjanalakkhaṇa) của tứ (vicāra).
Pītiyā pharaṇalakkhaṇaṃ.
For joy, the characteristic of pervading.
Đặc tính tràn ngập (pharaṇalakkhaṇa) của hỷ (pīti).
Sukhassa sātalakkhaṇaṃ.
For pleasure, the characteristic of being pleasant.
Đặc tính thỏa mãn (sātalakkhaṇa) của lạc (sukha).
Cittekaggatāya avikkhepalakkhaṇaṃ.
For one-pointedness of mind, the characteristic of non-distraction.
Đặc tính không xao lãng (avikkhepalakkhaṇa) của tâm nhất cảnh (cittekaggatā).
Phassassa phusanalakkhaṇaṃ.
For contact, the characteristic of touching.
Đặc tính xúc chạm (phusanalakkhaṇa) của xúc (phassa).
Satisambojjhaṅgassa upaṭṭhānalakkhaṇaṃ.
For the enlightenment factor of mindfulness, the characteristic of establishing.
Đặc tính an trú (upaṭṭhānalakkhaṇa) của niệm giác chi (satisambojjhaṅga).
Dhammavicayasambojjhaṅgassa pavicayalakkhaṇaṃ.
For the enlightenment factor of investigation of phenomena, the characteristic of investigating.
Đặc tính thẩm sát (pavicayalakkhaṇa) của trạch pháp giác chi (dhammavicayasambojjhaṅga).
Vīriyasambojjhaṅgassa paggahaṇalakkhaṇaṃ.
For the enlightenment factor of energy, the characteristic of exerting.
Đặc tính tinh tấn (paggahaṇalakkhaṇa) của tấn giác chi (vīriyasambojjhaṅga).
Pītisambojjhaṅgassa pharaṇalakkhaṇaṃ.
For the enlightenment factor of joy, the characteristic of pervading.
Đặc tính tràn ngập (pharaṇalakkhaṇa) của hỷ giác chi (pītisambojjhaṅga).
Passaddhisambojjhaṅgassa upasamalakkhaṇaṃ.
For the enlightenment factor of tranquility, the characteristic of calming.
Đặc tính an tịnh (upasamalakkhaṇa) của khinh an giác chi (passaddhisambojjhaṅga).
Samādhisambojjhaṅgassa avikkhepalakkhaṇaṃ.
For the enlightenment factor of concentration, the characteristic of non-distraction.
Đặc tính không tán loạn (avikkhepalakkhaṇa) của định giác chi (samādhisambojjhaṅga).
Upekkhāsambojjhaṅgassa paṭisaṅkhānalakkhaṇaṃ.
For the enlightenment factor of equanimity, the characteristic of reflecting.
Đặc tính quán xét (paṭisaṅkhānalakkhaṇa) của xả giác chi (upekkhāsambojjhaṅga).
Sammādiṭṭhiyā dassanalakkhaṇaṃ.
For right view, the characteristic of seeing.
Đặc tính thấy biết (dassanalakkhaṇa) của chánh kiến (sammādiṭṭhi).
Sammāsaṅkappassa abhiniropanalakkhaṇaṃ.
For right thought, the characteristic of directing onto.
Đặc tính đặt tâm vào (abhiniropanalakkhaṇa) của chánh tư duy (sammāsaṅkappa).
Sammāvācāya pariggāhalakkhaṇaṃ.
For right speech, the characteristic of embracing.
Đặc tính giữ gìn (pariggāhalakkhaṇa) của chánh ngữ (sammāvācā).
Sammākammantassa samuṭṭhānalakkhaṇaṃ.
For right action, the characteristic of originating.
Đặc tính phát khởi (samuṭṭhānalakkhaṇa) của chánh nghiệp (sammākammanta).
Sammāājīvassa vodānalakkhaṇaṃ.
For right livelihood, the characteristic of cleansing.
Đặc tính thanh tịnh (vodānalakkhaṇa) của chánh mạng (sammāājīva).
Sammāvāyāmassa paggahaṇalakkhaṇaṃ.
For right effort, the characteristic of exerting.
Đặc tính tinh tấn (paggahaṇalakkhaṇa) của chánh tinh tấn (sammāvāyāma).
Sammāsatiyā upaṭṭhānalakkhaṇaṃ.
For right mindfulness, the characteristic of establishing.
Đặc tính an trú (upaṭṭhānalakkhaṇa) của chánh niệm (sammāsati).
Sammāsamādhissa avikkhepalakkhaṇaṃ.
For right concentration, the characteristic of non-distraction.
Đặc tính không tán loạn (avikkhepalakkhaṇa) của chánh định (sammāsamādhi).
Avijjāya aññāṇalakkhaṇaṃ.
For ignorance, the characteristic of not knowing.
Đặc tính không biết (aññāṇalakkhaṇa) của vô minh (avijjā).
Saṅkhārānaṃ cetanālakkhaṇaṃ.
For formations, the characteristic of volition.
Đặc tính tác ý (cetanālakkhaṇa) của hành (saṅkhāra).
Viññāṇassa vijānanalakkhaṇaṃ.
For consciousness, the characteristic of cognizing.
Đặc tính nhận biết (vijānanalakkhaṇa) của thức (viññāṇa).
Nāmassa namanalakkhaṇaṃ.
For name, the characteristic of bending.
Đặc tính nghiêng về (namanalakkhaṇa) của danh (nāma).
Rūpassa ruppanalakkhaṇaṃ.
For form, the characteristic of being afflicted.
Đặc tính biến hoại (ruppanalakkhaṇa) của sắc (rūpa).
Saḷāyatanassa āyatanalakkhaṇaṃ.
For the six sense bases, the characteristic of being a sense base.
Đặc tính là căn cứ (āyatanalakkhaṇa) của sáu xứ (saḷāyatana).
Phassassa phusanalakkhaṇaṃ.
For contact, the characteristic of touching.
Đặc tính xúc chạm (phusanalakkhaṇa) của xúc (phassa).
Vedanāya vedayitalakkhaṇaṃ.
For feeling, the characteristic of being felt.
Đặc tính cảm thọ (vedayitalakkhaṇa) của thọ (vedanā).
Taṇhāya hetulakkhaṇaṃ.
For craving, the characteristic of being a cause.
Đặc tính là nguyên nhân (hetulakkhaṇa) của ái (taṇhā).
Upādānassa gahaṇalakkhaṇaṃ.
For clinging, the characteristic of grasping.
Đặc tính chấp thủ (gahaṇalakkhaṇa) của thủ (upādāna).
Bhavassa āyūhanalakkhaṇaṃ.
For existence, the characteristic of accumulating.
Đặc tính tạo tác (āyūhanalakkhaṇa) của hữu (bhava).
Jātiyā nibbattilakkhaṇaṃ.
For birth, the characteristic of manifestation.
Đặc tính sinh khởi (nibbattilakkhaṇa) của sinh (jāti).
Jarāya jīraṇalakkhaṇaṃ.
For aging, the characteristic of decaying.
Đặc tính già yếu (jīraṇalakkhaṇa) của già (jarā).
Maraṇassa cutilakkhaṇaṃ.
For death, the characteristic of passing away.
Đặc tính hoại diệt (cutilakkhaṇa) của chết (maraṇa).
Dhātūnaṃ suññatālakkhaṇaṃ.
For the elements, the characteristic of emptiness.
Đặc tính không (suññatālakkhaṇa) của các giới (dhātu).
Āyatanānaṃ āyatanalakkhaṇaṃ.
For the sense bases, the characteristic of being a sense base.
Đặc tính là căn cứ (āyatanalakkhaṇa) của các xứ (āyatana).
Satipaṭṭhānānaṃ upaṭṭhānalakkhaṇaṃ.
For the establishments of mindfulness, the characteristic of establishing.
Đặc tính an trú (upaṭṭhānalakkhaṇa) của các niệm xứ (satipaṭṭhāna).
Sammappadhānānaṃ padahanalakkhaṇaṃ.
For the right strivings, the characteristic of striving.
Đặc tính tinh tấn (padahanalakkhaṇa) của các chánh cần (sammappadhāna).
Iddhipādānaṃ ijjhanalakkhaṇaṃ.
For the bases of spiritual power, the characteristic of accomplishing.
Đặc tính thành tựu (ijjhanalakkhaṇa) của các thần túc (iddhipāda).
Indriyānaṃ adhipatilakkhaṇaṃ.
For the faculties, the characteristic of dominance.
Đặc tính thống trị (adhipatilakkhaṇa) của các căn (indriya).
Balānaṃ akampiyalakkhaṇaṃ.
For the powers, the characteristic of being unshakable.
Đặc tính không bị lay chuyển (akampiyalakkhaṇa) của các lực (bala).
Bojjhaṅgānaṃ niyyānalakkhaṇaṃ.
For the enlightenment factors, the characteristic of deliverance.
Đặc tính đưa đến giải thoát (niyyānalakkhaṇa) của các giác chi (bojjhaṅga).
Maggassa hetulakkhaṇaṃ.
For the path, the characteristic of being a cause.
Đặc tính là nhân (hetulakkhaṇa) của đạo (magga).
Khayeñāṇassa samucchedalakkhaṇaṃ.
For the knowledge of destruction, the characteristic of cutting off.
Đặc tính đoạn tận (samucchedalakkhaṇa) của diệt tận trí (khayeñāṇa).
Anuppāde ñāṇassa passaddhilakkhaṇaṃ.
For the knowledge of non-arising, the characteristic of tranquility.
Đặc tính an tịnh (passaddhilakkhaṇa) của bất sinh trí (anuppāde ñāṇa).
Chandassa mūlalakkhaṇaṃ.
For will, the characteristic of being a root.
Đặc tính là cội rễ (mūlalakkhaṇa) của dục (chanda).
Manasikārassa samuṭṭhānalakkhaṇaṃ.
For attention, the characteristic of being a cause.
Đặc tính là sự phát khởi (samuṭṭhānalakkhaṇa) của tác ý (manasikāra).
Phassassa samodhānalakkhaṇaṃ.
For contact, the characteristic of convergence.
Đặc tính là sự hòa hợp (samodhānalakkhaṇa) của xúc (phassa).
Vedanāya samosaraṇalakkhaṇaṃ.
For feeling, the characteristic of being a meeting-place.
Đặc tính là sự hội tụ (samosaraṇalakkhaṇa) của thọ (vedanā).
Samādhissa pamukhalakkhaṇaṃ.
For concentration, the characteristic of being foremost.
Đặc tính là sự dẫn đầu (pamukhalakkhaṇa) của định (samādhi).
Satiyā ādhipateyyalakkhaṇaṃ.
For mindfulness, the characteristic of sovereignty.
Đặc tính là sự chủ đạo (ādhipateyyalakkhaṇa) của niệm (sati).
Paññāya tatuttarilakkhaṇaṃ.
For wisdom, the characteristic of being superior to that.
Đặc tính là sự tối thượng (tatuttarilakkhaṇa) của tuệ (paññā).
Vimuttiyā sāralakkhaṇaṃ.
For liberation, the characteristic of being the core.
Đặc tính là tinh túy (sāralakkhaṇa) của giải thoát (vimutti).
Amatogadhassa nibbānassa pariyosānalakkhaṇaṃ tathaṃ avitathaṃ.
For Nibbāna, which has the Deathless as its destination, the characteristic of being the final end is true, not untrue.
Đặc tính là sự chấm dứt (pariyosānalakkhaṇa) của Niết Bàn (Nibbāna) bất tử (amatogadha) là chân thật, không sai khác.
Evaṃ tathalakkhaṇaṃ ñāṇagatiyā āgato avirajjhitvā patto anuppattoti tathāgato, evaṃ tathalakkhaṇaṃ āgatoti tathāgato.
Thus, having come to, having reached, having attained this true characteristic by the way of knowledge, without fail, he is the Tathāgata. Thus, having come to the true characteristic, he is the Tathāgata.
Vì Ngài đã đạt đến các đặc tính chân thật (tathalakkhaṇa) như vậy bằng sự đi của trí tuệ (ñāṇagati), không sai lạc, đã chứng đạt, đã thành tựu, nên Ngài là Như Lai (Tathāgata). Vì Ngài đã đến với các đặc tính chân thật như vậy nên Ngài là Như Lai.
Kathaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato?
How is it that he has fully awakened to the true phenomena as they really are? Thus he is the Tathāgata.
Làm thế nào Ngài đã giác ngộ hoàn toàn các pháp chân thật (tathadhamma) đúng như thật (yāthāvato) nên được gọi là Như Lai (Tathāgata)?
Tathadhammā nāma cattāri ariyasaccāni.
The true phenomena are the four noble truths.
Các pháp chân thật (tathadhammā) là Tứ Diệu Đế (cattāri ariyasaccāni).
Yathāha ‘‘cattārimāni, bhikkhave, tathāni avitathāni anaññathāni.
As it is said: "Monks, these four things are true, not untrue, not otherwise.
Như đã nói: “Này các Tỳ-khưu, đây là bốn sự thật, không sai khác, không khác biệt.
Katamāni cattāri, idaṃ dukkhanti, bhikkhave, tathametaṃ avitathametaṃ anaññathameta’’nti (saṃ. ni. 5.1050) vitthāro.
What four? 'This is suffering,' monks, this is true, this is not untrue, this is not otherwise," and so on in detail.
Thế nào là bốn? Này các Tỳ-khưu, đây là Khổ — đây là sự thật, đây là không sai khác, đây là không khác biệt” (Saṃ. Ni. 5.1050) và các chi tiết khác.
Tāni ca bhagavā abhisambuddho, tasmā tathānaṃ abhisambuddhattā tathāgatoti vuccati.
And the Blessed One has fully awakened to these; therefore, because of having fully awakened to these true things, he is called the Tathāgata.
Và Đức Thế Tôn đã giác ngộ hoàn toàn những điều đó, do đó, vì đã giác ngộ hoàn toàn các sự thật (tathānaṃ abhisambuddhattā) nên Ngài được gọi là Như Lai (Tathāgata).
Abhisambuddhattho hi ettha gatasaddo.
Here, the word 'gata' has the meaning of 'fully awakened to'.
Ở đây, từ “gata” có nghĩa là “đã giác ngộ hoàn toàn” (abhisambuddhattha).
Apica jarāmaraṇassa jātipaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe… saṅkhārānaṃ avijjāpaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho.
Moreover, the state of aging and death, having arisen and come about from birth as its condition, is true, not untrue, not otherwise... and so on... the state of formations, having arisen and come about from ignorance as its condition, is true, not untrue, not otherwise.
Hơn nữa, sự tập khởi của già và chết (jarāmaraṇa) do nhân sinh (jātipaccayasambhūtasamudāgata) là chân thật, không sai khác, không khác biệt… (v.v.)… sự tập khởi của hành (saṅkhāra) do nhân vô minh (avijjāpaccayasambhūtasamudāgata) là chân thật, không sai khác, không khác biệt.
Tathā avijjāya saṅkhārānaṃ paccayaṭṭho.
Likewise, the state of ignorance being a condition for formations is true.
Tương tự, nhân duyên của hành (saṅkhāra) là vô minh (avijjā).
Saṅkhārānaṃ viññāṇassa paccayaṭṭho…pe… jātiyā jarāmaraṇassa paccayaṭṭho tatho avitatho anaññatho.
The state of formations being a condition for consciousness... and so on... the state of birth being a condition for aging and death is true, not untrue, not otherwise.
Nhân duyên của thức (viññāṇa) là hành (saṅkhāra)… (v.v.)… nhân duyên của già và chết (jarāmaraṇa) là sinh (jāti) là chân thật, không sai khác, không khác biệt.
Taṃ sabbaṃ bhagavā abhisambuddho, tasmāpi tathānaṃ dhammānaṃ abhisambuddhattā tathāgatoti vuccati.
The Blessed One has fully awakened to all of that; therefore also, because of having fully awakened to these true phenomena, he is called the Tathāgata.
Đức Thế Tôn đã giác ngộ hoàn toàn tất cả những điều đó, do đó, vì đã giác ngộ hoàn toàn các pháp chân thật (tathānaṃ dhammānaṃ abhisambuddhattā) nên Ngài được gọi là Như Lai (Tathāgata).
Evaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato.
Thus, because he has fully awakened to the true phenomena as they really are, he is the Tathāgata.
Như vậy, vì Ngài đã giác ngộ hoàn toàn các pháp chân thật đúng như thật nên Ngài là Như Lai.
Kathaṃ tathadassitāya tathāgato?
How is he the Tathāgata on account of seeing what is true?
Làm thế nào Ngài là Như Lai (Tathāgata) do sự thấy biết chân thật (tathādassitā)?
Bhagavā yaṃ sadevake loke…pe… sadevamanussāya aparimāṇāsu lokadhātūsu aparimāṇānaṃ sattānaṃ cakkhudvāre āpāthaṃ āgacchantaṃ rūpārammaṇaṃ nāma atthi.
Whatever visible object there is that comes into the range of the eye-door of countless beings in the world with its devas... and so on... and humans, in countless world systems,
Đức Thế Tôn, trong thế giới với chư thiên… (v.v.)… trong vô lượng thế giới với chư thiên và loài người, có các đối tượng sắc (rūpārammaṇa) đi vào tầm nhìn của vô lượng chúng sinh.
Taṃ sabbākārato jānāti, passati.
the Blessed One knows and sees it in all its aspects.
Ngài biết và thấy tất cả những điều đó với mọi khía cạnh.
Evaṃ jānatā passatā ca tena taṃ iṭṭhāniṭṭhādivasena vā diṭṭhasutamutaviññātesu labbhamānakapadavasena vā ‘‘katamaṃ taṃ rūpaṃ rūpāyatanaṃ, yaṃ rūpaṃ catunnaṃ mahābhūtānaṃ upādāya vaṇṇanibhā sanidassanaṃ sappaṭighaṃ nīlaṃ pītaka’’nti (dha. sa. 616) ādinā nayena anekehi nāmehi terasahi vārehi dvepaññāsāya nayehi vibhajjamānaṃ tathameva hoti, vitathaṃ natthi.
And when that form is divided by him, knowing and seeing it thus, either by way of the desirable, undesirable, and so on, or by way of the terms obtainable in ‘seen, heard, sensed, cognized,’ or by the fifty-two methods with thirteen sections under many names following the method that begins, “What is that form, the form-base? That form which is derived from the four great elements, has the characteristic of color, is visible and resistant, blue, yellow...” it is just so, it is not otherwise.
Khi Ngài (Đức Phật) biết và thấy như vậy, thì sắc (rūpa) ấy, dù được phân chia theo cách là đáng ưa hay không đáng ưa, hoặc theo cách các từ ngữ được tìm thấy trong những gì đã thấy, đã nghe, đã cảm nhận, đã biết, như trong câu: “Thế nào là sắc, là sắc xứ, là sắc y cứ vào bốn đại, có màu sắc, hình dạng, có thể thấy được, có thể va chạm được, màu xanh, màu vàng?” và nhiều tên gọi khác, với mười ba cách và năm mươi hai phương pháp, thì vẫn là chân thật (tathā), không hề sai lệch (vitatha).
Esa nayo sotadvārādīsupi āpāthamāgacchantesu saddādīsu.
This same method applies to sounds and other objects that come into the range of the ear-door and so on.
Nguyên tắc này cũng áp dụng cho âm thanh (sadda) và các đối tượng khác xuất hiện ở các cửa giác quan như nhĩ môn (sotadvāra).
Vuttañcetaṃ bhagavatā ‘‘yaṃ, bhikkhave, sadevakassa lokassa…pe… sadevamanussāya diṭṭhaṃ sutaṃ mutaṃ viññātaṃ pattaṃ pariyesitaṃ anuvicaritaṃ manasā, tamahaṃ jānāmi, …tamahaṃ abhiññāsiṃ, taṃ tathāgatassa viditaṃ, taṃ tathāgato na upaṭṭhāsī’’ti (a. ni. 4.24).
And this was said by the Blessed One: “Monks, whatever in the world with its devas... and so on... with its devas and humans, is seen, heard, sensed, cognized, attained, sought, and mentally explored, I know it... I have directly known it. It is known to the Tathāgata. The Tathāgata was not attached to it.”
Và điều này đã được Đức Thế Tôn nói: “Này các Tỳ-khưu, những gì đã được thấy, đã được nghe, đã được cảm nhận, đã được biết, đã được đạt tới, đã được tìm cầu, đã được quán sát bằng ý (manasā) trong thế giới với chư thiên… cho đến… với chư thiên và loài người, Ta đều biết… Ta đã thắng tri điều đó, điều đó đã được Như Lai biết rõ, điều đó Như Lai không bỏ qua.”
Evaṃ tathadassitāya tathāgato.
Thus, he is the Tathāgata due to seeing what is true.
Vì thấy các pháp đúng như thật (tathadassitā) như vậy, nên Ngài là Như Lai (Tathāgata).
Tattha tathadassīatthe tathāgatoti padasambhavo veditabbo.
Therein, the derivation of the term ‘Tathāgata’ should be understood in the sense of one who sees what is true.
Ở đây, từ nguyên của từ Như Lai (Tathāgata) trong ý nghĩa thấy đúng như thật (tathadassī) cần được hiểu.
Kathaṃ tathāvāditāya tathāgato?
How is he the Tathāgata due to speaking what is true?
Bằng cách nào Ngài là Như Lai (Tathāgata) vì nói đúng như thật (tathāvāditā)?
Yaṃ rattiṃ bhagavā bodhimaṇḍe aparājitapallaṅke nisinno tiṇṇaṃ mārānaṃ matthakaṃ madditvā anuttaraṃ sammāsambodhiṃ abhisambuddho, yañca rattiṃ yamakasālānamantare anupādisesāya nibbānadhātuyā parinibbāyi, etthantare pañcacattālīsavassaparimāṇe kāle paṭhamabodhiyāpi majjhimabodhiyāpi pacchimabodhiyāpi yaṃ bhagavatā bhāsitaṃ suttaṃ geyyaṃ…pe… vedallaṃ, taṃ sabbaṃ atthato ca byañjanato ca anupavajjaṃ anūnamanadhikaṃ sabbākāraparipuṇṇaṃ rāgamadanimmadanaṃ dosamohamadanimmadanaṃ, natthi tattha vālaggamattampi pakkhalitaṃ, sabbaṃ taṃ ekamuddikāya lañchitaṃ viya, ekanāḷiyā mitaṃ viya, ekatulāya tulitaṃ viya ca tathameva hoti avitathaṃ.
On the night the Blessed One, sitting on the unconquered throne at the Bodhi-maṇḍa, crushed the heads of the three Māras and fully awakened to the unsurpassed perfect enlightenment, and on the night he attained final Nibbāna with the Nibbāna-element that has no remainder of clinging, between these two points in time, during the period of forty-five years, whatever was spoken by the Blessed One in the first, middle, and last periods of his awakening—be it Sutta, Geyya... and so on... up to Vedalla—all of it, in both meaning and phrasing, is flawless, neither deficient nor excessive, completely perfect in every aspect, subduing the intoxication of lust, subduing the intoxication of hatred and delusion. There is not even a hair’s breadth of error in it. All of it is just so, unerring, as if sealed with a single seal, measured with a single measuring vessel, or weighed with a single scale.
Trong đêm Đức Thế Tôn ngồi trên bồ-đoàn (bodhimaṇḍa), trên tòa bất bại (aparājitapallaṅka), nghiền nát đầu ba ma vương (māra), chứng đắc Vô thượng Chánh Đẳng Giác (anuttaraṃ sammāsambodhiṃ), và trong đêm Ngài nhập Vô dư y Niết-bàn (anupādisesāya nibbānadhātuyā parinibbāyi) giữa hai cây sala song thọ, trong khoảng thời gian bốn mươi lăm năm ấy, tất cả những gì Đức Thế Tôn đã thuyết giảng, dù là kinh (sutta), kệ (geyya)… cho đến… vấn đáp (vedalla), trong thời kỳ giác ngộ ban đầu, giác ngộ giữa chừng hay giác ngộ cuối cùng, tất cả đều không có khuyết điểm về nghĩa (attha) và văn (byañjana), không thiếu không thừa, hoàn hảo về mọi phương diện, làm tiêu tan sự say đắm của tham (rāga), sân (dosa) và si (moha). Không có một chút sai sót nào dù chỉ bằng đầu sợi lông. Tất cả đều chân thật (tathā), không hề sai lệch (avitatha), như thể được đóng một con dấu, được đo bằng một ống, được cân bằng một cái cân.
Tenāha – ‘‘yañca, cunda, rattiṃ tathāgato anuttaraṃ sammāsambodhiṃ abhisambujjhati, yañca rattiṃ anupādisesāya nibbānadhātuyā parinibbāyati, yaṃ etasmiṃ antare bhāsati lapati niddisati, sabbaṃ taṃ tatheva hoti no aññathā.
Therefore, he said: “Cunda, on the night the Tathāgata fully awakens to the unsurpassed perfect enlightenment, and on the night he attains final Nibbāna with the Nibbāna-element that has no remainder of clinging, whatever he speaks, utters, and explains in the interim, all of it is just so and not otherwise.
Vì vậy, Ngài đã nói: “Này Cunda, đêm nào Như Lai chứng đắc Vô thượng Chánh Đẳng Giác, và đêm nào Ngài nhập Vô dư y Niết-bàn, tất cả những gì Ngài nói, thuyết giảng, chỉ dạy trong khoảng thời gian đó đều đúng như thật, không khác.
Tasmā tathāgatoti vuccatī’’ti (a. ni. 4.23).
Therefore, he is called the Tathāgata.”
Vì vậy, Ngài được gọi là Như Lai (Tathāgata).”
Gadaattho hi ettha gatasaddo.
Here, the word gata has the meaning of ‘spoken’ (gada).
Ở đây, từ gata có nghĩa là gada (nói).
Evaṃ tathāvāditāya tathāgato.
Thus, he is the Tathāgata due to speaking what is true.
Như vậy, Ngài là Như Lai (Tathāgata) vì nói đúng như thật (tathāvāditā).
Apica āgadanaṃ āgado, vacananti attho.
Moreover, āgadana means āgada, which means ‘speech’.
Hơn nữa, āgadanaṃ là āgado, nghĩa là lời nói (vacanaṃ).
Tatho aviparīto āgado assāti dakārassa takāraṃ katvā tathāgatoti evametasmiṃ atthe padasiddhi veditabbā.
His speech (āgada) is true (tatha), not distorted. Thus, by changing the letter ‘d’ to ‘t’, the term ‘Tathāgata’ is formed. In this sense, the derivation of the term should be understood.
Từ nguyên của từ Như Lai (Tathāgata) trong ý nghĩa này, khi biến đổi âm da thành ta, cần được hiểu là: Ngài có lời nói chân thật (tatho aviparīto āgado).
Kathaṃ tathākāritāya tathāgato?
How is he the Tathāgata due to acting in accordance with truth?
Bằng cách nào Ngài là Như Lai (Tathāgata) vì hành động đúng như thật (tathākāritā)?
Bhagavato hi vācāya kāyo anulometi, kāyassapi vācā.
For the Blessed One, the body conforms to his speech, and his speech conforms to his body.
Thân của Đức Thế Tôn phù hợp với lời nói, và lời nói cũng phù hợp với thân của Ngài.
Tasmā yathāvādī tathākārī, yathākārī tathāvādī ca hoti.
Therefore, as he speaks, so he acts; and as he acts, so he speaks.
Do đó, Ngài nói thế nào thì làm thế ấy, và làm thế nào thì nói thế ấy.
Evaṃbhūtassa cassa yathā vācā, kāyopi tathāgato pavattoti attho.
For one who is thus, the meaning is that just as his speech is, so also his body has proceeded (tathāgato).
Đối với vị như vậy, lời nói thế nào thì thân cũng hành động (pavatta) như thế ấy, đó là ý nghĩa.
Yathā ca kāyo, vācāpi tathā gatā pavattāti tathāgato.
And just as his body is, so also his speech has proceeded (tathā gatā). Thus, he is the Tathāgata.
Và thân thế nào thì lời nói cũng hành động (pavatta) như thế ấy, nên Ngài là Như Lai (Tathāgata).
Tenāha ‘‘yathāvādī, bhikkhave, tathāgato tathākārī, yathākārī tathāvādī.
Therefore, it is said: “Monks, as the Tathāgata speaks, so he acts; as he acts, so he speaks.
Vì vậy, Ngài đã nói: “Này các Tỳ-khưu, Như Lai nói thế nào thì làm thế ấy, làm thế nào thì nói thế ấy.
Iti yathāvādī tathākārī, yathākārī tathāvādī, tasmā tathāgatoti vuccatī’’ti (a. ni. 4.23).
Thus, as he speaks, so he acts; as he acts, so he speaks. Therefore, he is called the Tathāgata.”
Vì nói thế nào thì làm thế ấy, làm thế nào thì nói thế ấy, nên Ngài được gọi là Như Lai (Tathāgata).”
Evaṃ tathākāritāya tathāgato.
Thus, he is the Tathāgata due to acting in accordance with truth.
Như vậy, Ngài là Như Lai (Tathāgata) vì hành động đúng như thật (tathākāritā).
Kathaṃ abhibhavanaṭṭhena tathāgato?
How is he the Tathāgata in the sense of having overcome?
Bằng cách nào Ngài là Như Lai (Tathāgata) theo nghĩa chinh phục (abhibhavanaṭṭhena)?
Upari bhavaggaṃ heṭṭhā aviciṃ pariyantaṃ katvā tiriyaṃ aparimāṇāsu lokadhātūsu sabbasatte abhibhavati, sīlenapi samādhināpi paññāyapi vimuttiyāpi vimuttiñāṇadassanenapi, na tassa tulā vā pamāṇaṃ vā atthi, atulo appameyyo anuttaro rājarājo devadevo sakkānaṃ atisakko brahmānaṃ atibrahmā.
He overcomes all beings—from the highest existence (bhavagga) above to the Avīci hell below, and across countless world-systems—by his virtue, concentration, wisdom, liberation, and the knowledge and vision of liberation. There is no one equal to or comparable to him. He is the unequalled, the immeasurable, the unsurpassed, the king of kings, the deva of devas, the foremost among Sakkas, the foremost among Brahmās.
Ngài chinh phục tất cả chúng sinh trong vô số thế giới (lokadhātu) theo chiều ngang, với đỉnh Hữu (bhavagga) ở trên và địa ngục A-tỳ (avici) ở dưới làm giới hạn, bằng giới (sīla), bằng định (samādhi), bằng tuệ (paññā), bằng giải thoát (vimutti), và bằng tri kiến giải thoát (vimuttiñāṇadassana). Không có ai ngang bằng hay so sánh được với Ngài. Ngài là Vô song (atula), Vô lượng (appameyya), Vô thượng (anuttara), Vua của các vị vua (rājarāja), Chư thiên của các vị trời (devadeva), vượt trên các vị Sakka (sakkānaṃ atisakko), vượt trên các vị Phạm thiên (brahmānaṃ atibrahmā).
Tenāha ‘‘sadevake, bhikkhave, loke…pe… sadevamanussāya tathāgato abhibhū anabhibhūto aññadatthu daso vasavattī.
Therefore, it is said: “Monks, in the world with its devas... and so on... with its devas and humans, the Tathāgata is the overcomer, the unconquered, the all-seeing, the wielder of power.
Vì vậy, Ngài đã nói: “Này các Tỳ-khưu, trong thế giới với chư thiên… cho đến… với chư thiên và loài người, Như Lai là bậc chinh phục (abhibhū), không bị ai chinh phục (anabhibhūto), là bậc thấy tất cả (aññadatthu daso), là bậc làm chủ (vasavattī).
Tasmā tathāgatoti vuccatī’’ti.
Therefore, he is called the Tathāgata.”
Vì vậy, Ngài được gọi là Như Lai (Tathāgata).”
Tatrevaṃ padasiddhi veditabbā, agado viya agado.
Therein, the derivation of the term should be understood thus: he is like an antidote (agada).
Ở đây, từ nguyên cần được hiểu như sau: agado giống như agado (thuốc giải độc).
Ko panesa?
What is this antidote?
Vậy cái gì là agado này?
Desanāvilāsamayo ceva puññussayo ca.
It is both the grace of his teaching and the abundance of his merit.
Đó là sự huy hoàng của giáo pháp (desanāvilāsamayo) và sự tích lũy công đức (puññussayo).
Tena hesa mahānubhāvo bhisakko dibbāgadena sappe viya sabbaparappavādino sadevakañca lokaṃ abhibhavati, iti sabbalokābhibhavane tatho aviparīto desanāvilāsamayo ceva puññassayo ca agado assāti dakārassa takāraṃ katvā tathāgatoti veditabbo.
For with this, he, the great and powerful physician, overcomes all holders of wrong views and the world with its devas, just as a snake is overcome with a divine antidote. Thus, in overcoming the entire world, he possesses a true and unerring antidote (agada) which is the grace of his teaching and the abundance of his merit. By changing the letter ‘d’ to ‘t’, he is to be understood as ‘Tathāgata’.
Vì vậy, với agado vĩ đại này, vị lương y (bhisakko) vĩ đại này chinh phục tất cả những người theo ngoại đạo (sabbaparappavādino) và thế giới với chư thiên (sadevakañca lokaṃ), như một vị thần y dùng thuốc giải độc thần diệu để chinh phục rắn. Như vậy, trong việc chinh phục tất cả thế gian, từ tathāgato cần được hiểu là: Ngài có agado chân thật (tatho aviparīto), không sai lệch, là sự huy hoàng của giáo pháp (desanāvilāsamayo) và sự tích lũy công đức (puññassayo), khi biến đổi âm da thành ta.
Evaṃ abhibhavanaṭṭhena tathāgato.
Thus, he is the Tathāgata in the sense of having overcome.
Như vậy, Ngài là Như Lai (Tathāgata) theo nghĩa chinh phục (abhibhavanaṭṭhena).
Apica tathāya gatotipi tathāgato, tathaṃ gatotipi tathāgato.
Moreover, he is the Tathāgata because he has understood (gato) what is true (tathāya), and also because he has attained (gato) the truth (tathaṃ).
Hơn nữa, Ngài là Như Lai (Tathāgata) vì đã đi đến chân lý (tathāya gato), và Ngài là Như Lai (Tathāgata) vì đã đạt đến chân lý (tathaṃ gato).
Gatoti avagato, atīto, patto, paṭipannoti attho.
Here, gato means understood, gone beyond, attained, or practised.
Gato có nghĩa là đã hiểu biết (avagato), đã vượt qua (atīto), đã đạt được (patto), đã thực hành (paṭipanno).
Tattha sakalaṃ lokaṃ tīraṇapariññāya tathāya gato avagatoti tathāgato.
In this context, he is the Tathāgata because he has understood (gato) the entire world with the true (tathāya) full understanding by discrimination.
Ở đây, Ngài là Như Lai (Tathāgata) vì đã hiểu biết (gato avagato) toàn bộ thế gian một cách chân thật (tathāya) bằng sự quán xét thấu triệt (tīraṇapariññāya).
Lokasamudayaṃ pahānapariññāya tathāya gato atītoti tathāgato.
He is the Tathāgata because he has gone beyond (gato) the origin of the world with the true (tathāya) full understanding by abandoning.
Ngài là Như Lai (Tathāgata) vì đã vượt qua (gato atīto) nguyên nhân của thế gian (lokasamudayaṃ) một cách chân thật (tathāya) bằng sự đoạn trừ (pahānapariññāya).
Lokanirodhaṃ sacchikiriyāya tathāya gato pattoti tathāgato.
He is the Tathāgata because he has attained (gato) the cessation of the world with the true (tathāya) realization.
Ngài là Như Lai (Tathāgata) vì đã đạt được (gato patto) sự diệt tận của thế gian (lokanirodhaṃ) một cách chân thật (tathāya) bằng sự chứng ngộ (sacchikiriyāya).
Lokanirodhagāminiṃ paṭipadaṃ tathaṃ gato paṭipannoti tathāgato.
He is the Tathāgata because he has practised (gato) the true (tathaṃ) path leading to the cessation of the world.
Ngài là Như Lai (Tathāgata) vì đã thực hành (gato paṭipanno) con đường dẫn đến sự diệt tận của thế gian (lokanirodhagāminiṃ paṭipadaṃ) một cách chân thật (tathaṃ).
Tena yaṃ vuttaṃ bhagavatā ‘‘loko, bhikkhave, tathāgatena abhisambuddho, lokasmā tathāgato visaṃyutto.
Therefore, the Blessed One has said: “Monks, the world has been fully understood by the Tathāgata; the Tathāgata is disengaged from the world.
Do đó, điều Đức Thế Tôn đã nói: “Này các Tỳ-khưu, thế gian đã được Như Lai thắng tri (abhisambuddho), Như Lai đã ly hệ khỏi thế gian (visaṃyutto).
Lokasamudayo, bhikkhave, tathāgatena abhisambuddho, lokasamudayo tathāgatassa pahīno.
Monks, the origin of the world has been fully understood by the Tathāgata; the origin of the world has been abandoned by the Tathāgata.
Này các Tỳ-khưu, nguyên nhân của thế gian đã được Như Lai thắng tri, nguyên nhân của thế gian đã được Như Lai đoạn trừ (pahīno).
Lokanirodho, bhikkhave, tathāgatena abhisambuddho, lokanirodho tathāgatassa sacchikato.
Monks, the cessation of the world has been fully understood by the Tathāgata; the cessation of the world has been realized by the Tathāgata.
Này các Tỳ-khưu, sự diệt tận của thế gian đã được Như Lai thắng tri, sự diệt tận của thế gian đã được Như Lai chứng ngộ (sacchikato).
Lokanirodhagāminī paṭipadā, bhikkhave, tathāgatena abhisambuddhā, lokanirodhagāminī paṭipadā tathāgatassa bhāvitā.
Monks, the path leading to the cessation of the world has been fully understood by the Tathāgata; the path leading to the cessation of the world has been developed by the Tathāgata.
Này các Tỳ-khưu, con đường dẫn đến sự diệt tận của thế gian đã được Như Lai thắng tri, con đường dẫn đến sự diệt tận của thế gian đã được Như Lai tu tập (bhāvitā).
Yaṃ, bhikkhave, sadevakassa lokassa…pe… sabbaṃ taṃ tathāgatena abhisambuddhaṃ, tasmā tathāgatoti vuccatī’’ti (a. ni. 4.23).
Monks, whatever in the world with its devas... and so on... all that has been fully understood by the Tathāgata. Therefore, he is called the Tathāgata.”
Này các Tỳ-khưu, tất cả những gì trong thế gian với chư thiên… cho đến… đều đã được Như Lai thắng tri, vì vậy Ngài được gọi là Như Lai (Tathāgata).”
Tassa evampi attho veditabbo.
The meaning should be understood in this way as well.
Ý nghĩa của điều này cũng cần được hiểu như vậy.
Idampi ca tathāgatassa tathāgatabhāvadīpane mukhamattameva.
And this, in explaining the Tathāgata-nature of the Tathāgata, is merely a brief introduction.
Và đây chỉ là một phần nhỏ trong việc giải thích ý nghĩa Như Lai của Đức Như Lai.
Sabbākārena pana tathāgatova tathāgatassa tathāgatabhāvaṃ vaṇṇeyya.
In every way, however, only a Tathāgata could describe the Tathāgata-nature of a Tathāgata.
Tuy nhiên, chỉ có Đức Như Lai mới có thể diễn tả trọn vẹn ý nghĩa Như Lai của chính Ngài.
Pariññātantaṃ tathāgatassāti ettha pana taṃ maññanāvatthu pariññātaṃ tathāgatassātipi attho veditabbo.
Here, in the phrase pariññātantaṃ tathāgatassāti, the meaning should also be understood as: that object of conceiving is fully understood by the Tathāgata.
Trong câu Pariññātantaṃ tathāgatassā (Điều ấy đã được Như Lai thấu triệt), ý nghĩa cũng cần được hiểu là: đối tượng của sự tưởng tri (maññanāvatthu) ấy đã được Như Lai thấu triệt (pariññātaṃ).
Pariññātantaṃ nāma pariññātapāraṃ pariññātāvasānaṃ anavasesato pariññātanti vuttaṃ hoti.
‘Fully understood to the end’ (pariññātantaṃ) means that which is fully understood to its limit, fully understood to its conclusion; that is, fully understood without remainder.
Pariññātantaṃ có nghĩa là đã thấu triệt đến cùng tận (pariññātapāraṃ), đã thấu triệt đến chỗ kết thúc (pariññātāvasānaṃ), đã thấu triệt không còn sót lại (anavasesato).
Buddhānañhi sāvakehi saddhiṃ kiñcāpi tena tena maggena kilesappahāne viseso natthi, pariññāya pana atthi.
Although for the Buddhas, there is no difference from their disciples in the abandoning of defilements by means of the various paths, there is, however, a difference in their full understanding.
Mặc dù không có sự khác biệt giữa chư Phật và các đệ tử của Ngài trong việc đoạn trừ phiền não (kilesappahāne) bằng con đường này hay con đường khác, nhưng có sự khác biệt trong sự thấu triệt (pariññāya).
Sāvakā hi catunnaṃ dhātūnaṃ ekadesameva sammasitvā nibbānaṃ pāpuṇanti.
For the disciples attain Nibbāna by contemplating just one portion of the four elements.
Các đệ tử chỉ quán xét một phần của bốn đại (catunnaṃ dhātūnaṃ ekadesameva) rồi đạt đến Niết-bàn.
Buddhānaṃ pana aṇuppamāṇampi saṅkhāragataṃ ñāṇena adiṭṭhamatulitamatīritamasacchikataṃ natthi.
But for the Buddhas, there is not even the slightest amount of conditioned phenomena that has not been seen, weighed, examined, and realized by their knowledge.
Nhưng đối với chư Phật, không có bất kỳ pháp hành (saṅkhāragataṃ) nào, dù nhỏ nhất, mà trí tuệ của Ngài chưa thấy (adiṭṭhaṃ), chưa cân nhắc (atulitaṃ), chưa quán sát (atīritaṃ), chưa chứng ngộ (asacchikataṃ).
13. Nandī dukkhassa mūlantiādīsu ca nandīti purimataṇhā.
13. And in the passage beginning, Delight is the root of suffering, delight means the former craving.
13. Trong các câu như Nandī dukkhassa mūlaṃ (Hỷ là cội rễ của khổ), thì nandī (hỷ) là ái trong kiếp trước.
Dukkhanti pañcakkhandhā.
Suffering means the five aggregates.
Dukkhaṃ (khổ) là năm uẩn.
Mūlantiādi.
Root, and so on.
Mūlaṃ (cội rễ) và tiếp theo.
Iti viditvāti taṃ purimabhavanandiṃ ‘‘imassa dukkhassa mūla’’nti evaṃ jānitvā.
Having known thus means having known that delight in a former existence thus: "It is the root of this suffering."
Iti viditvā (biết như vậy) là biết rõ sự hỷ trong kiếp trước đó là “cội rễ của khổ này” như thế.
Bhavāti kammabhavato.
From becoming means from kamma-becoming.
Bhavā (từ hữu) là từ nghiệp hữu.
Jātīti vipākakkhandhā.
Birth means the resultant aggregates.
Jātī (sanh) là các uẩn quả.
Te hi yasmā jāyanti, tasmā ‘‘jātī’’ti vuttā.
Since they are born, they are called "birth."
Vì chúng sanh khởi, nên được gọi là “sanh”.
Jātisīsena vā ayaṃ desanā.
Or this teaching is given with birth as the main point.
Hoặc sự thuyết giảng này là về sanh.
Etampi ‘‘iti viditvā’’ti iminā yojetabbaṃ.
This too should be connected with "having known thus."
Điều này cũng phải được kết hợp với “iti viditvā” (biết như vậy).
Ayañhi ettha attho ‘‘kammabhavato upapattibhavo hotīti evañca jānitvā’’ti.
For this is the meaning here: "And having known thus that from kamma-becoming, rebirth-becoming arises."
Ý nghĩa ở đây là “biết rằng từ nghiệp hữu mà có tái sanh hữu như vậy”.
Bhūtassāti sattassa.
Of what has come to be means of a being.
Bhūtassā (của chúng sanh) là của một hữu tình.
Jarāmaraṇanti jarā ca maraṇañca.
Aging and death means aging and death.
Jarāmaraṇaṃ (già chết) là già và chết.
Idaṃ vuttaṃ hoti – tena upapattibhavena bhūtassa sattassa khandhānaṃ jarāmaraṇaṃ hotīti evañca jānitvāti.
This is what is said: And having known thus that for a being that has come to be through that rebirth-becoming, there is aging and death of the aggregates.
Điều này có nghĩa là: “biết rằng già và chết của các uẩn của hữu tình đã sanh do tái sanh hữu đó, là như vậy”.
Kathaṃ pana ettāvatā esa sabbo dassito hotīti.
But how, with just this much, is all of this shown?
Nhưng làm thế nào mà tất cả những điều này đã được trình bày đầy đủ đến đây?
Ettha hi nandīti ayaṃ eko saṅkhepo.
Here, delight is one summary.
Ở đây, “nandī” (hỷ) là một tóm tắt.
Dukkhassāti vacanato dukkhaṃ dutiyo, bhavā jātīti vacanato bhavo tatiyo, jātijarāmaraṇaṃ catuttho.
From the words "of suffering," suffering is the second; from the words "from becoming, birth," becoming is the third; birth, aging, and death is the fourth.
Theo lời dạy “dukkhassa” (của khổ) thì khổ là thứ hai, theo lời dạy “bhavā jātī” (từ hữu sanh) thì hữu là thứ ba, sanh già chết là thứ tư.
Evaṃ tāva cattāro saṅkhepā veditabbā, koṭṭhāsāti attho.
Thus, the four summaries should be understood first; the meaning is, sections.
Như vậy, bốn tóm tắt, tức là các phần, cần phải được hiểu.
Taṇhādukkhānaṃ pana antaraṃ eko sandhi, dukkhassa ca bhavassa ca antaraṃ dutiyo, bhavassa ca jātiyā ca antaraṃ tatiyo.
Furthermore, the interval between craving and suffering is one connection; the interval between suffering and becoming is the second; the interval between becoming and birth is the third.
Khoảng cách giữa ái và khổ là một liên kết, khoảng cách giữa khổ và hữu là thứ hai, khoảng cách giữa hữu và sanh là thứ ba.
Evaṃ catunnaṃ aṅgulīnaṃ antarasadisā catusaṅkhepantarā tayo sandhī veditabbā.
In this way, the three connections between the four summaries, which are like the spaces between four fingers, should be understood.
Như vậy, ba liên kết nằm giữa bốn tóm tắt, giống như khoảng cách giữa bốn ngón tay, cần phải được hiểu.
Tattha nandīti atīto addhā, jātijarāmaraṇaṃ anāgato, dukkhañca bhavo ca paccuppannoti evaṃ tayo addhā veditabbā.
Therein, delight is the past period; birth, aging, and death is the future; suffering and becoming are the present. Thus, the three periods should be understood.
Trong đó, “nandī” (hỷ) là thời quá khứ, sanh già chết là thời vị lai, khổ và hữu là thời hiện tại. Như vậy, ba thời kỳ cần phải được hiểu.
Atīte pana pañcasu ākāresu nandīvacanena taṇhā ekā āgatā, tāya anāgatāpi avijjāsaṅkhāraupādānabhavā paccayalakkhaṇena gahitāva honti.
Furthermore, in the past, among the five aspects, by the word "delight," only craving has been mentioned; by it, ignorance, formations, clinging, and becoming, which have not been mentioned, are also included by the characteristic of being a condition.
Trong năm khía cạnh của thời quá khứ, ái được đề cập bởi từ “nandī” (hỷ) là một, và vô minh, hành, thủ, hữu chưa được đề cập cũng được bao hàm bởi đặc tính nhân duyên.
Jātijarāmaraṇavacanena pana yesaṃ khandhānaṃ tajjātijarāmaraṇaṃ, te vuttā yevāti katvā āyatiṃ viññāṇanāmarūpasaḷāyatanaphassavedanā gahitāva honti.
And by the words "birth, aging, and death," because it is said of whichever aggregates that birth, aging, and death occur, in the future, consciousness, name-and-form, the six sense bases, contact, and feeling are also included.
Còn bởi từ “sanh già chết”, các uẩn mà sanh già chết thuộc về chúng đã được đề cập, và do đó, thức, danh sắc, sáu xứ, xúc, thọ trong tương lai cũng được bao hàm.
Evamete ‘‘purimakammabhavasmiṃ moho avijjā, āyūhanā saṅkhārā, nikanti taṇhā, upagamanaṃ upādānaṃ, cetanā bhavo iti ime pañca dhammā purimakammabhavasmiṃ idha paṭisandhiyā paccayā.
In this way, these should be understood here: "In the past kamma-becoming, delusion is ignorance, volition is formations, fondness is craving, taking up is clinging, intention is becoming; these five things in the past kamma-becoming are conditions for rebirth in this life.
Như vậy, hai mươi khía cạnh với các đặc tính đã được chỉ rõ ở đây cần phải được hiểu là: “Trong nghiệp hữu quá khứ, si là vô minh, sự tích tập là hành, sự thích thú là ái, sự bám chấp là thủ, ý chí là hữu. Năm pháp này là nhân duyên cho sự tái sanh ở đây.
Idha paṭisandhi viññāṇaṃ, okkanti nāmarūpaṃ, pasādo āyatanaṃ, phuṭṭho phasso, vedayitaṃ vedanā iti ime pañca dhammā idhūpapattibhavasmiṃ purekatassa kammassa paccayā.
Here, rebirth-linking is consciousness, descent is name-and-form, sensitivity is sense base, being touched is contact, experiencing is feeling; these five things in this rebirth-becoming are due to kamma performed in the past.
Ở đây, sự tái sanh là thức, sự nhập vào là danh sắc, sự trong sáng là xứ, sự tiếp xúc là xúc, sự cảm nhận là thọ. Năm pháp này là nhân duyên cho nghiệp đã tạo trong kiếp trước, trong tái sanh hữu ở đây.
Idha paripakkattā āyatanānaṃ moho avijjā, āyūhanā saṅkhārā, nikanti taṇhā, upagamanamupādānaṃ, cetanā bhavo iti ime pañca dhammā idha kammabhavasmiṃ āyatiṃ paṭisandhiyā paccayā.
Here, due to the ripening of the sense bases, delusion is ignorance, volition is formations, fondness is craving, taking up is clinging, intention is becoming; these five things in this kamma-becoming are conditions for rebirth in the future.
Ở đây, do sự chín muồi của các xứ, si là vô minh, sự tích tập là hành, sự thích thú là ái, sự bám chấp là thủ, ý chí là hữu. Năm pháp này là nhân duyên cho sự tái sanh trong tương lai, trong nghiệp hữu ở đây.
Āyatiṃ paṭisandhi viññāṇaṃ, okkanti nāmarūpaṃ, pasādo āyatanaṃ, phuṭṭho phasso, vedayitaṃ vedanā iti ime pañca dhammā āyatiṃ upapattibhavasmiṃ idha katassa kammassa paccayā’’ti evaṃ niddiṭṭhalakkhaṇā vīsati ākārā idha veditabbā.
In the future, rebirth-linking will be consciousness, descent will be name-and-form, sensitivity will be sense base, being touched will be contact, experiencing will be feeling; these five things in the future rebirth-becoming will be due to kamma performed in this life." Thus, the twenty aspects with their stated characteristics should be understood here.
Trong tương lai, sự tái sanh là thức, sự nhập vào là danh sắc, sự trong sáng là xứ, sự tiếp xúc là xúc, sự cảm nhận là thọ. Năm pháp này là nhân duyên cho nghiệp đã tạo ở đây, trong tái sanh hữu trong tương lai”.
Evaṃ ‘‘nandī dukkhassa mūlanti iti viditvā bhavā jāti, bhūtassa jarāmaraṇa’’nti ettāvatā esa sabbopi catusaṅkhepo tisandhi tiyaddho vīsatākāro paṭiccasamuppādo dassito hotīti veditabbo.
Thus it should be understood that with just this much—"Having known thus that delight is the root of suffering, from becoming there is birth, and for what has come to be there is aging and death"—this entire dependent origination with its four summaries, three connections, three time periods, and twenty aspects has been shown.
Như vậy, “Nandī dukkhassa mūlanti iti viditvā bhavā jāti, bhūtassa jarāmaraṇa” (Hỷ là cội rễ của khổ, biết như vậy, từ hữu sanh, của chúng sanh là già chết) – đến đây, toàn bộ Duyên khởi với bốn tóm tắt, ba liên kết, ba thời kỳ và hai mươi khía cạnh đã được trình bày, cần phải được hiểu như vậy.
Idāni tasmā tiha, bhikkhave…pe… abhisambuddhoti vadāmīti ettha apubbapadavaṇṇanaṃ katvā padayojanāya atthanigamanaṃ karissāma.
Now, regarding the passage, Therefore, bhikkhus... I say that I am fully enlightened, having explained the terms not previously explained, we will conclude the meaning with the connection of the terms.
Bây giờ, trong câu tasmā tiha, bhikkhave…pe… abhisambuddhoti vadāmīti (Do đó, này các Tỳ-khưu…v.v… Ta nói rằng đã giác ngộ hoàn toàn), chúng ta sẽ giải thích các từ chưa được giải thích và kết luận ý nghĩa bằng cách kết hợp các từ.
Tasmā tihāti tasmā icceva vuttaṃ hoti.
Therefore is simply stated as tasmā.
Tasmā tihāti (Do đó) có nghĩa là “tasmā” (do đó) mà thôi.
Tikārahakārā hi nipātā.
For the syllables ti and ha are particles.
Vì ti và ha là các giới từ.
Sabbasoti anavasesavacanametaṃ.
In every way is a term meaning "without remainder."
Sabbasoti (hoàn toàn) là một từ chỉ sự không còn sót lại.
Taṇhānanti nandīti evaṃ vuttānaṃ sabbataṇhānaṃ.
Of cravings means of all cravings spoken of as "delight."
Taṇhānaṃ (của các ái) là của tất cả các ái được gọi là “nandī” (hỷ) như vậy.
Khayāti lokuttaramaggena accantakkhayā.
Through the destruction means through the utter destruction by the supramundane path.
Khayā (do sự diệt tận) là do sự diệt tận tuyệt đối bằng đạo siêu thế.
Virāgādīni khayavevacanāneva.
Fading away, and so on, are synonyms for destruction.
Virāgādīni (ly tham, v.v.) chỉ là những từ đồng nghĩa với “khaya” (diệt tận).
Yā hi taṇhā khīṇā, virattāpi tā bhavanti niruddhāpi cattāpi paṭinissaṭṭhāpi.
For whatever craving is destroyed, it is also faded away, ceased, given up, and relinquished.
Vì ái nào đã diệt tận, ái đó cũng trở nên ly tham, diệt, xả bỏ và từ bỏ hoàn toàn.
Khayāti vā catumaggakiccasādhāraṇametaṃ.
Or, through the destruction is common to the function of all four paths.
Hoặc khayā (diệt tận) là từ chung cho bốn việc của Đạo.
Tato paṭhamamaggena virāgā, dutiyena nirodhā, tatiyena cāgā, catutthena paṭinissaggāti yojetabbaṃ.
Therefore, it should be connected thus: fading away through the first path, cessation through the second, giving up through the third, relinquishment through the fourth.
Từ đó, cần phải kết hợp như sau: virāgā (do ly tham) bằng đạo thứ nhất, nirodhā (do sự đoạn diệt) bằng đạo thứ hai, cāgā (do sự xả bỏ) bằng đạo thứ ba, paṭinissaggā (do sự từ bỏ hoàn toàn) bằng đạo thứ tư.
Yāhi vā taṇhāhi pathaviṃ pathavito sañjāneyya, tāsaṃ khayā.
Or, through the destruction of those cravings by which one would perceive earth as earth.
Hoặc do sự diệt tận của những ái mà người ta nhận thức đất là đất.
Yāhi pathaviṃ maññeyya, tāsaṃ virāgā.
Through the fading away of those by which one would conceive earth.
Do sự ly tham của những ái mà người ta cho rằng đất.
Yāhi pathaviyā maññeyya, tāsaṃ nirodhā.
Through the cessation of those by which one would conceive in earth.
Do sự đoạn diệt của những ái mà người ta cho rằng trong đất.
Yāhi pathavito maññeyya, tāsaṃ cāgā.
Through the giving up of those by which one would conceive from earth.
Do sự xả bỏ của những ái mà người ta cho rằng từ đất.
Yāhi pathaviṃ meti maññeyya, tāsaṃ paṭinissaggā.
Through the relinquishment of those by which one would conceive 'earth is mine'.
Do sự từ bỏ hoàn toàn của những ái mà người ta cho rằng đất là của tôi.
Yāhi vā pathaviṃ maññeyya, tāsaṃ khayā…pe… yāhi pathaviṃ abhinandeyya, tāsaṃ paṭinissaggāti evamettha yojanā kātabbā, na kiñci virujjhati.
Or, through the destruction of those by which one would conceive earth... and so on... through the relinquishment of those by which one would delight in earth. The connection should be made in this way here; there is no contradiction whatsoever.
Hoặc do sự diệt tận của những ái mà người ta cho rằng đất…v.v… do sự từ bỏ hoàn toàn của những ái mà người ta hoan hỷ đất. Ở đây, sự kết hợp như vậy phải được thực hiện, không có gì mâu thuẫn.
Anuttaranti uttaravirahitaṃ sabbaseṭṭhaṃ.
Unsurpassable means without a superior, the very best.
Anuttaraṃ (vô thượng) là không có gì cao hơn, là tối thượng của tất cả.
Sammāsambodhinti sammā sāmañca bodhiṃ.
Perfect full enlightenment means the awakening that is right and happens by itself.
Sammāsambodhiṃ (Chánh Đẳng Giác) là sự giác ngộ đúng đắn và tự mình.
Atha vā pasatthaṃ sundarañca bodhiṃ.
Or, the praiseworthy and beautiful awakening.
Hoặc là sự giác ngộ đáng khen ngợi và tốt đẹp.
Bodhīti rukkhopi maggopi sabbaññutañāṇampi nibbānampi.
Awakening (bodhi) can refer to a tree, the path, the knowledge of omniscience, or Nibbāna.
Bodhi (Bồ-đề) có thể là cây, có thể là đạo, có thể là Toàn giác trí, và có thể là Nibbāna.
‘‘Bodhirukkhamūle paṭhamābhisambuddho’’ti (mahāva. 1; udā. 1) ca ‘‘antarā ca bodhiṃ antarā ca gaya’’nti (mahāva. 11; ma. ni. 1.285) ca āgataṭṭhānehi rukkho bodhīti vuccati.
In the places where it is stated, "the first to be fully enlightened at the root of the Bodhi tree," and "between Bodhi and Gayā," the tree is called Bodhi.
Ở những chỗ như “Bodhirukkhamūle paṭhamābhisambuddho” (Đã giác ngộ hoàn toàn lần đầu tiên dưới cội Bồ-đề) và “antarā ca bodhiṃ antarā ca gaya”ṃ (giữa cội Bồ-đề và Gaya), Bồ-đề được gọi là cây.
‘‘Catūsu maggesu ñāṇa’’nti (cūḷani. 121) āgataṭṭhāne maggo.
In the place where it is stated, "knowledge in the four paths," it is the path.
Ở chỗ như “Catūsu maggesu ñāṇa”ṃ (trí tuệ trong bốn đạo), đó là đạo.
‘‘Pappoti bodhiṃ varabhūrimedhaso’’ti (dī. ni. 3.217) āgataṭṭhāne sabbaññutañāṇaṃ.
In the place where it is stated, "he of excellent, vast, and good wisdom attains awakening," it is the knowledge of omniscience.
Ở chỗ như “Pappoti bodhiṃ varabhūrimedhaso” (Vị đại trí tuệ đạt đến Bồ-đề), đó là Toàn giác trí.
‘‘Patvāna bodhiṃ amataṃ asaṅkhata’’nti āgataṭṭhāne nibbānaṃ.
In the place where it is stated, "having reached Bodhi, the deathless, the unconditioned," it is Nibbāna.
Ở chỗ như “Patvāna bodhiṃ amataṃ asaṅkhata”ṃ (đã đạt đến Bồ-đề bất tử, vô vi), đó là Nibbāna.
Idha pana bhagavato arahattamaggañāṇaṃ adhippetaṃ.
Here, however, the Blessed One's knowledge of the path of arahantship is intended.
Ở đây, ý nghĩa được đề cập là A-la-hán đạo trí của Đức Thế Tôn.
Apare sabbaññutañāṇantipi vadanti.
Others say it is the knowledge of omniscience.
Một số người khác nói đó là Toàn giác trí.
Sāvakānaṃ arahattamaggo anuttarā bodhi hoti na hotīti.
Is the path of arahantship of the disciples the unsurpassable awakening or not?
A-la-hán đạo của các Sāvakānaṃ (Thanh văn) có phải là Bồ-đề vô thượng hay không?
Na hoti.
It is not.
Không phải.
Asabbaguṇadāyakattā.
Because it does not bestow all qualities.
Vì nó không ban cho tất cả các phẩm chất.
Tesañhi kassaci arahattamaggo arahattaphalameva deti, kassaci tisso vijjā, kassaci cha abhiññā, kassaci catasso paṭisambhidā, kassaci sāvakapāramīñāṇaṃ.
Indeed, for some of them, the path to arahatship gives only the fruit of arahatship; for some, the three true knowledges; for some, the six supernormal knowledges; for some, the four analytical knowledges; and for some, the knowledge of a disciple's perfections.
A-la-hán đạo của một số vị chỉ ban A-la-hán quả, của một số vị ban ba minh, của một số vị ban sáu thần thông, của một số vị ban Thanh văn Ba-la-mật trí.
Paccekabuddhānampi paccekabodhiñāṇameva deti.
For Paccekabuddhas, it gives only the knowledge of a Paccekabodhi.
A-la-hán đạo của các Paccekabuddhānaṃpi (Độc Giác Phật) chỉ ban Độc Giác Bồ-đề trí mà thôi.
Buddhānaṃ pana sabbaguṇasampattiṃ deti abhiseko viya rañño sabbalokissariyabhāvaṃ.
For Buddhas, however, it gives the accomplishment of all qualities, just as a consecration gives a king sovereignty over the entire world.
Còn đối với các Buddhānaṃ (Đức Phật), nó ban cho sự viên mãn của tất cả các phẩm chất, giống như lễ quán đảnh ban cho vua quyền cai trị toàn cõi thế gian.
Tasmā aññassa kassacipi anuttarā bodhi na hotīti.
Therefore, the bodhi of anyone else is not supreme.
Do đó, Bồ-đề vô thượng không thuộc về bất kỳ ai khác.
Abhisambuddhoti abhiññāsi paṭivijjhi, patto adhigatoti vuttaṃ hoti.
Abhisambuddho means he directly knew, he penetrated, he attained, he realized.
Abhisambuddhoti (đã giác ngộ hoàn toàn) có nghĩa là đã chứng ngộ, đã thấu hiểu, đã đạt được, đã thành tựu.
Iti vadāmīti iti vadāmi ācikkhāmi desemi paññapemi, paṭṭhapemi vivarāmi vibhajāmi uttānīkaromīti.
Iti vadāmi means thus I say, I declare, I teach, I proclaim, I establish, I reveal, I analyze, I make clear.
Iti vadāmīti (Ta nói như vậy) có nghĩa là Ta nói, Ta giảng dạy, Ta thuyết giảng, Ta tuyên bố, Ta thiết lập, Ta làm sáng tỏ, Ta phân tích, Ta làm cho rõ ràng.
Tatrāyaṃ yojanā – tathāgatopi, bhikkhave…pe… pathaviṃ na maññati…pe… pathaviṃ nābhinandati.
Herein, this is the connection: The Tathāgata too, monks… and so on… does not conceive the earth… and so on… does not delight in the earth.
Ở đây, sự kết hợp là: Này các Tỳ-khưu, Đức Tathāgata cũng…v.v… không cho rằng đất…v.v… không hoan hỷ đất.
Taṃ kissa hetu, nandī dukkhassa mūlaṃ, bhavā jāti, bhūtassa jarāmaraṇanti iti viditvāti.
For what reason? Because he has understood it thus: “Delight is the root of suffering, from existence comes birth, for one who has come to be there is aging and death.”
Vì lý do gì? Vì đã biết rằng hoan hỷ là cội rễ của khổ đau, từ hữu sinh ra sinh, từ sự hiện hữu sinh ra già và chết.
Tattha iti viditvāti itikāro kāraṇattho.
Therein, in iti viditvā, the word iti has the meaning of a cause.
Trong đó, iti viditvā (đã biết như vậy) – từ iti có nghĩa là lý do (kāraṇa).
Tena imassa paṭiccasamuppādassa viditattā paṭividdhattāti vuttaṃ hoti.
By that, it is said: “because of having known this dependent origination, because of having penetrated it.”
Do đó, có nghĩa là vì đã biết và thấu hiểu duyên khởi (paṭiccasamuppāda) này.
Kiñca bhiyyo – yasmā ca evamimaṃ paṭiccasamuppādaṃ viditvā tathāgatassa yā nandīti vuttataṇhā sabbappakārā, sā pahīnā, tāsañca tathāgato sabbaso taṇhānaṃ khayā…pe… anuttaraṃ sammāsambodhiṃ abhisambuddho.
Furthermore, because, having thus understood this dependent origination, the craving which is called ‘delight’ has been abandoned in all its aspects for the Tathāgata, and because the Tathāgata, through the complete destruction of all those cravings… and so on… has fully awakened to the supreme, perfect enlightenment.
Hơn nữa, vì sau khi Như Lai đã biết duyên khởi này như vậy, thì sự hoan hỷ, tức là ái (taṇhā) đã được nói đến, với tất cả các dạng thức của nó, đã được đoạn trừ; và vì Như Lai đã diệt trừ hoàn toàn tất cả các loại ái đó… (văn bản bị cắt)… nên đã chứng đắc Vô thượng Chánh Đẳng Giác (anuttaraṃ sammāsambodhiṃ).
Tasmā pathaviṃ na maññati…pe… pathaviṃ nābhinandatīti vadāmīti evaṃ abhisambuddhattā na maññati nābhinandatīti vadāmīti vuttaṃ hoti.
Therefore, I declare that he does not conceive the earth… and so on… does not delight in the earth. Thus, it is said: I declare that because he has fully awakened, he does not conceive, does not delight.
Do đó, ta nói rằng Như Lai không tưởng tượng về đất… (văn bản bị cắt)… không hoan hỷ về đất. Như vậy, có nghĩa là vì đã chứng đắc Vô thượng Chánh Đẳng Giác nên ta nói rằng Như Lai không tưởng tượng và không hoan hỷ.
Atha vā yasmā ‘‘nandī dukkhassa mūla’’ntiādinā nayena paṭiccasamuppādaṃ viditvā sabbaso taṇhā khayaṃ gatā, tasmā tiha, bhikkhave, tathāgato sabbaso taṇhānaṃ khayā…pe… abhisambuddhoti vadāmi.
Alternatively, because, having understood dependent origination in the manner of “delight is the root of suffering,” etc., all cravings have come to an end, therefore, monks, I declare that the Tathāgata, through the complete destruction of cravings… and so on… is fully awakened.
Hoặc, vì sau khi đã biết duyên khởi theo cách thức "hoan hỷ là cội rễ của khổ đau" và các điều khác, thì ái đã hoàn toàn đoạn diệt. Do đó, này các Tỳ-khưu, ta nói rằng Như Lai, do sự đoạn diệt hoàn toàn của ái… (văn bản bị cắt)… đã chứng đắc Vô thượng Chánh Đẳng Giác.
So evaṃ abhisambuddhattā pathaviṃ na maññati…pe… nābhinandatīti.
Being thus fully awakened, he does not conceive the earth… and so on… does not delight in it.
Vì đã chứng đắc Vô thượng Chánh Đẳng Giác như vậy, Ngài không tưởng tượng về đất… (văn bản bị cắt)… không hoan hỷ.
Yattha yattha hi yasmāti avatvā tasmāti vuccati, tattha tattha yasmāti ānetvā yojetabbaṃ, ayaṃ sāsanayutti.
Wherever ‘tasmā’ (therefore) is stated without stating ‘yasmā’ (because), ‘yasmā’ should be supplied and connected; this is the proper method of the Teaching.
Ở bất cứ chỗ nào mà từ "yasmā" (vì) không được nói đến nhưng từ "tasmā" (do đó) được nói đến, thì ở chỗ đó phải thêm từ "yasmā" vào để kết hợp. Đây là phép tắc trong giáo pháp.
Esa nayo sabbattha.
This is the method everywhere.
Quy tắc này áp dụng cho tất cả mọi nơi.
Evaṃ vicitranayadesanāvilāsayuttaṃ panetaṃ suttaṃ karavikarudamañjunā kaṇṇasukhena paṇḍitajanahadayānaṃ amatābhisekasadisena brahmassarena bhāsamānassāpi.
Although this sutta, endowed with the elegance of a teaching with such various methods, was spoken with a Brahma-like voice, which is pleasing to the ear with the sweet sound of the karavīka bird and is like an ambrosial consecration for the hearts of wise people,
Mặc dù Đức Thế Tôn đã thuyết giảng bài kinh này với cách thức trình bày đa dạng và phong phú như vậy, bằng giọng Phạm âm (brahmassarena) ngọt ngào như tiếng chim karavika, dễ chịu tai, giống như sự rưới cam lồ vào tâm trí của các bậc trí giả,
Na te bhikkhū bhagavato bhāsitaṃ abhinandunti te pañcasatā bhikkhū idaṃ bhagavato vacanaṃ nānumodiṃsu.
those monks did not delight in the Blessed One’s speech. Those five hundred monks did not approve of this word of the Blessed One.
nhưng các Tỳ-khưu ấy đã không hoan hỷ lời Đức Thế Tôn thuyết giảng. Năm trăm Tỳ-khưu ấy đã không tán đồng lời Đức Thế Tôn.
Aññāṇakena.
Due to not knowing.
Vì sự vô minh.
Te kira imassa suttassa atthaṃ na jāniṃsu, tasmā nābhinandiṃsu.
It is said that they did not know the meaning of this sutta; therefore, they did not delight in it.
Họ đã không hiểu ý nghĩa của bài kinh này, do đó họ không hoan hỷ.
Tesañhi tasmiṃ samaye evaṃ vicitranayadesanāvilāsayuttampi etaṃ suttaṃ ghanaputhulena dussapaṭṭena mukhe bandhaṃ katvā purato ṭhapitamanuññabhojanaṃ viya ahosi.
Indeed, at that time, this sutta, though endowed with the elegance of a teaching with such various methods, was for them like delicious food placed before them after their faces had been bound with a thick, heavy cloth.
Vào thời điểm đó, bài kinh này, dù được trình bày bằng nhiều cách thức đa dạng và phong phú như vậy, đối với các Tỳ-khưu ấy, giống như món ăn ngon lành được đặt trước mặt nhưng lại bị buộc chặt miệng bằng một tấm vải dày và lớn.
Nanu ca bhagavā attanā desitaṃ dhammaṃ pare ñāpetuṃ kappasatasahassādhikāni cattāri asaṅkhyeyyāni pāramiyo pūretvā sabbaññutaṃ patto.
But did not the Blessed One, in order to make others know the Dhamma he taught, attain omniscience after fulfilling the perfections for four incalculables and a hundred thousand aeons?
Chẳng phải Đức Thế Tôn đã hoàn thành các ba-la-mật (pāramī) trong bốn a-tăng-kỳ (asaṅkhyeyya) và một trăm ngàn đại kiếp (kappasatasahassādhikāni) để đạt được trí Tuệ Toàn Tri (sabbaññuta) nhằm làm cho người khác hiểu Pháp (Dhamma) mà Ngài đã thuyết giảng sao?
So kasmā yathā te na jānanti, tathā desesīti.
So why did he teach in a way that they would not understand?
Vậy tại sao Ngài lại thuyết giảng theo cách mà họ không hiểu?
Vuttamidaṃ imassa suttassa nikkhepavicāraṇāyaṃ eva ‘‘mānabhañjanatthaṃ sabbadhammamūlapariyāyanti desanaṃ ārabhī’’ti, tasmā na yidha puna vattabbamatthi, evaṃ mānabhañjanatthaṃ desitañca panetaṃ suttaṃ sutvā te bhikkhū taṃyeva kira pathaviṃ diṭṭhigatikopi sañjānāti, sekkhopi arahāpi tathāgatopi sañjānāti.
It was already stated in the exposition on the delivery of this sutta: “He began the discourse on the Root of All Things in order to crush conceit.” Therefore, there is nothing more to be said here. Hearing this sutta, which was taught to crush conceit, those monks thought: “Indeed, that very earth is perceived by one with wrong views, by the learner, by the arahant, and by the Tathāgata.
Điều này đã được nói trong phần phân tích tóm tắt của bài kinh này rằng: "Ngài đã bắt đầu thuyết giảng bài kinh Mūlapariyāya (Căn Bản Pháp Môn) này để phá tan kiêu mạn." Do đó, không cần phải nói lại ở đây. Sau khi nghe bài kinh được thuyết giảng để phá tan kiêu mạn như vậy, các Tỳ-khưu ấy đã suy nghĩ: "Đất này, ngay cả người có tà kiến (diṭṭhigatika) cũng nhận biết, bậc Hữu học (sekha) cũng nhận biết, bậc A-la-hán (arahā) cũng nhận biết, và Như Lai (tathāgata) cũng nhận biết.
Kinnāmidaṃ kathaṃ nāmidanti cintentā pubbe mayaṃ bhagavatā kathitaṃ yaṃkiñci khippameva jānāma, idāni panimassa mūlapariyāyassa antaṃ vā koṭiṃ vā na jānāma na passāma, aho buddhā nāma appameyyā atulāti uddhaṭadāṭhā viya sappā nimmadā hutvā buddhupaṭṭhānañca dhammassavanañca sakkaccaṃ āgamaṃsu.
What is this? What sort of thing is this?” And reflecting, “Previously, we quickly understood whatever the Blessed One said, but now we do not know or see the beginning or the end of this Root Discourse. Oh, Buddhas are truly immeasurable, incomparable!” they became free from intoxication, like snakes with their fangs removed, and approached the Buddha's presence and the hearing of the Dhamma with reverence.
Vậy cái này là gì? Cái này là như thế nào?" Họ nghĩ: "Trước đây, bất cứ điều gì Đức Thế Tôn nói, chúng ta đều nhanh chóng hiểu được. Nhưng bây giờ, chúng ta không biết và không thấy được giới hạn hay điểm cuối của bài kinh Căn Bản Pháp Môn này. Ôi, các vị Phật thật là vô lượng, vô song!" Họ trở nên không còn kiêu mạn, như những con rắn đã bị nhổ nanh, và thành kính đến hầu Phật và nghe Pháp.
Tena kho pana samayena bhikkhū dhammasabhāyaṃ sannisinnā imaṃ kathaṃ samuṭṭhāpesuṃ ‘‘aho buddhānaṃ ānubhāvo, te nāma brāhmaṇapabbajitā tathā mānamadamattā bhagavatā mūlapariyāyadesanāya nihatamānā katā’’ti, ayañcarahi tesaṃ bhikkhūnaṃ antarākathā vippakatā.
At that very time, the monks, sitting together in the Dhamma hall, raised this topic of conversation: “Oh, the power of the Buddhas! Those monks who had gone forth from the brahmin caste, so intoxicated with pride and conceit, have had their conceit crushed by the Blessed One’s teaching of the Root Discourse.” This was the intermittent talk of those monks that was in progress.
Vào thời điểm đó, các Tỳ-khưu đang tụ họp trong Pháp đường (dhammasabhā) đã khởi lên cuộc đàm luận này: "Ôi, sức mạnh của các vị Phật thật phi thường! Các vị Bà-la-môn xuất gia kia, vốn kiêu mạn và say đắm như vậy, đã bị Đức Thế Tôn làm cho kiêu mạn tiêu tan nhờ bài kinh Căn Bản Pháp Môn!" Như vậy, cuộc đàm luận giữa các Tỳ-khưu ấy vẫn còn dang dở.
Atha bhagavā gandhakuṭiyā nikkhamitvā taṅkhaṇānurūpena pāṭihāriyena dhammasabhāyaṃ paññattavarabuddhāsane nisīditvā te bhikkhū āha – ‘‘kāya nuttha, bhikkhave, etarahi kathāya sannisinnā’’ti.
Then the Blessed One, having come out of the perfumed chamber, by a miracle appropriate to that moment, sat down on the excellent Buddha-seat prepared in the Dhamma hall and said to those monks, “For what talk, monks, are you now gathered together?”
Rồi Đức Thế Tôn, rời khỏi Hương thất (gandhakuṭi), với một phép lạ (pāṭihāriya) phù hợp với khoảnh khắc đó, Ngài ngồi trên Pháp tòa cao quý đã được sắp đặt trong Pháp đường và hỏi các Tỳ-khưu ấy: "Này các Tỳ-khưu, hiện giờ các ông đang tụ họp để đàm luận về chuyện gì?"
Te tamatthaṃ bhagavato ārocesuṃ.
They related the matter to the Blessed One.
Họ đã trình bày sự việc đó lên Đức Thế Tôn.
Bhagavā etadavoca – ‘‘na, bhikkhave, idāneva, pubbepi ahaṃ ime evaṃ mānapaggahitasire vicarante nihatamāne akāsi’’nti.
The Blessed One said this: “Not just now, monks, but in the past too, I crushed the conceit of these very ones who were wandering with their heads held high in pride.”
Đức Thế Tôn nói: "Này các Tỳ-khưu, không phải chỉ bây giờ mà ngay cả trong quá khứ, Ta cũng đã làm cho những người kiêu mạn như vậy phải tiêu tan kiêu mạn."
Tato imissā aṭṭhuppattiyā idaṃ atītaṃ ānesi –
Then, on account of this origin story, he related this past event:
Từ đó, nhân dịp sự việc này, Ngài đã kể lại câu chuyện quá khứ sau đây:
Bhūtapubbaṃ, bhikkhave, aññataro disāpāmokkho brāhmaṇo bārāṇasiyaṃ paṭivasati tiṇṇaṃ vedānaṃ pāragū sanighaṇṭukeṭubhānaṃ sākkharappabhedānaṃ itihāsapañcamānaṃ padako veyyākaraṇo lokāyatamahāpurisalakkhaṇesu anavayo, so pañcamattāni māṇavakasatāni mante vāceti.
Once upon a time, monks, a certain world-renowned brahmin teacher lived in Bārāṇasī. He was a master of the three Vedas, along with the Nighaṇḍu and Keṭubha, the phonological distinctions, with history as the fifth; he was a grammarian and an exegete, and was unsurpassed in the Lokāyata and the marks of a great man. He taught the sacred texts to five hundred young men.
"Này các Tỳ-khưu, thuở xưa, có một Bà-la-môn nổi tiếng khắp các phương (disāpāmokkho) trú tại Bārāṇasī. Ông là người thông thạo ba bộ Veda, cùng với các từ điển (nighaṇṭu), ngữ pháp (keṭubha), các phân loại chữ cái (sākkharappabheda), và bộ Itihāsa (sử thi) là thứ năm. Ông là người đọc tụng (padako), nhà ngữ pháp (veyyākaraṇo), và tinh thông về Lokāyata (luận lý học thế gian) và các tướng đại nhân (mahāpurisalakkhaṇa). Ông đã dạy chú thuật cho khoảng năm trăm môn đệ.
Paṇḍitā māṇavakā bahuñca gaṇhanti lahuñca, suṭṭhu ca upadhārenti, gahitañca tesaṃ na vinassati.
The wise young men learned a great deal and learned it quickly, and they paid close attention. And what they had learned was not lost to them.
Các môn đệ ấy là những người thông minh, học được nhiều và dễ dàng, ghi nhớ rất kỹ, và những gì đã học không bị mất đi.
Sopi brāhmaṇo ācariyamuṭṭhiṃ akatvā ghaṭe udakaṃ āsiñcanto viya sabbampi sippaṃ uggaṇhāpetvā te māṇavake etadavoca ‘‘ettakamidaṃ sippaṃ diṭṭhadhammasamparāyahita’’nti.
That brahmin, too, without keeping a “teacher's fist,” had them learn all the skills, just like pouring water into a pot, and then said this to those young men: “This much is the skill that is for the welfare of this life and the next.”
Vị Bà-la-môn ấy, không giữ lại bất kỳ bí quyết nào của thầy (ācariyamuṭṭhiṃ akatvā), đã dạy tất cả các môn học cho các môn đệ như đổ nước từ bình này sang bình khác, và nói với họ: "Môn học này, chừng này, là có lợi cho đời này và đời sau (diṭṭhadhammasamparāyahitaṃ)."
Te māṇavakā – ‘‘yaṃ amhākaṃ ācariyo jānāti, mayampi taṃ jānāma, mayampi dāni ācariyā evā’’ti mānaṃ uppādetvā tato pabhuti ācariye agāravā nikkhittavattā vihariṃsu.
Those young men, thinking, “What our teacher knows, we also know. Now we too are teachers,” generated conceit and from then on lived disrespectfully towards their teacher, having abandoned their duties.
Các môn đệ ấy liền khởi lên sự kiêu mạn rằng: "Những gì thầy chúng ta biết, chúng ta cũng biết. Bây giờ chúng ta cũng là những người thầy rồi!" Từ đó, họ sống thiếu tôn kính với thầy và bỏ bê bổn phận.
Ācariyo ñatvā ‘‘karissāmi nesaṃ mānaniggaha’’nti cintesi.
The teacher, knowing this, thought, “I will crush their conceit.”
Người thầy biết được điều đó và nghĩ: "Ta sẽ làm cho họ khuất phục kiêu mạn."
So ekadivasaṃ upaṭṭhānaṃ āgantvā vanditvā nisinne te māṇavake āha ‘‘tātā pañhaṃ pucchissāmi, kaccittha samatthā kathetu’’nti.
So one day, he said to those young men who had come to attend on him, and were seated after paying homage, “My dears, I will ask a question. Are you able to answer it?”
Một ngày nọ, ông đến chỗ các môn đệ đang ngồi sau khi đã đảnh lễ, và nói: "Này các con, ta sẽ hỏi một câu hỏi. Các con có thể trả lời được không?"
Te ‘‘pucchatha ācariya, pucchatha ācariyā’’ti sahasāva āhaṃsu, yathā taṃ sutamadamattā.
As might be expected of those intoxicated with the pride of learning, they immediately said, “Ask, teacher, ask, teacher!”
Họ vội vàng trả lời: "Thưa thầy, xin thầy cứ hỏi! Thưa thầy, xin thầy cứ hỏi!" đúng như những người say sưa vì sự học.
Ācariyo āha –
The teacher said:
Người thầy nói:
Te cintetvā ajānamānā tuṇhī ahesuṃ.
They, after thinking, not knowing the answer, remained silent.
Họ suy nghĩ nhưng không biết, nên im lặng.
Ācariyo āha ‘‘alaṃ tātā gacchathajja, sve katheyyāthā’’ti uyyojesi.
The teacher said, “Enough, my dears, go for today. You may speak tomorrow,” and dismissed them.
Người thầy nói: "Thôi được rồi, các con hãy về hôm nay, ngày mai hãy trả lời!" và cho họ về.
Te dasapi vīsatipi sampiṇḍitā hutvā na tassa pañhassa ādiṃ, na antamaddasaṃsu.
Even after gathering together for ten or twenty days, they could not see the beginning or the end of that question.
Mười người, hai mươi người, họ tụ tập lại nhưng không tìm thấy đầu mối hay kết thúc của câu hỏi đó.
Āgantvā ācariyassa ārocesuṃ ‘‘na imassa pañhassa atthaṃ ājānāmā’’ti.
Having approached the teacher, they reported, “We do not know the meaning of this question.”
Họ trở lại và trình bày với thầy: "Chúng con không hiểu ý nghĩa của câu hỏi này."
Ācariyo tesaṃ niggahatthāya imaṃ gāthamabhāsi –
To admonish them, the teacher recited this verse –
Người thầy, để khuất phục họ, đã nói bài kệ này:
Gāthāyattho – bahūni narānaṃ sīsāni dissanti, sabbāni ca tāni lomasāni sabbāni ca mahantāni gīvāyameva ca ṭhapitāni, na tālaphalaṃ viya hatthena gahitāni, natthi tesaṃ imehi dhammehi nānākaraṇaṃ.
The meaning of the verse is as follows: Many heads of men are seen, and all of them are hairy, and all are large, and they are set upon the neck; they are not held in the hand like a palmyra fruit. There is no distinction among them with regard to these qualities.
Ý nghĩa của bài kệ – Nhiều cái đầu của con người được thấy, tất cả chúng đều có tóc và tất cả đều to lớn, chúng được đặt trên cổ, không phải được cầm bằng tay như quả thốt nốt. Không có sự khác biệt nào giữa chúng về những đặc điểm này.
Ettha pana kocideva kaṇṇavāti attānaṃ sandhāyāha.
Here, however, “only someone here has ears” was said in reference to himself.
Ở đây, "có người nào đó có tai" là nói đến chính mình.
Kaṇṇavāti paññavā.
One with ears means one with wisdom.
Kaṇṇavā có nghĩa là người có trí tuệ.
Kaṇṇacchiddaṃ pana na kassaci natthi, taṃ sutvā te māṇavakā maṅkubhūtā pattakkhandhā adhomukhā aṅguliyā bhūmiṃ vilikhantā tuṇhī ahesuṃ.
But there is no one who does not have ear-holes. Hearing that, those young men became disconcerted, with drooping shoulders and downcast faces, scratching the ground with their fingers, they became silent.
Thật ra, không ai là không có lỗ tai, nghe lời đó, các thanh niên ấy trở nên bối rối, cúi đầu, mặt úp xuống, dùng ngón tay vạch đất và im lặng.
Atha nesaṃ ahirikabhāvaṃ passitvā ācariyo ‘‘uggaṇhatha tātā pañha’’nti pañhaṃ vissajjesi.
Then, seeing their shamelessness, the teacher explained the riddle, saying, “Learn the riddle, my dears.”
Bấy giờ, thấy sự vô liêm sỉ của họ, vị đạo sư nói: "Này các con, hãy học hỏi câu hỏi này!" rồi giải đáp câu hỏi.
Kāloti purebhattakālopi pacchābhattakālopīti evamādi.
Time means the forenoon-time, the afternoon-time, and so on.
Kālo (Thời gian) có nghĩa là thời gian trước bữa ăn, thời gian sau bữa ăn, v.v.
Bhūtānīti sattādhivacanametaṃ.
Beings is a designation for sentient beings.
Bhūtāni đây là từ chỉ các chúng sinh.
Kālo hi bhūtānaṃ na cammamaṃsādīni khādati, apica kho nesaṃ āyuvaṇṇabalāni khepento yobbaññaṃ maddanto ārogyaṃ vināsento ghasati khādatīti vuccati.
For time does not eat the skin, flesh, etc., of beings, but rather, by depleting their lifespan, beauty, and strength, by crushing their youth, and by destroying their health, it is said to devour and eat them.
Thời gian không ăn thịt hay xương của chúng sinh, nhưng nó làm suy giảm tuổi thọ, sắc đẹp và sức mạnh của họ, nghiền nát tuổi trẻ, hủy hoại sức khỏe, nên được gọi là ghasati (ăn, nuốt).
Sabbāneva sahattanāti evaṃ ghasanto ca na kiñci vajjeti, sabbāneva ghasati.
All, including itself: And in devouring thus, it does not leave anything out; it devours all without exception.
Sabbāneva sahattanā (tất cả cùng với chính nó) có nghĩa là, khi ăn như vậy, nó không bỏ sót bất cứ điều gì, nó ăn tất cả.
Na kevalañca bhūtāniyeva, apica kho sahattanā attānampi ghasati.
And not only beings, but it also devours itself along with them.
Không chỉ ăn các chúng sinh, mà còn ăn chính nó, tức là thời gian ăn chính nó.
Purebhattakālo hi pacchābhattakālaṃ na pāpuṇāti.
For the forenoon-time does not reach the afternoon-time.
Thời gian trước bữa ăn không đạt đến thời gian sau bữa ăn.
Esa nayo pacchābhattakālādīsu.
This same principle applies to the afternoon-time and so on.
Tương tự đối với thời gian sau bữa ăn, v.v.
Yo ca kālaghaso bhūtoti khīṇāsavassetaṃ adhivacanaṃ.
And that being who devours time is a designation for one whose taints are destroyed.
Yo ca kālaghaso bhūto đây là từ chỉ vị A-la-hán.
So hi āyatiṃ paṭisandhikālaṃ khepetvā khāditvā ṭhitattā ‘‘kālaghaso’’ti vuccati.
For he, having exhausted and consumed the time for future rebirth-linking, is called one who “devours time.”
Vị ấy được gọi là "kālaghaso" (kẻ nuốt thời gian) vì đã tiêu diệt và nuốt chửng thời gian tái sinh trong tương lai.
Sa bhūtapacaniṃ pacīti so yāyaṃ taṇhā apāyesu bhūte pacati, taṃ ñāṇagginā paci dayhi bhasmamakāsi, tena ‘‘bhūtapacaniṃ pacī’’ti vuccati.
He has cooked the cooker of beings: That is, the craving which cooks beings in the states of loss—he has cooked it, burned it, and reduced it to ash with the fire of knowledge. Therefore, he is called one who “has cooked the cooker of beings.”
Sa bhūtapacaniṃ pacī có nghĩa là vị ấy đã đốt cháy và biến thành tro bằng ngọn lửa trí tuệ cái tham ái đã nung nấu các chúng sinh trong các cảnh khổ, vì vậy được gọi là "bhūtapacaniṃ pacī".
‘‘Pajani’’ntipi pāṭho.
There is also the reading “pajaniṃ.”
Cũng có bản đọc là "pajaniṃ".
Janikaṃ nibbattikanti attho.
The meaning is that which generates or produces.
Ý nghĩa là kẻ tạo ra, kẻ sinh ra.
‘‘Abhiññāyāhaṃ, bhikkhave, dhammaṃ desemi no anabhiññāya, sanidānāhaṃ…pe… sappāṭihāriyāhaṃ, bhikkhave, dhammaṃ desemi no appāṭihāriyaṃ.
“I teach the Dhamma, bhikkhus, having directly known it, not without having directly known it. I teach the Dhamma with its cause… and so on… I teach the Dhamma, bhikkhus, with its marvels, not without its marvels.
"Này các Tỳ-khưu, Ta thuyết pháp với sự thắng trí, không phải không có thắng trí; Ta thuyết pháp có nguyên nhân... (v.v.)... Ta thuyết pháp có thần thông, không phải không có thần thông.
Tassa mayhaṃ, bhikkhave, abhiññāya dhammaṃ desayato…pe… no appāṭihāriyaṃ.
Of me, bhikkhus, who teaches the Dhamma having directly known it… and so on… not without its marvels,
Này các Tỳ-khưu, đối với Ta, người thuyết pháp với sự thắng trí... (v.v.)... không phải không có thần thông.
Karaṇīyo ovādo, karaṇīyā anusāsanī.
the exhortation should be followed, the instruction should be followed.
Sự khuyên dạy cần được thực hiện, sự giáo huấn cần được thực hiện.
Alañca pana vo, bhikkhave, tuṭṭhiyā alaṃ attamanatāya alaṃ somanassāya.
And it is enough for you, bhikkhus, to be glad, enough to be satisfied, enough to be joyful, thinking:
Và này các Tỳ-khưu, các ông đủ để hoan hỷ, đủ để vui mừng, đủ để hân hoan.
Sammāsambuddho bhagavā, svākkhāto dhammo, suppaṭipanno saṅghoti.
‘The Blessed One is a perfectly enlightened one, the Dhamma is well-proclaimed, the Saṅgha is of good conduct.’
Thế Tôn là bậc Chánh Đẳng Giác, Pháp được thuyết giảng khéo léo, Tăng đoàn thực hành tốt đẹp.
Idamavoca bhagavā, imasmiñca pana veyyākaraṇasmiṃ bhaññamāne dasasahassilokadhātu akampitthā’’ti (a. ni. 3.126).
This the Blessed One said, and while this prose discourse was being spoken, the ten-thousand-world-system quaked.”
Thế Tôn đã nói điều này, và khi lời giải thích này được thuyết giảng, mười ngàn thế giới đã rung chuyển."
14. Evaṃ me sutaṃ…pe… sāvatthiyanti sabbāsavasuttaṃ.
14. Thus have I heard… and so on… at Sāvatthī is the Sabbāsava Sutta.
14. Evaṃ me sutaṃ...pe... Sāvatthiya (Như vầy tôi nghe... tại Sāvatthī) là kinh Sabbāsava.
Tatrāyaṃ apubbapadavaṇṇanā – sāvatthīti savatthassa isino nivāsaṭṭhānabhūtā nagarī, yathā kākandī mākandī kosambīti evaṃ tāva akkharacintakā.
Therein, this is the explanation of words not previously explained: Sāvatthī is the city that was the dwelling place of the seer Savattha. Thus say the etymologists, just as in the cases of Kākandī, Mākandī, and Kosambī.
Trong đó, đây là phần giải thích các từ chưa từng có trước đây – Sāvatthī là thành phố là nơi cư trú của vị ẩn sĩ tên Savattha, giống như Kākanadī, Mākanadī, Kosambī, v.v. Đó là cách các nhà ngữ pháp giải thích.
Aṭṭhakathācariyā pana bhaṇanti ‘‘yaṃkiñci manussānaṃ upabhogaparibhogaṃ sabbamettha atthīti sāvatthī.
The commentary teachers, however, say: “Because everything for human use and enjoyment is found here, it is called Sāvatthī.”
Tuy nhiên, các vị chú giải sư nói rằng: "Bất cứ vật dụng tiêu dùng nào của con người đều có ở đây, vì vậy gọi là Sāvatthī.
Satthasamāyoge ca kiṃ bhaṇḍamatthīti pucchite sabbamatthī’’ti vacanamupādāya sāvatthī.
And when asked at a gathering of merchants, “What goods are available?” the response “Everything is available” gave rise to the name Sāvatthī.
Và khi được hỏi 'có hàng hóa gì không' tại nơi hội họp của mọi người, câu trả lời là 'có tất cả', dựa vào lời nói đó mà gọi là Sāvatthī."
Tassaṃ sāvatthiyaṃ.
Like Āḷakamandā of the gods, is the supreme city of Sāvatthī.”
Đã đạt đến sự tăng trưởng và phát triển, thịnh vượng, phong phú, làm say đắm lòng người; Thành phố Sāvatthī tối thượng, giống như Alakamandā của chư thiên."
Jetavaneti ettha attano paccatthikajanaṃ jinātīti jeto, raññā vā attano paccatthikajane jite jātoti jeto, maṅgalakamyatāya vā tassa evaṃnāmameva katanti jeto, jetassa vanaṃ jetavanaṃ.
In that Sāvatthī. In Jeta’s Grove: Here, because he conquers his enemies, he is Jeta; or he was born when the king conquered his enemies, so he is Jeta; or, for the sake of an auspicious name, he was simply named so. Jeta’s Grove is the grove of Jeta.
Tại Sāvatthī đó.
Tañhi jetena rājakumārena ropitaṃ saṃvaddhitaṃ paripālitaṃ, so ca tassa sāmī ahosi.
For it was planted, nurtured, and protected by Prince Jeta, and he was its owner.
Jetavane (Trong Jetavana): Ở đây, Jeta là người chiến thắng kẻ thù của mình, hoặc Jeta là người được sinh ra khi nhà vua đã chiến thắng kẻ thù của mình, hoặc Jeta là tên được đặt để cầu may mắn. Jetavana là khu rừng của Jeta.
Tasmā jetavananti vuccati, tasmiṃ jetavane.
Therefore, it is called Jeta’s Grove. In that Jeta’s Grove. In Anāthapiṇḍika’s monastery: Here, that householder was named Sudatta by his parents.
Khu rừng ấy được trồng, nuôi dưỡng và bảo vệ bởi hoàng tử Jeta, và ông là chủ của nó.
Anāthapiṇḍikassa ārāmeti ettha sudatto nāma so gahapati mātāpitūhi katanāmavasena.
However, due to his abundance of all desirable things, his freedom from the stain of stinginess, and his possession of virtues such as compassion, he constantly gave alms to the destitute; thus he became known as Anāthapiṇḍika.
Vì vậy, nó được gọi là Jetavana, trong Jetavana đó.
Sabbakāmasamiddhitāya pana vigatamalamaccheratāya karuṇādiguṇasamaṅgitāya ca niccakālaṃ anāthānaṃ piṇḍamadāsi, tena anāthapiṇḍikoti saṅkhaṃ gato.
Beings, or especially the ordained, delight (āramanti) here, thus it is a monastery (ārāma). Because of the beauty of its flowers, fruits, and so on, and its possession of the five qualities of a dwelling place, such as being not too far and not too near, people come from all around and delight (ramanti), take great delight (abhiramanti), and live there without dissatisfaction.
Anāthapiṇḍikassa ārāme (Trong tu viện của Anāthapiṇḍika): Ở đây, vị gia chủ đó tên là Sudatta theo tên cha mẹ đặt.
Āramanti ettha pāṇino visesena vā pabbajitāti ārāmo, tassa pupphaphalādisobhāya nātidūranaccāsannatādipañcavidhasenāsanaṅgasampattiyā ca tato tato āgamma ramanti abhiramanti anukkaṇṭhitā hutvā nivasantīti attho.
Or, due to its aforementioned qualities, it draws in and delights even those who have gone elsewhere, thus it is a monastery (ārāma).
Nhưng vì ông luôn bố thí thức ăn cho những người vô gia cư do sự sung túc mọi ham muốn, không còn ô nhiễm keo kiệt, và đầy đủ các đức tính như lòng bi mẫn, nên ông được gọi là Anāthapiṇḍika.
Vuttappakārāya vā sampattiyā tattha tattha gatepi attano abbhantaraṃyeva ānetvā rametīti ārāmo.
For it was purchased by the householder Anāthapiṇḍika from Prince Jeta for eighteen crores of gold coins, covering the ground with them, had dwellings built for another eighteen crores of gold coins, and completed the monastery dedication ceremony for a further eighteen crores of gold coins. Thus, with an expenditure of fifty-four crores of gold coins, it was dedicated to the Saṅgha with the Buddha at its head.
Ārāma (tu viện) là nơi các chúng sinh đặc biệt là các tu sĩ vui vẻ, tức là họ đến từ khắp nơi và sống ở đó mà không chán nản, do vẻ đẹp của hoa quả và sự đầy đủ năm yếu tố của chỗ ở như không quá xa, không quá gần.
So hi anāthapiṇḍikena gahapatinā jetassa rājakumārassa hatthato aṭṭhārasahi hiraññakoṭīhi koṭisantharena kīṇitvā aṭṭhārasahi hiraññakoṭīhi senāsanāni kārāpetvā aṭṭhārasahi hiraññakoṭīhi vihāramahaṃ niṭṭhāpetvā evaṃ catupaññāsahiraññakoṭipariccāgena buddhappamukhassa saṅghassa niyyādito.
Therefore, it is called “Anāthapiṇḍika’s monastery.”
Hoặc Ārāma là nơi mang những chúng sinh đã đi đến nhiều nơi khác nhau trở về nội tâm của mình và làm cho họ vui vẻ, do sự đầy đủ các đặc tính đã nói.
Tasmā ‘‘anāthapiṇḍikassa ārāmo’’ti vuccati.
In that Anāthapiṇḍika’s monastery.
Tu viện này đã được gia chủ Anāthapiṇḍika mua từ tay hoàng tử Jeta với mười tám triệu đồng vàng, trải vàng khắp nơi, xây dựng các chỗ ở với mười tám triệu đồng vàng, hoàn tất lễ cúng dường tu viện với mười tám triệu đồng vàng, và như vậy, với sự cúng dường tổng cộng năm mươi bốn triệu đồng vàng, đã dâng cho Tăng đoàn do Đức Phật đứng đầu.
Tasmiṃ anāthapiṇḍikassa ārāme.
Here, the phrase “in Jeta’s Grove” is a declaration of the former owner.
Vì vậy, nó được gọi là "tu viện của Anāthapiṇḍika".
Ettha ca ‘‘jetavane’’ti vacanaṃ purimasāmiparikittanaṃ.
The phrase “in Anāthapiṇḍika’s monastery” is a declaration of the later owner.
Tại đó, từ "Jetavane" là để nhắc đến chủ sở hữu trước đây.
‘‘Anāthapiṇḍikassa ārāme’’ti pacchimasāmiparikittanaṃ.
What is the purpose of declaring these?
"Anāthapiṇḍikassa ārāme" là để nhắc đến chủ sở hữu sau này.
Kimetesaṃ parikittane payojananti.
It is for those who desire merit to follow the example they have seen.
Mục đích của việc nhắc đến những điều này là gì?
Puññakāmānaṃ diṭṭhānugatiāpajjanaṃ.
For in this case, the eighteen crores of gold coins received from the sale of the land for the gatehouses and mansions, and the trees worth many crores, were Jeta’s contribution. The fifty-four crores were Anāthapiṇḍika’s.
Để những người mong muốn phước báu noi theo gương tốt.
Tatra hi dvārakoṭṭhakapāsādamāpane bhūmivikkayaladdhā aṭṭhārasa hiraññakoṭiyo anekakoṭiagghanakā rukkhā ca jetassa pariccāgo, catupaññāsa koṭiyo anāthapiṇḍikassa.
In this regard, eighteen crores of gold coins received from the sale of the land for measuring the gateway and mansion, and trees worth many crores, were the donation of Jeta; fifty-four crores were from Anāthapiṇḍika.
Ở đó, mười tám crore (cô-ti) tiền vàng thu được từ việc bán đất để xây cổng tháp, cung điện, và các cây cối trị giá vô số crore là sự cúng dường của Hoàng tử Jeta; năm mươi bốn crore là của Anāthapiṇḍika.
Iti tesaṃ parikittanena evaṃ puññakāmā puññāni karontīti dassento āyasmā ānando aññepi puññakāme tesaṃ diṭṭhānugatiāpajjane niyojeti.
Thus, by mentioning them, the Venerable Ānanda, showing that "in this way, those who desire merit perform meritorious deeds," encourages other merit-seekers to follow their seen example.
Như vậy, bằng cách tán dương hai vị ấy, Tôn giả Ānanda đã khuyến khích những người muốn tạo phước khác noi theo gương của hai vị ấy, để họ cũng làm các việc phước thiện như vậy.
Sabbāsavasaṃvarapariyāyaṃ vo, bhikkhaveti kasmā idaṃ suttamabhāsi?
The discourse on the restraint of all cankers for you, monks—why was this sutta spoken?
Này các Tỳ-khưu, Ta sẽ thuyết giảng cho các ông về phương pháp chế ngự mọi lậu hoặc – Vì sao kinh này được thuyết giảng?
Tesaṃ bhikkhūnaṃ upakkilesavisodhanaṃ ādiṃ katvā āsavakkhayāya paṭipattidassanatthaṃ.
To show the practice for the destruction of the cankers, beginning with the purification of those monks' defilements.
Để chỉ rõ con đường tu tập dẫn đến sự diệt trừ các lậu hoặc, bắt đầu từ việc thanh lọc các phiền não của những vị Tỳ-khưu ấy.
Tattha sabbāsavasaṃvarapariyāyanti sabbesaṃ āsavānaṃ saṃvarakāraṇaṃ saṃvarabhūtaṃ kāraṇaṃ, yena kāraṇena te saṃvaritā pidahitā hutvā anuppādanirodhasaṅkhātaṃ khayaṃ gacchanti pahīyanti nappavattanti, taṃ kāraṇanti attho.
Therein, the discourse on the restraint of all cankers means the cause of restraint, the causal condition that is restraint for all cankers; the cause by which they, being restrained and closed off, go to destruction—termed non-arising and cessation—are abandoned, and do not proceed. That is the meaning.
Trong đó, sabbāsavasaṃvarapariyāyaṃ (phương pháp chế ngự mọi lậu hoặc) có nghĩa là nguyên nhân của sự chế ngự mọi lậu hoặc, hoặc nguyên nhân làm cho các lậu hoặc bị chế ngự. Nhờ nguyên nhân ấy, chúng bị chế ngự, bị che đậy, bị diệt trừ theo cách không tái sinh, bị loại bỏ và không tái diễn. Đó là ý nghĩa của nguyên nhân.
Tattha āsavantīti āsavā, cakkhutopi…pe… manatopi sandanti pavattantīti vuttaṃ hoti.
Therein, they flow, thus they are cankers; it is said that they seep and proceed from the eye... and so on... from the mind.
Trong đó, āsavā (lậu hoặc) là những gì chảy ra. Điều này có nghĩa là chúng chảy ra và phát sinh từ mắt... cho đến... từ ý.
Dhammato yāva gotrabhuṃ okāsato yāva bhavaggaṃ savantīti vā āsavā, ete dhamme etañca okāsaṃ anto karitvā pavattantīti attho.
Or, they are cankers because they flow up to the gotrabhū regarding dhammas, and up to the bhavagga regarding realms; the meaning is that they proceed by including these dhammas and this realm within.
Hoặc, āsavā là những gì chảy tràn từ Pháp cho đến Gotrabhu (chuyển tộc), và từ không gian cho đến Bhavagga (đỉnh hữu). Điều này có nghĩa là chúng phát sinh bao gồm cả những pháp ấy và những không gian ấy.
Antokaraṇattho hi ayaṃ ākāro.
For this ‘ā’ has the meaning of including within.
Thật vậy, hình thái này có nghĩa là bao gồm bên trong.
Cirapārivāsiyaṭṭhena madirādayo āsavā, āsavā viyātipi āsavā.
They are also cankers in the sense of being like fermented liquors and so on, due to being long-matured.
Vì có sự tồn tại lâu dài, nên các loại rượu và những thứ tương tự được gọi là āsavā, hoặc chúng giống như āsavā.
Lokasmiñhi cirapārivāsikā madirādayo āsavāti vuccanti.
In the world, long-matured fermented liquors and so on are called cankers.
Trong thế gian, các loại rượu và những thứ tương tự được gọi là āsavā vì chúng tồn tại lâu dài.
Yadi ca cirapārivāsiyaṭṭhena āsavā, eteyeva bhavitumarahanti.
And if they are cankers in the sense of being long-matured, it is fitting that these very things should be so.
Nếu āsavā có nghĩa là tồn tại lâu dài, thì chỉ những điều này mới có thể là āsavā.
Vuttañhetaṃ ‘‘purimā, bhikkhave, koṭi na paññāyati avijjāya, ito pubbe avijjā nāhosī’’tiādi (a. ni. 10.61).
For this has been said: "Monks, the prior point of ignorance is not discerned, (thinking) 'Before this, there was no ignorance'," and so on.
Điều này đã được nói: "Này các Tỳ-khưu, không thể nhận biết điểm khởi đầu của vô minh, rằng trước đây vô minh không tồn tại," v.v.
Āyataṃ vā saṃsāradukkhaṃ savanti pasavantītipi āsavā.
Or, they are also cankers because they flow out, they produce the long suffering of saṃsāra.
Hoặc, āsavā cũng là những gì làm phát sinh và tràn chảy khổ đau luân hồi lâu dài.
Purimāni cettha nibbacanāni yattha kilesā āsavāti āgacchanti, tattha yujjanti, pacchimaṃ kammepi.
Among these, the former etymologies are appropriate wherever defilements are called cankers; the latter is also appropriate for kamma.
Trong những giải thích này, hai giải thích đầu phù hợp ở những chỗ phiền não được gọi là āsavā, còn giải thích sau phù hợp với nghiệp.
Na kevalañca kammakilesāyeva āsavā, apica kho nānappakārakā uppaddavāpi.
Not only kamma and defilements are cankers, but also various kinds of calamities.
Không chỉ nghiệp và phiền não là āsavā, mà còn có nhiều loại tai họa khác nhau.
Suttesu hi ‘‘nāhaṃ, cunda, diṭṭhadhammikānaṃyeva āsavānaṃ saṃvarāya dhammaṃ desemī’’ti (dī. ni. 3.182) ettha vivādamūlabhūtā kilesā āsavāti āgatā.
For in the suttas, in the passage, "Cunda, I do not teach the Dhamma for the restraint of cankers only in the present life," the defilements that are the root of disputes are referred to as cankers.
Trong các kinh, như trong câu "Này Cunda, Ta không thuyết Pháp chỉ để chế ngự các lậu hoặc hiện tại (diṭṭhadhammika āsava)," ở đây, các phiền não là nguyên nhân của tranh chấp được gọi là āsavā.
Ettha tebhūmakañca kammaṃ avasesā ca akusalā dhammā.
Here, both the kamma of the three planes and the remaining unwholesome states are meant.
Những lậu hoặc ấy của tôi đã diệt tận, đã bị phá hủy và tiêu tan hoàn toàn.”
‘‘Diṭṭhadhammikānaṃ āsavānaṃ saṃvarāya samparāyikānaṃ āsavānaṃ paṭighātāyā’’ti (pārā. 39) ettha parūpavādavippaṭisāravadhabandhādayo ceva apāyadukkhabhūtā ca nānappakārā upaddavā.
In the passage, "For the restraint of cankers in the present life, for the warding off of cankers in future lives," various calamities such as blame from others, remorse, killing, and bondage, as well as the suffering of the lower realms, are meant.
Ở đây, ba cõi nghiệp và các pháp bất thiện còn lại được gọi là āsavā. Trong câu "để chế ngự các lậu hoặc hiện tại và để diệt trừ các lậu hoặc vị lai," ở đây, sự chỉ trích của người khác, sự hối hận, giết chóc, trói buộc, v.v., và các tai họa khác nhau vốn là khổ đau của các đường ác được gọi là āsavā.
Te panete āsavā yattha yathā āgatā, tattha tathā veditabbā.
These cankers should be understood in each case according to how they are presented.
Tuy nhiên, những lậu hoặc này phải được hiểu tùy theo cách chúng xuất hiện ở từng chỗ.
Ete hi vinaye tāva ‘‘diṭṭhadhammikānaṃ āsavānaṃ saṃvarāya, samparāyikānaṃ āsavānaṃ paṭighātāyā’’ti dvedhā āgatā.
Indeed, in the Vinaya they appear in a twofold way: "For the restraint of cankers in the present life, for the warding off of cankers in future lives."
Thật vậy, trong Luật tạng, những lậu hoặc này được đề cập theo hai loại: "để chế ngự các lậu hoặc hiện tại, và để diệt trừ các lậu hoặc vị lai."
Saḷāyatane ‘‘tayome āvuso āsavā, kāmāsavo bhavāsavo avijjāsavo’’ti (a. ni. 6.63) tidhā āgatā.
In the Saḷāyatana Saṃyutta, they appear in a threefold way: "Friends, there are these three cankers: the canker of sensuality, the canker of existence, the canker of ignorance."
Trong Saḷāyatana, chúng được đề cập theo ba loại: "Này hiền giả, có ba loại lậu hoặc này: lậu hoặc dục (kāmāsava), lậu hoặc hữu (bhavāsava), lậu hoặc vô minh (avijjāsava)."
Aññesu ca suttantesu abhidhamme ca teyeva diṭṭhāsavena saha catudhā āgatā.
And in other suttas and in the Abhidhamma, these same three, together with the canker of views, appear in a fourfold way.
Trong các kinh khác và trong Vi diệu pháp, chúng được đề cập theo bốn loại, cùng với lậu hoặc kiến (diṭṭhāsava).
Nibbedhikapariyāye – ‘‘atthi, bhikkhave, āsavā nirayagāminiyā, atthi āsavā tiracchānayonigāminiyā, atthi āsavā pettivisayagāminiyā, atthi āsavā manussalokagāminiyā, atthi āsavā devalokagāminiyā’’ti (a. ni. 6.63) pañcadhā āgatā.
In the Nibbedhika Sutta, they appear in a fivefold way: "Monks, there are cankers that lead to hell, there are cankers that lead to the animal realm, there are cankers that lead to the sphere of spirits, there are cankers that lead to the human world, there are cankers that lead to the divine world."
Trong Nibbedhikapariyāya, chúng được đề cập theo năm loại: "Này các Tỳ-khưu, có những lậu hoặc dẫn đến địa ngục; có những lậu hoặc dẫn đến loài súc sinh; có những lậu hoặc dẫn đến cõi ngạ quỷ; có những lậu hoặc dẫn đến cõi người; có những lậu hoặc dẫn đến cõi trời."
Chakkanipāte – ‘‘atthi, bhikkhave, āsavā saṃvarā pahātabbā’’tiādinā nayena chadhā āgatā.
In the Book of the Sixes, they appear in a sixfold way, by the method beginning, "Monks, there are cankers to be abandoned by restraint."
Trong Sáu Pháp, chúng được đề cập theo sáu loại, theo cách như "Này các Tỳ-khưu, có những lậu hoặc phải được đoạn trừ bằng sự chế ngự," v.v.
Imasmiṃ pana sutte teyeva dassanāpahātabbehi saddhiṃ sattadhā āgatāti.
But in this sutta, these same six, together with those to be abandoned by vision, appear in a sevenfold way.
Còn trong kinh này, chúng được đề cập theo bảy loại, cùng với những gì phải được đoạn trừ bằng thấy và những gì phải được đoạn trừ bằng tu tập.
Ayaṃ tāva āsavapade vacanattho ceva pabhedo ca.
This, for now, is the etymology and classification of the term 'canker'.
Đây là ý nghĩa từ nguyên và sự phân loại của từ āsava.
Saṃvarapade pana saṃvarayatīti saṃvaro, pidahati nivāreti pavattituṃ na detīti attho.
As for the term 'restraint', one restrains, thus it is restraint; the meaning is that it closes off, prevents, does not allow to proceed.
Còn trong từ saṃvara (chế ngự), saṃvaro là cái chế ngự, có nghĩa là cái che đậy, ngăn chặn, không cho phát sinh.
Tathā hi ‘‘anujānāmi, bhikkhave, divā paṭisallīyantena dvāraṃ saṃvaritvā paṭisallīyitu’’nti (pārā. 77), ‘‘sotānaṃ saṃvaraṃbraūmi, paññāyete pidhīyare’’ti (su. ni. 1041) ca ādīsu pidhānaṭṭhena saṃvaramāha.
For indeed, in passages such as, "Monks, I allow one who is in seclusion during the day to be in seclusion after having restrained the door," and "I speak of the restraint of the streams; they are closed off by wisdom," he speaks of restraint in the sense of closing off.
Thật vậy, trong các câu như "Này các Tỳ-khưu, Ta cho phép Tỳ-khưu ẩn cư vào ban ngày, hãy đóng cửa lại rồi ẩn cư" và "Ta nói về sự chế ngự các dòng chảy, chúng bị che đậy bởi trí tuệ," từ saṃvara được dùng với nghĩa che đậy.
Svāyaṃ saṃvaro pañcavidho hoti sīlasaṃvaro satiñāṇa khanti vīriyasaṃvaroti.
This restraint is of five kinds: restraint by virtue, restraint by mindfulness, by knowledge, by patience, and by energy.
Sự chế ngự này có năm loại: chế ngự giới (sīlasaṃvara), chế ngự niệm (satisaṃvara), chế ngự trí tuệ (ñāṇasaṃvara), chế ngự nhẫn nại (khantisaṃvara), và chế ngự tinh tấn (vīriyasaṃvara).
Tattha ‘‘iminā pātimokkhasaṃvarena upeto’’ti (vibha. 511) ayaṃ sīlasaṃvaro.
Therein, "endowed with this Pātimokkha restraint" refers to restraint by virtue.
Trong đó, "được trang bị sự chế ngự Pātimokkha này" – đây là chế ngự giới.
Pātimokkhasīlañhi ettha saṃvaroti vuttaṃ.
For here Pātimokkha virtue is called restraint.
Thật vậy, giới Pātimokkha ở đây được gọi là sự chế ngự.
‘‘Cakkhundriye saṃvaramāpajjatī’’tiādīsu (dī. ni. 1.213) satisaṃvaro.
In passages beginning, "He practices restraint over the eye faculty," it is restraint by mindfulness.
Trong các câu như "thực hành sự chế ngự nơi căn mắt," v.v., đây là chế ngự niệm.
Sati hettha saṃvaroti vuttā.
For here mindfulness is called restraint.
Thật vậy, niệm ở đây được gọi là sự chế ngự.
‘‘Sotānaṃ saṃvaraṃ brūmi, paññāyete pidhīyare’’ti ayaṃ ñāṇasaṃvaro.
"I speak of the restraint of the streams; they are closed off by wisdom"—this is restraint by knowledge.
"Ta nói về sự chế ngự các dòng chảy, chúng bị che đậy bởi trí tuệ" – đây là chế ngự trí tuệ.
Ñāṇañhettha pidhīyareti iminā pidhānaṭṭhena saṃvaroti vuttaṃ.
For here knowledge is called restraint in the sense of closing off, with the words "they are closed off."
Thật vậy, trí tuệ ở đây được gọi là sự chế ngự với ý nghĩa che đậy, qua câu "chúng bị che đậy."
‘‘Khamo hoti sītassa…pe…, uppannaṃ kāmavitakkaṃ nādhivāsetī’’tiādinā (ma. ni. 1.24-26) pana nayena idheva khantivīriyasaṃvarā āgatā.
But the restraints of patience and energy are mentioned right here in this sutta by the method beginning, "He is patient with cold... and so on..., he does not tolerate an arisen thought of sensuality."
Còn theo cách như "chịu đựng được cái lạnh... v.v., không chấp nhận ý nghĩ dục lạc đã khởi lên," v.v., ở đây, chế ngự nhẫn nại và chế ngự tinh tấn được đề cập ngay trong kinh này.
Tesañca ‘‘sabbāsavasaṃvarapariyāya’’nti iminā uddesena saṅgahitattā saṃvarabhāvo veditabbo.
And because they are included in this heading "the discourse on the restraint of all cankers," their nature as restraint should be understood.
Và sự chế ngự của chúng phải được hiểu là đã được bao gồm trong đề mục "phương pháp chế ngự mọi lậu hoặc" này.
Apica pañcavidhopi ayaṃ saṃvaro idha āgatoyeva, tattha khantivīriyasaṃvarā tāva vuttāyeva.
Furthermore, all five kinds of restraint are indeed mentioned here. Therein, the restraints of patience and energy have just been mentioned.
Hơn nữa, cả năm loại chế ngự này đều được đề cập ở đây; trong đó, chế ngự nhẫn nại và chế ngự tinh tấn đã được nói đến rồi.
‘‘So tañca anāsanaṃ tañca agocara’’nti (ma. ni. 1.25) ayaṃ panettha sīlasaṃvaro.
"He avoids that which is an unsuitable seat and that which is an unsuitable resort"—this here is restraint by virtue.
"Vị ấy tránh nơi không thích hợp và nơi không phải là cảnh giới" – đây là chế ngự giới.
‘‘Paṭisaṅkhā yoniso cakkhundriyasaṃvarasaṃvuto’’ti (ma. ni. 1.22) ayaṃ satisaṃvaro.
"Reflecting wisely, he dwells restrained with the restraint of the eye faculty"—this is restraint by mindfulness.
"Suy xét kỹ lưỡng, được chế ngự bằng sự chế ngự căn mắt" – đây là chế ngự niệm.
Sabbattha paṭisaṅkhā ñāṇasaṃvaro.
In all cases, reflection is restraint by knowledge.
Sự suy xét kỹ lưỡng ở mọi nơi là chế ngự trí tuệ.
Aggahitaggahaṇena pana dassanaṃ paṭisevanā bhāvanā ca ñāṇasaṃvaro.
Moreover, by taking up what has not been taken up, vision, using, and development are also restraint by knowledge.
Và bằng cách bao gồm những gì chưa được nắm bắt, sự thấy, sự thọ dụng, và sự tu tập cũng là chế ngự trí tuệ.
Pariyāyanti etena dhammāti pariyāyo, uppattiṃ nirodhaṃ vā gacchantīti vuttaṃ hoti.
Dhammas go by way of this, thus it is a 'discourse' (pariyāya); it is said that they go towards arising or towards cessation.
Pariyāya là con đường mà các pháp đi qua, có nghĩa là chúng đi đến sự phát sinh hoặc sự diệt trừ.
Ettāvatā ‘‘sabbāsavasaṃvarapariyāya’’nti ettha yaṃ vattabbaṃ, taṃ vuttaṃ hoti.
With this much, what should be said regarding "the discourse on the restraint of all cankers" has been said.
Cho đến đây, những gì cần nói về "phương pháp chế ngự mọi lậu hoặc" đã được nói.
15. Idāni jānato ahantiādīsu jānatoti jānantassa.
15. Now, in the passage beginning, "For one who knows, I say," for one who knows means for one knowing.
15. Bây giờ, trong các câu như "jānato ahaṃ" (Ta biết), jānato có nghĩa là của người biết.
Passatoti passantassa.
For one who sees means for one seeing.
Passato có nghĩa là của người thấy.
Dvepi padāni ekatthāni, byañjanameva nānaṃ.
Both terms have the same meaning; only the expression is different.
Cả hai từ đều có cùng ý nghĩa, chỉ khác nhau về hình thức.
Evaṃ santepi jānatoti ñāṇalakkhaṇaṃ upādāya puggalaṃ niddisati, jānanalakkhaṇañhi ñāṇaṃ.
Even so, 'for one who knows' indicates the person by reference to the characteristic of knowledge, for knowledge has the characteristic of knowing.
Dù vậy, jānato dùng để chỉ cá nhân dựa trên đặc tính của trí tuệ, vì trí tuệ có đặc tính là biết.
Passatoti ñāṇappabhāvaṃ upādāya, passanappabhāvañhi ñāṇaṃ.
'For one who sees' indicates the person by reference to the power of knowledge, for knowledge has the power of seeing.
Passato dùng để chỉ cá nhân dựa trên năng lực của trí tuệ, vì trí tuệ có năng lực là thấy.
Ñāṇasamaṅgī puggalo cakkhumā viya cakkhunā rūpāni ñāṇena vivaṭe dhamme passati.
A person endowed with knowledge sees the unveiled dhammas with knowledge, just as a sighted person sees forms with the eye.
Người có đầy đủ trí tuệ, giống như người có mắt thấy các sắc bằng mắt, thấy các pháp đã được khai mở bằng trí tuệ.
Apica yonisomanasikāraṃ uppādetuṃ jānato, ayonisomanasikāro yathā na uppajjati, evaṃ passatoti ayamettha sāro.
Furthermore, the essential meaning here is: for one who knows how to arouse wise attention, and sees in such a way that unwise attention does not arise.
Hơn nữa, điểm cốt yếu ở đây là người biết cách phát sinh tác ý như lý (yonisomanasikāra), và thấy sao cho tác ý phi như lý (ayonisomanasikāra) không phát sinh.
Keci panācariyā bahū papañce bhaṇanti, te imasmiṃ atthe na yujjanti.
But some teachers speak of many elaborations; they are not appropriate in this context.
Một số vị đạo sư khác nói nhiều điều phức tạp, nhưng những điều đó không phù hợp với ý nghĩa này.
No ajānato no apassatoti yo pana na jānāti na passati, tassa no vadāmīti attho.
Not for one who does not know, not for one who does not see: The meaning is: for a person who does not know and does not see, I do not declare it.
Không phải kẻ không biết, không thấy, nghĩa là: Ta không nói cho kẻ không biết, không thấy.
Etena ye ajānato apassatopi saṃvarādīhiyeva suddhiṃ vadanti, te paṭikkhittā honti.
By this, those who claim that purity comes through restraint and so on, even for one who does not know and does not see, are refuted.
Với điều này, những người cho rằng sự thanh tịnh chỉ đến từ sự phòng hộ, v.v., ngay cả đối với kẻ không biết, không thấy, thì đã bị bác bỏ.
Purimena vā padadvayena upāyo vutto, iminā anupāyapaṭisedho.
Alternatively, by the former pair of words the method is stated, and by this latter pair, the non-method is rejected.
Hoặc hai từ trước đã nói về phương tiện, còn hai từ này là sự phủ nhận phi phương tiện.
Saṅkhepena cettha ñāṇaṃ āsavasaṃvarapariyāyoti dassitaṃ hoti.
And here it is shown in brief that knowledge is the cause for the restraint of the āsavas.
Nói tóm lại, ở đây đã chỉ ra rằng tuệ là phương pháp phòng hộ các lậu hoặc.
Idāni yaṃ jānato āsavānaṃ khayo hoti, taṃ dassetukāmo kiñca, bhikkhave, jānatoti pucchaṃ ārabhi, tattha jānanā bahuvidhā.
Now, wishing to show what it is that, for one who knows, the destruction of the āsavas occurs, he began the question, “And what, bhikkhus, for one who knows…?” Therein, knowing is of many kinds.
Bây giờ, để chỉ ra điều mà khi biết thì các lậu hoặc đoạn diệt, Thế Tôn đã bắt đầu câu hỏi "Này các Tỳ-khưu, khi biết điều gì?" Trong đó, sự biết có nhiều loại.
Dabbajātiko eva hi koci bhikkhu chattaṃ kātuṃ jānāti, koci cīvarādīnaṃ aññataraṃ, tassa īdisāni kammāni vattasīse ṭhatvā karontassa sā jānanā maggaphalānaṃ padaṭṭhānaṃ na hotīti na vattabbā.
Indeed, some bhikkhu who is of an intelligent nature knows how to make an umbrella, another knows how to do something with robes and so forth. It should not be said that for one who, established at the head of his duties, does such work, that knowing is not a basis for the path and its fruit.
Thật vậy, có vị Tỳ-khưu thuộc hạng thợ thủ công biết làm dù, có vị biết làm y phục, v.v., thì sự biết như vậy khi làm những việc này dựa trên nguyên tắc bổn phận không thể nói là không phải là nền tảng cho đạo quả.
Yo pana sāsane pabbajitvā vejjakammādīni kātuṃ jānāti, tassevaṃ jānato āsavā vaḍḍhantiyeva, tasmā yaṃ jānato passato ca āsavānaṃ khayo hoti, tadeva dassento āha yoniso ca manasikāraṃ ayoniso ca manasikāranti.
But as for one who, having gone forth in the dispensation, knows how to practice medicine and so on, for one who knows in this way, the āsavas only increase. Therefore, to show precisely what it is that, for one who knows and sees, the destruction of the āsavas occurs, he said, “Wise attention and unwise attention.”
Còn vị xuất gia trong giáo pháp mà biết làm nghề y, v.v., thì khi biết như vậy, các lậu hoặc của vị ấy chỉ tăng trưởng. Vì vậy, để chỉ ra điều mà khi biết và thấy thì các lậu hoặc đoạn diệt, Thế Tôn đã nói: "Sự tác ý như lý và sự tác ý phi lý".
Ayoniso manasikāroti anupāyamanasikāro uppathamanasikāro.
Unwise attention is attention that is not the means, attention that is the wrong path.
Tác ý phi lý (ayoniso manasikāra) là sự tác ý sai phương pháp, sự tác ý lệch lạc.
Anicce niccanti dukkhe sukhanti anattani attāti asubhe subhanti ayoniso manasikāro uppathamanasikāro.
Unwise attention, attention that is the wrong path, is to see the impermanent as permanent, the painful as pleasant, the not-self as self, and the foul as beautiful.
Tác ý phi lý là sự tác ý lệch lạc, khi tác ý "thường" trong pháp vô thường, "lạc" trong pháp khổ, "ngã" trong pháp vô ngã, "tịnh" trong pháp bất tịnh.
Saccappaṭikulena vā cittassa āvaṭṭanā anvāvaṭṭanā ābhogo samannāhāro manasikāro, ayaṃ vuccati ayoniso manasikāroti.
Alternatively, it is the turning and re-turning of the mind, the directing, attending, and applying of the mind in a way contrary to the truths. This is called unwise attention.
Hoặc là sự xoay chuyển, sự xoay chuyển liên tục, sự chú ý, sự hướng tâm, sự tác ý của tâm trái ngược với Tứ Thánh Đế. Đây được gọi là tác ý phi lý.
Evaṃ yoniso manasikāraṃ uppādetuṃ jānato, ayoniso manasikāro ca yathā na uppajjati, evaṃ passato āsavānaṃ khayo hoti.
Thus, for one who knows how to arouse wise attention and who sees how unwise attention does not arise, there is the destruction of the āsavas.
Như vậy, khi biết cách phát sinh tác ý như lý, và khi thấy rằng tác ý phi lý không phát sinh, thì các lậu hoặc sẽ đoạn diệt.
Idāni imassevatthassa yuttiṃ dassento āha ayoniso, bhikkhave…pe… pahīyantīti.
Now, to show the reason for this very matter, he said: “Bhikkhus, for one who attends unwisely… they are abandoned.”
Bây giờ, để chỉ ra tính hợp lý của ý nghĩa này, Thế Tôn nói: "Này các Tỳ-khưu, do tác ý phi lý… (v.v.)… thì được đoạn trừ".
Tena kiṃ vuttaṃ hoti, yasmā ayoniso manasikaroto āsavā uppajjanti, yoniso manasikaroto pahīyanti, tasmā jānitabbaṃ yoniso manasikāraṃ uppādetuṃ jānato, ayoniso manasikāro ca yathā na uppajjati, evaṃ passato āsavānaṃ khayo hotīti, ayaṃ tāvettha saṅkhepavaṇṇanā.
What is said by this? Since āsavas arise for one who attends unwisely and are abandoned for one who attends wisely, it should therefore be understood that for one who knows how to arouse wise attention and who sees how unwise attention does not arise, there is the destruction of the āsavas. This, for now, is the summary explanation here.
Điều đó có nghĩa là gì? Vì khi tác ý phi lý thì các lậu hoặc phát sinh, khi tác ý như lý thì các lậu hoặc đoạn trừ. Do đó, cần phải biết rằng khi biết cách phát sinh tác ý như lý, và khi thấy rằng tác ý phi lý không phát sinh, thì các lậu hoặc sẽ đoạn diệt. Đây là phần giải thích tóm tắt ở đây.
Ayaṃ pana vitthāro – tattha ‘‘yoniso ayoniso’’ti imehi tāva dvīhi padehi ābaddhaṃ hoti upari sakalasuttaṃ.
But this is the detailed explanation: The entire sutta that follows is connected to these two terms, "wise" and "unwise."
Đây là phần giải thích chi tiết: Ở đây, toàn bộ bài kinh phía trên được kết nối bởi hai từ "như lý" và "phi lý".
Vaṭṭavivaṭṭavasena hi upari sakalasuttaṃ vuttaṃ.
For the entire sutta that follows is spoken in terms of the round of existence (vaṭṭa) and the ending of the round (vivaṭṭa).
Thật vậy, toàn bộ bài kinh phía trên được nói theo cách luân hồi (vaṭṭa) và thoát ly luân hồi (vivaṭṭa).
Ayoniso manasikāramūlakañca vaṭṭaṃ, yoniso manasikāramūlakañca vivaṭṭaṃ.
And the round of existence is rooted in unwise attention, while the ending of the round is rooted in wise attention.
Luân hồi có gốc rễ từ tác ý phi lý, và thoát ly luân hồi có gốc rễ từ tác ý như lý.
Kathaṃ?
How so?
Như thế nào?
Ayoniso manasikāro hi vaḍḍhamāno dve dhamme paripūreti avijjañca bhavataṇhañca.
Unwise attention, as it increases, brings to fulfillment two things: ignorance and craving for becoming.
Tác ý phi lý khi tăng trưởng sẽ làm viên mãn hai pháp: vô minh và ái hữu.
Avijjāya ca sati ‘‘avijjāpaccayā saṅkhārā…pe… dukkhakkhandhassa samudayo hoti.
When there is ignorance, “with ignorance as condition, formations come to be… thus is the origin of this whole mass of suffering.”
Khi có vô minh thì "do vô minh duyên hành... (v.v.)... mà toàn bộ khối khổ tập khởi".
Taṇhāya sati taṇhāpaccayā upādānaṃ…pe… samudayo hotī’’ti.
When there is craving, “with craving as condition, clinging comes to be… thus is the origin.”
Khi có ái thì "do ái duyên thủ... (v.v.)... mà tập khởi".
Evaṃ ayaṃ ayoniso manasikārabahulo puggalo vātavegābhighātena vippanaṭṭhanāvā viya gaṅgāvaṭṭe patitagokulaṃ viya cakkayante yuttabalibaddo viya ca punappunaṃ bhavayonigativiññāṇaṭṭhitisattāvāsesu āvaṭṭaparivaṭṭaṃ karoti, evaṃ tāva ayoniso manasikāramūlakaṃ vaṭṭaṃ.
In this way, a person who is full of unwise attention revolves and turns back and forth again and again through states of being, births, destinies, stations of consciousness, and abodes of beings, like a wrecked ship struck by the force of the wind, like a herd of cattle fallen into a whirlpool in the Ganges, and like an ox yoked to a grinding machine. Thus, for now, is the round of existence rooted in unwise attention.
Như vậy, người nhiều tác ý phi lý này, giống như con thuyền bị gió bão đánh tan tác, giống như đàn bò rơi xuống xoáy nước sông Hằng, giống như con bò bị buộc vào cỗ máy quay, cứ mãi xoay vần trong các cõi hữu, chủng loại, cảnh giới, trụ xứ của thức và nơi cư trú của chúng sinh. Như vậy, luân hồi có gốc rễ từ tác ý phi lý.
Yoniso manasikāro pana vaḍḍhamāno – ‘‘yoniso manasikārasampannassetaṃ, bhikkhave, bhikkhuno pāṭikaṅkhaṃ, ariyaṃ aṭṭhaṅgikaṃ maggaṃ bhāvessati, ariyaṃ aṭṭhaṅgikaṃ maggaṃ bahulīkarissatī’’ti (saṃ. ni. 5.55) vacanato sammādiṭṭhipamukhaṃ aṭṭhaṅgikaṃ maggaṃ paripūreti.
Wise attention, on the other hand, as it increases, brings to fulfillment the Eightfold Path headed by Right View, according to the saying: “Bhikkhus, it can be expected of a bhikkhu who is endowed with wise attention that he will develop the Noble Eightfold Path, that he will cultivate the Noble Eightfold Path.”
Còn tác ý như lý, khi tăng trưởng, sẽ làm viên mãn Bát Chánh Đạo, đứng đầu là Chánh Kiến, theo lời dạy: "Này các Tỳ-khưu, đối với Tỳ-khưu có tác ý như lý đầy đủ, điều này có thể mong đợi: vị ấy sẽ tu tập Bát Chánh Đạo, vị ấy sẽ làm cho Bát Chánh Đạo được sung mãn" (Tương Ưng Bộ 5.55).
Yā ca sammādiṭṭhi, sā vijjāti tassa vijjuppādā avijjānirodho, ‘‘avijjānirodhā saṅkhāranirodho…pe… evaṃ etassa kevalassa dukkhakkhandhassa nirodho hotī’’ti (mahāva. 1) evaṃ yoniso manasikāramūlakaṃ vivaṭṭaṃ veditabbaṃ.
And that which is Right View is knowledge. Thus, with the arising of this knowledge, there is the cessation of ignorance. “With the cessation of ignorance comes the cessation of formations… Thus is the cessation of this whole mass of suffering.” In this way, the ending of the round, rooted in wise attention, should be understood.
Chánh Kiến chính là minh. Do sự phát sinh của minh ấy mà vô minh đoạn diệt, "do vô minh diệt nên hành diệt... (v.v.)... như vậy toàn bộ khối khổ này đoạn diệt" (Đại Phẩm 1). Như vậy, cần phải biết rằng thoát ly luân hồi có gốc rễ từ tác ý như lý.
Evaṃ imehi dvīhi padehi ābaddhaṃ hoti upari sakalasuttaṃ.
Thus, the entire sutta that follows is connected to these two terms.
Như vậy, toàn bộ bài kinh phía trên được kết nối bởi hai từ này.
Tattha ayoniso manasikarototi vuttappakāraṃ ayoniso manasikāraṃ uppādayato.
Therein, for one who attends unwisely means for one who arouses unwise attention of the kind described.
Trong đó, do tác ý phi lý (ayoniso manasikaroto) nghĩa là do phát sinh tác ý phi lý theo cách đã nói.
Anuppannā ceva āsavā uppajjantīti ettha ye pubbe appaṭiladdhapubbaṃ cīvarādiṃ vā paccayaṃ upaṭṭhākasaddhivihārikaantevāsikānaṃ vā aññataraṃ manuññaṃ vatthuṃ paṭilabhitvā, taṃ subhaṃ sukhanti ayoniso manasikaroto, aññataraññataraṃ vā pana ananubhūtapubbaṃ ārammaṇaṃ yathā vā tathā vā ayoniso manasikaroto āsavā uppajjanti, te anuppannā uppajjantīti veditabbā, aññathā hi anamatagge saṃsāre anuppannā nāma āsavā na santi.
Unarisen āsavas arise: In this context, it should be understood that those āsavas which arise for one who attends unwisely to a pleasing object as “beautiful” or “pleasant”—after having obtained a requisite such as a robe which he had never before obtained, or one among his attendants, fellow residents, or pupils—are “unarisen āsavas arising.” Or again, the āsavas that arise for one who attends unwisely in one way or another to some previously unexperienced object are to be understood as “unarisen āsavas arising.” For otherwise, in this beginningless saṃsāra, there are no āsavas that are truly unarisen.
Và các lậu hoặc chưa sinh thì phát sinh (anuppannā ceva āsavā uppajjantīti) ở đây, cần phải hiểu rằng những lậu hoặc phát sinh đối với người trước đây chưa từng có y phục, v.v., hoặc chưa từng có bất kỳ vật gì dễ chịu từ người thị giả, đồng cư sĩ, đệ tử, và tác ý phi lý về vật đó là "tịnh", "lạc", hoặc đối với bất kỳ đối tượng nào chưa từng trải nghiệm trước đây, tác ý phi lý theo cách này hay cách khác, thì những lậu hoặc đó được gọi là "chưa sinh thì phát sinh". Nếu không, trong luân hồi vô thủy vô chung, không có lậu hoặc nào gọi là "chưa sinh".
Anubhūtapubbepi ca vatthumhi ārammaṇe vā yassa pakatisuddhiyā vā uddesaparipucchāpariyattinavakammayonisomanasikārānaṃ vā aññataravasena pubbe anuppajjitvā pacchā tādisena paccayena sahasā uppajjanti, imepi anuppannā uppajjantīti veditabbā.
And even with respect to an object or sense-object previously experienced, if for a certain person āsavas did not arise before, either due to his natural purity or through one of the practices such as studying, questioning, recitation, new work, or wise attention, but then later they arise suddenly due to a similar condition, these too are to be understood as “unarisen āsavas arising.”
Và ngay cả đối với vật hay đối tượng đã từng trải nghiệm, nhưng do sự thanh tịnh tự nhiên, hoặc do sự học hỏi, vấn đáp, tụng đọc, làm việc mới, tác ý như lý, v.v., mà trước đây chưa từng phát sinh, nhưng sau đó đột nhiên phát sinh do duyên như vậy, thì những lậu hoặc này cũng được gọi là "chưa sinh thì phát sinh".
Tesuyeva pana vatthārammaṇesu punappunaṃ uppajjamānā uppannā pavaḍḍhantīti vuccanti.
But when they arise again and again in relation to those very same objects and sense-objects, they are said to be “arisen āsavas that increase.”
Còn những lậu hoặc tiếp tục phát sinh nhiều lần trên cùng những vật và đối tượng đó thì được gọi là "đã sinh thì tăng trưởng".
Ito aññathā hi paṭhamuppannānaṃ vaḍḍhi nāma natthi.
For otherwise, there is no such thing as the increase of what has first arisen.
Ngoài cách này, không có sự tăng trưởng nào đối với những lậu hoặc mới phát sinh lần đầu.
Yoniso ca kho, bhikkhaveti ettha pana yassa pakatisuddhiyā vā seyyathāpi āyasmato mahākassapassa bhaddāya ca kāpilāniyā, uddesaparipucchādīhi vā kāraṇehi āsavā nuppajjanti, so ca jānāti ‘‘na kho me āsavā maggena samugghātaṃ gatā, handa nesaṃ samugghātāya paṭipajjāmī’’ti.
And indeed, bhikkhus, for one who wisely…: Here, for a person for whom āsavas do not arise, either due to his natural purity, as in the case of the Venerable Mahākassapa and Bhaddā Kāpilānī, or due to reasons such as studying, questioning, and so forth, he knows, “My āsavas have not been uprooted by the path. Come now, I will practice for their uprooting.”
Còn ở đây, Này các Tỳ-khưu, do tác ý như lý (yoniso ca kho, bhikkhave), đối với người mà các lậu hoặc không phát sinh do sự thanh tịnh tự nhiên, như Tôn giả Mahākassapa và Bhaddā Kāpilānī, hoặc do các lý do như học hỏi, vấn đáp, v.v., và vị ấy biết rằng "các lậu hoặc của ta chưa bị nhổ tận gốc bằng Đạo, vậy ta hãy thực hành để nhổ tận gốc chúng".
Tato maggabhāvanāya sabbe samugghāteti.
Then, through the development of the path, he uproots them all.
Từ đó, do tu tập Đạo, vị ấy nhổ tận gốc tất cả chúng.
Tassa te āsavā anuppannā na uppajjantīti vuccanti.
For him, those āsavas are said to be “unarisen and do not arise.”
Những lậu hoặc đó của vị ấy được gọi là "chưa sinh thì không phát sinh".
Yassa pana kārakasseva sato satisammosena sahasā āsavā uppajjanti, tato saṃvegamāpajjitvā yoniso padahanto te āsave samucchindati, tassa uppannā pahīyantīti vuccanti maṇḍalārāmavāsīmahātissabhūtattherassa viya.
But for one who, while being a doer, has āsavas suddenly arise due to a lapse of mindfulness, and who then, becoming agitated, strives wisely and eradicates those āsavas, for him, they are said to be “arisen and are abandoned,” as in the case of the Elder Mahātissabhūta, resident of Maṇḍalārāma.
Còn đối với người đang thực hành mà do sự lãng quên chánh niệm, các lậu hoặc đột nhiên phát sinh, sau đó vị ấy cảm thấy chấn động và nỗ lực như lý, nhổ sạch các lậu hoặc đó, thì những lậu hoặc đó được gọi là "đã sinh thì đoạn trừ", như trường hợp của Đại Trưởng lão Tissabhūta sống ở Maṇḍalārāma.
So kira tasmiṃyeva vihāre uddesaṃ gaṇhāti, athassa gāme piṇḍāya carato visabhāgārammaṇe kileso uppajji, so taṃ vipassanāya vikkhambhetvā vihāraṃ agamāsi.
It is said that he was learning the recitation in that very monastery. Then, while he was walking for alms in the village, a defilement arose in him concerning a dissimilar object. Suppressing it with insight, he went to the monastery.
Vị Tỳ-kheo ấy đã học kinh điển tại chính tu viện đó. Sau đó, khi vị ấy đi khất thực trong làng, một phiền não (kilesa) đã khởi lên trong tâm vị ấy do một đối tượng không phù hợp (visabhāgārammaṇa). Vị ấy đã trấn áp nó bằng thiền quán (vipassanā) và trở về tu viện.
Tassa supinantepi taṃ ārammaṇaṃ na upaṭṭhāsi.
That object did not appear to him even in a dream.
Ngay cả trong giấc mơ, đối tượng đó cũng không hiện ra với vị Tỳ-kheo ấy.
So ‘‘ayaṃ kileso vaḍḍhitvā apāyasaṃvattaniko hotī’’ti saṃvegaṃ janetvā ācariyaṃ āpucchitvā vihārā nikkhamma mahāsaṅgharakkhitattherassa santike rāgapaṭipakkhaṃ asubhakammaṭṭhānaṃ gahetvā gumbantaraṃ pavisitvā paṃsukūlacīvaraṃ santharitvā nisajja anāgāmimaggena pañcakāmaguṇikarāgaṃ chinditvā uṭṭhāya ācariyaṃ vanditvā punadivase uddesamaggaṃ pāpuṇi.
Thinking, “This defilement, having grown, will lead to the lower realms,” he aroused a sense of urgency. After taking leave of his teacher, he departed from the monastery, and in the presence of the Elder Mahāsaṅgharakkhita, he took up the meditation subject of impurity, which is the antidote to lust. He then entered a thicket, spread out his rag-robe, and sat down. With the path of a non-returner, he cut off the lust related to the five strands of sensual pleasure. Rising up, he paid homage to his teacher and on the next day, he attained the path of recitation.
Vị Tỳ-kheo ấy đã khởi lên sự xúc động (saṃvegaṃ) rằng: “Phiền não này, nếu gia tăng, sẽ dẫn đến cõi khổ (apāya),” rồi thưa hỏi vị thầy của mình, rời khỏi tu viện, đến chỗ Đại Trưởng lão Mahāsaṅgharakkhita để thọ nhận đề mục thiền bất tịnh (asubhakammaṭṭhānaṃ) đối trị với tham ái (rāga). Sau đó, vị ấy đi vào bụi cây, trải y phấn tảo (paṃsukūlacīvaraṃ) ra và ngồi xuống, đoạn trừ tham ái liên quan đến năm dục lạc (pañcakāmaguṇikarāgaṃ) bằng đạo quả Bất Lai (Anāgāmimagga). Vị ấy đứng dậy, đảnh lễ vị thầy và đạt đến đạo quả Bất Lai vào ngày hôm sau.
Ye pana vattamānuppannā, tesaṃ paṭipattiyā pahānaṃ nāma natthi.
But for those that have arisen in the present moment, there is no abandoning by means of practice.
Tuy nhiên, đối với những lậu hoặc (āsava) đang hiện hữu và đã sinh khởi, không có sự đoạn trừ bằng hành trì.
16. Idāni ‘‘uppannā ca āsavā pahīyantī’’ti idameva padaṃ gahetvā ye te āsavā pahīyanti, tesaṃ nānappakārato aññampi pahānakāraṇaṃ āvikātuṃ desanaṃ vitthārento atthi, bhikkhave, āsavā dassanā pahātabbātiādimāha yathā taṃ desanāpabhedakusalo dhammarājā.
16. Now, taking this very phrase, “and arisen āsavas are abandoned,” to reveal another cause of abandoning those āsavas that are abandoned, in various ways, the King of Dhamma, who is skilled in the divisions of teaching, extending the discourse, said, “There are, bhikkhus, āsavas to be abandoned by vision,” and so on.
16. Giờ đây, để làm sáng tỏ thêm nguyên nhân đoạn trừ các lậu hoặc (āsava) đã sinh khởi và được đoạn trừ, lấy chính câu “các lậu hoặc đã sinh khởi được đoạn trừ” này, Đức Pháp Vương (Dhammarājā), bậc thiện xảo trong việc phân loại các bài thuyết pháp, đã bắt đầu bài thuyết pháp bằng câu “Này các Tỳ-kheo, có những lậu hoặc cần phải đoạn trừ bằng Chánh kiến (dassanā pahātabbā)” và những câu tương tự.
Tattha dassanā pahātabbāti dassanena pahātabbā.
Therein, to be abandoned by vision means to be abandoned by the vision of the path of stream-entry.
Trong đó, dassanā pahātabbā có nghĩa là đoạn trừ bằng Chánh kiến (dassanena).
Esa nayo sabbattha.
This is the method in all cases.
Nguyên tắc này áp dụng cho tất cả các trường hợp.
17. Idāni tāni padāni anupubbato byākātukāmo ‘‘katame ca, bhikkhave, āsavā dassanā pahātabbā’’ti pucchaṃ katvā mūlapariyāyavaṇṇanāyaṃ vuttanayeneva ‘‘idha, bhikkhave, assutavā puthujjano’’ti puggalādhiṭṭhānaṃ desanaṃ ārabhi.
17. Now, wishing to explain those phrases in sequence, having posed the question, “And which, bhikkhus, are the āsavas to be abandoned by vision?” he began the discourse based on the person, saying, “Here, bhikkhus, an uninstructed ordinary person,” in the same way as was said in the commentary on the Mūlapariyāya Sutta.
17. Giờ đây, Đức Phật muốn giải thích các từ ngữ đó theo thứ tự, Ngài đã đặt câu hỏi: “Này các Tỳ-kheo, những lậu hoặc nào cần phải đoạn trừ bằng Chánh kiến?” và bắt đầu bài thuyết pháp về cá nhân (puggalādhiṭṭhānaṃ desanāṃ) theo cách đã được trình bày trong phần giải thích về Mūlapariyāya-sutta, với câu “Ở đây, này các Tỳ-kheo, một phàm phu không học hỏi (assutavā puthujjano).”
Tattha manasikaraṇīye dhamme nappajānātīti āvajjitabbe samannāharitabbe dhamme na pajānāti.
Therein, does not know the dhammas that should be attended to means he does not know the dhammas that should be adverted to, that should be brought to mind.
Trong đó, manasikaraṇīye dhamme nappajānāti có nghĩa là không biết các pháp cần phải tác ý (āvajjitabbe samannāharitabbe).
Amanasikaraṇīyeti tabbiparīte.
Those that should not be attended to means the opposite of those.
Amanasikaraṇīye là ngược lại.
Esa nayo sesapadesupi.
This is the method in the remaining phrases as well.
Nguyên tắc này áp dụng cho các từ ngữ còn lại.
Yasmā pana ime dhammā manasikaraṇīyā, ime amanasikaraṇīyāti dhammato niyamo natthi, ākārato pana atthi.
But since there is no fixed rule in terms of the dhammas themselves that “these dhammas should be attended to, these should not be attended to,” there is, however, a rule in terms of the mode.
Tuy nhiên, không có quy luật cố định về bản chất của các pháp, rằng “những pháp này cần phải tác ý, những pháp kia không cần phải tác ý,” nhưng có quy luật về phương cách.
Yenā ākārena manasikariyamānā akusaluppattipadaṭṭhānā honti, tenākārena na manasikātabbā.
The mode in which, when they are being attended to, they become a basis for the arising of the unwholesome—in that mode they should not be attended to.
Theo phương cách nào mà khi tác ý sẽ trở thành nguyên nhân phát sinh bất thiện pháp, thì không nên tác ý theo phương cách đó.
Yena kusaluppattipadaṭṭhānā honti, tenākārena manasikātabbā.
The mode in which they become a basis for the arising of the wholesome—in that mode they should be attended to.
Theo phương cách nào mà khi tác ý sẽ trở thành nguyên nhân phát sinh thiện pháp, thì nên tác ý theo phương cách đó.
Tasmā ‘‘ya’ssa, bhikkhave, dhamme manasikaroto anuppanno vā kāmāsavo’’tiādimāha.
Therefore, he said, “For him, bhikkhus, by attending to a dhamma, the unarisen āsava of sensuality,” and so on.
Vì vậy, Đức Phật đã nói: “Này các Tỳ-kheo, đối với người nào, khi tác ý các pháp, lậu hoặc dục (kāmāsavo) chưa sinh sẽ sinh…” và những câu tương tự.
Tattha ya’ssāti ye assa assutavato puthujjanassa.
Therein, ya’ssā means ‘ye assa’, ‘of which uninstructed ordinary person’.
Trong đó, ya’ssā có nghĩa là đối với người phàm phu không học hỏi (assutavato puthujjanassa).
Manasikarototi āvajjayato samannāharantassa.
By attending to means for one who is adverting, for one who is bringing to mind.
Manasikaroto có nghĩa là người đang tác ý (āvajjayato samannāharantassa).
Anuppanno vā kāmāsavoti ettha samuccayattho vāsaddo, na vikappattho.
Herein, in the unarisen āsava of sensuality, the word ‘vā’ has the meaning of conjunction, not of alternative.
Ở đây, trong anuppanno vā kāmāsavo, từ vā có nghĩa là tập hợp (samuccaya), không phải là lựa chọn (vikappa).
Tasmā yathā ‘‘yāvatā, bhikkhave, sattā apadā vā dvipadā vā…pe… tathāgato tesaṃ aggamakkhāyatī’’ti (itivu. 90) vutte apadā ca dvipadā cāti attho, yathā ca ‘‘bhūtānaṃ vā sattānaṃ ṭhitiyā sambhavesīnaṃ vā anuggahāyā’’ti (ma. ni. 1.402) vutte bhūtānañca sambhavesīnañcāti attho, yathā ca ‘‘aggito vā udakato vā mithubhedato vā’’ti (udā. 76) vutte aggito ca udakato ca mithubhedato cāti attho, evamidhāpi anuppanno ca kāmāsavo uppajjati, uppanno ca kāmāsavo pavaḍḍhatīti attho daṭṭhabbo.
Therefore, just as when it is said, “Bhikkhus, whatever beings are without feet or with two feet... the Tathāgata is declared the chief among them,” the meaning is ‘both without feet and with two feet’; and just as when it is said, “for the maintenance of beings that have come to be, or for the support of those seeking to be born,” the meaning is ‘both of beings that have come to be and of those seeking to be born’; and just as when it is said, “from fire or from water or from discord,” the meaning is ‘both from fire and from water and from discord’; so too here, the meaning should be understood as ‘both the unarisen āsava of sensuality arises, and the arisen āsava of sensuality increases’.
Vì vậy, cũng như khi nói “Này các Tỳ-kheo, trong số tất cả chúng sinh, dù không chân hay hai chân… Như Lai được tuyên bố là tối thượng trong số họ,” có nghĩa là chúng sinh không chân và hai chân; và cũng như khi nói “vì sự tồn tại của chúng sinh đã sinh hoặc vì sự hỗ trợ của chúng sinh đang sinh,” có nghĩa là vì chúng sinh đã sinh và chúng sinh đang sinh; và cũng như khi nói “do lửa, do nước, hoặc do sự chia rẽ lẫn nhau,” có nghĩa là do lửa, do nước và do sự chia rẽ lẫn nhau; thì ở đây cũng vậy, phải hiểu rằng lậu hoặc dục chưa sinh sẽ sinh, và lậu hoặc dục đã sinh sẽ tăng trưởng.
Evaṃ sesesu.
Likewise in the remaining cases.
Tương tự cho các trường hợp còn lại.
Ettha ca kāmāsavoti pañcakāmaguṇiko rāgo.
Herein, the āsava of sensuality is the lust related to the five strands of sensual pleasure.
Ở đây, kāmāsavo là tham ái liên quan đến năm dục lạc.
Bhavāsavoti rupārūpabhave chandarāgo, jhānanikanti ca sassatucchedadiṭṭhisahagatā.
The āsava of existence is sensual desire and lust in the fine-material and immaterial existences, delight in jhāna, and that which is associated with the views of eternalism and annihilationism.
Bhavāsavo là tham ái đối với các cõi sắc (rūpabhava) và vô sắc (arūpabhava), sự hoan hỷ trong thiền định (jhānanikanti) và tham ái đi kèm với tà kiến thường kiến (sassatadiṭṭhi) và đoạn kiến (ucchedadiṭṭhi).
Evaṃ diṭṭhāsavopi bhavāsave eva samodhānaṃ gacchati.
In this way, the āsava of views is also included in the āsava of existence.
Như vậy, lậu hoặc tà kiến (diṭṭhāsavopi) cũng bao gồm trong lậu hoặc hữu (bhavāsava).
Avijjāsavoti catūsu saccesu aññāṇaṃ.
The āsava of ignorance is the lack of knowledge concerning the four truths.
Avijjāsavo là sự vô minh (aññāṇaṃ) về Tứ Thánh Đế (catūsu saccesu).
Tattha kāmaguṇe assādato manasikaroto anuppanno ca kāmāsavo uppajjati, uppanno ca pavaḍḍhati.
Therein, for one who attends with relish to the strands of sensual pleasure, both the unarisen āsava of sensuality arises, and the arisen one increases.
Trong đó, đối với người tác ý các dục lạc với sự hưởng thụ, lậu hoặc dục chưa sinh sẽ sinh, và lậu hoặc dục đã sinh sẽ tăng trưởng.
Mahaggatadhamme assādato manasikaroto anuppanno ca bhavāsavo uppajjati, uppanno ca pavaḍḍhati.
For one who attends with relish to the sublime states, both the unarisen āsava of existence arises, and the arisen one increases.
Đối với người tác ý các pháp siêu thế (mahaggatadhamme) với sự hưởng thụ, lậu hoặc hữu chưa sinh sẽ sinh, và lậu hoặc hữu đã sinh sẽ tăng trưởng.
Tīsu bhūmīsu dhamme catuvipallāsapadaṭṭhānabhāvena manasikaroto anuppanno ca avijjāsavo uppajjati, uppanno ca pavaḍḍhatīti veditabbo.
It should be understood that for one who attends to the dhammas in the three planes as being a basis for the four perversions, both the unarisen āsava of ignorance arises, and the arisen one increases.
Phải hiểu rằng, đối với người tác ý các pháp trong ba cõi (tīsu bhūmīsu dhamme) theo cách là nguyên nhân của bốn sự điên đảo (catuvipallāsapadaṭṭhānabhāvena), lậu hoặc vô minh chưa sinh sẽ sinh, và lậu hoặc vô minh đã sinh sẽ tăng trưởng.
Vuttanayapaccanīkato sukkapakkho vitthāretabbo.
The bright side should be elaborated in opposition to the method stated.
Mặt thiện (sukkapakkho) cần được giải thích mở rộng theo cách đối nghịch với phương pháp đã nói.
Kasmā pana tayo eva āsavā idha vuttāti.
But why are only three āsavas mentioned here?
Tại sao ở đây chỉ nói đến ba lậu hoặc?
Vimokkhapaṭipakkhato.
Because of their opposition to the liberations.
Vì chúng là đối nghịch với các giải thoát (vimokkha).
Appaṇihitavimokkhapaṭipakkho hi kāmāsavo,.
For the āsava of sensuality is the opponent of the undirected liberation.
Lậu hoặc dục (kāmāsavo) là đối nghịch với Vô Nguyện Giải Thoát (Appaṇihitavimokkha).
Animittasuññatavimokkhapaṭipakkhā itare.
The others are the opponents of the signless and emptiness liberations.
Các lậu hoặc khác là đối nghịch với Vô Tướng Giải Thoát (Animittavimokkha) và Không Tướng Giải Thoát (Suññatavimokkha).
Tasmā ime tayo āsave uppādentā tiṇṇaṃ vimokkhānaṃ abhāgino honti, anuppādentā bhāginoti etamatthaṃ dassentena tayo eva vuttāti veditabbā.
Therefore, it should be understood that by showing that those who generate these three āsavas have no share in the three liberations, while those who do not generate them do have a share, for this reason, only three were mentioned.
Vì vậy, phải hiểu rằng Đức Phật đã nói ba lậu hoặc này để chỉ ra rằng những ai làm phát sinh ba lậu hoặc này thì không có phần trong ba giải thoát, còn những ai không làm phát sinh chúng thì có phần.
Diṭṭhāsavopi vā ettha vutto yevāti vaṇṇitametaṃ.
Or, it has been explained that the āsava of views is also spoken of here.
Hoặc, lậu hoặc tà kiến (diṭṭhāsavopi) cũng đã được nói đến ở đây.
18. Ettāvatā yo ayaṃ puggalādhiṭṭhānāya desanāya dassanā pahātabbe āsave niddisituṃ assutavā puthujjano vutto, so yasmā ‘‘ayoniso, bhikkhave, manasikaroto anuppannā ceva āsavā uppajjantī’’ti evaṃ sāmaññato vuttānaṃ ayoniso manasikārapaccayānaṃ kāmāsavādīnampi adhiṭṭhānaṃ, tasmā tepi āsave teneva puggalena dassetvā idāni dassanā pahātabbe āsave dassento so evaṃ ayoniso manasi karoti, ahosiṃ nu kho ahantiādimāha.
18. In this way, the uninstructed ordinary person who was mentioned in the discourse based on the person to point out the āsavas to be abandoned by vision—since he is also the basis for the āsava of sensuality and so on, which are conditioned by unwise attention and spoken of in general as, “Bhikkhus, for one who attends unwisely, both unarisen āsavas arise”—therefore, having shown those āsavas through that same person, he now, showing the āsavas to be abandoned by vision, said, “He attends thus unwisely: ‘Did I exist, indeed?’” and so on.
18. Cho đến đây, phàm phu không học hỏi (assutavā puthujjano) đã được nói đến để chỉ ra các lậu hoặc cần đoạn trừ bằng Chánh kiến (dassanā pahātabbe āsave) trong bài thuyết pháp về cá nhân (puggalādhiṭṭhānāya desanāya). Vì người đó cũng là nền tảng cho các lậu hoặc dục (kāmāsavādīnaṃ) và các lậu hoặc khác, vốn là nguyên nhân của sự tác ý không như lý (ayoniso manasikāra), như đã được nói chung: “Này các Tỳ-kheo, đối với người tác ý không như lý, những lậu hoặc chưa sinh sẽ sinh,” nên Đức Phật đã chỉ ra các lậu hoặc đó qua chính cá nhân ấy. Giờ đây, để chỉ ra các lậu hoặc cần đoạn trừ bằng Chánh kiến, Ngài đã nói: “Người ấy tác ý không như lý như sau: ‘Ta đã từng hiện hữu chăng?’” và những câu tương tự.
Vicikicchāsīsena cettha diṭṭhāsavampi dassetuṃ imaṃ desanaṃ ārabhi.
And here, he began this discourse to show the āsava of views as well, under the heading of doubt.
Ở đây, Đức Phật đã bắt đầu bài thuyết pháp này để chỉ ra cả lậu hoặc tà kiến (diṭṭhāsavampi) thông qua sự hoài nghi (vicikicchā).
Tassattho, yassa te iminā vuttanayena āsavā uppajjanti, so puthujjano, yo cāyaṃ ‘‘assutavā’’tiādinā nayena vutto, so puthujjano evaṃ ayoniso anupāyena uppathena manasi karoti.
Its meaning is: that ordinary person for whom those āsavas arise in this stated manner, and which ordinary person was mentioned by the method beginning with “uninstructed,” that ordinary person attends thus unwisely, by an improper means, by a wrong path.
Ý nghĩa của câu đó là: người phàm phu mà các lậu hoặc sinh khởi theo cách đã nói ở trên, tức là người phàm phu đã được nói đến theo cách “người không học hỏi” v.v., người phàm phu đó tác ý không như lý (ayoniso), tức là không đúng phương pháp, theo con đường sai lạc.
Kathaṃ?
How?
Như thế nào?
Ahosiṃ nu kho…pe…so kuhiṃ gāmī bhavissatīti.
“Did I exist, indeed... where will he be going?”
“Ta đã từng hiện hữu chăng?… Người ấy sẽ đi về đâu?”
Kiṃ vuttaṃ hoti, so evaṃ ayoniso manasi karoti, yathāssa ‘‘ahaṃ ahosiṃ nu kho’’tiādinā nayena vuttā soḷasavidhāpi vicikicchā uppajjatīti.
What is said is this: he attends thus unwisely, in such a way that the sixteen kinds of doubt spoken of by the method beginning with “Did I exist, indeed?” arise in him.
Ý nghĩa là gì? Người ấy tác ý không như lý, khiến cho mười sáu loại hoài nghi (vicikicchā) đã được nói đến theo cách “Ta đã từng hiện hữu chăng?” v.v. đều sinh khởi.
Tattha ahosiṃ nu kho nanu khoti sassatākārañca adhiccasamuppattiākārañca nissāya atīte attano vijjamānataṃ avijjamānatañca kaṅkhati.
Therein, did I exist, indeed, did I not exist, indeed—based on the mode of eternalism and the mode of fortuitous origination, he doubts his own existence and non-existence in the past.
Trong đó, ahosiṃ nu kho nanu kho là hoài nghi về sự hiện hữu hay không hiện hữu của tự ngã trong quá khứ, dựa trên quan điểm thường kiến (sassatākārañca) và quan điểm vô nhân vô duyên (adhiccasamuppattiākārañca).
Kiṃ kāraṇanti na vattabbaṃ.
It should not be said, “For what reason?”
Không nên hỏi “Nguyên nhân là gì?”
Ummattako viya hi bālaputhujjano yathā vā tathā vā pavattati.
For a foolish ordinary person acts in any way whatsoever, like a madman.
Vì phàm phu ngu si hành xử như một kẻ điên, lúc thế này lúc thế kia.
Apica ayoniso manasikāroyevettha kāraṇaṃ.
Moreover, unwise attention itself is the reason here.
Hơn nữa, tác ý không như lý (ayoniso manasikāro) chính là nguyên nhân ở đây.
Evaṃ ayoniso manasikārassa pana kiṃ kāraṇanti.
But what is the reason for such unwise attention?
Vậy nguyên nhân của tác ý không như lý là gì?
Sveva puthujjanabhāvo ariyānaṃ adassanādīni vā.
That very state of being an ordinary person, or not seeing the noble ones, and so on.
Chính là trạng thái phàm phu của người đó, hoặc sự không thấy các bậc Thánh, v.v.
Nanu ca puthujjanopi yoniso manasi karotīti.
But does not an ordinary person also attend wisely?
Nhưng chẳng phải phàm phu cũng tác ý như lý (yoniso manasi karoti) sao?
Ko vā evamāha na manasi karotīti.
Who says he does not attend?
Ai nói rằng họ không tác ý như lý?
Na pana tattha puthujjanabhāvo kāraṇaṃ, saddhammassavanakalyāṇamittādīni tattha kāraṇāni.
But the state of being an ordinary person is not the reason there; hearing the good Dhamma, having noble friends, and so on, are the reasons there.
Nhưng ở đó, trạng thái phàm phu không phải là nguyên nhân; mà việc nghe Chánh pháp (saddhammassavana), có bạn lành (kalyāṇamitta) v.v. mới là nguyên nhân.
Na hi macchamaṃsādīni attano attano pakatiyā sugandhāni, abhisaṅkhārapaccayā pana sugandhānipi honti.
Indeed, things like fish and meat are not fragrant by their own nature, but through the condition of preparation, they can become fragrant.
Cá thịt và những thứ tương tự không tự thân có mùi thơm tự nhiên, nhưng do sự chuẩn bị và chế biến mà chúng trở nên thơm.
Kathaṃ nu khoti saṇṭhānākāraṃ nissāya dīgho nu kho ahosiṃ, rassaodātakaṇhappamāṇikaappamāṇikādīnaṃ aññataroti kaṅkhati.
How, indeed, was I? — with reference to physical form and appearance, one is in doubt, thinking, "Was I tall, or was I one among those who are short, fair, dark, of a certain measure, or beyond measure?"
Tôi đã như thế nào vậy? Người ấy hoài nghi, dựa vào hình dáng và tướng mạo, rằng: "Tôi đã cao ư, hay thấp, trắng trẻo, đen đúa, có kích thước vừa phải, hay vô lượng?"
Keci pana issaranimmānādiṃ nissāya kena nu kho kāraṇena ahosinti hetuto kaṅkhatīti vadanti.
Some, however, say that with reference to creation by a lord (issara) and so on, one is in doubt about the cause, thinking, "By what cause was I?"
Một số người nói rằng người ấy hoài nghi về nguyên nhân, dựa vào sự tạo hóa của Thượng đế, v.v., rằng: "Do nguyên nhân nào mà tôi đã tồn tại?"
Etarahi vā paccuppannamaddhānanti idāni vā paṭisandhiṃ ādiṃ katvā cutipariyantaṃ sabbampi vattamānakālaṃ gahetvā.
Now, in the present time means taking the entire present period, from conception as the beginning to death as the end.
Hoặc trong hiện tại (paccuppannamaddhāna) có nghĩa là bao gồm tất cả thời gian hiện tại, từ sự tái sinh (paṭisandhi) cho đến cái chết (cuti).
Ajjhattaṃ kathaṃkathī hotīti attano khandhesu vicikiccho hoti.
Becomes perplexed about himself means he has doubt about his own aggregates.
Trở nên hoài nghi trong nội tâm (ajjhattaṃ kathaṃkathī hoti) có nghĩa là có sự hoài nghi (vicikicchā) về các uẩn (khandha) của chính mình.
Ahaṃ nu khosmīti attano atthibhāvaṃ kaṅkhati.
Am I, indeed? means one is in doubt about one's own existence.
Có phải tôi tồn tại không? Người ấy hoài nghi về sự hiện hữu của chính mình.
Yuttaṃ panetanti?
But is this fitting?
Điều này có hợp lý không?
Yuttaṃ ayuttanti kā ettha cintā.
What thought is there here as to whether it is fitting or unfitting?
Hợp lý hay không hợp lý, điều gì phải suy nghĩ ở đây?
Apicettha idaṃ vatthumpi udāharanti.
Moreover, they also cite this story in this context.
Hơn nữa, ở đây họ cũng kể câu chuyện này.
Cūḷamātāya kira putto muṇḍo, mahāmātāya putto amuṇḍo, taṃ puttaṃ muṇḍesuṃ.
It is said that the son of the junior mother was bald, while the son of the senior mother was not bald. They shaved that son's head.
Nghe nói, con trai của người dì ghẻ thì cạo đầu, con trai của người mẹ ruột thì không cạo đầu. Họ đã cạo đầu đứa con trai đó.
So uṭṭhāya ahaṃ nu kho cūḷamātāya puttoti cintesi.
Upon rising, he wondered, "Am I the son of the junior mother?"
Anh ta thức dậy và tự hỏi: "Có phải tôi là con trai của dì ghẻ không?"
Evaṃ ahaṃ nu khosmīti kaṅkhā hoti.
In this way, the doubt "Am I, indeed?" occurs.
Như vậy, sự hoài nghi "Có phải tôi tồn tại không?" phát sinh.
No nu khosmīti attano natthibhāvaṃ kaṅkhati.
Am I not, indeed? means one is in doubt about one's own non-existence.
Không phải tôi tồn tại ư? Người ấy hoài nghi về sự không tồn tại của chính mình.
Tatrāpi idaṃ vatthu – eko kira macche gaṇhanto udake ciraṭṭhānena sītibhūtaṃ attano ūruṃ macchoti cintetvā pahari.
Here too, there is this story: A certain man, while catching fish, struck his own thigh, which had become cold from standing long in the water, thinking it was a fish.
Trong trường hợp này cũng có câu chuyện này: Nghe nói, một người đàn ông đang bắt cá, vì đứng lâu trong nước nên đùi của anh ta bị lạnh. Anh ta tưởng đó là cá và đánh vào đó.
Aparo susānapasse khettaṃ rakkhanto bhīto saṅkuṭito sayi.
Another, while guarding a field near a charnel ground, lay down curled up in fear.
Một người khác đang canh ruộng gần nghĩa địa, vì sợ hãi nên co rúm người lại nằm xuống.
So paṭibujjhitvā attano jaṇṇukāni dve yakkhāti cintetvā pahari.
Upon waking, he struck his own two knees, thinking they were two yakkhas.
Anh ta thức dậy và tưởng hai đầu gối của mình là hai con quỷ (yakkha) nên đánh vào đó.
Evaṃ no nu khosmīti kaṅkhati.
In this way, one doubts, "Am I not, indeed?"
Như vậy, sự hoài nghi "Không phải tôi tồn tại ư?" phát sinh.
Kiṃ nu khosmīti khattiyova samāno attano khattiyabhāvaṃ kaṅkhati.
What, indeed, am I? means that while being a Khattiya, one is in doubt about one's Khattiya-nature.
Tôi là gì vậy? Một chiến sĩ (khattiya) hoài nghi về thân phận chiến sĩ của chính mình.
Esa nayo sesesu.
This method applies to the rest.
Tương tự cho các trường hợp còn lại.
Devo pana samāno devabhāvaṃ ajānanto nāma natthi.
However, there is no one who, being a deva, is unaware of their deva-nature.
Tuy nhiên, một vị trời (deva) không bao giờ không biết thân phận vị trời của mình.
Sopi pana ‘‘ahaṃ rūpī nu kho arūpī nu kho’’tiādinā nayena kaṅkhati.
But even such a being doubts in this way, "Am I corporeal or incorporeal?" and so on.
Nhưng vị trời đó cũng hoài nghi theo cách: "Có phải tôi có sắc (rūpī) hay không có sắc (arūpī)?" v.v.
Khattiyādayo kasmā na jānantīti ce.
If one asks, "Why do Khattiyas and others not know?"
Nếu hỏi: "Tại sao các chiến sĩ, v.v., không biết?"
Apaccakkhā tesaṃ tattha tattha kule uppatti.
Their birth in those respective families is not directly perceived by them.
Sự tái sinh của họ trong các gia đình khác nhau không phải là điều họ chứng kiến trực tiếp.
Gahaṭṭhāpi ca potthalikādayo pabbajitasaññino.
And householders like Potalika and others perceive themselves as renunciants.
Các gia chủ (gahaṭṭha) cũng có khi lầm tưởng những người như Potthapāda là người xuất gia (pabbajita).
Pabbajitāpi ‘‘kuppaṃ nu kho me kamma’’ntiādinā nayena gahaṭṭhasaññino.
Renunciants too, in the manner of "Is my practice corruptible?", perceive themselves as householders.
Các người xuất gia (pabbajita) cũng có khi lầm tưởng mình là gia chủ (gahaṭṭha) theo cách: "Có phải nghiệp của tôi đã bị phá hủy không?" v.v.
Manussāpi ca rājāno viya attani devasaññino honti.
And humans perceive themselves as devas, just like kings do.
Con người cũng có khi tự cho mình là thần linh (deva), như các vị vua.
Kathaṃ nu khosmīti vuttanayameva.
How, indeed, am I? is just as has been explained.
Tôi như thế nào vậy? Cũng theo cách đã nói.
Kevalañcettha abbhantare jīvo nāma atthīti gahetvā tassa saṇṭhānākāraṃ nissāya dīgho nu khosmi, rassacaturaṃsachaḷaṃsaaṭṭhaṃsasoḷasaṃsādīnaṃ aññatarappakāroti kaṅkhanto kathaṃ nu khosmīti kaṅkhatīti veditabbo.
It should be understood that here, simply by holding that there is a soul (jīva) inside, one who, with reference to its form and appearance, is in doubt, thinking, "Am I long? Or am I of some other type, such as short, square, hexagonal, octagonal, or sixteen-sided?", is doubting in the way of "How, indeed, am I?".
Chỉ cần hiểu rằng ở đây, người ấy hoài nghi "Tôi như thế nào vậy?" bằng cách chấp giữ rằng có một linh hồn (jīva) bên trong, và dựa vào hình dáng, tướng mạo của nó mà hoài nghi: "Có phải tôi cao, hay thấp, vuông, sáu cạnh, tám cạnh, mười sáu cạnh, hay một loại nào khác?"
Sarīrasaṇṭhānaṃ pana paccuppannaṃ ajānanto nāma natthi.
However, there is no one who does not know their present bodily form.
Tuy nhiên, không ai không biết hình dáng cơ thể hiện tại của mình.
19. Evaṃ soḷasappabhedaṃ vicikicchaṃ dassetvā idāni yaṃ iminā vicikicchāsīsena diṭṭhāsavaṃ dassetuṃ ayaṃ desanā āraddhā.
19. Having thus shown doubt in its sixteen varieties, now this discourse has been undertaken to explain the canker of views, with this doubt as its basis.
19. Sau khi trình bày mười sáu loại hoài nghi (vicikicchā) như vậy, bây giờ, để chỉ ra sự ô nhiễm của tà kiến (diṭṭhāsava) mà giáo pháp này được bắt đầu thông qua đầu mối hoài nghi này,
Taṃ dassento tassa evaṃ ayoniso manasikaroto channaṃ diṭṭhīnantiādimāha.
Explaining this, he said, For one who attends improperly in this way, one of six views arises, and so on.
Đức Phật đã nói: "Khi người ấy tác ý phi như lý như vậy, một trong sáu loại tà kiến..." v.v.
Tattha tassa puggalassa yathā ayaṃ vicikicchā uppajjati, evaṃ ayoniso manasikaroto tasseva savicikicchassa ayoniso manasikārassa thāmagatattā channaṃ diṭṭhīnaṃ aññatarā diṭṭhi uppajjatīti vuttaṃ hoti.
Herein, it is meant that for that person who attends improperly in such a way that this doubt arises, because that improper attention of the doubter has gained strength, one of the six views arises.
Ở đây, điều được nói là: Khi người ấy tác ý phi như lý theo cách mà sự hoài nghi này phát sinh nơi người ấy, do sự kiên cố của tác ý phi như lý đó nơi người có hoài nghi, một trong sáu loại tà kiến (diṭṭhi) sẽ phát sinh.
Tattha sabbapadesu vāsaddo vikappattho, evaṃ vā evaṃ vā diṭṭhi uppajjatīti vuttaṃ hoti.
Therein, in all instances, the word 'or' is used in the sense of an alternative; it is meant that a view arises in this way or that way.
Ở đây, từ "vā" (hoặc) trong tất cả các đoạn văn có nghĩa là lựa chọn, tức là tà kiến này hoặc tà kiến kia phát sinh.
Atthi me attāti cettha sassatadiṭṭhi sabbakālesu attano atthitaṃ gaṇhāti.
Here, in I have a self, the eternalist view grasps one's own existence in all times.
Có tự ngã của tôi (Atthi me attā) – ở đây, tà kiến thường hằng (sassatadiṭṭhi) chấp giữ sự tồn tại của tự ngã trong mọi thời điểm.
Saccato thetatoti bhūtato ca thirato ca, ‘‘idaṃ sacca’’nti bhūtato suṭṭhu daḷhabhāvenāti vuttaṃ hoti.
As true and enduring means as real and as stable; it is meant that one grasps it as "This is true," as real, and with great firmness.
Chân thật và kiên cố (Saccato thetato) có nghĩa là chân thật và vững chắc, tức là "điều này là chân thật" theo nghĩa chân thật và vô cùng kiên cố.
Natthi me attāti ayaṃ pana ucchedadiṭṭhi, sato sattassa tattha tattha vibhavaggahaṇato.
I have no self, however, is the annihilationist view, because it grasps the non-existence of an existing being in various places.
Không có tự ngã của tôi (Natthi me attā) – đây là tà kiến đoạn diệt (ucchedadiṭṭhi), vì nó chấp giữ sự hủy diệt của chúng sinh hữu tồn ở từng nơi.
Atha vā purimāpi tīsu kālesu atthīti gahaṇato sassatadiṭṭhi, paccuppannameva atthīti gaṇhanto ucchedadiṭṭhi.
Alternatively, the former is the eternalist view from grasping "it exists" in the three times, while one who grasps "it exists" only in the present holds the annihilationist view.
Hoặc, tà kiến đầu tiên cũng là tà kiến thường hằng vì nó chấp giữ sự tồn tại trong ba thời; người chấp giữ rằng chỉ có hiện tại tồn tại là tà kiến đoạn diệt.
Pacchimāpi atītānāgatesu natthīti gahaṇato bhasmantāhutiyoti gahitadiṭṭhikānaṃ viya, ucchedadiṭṭhi.
The latter, too, from grasping "it does not exist" in the past and future, is the annihilationist view, like that of those who hold the view that one is annihilated with the ashes.
Tà kiến sau cũng là tà kiến đoạn diệt, như những người chấp giữ tà kiến "chỉ đến tro tàn là hết" (bhasmantāhutiyo), vì nó chấp giữ rằng không có sự tồn tại trong quá khứ và tương lai.
Atīte eva natthīti gaṇhanto adhiccasamuppattikasseva sassatadiṭṭhi.
One who grasps "it did not exist" only in the past holds an eternalist view, like that of one who believes in spontaneous arising.
Người chấp giữ rằng không có sự tồn tại chỉ trong quá khứ thì đó là tà kiến thường hằng, giống như tà kiến "vô nhân sinh" (adhiccasamuppattika).
Attanāva attānaṃ sañjānāmīti saññākkhandhasīsena khandhe attāti gahetvā saññāya avasesakkhandhe sañjānato iminā attanā imaṃ attānaṃ sañjānāmīti hoti.
I perceive the self by the self — for one who, taking the aggregates as self, with the aggregate of perception as the chief, perceives the remaining aggregates by means of perception, it becomes, "I perceive this self by means of this self."
Tôi nhận biết tự ngã bằng chính tự ngã (Attanāva attānaṃ sañjānāmī) – điều này xảy ra khi người ấy chấp giữ các uẩn (khandha) là tự ngã (attā) dựa trên uẩn tưởng (saññākkhandha), và nhận biết các uẩn còn lại bằng tưởng (saññā), tức là "bằng tự ngã này (tức tưởng) tôi nhận biết tự ngã kia (tức các uẩn còn lại)".
Attanāva anattānanti saññākkhandhaṃyeva attāti gahetvā, itare cattāropi anattāti gahetvā saññāya tesaṃ jānato evaṃ hoti.
The not-self by the self — for one who, taking only the aggregate of perception as self and taking the other four as not-self, knows them by means of perception, it becomes thus.
Bằng tự ngã nhận biết vô ngã (Attanāva anattānaṃ) – điều này xảy ra khi người ấy chấp giữ uẩn tưởng (saññākkhandha) là tự ngã (attā), và chấp giữ bốn uẩn còn lại là vô ngã (anattā), rồi nhận biết chúng bằng tưởng.
Anattanāva attānanti saññākkhandhaṃ anattāti.
The self by the not-self — for one who takes the aggregate of perception as not-self
Bằng vô ngã nhận biết tự ngã (Anattanāva attānaṃ) – điều này xảy ra khi người ấy chấp giữ uẩn tưởng là vô ngã,
Itare cattāro attāti gahetvā saññāya tesaṃ jānato evaṃ hoti, sabbāpi sassatucchedadiṭṭhiyova.
and takes the other four as self, knowing them by means of perception, it becomes thus. All of these are just eternalist-annihilationist views.
và chấp giữ bốn uẩn còn lại là tự ngã, rồi nhận biết chúng bằng tưởng. Tất cả đều là tà kiến thường hằng và đoạn diệt.
Vado vedeyyotiādayo pana sassatadiṭṭhiyā eva abhinivesākārā.
Terms like the speaker, the feeler, however, are manifestations of clinging to the eternalist view alone.
Tuy nhiên, các quan điểm như "Người nói, người cảm thọ" v.v., là những hình thức chấp thủ của tà kiến thường hằng.
Tattha vadatīti vado, vacīkammassa kārakoti vuttaṃ hoti.
Therein, because one speaks, one is a speaker; this means one is the agent of the verbal action.
Ở đây, vado là "người nói", có nghĩa là người thực hiện hành động lời nói.
Vedayatīti vedeyyo, jānāti anubhavati cāti vuttaṃ hoti.
Because one feels, one is a feeler; this means one knows and experiences.
Vedeyyo là "người cảm thọ", có nghĩa là người biết và trải nghiệm.
Kiṃ vedetīti, tatra tatra kalyāṇapāpakānaṃ kammānaṃ vipākaṃ paṭisaṃvedeti.
What does one feel? One experiences the result of wholesome and unwholesome kamma in various spheres.
Biết gì? Người ấy cảm thọ quả báo của các nghiệp thiện và bất thiện ở từng nơi.
Tatra tatrāti tesu tesu yonigatiṭṭhitinivāsanikāyesu ārammaṇesu vā.
In various spheres means in those various wombs, destinations, states, abodes, classes of beings, or sense-objects.
Tatra tatrā có nghĩa là ở những chủng loại, cõi giới, trạng thái và nơi cư trú khác nhau, hoặc ở những đối tượng khác nhau.
Niccoti uppādavayarahito.
Permanent means devoid of arising and passing away.
Nicco (thường hằng) là không có sự sinh và diệt.
Dhuvoti thiro sārabhūto.
Stable means firm, essential.
Dhuvo (kiên cố) là vững chắc, bản chất cốt yếu.
Sassatoti sabbakāliko.
Eternal means existing at all times.
Sassato (vĩnh cửu) là tồn tại trong mọi thời gian.
Avipariṇāmadhammoti attano pakatibhāvaṃ avijahanadhammo, kakaṇṭako viya nānappakārataṃ nāpajjati.
Not subject to change means having the nature of not abandoning its own intrinsic state; like a chameleon, it does not assume various forms.
Avipariṇāmadhammo (không biến đổi bản chất) là bản chất không từ bỏ trạng thái tự nhiên của mình, không trở thành nhiều loại khác nhau như con tắc kè hoa.
Sassatisamanti candasūriyasamuddamahāpathavīpabbatā lokavohārena sassatiyoti vuccanti.
Like unto the eternal — the moon, sun, ocean, great earth, and mountains are called 'eternal' in worldly parlance.
Sassatisamaṃ (tương tự vĩnh cửu) – mặt trăng, mặt trời, biển cả, trái đất lớn, núi non được gọi là vĩnh cửu theo cách nói thông thường của thế gian.
Sassatīhi samaṃ sassatisamaṃ.
Like unto the eternal means equal to the eternal things.
Sassatisamaṃ là tương tự như những thứ vĩnh cửu.
Yāva sassatiyo tiṭṭhanti, tāva tatheva ṭhassatīti gaṇhato evaṃdiṭṭhi hoti.
Such a view arises for one who holds that it will stand just so for as long as the eternal things stand.
Khi một người chấp giữ rằng nó sẽ tồn tại như vậy chừng nào những thứ vĩnh cửu còn tồn tại, thì tà kiến này phát sinh.
Idaṃ vuccati, bhikkhave, diṭṭhigatantiādīsu.
In passages such as This, monks, is called what is gone to by view.
Trong "Này các Tỳ-khưu, đây được gọi là tà kiến (diṭṭhigata)" v.v.
Idanti idāni vattabbassa paccakkhanidassanaṃ.
This is a direct pointing to what is about to be said.
Idaṃ (đây) là sự chỉ rõ trực tiếp điều sắp nói.
Diṭṭhigatasambandhena ca idanti vuttaṃ, na diṭṭhisambandhena.
And it is said as 'this' in connection with 'what is gone to by view', not in connection with 'view'.
Và từ "idaṃ" được nói liên quan đến diṭṭhigata, chứ không phải liên quan đến diṭṭhi.
Ettha ca diṭṭhiyeva diṭṭhigataṃ, gūthagataṃ viya.
And here, view itself is what is gone to by view, like 'gone to filth'.
Ở đây, chính diṭṭhi (tà kiến) là diṭṭhigata, giống như gūthagata (đi đến phân).
Diṭṭhīsu vā gatamidaṃ dassanaṃ dvāsaṭṭhidiṭṭhiantogadhattātipi diṭṭhigataṃ.
Or, because this seeing has gone among the views, being included within the sixty-two views, it is also 'what is gone to by view'.
Hoặc, sự thấy này (dassana) đi vào các tà kiến (diṭṭhīsu gataṃ), vì nó nằm trong số sáu mươi hai tà kiến, nên cũng được gọi là diṭṭhigata.
Diṭṭhiyā vā gataṃ diṭṭhigataṃ.
Or, 'gone to by view' is 'what is gone to by means of view'.
Hoặc, điều đã đi bằng tà kiến (diṭṭhiyā gataṃ) là diṭṭhigata.
Idañhi atthi me attātiādi diṭṭhiyā gamanamattameva, natthettha attā vā nicco vā kocīti vuttaṃ hoti.
For this is merely the process of the view “there is a self for me,” and so on; it is meant that herein there is no one who is a self or is permanent.
Thật vậy, đây chỉ là sự phát sinh của tà kiến như "có tự ngã của tôi", không có bất kỳ tự ngã hay cái gì thường hằng ở đây. Đó là ý muốn nói.
Sā cāyaṃ diṭṭhi dunniggamanaṭṭhena gahanaṃ.
And this view, in the sense of being difficult to escape, is a thicket.
Và tà kiến này là gahanaṃ (rừng rậm) vì khó thoát ra.
Duratikkamaṭṭhena sappaṭibhayaṭṭhena ca kantāro, dubbhikkhakantāravāḷakantārādayo viya.
In the sense of being difficult to cross and in the sense of being perilous, it is a wilderness, like a wilderness of famine, a wilderness of wild beasts, and so on.
Nó là kantāro (hoang mạc) vì khó vượt qua và vì đầy hiểm nguy, giống như hoang mạc hạn hán, hoang mạc đầy thú dữ, v.v.
Sammādiṭṭhiyā vinivijjhanaṭṭhena vilomanaṭṭhena vā visūkaṃ.
In the sense of being pierced by right view, or in the sense of being perverse, it is a side-track.
Nó là visūkaṃ (sự xáo trộn) vì bị chánh kiến xuyên phá, hay vì sự nghịch lý.
Kadāci sassatassa, kadāci ucchedassa gahaṇato virūpaṃ phanditanti vipphanditaṃ.
Because it sometimes grasps eternalism and sometimes annihilationism, it is a distorted agitation, thus it is agitation.
Nó là vipphanditaṃ (sự dao động) vì đôi khi chấp thường kiến, đôi khi chấp đoạn kiến, nên là sự dao động sai lệch.
Bandhanaṭṭhena saṃyojanaṃ.
In the sense of binding, it is a fetter.
Nó là saṃyojanaṃ (kiết sử) vì có tính chất trói buộc.
Tenāha ‘‘diṭṭhigahanaṃ…pe… diṭṭhisaṃyojana’’nti.
Therefore, he said, “a thicket of views… a fetter of views.”
Vì thế, Ngài nói: “diṭṭhigahanaṃ…pe… diṭṭhisaṃyojanaṃ” (rừng rậm tà kiến… kiết sử tà kiến).
Idānissa tameva bandhanatthaṃ dassento diṭṭhisaṃyojanasaṃyuttotiādimāha.
Now, showing that very sense of binding, he stated, “bound by the fetter of views,” and so on.
Bây giờ, để chỉ rõ tính chất trói buộc ấy của nó, Ngài nói: “ diṭṭhisaṃyojanasaṃyutto” (bị kiết sử tà kiến trói buộc), v.v.
Tassāyaṃ saṅkhepattho.
The following is its summary meaning.
Đây là ý nghĩa tóm tắt của nó.
Iminā diṭṭhisaṃyojanena saṃyutto puthujjano etehi jātiādīhi na parimuccatīti.
The ordinary person bound by this fetter of views is not freed from these things, such as birth.
Phàm nhân bị kiết sử tà kiến này trói buộc sẽ không thoát khỏi sinh, v.v.
Kiṃ vā bahunā, sakalavaṭṭadukkhatopi na muccatīti.
Or what is the use of saying much? He is not freed from the entire suffering of the round of existence.
Hay nói rộng ra, không thoát khỏi tất cả khổ đau của vòng luân hồi.
20. Evaṃ chappabhedaṃ diṭṭhāsavaṃ dassetvā yasmā sīlabbataparāmāso kāmāsavādivacaneneva dassito hoti.
20. Having thus shown the six kinds of canker of views, since the misapprehension of precepts and practices is shown by the very words “canker of sensuality,” etc.,
20. Sau khi trình bày lậu hoặc tà kiến có sáu loại như vậy, bởi vì chấp thủ giới cấm đã được chỉ rõ qua lời nói về lậu hoặc dục, v.v.
Kāmasukhatthañhi bhavasukhabhavavisuddhiatthañca avijjāya abhibhūtā ito bahiddhā samaṇabrāhmaṇā sīlabbatāni parāmasanti, tasmā taṃ adassetvā diṭṭhiggahaṇena vā tassa gahitattāpi taṃ adassetvāva idāni yo puggalo dassanā pahātabbe āsave pajahati, taṃ dassetvā tesaṃ āsavānaṃ pahānaṃ dassetuṃ pubbe vā ayoniso manasikaroto puthujjanassa tesaṃ uppattiṃ dassetvā idāni tabbiparītassa pahānaṃ dassetuṃ sutavā ca kho, bhikkhavetiādimāha.
for the sake of sensual pleasure, and for the sake of the pleasure of existence and purification from existence, ascetics and brahmins outside this teaching, being overcome by ignorance, misapprehend precepts and practices. Therefore, without showing that, or because it is included in the grasping of views, also without showing it, now, to show the person who abandons the cankers to be abandoned by seeing, and to show the abandoning of those cankers, or having previously shown the arising of those cankers in an ordinary person who attends unwisely, now, to show the abandoning by one who is the opposite of that, he stated, “ But, monks, the instructed one…,” and so on.
Vì những sa môn, bà la môn ngoại đạo bị vô minh che lấp, vì muốn hưởng lạc dục, vì muốn có lạc hữu và thanh tịnh hóa hữu, đã chấp thủ giới cấm; do đó, không trình bày điều đó, hoặc vì nó đã được bao hàm trong sự chấp thủ tà kiến, nên không trình bày điều đó. Bây giờ, để trình bày về người đoạn trừ các lậu hoặc cần được đoạn trừ bằng Tuệ quán (dassanā pahātabbe āsave pajahati), và để trình bày sự đoạn trừ các lậu hoặc ấy, hay trước đó, sau khi trình bày sự phát sinh của chúng ở phàm nhân do tác ý không đúng cách, bây giờ, để trình bày sự đoạn trừ của người ngược lại, Ngài nói: “ sutavā ca kho, bhikkhave” (Này các tỳ khưu, người đã nghe pháp), v.v.
Tassattho, yāva ‘‘so idaṃ dukkha’’nti āgacchati, tāva heṭṭhā vuttanayena ca vuttapaccanīkato ca veditabbo.
Its meaning should be understood in the manner stated below and in the manner opposite to what was stated, up to the point where it says, “He… ‘This is suffering.’”
Ý nghĩa của nó, cho đến khi nói “đây là khổ”, thì phải hiểu theo cách đã nói ở trên và theo cách đối nghịch đã nói.
Paccanīkato ca sabbākārena ariyadhammassa akovidāvinītapaccanīkato ayaṃ ‘‘sutavā ariyasāvako ariyadhammassa kovido ariyadhamme suvinīto’’ti veditabbo.
And in the opposite manner: this instructed noble disciple should be understood as “one who has heard, is skilled in the noble Dhamma, is well-trained in the noble Dhamma,” in opposition to being unskilled and untrained in the noble Dhamma in all respects.
Và từ sự đối nghịch, tức là từ sự không thông thạo và không được huấn luyện trong Thánh pháp về mọi phương diện, người này được hiểu là “vị Thánh đệ tử đã nghe pháp, thông thạo Thánh pháp, được huấn luyện tốt trong Thánh pháp”.
Apica kho sikhāpattavipassanato pabhuti yāva gotrabhu, tāva tadanurūpena atthena ayaṃ ariyasāvakoti veditabbo.
Furthermore, from the attainment of peak insight up to the change-of-lineage, this one should be understood as a noble disciple in a meaning appropriate to that state.
Hơn nữa, vị Thánh đệ tử này được hiểu theo ý nghĩa tương ứng, từ lúc đạt được vipassanā cao nhất cho đến khi đạt được Gotrabhu-ñāṇa.
21. ‘‘So idaṃ dukkhanti yoniso manasi karotī’’tiādīsu pana ayaṃ atthavibhāvanā, so catusaccakammaṭṭhāniko ariyasāvako taṇhāvajjā tebhūmakā khandhā dukkhaṃ, taṇhā dukkhasamudayo, ubhinnaṃ appavatti nirodho, nirodhasampāpako maggoti evaṃ pubbeva ācariyasantike uggahitacatusaccakammaṭṭhāno aparena samayena vipassanāmaggaṃ samāruḷho samāno te tebhūmake khandhe idaṃ dukkhanti yoniso manasi karoti, upāyena pathena samannāharati ceva vipassati ca.
21. But in the phrases “He wisely attends, ‘This is suffering,’” and so on, this is the explanation of the meaning: that noble disciple who has the four truths as his meditation subject, having already learned the meditation subject of the four truths from a teacher—that the aggregates of the three planes, excluding craving, are suffering; craving is the origin of suffering; the non-occurrence of both is cessation; the path leading to cessation is the path—at a later time, having entered upon the path of insight, wisely attends to those aggregates of the three planes as, ‘This is suffering,’ that is, he brings it to mind and sees it with method, with the way.
21. Trong các câu như “Vị ấy tác ý đúng đắn rằng đây là khổ”, v.v., đây là sự phân tích ý nghĩa: Vị Thánh đệ tử hành thiền Tứ Thánh Đế ấy, các uẩn thuộc ba cõi, trừ ái, là khổ; ái là dukkhasamudayo (nguyên nhân của khổ); sự không phát sinh của cả hai là nirodho (sự diệt khổ); con đường dẫn đến sự diệt khổ là maggo (Đạo). Như vậy, vị ấy đã học pháp hành Tứ Thánh Đế từ các vị thầy trước đó, sau này khi đã bước vào con đường tuệ quán, vị ấy tác ý đúng đắn rằng các uẩn thuộc ba cõi ấy là đây là khổ, vị ấy thâu nhiếp và quán chiếu bằng phương pháp và con đường đúng đắn.
Ettha hi yāva sotāpattimaggo, tāva manasikārasīseneva vipassanā vuttā.
Here, indeed, up to the path of stream-entry, insight is spoken of under the heading of attention.
Ở đây, cho đến Sơ quả Tu-đà-hoàn, tuệ quán được nói đến chủ yếu qua khía cạnh tác ý (manasikāra).
Yā panāyaṃ tasseva dukkhassa samuṭṭhāpikā pabhāvikā taṇhā, ayaṃ samudayoti yoniso manasi karoti.
And that craving which is the originator, the producer of that very suffering, he wisely attends to as, ‘This is the origin.’
Và ái, là cái sinh khởi và phát sinh ra khổ ấy, vị ấy tác ý đúng đắn rằng đây là samudaya (nguyên nhân sinh khổ).
Yasmā pana dukkhañca samudayo ca idaṃ ṭhānaṃ patvā nirujjhanti nappavattanti, tasmā yadidaṃ nibbānaṃ nāma, ayaṃ dukkhanirodhoti yoniso manasi karoti.
And since suffering and its origin, upon reaching this state, cease and do not occur, therefore, that which is called Nibbāna, he wisely attends to as, ‘This is the cessation of suffering.’
Vì khổ và nguyên nhân của khổ sẽ diệt và không còn phát sinh khi đạt đến trạng thái này, nên vị ấy tác ý đúng đắn rằng cái gọi là Nibbāna này là sự diệt khổ.
Nirodhasampāpakaṃ aṭṭhaṅgikaṃ maggaṃ ayaṃ dukkhanirodhagāminī paṭipadāti yoniso manasi karoti, upāyena pathena samannāharati ceva vipassati ca.
The eightfold path that leads to cessation, he wisely attends to as, ‘This is the practice leading to the cessation of suffering,’ that is, he brings it to mind and sees it with method, with the way.
Con đường Bát Chánh Đạo dẫn đến sự diệt khổ, vị ấy tác ý đúng đắn rằng đây là con đường dẫn đến sự diệt khổ, vị ấy thâu nhiếp và quán chiếu bằng phương pháp và con đường đúng đắn.
Tatrāyaṃ upāyo, abhiniveso nāma vaṭṭe hoti, vivaṭṭe natthi.
Therein, this is the method: adherence occurs in the round of existence; it does not occur in what is free from the round.
Trong đó, phương pháp này là: sự bám chấp (abhinivesa) chỉ có trong luân hồi (vaṭṭa), không có trong sự thoát ly luân hồi (vivaṭṭa).
Tasmā ‘‘ayaṃ atthi imasmiṃ kāye pathavīdhātu, āpodhātū’’tiādinā nayena sakasantatiyaṃ cattāri bhūtāni tadanusārena upādārūpāni ca pariggahetvā ayaṃ rūpakkhandhoti vavatthapeti.
Therefore, having apprehended the four elements in his own continuum by the method beginning, “In this body there is the earth element, the water element,” and so on, and the derived forms in accordance with them, he determines, “This is the form-aggregate.”
Do đó, vị ấy thâu tóm bốn đại trong thân mình theo cách như “trong thân này có địa đại, có thủy đại”, v.v., và các sắc y sinh tương ứng, rồi phân định rằng đây là sắc uẩn.
Taṃ vavatthāpayato uppanne tadārammaṇe cittacetasike dhamme ime cattāro arūpakkhandhāti vavatthapeti.
When mental and mental-concomitant states with that form as their object arise for him who is so determining, he determines, “These are the four formless aggregates.”
Khi phân định sắc uẩn như vậy, vị ấy phân định các pháp tâm và tâm sở sinh khởi có đối tượng là sắc uẩn ấy là bốn uẩn phi sắc này.
Tato ime pañcakkhandhā dukkhanti vavatthapeti.
Then he determines, “These five aggregates are suffering.”
Sau đó, vị ấy phân định năm uẩn này là khổ.
Te pana saṅkhepato nāmañca rūpañcāti dve bhāgāyeva honti.
But in brief, they are just two parts: mentality and materiality.
Tuy nhiên, tóm lại, chúng chỉ có hai phần là danh và sắc.
Idañca nāmarūpaṃ sahetu sappaccayaṃ uppajjati.
And this mentality-materiality arises with a cause, with a condition.
Và danh sắc này sinh khởi có nguyên nhân và có duyên.
Tassa ayaṃ hetu ayaṃ paccayoti avijjābhavataṇhākammāhārādike hetupaccaye vavatthapeti.
He determines the causes and conditions, such as ignorance, existence, craving, kamma, and nutriment, thinking, “This is its cause, this is its condition.”
Vị ấy phân định các nguyên nhân và duyên của nó như vô minh, hữu, ái, nghiệp, vật thực, v.v., rằng đây là nguyên nhân, đây là duyên.
Tato tesaṃ paccayānañca paccayuppannadhammānañca yāthāvasarasalakkhaṇaṃ vavatthapetvā ime dhammā ahutvā hontīti aniccalakkhaṇaṃ āropeti, udayabbayapīḷitattā dukkhāti dukkhalakkhaṇaṃ āropeti.
Then, having determined the true characteristic nature of those conditions and the conditionally arisen phenomena, he applies the characteristic of impermanence, thinking, “These phenomena, having not been, come to be”; he applies the characteristic of suffering, thinking, “They are suffering because they are oppressed by rise and fall.”
Sau đó, sau khi phân định đặc tính bản chất và chức năng chân thật của các duyên ấy và các pháp do duyên sinh, vị ấy áp đặt đặc tính vô thường (aniccalakkhaṇa) rằng các pháp này không có rồi có, và áp đặt đặc tính khổ (dukkhalakkhaṇa) rằng chúng là khổ vì bị sự sinh diệt bức bách.
Avasavattanato anattāti anattalakkhaṇaṃ āropeti.
He applies the characteristic of non-self, thinking, “They are non-self because they are not subject to one's will.”
Vị ấy áp đặt đặc tính vô ngã (anattalakkhaṇa) rằng chúng là vô ngã vì không chịu sự chi phối.
Evaṃ tīṇi lakkhaṇāni āropetvā paṭipāṭiyā vipassanaṃ pavattento sotāpattimaggaṃ pāpuṇāti.
Thus, having applied the three characteristics and developing insight sequentially, he attains the path of stream-entry.
Như vậy, sau khi áp đặt ba đặc tính, vị ấy tuần tự phát triển tuệ quán và đạt đến Sơ quả Tu-đà-hoàn.
Tasmiṃ khaṇe cattāri saccāni ekapaṭivedheneva paṭivijjhati, ekābhisamayena abhisameti.
At that moment, he penetrates the four truths with a single penetration, he fully understands them with a single full understanding.
Vào khoảnh khắc ấy, vị ấy thâm nhập Tứ Thánh Đế chỉ bằng một sự thâm nhập, chứng ngộ chỉ bằng một sự chứng ngộ.
Dukkhaṃ pariññāpaṭivedhena paṭivijjhati, samudayaṃ pahānapaṭivedhena, nirodhaṃ sacchikiriyāpaṭivedhena, maggaṃ bhāvanāpaṭivedhena.
He penetrates suffering through the penetration of full understanding, the origin through the penetration of abandonment, cessation through the penetration of realization, and the path through the penetration of development.
Vị ấy thâm nhập Khổ bằng sự thâm nhập của sự liễu tri (pariññā), Tập bằng sự thâm nhập của sự đoạn trừ (pahāna), Diệt bằng sự thâm nhập của sự chứng ngộ (sacchikiriyā), và Đạo bằng sự thâm nhập của sự tu tập (bhāvanā).
Dukkhañca pariññābhisamayena abhisameti…pe… maggaṃ bhāvanābhisamayena abhisameti, no ca kho aññamaññena ñāṇena.
And he fully understands suffering through the full understanding of comprehension... he fully understands the path through the full understanding of development, but not with different kinds of knowledge.
Vị ấy chứng ngộ Khổ bằng sự chứng ngộ của sự liễu tri… (v.v.)… chứng ngộ Đạo bằng sự chứng ngộ của sự tu tập, nhưng không phải bằng những trí khác nhau.
Ekañāṇeneva hi esa nirodhaṃ ārammaṇato, sesāni kiccato paṭivijjhati ceva abhisameti ca.
For with a single knowledge, he both penetrates and fully understands cessation as the object and the remaining truths through their function.
Thật vậy, vị ấy thâm nhập và chứng ngộ Diệt bằng một trí duy nhất như là đối tượng, và các Thánh Đế còn lại như là chức năng.
Na hissa tasmiṃ samaye evaṃ hoti – ‘‘ahaṃ dukkhaṃ parijānāmī’’ti vā…pe… ‘‘maggaṃ bhāvemī’’ti vā.
For at that time, it does not occur to him, “I am fully understanding suffering,” or... “I am developing the path.”
Vào lúc đó, vị ấy không có ý nghĩ như: “Tôi liễu tri Khổ” hay… (v.v.)… “Tôi tu tập Đạo”.
Apica khvassa ārammaṇaṃ katvā paṭivedhavasena nirodhaṃ sacchikaroto evaṃ taṃ ñāṇaṃ dukkhapariññākiccampi samudayapahānakiccampi maggabhāvanākiccampi karotiyeva.
And yet, for him who is realizing cessation by making it the object through the power of penetration, that very knowledge also performs the function of fully understanding suffering, the function of abandoning the origin, and the function of developing the path.
Hơn nữa, khi vị ấy chứng ngộ Diệt làm đối tượng bằng sức mạnh của sự thâm nhập, trí tuệ ấy vẫn thực hiện chức năng liễu tri Khổ, chức năng đoạn trừ Tập, và chức năng tu tập Đạo.
Tassevaṃ upāyena yoniso manasikaroto tīṇi saṃyojanāni pahīyanti, vīsativatthukā sakkāyadiṭṭhi, aṭṭhavatthukā vicikicchā, ‘‘sīlena suddhi vatena suddhī’’ti sīlabbatānaṃ parāmasanato sīlabbataparāmāsoti.
For one attending wisely in this way, three fetters are abandoned: identity-view with its twenty bases, doubt with its eight bases, and misapprehension of precepts and practices from misapprehending precepts and practices as “purification is through precepts, purification is through practices.”
Khi vị ấy tác ý đúng đắn bằng phương pháp như vậy, ba kiết sử được đoạn trừ: thân kiến (sakkāyadiṭṭhi) có hai mươi căn cứ, hoài nghi (vicikicchā) có tám căn cứ, và chấp thủ giới cấm (sīlabbataparāmāsa) do chấp thủ các giới cấm như “thanh tịnh nhờ giới, thanh tịnh nhờ cấm”.
Tattha catūsu āsavesu sakkāyadiṭṭhisīlabbataparāmāsā diṭṭhāsavena saṅgahitattā āsavā ceva saṃyojanā ca.
Therein, among the four cankers, since identity-view and misapprehension of precepts and practices are included in the canker of views, they are both cankers and fetters.
Trong đó, trong bốn lậu hoặc, thân kiến và chấp thủ giới cấm được bao hàm trong lậu hoặc tà kiến, nên chúng vừa là lậu hoặc vừa là kiết sử.
Vicikicchā saṃyojanameva, na āsavo.
Doubt is only a fetter, not a canker.
Hoài nghi chỉ là kiết sử, không phải là lậu hoặc.
‘‘Dassanā pahātabbā āsavā’’ti ettha pariyāpannattā pana āsavāti.
But because it is included in the phrase “cankers to be abandoned by seeing,” it is called a canker.
Tuy nhiên, vì nó được bao hàm trong “các lậu hoặc cần được đoạn trừ bằng Tuệ quán”, nên nó cũng là lậu hoặc.
‘‘Ime vuccanti…pe… pahātabbā’’ti ime sakkāyadiṭṭhiādayo dassanā pahātabbā nāma āsavāti dassento āha.
Showing that these, namely identity-view and so on, are the cankers to be abandoned by seeing, he said, “These are called… to be abandoned.”
Ngài nói: “ Ime vuccanti…pe… pahātabbā” (Này các tỳ khưu, những điều này được gọi là… cần được đoạn trừ) để chỉ rõ rằng thân kiến, v.v., là các lậu hoặc cần được đoạn trừ bằng Tuệ quán.
Atha vā yā ayaṃ channaṃ diṭṭhīnaṃ aññatarā diṭṭhi uppajjatīti evaṃ sarūpeneva sakkāyadiṭṭhi vibhattā.
Or else, identity-view was explained in its own form when it was said, “whichever of these six views arises.”
Hoặc, thân kiến đã được phân tích rõ ràng là một trong sáu tà kiến sinh khởi như vậy.
Taṃ sandhāyāha ‘‘ime vuccanti, bhikkhave’’ti.
Referring to that, he said, “These are called, monks.”
Nhằm ám chỉ điều đó, Ngài nói: “ Ime vuccanti, bhikkhave” (Này các tỳ khưu, những điều này được gọi là).
Sā ca yasmā sahajātapahānekaṭṭhehi saddhiṃ pahīyati.
And since it is abandoned along with its co-existent and equally abandoned states,
Và vì nó được đoạn trừ cùng với những pháp đồng sinh và những pháp có cùng mục đích đoạn trừ.
Diṭṭhāsave hi pahīyamāne taṃsahajāto catūsu diṭṭhisampayuttacittesu kāmāsavopi avijjāsavopi pahīyati.
for when the canker of views is being abandoned, the canker of sensuality and the canker of ignorance that are co-nascent with it in the four consciousnesses associated with views are also abandoned.
Khi lậu hoặc tà kiến được đoạn trừ, lậu hoặc dục và lậu hoặc vô minh đồng sinh với nó trong bốn tâm tương ưng với tà kiến cũng được đoạn trừ.
Pahānekaṭṭho pana catūsu diṭṭhivippayuttesu nāgasupaṇṇādisamiddhipatthanāvasena uppajjamāno bhavāsavo.
However, the āsava of becoming (bhavāsavo), which has the characteristic of being abandoned together, arises in the four types of consciousness dissociated from wrong view, by way of wishing for the powers of nāgas, supaṇṇas, and so on.
Tuy nhiên, bhavāsava (lậu hoặc hữu) phát sinh trong bốn tâm ly tà kiến (diṭṭhivippayutta) do sự mong cầu sự thịnh vượng như của chư thiên Nāga và Supaṇṇa, là loại bị đoạn trừ đồng thời (pahānekaṭṭha).
Teneva sampayutto avijjāsavopi, dvīsu domanassacittesu pāṇātipātādinibbattako avijjāsavopi, tathā vicikicchācittasampayutto avijjāsavopīti evaṃ sabbathāpi avasesā tayopi āsavā pahīyanti.
Associated with that, the āsava of ignorance (avijjāsavo) is also abandoned; the āsava of ignorance that produces the killing of living beings and so on in the two consciousnesses rooted in grief is also abandoned; likewise, the āsava of ignorance associated with the consciousness of doubt is also abandoned. Thus, in every way, the remaining three āsavas are abandoned.
Avijjāsava (lậu hoặc vô minh) liên kết với nó cũng bị đoạn trừ; avijjāsava phát sinh từ các hành vi như sát sinh trong hai tâm sân hận cũng bị đoạn trừ; và avijjāsava liên kết với tâm hoài nghi cũng bị đoạn trừ. Như vậy, tất cả ba loại lậu hoặc còn lại đều bị đoạn trừ theo mọi cách.
Tasmā bahuvacananiddeso katoti evamettha attho veditabbo.
Therefore, the meaning here should be understood thus: the exposition was made in the plural.
Do đó, việc sử dụng số nhiều đã được thực hiện. Ý nghĩa ở đây phải được hiểu như vậy.
Esa porāṇānaṃ adhippāyo.
This is the intention of the ancients.
Đây là ý định của các bậc cổ đức.
Dassanā pahātabbāti dassanaṃ nāma sotāpattimaggo, tena pahātabbāti attho.
To be abandoned by seeing: ‘seeing’ (dassana) means the path of stream-entry; the meaning is ‘to be abandoned by that’.
Dassanā pahātabbā (phải đoạn trừ bằng sự thấy) có nghĩa là dassana (sự thấy) là Sơ quả Tu-đà-hoàn (sotāpattimagga), và nó phải được đoạn trừ bằng sự thấy đó.
Kasmā sotāpattimaggo dassanaṃ?
Why is the path of stream-entry called ‘seeing’?
Tại sao Sơ quả Tu-đà-hoàn lại được gọi là dassana?
Paṭhamaṃ nibbānadassanato.
Because of seeing nibbāna for the first time.
Vì lần đầu tiên thấy Nibbāna.
Nanu gotrabhu paṭhamataraṃ passatīti?
But does not gotrabhū see it even earlier?
Há không phải Gotrabhu (chuyển tộc trí) thấy trước tiên sao?
No na passati.
It is not that it does not see.
Không, nó không thấy.
Disvā kattabbakiccaṃ pana na karoti saṃyojanānaṃ appahānato.
But having seen, it does not perform the task that needs to be done, because of not having abandoned the fetters.
Nhưng sau khi thấy, nó không thực hiện việc cần làm vì các kiết sử chưa bị đoạn trừ.
Tasmā passatīti na vattabbo.
Therefore, it should not be said that it ‘sees’.
Do đó, không nên nói rằng nó thấy.
Yattha katthaci rājānaṃ disvāpi paṇṇākāraṃ datvā kiccanipphattiyā adiṭṭhattā ‘‘ajjāpi rājānaṃ na passāmī’’ti vadanto gāmavāsī puriso cettha nidassanaṃ.
An example here is a villager who, having seen the king somewhere, but not having had his task accomplished by giving a gift, says, “I still have not seen the king.”
Ở đây, một người dân làng, dù đã thấy vua ở đâu đó nhưng chưa hoàn thành việc cần làm bằng cách dâng lễ vật, vẫn nói: “Hôm nay tôi vẫn chưa thấy vua,” là một ví dụ.
Nanu ca dassanena bhāvanāyāti imehi dvīhi appahātabbo āsavo nāma natthi, atha kasmā visuṃ saṃvarādīhi pahātabbe dassetīti.
Is it not so that there is no āsava that is not abandoned by these two, namely by seeing and by development? Why then does He show separately those to be abandoned by restraint and so on?
Há không phải không có lậu hoặc nào không bị đoạn trừ bằng sự thấy và sự tu tập (bhāvanā) này sao? Vậy tại sao lại trình bày riêng những lậu hoặc phải đoạn trừ bằng sự phòng hộ (saṃvara) v.v.?
Saṃvarādīhi pubbabhāge vikkhambhitā āsavā catūhi maggehi samugghātaṃ gacchanti, tasmā tesaṃ maggānaṃ pubbabhāge imehi pañcahākārehi vikkhambhanappahānaṃ dassento evamāha.
The āsavas that are suppressed in the preliminary stage by restraint and so on are eradicated by the four paths. Therefore, He spoke thus to show the abandoning by suppression through these five methods in the preliminary stage of those paths.
Các lậu hoặc đã bị trấn áp (vikkhambhitā) bởi sự phòng hộ v.v. trong giai đoạn trước sẽ bị nhổ tận gốc (samugghātaṃ) bởi bốn đạo. Do đó, Ngài nói như vậy để trình bày sự đoạn trừ bằng trấn áp (vikkhambhanappahāna) thông qua năm phương cách này trong giai đoạn trước của các đạo đó.
Tasmā yo cāyaṃ vutto paṭhamo dassanamaggoyeva, idāni bhāvanānāmena vuccissanti tayo maggā, tesaṃ sabbesampi ayaṃ pubbabhāgapaṭipadāti veditabbā.
Therefore, this which was spoken of first is the path of seeing. Now, the three paths will be spoken of by the name of development. It should be known that this is the preliminary practice for all of them.
Vì vậy, đạo thấy (dassanamagga) đầu tiên đã được nói đến, và bây giờ ba đạo sẽ được gọi là bhāvanā (tu tập), thì tất cả những điều này phải được hiểu là con đường thực hành sơ khởi (pubbabhāgapaṭipadā) của chúng.
Tattha idhāti imasmiṃ sāsane.
Therein, here means in this teaching.
Trong đó, idha (ở đây) có nghĩa là trong giáo pháp này.
Paṭisaṅkhāti paṭisaṅkhāya.
Having reflected means by means of reflection.
Paṭisaṅkhā có nghĩa là sau khi suy xét.
Tatthāyaṃ saṅkhāsaddo ñāṇakoṭṭhāsapaññattigaṇanāsu dissati.
Therein, this word saṅkhā is seen in the senses of knowledge, category, concept, and counting.
Trong đó, từ saṅkhā này được thấy trong các ý nghĩa như tri kiến, phần, khái niệm và tính toán.
‘‘Saṅkhāyekaṃ paṭisevatī’’tiādīsu (ma. ni. 2.168) hi ñāṇe dissati.
For it is seen in the sense of knowledge in such passages as, “Having reflected, one uses it.”
Nó được thấy trong ý nghĩa tri kiến trong các câu như “Saṅkhāya ekaṃ paṭisevati” (Trung Bộ 2.168).
‘‘Papañcasaññāsaṅkhā samudācarantī’’tiādīsu (ma. ni. 1.201) koṭṭhāse.
It is seen in the sense of category in such passages as, “Categories of conceptual proliferation arise.”
Trong ý nghĩa phần, trong các câu như “Papañcasaññāsaṅkhā samudācarantī” (Trung Bộ 1.201).
‘‘Tesaṃ tesaṃ dhammānaṃ saṅkhā samaññā’’tiādīsu (dha. sa. 1313) paññattiyaṃ.
It is seen in the sense of concept in such passages as, “The term, the designation for these various phenomena.”
Trong ý nghĩa khái niệm, trong các câu như “Tesaṃ tesaṃ dhammānaṃ saṅkhā samaññā” (Pháp Tụ 1313).
‘‘Na sukaraṃ saṅkhātu’’ntiādīsu (saṃ. ni. 2.128) gaṇanāyaṃ.
It is seen in the sense of counting in such passages as, “It is not easy to count.”
Trong ý nghĩa tính toán, trong các câu như “Na sukaraṃ saṅkhātuṃ” (Tương Ưng Bộ 2.128).
Idha pana ñāṇe daṭṭhabbo.
Here, however, it should be understood in the sense of knowledge.
Ở đây, nó phải được hiểu theo nghĩa tri kiến.
Paṭisaṅkhā yonisoti hi upāyena pathena paṭisaṅkhāya ñatvā paccavekkhitvāti attho.
Having wisely reflected means having reflected, known, and considered with method, with reason.
Paṭisaṅkhā yoniso có nghĩa là suy xét một cách khéo léo, tức là biết và quán xét bằng phương pháp đúng đắn.
Ettha ca asaṃvare ādīnavapaṭisaṅkhā yoniso paṭisaṅkhāti veditabbā.
And here, the wise reflection should be understood as the reflection on the danger in non-restraint.
Ở đây, cần hiểu rằng đó là sự suy xét khéo léo về sự nguy hiểm của việc không phòng hộ.
Sā cāyaṃ ‘‘varaṃ, bhikkhave, tattāya ayosalākāya ādittāya sampajjalitāya sajotibhūtāya cakkhundriyaṃ sampalimaṭṭhaṃ, na tveva cakkhuviññeyyesu rūpesu anubyañjanaso nimittaggāho’’tiādinā (saṃ. ni. 4.235) ādittapariyāyanayena veditabbā.
And that should be understood in the manner of the Discourse on the Fire, which begins: “Monks, it is better that the eye faculty be wiped with a heated iron rod, blazing, afire, and glowing, than that there be the grasping of a sign by way of its details in forms cognizable by the eye.”
Và sự suy xét về sự nguy hiểm này phải được hiểu theo phương pháp của bài kinh Lửa Cháy (Ādittapariyāya), như trong câu: “Này các Tỳ-kheo, thà dùng một thanh sắt nung đỏ, đang cháy, đang rực lửa, đang bốc khói mà chọc vào mắt còn hơn là nắm giữ tướng chung (nimittaggāha) theo các tướng phụ (anubyañjanaso) trong các sắc khả kiến bằng mắt.”
Cakkhundriyasaṃvarasaṃvuto viharatīti ettha cakkhumeva indriyaṃ cakkhundriyaṃ, saṃvaraṇato saṃvaro, pidahanato thakanatoti vuttaṃ hoti.
In the phrase he dwells restrained with the restraint of the eye faculty, eye itself is faculty, hence eye-faculty. Because it restrains, it is restraint; it means covering, shutting.
Trong câu cakkhundriyasaṃvarasaṃvuto viharati (sống được phòng hộ bằng sự phòng hộ nhãn căn), cakkhu (mắt) chính là indriya (căn) là cakkhundriya (nhãn căn), và saṃvara (phòng hộ) là sự che đậy, sự đóng kín.
Satiyā etaṃ adhivacanaṃ.
This is a synonym for mindfulness.
Đây là tên gọi của niệm (sati).
Cakkhundriye saṃvaro cakkhundriyasaṃvaro.
Restraint in the eye faculty is eye-faculty-restraint.
Sự phòng hộ nơi nhãn căn là cakkhundriyasaṃvara (sự phòng hộ nhãn căn).
Titthakāko āvāṭakacchapo vanamahiṃsotiādayo viya.
It is like ‘a crow on the bank,’ ‘a tortoise in a pit,’ ‘a buffalo in the forest,’ and so on.
Giống như “con quạ ở bến sông” (titthakāko), “con rùa trong hố” (āvāṭakacchapo), “con trâu rừng” (vanamahiṃso) v.v.
Tattha kiñcāpi cakkhundriye saṃvaro vā asaṃvaro vā natthi.
Therein, although there is neither restraint nor non-restraint in the eye faculty itself.
Trong đó, dù cho không có sự phòng hộ hay không phòng hộ nơi nhãn căn.
Na hi cakkhupasādaṃ nissāya sati vā muṭṭhasaccaṃ vā uppajjati.
For neither mindfulness nor lapse of mindfulness arises dependent on the eye-sensitivity.
Vì niệm hay sự thất niệm không phát sinh dựa vào nhãn tịnh sắc (cakkhupasāda).
Apica yadā rūpārammaṇaṃ cakkhussa āpāthaṃ āgacchati, tadā bhavaṅge dvikkhattuṃ uppajjitvā niruddhe kiriyamanodhātu āvajjanakiccaṃ sādhayamānā uppajjitvā nirujjhati, tato cakkhuviññāṇaṃ dassanakiccaṃ, tato vipākamanodhātu sampaṭicchanakiccaṃ, tato vipākāhetukamanoviññāṇadhātu santīraṇakiccaṃ, tato kiriyāhetukamanoviññāṇadhātu voṭṭhabbanakiccaṃ sādhayamānā uppajjitvā nirujjhati.
However, when a form-object comes into the range of the eye, then, after the bhavaṅga has arisen twice and ceased, the functional mind-element, accomplishing the function of adverting, arises and ceases. Then, eye-consciousness, the function of seeing; then, resultant mind-element, the function of receiving; then, resultant rootless mind-consciousness-element, the function of investigating; then, functional rootless mind-consciousness-element, accomplishing the function of determining, arises and ceases.
Tuy nhiên, khi một đối tượng sắc (rūpārammaṇa) đi vào phạm vi của mắt, thì bhavaṅga (tâm hữu phần) phát sinh và diệt hai lần, sau đó manodhātu (ý giới) thuộc loại hành động (kiriya) phát sinh và diệt, thực hiện chức năng hướng tâm (āvajjanakicca); sau đó cakkhuviññāṇa (nhãn thức) thực hiện chức năng thấy; sau đó manodhātu thuộc loại quả (vipāka) thực hiện chức năng tiếp nhận; sau đó manoviññāṇadhātu (ý thức giới) thuộc loại quả vô nhân (vipākāhetuka) thực hiện chức năng thẩm sát; sau đó manoviññāṇadhātu thuộc loại hành động vô nhân (kiriyāhetukamanoviññāṇadhātu) phát sinh và diệt, thực hiện chức năng quyết định.
Tadanantaraṃ javanaṃ javati.
Immediately after that, javana impels.
Ngay sau đó, javana (tâm tốc hành) vận hành.
Tatthapi neva bhavaṅgasamaye, na āvajjanādīnaṃ aññatarasamaye saṃvaro vā asaṃvaro vā atthi.
There too, there is neither restraint nor non-restraint at the time of bhavaṅga, nor at the time of any of the others, such as adverting.
Ngay cả ở đó, không có sự phòng hộ hay không phòng hộ vào thời điểm của bhavaṅga, cũng không có vào bất kỳ thời điểm nào của āvajjanā (hướng tâm) v.v.
Javanakkhaṇe pana sace dussīlyaṃ vā muṭṭhasaccaṃ vā aññāṇaṃ vā akkhanti vā kosajjaṃ vā uppajjati, ayaṃ asaṃvaro hoti.
But at the moment of javana, if immorality, or lapse of mindfulness, or ignorance, or intolerance, or laziness arises, this is non-restraint.
Tuy nhiên, vào khoảnh khắc của javana, nếu sự ác giới (dussīlya), hay sự thất niệm (muṭṭhasacca), hay sự vô minh (aññāṇa), hay sự không nhẫn nại (akkhanti), hay sự biếng nhác (kosajja) phát sinh, thì đó là sự không phòng hộ.
Evaṃ hontopi so cakkhundriye asaṃvaroti vuccati.
Even when it is like this, it is called non-restraint in the eye faculty.
Dù nó phát sinh như vậy, nó vẫn được gọi là sự không phòng hộ nơi nhãn căn.
Tasmiñhi sati dvārampi aguttaṃ hoti, bhavaṅgampi āvajjanādīni vīthicittānipi.
Because when that is present, the door is unguarded, and so are the bhavaṅga and the cognitive-process consciousnesses such as adverting.
Vì khi có điều đó, ngay cả cửa (dvāra) cũng không được bảo vệ, bhavaṅga cũng vậy, và các tâm lộ trình (vīthicitta) như āvajjanā v.v. cũng vậy.
Yathā kiṃ, yathā nagare catūsu dvāresu asaṃvutesu kiñcāpi anto gharakoṭṭhakagabbhādayo susaṃvutā, tathāpi antonagare sabbaṃ bhaṇḍaṃ arakkhitaṃ agopitameva hoti.
Like what? It is like when the four gates of a city are unrestrained; although the houses, storerooms, and inner chambers inside are well restrained, still all the goods within the city are unprotected and unguarded.
Giống như thế nào? Giống như khi bốn cửa thành không được đóng, dù các phòng ốc, kho báu v.v. bên trong thành được đóng kín cẩn thận, nhưng tất cả tài sản trong thành vẫn không được bảo vệ, không được canh giữ.
Nagaradvārena hi pavisitvā corā yadicchanti, taṃ kareyyuṃ, evameva javane dussīlyādīsu uppannesu, tasmiṃ asaṃvare sati dvārampi aguttaṃ hoti, bhavaṅgampi āvajjanādīni vīthicittānipīti.
For thieves, having entered through the city gate, could do whatever they wish. In the very same way, when immorality and so on have arisen in the javana, when that non-restraint is present, the door is unguarded, and so are the bhavaṅga and the cognitive-process consciousnesses such as adverting.
Vì bọn trộm có thể vào qua cửa thành và làm bất cứ điều gì chúng muốn. Cũng vậy, khi ác giới v.v. phát sinh trong javana, nếu có sự không phòng hộ đó, thì ngay cả cửa cũng không được bảo vệ, bhavaṅga cũng vậy, và các tâm lộ trình như āvajjanā v.v. cũng vậy.
Tasmiṃ pana sīlādīsu uppannesu dvārampi guttaṃ hoti, bhavaṅgampi āvajjanādīni vīthicittānipi.
But when virtue and so on have arisen in that, the door is guarded, and so are the bhavaṅga and the cognitive-process consciousnesses such as adverting.
Tuy nhiên, khi giới luật (sīla) v.v. phát sinh trong đó, thì ngay cả cửa cũng được bảo vệ, bhavaṅga cũng vậy, và các tâm lộ trình như āvajjanā v.v. cũng vậy.
Yathā kiṃ?
Like what?
Giống như thế nào?
Yathā nagaradvāresu susaṃvutesu kiñcāpi anto gharādayo asaṃvutā, tathāpi antonagare sabbaṃ bhaṇḍaṃ surakkhitaṃ sugopitameva hoti.
It is like when the city gates are well restrained; although the houses and so on inside are unrestrained, still all the goods within the city are well protected and well guarded.
Giống như khi các cửa thành được đóng kín cẩn thận, dù các ngôi nhà v.v. bên trong không được đóng, nhưng tất cả tài sản trong thành vẫn được bảo vệ cẩn thận, được canh giữ kỹ lưỡng.
Nagaradvāresu hi pihitesu corānaṃ paveso natthi, evameva javane sīlādīsu uppannesu dvārampi suguttaṃ hoti, bhavaṅgampi āvajjanādīni vīthicittānipi.
For when the city gates are closed, there is no entry for thieves. In the very same way, when virtue and so on have arisen in the javana, the door is well guarded, and so are the bhavaṅga and the cognitive-process consciousnesses such as adverting.
Vì khi các cửa thành bị đóng, bọn trộm không thể vào. Cũng vậy, khi giới luật v.v. phát sinh trong javana, thì ngay cả cửa cũng được bảo vệ cẩn thận, bhavaṅga cũng vậy, và các tâm lộ trình như āvajjanā v.v. cũng vậy.
Tasmā javanakkhaṇe uppajjamānopi cakkhundriye saṃvaroti vutto.
Therefore, although arising at the moment of javana, it is called restraint in the eye faculty.
Do đó, sự phòng hộ phát sinh vào khoảnh khắc của javana cũng được gọi là sự phòng hộ nơi nhãn căn.
Idha cāyaṃ satisaṃvaro adhippetoti veditabbo.
And here it should be understood that this restraint by mindfulness is intended.
Và ở đây, sự phòng hộ bằng niệm (satisaṃvara) được đề cập đến.
Cakkhundriyasaṃvarena saṃvuto cakkhundriyasaṃvarasaṃvuto, upetoti vuttaṃ hoti.
Restrained by the restraint of the eye faculty is restrained with the restraint of the eye faculty; it means endowed with.
Được phòng hộ bằng sự phòng hộ nhãn căn là cakkhundriyasaṃvarasaṃvuto, có nghĩa là được trang bị.
Tathā hi, pātimokkhasaṃvarasaṃvutoti imassa vibhaṅge ‘‘iminā pātimokkhasaṃvarena upeto hoti…pe… samannāgato’’ti (vibha. 511) vuttaṃ.
Indeed, in the analysis of the phrase ‘restrained with the restraint of the pātimokkha’, it is said, “he is endowed with this restraint of the pātimokkha... furnished with.”
Thật vậy, trong phần phân tích của “pātimokkhasaṃvarasaṃvuto” (được phòng hộ bằng sự phòng hộ giới bổn), có nói “iminā pātimokkhasaṃvarena upeto hoti…pe… samannāgato” (được trang bị bằng sự phòng hộ giới bổn này… v.v… được sở hữu).
Taṃ ekajjhaṃ katvā cakkhundriyasaṃvarena saṃvutoti evamattho veditabbo.
Taking that together, the meaning should be understood thus: restrained by the restraint of the eye faculty.
Tổng hợp điều đó lại, ý nghĩa phải được hiểu là “được phòng hộ bằng sự phòng hộ nhãn căn” như vậy.
Atha vā saṃvarīti saṃvuto, thakesi pidahīti vuttaṃ hoti.
Alternatively, he who restrains is restrained; it means he has shut, he has closed.
Hoặc là, saṃvarīti saṃvuto (phòng hộ là được phòng hộ), có nghĩa là đã che đậy, đã đóng kín.
Cakkhundriye saṃvarasaṃvuto cakkhundriyasaṃvarasaṃvuto, cakkhundriyasaṃvarasaññitaṃ satikavāṭaṃ cakkhudvāre, gharadvāre kavāṭaṃ viya saṃvari thakesi pidahīti vuttaṃ hoti.
He has restrained in the restraint of the eye faculty is ‘he has restrained with the restraint of the eye faculty.’ It means he has restrained, shut, closed the gate of mindfulness called ‘restraint of the eye faculty’ at the eye-door, just as one does a gate at the door of a house.
Cakkhundriyasaṃvarasaṃvuto (được phòng hộ bằng sự phòng hộ nhãn căn) có nghĩa là đã che đậy, đã đóng kín cánh cửa niệm (satikavāṭa) gọi là sự phòng hộ nhãn căn ở cửa mắt, giống như cánh cửa ở cửa nhà.
Ayameva cettha attho sundarataro.
This very meaning is more excellent here.
Ý nghĩa này ở đây là tốt nhất.
Tathā hi ‘‘cakkhundriyasaṃvaraṃ asaṃvutassa viharato saṃvutassa viharato’’ti etesu padesu ayameva attho dissati.
Indeed, in such passages as “for one dwelling unrestrained in the restraint of the eye faculty, for one dwelling restrained,” this very meaning is seen.
Thật vậy, ý nghĩa này được thấy trong các đoạn văn “cakkhundriyasaṃvaraṃ asaṃvutassa viharato saṃvutassa viharato” (khi sống không phòng hộ nhãn căn, khi sống phòng hộ nhãn căn).
Viharatīti evaṃ cakkhundriyasaṃvarasaṃvuto yena kenaci iriyāpathavihārena viharati.
He abides: Thus, being restrained in the eye faculty, he abides in any posture.
Viharati (an trú) nghĩa là, một người đã chế ngự được sự phòng hộ căn mắt như vậy, sống với bất kỳ oai nghi nào.
Yañhissātiādimhi yaṃ cakkhundriyasaṃvaraṃ assa bhikkhuno asaṃvutassa athaketvā apidahitvā viharantassāti evamattho veditabbo.
In the phrase beginning with Yañhissā, the meaning should be understood in this way: for that monk who, being unrestrained in the restraint of the eye faculty, abides without closing or shutting it.
Trong đoạn Yañhissā (mà đối với vị ấy) và những đoạn tiếp theo, cần hiểu nghĩa là: sự phòng hộ căn mắt mà vị tỳ khưu ấy không chế ngự, sống mà không đóng kín hay che đậy.
Atha vā, ye-kārassa yanti ādeso.
Alternatively, the particle yaṃ is a substitute for the particle ye.
Hoặc, chữ "ye" (những gì) được chuyển thành yaṃ (điều gì).
Hikāro ca padapūraṇo, ye assāti attho.
The particle hi is merely a-syllable-filler; the meaning is "ye assa" (which for him).
Và chữ hi là một từ đệm, nghĩa là "ye assa" (những gì có).
Uppajjeyyunti nibbatteyyuṃ.
Might arise: means might be produced.
Uppajjeyyuṃ (sẽ khởi lên) nghĩa là sẽ phát sinh.
Āsavā vighātapariḷāhāti cattāro āsavā ca aññe ca vighātakarā kilesapariḷāhā vipākapariḷāhā ca.
Āsavā, distress, and fevers: means the four āsavā, as well as other distressing defilements, fevers, and resultant fevers.
Āsavā vighātapariḷāhā (các lậu hoặc, sự phiền não và sự thiêu đốt) nghĩa là bốn lậu hoặc và các phiền não khác gây ra sự phiền não, cũng như các quả báo gây ra sự thiêu đốt.
Cakkhudvāre hi iṭṭhārammaṇaṃ āpāthagataṃ kāmassādavasena assādayato abhinandato kāmāsavo uppajjati, īdisaṃ aññasmimpi sugatibhave labhissāmīti bhavapatthanāya assādayato bhavāsavo uppajjati, sattoti vā sattassāti vā gaṇhantassa diṭṭhāsavo uppajjati, sabbeheva sahajātaṃ aññāṇaṃ avijjāsavoti cattāro āsavā uppajjanti.
For when a desirable object comes into the range of the eye-door, for one who savors and delights in it with sensual relish, the āsava of sensual pleasure arises. For one who savors it with the wish for continued existence, thinking, "May I obtain such a thing in another fortunate existence," the āsava of continued existence arises. For one who grasps it as "a being" or "belonging to a being," the āsava of views arises. The ignorance co-arising with all of these is the āsava of ignorance. In this way, the four āsavā arise.
Thật vậy, tại căn mắt, khi một đối tượng khả ái đi vào tầm nhìn, nếu người ấy thưởng thức và hoan hỷ theo cách thỏa mãn dục lạc, thì lậu hoặc dục (kāmāsava) khởi lên; nếu thưởng thức với ước muốn về sự tồn tại, rằng "tôi sẽ đạt được điều tương tự trong các cõi thiện khác", thì lậu hoặc hữu (bhavāsava) khởi lên; nếu chấp thủ rằng "đây là một chúng sinh" hoặc "đây là của một chúng sinh", thì lậu hoặc kiến (diṭṭhāsava) khởi lên; và sự vô minh đồng sinh với tất cả các lậu hoặc này được gọi là lậu hoặc vô minh (avijjāsava) – như vậy, bốn lậu hoặc khởi lên.
Tehi sampayuttā apare kilesā vighātapariḷāhā, āyatiṃ vā tesaṃ vipākā.
The other defilements associated with them are distressing fevers, or in the future, their results.
Các phiền não khác đồng hành với chúng là sự phiền não và sự thiêu đốt, hoặc quả báo của chúng trong tương lai.
Tepi hi asaṃvutasseva viharato uppajjeyyunti vuccanti.
It is said that these, too, would arise for one who abides unrestrained.
Chúng cũng được nói là sẽ khởi lên đối với người sống mà không có sự phòng hộ.
23. Paṭisaṅkhā yoniso cīvarantiādīsu yaṃ vattabbaṃ, taṃ sabbaṃ visuddhimagge sīlakathāyaṃ vuttameva.
23. In the passage beginning Having reflected wisely on the robe, everything that needs to be said has already been said in the Visuddhimagga, in the section on virtue.
23. Những gì cần nói trong các đoạn như Paṭisaṅkhā yoniso cīvaraṃ (sau khi quán xét một cách thiện xảo, y phục), tất cả đều đã được nói trong phần Giới (sīlakathā) của Thanh Tịnh Đạo (Visuddhimagga).
Yañhissāti yaṃ cīvarapiṇḍapātādīsu vā aññataraṃ assa.
Yañhissā: means whichever of the requisites, such as robes, almsfood, and so on, there might be for him.
Yañhissā (mà đối với vị ấy) nghĩa là bất kỳ vật phẩm nào trong y phục, bát khất thực, v.v., mà vị ấy có.
Appaṭisevatoti evaṃ yoniso appaṭisevantassa.
For one not using: means for one not using it in this way with wise reflection.
Appaṭisevato (không thọ dụng) nghĩa là đối với người không thọ dụng một cách thiện xảo như vậy.
Sesaṃ vuttanayameva.
The rest is just as explained before.
Phần còn lại tương tự như cách giải thích đã nêu.
Kevalaṃ panidha aladdhaṃ cīvarādiṃ patthayato laddhaṃ vā assādayato kāmāsavassa uppatti veditabbā.
However, it should be understood here that for one who longs for requisites like robes that have not been obtained, or who savors what has been obtained, the āsava of sensual pleasure arises.
Tuy nhiên, ở đây, sự khởi lên của lậu hoặc dục (kāmāsava) cần được hiểu là do ước muốn các vật phẩm như y phục chưa đạt được, hoặc do thưởng thức các vật phẩm đã đạt được.
Īdisaṃ aññasmimpi sampattibhave sugatibhave labhissāmīti bhavapatthanāya assādayato bhavāsavassa, ahaṃ labhāmi na labhāmīti vā mayhaṃ vā idanti attasaññaṃ adhiṭṭhahato diṭṭhāsavassa uppatti veditabbā.
It should be understood that for one who savors with the wish for continued existence, thinking, "May I obtain such things in another prosperous and fortunate existence," the āsava of continued existence arises. And for one who establishes the perception of self, thinking, "I obtain" or "I do not obtain," or "This is mine," the āsava of views arises.
Sự khởi lên của lậu hoặc hữu (bhavāsava) cần được hiểu là do thưởng thức với ước muốn về sự tồn tại, rằng "tôi sẽ đạt được điều tương tự trong các cõi đầy đủ phước báu, các cõi thiện khác"; và sự khởi lên của lậu hoặc kiến (diṭṭhāsava) là do chấp thủ nhận thức về ngã, rằng "tôi đạt được hay không đạt được" hoặc "đây là của tôi".
Sabbeheva pana sahajāto avijjāsavoti evaṃ catunnaṃ āsavānaṃ uppatti vipākapariḷāhā ca navavedanuppādanatopi veditabbā.
And the āsava of ignorance is that which is co-nascent with all of them. Thus, the arising of the four āsavā and their resultant fevers should also be understood from the production of new feelings.
Và lậu hoặc vô minh (avijjāsava) là sự vô minh đồng sinh với tất cả các lậu hoặc này. Như vậy, sự khởi lên của bốn lậu hoặc và các quả báo gây ra sự thiêu đốt cũng cần được hiểu là do sự phát sinh của các cảm thọ mới.
24. Paṭisaṅkhā yoniso khamo hoti sītassāti upāyena pathena paccavekkhitvā khamo hoti sītassa sītaṃ khamati sahati, na avīrapuriso viya appamattakenapi sītena calati kampati kammaṭṭhānaṃ vijahati.
24. Having reflected wisely, he is tolerant of cold: Having reflected by a skillful means, a proper way, he becomes tolerant of cold; he endures and bears the cold. He is not like an unheroic man who trembles and shakes at the slightest cold and abandons his meditation subject.
24. Paṭisaṅkhā yoniso khamo hoti sītassa (sau khi quán xét một cách thiện xảo, vị ấy có khả năng chịu đựng cái lạnh) nghĩa là, sau khi quán xét bằng phương pháp đúng đắn, vị ấy có khả năng chịu đựng cái lạnh, chịu đựng và nhẫn nại với cái lạnh, không bị lay động hay run rẩy bởi một chút lạnh nhỏ như một người không có nghị lực, và không từ bỏ đề mục thiền định.
Apica kho lomasanāgatthero viya anappakenāpi sītena phuṭṭho na calati na kampati, kammaṭṭhānameva manasi karoti.
Rather, like the Elder Lomasanāga, when touched by even intense cold, he does not tremble or shake, but attends only to his meditation subject.
Hơn nữa, giống như Trưởng lão Lomasanāgata, dù bị cái lạnh khắc nghiệt tác động, vị ấy không hề lay động hay run rẩy, mà chỉ chuyên tâm vào đề mục thiền định.
Thero kira cetiyapabbate piyaṅguguhāyaṃ padhānaghare viharanto antaraṭṭhake himapātasamaye lokantarikaniraye paccavekkhitvā kammaṭṭhānaṃ avijahantova abbhokāse vītināmesi.
It is said that the Elder, while dwelling in a meditation hut in the Piyaṅgu cave on Cetiyapabbata, during the eight-day period of snowfall, reflected on the Lokantarika hell and passed the time in the open air without ever abandoning his meditation subject.
Tương truyền, khi Trưởng lão ấy đang trú tại một ngôi nhà thiền định trong hang Piyaṅgu trên núi Cetiyapabbata, vào mùa tuyết rơi giữa mùa đông, Ngài đã quán xét về địa ngục Lokantarika và trải qua thời gian ở ngoài trời mà không từ bỏ đề mục thiền định.
Evaṃ uṇhādīsupi atthayojanā veditabbā.
Similarly, the application of meaning should be understood for heat, and so on.
Tương tự, cách giải thích ý nghĩa cũng cần được hiểu đối với uṇhādīsu (cái nóng, v.v.).
Kevalañhi yo bhikkhu adhimattampi uṇhaṃ sahati sveva thero viya, ayaṃ ‘‘khamo uṇhassā’’ti veditabbo.
For only that monk who endures even intense heat, just like the Elder, should be understood as "tolerant of heat."
Chỉ có vị tỳ khưu nào chịu đựng được cả cái nóng quá mức, giống như vị Trưởng lão này, mới được gọi là "khamo uṇhassa" (người chịu đựng được cái nóng).
Thero kira gimhasamaye pacchābhattaṃ bahicaṅkame nisīdi.
It is said that the Elder, during the summer season, sat in the afternoon on an open-air walkway.
Tương truyền, vị Trưởng lão ấy vào mùa hè, sau bữa ăn, ngồi ở lối đi kinh hành bên ngoài.
Kammaṭṭhānaṃ manasikaronto sedāpissa kacchehi muccanti.
As he was attending to his meditation subject, sweat poured from his armpits.
Khi Ngài chuyên tâm vào đề mục thiền định, mồ hôi chảy ra từ nách của Ngài.
Atha naṃ antevāsiko āha ‘‘idha, bhante, nisīdatha, sītalo okāso’’ti.
Then a resident pupil said to him, "Venerable sir, please sit here, it is a cool place."
Bấy giờ, một đệ tử nói với Ngài: "Bạch Đại đức, xin Ngài ngồi ở đây, nơi này mát mẻ."
Thero ‘‘uṇhabhayenevamhi āvuso idha nisinno’’ti avīcimahānirayaṃ paccavekkhitvā nisīdiyeva.
The Elder replied, "Friend, it is precisely out of fear of heat that I am sitting here," and reflecting on the great Avīci hell, he remained seated.
Vị Trưởng lão nói: "Này hiền giả, chính vì sợ cái nóng mà tôi ngồi ở đây," và sau khi quán xét về đại địa ngục Avīci, Ngài vẫn tiếp tục ngồi.
Uṇhanti cettha aggisantāpova veditabbo.
And here, heat should be understood as the heat of fire.
Ở đây, uṇhaṃ (cái nóng) cần được hiểu là sức nóng của lửa.
Sūriyasantāpavasena panetaṃ vatthu vuttaṃ.
However, this story is told with reference to the heat of the sun.
Tuy nhiên, câu chuyện này được kể theo nghĩa sức nóng của mặt trời.
Yo ca dve tayo vāre bhattaṃ vā pānīyaṃ vā alabhamānopi anamatagge saṃsāre attano pettivisayūpapattiṃ paccavekkhitvā avedhento kammaṭṭhānaṃ na vijahatiyeva.
One who, even when not receiving food or water for two or three occasions, reflects on his own birth in the sphere of tormented spirits in this beginningless saṃsāra, and without wavering, does not abandon his meditation subject.
Và vị tỳ khưu nào, dù không nhận được thức ăn hay nước uống hai ba lần, cũng không hề run rẩy mà quán xét về sự tái sinh của mình vào cõi ngạ quỷ trong vòng luân hồi vô thủy, và không từ bỏ đề mục thiền định.
Adhimattehi ḍaṃsamakasavātātapasamphassehi phuṭṭho cāpi tiracchānūpapattiṃ paccavekkhitvā avedhento kammaṭṭhānaṃ na vijahatiyeva.
And one who, when afflicted by the intense touch of gadflies, mosquitoes, wind, and sun, reflects on birth in the animal realm, and without wavering, does not abandon his meditation subject.
Dù bị xúc chạm bởi muỗi, côn trùng, gió, nắng nóng quá mức, vị ấy cũng quán xét về sự tái sinh vào cõi súc sinh, không hề run rẩy và không từ bỏ đề mục thiền định.
Sarīsapasamphassena phuṭṭho cāpi anamatagge saṃsāre sīhabyagghādimukhesu anekavāraṃ parivattitapubbabhāvaṃ paccavekkhitvā avedhento kammaṭṭhānaṃ na vijahatiyeva padhāniyatthero viya.
And one who, when afflicted by the touch of a creeping creature, reflects on having been turned over in the mouths of lions, tigers, and the like many times in this beginningless saṃsāra, and without wavering, does not abandon his meditation subject, like the Elder Padhāniya.
Dù bị xúc chạm bởi rắn rết, vị ấy cũng quán xét về việc đã từng luân chuyển nhiều lần vào miệng sư tử, hổ, v.v., trong vòng luân hồi vô thủy, không hề run rẩy và không từ bỏ đề mục thiền định, giống như Trưởng lão Padhāniya.
Ayaṃ ‘‘khamo jighacchāya…pe… sarīsapasamphassāna’’nti veditabbo.
Such a one should be understood as "tolerant of hunger... and the touch of creeping creatures."
Vị này được gọi là "khamo jighacchāya…pe… sarīsapasamphassānaṃ" (người chịu đựng được đói…v.v… sự xúc chạm của rắn rết).
Theraṃ kira khaṇḍacelavihāre kaṇikārapadhāniyaghare ariyavaṃsaṃ suṇantaṃ ghoraviso sappo ḍaṃsi.
It is said that while the Elder was listening to the Ariyavaṃsa discourse in the Kaṇikāra meditation hall at Khaṇḍacela monastery, a snake with deadly venom bit him.
Tương truyền, khi Trưởng lão ấy đang nghe Ariyavaṃsa (Pháp hệ của các bậc Thánh) tại một ngôi nhà thiền định Kanikāra trong tịnh xá Khaṇḍacela, một con rắn độc dữ tợn đã cắn Ngài.
Thero jānitvāpi pasannacitto nisinno dhammaṃyeva suṇāti.
Even though the Elder knew, he sat with a serene mind and just listened to the Dhamma.
Dù biết điều đó, Trưởng lão vẫn ngồi yên với tâm thanh tịnh, chỉ lắng nghe Pháp.
Visavego thaddho ahosi.
The force of the venom became fierce.
Nọc độc trở nên cứng đờ.
Thero upasampadamaṇḍalaṃ ādiṃ katvā sīlaṃ paccavekkhitvā parisuddhasīlohamasmīti pītiṃ uppādesi.
The Elder, beginning with the ordination boundary, reflected on his virtue and generated joy, thinking, "I am one of pure virtue."
Trưởng lão quán xét giới hạnh của mình, bắt đầu từ giới cụ túc, và phát sinh hỷ lạc rằng "ta có giới hạnh thanh tịnh".
Saha pītuppādā visaṃ nivattitvā pathaviṃ pāvisi.
Simultaneously with the arising of joy, the venom retreated and entered the earth.
Ngay khi hỷ lạc khởi lên, nọc độc rút lui và chui xuống đất.
Thero tattheva cittekaggataṃ labhitvā vipassanaṃ vaḍḍhetvā arahattaṃ pāpuṇi.
The Elder, right there, gained one-pointedness of mind, developed insight, and attained Arahantship.
Trưởng lão đã đạt được sự nhất tâm ngay tại đó, phát triển thiền quán (vipassanā), và đạt được quả A-la-hán.
Thero kira paccayasantosabhāvanārāmatāya mahāariyavaṃsappaṭipadaṃ kathesi, sabbo mahāgāmo āgacchati.
It is said that the Elder, due to his contentment with requisites and his delight in development, gave a discourse on the great practice of the Ariyavaṃsa, and the entire great village came.
Tương truyền, vì hoan hỷ với sự tu tập hạnh tri túc, vị Trưởng lão ấy đã thuyết giảng về Đại Ariyavaṃsa, và toàn bộ ngôi làng lớn đều đến nghe.
Therassa mahāsakkāro uppajjati.
Great honor arose for the Elder.
Trưởng lão nhận được sự tôn kính lớn.
Taṃ aññataro mahāthero adhivāsetuṃ asakkonto dīghabhāṇako ariyavaṃsaṃ kathemīti sabbarattiṃ kolāhalaṃ karosītiādīhi akkosi.
Another great elder, unable to tolerate this, abused him with words like, "The Dīghabhāṇaka, saying he is giving a discourse on the Ariyavaṃsa, makes a racket all night long!"
Một vị Đại Trưởng lão khác, không thể chịu đựng được điều đó, đã mắng nhiếc vị Trưởng lão Dīghabhāṇaka rằng "ngươi gây ồn ào suốt đêm khi thuyết giảng Ariyavaṃsa!".
Ubhopi ca attano attano vihāraṃ gacchantā gāvutamattaṃ ekapathena agamaṃsu.
As both were going to their respective monasteries, they walked for about a league on the same path.
Cả hai vị đều đi về tịnh xá của mình, và đã đi chung một con đường khoảng một do tuần.
Sakalagāvutampi so taṃ akkosiyeva.
For that entire league, that one kept abusing him.
Suốt một do tuần đó, vị kia vẫn tiếp tục mắng nhiếc Ngài.
Tato yattha dvinnaṃ vihārānaṃ maggo bhijjati, tattha ṭhatvā dīghabhāṇakatthero taṃ vanditvā ‘‘esa, bhante, tumhākaṃ maggo’’ti āha.
Then, at the place where the path to the two monasteries diverged, the Elder Dīghabhāṇaka stopped, paid homage to him, and said, "Venerable sir, this is your path."
Sau đó, tại nơi con đường chia ra thành hai lối đi đến hai tịnh xá, Trưởng lão Dīghabhāṇaka đã đứng lại, đảnh lễ vị kia và nói: "Bạch Đại đức, đây là con đường của Ngài."
So asuṇanto viya agamāsi.
The other went on as if he had not heard.
Vị kia đi tiếp như thể không nghe thấy gì.
Theropi vihāraṃ gantvā pāde pakkhāletvā nisīdi.
The Elder, too, went to his monastery, washed his feet, and sat down.
Trưởng lão Dīghabhāṇaka cũng về tịnh xá, rửa chân và ngồi xuống.
Tamenaṃ antevāsiko ‘‘kiṃ, bhante, sakalagāvutaṃ paribhāsantaṃ na kiñci avocutthā’’ti āha.
His pupil asked him, "Venerable sir, why did you not say anything at all to him who was reviling you for a whole league?"
Người đệ tử hỏi vị Trưởng lão: “Bạch Tôn giả, tại sao Tôn giả không nói một lời nào với vị Đại Trưởng lão đã mắng chửi Tôn giả suốt cả một gāvuta (khoảng 1/4 yojana)?”
Thero ‘‘khantiyeva, āvuso, mayhaṃ bhāro, na akkhanti.
The elder said, "Friend, patience alone is my burden, not impatience.
Vị Trưởng lão nói: “Này hiền hữu, sự nhẫn nhục là gánh nặng của ta, không phải sự không nhẫn nhục.
Ekapaduddhārepi kammaṭṭhānaviyogaṃ na passāmī’’ti āha.
I do not see a separation from the meditation subject even in a single footstep."
Ngay cả trong một bước chân, ta cũng không thấy sự tách rời khỏi đề mục thiền định.”
Ettha ca vacanameva vacanapathoti veditabbo.
And here, speech itself should be understood as the path of speech.
Ở đây, chỉ lời nói thôi đã được hiểu là con đường lời nói (vacanapatha).
Yo pana uppannā sārīrikā vedanā dukkhamanaṭṭhena dukkhā, bahalaṭṭhena tibbā, pharusaṭṭhena kharā, tikhiṇaṭṭhena kaṭukā, assādavirahato asātā, manaṃ avaḍḍhanato amanāpā, pāṇaharaṇasamatthatāya pāṇaharā adhivāsetiyeva, na vedhati.
But one who endures arisen bodily feelings that are painful in the sense of being afflictive, intense in the sense of being strong, harsh in the sense of being rough, sharp in the sense of being piercing, unpleasant from the absence of gratification, disagreeable from not delighting the mind, and life-destroying in their capacity to take life, and is not shaken—
Vị tỳ khưu nào nhẫn chịu những cảm thọ thân thể đã khởi lên, là khổ vì có tính chất gây đau đớn, là dữ dội (tibbā) vì có tính chất nặng nề, là thô ráp (kharā) vì có tính chất gay gắt, là cay độc (kaṭukā) vì có tính chất sắc bén, là không lạc (asātā) vì không có vị ngọt, là không vừa ý (amanāpā) vì không làm cho tâm tăng trưởng, là lấy mạng (pāṇaharā) vì có khả năng đoạt mạng sống, vị ấy không hề run sợ.
Evaṃ sabhāvo hoti cittalapabbate padhāniyatthero viya.
one who has such a nature is like the Meditating Elder of Cittala mountain.
Vị ấy có bản chất như vậy, giống như vị Trưởng lão Padhāniya ở núi Cittala.
Ayaṃ ‘‘uppannānaṃ…pe… adhivāsanajātiko’’ti veditabbo.
This one should be known as being "of a nature to endure arisen... etc."
Vị này được hiểu là “có bản chất nhẫn chịu những cảm thọ đã khởi lên…v.v…”
Therassa kira rattiṃ padhānena vītināmetvā ṭhitassa udaravāto uppajji.
It is said that a wind in the stomach arose for the elder who had spent the night striving.
Nghe nói, sau khi vị Trưởng lão đã trải qua đêm với sự tinh tấn, một cơn đau bụng nổi lên.
So taṃ adhivāsetuṃ asakkonto āvattati parivattati.
Unable to endure it, he tossed and turned.
Vì không thể nhẫn chịu được, ngài lăn qua lăn lại.
Tamenaṃ caṅkamapasse ṭhito piṇḍapātiyatthero āha ‘‘āvuso, pabbajito nāma adhivāsanasīlo hotī’’ti.
The Piṇḍapātiya Elder, standing at the side of the walking path, said to him, "Friend, one who has gone forth should have the virtue of endurance."
Vị Trưởng lão Piṇḍapātiya đang đứng bên cạnh đường kinh hành nói với ngài: “Này hiền hữu, một người xuất gia phải có thói quen nhẫn chịu.”
So ‘‘sādhu, bhante’’ti adhivāsetvā niccalo sayi.
Saying, "Good, venerable sir," he endured and lay down motionless.
Ngài đáp: “Lành thay, bạch Tôn giả,” rồi nhẫn chịu và nằm yên bất động.
Vāto nābhito yāva hadayaṃ phāleti.
The wind tore from his navel up to his heart.
Cơn gió đau xé từ rốn lên đến tim.
Thero vedanaṃ vikkhambhetvā vipassanto muhuttena anāgāmī hutvā parinibbāyīti.
The elder, having suppressed the pain and practicing insight, in a moment became a non-returner and attained final Nibbāna.
Vị Trưởng lão đã vượt qua cảm thọ và quán chiếu, trong khoảnh khắc trở thành bậc Bất hoàn và nhập Niết Bàn.
Yañhissāti sītādīsu yaṃkiñci ekadhammampi assa.
Whatever for him: whatever single thing among cold and so on there might be for him.
Yañhissā (bất cứ điều gì có) nghĩa là bất kỳ một pháp nào, như lạnh, v.v., có ở vị ấy.
Anadhivāsayatoti anadhivāsentassa akkhamantassa.
From not enduring: for one who does not endure, who is not patient.
Anadhivāsayato (không nhẫn chịu) nghĩa là đối với người không nhẫn chịu, không chấp nhận.
Sesaṃ vuttanayameva.
The rest is in the way already stated.
Phần còn lại là theo cách đã nói.
Āsavuppatti panettha evaṃ veditabbā.
Here, the arising of the taints should be understood thus.
Ở đây, sự khởi lên của các lậu hoặc cần được hiểu như sau:
Sītena phuṭṭhassa uṇhaṃ patthayantassa kāmāsavo uppajjati, evaṃ sabbattha.
For one afflicted by cold who longs for heat, the taint of sensual pleasure arises; and so in all cases.
Đối với người bị lạnh chạm phải, mong muốn hơi ấm, lậu hoặc dục (kāmāsava) khởi lên; cũng vậy trong mọi trường hợp.
Natthi no sampattibhave sugatibhave sītaṃ vā uṇhaṃ vāti bhavaṃ patthayantassa bhavāsavo.
For one who longs for existence, thinking, "In a fortunate existence, in a good destination, there is no cold or heat for us," the taint of existence arises.
Đối với người mong muốn sự tồn tại (bhava) – “Chúng ta không có lạnh hay nóng trong đời sống hiện tại, trong cõi thiện lạc” – lậu hoặc hữu (bhavāsava) khởi lên.
Mayhaṃ sītaṃ uṇhanti gāho diṭṭhāsavo.
The grasping, "My cold, my heat," is the taint of views.
Sự chấp thủ “cái lạnh của tôi, cái nóng của tôi” là lậu hoặc kiến (diṭṭhāsava).
Sabbeheva sampayutto avijjāsavoti.
The taint of ignorance is associated with all of them.
Vô minh lậu hoặc (avijjāsava) liên hệ với tất cả các lậu hoặc trên.
‘‘Ime vuccanti…pe… adhivāsanā pahātabbā’’ti ime sītādīsu ekamekassa vasena cattāro cattāro katvā aneke āsavā imāya khantisaṃvarasaṅkhātāya adhivāsanāya pahātabbāti vuccantīti attho.
"These are called… etc.… to be abandoned by enduring": this means that these many taints—taking them as four for each case of cold and so on—are said to be abandoned by this enduring, which is called the restraint of patience.
“Những điều này được gọi là…v.v… phải được đoạn trừ bằng sự nhẫn chịu” (Ime vuccanti…pe… adhivāsanā pahātabbā) có nghĩa là những lậu hoặc vô số này, được chia thành bốn loại cho mỗi yếu tố như lạnh, v.v., được gọi là phải được đoạn trừ bằng sự nhẫn chịu, tức là sự tự kiềm chế bằng nhẫn nhục.
Ettha ca yasmā ayaṃ khanti sītādidhamme adhivāseti, attano upari āropetvā vāsetiyeva.
And here, because this patience endures things like cold, it places them upon oneself and lets them be.
Ở đây, cần hiểu rằng vì sự nhẫn nhục này chấp nhận các pháp như lạnh, v.v., và đặt chúng lên chính mình để chịu đựng.
Na asahamānā hutvā nirassati, tasmā ‘‘adhivāsanā’’ti vuccatīti veditabbā.
It does not reject them by being unable to bear them; therefore, it should be understood that it is called "enduring."
Nó không từ chối chúng vì không thể chịu đựng, do đó nó được gọi là “nhẫn chịu (adhivāsanā).”
25. Paṭisaṅkhā yoniso caṇḍaṃ hatthiṃ parivajjetīti ahaṃ samaṇoti caṇḍassa hatthissa āsanne na ṭhātabbaṃ.
25. Reflecting wisely, one avoids a fierce elephant: "I am a recluse; I should not stand near a fierce elephant.
25. Quán xét một cách khéo léo, tránh né con voi hung dữ (Paṭisaṅkhā yoniso caṇḍaṃ hatthiṃ parivajjeti) nghĩa là: “Ta là một sa-môn,” không nên đứng gần con voi hung dữ.
Tatonidānañhi maraṇampi siyā maraṇamattampi dukkhanti evaṃ upāyena pathena paccayena paccavekkhitvā caṇḍaṃ hatthiṃ parivajjeti paṭikkamati.
From that cause, there could be death, or pain equivalent to death." Thus reflecting with skillful means, method, and reason, one avoids a fierce elephant, one retreats.
Vì từ đó có thể dẫn đến cái chết hoặc sự đau khổ tương đương với cái chết; do đó, sau khi quán xét bằng phương tiện, con đường, nguyên nhân (như vậy), vị ấy tránh né, lùi xa con voi hung dữ.
Esa nayo sabbattha.
This is the method in all cases.
Nguyên tắc này cũng áp dụng cho mọi trường hợp.
Caṇḍanti ca duṭṭhaṃ, vāḷanti vuttaṃ hoti.
And fierce means vicious, savage is what is said.
Caṇḍa (hung dữ) có nghĩa là độc ác, hay nói cách khác là hoang dã.
Khāṇunti khadirakhāṇuādiṃ.
Stump: a stump of acacia wood, and so on.
Khāṇu (gốc cây) có nghĩa là gốc cây khadirā, v.v.
Kaṇṭakaṭṭhānanti kaṇṭakānaṃ ṭhānaṃ, yattha kaṇṭakā vijjanti, taṃ okāsanti vuttaṃ hoti.
A place of thorns: a place of thorns; where there are thorns, that location is what is meant.
Kaṇṭakaṭṭhāna (nơi có gai) có nghĩa là nơi có gai, nơi gai đâm, tức là nơi có nhiều gai.
Sobbhanti sabbato paricchinnataṭaṃ.
Chasm: a bank cut off on all sides.
Sobbha (hố sâu) có nghĩa là vực sâu có bờ bị cắt đứt từ mọi phía.
Papātanti ekato chinnataṭaṃ.
Precipice: a bank cut off on one side.
Papāta (vách đá) có nghĩa là vách đá có bờ bị cắt đứt từ một phía.
Candanikanti ucchiṭṭhodakagabbhamalādīnaṃ chaḍḍanaṭṭhānaṃ.
Cesspool: a place for disposing of leftover water, fetal matter, filth, and so on.
Candanika (nơi đổ rác) là nơi đổ nước rửa chén, chất thải thai nhi, v.v.
Oḷigallanti tesaṃyeva sakaddamādīnaṃ sandanokāsaṃ.
Sewer: a channel for the flow of these same things, such as mud.
Oḷigalla (rãnh thoát nước) là nơi những thứ đó chảy ra, có bùn, v.v.
Taṃ jaṇṇumattampi asucibharitaṃ hoti, dvepi cetāni ṭhānāni amanussaduṭṭhāni honti.
It can be knee-deep, filled with filth, and both these places are corrupted by non-human beings.
Nơi đó có thể ngập đầy chất bẩn đến đầu gối, và cả hai nơi này đều là những nơi bị phi nhân quấy phá.
Tasmā tāni vajjetabbāni.
Therefore, they should be avoided.
Do đó, chúng cần được tránh né.
Anāsaneti ettha pana ayuttaṃ āsanaṃ anāsanaṃ, taṃ atthato aniyatavatthukaṃ rahopaṭicchannāsananti veditabbaṃ.
In unsuitable seating, an unsuitable seat is unsuitable seating; by meaning, this should be understood as a seat in a secluded, hidden place, which is of an indeterminate nature.
Còn trong Anāsane (nơi không thích hợp), chỗ ngồi không thích hợp là anāsana, theo nghĩa đen là chỗ ngồi không cố định, chỗ ngồi kín đáo, ẩn khuất.
Agocareti etthapi ca ayutto gocaro agocaro, so vesiyādibhedato pañcavidho.
In unsuitable resort, an unsuitable resort is unsuitable resort; it is of five kinds, such as prostitutes.
Trong Agocare (nơi không thích hợp để đi khất thực), nơi khất thực không thích hợp là agocara, có năm loại, phân biệt theo các gái mại dâm, v.v.
Pāpake mitteti lāmake dussīle mittapatirūpake, amitte vā.
Evil friends: base, immoral people who are friends in appearance, or who are non-friends.
Pāpake mitte (bạn bè xấu) là những người bạn xấu, vô đạo đức, những kẻ giả vờ làm bạn, hoặc kẻ thù.
Bhajantanti sevamānaṃ.
Associating: serving, attending upon.
Bhajanta (kết giao) là người giao du.
Viññū sabrahmacārīti paṇḍitā buddhisampannā sabrahmacārayo, bhikkhūnametaṃ adhivacanaṃ.
Wise companions in the holy life: wise, intelligent companions in the holy life; this is a designation for bhikkhus.
Viññū sabrahmacārī (những vị đồng phạm hạnh có trí tuệ) là những vị đồng phạm hạnh thông thái, đầy trí tuệ; đây là tên gọi khác của các tỳ khưu.
Te hi ekakammaṃ ekuddeso samasikkhatāti imaṃ brahmaṃ samānaṃ caranti, tasmā sabrahmacārīti vuccanti.
Because they have the same kamma, the same recitation, and the same training, they fare together in this holy life; therefore, they are called companions in the holy life.
Họ thực hành đời sống Phạm hạnh giống nhau, có cùng hành động, cùng mục đích, cùng học giới, do đó họ được gọi là sabrahmacārī.
Pāpakesu ṭhānesūti lāmakesu ṭhānesu.
In evil situations: in base situations.
Pāpakesu ṭhānesu (ở những nơi xấu ác) là ở những nơi thấp kém.
Okappeyyunti saddaheyyuṃ, adhimucceyyuṃ ‘‘addhā ayamāyasmā akāsi vā karissati vā’’ti.
Would suspect: they would believe, they would be convinced, "Surely this venerable one has done it or will do it."
Okappeyyu (họ sẽ tin) nghĩa là họ sẽ tin tưởng, chấp nhận: “Chắc chắn vị Tôn giả này đã làm hoặc sẽ làm điều xấu.”
Yañhissāti hatthiādīsu yaṃkiñci ekampi assa.
Whatever for him: whatever single one among elephants and so on there might be for him.
Yañhissā (bất cứ điều gì có) nghĩa là bất kỳ một điều gì, như voi, v.v., có ở vị ấy.
Sesaṃ vuttanayameva.
The rest is in the way already stated.
Phần còn lại là theo cách đã nói.
Āsavuppatti panettha evaṃ veditabbā.
Here, the arising of the taints should be understood thus.
Ở đây, sự khởi lên của các lậu hoặc cần được hiểu như sau:
Hatthiādinidānena dukkhena phuṭṭhassa sukhaṃ patthayato kāmāsavo uppajjati.
For one afflicted by pain caused by an elephant or the like, who longs for pleasure, the taint of sensual pleasure arises.
Đối với người bị khổ đau do voi, v.v., chạm phải, mong muốn hạnh phúc, lậu hoặc dục (kāmāsava) khởi lên.
Natthi no sampattibhave sugatibhave īdisaṃ dukkhanti bhavaṃ patthentassa bhavāsavo.
For one who longs for existence, thinking, "In a fortunate existence, in a good destination, there is no such pain for us," the taint of existence arises.
Đối với người mong muốn sự tồn tại (bhava) – “Chúng ta không có khổ đau như vậy trong đời sống hiện tại, trong cõi thiện lạc” – lậu hoặc hữu (bhavāsava) khởi lên.
Maṃ hatthī maddati, maṃ assoti gāho diṭṭhāsavo.
The grasping, "An elephant is crushing me, a horse is crushing me," is the taint of views.
Sự chấp thủ “voi giẫm đạp tôi, ngựa đá tôi” là lậu hoặc kiến (diṭṭhāsava).
Sabbeheva sampayutto avijjāsavoti.
The taint of ignorance is associated with all of them.
Vô minh lậu hoặc (avijjāsava) liên hệ với tất cả các lậu hoặc trên.
Ettha ca kāmavitakkoti ‘‘yo kāmapaṭisaṃyutto takko vitakko micchāsaṅkappo’’ti vibhaṅge (vibha. 910) vutto.
Here, a thought of sensual pleasure is what is stated in the Vibhaṅga as "the initial thought, the sustained thought, the wrong intention which is connected with sensual pleasures."
Ở đây, kāmavitakka (ý nghĩ dục vọng) được định nghĩa trong Vibhaṅga (Vibha. 910) là “suy nghĩ, ý nghĩ, tà tư duy liên quan đến dục vọng.”
Esa nayo itaresu.
This is the method for the others.
Nguyên tắc này cũng áp dụng cho các loại khác.
Uppannuppanneti uppanne uppanne, uppannamatteyevāti vuttaṃ hoti.
Whenever they arise: means upon each arising, as soon as they have arisen.
Uppannuppanne (mỗi khi khởi lên) có nghĩa là mỗi khi nó khởi lên, tức là ngay khi nó vừa khởi lên.
Sakiṃ vā uppanne vinodetvā dutiyavāre ajjhupekkhitā na hoti, satakkhattumpi uppanne uppanne vinodetiyeva.
Or, having dispelled it when it arises once, one is not indifferent the second time; even if it arises a hundred times, one dispels it each time it arises.
Sau khi loại bỏ nó một lần, vị ấy không bỏ qua khi nó khởi lên lần thứ hai; mà mỗi khi nó khởi lên, dù là hàng trăm lần, vị ấy vẫn loại bỏ nó.
Pāpake akusaleti lāmakaṭṭhena pāpake, akosallatāya akusale.
Evil, unwholesome: evil in the sense of being base, unwholesome due to lack of skill.
Pāpake akusale (bất thiện xấu ác) nghĩa là xấu ác vì tính chất thấp kém, và bất thiện vì thiếu khéo léo.
Dhammeti teyeva kāmavitakkādayo sabbepi vā nava mahāvitakke.
In the dhammas refers to just those thoughts of sensual desire and so on, or alternatively, to all nine great thoughts.
Dhamme là chính những tầm dục (kāmavitakka) và các loại tương tự, hoặc là tất cả chín đại tầm (mahāvitakka).
Tattha tayo vuttā eva.
Among them, three have already been mentioned.
Trong đó, ba loại đã được đề cập rồi.
Avasesā ‘‘ñātivitakko janapadavitakko amaravitakko parānuddayatāpaṭisaṃyutto vitakko lābhasakkārasilokapaṭisaṃyutto vitakko anavaññattipaṭisaṃyutto vitakko’’ti (mahāni. 207) ime cha.
The remaining six are: "thought about relatives, thought about the country, thought connected with immortality, thought connected with compassion for others, thought connected with gain, honor, and fame, and thought connected with not being disdained."
Các loại còn lại là sáu loại này: "tầm về bà con (ñātivitakka), tầm về xứ sở (janapadavitakka), tầm về sự bất tử (amaravitakka), tầm liên quan đến lòng trắc ẩn đối với người khác (parānuddayatāpaṭisaṃyutto vitakka), tầm liên quan đến lợi lộc, sự tôn kính và danh tiếng (lābhasakkārasilokapaṭisaṃyutto vitakka), tầm liên quan đến sự không bị khinh miệt (anavaññattipaṭisaṃyutto vitakka)".
27. Paṭisaṅkhā yoniso satisambojjhaṅgaṃ bhāvetīti abhāvanāya ādīnavaṃ, bhāvanāya ca ānisaṃsaṃ upāyena pathena paccavekkhitvā satisambojjhaṅgaṃ bhāveti, esa nayo sabbattha.
27. Reflecting wisely, one develops the enlightenment factor of mindfulness means that after reflecting, by a skillful method, on the danger in not developing it and the benefit in developing it, one develops the enlightenment factor of mindfulness. This is the method in all cases.
27. Paṭisaṅkhā yoniso satisambojjhaṅgaṃ bhāvetī (Sau khi quán xét một cách có phương pháp, tu tập chi giác ngộ niệm) nghĩa là sau khi quán xét một cách có phương pháp về hiểm họa của sự không tu tập và lợi ích của sự tu tập, hành giả tu tập chi giác ngộ niệm (satisambojjhaṅga); đây là cách nói chung cho tất cả.
Ettha ca kiñcāpi ime uparimaggattayasamayasambhūtā lokuttarabojjhaṅgā eva adhippetā, tathāpi ādikammikānaṃ bojjhaṅgesu asammohatthaṃ lokiyalokuttaramissakena nesaṃ nayena atthavaṇṇanaṃ karissāmi.
And here, although it is these supramundane enlightenment factors that arise at the time of the three higher paths that are intended, still, for the sake of non-confusion about the enlightenment factors for beginners, I will explain their meaning by a method that mixes the mundane and supramundane.
Ở đây, mặc dù những chi giác ngộ siêu thế (lokuttarabojjhaṅga) phát sinh trong thời kỳ ba đạo quả trên là ý chính, nhưng để những người sơ cơ không bị nhầm lẫn về các chi giác ngộ, tôi sẽ giải thích ý nghĩa của chúng theo cách kết hợp cả thế gian và siêu thế.
Idha pana lokiyanayaṃ pahāya lokuttaranayo eva gahetabbo.
Here, however, the mundane method should be abandoned and only the supramundane method should be taken.
Tuy nhiên, ở đây, phải từ bỏ cách thế gian và chỉ chấp nhận cách siêu thế.
Tattha satisambojjhaṅgantiādinā nayena vuttānaṃ sattannaṃ ādipadānaṃyeva tāva –
Therein, first of all, for the seven initial terms spoken of in the manner of "the enlightenment factor of mindfulness," and so on—
Trong đó, trước hết là sự phân tích về ý nghĩa và các đặc tính của bảy từ đầu tiên được nói đến theo cách satisambojjhaṅgaṃ (chi giác ngộ niệm) và các loại tương tự:
Tattha satisambojjhaṅge tāva saraṇaṭṭhena sati.
Therein, in the case of the enlightenment factor of mindfulness, mindfulness is so-called in the sense of remembering.
Trong số đó, đối với chi giác ngộ niệm (satisambojjhaṅga), sati (niệm) có nghĩa là ghi nhớ (saraṇaṭṭhena).
Sā panesā upaṭṭhānalakkhaṇā, apilāpanalakkhaṇā vā.
It has the characteristic of establishment, or the characteristic of not floating away.
Niệm này có đặc tính là sự hiện diện (upaṭṭhānalakkhaṇā), hoặc là sự không quên lãng (apilāpanalakkhaṇā).
Vuttampi hetaṃ ‘‘yathā, mahārāja, rañño bhaṇḍāgāriko rañño sāpateyyaṃ apilāpeti, ettakaṃ, mahārāja, hiraññaṃ, ettakaṃ suvaṇṇaṃ, ettakaṃ sāpateyyanti, evameva kho, mahārāja, sati uppajjamānā kusalākusalasāvajjānavajjahīnapaṇītakaṇhasukkasappaṭibhāge dhamme apilāpeti.
For this has been said: "Just as, great king, the king's treasurer makes the king's property not float away, saying, ‘This much, great king, is the silver, this much the gold, this much the property,’ even so, great king, when mindfulness arises, it makes the wholesome and unwholesome, blameable and blameless, inferior and superior, dark and bright dhammas with their counterparts not float away.
Điều này cũng đã được nói: "Thưa Đại vương, giống như một người giữ kho của vua không làm mất tài sản của vua, nói: 'Thưa Đại vương, vàng bạc là chừng này, tài sản là chừng này', cũng vậy, thưa Đại vương, khi niệm phát sinh, nó không làm mất các pháp thiện, bất thiện, hữu tội, vô tội, thấp kém, cao thượng, đen tối, trong sáng, và các phần tương ứng.
Ime cattāro satipaṭṭhānā’’ti (mi. pa. 2.1.13) vitthāro.
These are the four establishments of mindfulness" and so on in detail.
Đây là bốn niệm xứ (satipaṭṭhāna)" – đây là phần giải thích chi tiết.
Apilāpanarasā.
It has the function of not floating away.
Niệm có chức năng là không quên lãng (apilāpanarasā).
Kiccavaseneva hissa etaṃ lakkhaṇaṃ therena vuttaṃ.
For this characteristic of it was stated by the elder simply in terms of its function.
Vì đặc tính này của nó đã được vị Trưởng lão nói đến theo chức năng của nó.
Asammosarasā vā.
Or, it has the function of non-confusion.
Hoặc có chức năng là không nhầm lẫn (asammosarasā).
Gocarābhimukhabhāvapaccupaṭṭhānā.
It has the manifestation of facing the object.
Sự hiện hữu của nó là hướng đến đối tượng (gocarābhimukhabhāvapaccupaṭṭhānā).
Sati eva sambojjhaṅgo satisambojjhaṅgo.
Mindfulness itself is an enlightenment factor, thus it is the enlightenment factor of mindfulness.
Niệm chính là chi giác ngộ (sambojjhaṅga), nên gọi là satisambojjhaṅgo (chi giác ngộ niệm).
Tattha bodhiyā bodhissa vā aṅgoti bojjhaṅgo.
Therein, it is a factor of enlightenment (bodhi) or of one who is enlightened (bodhi), thus it is an enlightenment factor (bojjhaṅga).
Trong đó, bojjhaṅgo (chi giác ngộ) là một chi phần của sự giác ngộ (bodhi) hoặc của người giác ngộ (bodhissa).
Kiṃ vuttaṃ hoti?
What is meant by this?
Ý nghĩa là gì?
Yā hi ayaṃ dhammasāmaggī, yāya lokiyalokuttaramaggakkhaṇe uppajjamānāya līnuddhaccapatiṭṭhānāyūhana-kāmasukhattakilamathānuyoga-ucchedasassatābhinivesādīnaṃ anekesaṃ upaddavānaṃ paṭipakkhabhūtāya satidhammavicayavīriyapītipassaddhisamādhiupekkhāsaṅkhātāya dhammasāmaggiyā ariyasāvako bujjhatīti katvā ‘‘bodhī’’ti vuccati.
This collection of dhammas—namely, the collection of dhammas called mindfulness, investigation-of-dhammas, energy, rapture, tranquility, concentration, and equanimity, which is opposed to numerous troubles such as torpor and restlessness, establishment and striving, indulgence in sensual pleasures and self-mortification, and adherence to annihilationism and eternalism—arising at the moment of the mundane or supramundane path, through which a noble disciple awakens, is called "enlightenment" (bodhi).
Đó là sự hòa hợp của các pháp này, mà khi phát sinh trong khoảnh khắc đạo thế gian và đạo siêu thế, đối nghịch với nhiều chướng ngại như sự trì trệ, phóng dật, sự trụ chấp, sự tích lũy, sự dính mắc vào dục lạc và khổ hạnh, sự chấp đoạn và chấp thường, v.v., tức là sự hòa hợp của các pháp được gọi là niệm (sati), trạch pháp (dhammavicaya), tinh tấn (vīriya), hỷ (pīti), khinh an (passaddhi), định (samādhi), xả (upekkhā), mà nhờ đó vị Thánh đệ tử giác ngộ, nên được gọi là bodhī (giác ngộ).
Bujjhatīti kilesasantānaniddāya uṭṭhahati, cattāri vā ariyasaccāni paṭivijjhati, nibbānameva vā sacchikarotīti vuttaṃ hoti.
Awakens means one rises from the sleep of the continuity of defilements, or one penetrates the Four Noble Truths, or one directly realizes Nibbāna itself.
Bujjhatī (giác ngộ) nghĩa là thức dậy khỏi giấc ngủ của dòng phiền não, hoặc thấu hiểu Tứ Thánh Đế, hoặc chứng ngộ Niết Bàn.
Yathāha ‘‘satta bojjhaṅge bhāvetvā anuttaraṃ sammāsambodhiṃ abhisambuddho’’ti.
As it is said: "Having developed the seven enlightenment factors, he fully awakened to the unsurpassed perfect enlightenment."
Như đã nói: "Sau khi tu tập bảy chi giác ngộ, Ngài đã chứng ngộ Vô thượng Chánh Đẳng Giác."
Tassā dhammasāmaggisaṅkhātāya bodhiyā aṅgotipi bojjhaṅgo, jhānaṅgamaggaṅgādayo viya.
It is a factor of that enlightenment (bodhi) called a collection of dhammas, thus it is an enlightenment factor (bojjhaṅga), just like the factors of jhāna, factors of the path, and so on.
Nó cũng là một chi phần của sự giác ngộ (bodhi) được gọi là sự hòa hợp của các pháp, giống như chi phần của thiền (jhānaṅga) và chi phần của đạo (maggaṅga), v.v.
Yopesa yathāvuttappakārāya etāya dhammasāmaggiyā bujjhatīti katvā ariyasāvako ‘‘bodhī’’ti vuccati, tassa bodhissa aṅgotipi bojjhaṅgo, senaṅgarathaṅgādayo viya.
And because this noble disciple awakens by means of this collection of dhammas of the kind just described, he is called "enlightened" (bodhi). It is a factor of that enlightened one (bodhi), thus it is an enlightenment factor (bojjhaṅga), just like the constituents of an army, the constituents of a chariot, and so on.
Vị Thánh đệ tử cũng được gọi là bodhī (người giác ngộ) vì vị ấy giác ngộ nhờ sự hòa hợp của các pháp như đã nói; nó cũng là một chi phần của người giác ngộ đó, giống như chi phần của quân đội (senaṅga) và chi phần của xe (rathaṅga), v.v.
Tenāhu aṭṭhakathācariyā ‘‘bujjhanakassa puggalassa aṅgāti vā bojjhaṅgā’’ti.
Therefore, the commentary masters said: "Or, they are factors of the person who is awakening, thus they are enlightenment factors."
Vì vậy, các vị Luận sư đã nói: "Hoặc là các chi phần của người giác ngộ, nên gọi là bojjhaṅgā."
Apica ‘‘bojjhaṅgāti kenaṭṭhena bojjhaṅgā?
Furthermore: "Enlightenment factors, in what sense are they enlightenment factors?
Hơn nữa, "Vì ý nghĩa nào mà các bojjhaṅgā được gọi là bojjhaṅgā?
Bodhāya saṃvattantīti bojjhaṅgā, bujjhantīti bojjhaṅgā, anubujjhantīti bojjhaṅgā, paṭibujjhantīti bojjhaṅgā, sambujjhantīti bojjhaṅgā’’tiādinā (paṭi. ma. 3.17) paṭisambhidānayenāpi attho veditabbo.
They lead to enlightenment, thus they are enlightenment factors; they awaken, thus they are enlightenment factors; they awaken in conformity, thus they are enlightenment factors; they awaken from sleep, thus they are enlightenment factors; they fully awaken, thus they are enlightenment factors." By this method from the Paṭisambhidā, the meaning should also be understood.
Vì chúng dẫn đến giác ngộ (bodhāya saṃvattanti) nên gọi là bojjhaṅgā; vì chúng giác ngộ (bujjhanti) nên gọi là bojjhaṅgā; vì chúng tùy giác ngộ (anubujjhanti) nên gọi là bojjhaṅgā; vì chúng tỉnh giác (paṭibujjhanti) nên gọi là bojjhaṅgā; vì chúng chánh giác (sambujjhanti) nên gọi là bojjhaṅgā" – ý nghĩa này cũng phải được hiểu theo cách của Paṭisambhidā (Phân tích đạo).
Pasattho sundaro vā bojjhaṅgoti sambojjhaṅgo.
A praiseworthy or beautiful enlightenment factor is a sambojjhaṅga.
Chi giác ngộ (bojjhaṅga) đáng ca ngợi hoặc tốt đẹp nên gọi là sambojjhaṅgo (chi giác ngộ hoàn toàn).
Evaṃ sati eva sambojjhaṅgo satisambojjhaṅgo.
Thus, mindfulness itself is an enlightenment factor (sambojjhaṅga), hence satisambojjhaṅga.
Như vậy, niệm (sati) chính là chi giác ngộ hoàn toàn (sambojjhaṅga), nên gọi là satisambojjhaṅgo (chi giác ngộ niệm).
Taṃ satisambojjhaṅgaṃ.
That enlightenment factor of mindfulness.
Đó là satisambojjhaṅgaṃ (chi giác ngộ niệm).
Evaṃ tāva ekassa ādipadassa atthato lakkhaṇādīhi ca vinicchayo viññātabbo.
In this way, the determination of one initial term should be understood by its meaning and by its characteristics, and so on.
Như vậy, sự phân tích về ý nghĩa và các đặc tính của một từ đầu tiên này phải được hiểu.
Dutiyādīsu pana catusaccadhamme vicinātīti dhammavicayo.
As for the second and subsequent terms, it investigates the dhammas of the Four Truths, thus it is investigation-of-dhammas.
Trong các từ thứ hai trở đi, dhammavicayo (trạch pháp) là sự phân tích các pháp Tứ Thánh Đế.
So pana vicayalakkhaṇo, obhāsanaraso, asammohapaccupaṭṭhāno.
It has the characteristic of investigation, the function of illuminating, and the manifestation of non-confusion.
Nó có đặc tính là sự phân tích, chức năng là làm sáng tỏ, và sự hiện hữu là không nhầm lẫn.
Vīrabhāvato vidhinā īrayitabbato ca vīriyaṃ.
Because of its heroic nature and because it is to be set in motion methodically, it is energy.
Vīriya (tinh tấn) là vì nó có tính chất dũng mãnh và phải được thúc đẩy một cách có phương pháp.
Taṃ paggahalakkhaṇaṃ, upatthambhanarasaṃ, anosīdanapaccupaṭṭhānaṃ.
It has the characteristic of exertion, the function of supporting, and the manifestation of non-subsiding.
Nó có đặc tính là sự nâng đỡ, chức năng là sự hỗ trợ, và sự hiện hữu là không chán nản.
Pīṇayatīti pīti.
It pleases, thus it is rapture.
Pīti (hỷ) là sự làm cho hoan hỷ.
Sā pharaṇalakkhaṇā, tuṭṭhilakkhaṇā vā, kāyacittānaṃ pīṇanarasā, tesaṃyeva odagyapaccupaṭṭhānā.
It has the characteristic of suffusion or the characteristic of delight, the function of nourishing the body and mind, and the manifestation of their elation.
Nó có đặc tính là sự lan tỏa hoặc đặc tính là sự vui thích, chức năng là làm cho thân và tâm hoan hỷ, và sự hiện hữu là sự phấn khởi của chính chúng.
Kāyacittadarathapassambhanato passaddhi.
From the calming of distress of body and mind, it is tranquility.
Passaddhi (khinh an) là sự làm cho thân và tâm được an tịnh.
Sā upasamalakkhaṇā, kāyacittadarathanimmaddanarasā, āyacittānaṃ aparipphandanabhūtasītibhāvapaccupaṭṭhānā.
It has the characteristic of appeasement, the function of crushing the distress of body and mind, and the manifestation of the unagitated, cool state of body and mind.
Nó có đặc tính là sự an tịnh, chức năng là làm dịu sự bứt rứt của thân và tâm, và sự hiện hữu là sự không dao động, sự mát mẻ của thân và tâm.
Samādhānato samādhi.
From composing, it is concentration.
Samādhi (định) là sự định tâm.
So avikkhepalakkhaṇo, avisāralakkhaṇo vā, cittacetasikānaṃ sampiṇḍanaraso, cittaṭṭhitipaccupaṭṭhāno.
It has the characteristic of non-distraction or the characteristic of non-diffusion, the function of unifying the mind and mental factors, and the manifestation of mental stability.
Nó có đặc tính là không tán loạn hoặc đặc tính là không phân tán, chức năng là sự tập trung các tâm sở và tâm, và sự hiện hữu là sự an trụ của tâm.
Ajjhupekkhanato upekkhā.
From looking on with equanimity, it is equanimity.
Upekkhā (xả) là sự thờ ơ.
Sā paṭisaṅkhānalakkhaṇā, samavāhitalakkhaṇā vā, ūnādhikatānivāraṇarasā, pakkhapātupacchedarasā vā, majjhattabhāvapaccupaṭṭhānā.
It has the characteristic of reflecting or the characteristic of carrying evenly, the function of preventing deficiency and excess, or the function of cutting off partiality, and the manifestation of neutrality.
Nó có đặc tính là sự quán xét hoặc đặc tính là sự cân bằng, chức năng là ngăn chặn sự thiếu sót hoặc quá mức, hoặc chức năng là cắt đứt sự thiên vị, và sự hiện hữu là sự trung lập.
Sesaṃ vuttanayameva.
The rest is as has been explained.
Phần còn lại cũng theo cách đã nói.
Evaṃ sesapadānampi atthato lakkhaṇādīhi ca vinicchayo viññātabbo.
In this way, the determination of the remaining terms should also be understood by their meaning and by their characteristics, and so on.
Như vậy, sự phân tích về ý nghĩa và các đặc tính của các từ còn lại cũng phải được hiểu.
Kamatoti ettha ca ‘‘satiñca khvāhaṃ, bhikkhave, sabbatthikaṃ vadāmī’’ti (saṃ. ni. 5.234) vacanato sabbesaṃ sesabojjhaṅgānaṃ upakārakattā satisambojjhaṅgova paṭhamaṃ vutto.
By order: Here, because it is said, "And I, bhikkhus, declare mindfulness to be useful everywhere," the enlightenment factor of mindfulness is mentioned first because it is beneficial to all the other enlightenment factors.
Trong phần kamato (theo thứ tự) này, chi giác ngộ niệm (satisambojjhaṅga) được nói đến đầu tiên vì nó là yếu tố hỗ trợ cho tất cả các chi giác ngộ còn lại, theo lời dạy: "Này các Tỳ-khưu, Ta nói niệm là cần thiết trong mọi trường hợp."
Tato paraṃ ‘‘so tathā sato viharanto taṃ dhammaṃ paññāya pavicinatī’’tiādinā (vibha. 469) nayena sesabojjhaṅgānaṃ pubbāpariyavacane payojanaṃ sutteyeva vuttaṃ.
After that, the purpose in the sequential mention of the other enlightenment factors is stated in the Sutta itself, by the method of "dwelling thus mindful, he investigates that dhamma with wisdom," and so on.
Sau đó, mục đích của việc trình bày thứ tự trước sau của các chi giác ngộ còn lại đã được nói đến trong chính kinh, theo cách: "Vị ấy sống chánh niệm như vậy, dùng trí tuệ để phân tích pháp ấy," v.v.
Evamettha kamatopi vinicchayo viññātabbo.
Thus, the determination by order should also be understood here.
Như vậy, sự phân tích theo thứ tự cũng phải được hiểu ở đây.
Anūnādhikatoti kasmā pana bhagavatā satteva bojjhaṅgā vuttā anūnā anadhikāti.
By being neither deficient nor excessive: Now, why were exactly seven enlightenment factors stated by the Blessed One, no less and no more?
Anūnādhikato (không thiếu không thừa) – tại sao Đức Thế Tôn chỉ nói đến bảy chi giác ngộ, không thiếu không thừa?
Līnuddhaccapaṭipakkhato sabbatthikato ca.
Because they are opposed to torpor and restlessness, and because of being universally useful.
Vì chúng đối trị với sự trì trệ và phóng dật, và vì chúng cần thiết trong mọi trường hợp.
Ettha hi tayo bojjhaṅgā līnassa paṭipakkhā.
Here, three enlightenment factors are opposed to torpor.
Ở đây, ba chi giác ngộ đối trị với sự trì trệ.
Yathāha – ‘‘yasmiñca kho, bhikkhave, samaye līnaṃ cittaṃ hoti, kālo tasmiṃ samaye dhammavicayasambojjhaṅgassa bhāvanāya, kālo vīriyasambojjhaṅgassa bhāvanāya, kālo pītisambojjhaṅgassa bhāvanāyā’’ti (saṃ. ni. 5.234).
As it is said: "And, bhikkhus, at a time when the mind is sluggish, that is the right time for the development of the enlightenment factor of investigation-of-dhammas, the right time for the development of the enlightenment factor of energy, the right time for the development of the enlightenment factor of rapture."
Như đã nói: "Này các Tỳ-khưu, khi tâm trì trệ, đó là lúc tu tập chi giác ngộ trạch pháp, lúc tu tập chi giác ngộ tinh tấn, lúc tu tập chi giác ngộ hỷ."
Tayo uddhaccassa paṭipakkhā.
Three are opposed to restlessness.
Ba chi đối trị với sự phóng dật.
Yathāha – ‘‘yasmiñca kho, bhikkhave, samaye uddhataṃ cittaṃ hoti, kālo tasmiṃ samaye passaddhisambojjhaṅgassa bhāvanāya, kālo samādhisambojjhaṅgassa bhāvanāya, kālo upekkhāsambojjhaṅgassa bhāvanāyā’’ti (saṃ. ni. 5.234).
As was said: “And when, monks, the mind is restless, that is the time for the development of the tranquility enlightenment-factor, the time for the development of the concentration enlightenment-factor, the time for the development of the equanimity enlightenment-factor.”
Như đã nói: ‘‘Này các Tỳ-khưu, vào lúc nào đó, khi tâm bị phóng dật, đó là lúc để tu tập Passaddhisambojjhaṅga (Khinh an giác chi), là lúc để tu tập Samādhisambojjhaṅga (Định giác chi), là lúc để tu tập Upekkhāsambojjhaṅga (Xả giác chi).’’
Eko panettha sabbatthiko.
One among them is applicable everywhere.
Trong số đó, có một giác chi là phổ dụng.
Yathāha – ‘‘satiñca khvāhaṃ, bhikkhave, sabbatthikaṃ vadāmī’’ti.
As was said: “And mindfulness, monks, I say is applicable everywhere.”
Như đã nói: ‘‘Này các Tỳ-khưu, Ta nói niệm là phổ dụng.’’
‘‘Sabbatthaka’’ntipi pāṭho, dvinnampi sabbattha icchitabbanti attho.
There is also the reading sabbatthakaṃ; the meaning for both is that it is desired in all situations.
Cũng có bản đọc là ‘‘Sabbatthaka’’, nghĩa là cả hai (sabbatthika và sabbatthaka) đều được mong muốn ở mọi nơi.
Evaṃ līnuddhaccapaṭipakkhato sabbatthikato ca satteva bojjhaṅgā vuttā anūnā anadhikāti, evamettha anūnādhikatopi vinicchayo viññātabbo.
Thus, because they are counterparts to sloth and restlessness and because one is applicable everywhere, only seven enlightenment-factors are stated, neither fewer nor more. In this way, the determination as to their being neither fewer nor more should be understood here.
Như vậy, do là đối nghịch của tâm hôn trầm và phóng dật, và do là phổ dụng, chỉ có bảy giác chi được nói đến, không thiếu cũng không thừa. Quyết định về việc không thiếu không thừa cũng cần được hiểu theo cách này.
Evaṃ tāva ‘‘satisambojjhaṅga’’ntiādinā nayena vuttānaṃ sattannaṃ ādipadānaṃyeva atthavaṇṇanaṃ ñatvā idāni bhāveti vivekanissitantiādīsu evaṃ ñātabbā.
Having thus first understood the explanation of the meaning of only the initial words of the seven spoken in the manner of “the enlightenment-factor of mindfulness,” etc., now, regarding “develops, based on seclusion,” etc., it should be understood thus.
Sau khi đã hiểu ý nghĩa của bảy từ đầu tiên được nói đến theo cách ‘‘Satisambojjhaṅga’’ (Niệm giác chi) và các từ tương tự, bây giờ cần hiểu theo cách này trong các câu ‘‘Bhāveti vivekanissitaṃ’’ (tu tập nương vào sự viễn ly) và các câu khác.
Bhāvetīti vaḍḍheti, attano cittasantāne punappunaṃ janeti abhinibbattetīti attho.
Develops means increases, repeatedly generates and produces it in one's own mental continuum.
Bhāvetī có nghĩa là phát triển, tức là liên tục tạo ra và làm phát sinh trong dòng tâm thức của mình.
Vivekanissitanti viveke nissitaṃ.
Based on seclusion means based in seclusion.
Vivekanissitaṃ có nghĩa là nương tựa vào sự viễn ly (viveka).
Vivekoti vivittatā.
Seclusion means seclusion.
Viveka có nghĩa là sự viễn ly.
Svāyaṃ tadaṅgaviveko vikkhambhanasamucchedapaṭippassaddhi nissaraṇavivekoti pañcavidho.
This is of five kinds: seclusion by substitution of opposites, seclusion by suppression, seclusion by cutting off, seclusion by tranquilization, and seclusion by escape.
Sự viễn ly này có năm loại: tadaṅgaviveka (viễn ly từng phần), vikkhambhanaviveka (viễn ly bằng cách trấn áp), samucchedaviveka (viễn ly bằng cách đoạn diệt), paṭippassaddhiviveka (viễn ly bằng cách an tịnh), và nissaraṇaviveka (viễn ly bằng cách xuất ly).
Tassa nānattaṃ ‘‘ariyadhamme avinīto’’ti ettha vuttanayeneva veditabbaṃ.
Its diversity should be understood in the same way as was stated in the section on “one who is untrained in the noble Dhamma.”
Sự khác biệt của nó cần được hiểu theo cách đã nói trong câu ‘‘ariyadhamme avinīto’’ (không được huấn luyện trong Pháp cao thượng).
Ayameva hi tattha vinayoti vutto.
For this very thing was called discipline there.
Chính sự viễn ly này được gọi là sự huấn luyện (vinaya) ở đó.
Evaṃ etasmiṃ pañcavidhe viveke.
Thus, in this fivefold seclusion.
Như vậy, trong năm loại viễn ly này.
Vivekanissitanti tadaṅgavivekanissitaṃ samucchedavivekanissitaṃ nissaraṇavivekanissitañca satisambojjhaṅgaṃ bhāvetīti ayamattho veditabbo.
Based on seclusion: this meaning should be understood as: one develops the enlightenment-factor of mindfulness based on seclusion by substitution of opposites, based on seclusion by cutting off, and based on seclusion by escape.
Vivekanissitaṃ có nghĩa là tu tập Niệm giác chi nương vào tadaṅgaviveka, nương vào samucchedaviveka và nương vào nissaraṇaviveka. Đây là ý nghĩa cần được hiểu.
Tathā hi ayaṃ bojjhaṅgabhāvanānuyutto yogī vipassanākkhaṇe kiccato tadaṅgavivekanissitaṃ, ajjhāsayato nissaraṇavivekanissitaṃ, maggakāle pana kiccato samucchedavivekanissitaṃ, ārammaṇato nissaraṇavivekanissitaṃ satisambojjhaṅgaṃ bhāveti.
For this yogī, dedicated to developing the enlightenment-factors, at the moment of insight, develops the enlightenment-factor of mindfulness based on seclusion by substitution of opposites in terms of function and based on seclusion by escape in terms of intention. But at the time of the path, he develops it based on seclusion by cutting off in terms of function and based on seclusion by escape in terms of the object.
Thật vậy, vị hành giả chuyên tâm tu tập giác chi này, vào lúc quán (vipassanā), về mặt công năng thì nương vào tadaṅgaviveka, về mặt ý định thì nương vào nissaraṇaviveka. Còn vào lúc đạo (magga), về mặt công năng thì nương vào samucchedaviveka, về mặt đối tượng thì nương vào nissaraṇaviveka mà tu tập Niệm giác chi.
Pañcavidhavivekanissitantipi eke, te hi na kevalaṃ balavavipassanāmaggaphalakkhaṇesu eva bojjhaṅge uddharanti, vipassanāpādakakasiṇajjhānaānāpānāsubhabrahmavihārajjhānesupi uddharanti.
Some say, “based on the fivefold seclusion.” They do not extract the enlightenment-factors only at the stages of strong insight, path, and fruition, but also extract them in the jhānas of kasiṇa, mindfulness of breathing, foulness, and the divine abidings, which are the basis for insight.
Một số người nói rằng nó nương vào năm loại viễn ly. Vì họ không chỉ phát triển các giác chi vào lúc vipassanā, đạo và quả mạnh mẽ, mà còn phát triển chúng trong các thiền chỉ (jhāna) như kasiṇa (biến xứ), ānāpāna (hơi thở vào ra), asubha (bất tịnh) và brahmavihāra (Phạm trú) làm nền tảng cho vipassanā.
Na ca paṭisiddhā aṭṭhakathācariyehi.
And this is not rejected by the commentary masters.
Và các vị Aṭṭhakathācariya (Sớ giải sư) cũng không bác bỏ điều đó.
Tasmā tesaṃ matena etesaṃ jhānānaṃ pavattikkhaṇe kiccato eva vikkhambhanavivekanissitaṃ.
Therefore, according to their opinion, at the moment of occurrence of these jhānas, it is based on seclusion by suppression in terms of function.
Do đó, theo quan điểm của họ, vào lúc các thiền chỉ này phát sinh, về mặt công năng, nó nương vào vikkhambhanaviveka.
Yathā ca ‘‘vipassanākkhaṇe ajjhāsayato nissaraṇavivekanissita’’nti vuttaṃ, evaṃ paṭippassaddhivivekanissitampi bhāvetīti vattuṃ vaṭṭati.
And just as it was said, “at the moment of insight, based on seclusion by escape in terms of intention,” so too it is proper to say that one develops it based on seclusion by tranquilization.
Và như đã nói ‘‘vào lúc vipassanā, về mặt ý định thì nương vào nissaraṇaviveka’’, thì cũng có thể nói rằng nó tu tập nương vào paṭippassaddhiviveka.
Esa nayo virāganissitādīsu.
This is the method for based on dispassion, etc.
Cách này cũng áp dụng cho virāganissita (nương vào sự ly tham) và các giác chi khác.
Vivekaṭṭhā eva hi virāgādayo.
For dispassion and the others have the same meaning as seclusion.
Vì viveka (viễn ly), virāga (ly tham) và các từ khác đều có cùng ý nghĩa.
Kevalañhettha vossaggo duvidho pariccāgavossaggo ca pakkhandanavossaggo cāti.
Here, however, relinquishment is twofold: relinquishment as abandoning and relinquishment as plunging into.
Tuy nhiên, ở đây, vossagga (sự xả bỏ) có hai loại: pariccāgavossagga (sự xả bỏ bằng cách từ bỏ) và pakkhandanavossagga (sự xả bỏ bằng cách hướng đến).
Tattha pariccāgavossaggoti vipassanākkhaṇe ca tadaṅgavasena, maggakkhaṇe ca samucchedavasena kilesappahānaṃ.
Therein, relinquishment as abandoning is the abandoning of defilements at the moment of insight by way of substitution of opposites, and at the moment of the path by way of cutting off.
Trong đó, pariccāgavossagga là sự đoạn trừ các phiền não, vào lúc quán (vipassanā) thì theo cách tadaṅga (từng phần), và vào lúc đạo (magga) thì theo cách samuccheda (đoạn diệt).
Pakkhandanavossaggoti vipassanākkhaṇe tanninnabhāvena, maggakkhaṇe pana ārammaṇakaraṇena nibbānapakkhandanaṃ.
Relinquishment as plunging into is the plunging into Nibbāna at the moment of insight by being inclined toward it, and at the moment of the path by making it the object.
Pakkhandanavossagga là sự hướng đến Nibbāna, vào lúc quán (vipassanā) thì theo khuynh hướng hướng đến Nibbāna, và vào lúc đạo (magga) thì bằng cách lấy Nibbāna làm đối tượng.
Tadubhayampi imasmiṃ lokiyalokuttaramissake atthavaṇṇanānaye vaṭṭati.
Both of these are suitable in this explanatory method that mixes the mundane and the supramundane.
Cả hai điều này đều phù hợp trong cách giải thích ý nghĩa pha trộn giữa thế gian và xuất thế gian này.
Tathā hi ayaṃ satisambojjhaṅgo yathāvuttena pakārena kilese pariccajati, nibbānañca pakkhandati.
For this enlightenment-factor of mindfulness abandons defilements and plunges into Nibbāna in the way stated.
Thật vậy, Niệm giác chi này theo cách đã nói, từ bỏ các phiền não và hướng đến Nibbāna.
Vossaggapariṇāminti iminā pana sakalena vacanena vossaggattaṃ pariṇamantaṃ pariṇatañca paripaccantaṃ paripakkañcāti.
By the entire phrase maturing in relinquishment, it means maturing toward relinquishment, being matured, ripening, and being ripened.
Còn với toàn bộ cụm từ Vossaggapariṇāmiṃ, có nghĩa là sự xả bỏ đang chuyển hóa, đã chuyển hóa, đang chín muồi và đã chín muồi.
Idaṃ vuttaṃ hoti ‘‘ayañhi bojjhaṅgabhāvanānuyutto bhikkhu yathā satisambojjhaṅgo kilesapariccāgavossaggattaṃ nibbānapakkhandanavossaggattañca paripaccati, yathā ca paripakko hoti, tathā naṃ bhāvetī’’ti.
This is what is meant: “This bhikkhu, dedicated to developing the enlightenment-factors, develops the enlightenment-factor of mindfulness in such a way that it ripens toward the state of relinquishment as abandoning defilements and the state of relinquishment as plunging into Nibbāna, and in such a way that it becomes ripened.”
Điều này có nghĩa là: ‘‘Vị Tỳ-khưu chuyên tâm tu tập giác chi này, tu tập Niệm giác chi theo cách mà sự xả bỏ phiền não và sự hướng đến Nibbāna chín muồi, và đã chín muồi.’’
Esa nayo sesabojjhaṅgesu.
This is the method for the remaining enlightenment-factors.
Cách này cũng áp dụng cho các giác chi còn lại.
Idha pana nibbānaṃyeva sabbasaṅkhatehi vivittattā viveko, sabbesaṃ virāgabhāvato virāgo, nirodhabhāvato nirodhoti vuttaṃ.
Here, however, Nibbāna itself is called seclusion because it is secluded from all conditioned things, dispassion because it is the dispassion from all things, and cessation because it is the cessation of them.
Ở đây, Nibbāna được gọi là viveka (viễn ly) vì nó viễn ly khỏi tất cả các pháp hữu vi, là virāga (ly tham) vì nó là sự ly tham khỏi tất cả, và là nirodha (diệt) vì nó là sự diệt của tất cả.
Maggo eva ca vossaggapariṇāmī, tasmā satisambojjhaṅgaṃ bhāveti vivekaṃ ārammaṇaṃ katvā pavattiyā vivekanissitaṃ.
The path itself matures in relinquishment. Therefore, one develops the enlightenment-factor of mindfulness that is based on seclusion due to its arising with seclusion as its object.
Và chính đạo là vossaggapariṇāmī (chuyển hóa thành sự xả bỏ). Do đó, tu tập Niệm giác chi nương vào viveka (viễn ly) bằng cách lấy viveka làm đối tượng trong sự vận hành.
Tathā virāganissitaṃ nirodhanissitaṃ.
Likewise, based on dispassion and based on cessation.
Cũng vậy, nương vào virāga (ly tham) và nương vào nirodha (diệt).
Tañca kho ariyamaggakkhaṇuppattiyā kilesānaṃ samucchedato pariccāgabhāvena ca nibbānapakkhandanabhāvena ca pariṇataṃ paripakkanti ayameva attho daṭṭhabbo.
And this very meaning should be seen: that it has matured and ripened at the moment of the arising of the noble path through the abandoning by cutting off defilements and through the plunging into Nibbāna.
Và điều đó, vào lúc phát sinh của Thánh đạo, do sự đoạn diệt các phiền não, do tính chất từ bỏ và do tính chất hướng đến Nibbāna, đã chuyển hóa và chín muồi. Chính ý nghĩa này cần được hiểu.
Esa nayo sesabojjhaṅgesu.
This is the method for the remaining enlightenment-factors.
Cách này cũng áp dụng cho các giác chi còn lại.
28. Idāni imehi sattahākārehi pahīnāsavaṃ bhikkhuṃ thomento āsavappahāne cassa ānisaṃsaṃ dassento eteheva ca kāraṇehi āsavappahāne sattānaṃ ussukkaṃ janento yato kho, bhikkhave…pe… antamakāsi dukkhassāti āha.
Now, praising the bhikkhu who has abandoned the cankers through these seven methods, and showing the benefit in his abandoning of the cankers, and also by these same reasons generating diligence in beings for the abandoning of the cankers, he said: When, monks… he has made an end of suffering.
Bây giờ, để tán thán vị Tỳ-khưu đã đoạn trừ các lậu hoặc bằng bảy cách này, và để chỉ ra lợi ích của việc đoạn trừ lậu hoặc của vị ấy, đồng thời để khích lệ chúng sinh nỗ lực đoạn trừ lậu hoặc bằng chính những lý do này, Đức Phật đã nói: ‘‘Yato kho, bhikkhave…pe… antamakāsi dukkhassā’’ (Này các Tỳ-khưu, khi nào…pe… đã chấm dứt khổ đau).
Tattha yato khoti sāmivacane tokāro, yassa khoti vuttaṃ hoti.
Therein, when has the particle to in the genitive sense; it means “of whom.”
Trong đó, yato kho là từ có ý nghĩa sở hữu cách, tức là ‘‘của ai’’.
Porāṇā pana yasmiṃ kāleti vaṇṇayanti.
The ancients, however, explain it as “at which time.”
Tuy nhiên, các bậc cổ đức giải thích là ‘‘vào lúc nào’’.
Ye āsavā dassanā pahātabbāti ye āsavā dassanena pahātabbā, te dassaneneva pahīnā honti, na appahīnesuyeva pahīnasaññī hoti.
The cankers that are to be abandoned by seeing: the cankers that are to be abandoned by seeing are abandoned by seeing itself; one does not perceive them as abandoned when they are not yet abandoned.
Ye āsavā dassanā pahātabbā có nghĩa là những lậu hoặc nào cần được đoạn trừ bằng sự thấy (Dassanā), thì chúng đã được đoạn trừ bằng sự thấy. Vị ấy không có tưởng rằng đã đoạn trừ những lậu hoặc chưa được đoạn trừ.
Evaṃ sabbattha vitthāro.
The detailed explanation is similar in all cases.
Cách giải thích chi tiết này cũng áp dụng cho tất cả các trường hợp khác.
Sabbāsavasaṃvarasaṃvutoti sabbehi āsavapidhānehi pihito, sabbesaṃ vā āsavānaṃ pidhānehi pihito.
Restrained by the restraint of all cankers means he is covered by all coverings of the cankers, or covered by the coverings of all cankers.
Sabbāsavasaṃvarasaṃvuto có nghĩa là được che chắn bởi tất cả các sự ngăn chặn lậu hoặc, hoặc được che chắn bởi sự ngăn chặn tất cả các lậu hoặc.
Acchecchi taṇhanti sabbampi taṇhaṃ chindi, saṃchindi samucchindi.
He cut off craving means he severed, completely severed, and cut off all craving.
Acchecchi taṇhaṃ có nghĩa là đã cắt đứt tất cả ái dục, đã cắt đứt hoàn toàn, đã đoạn diệt.
Vivattayi saṃyojananti dasavidhampi saṃyojanaṃ parivattayi nimmalamakāsi.
He turned away the fetter means he turned around the tenfold fetter, he made it stainless.
Vivattayi saṃyojanaṃ có nghĩa là đã loại bỏ, đã làm cho thanh tịnh tất cả mười loại kiết sử.
Sammāti hetunā kāraṇena.
Rightly means by reason, by cause.
Sammā có nghĩa là đúng cách, đúng lý do.
Mānābhisamayāti mānassa dassanābhisamayā pahānābhisamayā ca.
Through the full understanding of conceit means through the full understanding of conceit by seeing and by abandoning.
Mānābhisamayā có nghĩa là do sự chứng ngộ về kiêu mạn, tức là sự thấy (dassanābhisamaya) và sự đoạn trừ (pahānābhisamaya) kiêu mạn.
Arahattamaggo hi kiccavasena mānaṃ passati, ayamassa dassanābhisamayo.
For the path of arahantship sees conceit in terms of its function; this is its full understanding by seeing.
Thật vậy, đạo A-la-hán, về mặt công năng, thấy được kiêu mạn. Đây là sự chứng ngộ bằng sự thấy của nó.
Tena diṭṭho pana so tāvadeva pahīyati diṭṭhavisena diṭṭhasattānaṃ jīvitaṃ viya.
And once seen by it, conceit is abandoned at that very moment, just as the life of beings is ended when seen by a snake with venom in its eyes.
Và kiêu mạn đã được thấy bởi đạo đó sẽ được đoạn trừ ngay lập tức, giống như mạng sống của những chúng sinh bị rắn cắn đã được nhìn thấy.
Ayamassa pahānābhisamayo.
This is its full understanding by abandoning.
Đây là sự chứng ngộ bằng sự đoạn trừ của nó.
Antamakāsi dukkhassāti evaṃ arahattamaggena sammā mānassa diṭṭhattā pahīnattā ca ye ime ‘‘kāyabandhanassa anto jīrati (cūḷava. 278).
He has made an end of suffering means that, because conceit was rightly seen and abandoned by the path of arahantship, those things such as “the end of the physical bondage wastes away”
Antamakāsi dukkhassā có nghĩa là do kiêu mạn đã được thấy và đoạn trừ đúng cách bằng đạo A-la-hán, nên những điều này ‘‘sự ràng buộc của thân thể đã mục nát.
Haritantaṃ vā’’ti (ma. ni. 1.304) evaṃ vuttaantimamariyādanto ca, ‘‘antamidaṃ, bhikkhave, jīvikāna’’nti (itivu. 91; saṃ. ni. 3.80) evaṃ vuttalāmakanto ca, ‘‘sakkāyo eko anto’’ti (a. ni. 6.61) evaṃ vuttakoṭṭhāsanto ca, ‘‘esevanto dukkhassa sabbapaccayasaṅkhayā’’ti (saṃ. ni. 2.51) evaṃ vuttakoṭanto cāti evaṃ cattāro antā, tesu sabbasseva vaṭṭadukkhassa antaṃ catutthakoṭisaṅkhātaṃ antimakoṭisaṅkhātaṃ antamakāsi paricchedaṃ parivaṭumaṃ akāsi.
Just as it is said, “or to green grass,” which refers to the final boundary; and as it is said, “Monks, this is the lowest of livelihoods,” which refers to the lowest end; and as it is said, “Identity-view is one extreme,” which refers to the end as a portion; and as it is said, “This is the end of suffering, with the cessation of all conditions,” which refers to the end as a cessation—thus there are these four ends. Among them, he made an end to all the suffering of the cycle of rebirth, an end designated as the fourth part, the final part; he made a demarcation, a complete encircling.
Hoặc là “cỏ xanh” như vậy (Ma. Ni. 1.304) là một loại giới hạn cuối cùng, và “này các Tỳ-kheo, đây là sự cùng tận của các phương tiện sinh sống” (Itivu. 91; Saṃ. Ni. 3.80) là một loại giới hạn thấp kém, và “sakkāya là một giới hạn” (A. Ni. 6.61) là một loại giới hạn của phần, và “đây là sự chấm dứt khổ đau do sự diệt tận của mọi duyên” (Saṃ. Ni. 2.51) là một loại giới hạn của điểm cuối. Như vậy có bốn giới hạn. Trong số đó, vị ấy đã chấm dứt tất cả khổ đau trong vòng luân hồi, tức là đã tạo ra một sự chấm dứt, một sự đoạn tuyệt, một sự kết thúc được gọi là điểm cuối thứ tư.
Antimasamussayamattāvasesaṃ dukkhaṃ akāsīti vuttaṃ hoti.
It is said that he made the suffering remain only as the final physical frame.
Có nghĩa là vị ấy đã làm cho khổ đau chỉ còn lại sự tồn tại cuối cùng.
29. Evaṃ me sutanti dhammadāyādasuttaṃ.
29. Thus have I heard—this is the Dhammadāyāda Sutta.
29. Evaṃ me sutaṃ là Kinh Dhammadāyāda.
Yasmā panassa aṭṭhuppattiko nikkhepo, tasmā taṃ dassetvā vassa apubbapadavaṇṇanaṃ karissāma.
And since its exposition is based on an occasion of utterance, we will first show that occasion and then provide the commentary on its unprecedented words.
Vì nó có một phần giới thiệu về nguyên nhân xuất hiện, nên chúng tôi sẽ trình bày phần đó trước rồi sau đó sẽ giải thích các từ ngữ chưa từng được giải thích.
Katarāya ca panidaṃ aṭṭhuppattiyā nikkhittanti.
On what occasion, then, was this discourse delivered?
Vậy thì kinh này được trình bày dựa trên nguyên nhân xuất hiện nào?
Lābhasakkāre.
On the occasion of gains and honor.
Đó là do sự lợi lộc và kính trọng.
Bhagavato kira mahālābhasakkāro uppajji.
It is said that great gains and honor arose for the Blessed One.
Được biết, Đức Thế Tôn đã nhận được sự lợi lộc và kính trọng lớn lao.
Yathā taṃ cattāro asaṅkhyeyye pūritadānapāramīsañcayassa.
This was as befitting one who had an accumulation of the perfection of giving fulfilled over four incalculable aeons.
Như một người đã hoàn thành ba-la-mật bố thí trong bốn A-tăng-kỳ kiếp.
Sabbadisāsu yamakamahāmegho vuṭṭhahitvā mahoghaṃ viya sabbapāramiyo ekasmiṃ attabhāve vipākaṃ dassāmāti sampiṇḍitā viya lābhasakkāramahoghaṃ nibbattayiṃsu.
Just as a great twin-cloud, having arisen in all directions, would resemble a great flood, so too all the perfections, as if gathered together with the thought, “We will give our result in this one existence,” produced a great flood of gains and honor.
Tất cả các ba-la-mật, như một trận mưa lớn song hành từ mọi hướng đổ xuống thành một dòng lũ lớn, dường như đã hợp lại để cho quả trong một đời sống, tạo ra một dòng lũ lớn của lợi lộc và kính trọng.
Tato tato annapānayānavatthamālāgandhavilepanādihatthā khattiyabrāhmaṇādayo āgantvā – ‘‘kahaṃ buddho, kahaṃ bhagavā, kahaṃ devadevo, narāsabho, purisasīho’’ti bhagavantaṃ pariyesanti.
From all directions, Khattiyas, Brahmins, and others came with food, drinks, vehicles, clothing, garlands, perfumes, and ointments in their hands, searching for the Blessed One, asking, “Where is the Buddha? Where is the Blessed One? Where is the deva of devas, the bull of men, the lion of men?”
Từ khắp nơi, các vị vua chúa, Bà-la-môn, v.v., mang theo thức ăn, nước uống, xe cộ, y phục, vòng hoa, hương liệu, dầu xức, v.v., đến và tìm Đức Thế Tôn, hỏi: “Đức Phật ở đâu? Đức Thế Tôn ở đâu? Vị Thiên Trung Thiên, bậc Nhân Trung Tôn, Sư tử giữa loài người ở đâu?”
Sakaṭasatehipi paccaye āharitvā okāsaṃ alabhamānā samantā gāvutappamāṇampi sakaṭadhurena sakaṭadhuramāhaccatiṭṭhanti ceva anubandhanti ca.
Even after bringing requisites by the hundreds of cartloads, they could not find an opportunity to offer them and stood with cart yokes touching cart yokes, covering a distance of a gāvuta all around, and they followed along.
Ngay cả khi mang theo hàng trăm cỗ xe đầy vật phẩm, họ cũng không tìm được chỗ để dâng cúng, mà phải đứng chen chúc nhau, xe nối xe, trong phạm vi một gāvuta (khoảng 1/4 yojana) xung quanh, và tiếp tục đi theo Ngài.
Andhakavindabrāhmaṇādayo viya.
Like the Brahmins of Andhakavinda and others.
Giống như các Bà-la-môn ở Andhakavinda và những người khác.
Sabbaṃ khandhake tesu tesu suttesu ca āgatanayeneva veditabbaṃ.
Everything should be understood in the manner stated in the Khandhakas and in various suttas.
Tất cả những điều này cần được hiểu theo cách đã được trình bày trong các Khandhaka và trong các kinh khác nhau.
Yathā ca bhagavato, evaṃ bhikkhusaṅghassāpi.
And just as for the Blessed One, so it was for the Saṅgha of monks.
Và không chỉ Đức Thế Tôn, mà Tăng đoàn cũng vậy.
Vuttampi cetaṃ – ‘‘tena kho pana samayena bhagavā sakkato hoti garukato mānito pūjito apacito lābhī cīvarapiṇḍapātasenāsanagilānapaccayabhesajjaparikkhārānaṃ, bhikkhusaṅghopi kho sakkato hoti…pe… parikkhārāna’’nti (udā. 14).
And this has been said: “At that time, the Blessed One was respected, revered, esteemed, honored, and venerated, a recipient of robes, alms-food, lodging, and medicinal requisites for the sick. The Saṅgha of monks was also respected... and so on... a recipient of requisites.”
Điều này cũng đã được nói: “Vào thời điểm đó, Đức Thế Tôn được tôn kính, được trọng vọng, được kính mến, được cúng dường, được tôn trọng, được lợi lộc về y phục, vật thực khất thực, chỗ ở, thuốc men trị bệnh, các vật dụng cần thiết. Tăng đoàn cũng được tôn kính… (v.v.)… các vật dụng cần thiết.” (Udā. 14).
Tathā – ‘‘yāvatā kho, cunda, etarahi saṅgho vā gaṇo vā loke uppanno, nāhaṃ, cunda, aññaṃ ekasaṅghampi samanupassāmi, evaṃ lābhaggayasaggapattaṃ, yathariva, cunda, bhikkhusaṅgho’’ti (dī. ni. 3.176).
Likewise: “Cunda, of all the communities or groups that have now arisen in the world, I do not see a single other community, Cunda, that has reached such a pinnacle of gain and fame as has the Saṅgha of monks.”
Cũng vậy: “Này Cunda, trong số các hội chúng hay đoàn thể đã xuất hiện trên thế gian này, ta không thấy một hội chúng nào khác đạt được sự lợi lộc và danh tiếng cao tột như Tăng đoàn, này Cunda.” (Dī. Ni. 3.176).
Svāyaṃ bhagavato ca bhikkhusaṅghassa ca uppanno lābhasakkāro ekato hutvā dvinnaṃ mahānadīnaṃ udakamiva appameyyo ahosi.
These gains and honor that arose for the Blessed One and the Saṅgha of monks, having come together, became immeasurable, like the water of two great rivers.
Sự lợi lộc và kính trọng phát sinh cho Đức Thế Tôn và Tăng đoàn đã hợp lại, trở thành vô lượng, như nước của hai con sông lớn.
Kamena bhikkhū paccayagarukā paccayabāhulikā ahesuṃ.
Gradually, the monks became attached to requisites and indulgent in requisites.
Dần dần, các Tỳ-kheo trở nên coi trọng vật phẩm và có nhiều vật phẩm.
Pacchābhattampi telamadhuphāṇitādīsu āhaṭesu gaṇḍiṃyeva paharitvā ‘‘amhākaṃ ācariyassa detha, upajjhāyassa dethā’’ti uccāsaddamahāsaddaṃ karonti.
Even after the meal, when things like oil, honey, and molasses were brought, they would just strike the gong and make a loud and great noise, shouting, “Give some to our teacher! Give some to our preceptor!”
Ngay cả sau bữa ăn, khi dầu, mật, đường thốt nốt, v.v., được mang đến, họ chỉ gõ vào chuông và la lớn: “Hãy dâng cho vị A-xà-lê của chúng tôi, hãy dâng cho vị Upajjhāya của chúng tôi!”
Sā ca nesaṃ pavatti bhagavatopi pākaṭā ahosi.
And this behavior of theirs became known to the Blessed One.
Hành vi đó của họ cũng đã rõ ràng đối với Đức Thế Tôn.
Tato bhagavā ananucchavikanti dhammasaṃvegaṃ uppādetvā cintesi –
Then the Blessed One, feeling a sense of spiritual urgency, thinking, “This is not appropriate,” reflected:
Sau đó, Đức Thế Tôn, nhận thấy điều đó không phù hợp, đã khởi lên sự xúc động về Dhamma và suy nghĩ:
‘‘Paccayā akappiyāti na sakkā sikkhāpadaṃ paññapetuṃ.
“It is not possible to lay down a training rule that requisites are improper.
“Không thể chế định một giới luật rằng các vật phẩm là không hợp lệ.
Paccayapaṭibaddhā hi kulaputtānaṃ samaṇadhammavutti.
For the life of the holy practice for sons of good family is dependent on requisites.
Vì cuộc sống tu hành của các thiện nam tử phụ thuộc vào vật phẩm.
Handāhaṃ dhammadāyādapaṭipadaṃ desemi.
Let me now teach the practice of being heirs to the Dhamma.
Vậy ta sẽ thuyết giảng con đường thừa kế Dhamma (Dhammadāyādapaṭipadā).
Sā sikkhākāmānaṃ kulaputtānaṃ sikkhāpadapaññatti viya bhavissati nagaradvāre ṭhapitasabbakāyikaādāso viya ca, yathā hi nagaradvāre ṭhapite sabbakāyike ādāse cattāro vaṇṇā attano chāyaṃ disvā vajjaṃ pahāya niddosā honti, evameva sikkhākāmā kulaputtā payogamaṇḍanena attānaṃ maṇḍetukāmā imaṃ sabbakāyikādāsūpamaṃ desanaṃ āvajjitvā āmisadāyādapaṭipadaṃ vajjetvā dhammadāyādapaṭipadaṃ pūrentā khippameva jātijarāmaraṇassa antaṃ karissantī’’ti.
For sons of good family who are keen on the training, this will be like the laying down of a training rule and like a full-length mirror placed at a city gate. For just as when a full-length mirror is placed at a city gate, people of the four castes see their own reflection, abandon their blemishes, and become faultless, in the same way, sons of good family who are keen on the training, desiring to adorn themselves with the ornament of yogic practice, reflecting on this teaching that is like a full-length mirror, will avoid the practice of being heirs to material things and fulfill the practice of being heirs to the Dhamma, and will quickly make an end of birth, aging, and death.”
Con đường đó sẽ như một giới luật được chế định cho các thiện nam tử muốn tu học, và như một tấm gương toàn thân được đặt ở cổng thành. Giống như khi một tấm gương toàn thân được đặt ở cổng thành, bốn giai cấp nhìn thấy hình ảnh của mình, loại bỏ khuyết điểm và trở nên không tì vết, cũng vậy, các thiện nam tử muốn tu học, muốn trang điểm cho mình bằng sự nỗ lực, sẽ quán chiếu giáo pháp này, ví như tấm gương toàn thân, từ bỏ con đường thừa kế vật chất (āmisadāyādapaṭipadā), và hoàn thành con đường thừa kế Dhamma (dhammadāyādapaṭipadaṃ), họ sẽ nhanh chóng chấm dứt sinh, già, chết.”
Imissā aṭṭhuppattiyā idaṃ suttaṃ abhāsi.
Because of this occasion of utterance, he delivered this sutta.
Kinh này được thuyết giảng dựa trên nguyên nhân xuất hiện đó.
Tattha dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādāti dhammassa me dāyādā, bhikkhave, bhavatha, mā āmisassa.
Therein, “Monks, be my heirs in the Dhamma, not heirs in material things” means, “Monks, be heirs to my Dhamma, not to material things.”
Trong đó, dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā có nghĩa là: “Này các Tỳ-kheo, hãy là người thừa kế Dhamma của Ta, đừng là người thừa kế vật chất (āmisa) của Ta.”
Yo mayhaṃ dhammo, tassa paṭiggāhakā bhavatha, yañca kho mayhaṃ āmisaṃ, tassa mā paṭiggāhakā bhavathāti vuttaṃ hoti.
The meaning is: “Be inheritors of my Dhamma; do not be inheritors of my material things.”
Có nghĩa là: “Hãy là người tiếp nhận Dhamma của Ta, nhưng đừng là người tiếp nhận vật chất của Ta.”
Tattha dhammopi duvidho – nippariyāyadhammo, pariyāyadhammoti.
Therein, the Dhamma is twofold: the Dhamma in the ultimate sense and the Dhamma in a relative sense.
Trong đó, Dhamma cũng có hai loại: nippariyāya-dhamma (Dhamma trực tiếp, tối hậu) và pariyāya-dhamma (Dhamma gián tiếp, phương tiện).
Āmisampi duvidhaṃ – nippariyāyāmisaṃ, pariyāyāmisanti.
Material things are also twofold: material things in the ultimate sense and material things in a relative sense.
Vật chất (āmisa) cũng có hai loại: nippariyāya-āmisa (vật chất trực tiếp) và pariyāya-āmisa (vật chất gián tiếp).
Maggaphalanibbānabhedo hi navavidhopi lokuttaradhammo nippariyāyadhammo nibbattitadhammo, na yena kenaci pariyāyena kāraṇena vā lesena vā dhammo.
The ninefold supramundane Dhamma, comprising the paths, fruits, and Nibbāna, is the Dhamma in the ultimate sense. It is the Dhamma that has been produced; it is not the Dhamma in any relative sense, by way of any reason or pretext.
Chín loại Dhamma siêu thế (lokuttara-dhamma), tức là Đạo, Quả và Nibbāna, là nippariyāya-dhamma, là Dhamma đã được thành tựu, không phải là Dhamma do bất kỳ phương tiện, nguyên nhân hay cách thức nào.
Yaṃ panidaṃ vivaṭṭūpanissitaṃ kusalaṃ, seyyathidaṃ, idhekacco vivaṭṭaṃ patthento dānaṃ deti, sīlaṃ samādiyati, uposathakammaṃ karoti, gandhamālādīhi vatthupūjaṃ karoti, dhammaṃ suṇāti deseti jhānasamāpattiyo nibbatteti, evaṃ karonto anupubbena nippariyāyadhammaṃ amataṃ nibbānaṃ paṭilabhati, ayaṃ pariyāyadhammo.
But as for that wholesome state that is conducive to the unbinding—namely, when someone here, aspiring for the unbinding, gives gifts, undertakes the moral precepts, observes the Uposatha, performs offerings to the sacred objects with perfumes, garlands, and so on, listens to and teaches the Dhamma, and produces the jhānas and attainments; by doing so, one gradually attains the Dhamma in the ultimate sense, the deathless Nibbāna—this is the Dhamma in a relative sense.
Còn điều thiện này, dựa trên sự thoát ly (vivaṭṭa), như có người ở đây, mong cầu sự thoát ly, bố thí, thọ trì giới, thực hành uposatha, cúng dường hoa hương, v.v., nghe pháp, thuyết pháp, thành tựu các thiền định và các định, khi làm như vậy, dần dần đạt được Nibbāna bất tử, tức là nippariyāya-dhamma, thì đây là pariyāya-dhamma.
Tathā cīvarādayo cattāro paccayā nippariyāyāmisameva, na aññena pariyāyena kāraṇena vā lesena vā āmisaṃ.
Similarly, the four requisites, such as robes, are material things in the ultimate sense; they are not material things in any other relative sense, by way of any reason or pretext.
Cũng vậy, bốn vật phẩm như y phục, v.v., là nippariyāya-āmisa (vật chất trực tiếp), không phải là āmisa do bất kỳ phương tiện, nguyên nhân hay cách thức nào khác.
Yaṃ panidaṃ vaṭṭagāmikusalaṃ, seyyathidaṃ, idhekacco vaṭṭaṃ patthento sampattibhavaṃ icchamāno dānaṃ deti…pe… samāpattiyo nibbatteti, evaṃ karonto anupubbena devamanussasampattiṃ paṭilabhati, idaṃ pariyāyāmisaṃnāma.
But as for that wholesome state that leads to the cycle of rebirth—namely, when someone here, aspiring for the cycle of rebirth, desiring a state of fortunate existence, gives gifts... and so on... produces the attainments; by doing so, one gradually attains fortunate states among devas and humans—this is called material things in a relative sense.
Còn điều thiện này dẫn đến vòng luân hồi (vaṭṭagāmikusalaṃ), như có người ở đây, mong cầu vòng luân hồi, mong muốn sự thành tựu của các cõi, bố thí… (v.v.)… thành tựu các thiền định và các định, khi làm như vậy, dần dần đạt được sự thành tựu của chư thiên và loài người, thì đây gọi là pariyāya-āmisa (vật chất gián tiếp).
Tattha nippariyāyadhammopi bhagavatoyeva santako.
Therein, the Dhamma in the ultimate sense also belongs to the Blessed One.
Trong đó, nippariyāya-dhamma cũng thuộc về Đức Thế Tôn.
Bhagavatā hi kathitattā bhikkhū maggaphalanibbānāni adhigacchanti.
For it is because it was taught by the Blessed One that monks realize the paths, fruits, and Nibbāna.
Vì do Đức Thế Tôn đã thuyết giảng mà các Tỳ-kheo đạt được Đạo, Quả và Nibbāna.
Vuttampi cetaṃ ‘‘so hi brāhmaṇa bhagavā anuppannassa maggassa uppādetā, asañjātassa maggassa sañjanetā, anakkhātassa maggassa akkhātā, maggaññū maggavidū maggakovido.
And this has been said: “For that Blessed One, Brahmin, is the producer of the unarisen path, the generator of the unoriginated path, the declarer of the undeclared path. He is the knower of the path, the discoverer of the path, the one skilled in the path.”
Điều này cũng đã được nói: “Này Bà-la-môn, Đức Thế Tôn là Đấng làm phát sinh con đường chưa từng phát sinh, là Đấng làm cho con đường chưa từng hiện hữu được hiện hữu, là Đấng thuyết giảng con đường chưa từng được thuyết giảng, là Đấng biết con đường, là Đấng thông thạo con đường, là Đấng thiện xảo về con đường.”
Maggānugā ca pana etarahi sāvakā viharanti pacchā samannāgatā’’ti (ma. ni. 3.79) ca – ‘‘so hāvuso, bhagavā jānaṃ jānāti, passaṃ passati cakkhubhūto ñāṇabhūto dhammabhūto brahmabhūto vattā pavattā atthassa ninnetā amatassa dātā dhammassāmī tathāgato’’ti (ma. ni. 1.203) ca.
And, “And now, venerable sir, the disciples dwell following the path, endowed with it afterwards.” And, “For that Blessed One, friends, knowing, knows; seeing, sees. He is the Eye, he is the Knowledge, he is the Dhamma, he is the Brahmā; the proclaimer, the expounder, the leader to the goal, the giver of the deathless, the Lord of the Dhamma, the Tathāgata.”
Và ‘này các Tỳ-khưu, các đệ tử hiện nay đang sống theo con đường đã được thiết lập sau này’ – và ‘này hiền giả, Thế Tôn ấy biết những gì cần biết, thấy những gì cần thấy, Ngài là mắt, là trí, là Pháp, là Phạm thiên, là người nói, người thuyết, người dẫn dắt đến mục đích, người ban tặng bất tử, là Chủ của Pháp, là Như Lai’.
Pariyāyadhammopi bhagavatoyeva santako.
The pariyāya-dhamma also belongs to the Blessed One.
Pháp hữu vi (pariyāyadhamma) cũng thuộc về Thế Tôn.
Bhagavatā hi kathitattā evaṃ jānanti ‘‘vivaṭṭaṃ patthetvā dānaṃ dento…pe… samāpattiyo nibbattento anukkamena amataṃ nibbānaṃ paṭilabhatī’’ti.
For it is because it was taught by the Blessed One that they know thus: “One who gives a gift desiring that which is free from the round… and so on… who produces attainments, in due course obtains the deathless, Nibbāna.”
Vì được Thế Tôn thuyết giảng, họ biết rằng: “Người bố thí với mong muốn thoát khỏi luân hồi… (v.v.)… người phát sinh các thiền định sẽ tuần tự đạt được Niết Bàn bất tử.”
Nippariyāyāmisampi ca bhagavatoyeva santakaṃ.
And the nippariyāya-āmisa also belongs to the Blessed One.
Và vật chất vô vi (nippariyāyāmisa) cũng thuộc về Thế Tôn.
Bhagavatā hi anuññātattāyeva bhikkhūhi jīvakavatthuṃ ādiṃ katvā paṇītacīvaraṃ laddhaṃ.
For it was only because it was permitted by the Blessed One that the bhikkhus received fine robes, beginning with the case of Jīvaka.
Vì được Thế Tôn cho phép, các Tỳ-khưu đã nhận được y phục cao cấp, bắt đầu từ câu chuyện của Jīvaka.
Yathāha ‘‘anujānāmi, bhikkhave, gahapaticīvaraṃ.
As he said: “I allow, bhikkhus, a householder’s robe.
Như Ngài đã nói: “Này các Tỳ-khưu, Ta cho phép y phục của gia chủ.
Yo icchati, paṃsukūliko hotu, yo icchati, gahapaticīvaraṃ sādiyatu.
Whoever wishes, let him be a wearer of refuse-rag robes; whoever wishes, let him accept a householder’s robe.
Ai muốn, hãy là người mặc y phấn tảo; ai muốn, hãy chấp nhận y phục của gia chủ.
Itarītarenapāhaṃ, bhikkhave, santuṭṭhiṃyeva vaṇṇemī’’ti (mahāva. 337).
In either case, bhikkhus, I praise only contentment.”
Này các Tỳ-khưu, Ta ca ngợi sự tri túc với bất cứ thứ gì có được.”
Pubbe ca bhikkhū paṇītapiṇḍapātaṃ nālatthuṃ.
And formerly, bhikkhus did not get fine almsfood.
Trước đây, các Tỳ-khưu không nhận được những bữa ăn khất thực cao cấp.
Sapadānapiṇḍiyālopabhojanā evāhesuṃ.
They were only eaters of lumps of food collected on an uninterrupted alms-round.
Họ chỉ ăn những bữa khất thực từng nắm một theo thứ tự.
Tehi rājagahe viharantena bhagavatā – ‘‘anujānāmi, bhikkhave, saṅghabhattaṃ uddesabhattaṃ nimantanaṃ salākabhattaṃ pakkhikaṃ uposathikaṃ pāṭipadika’’nti (cūḷava. 325) evaṃ anuññātattāyeva paṇītabhojanaṃ laddhaṃ.
It was only because it was permitted by the Blessed One dwelling in Rājagaha in this way—“I allow, bhikkhus, a meal for the Saṅgha, a meal by designation, an invitation, a meal by ticket, a fortnightly meal, an Uposatha-day meal, and a first-day-of-the-fortnight meal”—that they received fine food.
Vì được Thế Tôn cho phép khi Ngài trú tại Rājagaha, với lời dạy: “Này các Tỳ-khưu, Ta cho phép bữa ăn của Tăng, bữa ăn chỉ định, bữa ăn được mời, bữa ăn bằng phiếu, bữa ăn nửa tháng, bữa ăn ngày Uposatha, bữa ăn ngày đầu tháng,” nên họ đã nhận được những bữa ăn cao cấp.
Tathā senāsanaṃ.
Similarly for lodgings.
Cũng vậy đối với chỗ ở.
Pubbe hi akatapabbhārarukkhamūlādisenāsanāyeva bhikkhū ahesuṃ.
For formerly, bhikkhus had only lodgings such as unprepared rock-clefts and the roots of trees.
Trước đây, các Tỳ-khưu chỉ có chỗ ở dưới gốc cây không có mái che, v.v.
Te ‘‘anujānāmi, bhikkhave, pañca leṇānī’’ti (cūḷava. 294) evaṃ bhagavatā anuññātattāyeva vihāro aḍḍhayogo pāsādo hammiyaṃ guhāti imāni senāsanāni labhiṃsu.
It was only because it was permitted by the Blessed One in this way—“I allow, bhikkhus, five kinds of dwellings”—that they received these lodgings: a monastery, a gabled house, a long-house, a mansion, and a cave.
Vì được Thế Tôn cho phép với lời dạy: “Này các Tỳ-khưu, Ta cho phép năm loại trú xứ,” nên họ đã nhận được các loại chỗ ở này: tịnh xá (vihāra), nhà nửa mái (aḍḍhayoga), lầu (pāsāda), nhà gác (hammiya), và hang động (guhā).
Pubbe ca muttaharītakeneva bhesajjaṃ akaṃsu.
And formerly, they made medicine only with fermented myrobalan fruit.
Trước đây, họ chỉ dùng thuốc là quả harīṭaka ngâm nước tiểu bò.
Te bhagavatāyeva – ‘‘anujānāmi, bhikkhave, pañca bhesajjāni, seyyathidaṃ, sappi, navanītaṃ, telaṃ, madhu, phāṇita’’nti (mahāva. 260) evamādinā nayena anuññātattā nānābhesajjāni labhiṃsu.
It was only because it was permitted by the Blessed One in this way—“I allow, bhikkhus, five medicines, that is: ghee, fresh butter, oil, honey, and molasses”—that they received various medicines.
Vì được Thế Tôn cho phép theo cách này: “Này các Tỳ-khưu, Ta cho phép năm loại thuốc, đó là: bơ, bơ tươi, dầu, mật, và đường thô,” nên họ đã nhận được nhiều loại thuốc khác nhau.
Pariyāyāmisampi bhagavatoyeva santakaṃ.
The pariyāya-āmisa also belongs to the Blessed One.
Vật chất hữu vi (pariyāyāmisa) cũng thuộc về Thế Tôn.
Bhagavatā hi kathitattā yeva jānanti – ‘‘sampattibhavaṃ patthento dānaṃ datvā sīlaṃ…pe… samāpattiyo nibbattetvā anukkamena pariyāyāmisaṃ dibbasampattiṃ manussasampattiṃ paṭilabhatī’’ti.
For it is only because it was taught by the Blessed One that they know: “One who desires an existence of good fortune, having given a gift, having undertaken the precepts… and so on… having produced the attainments, in due course obtains the pariyāya-āmisa of divine fortune and human fortune.”
Vì được Thế Tôn thuyết giảng, họ biết rằng: “Người bố thí với mong muốn tái sinh tốt đẹp, giữ giới… (v.v.)… phát sinh các thiền định, sẽ tuần tự đạt được sự thịnh vượng của chư thiên và sự thịnh vượng của loài người, là vật chất hữu vi.”
Tadeva, yasmā nippariyāyadhammopi pariyāyadhammopi nippariyāyāmisampi pariyāyāmisampi bhagavatoyeva santakaṃ, tasmā tattha attano sāmibhāvaṃ dassento āha – ‘‘dhammadāyādā me, bhikkhave, bhavatha mā āmisadāyādā’’ti.
Therefore, because the nippariyāya-dhamma, the pariyāya-dhamma, the nippariyāya-āmisa, and the pariyāya-āmisa all belong to the Blessed One, he said—“Be my heirs in Dhamma, bhikkhus, not my heirs in material things”—to show his own mastery over them.
Do đó, vì cả Pháp vô vi, Pháp hữu vi, vật chất vô vi và vật chất hữu vi đều thuộc về Thế Tôn, nên để thể hiện quyền sở hữu của mình đối với những điều đó, Ngài nói: “Này các Tỳ-khưu, hãy là những người thừa tự Pháp của Ta, đừng là những người thừa tự vật chất.”
Yo mayhaṃ santako duvidhopi dhammo, tassa dāyādā bhavatha.
Be heirs to that twofold Dhamma which is mine.
Ý nghĩa của điều này là: Hãy là những người thừa tự của hai loại Pháp thuộc về Ta.
Yañca kho etaṃ mayhameva santakaṃ āmisaṃ, tassa dāyādā mā bhavatha.
Do not be heirs to that material thing which is also mine.
Nhưng đừng là những người thừa tự của vật chất thuộc về Ta.
Dhammakoṭṭhāsasseva sāmino bhavatha, mā āmisakoṭṭhāsassa.
Be masters of the portion of Dhamma, not of the portion of material things.
Hãy là chủ nhân của phần Pháp, đừng là chủ nhân của phần vật chất.
Yo hi jinasāsane pabbajitvā paccayaparamo viharati catūsu taṇhuppādesu sandissamāno nikkhittadhuro dhammānudhammappaṭipattiyaṃ, ayaṃ āmisadāyādo nāma.
For one who, having gone forth in the Victor’s Dispensation, dwells with requisites as his highest aim, being seen in the four sources of craving, having laid down the yoke in the practice in accordance with the Dhamma, is called an heir in material things.
Thật vậy, người xuất gia trong giáo pháp của Đấng Chiến Thắng mà sống chỉ quan tâm đến vật chất, bị ràng buộc bởi bốn nguyên nhân phát sinh tham ái, bỏ gánh thực hành Pháp và tùy Pháp, người này được gọi là người thừa tự vật chất (āmisadāyāda).
Tādisā mā bhavatha.
Do not be like that.
Các con đừng trở thành những người như vậy.
Yo pana anuññātapaccayesu appicchatādīni nissāya paṭisaṅkhā sevamāno paṭipattiparamo viharati catūsu ariyavaṃsesu sandissamāno, ayaṃ dhammadāyādo nāma.
But one who, relying on fewness of wishes and so on regarding the permitted requisites, uses them with reflection and dwells with the practice as his highest aim, being seen in the four noble lineages, is called an heir in Dhamma.
Còn người sống thực hành tối thượng, nương vào sự ít dục, v.v., đối với các vật chất được cho phép, quán xét mà sử dụng, hiển hiện trong bốn Thánh chủng, người này được gọi là người thừa tự Pháp (dhammadāyāda).
Tādisā bhavathāti vuttaṃ hoti.
The meaning is: be like that.
Điều đó có nghĩa là: Hãy trở thành những người như vậy.
Tassāyamattho – atthi me tumhesu anukampā anuddayā hitesitā, kena nu kho kāraṇena kena upāyena sāvakā dhammadāyādā assu dhammakoṭṭhāsasāmino, no āmisadāyādāti.
This is its meaning: I have compassion, sympathy, and a desire for the welfare of you all, thinking: “By what reason, by what means, might my disciples be heirs in Dhamma, masters of the portion of Dhamma, and not heirs in material things?”
Ý nghĩa của điều này là: Ta có lòng thương xót, từ bi, và mong muốn lợi ích cho các con. Bằng lý do nào, bằng phương tiện nào mà các đệ tử có thể trở thành những người thừa tự Pháp, chủ nhân của phần Pháp, chứ không phải là những người thừa tự vật chất?
Ayaṃ pana adhippāyo, passati kira bhagavā āmisagarukānaṃ āmise upakkhalitānaṃ atītakāle tāva kapilassa bhikkhuno, ‘‘saṅghāṭipi ādittā hotī’’tiādinā (pārā. 230; saṃ. ni. 2.218) nayena āgatapāpabhikkhubhikkhunīsikkhamānādīnañca anekasatānaṃ apāyaparipūraṇattaṃ attano sāsane pabbajitānañca devadattādīnaṃ.
This, however, is the intention: The Blessed One sees, it is said, that those who are devoted to material things and who have stumbled over material things—such as the bhikkhu Kapila in the past, and hundreds of evil bhikkhus, bhikkhunīs, female probationers, and others mentioned in the passage beginning, “Even the outer robe would be ablaze”—fill the lower realms; and likewise Devadatta and others who have gone forth in his Dispensation.
Đây là ý nghĩa: Thế Tôn thấy rằng trong quá khứ, những Tỳ-khưu nặng về vật chất, vướng mắc vào vật chất, như Tỳ-khưu Kapilā, đã phải chịu sự đọa lạc vào các cõi khổ, như đã nói: “Y Tăng-già-lê cũng bị cháy,” và hàng trăm Tỳ-khưu, Tỳ-khưu-ni, Sa-di-ni, v.v., xấu ác đã phải lấp đầy các cõi khổ, cũng như Devadatta và những người khác đã xuất gia trong giáo pháp của Ngài.
Dhammagarukānaṃ pana sāriputtamoggallānamahākassapādīnaṃ abhiññāpaṭisambhidādiguṇappaṭilābhaṃ.
But he sees the attainment of qualities such as the supernormal knowledges and analytical knowledges by those devoted to the Dhamma, such as Sāriputta, Moggallāna, and Mahākassapa.
Ngài cũng thấy rằng những người nặng về Pháp, như Sāriputta, Moggallāna, Mahākassapa, v.v., đã đạt được các phẩm chất như thần thông và phân tích pháp.
Tasmā tesaṃ apāyā parimuttiṃ sabbaguṇasampattiñca icchanto āha – ‘‘atthi me tumhesu anukampā kinti me sāvakā dhammadāyādā bhaveyyuṃ, no āmisadāyādā’’ti.
Therefore, desiring their release from the lower realms and the full possession of all qualities, he said: “I have compassion for you. How might my disciples become heirs in Dhamma, not heirs in material things?”
Vì vậy, mong muốn họ thoát khỏi các cõi khổ và đạt được mọi phẩm chất tốt đẹp, Ngài nói: “Ta có lòng thương xót đối với các con, mong sao các đệ tử của Ta sẽ là những người thừa tự Pháp, chứ không phải là những người thừa tự vật chất.”
Paccayagaruko ca catuparisantare kūṭakahāpaṇo viya nibbutaṅgāro viya ca nittejo nippabho hoti.
And one who is devoted to requisites is without majesty and without splendor in the midst of the four assemblies, like a counterfeit coin or like an extinguished ember.
Và người nặng về vật chất thì giống như đồng tiền giả giữa bốn chúng hội, giống như than đã tắt, không còn hào quang, không còn uy tín.
Tato vivattitacitto dhammagaruko tejavā sīhova abhibhuyyacārī, tasmāpi evamāha – ‘‘atthi me…pe… no āmisadāyādā’’ti.
One who is devoted to the Dhamma, with a mind turned away from that, is powerful and moves with dominance like a lion; therefore, he also said: “I have… and so on… not heirs in material things.”
Từ đó, người có tâm chuyển hướng khỏi sự nặng về vật chất và nặng về Pháp thì có uy lực, giống như sư tử đi lại không sợ hãi. Vì vậy, Ngài cũng nói: “Ta có… (v.v.)… không phải là những người thừa tự vật chất.”
Evaṃ ‘‘dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’’ti idaṃ anukampāya paṇītataraṃ lābhaṃ icchantena vuttaṃ, no alābhatthikenāti sāvetvā idāni imassa ovādassa akaraṇe ādīnavaṃ dassento āha ‘‘tumhe ca me, bhikkhave…pe… no dhammadāyādā’’ti.
Thus, having made it known that the statement, “Be my heirs in Dhamma, bhikkhus, not my heirs in material things,” was said out of compassion by one desiring a more excellent gain, not by one desiring no gain for them, he now said, “And if you, bhikkhus… and so on… not heirs in Dhamma,” to show the danger in not following this advice.
Như vậy, lời dạy “Này các Tỳ-khưu, hãy là những người thừa tự Pháp của Ta, đừng là những người thừa tự vật chất” này được nói ra với lòng từ bi, mong muốn lợi lộc cao quý hơn, chứ không phải vì không muốn lợi lộc. Sau khi tuyên bố điều đó, bây giờ để chỉ ra sự bất lợi nếu không thực hành lời khuyên này, Ngài nói: “Và nếu các con, này các Tỳ-khưu… (v.v.)… không phải là những người thừa tự Pháp.”
Tattha tumhepi tena ādiyā bhaveyyāthāti tumhepi tena āmisadāyādabhāvena no dhammadāyādabhāvena ādiyā bhaveyyātha.
Therein, “You too would on that account be pointed at” means: you too, by that state of being heirs in material things and not being heirs in Dhamma, would be pointed at.
Trong đó, “các con cũng sẽ bị khiển trách vì điều đó” có nghĩa là các con sẽ bị khiển trách vì là những người thừa tự vật chất chứ không phải là những người thừa tự Pháp.
Apadisitabbā visuṃ kātabbā vavatthapetabbā, viññūhi gārayhā bhaveyyāthāti vuttaṃ hoti.
The meaning is: you would be pointed out, set apart, distinguished, and censured by the wise.
Điều đó có nghĩa là các con sẽ bị chỉ trích, bị phân biệt, bị tách riêng, bị những người trí tuệ khiển trách.
Āmisadāyādā satthusāvakā viharanti, no dhammadāyādāti.
“The Teacher’s disciples dwell as heirs in material things, not as heirs in Dhamma.”
Các đệ tử của Bậc Đạo Sư sống như những người thừa tự vật chất, chứ không phải là những người thừa tự Pháp.
Ahampi tena ādiyo bhaveyyanti ahampi tena tumhākaṃ āmisadāyādabhāvena no dhammadāyādabhāvena gārayho bhaveyyaṃ.
“I too would on that account be pointed at” means: I too, on account of your being heirs in material things and not heirs in Dhamma, would be censured.
“Ta cũng sẽ bị khiển trách vì điều đó” có nghĩa là Ta cũng sẽ bị khiển trách vì các con là những người thừa tự vật chất chứ không phải là những người thừa tự Pháp.
Āmisa…pe… dāyādāti.
“Heirs in material things… and so on… heirs.”
Vì thừa tự vật chất… (v.v.)… không phải thừa tự Pháp.
Idaṃ bhagavā tesaṃ atīva mudukaraṇatthamāha.
The Blessed One said this to make them extremely pliant.
Đức Phật nói điều này để làm cho họ trở nên vô cùng mềm mỏng.
Ayañhi ettha adhippāyo – sace, bhikkhave, tumhe āmisalolā carissatha, tattha viññū maṃ garahissanti ‘‘kathañhi nāma sabbaññū samāno attano sāvake dhammadāyāde no āmisadāyāde kātuṃ na sakkotī’’ti.
For this is the intention here: “If, bhikkhus, you wander about greedy for material things, the wise will censure me for it, saying, ‘How is it that, being omniscient, he is not able to make his own disciples heirs in Dhamma and not heirs in material things?’”
Ý nghĩa ở đây là: “Này các Tỳ-khưu, nếu các con sống tham lam vật chất, thì những người trí tuệ sẽ khiển trách Ta: ‘Làm sao một vị Toàn Giác lại không thể khiến các đệ tử của mình trở thành những người thừa tự Pháp chứ không phải là những người thừa tự vật chất?’”
Seyyathāpi nāma anākappasampanne bhikkhū disvā ācariyupajjhāye garahanti ‘‘kassime saddhivihārikā, kassantevāsikā’’ti; seyyathā vā pana kulakumārake vā kulakumārikāyo vā dussīle pāpadhamme disvā mātāpitaro garahanti ‘‘kassime puttā, kassa dhītaro’’ti; evameva maṃ viññū garahissanti ‘‘kathañhi nāma sabbaññū samāno attano sāvake dhammadāyāde no āmisadāyāde kātuṃ na sakkotī’’ti.
Just as, upon seeing bhikkhus of improper conduct, people censure their preceptors and teachers, asking, “Whose co-residents are these? Whose pupils are these?”; or just as, upon seeing immoral young men and women of bad character, people censure their parents, asking, “Whose sons are these? Whose daughters are these?”; in the very same way, the wise will censure me, saying, “How is it that, being omniscient, he is not able to make his own disciples heirs in Dhamma and not heirs in material things?”
Giống như khi thấy các Tỳ-khưu không có hạnh kiểm tốt, các vị A-xà-lê và Hòa thượng khiển trách: “Đây là các Sa-di của ai, đây là các đệ tử của ai?”; hoặc giống như khi thấy các con trai hay con gái trong gia đình có đạo đức xấu, cha mẹ khiển trách: “Đây là con trai của ai, con gái của ai?”; cũng vậy, những người trí tuệ sẽ khiển trách Ta: “Làm sao một vị Toàn Giác lại không thể khiến các đệ tử của mình trở thành những người thừa tự Pháp chứ không phải là những người thừa tự vật chất?”
Evaṃ imassa ovādassa akaraṇe ādīnavaṃ dassetvā karaṇe ānisaṃsaṃ dassento tumhe ca metiādimāha.
Having thus shown the danger in not following this exhortation, to show the benefit in following it, he spoke the words beginning with "And you for me".
Như vậy, sau khi chỉ ra sự nguy hại của việc không thực hành lời giáo huấn này và muốn chỉ ra lợi ích của việc thực hành, Ngài đã nói lời bắt đầu bằng "chư Tỳ-khưu, các ông và Ta...".
Tattha ahampi tena na ādiyo bhaveyyanti seyyathāpi nāma vattaparipūrake daharabhikkhū uddesaparipucchāsampanne vassasatikatthere viya ākappasampanne disvā, kassa saddhivihārikā, kassantevāsikāti, asukassāti, ‘‘patirūpaṃ therassa, paṭibalo vata ovadituṃ anusāsitu’’nti ācariyupajjhāyā na ādiyā na gārayhā bhavanti, evameva ahampi tena tumhākaṃ dhammadāyādabhāvena no āmisadāyādabhāvena kassa sāvakā nālakapaṭipadaṃ tuvaṭṭakapaṭipadaṃ candūpamapaṭipadaṃ rathavinītapaṭipadaṃ mahāgosiṅgasālapaṭipadaṃ mahāsuññatapaṭipadaṃ paṭipannā catupaccayasantosabhāvanārāmaariyavaṃsesu sakkhibhūtā paccayagedhato vivattamānasā abbhā muttacandasamā viharantīti; ‘‘samaṇassa gotamassā’’ti vutte ‘‘sabbaññū vata bhagavā, asakkhi vata sāvake āmisadāyādapaṭipadaṃ chaḍḍāpetvā dhammadāyādapaṭipattipūrake kātu’’nti viññūnaṃ na ādiyo na gārayho bhaveyyanti.
Herein, "I too would not be blameworthy on that account" means: just as when one sees young bhikkhus who are fulfillers of the duties and accomplished in recitation and inquiry, appearing as well-conducted as a hundred-year-old thera, and upon asking, "Whose co-residents are they? Whose pupils are they?" and being told, "Of such-and-such a one," their teachers and preceptors are not blameworthy, not reprehensible, because it is said, "It is fitting for the thera; indeed, he is capable of exhorting and instructing;" in the very same way, I too, on account of you being heirs of the Dhamma and not heirs of material things, would not be blameworthy nor reprehensible to the wise. For when asked, "Whose disciples are these, who practice the Nālaka-paṭipadā, the Tuvaṭṭaka-paṭipadā, the Candūpama-paṭipadā, the Rathavinīta-paṭipadā, the Mahāgosiṅgasāla-paṭipadā, and the Mahāsuññata-paṭipadā; who are witnesses to the noble lineages of contentment with the four requisites and delight in development; whose minds are turned away from greed for requisites; and who live like the moon freed from clouds?" and it is answered, "Of the ascetic Gotama," it would be said, "Indeed, the Blessed One is all-knowing! Indeed, he was able to make his disciples abandon the practice of being heirs to material things and become fulfillers of the practice of being heirs to the Dhamma!"
Trong đó, về câu "Ta cũng sẽ không bị chê trách bởi điều đó", ví như khi thấy các Tỳ-khưu trẻ tuổi nhưng đầy đủ oai nghi, thực hành các bổn phận, thành thạo trong việc học hỏi và vấn đáp, giống như các Trưởng lão trăm tuổi, người ta hỏi: "Đây là đệ tử của ai, là học trò của ai vậy?" và được trả lời: "Là của vị Tôn giả kia." Khi ấy, người ta nói: "Thật xứng đáng với vị Trưởng lão! Ngài quả là người có khả năng giáo huấn, khuyên răn." Các vị thầy và thầy tế độ sẽ không bị chê trách hay khiển trách. Cũng vậy, Ta cũng sẽ không bị những người trí thức chê trách hay khiển trách khi họ nói: "Đệ tử của ai đã thực hành con đường Nāḷaka, con đường Tuvaṭṭaka, con đường Candūpama, con đường Rathavinīta, con đường Mahāgosiṅgasāla, con đường Mahāsuññatā, trở thành chứng nhân trong các bậc Thánh chủng (ariyavaṃsa) với sự thỏa mãn về bốn vật dụng và sự an trú trong thiền định, tâm thoát ly khỏi sự tham ái vật chất, an trú như mặt trăng thoát khỏi mây?" và được trả lời: "Là của Sa-môn Gotama." Khi đó, họ nói: "Đức Thế Tôn quả là bậc Toàn Giác! Ngài đã có thể khiến các đệ tử từ bỏ con đường thừa kế vật chất để trở thành những người hoàn thành sự thực hành thừa kế Pháp."
Evamimasmiṃ pade adhippāyaṃ ñatvā sesaṃ kaṇhapakkhe vuttanayapaccanīkena veditabbaṃ.
Having thus understood the intention in this passage, the rest should be understood in a way that is contrary to the method stated for the dark fortnight.
Sau khi hiểu ý nghĩa của đoạn này, phần còn lại cần được hiểu theo cách ngược lại với phương pháp đã nói trong khía cạnh đen tối.
Evaṃ imassa ovādassa karaṇe ānisaṃsaṃ dassetvā idāni taṃ ovādaṃ niyyātento āha – ‘‘tasmā tiha me, bhikkhave…pe… no āmisadāyādā’’ti.
Having thus shown the benefit in following this exhortation, he now, entrusting that exhortation, said: "Therefore, bhikkhus, be... etc... not heirs of material things."
Như vậy, sau khi chỉ ra lợi ích của việc thực hành lời giáo huấn này, giờ đây, Ngài đã trao lại lời giáo huấn đó, nói rằng: "Do đó, này chư Tỳ-khưu... (v.v.)... không phải là những người thừa kế vật chất."
Tattha idhāti nipātapadametaṃ.
Therein, "Here" is a particle.
Trong đó, idhā là một từ trạng từ.
Bhuttāvīti bhuttavā, katabhattakiccoti vuttaṃ hoti.
"Having eaten" means one who has eaten, one who has completed the task of eating a meal.
Bhuttāvī có nghĩa là đã dùng bữa, đã hoàn tất việc ăn uống.
Pavāritoti yāvadatthapavāraṇāya pavārito, yāvadatthaṃ bhuñjitvā paṭikkhittabhojano tittovāti vuttaṃ hoti.
"Refused" means he has refused by the yāvadattha-pavāraṇā, having eaten as much as he wished; it means he has refused further food, being satisfied.
Pavārito có nghĩa là đã được thỉnh mời tùy ý, tức là đã ăn đủ và từ chối thức ăn, đã no đủ.
Catubbidhā hi pavāraṇā vassaṃvuṭṭhapavāraṇā paccayapavāraṇā anatirittapavāraṇā yāvadatthapavāraṇāti.
For there are four kinds of pavāraṇā: vassaṃvuṭṭha-pavāraṇā, paccaya-pavāraṇā, anatiritta-pavāraṇā, and yāvadattha-pavāraṇā.
Thật vậy, có bốn loại pavāraṇā: pavāraṇā sau mùa an cư, pavāraṇā vật dụng, pavāraṇā không dư thừa, và pavāraṇā tùy ý.
Tattha, ‘‘anujānāmi bhikkhave, vassaṃvuṭṭhānaṃ bhikkhūnaṃ tīhi ṭhānehi pavāretu’’nti (mahāva. 209) ayaṃ vassaṃvuṭṭhapavāraṇā.
Therein, "I allow, bhikkhus, the bhikkhus who have completed the rains-residence to perform pavāranā on three grounds"—this is the vassaṃvuṭṭha-pavāraṇā.
Trong đó, "Này chư Tỳ-khưu, Ta cho phép các Tỳ-khưu đã an cư ba tháng được pavāraṇā theo ba cách" là pavāraṇā sau mùa an cư.
‘‘Icchāmahaṃ, bhante, saṅghaṃ catumāsaṃ bhesajjena pavāretu’’nti (pāci. 303) ca ‘‘aññatra punapavāraṇāya aññatra niccapavāraṇāyā’’ti (pāci. 307) ca ayaṃ paccayapavāraṇā.
"I wish, venerable sir, to invite the Saṅgha with medicine for four months," and "apart from a renewed invitation, apart from a standing invitation"—this is the paccaya-pavāraṇā.
"Bạch Thế Tôn, con muốn thỉnh mời Tăng chúng dùng thuốc trong bốn tháng" và "trừ pavāraṇā lặp lại, trừ pavāraṇā thường xuyên" là pavāraṇā vật dụng.
‘‘Pavārito nāma asanaṃ paññāyati, bhojanaṃ paññāyati, hatthapāse ṭhito abhiharati, paṭikkhepo paññāyati, eso pavārito nāmā’’ti (pāci. 239) ayaṃ anatirittapavāraṇā.
"Refused means: eating is apparent, food is apparent, one standing within arm's reach offers it, refusal is apparent, this is what is called 'refused'"—this is the anatiritta-pavāraṇā.
"Pavārito có nghĩa là đồ ăn được bày ra, thức ăn được bày ra, người đứng trong tầm tay mang đến, và sự từ chối được biểu lộ. Đó gọi là pavārito" là pavāraṇā không dư thừa.
‘‘Paṇītena khādanīyena bhojanīyena sahatthā santappesi sampavāresī’’ti (dī. ni. 1.297, 358) ayaṃ yāvadatthapavāraṇā.
"He satisfied and gratified him with his own hands with fine hard and soft food"—this is the yāvadattha-pavāraṇā.
"Tự tay cúng dường và thỉnh mời (sampavāresi) bằng đồ ăn và thức uống cao cấp" là pavāraṇā tùy ý.
Ayamidha adhippetā.
This is what is intended here.
Đây là điều được đề cập ở đây.
Tena vuttaṃ ‘‘pavāritoti yāvadatthapavāraṇāya pavārito’’ti.
Therefore it was said, "'Refused' means he has refused by the yāvadattha-pavāraṇā."
Do đó, đã nói: "pavārito có nghĩa là đã được thỉnh mời tùy ý."
Paripuṇṇoti bhojanena paripuṇṇo.
"Full" means full from the meal.
Paripuṇṇo có nghĩa là no đủ thức ăn.
Pariyositoti pariyositabhojano, uttarapadalopo daṭṭhabbo.
"Finished" means having finished the meal; the elision of the latter part of the compound should be understood.
Pariyosito có nghĩa là đã hoàn tất việc ăn uống; cần hiểu là có sự lược bỏ từ ở phía sau.
Yāvatakaṃ bhuñjitabbaṃ, tāvatakaṃ bhuttaṃ hoti, avasitā me bhojanakiriyāti attho.
It means that as much as should be eaten has been eaten; the meaning is, "My act of eating is finished."
Nghĩa là, đã ăn đủ lượng cần ăn, và việc ăn uống đã kết thúc.
Suhitoti dhāto, jighacchādukkhābhāvena vā sukhitoti vuttaṃ hoti.
"Satiated" means satisfied, or because of the absence of the suffering of hunger, he is happy.
Suhito có nghĩa là no đủ, hoặc hạnh phúc vì không còn khổ đau do đói khát.
Yāvadatthoti yāvatako me bhojanena attho, so sabbo pattoti.
"To his heart's content" means that whatever my need for food was, all of it has been met.
Yāvadattho có nghĩa là tất cả những gì ta cần từ thức ăn đã được đáp ứng.
Ettha ca purimānaṃ tiṇṇaṃ pacchimāni sādhakāni.
And here, the latter three terms establish the former ones.
Ở đây, ba từ sau là bằng chứng cho ba từ trước.
Yo hi pariyosito, so bhuttāvī hoti.
For one who has finished is one who has eaten.
Vì ai đã hoàn tất việc ăn uống thì người đó đã dùng bữa.
Yo ca suhito, so yāvadatthapavāraṇāya pavārito.
And one who is satiated is one who has refused by the yāvadattha-pavāraṇā.
Và ai đã no đủ thì người đó đã được thỉnh mời tùy ý.
Yo yāvadattho, so paripuṇṇoti.
One who has eaten to his heart's content is one who is full.
Và ai đã được đáp ứng đủ thì người đó đã no đủ.
Purimāni vā pacchimānaṃ.
Or the former terms establish the latter ones.
Hoặc ngược lại, ba từ trước là bằng chứng cho ba từ sau.
Yasmā hi bhuttāvī, tasmā pariyosito.
For because one has eaten, one has therefore finished.
Vì đã dùng bữa, nên đã hoàn tất việc ăn uống.
Yasmā pavārito, tasmā suhito.
Because one has refused, one is therefore satiated.
Vì đã được thỉnh mời, nên đã no đủ.
Yasmā paripuṇṇo, tasmā yāvadatthoti.
Because one is full, one has therefore eaten to his heart's content.
Vì đã no đủ, nên đã được đáp ứng đủ.
Sabbañcetaṃ parikappetvā vuttanti veditabbaṃ.
And it should be understood that all this is said by way of conjecture.
Và tất cả điều này cần được hiểu là đã được suy đoán mà nói.
Siyāti ekaṃse ca vikappane ca.
"Might be" is used both in the sense of 'certainty' and 'supposition'.
Siyā có nghĩa là cả sự chắc chắn và sự lựa chọn.
‘‘Pathavīdhātu siyā ajjhattikā, siyā bāhirā’’ti (ma. ni. 3.349) ekaṃse.
In "The earth element might be internal, might be external," it is used in the sense of 'certainty'.
Trong câu "Địa đại (pathavīdhātu) có thể là nội tại, có thể là bên ngoài" là chắc chắn.
‘‘Siyā aññatarassa bhikkhuno āpatti vītikkamo’’ti (ma. ni. 3.39) vikappane.
In "Might some bhikkhu have transgressed an offense?" it is used in the sense of 'supposition'.
Trong câu "Có thể một Tỳ-khưu nào đó đã phạm giới" là lựa chọn.
Idha ubhayampi vaṭṭati.
Here, both are suitable.
Ở đây, cả hai đều có thể áp dụng.
Atirekova atirekadhammo.
An "excessive item" is simply what is in excess.
Atirekadhamma là Pháp dư thừa.
Tathā chaḍḍanīya dhammo.
Likewise, a "discardable item".
Cũng vậy, chaḍḍanīya dhamma là Pháp cần phải từ bỏ.
Adhiko ca chaḍḍetabbo ca, na aññaṃ kiñci kātabboti attho.
The meaning is: it is extra and it should be discarded; nothing else is to be done.
Nghĩa là, nó là cái dư thừa và cần phải từ bỏ, không cần làm gì khác.
Athāti tamhi kāle.
"Then" means at that time.
Athā có nghĩa là vào lúc đó.
Jighacchādubbalyaparetāti jighacchāya ca dubbalyena ca paretā phuṭṭhā anugatā ca aṭṭhapi dasapi divasāni.
"Afflicted by hunger and weakness" means afflicted, touched, and overcome by both hunger and weakness for eight or even ten days.
Jighacchādubbalyaparetā có nghĩa là bị đói và yếu đuối hành hạ, kéo dài tám hoặc mười ngày.
Tattha keci jighacchitāpi na dubbalā honti, sakkonti jighacchaṃ sahituṃ.
Therein, some, though hungry, are not weak; they are able to endure hunger.
Trong số đó, một số người tuy đói nhưng không yếu, có thể chịu đựng được cơn đói.
Ime pana na tādisāti dassetuṃ ubhayamāha.
To show that these, however, are not like that, he said both.
Nhưng những người này không như vậy, để chỉ ra điều đó, Ngài đã nói cả hai.
Tyāhanti te ahaṃ.
"To them I" means to them I.
Tyāhaṃ là "Ta (ahaṃ) và các người (te)".
Sace ākaṅkhathāti yadi icchatha.
"If you wish" means if you desire.
Sace ākaṅkhathā có nghĩa là nếu các người muốn.
Tatrekassāti tesu dvīsu ekassa.
"Therein, for one of them" means for one of those two.
Tatrekassā có nghĩa là một trong hai người đó.
Yo imaṃ dhammadesanaṃ suṭṭhu sutavā punappunaṃ āvajjeti ca, taṃ sandhāyāha vuttaṃ kho panetanti.
Referring to the one who, having heard this Dhamma discourse well, repeatedly reflects on it, he said, "But this has been said".
Về người đã nghe kỹ lời thuyết Pháp này và thường xuyên suy ngẫm về nó, Ngài nói: "Vuttaṃ kho panetaṃ".
Ayaṃ vutta-saddo kesohāraṇepi dissati ‘‘kāpaṭiko māṇavo daharo vuttasiro’’tiādīsu (ma. ni. 2.426).
This word "said" (vutta) is also seen in the context of hair-cutting, in passages such as, "the young brahmin Kāpaṭika with a shaven head."
Từ vutta này cũng được thấy trong các ngữ cảnh như cạo tóc, ví dụ: "Kāpaṭika maṇava dahara vuttasiro" (chàng thanh niên giả mạo, đầu cạo trọc).
Ropitepi ‘‘yathā sāradikaṃ bījaṃ, khette vuttaṃ virūhatī’’tiādīsu (jā. 1.3.31).
Also in the context of planting, in passages such as, "As an autumn seed, sown (vutta) in a field, sprouts."
Cũng trong ngữ cảnh gieo trồng, ví dụ: "Yathā sāradikaṃ bījaṃ, khette vuttaṃ virūhatī" (như hạt giống mùa thu, được gieo trên ruộng sẽ nảy mầm).
Kathitepi ‘‘vuttamidaṃ bhagavatā, vuttamidaṃ arahatā’’tiādīsu.
Also in the context of being spoken, in passages such as, "This was said (vutta) by the Blessed One, said by the Arahant."
Cũng trong ngữ cảnh đã nói, ví dụ: "Vuttamidaṃ Bhagavatā, vuttamidaṃ Arahatā" (điều này đã được Đức Thế Tôn nói, điều này đã được bậc A-la-hán nói).
Idha pana kathite daṭṭhabbo.
Here, however, it should be understood in the sense of 'spoken'.
Ở đây, cần hiểu là đã nói.
Kathitaṃ kho panetanti ayañhissa attho.
For its meaning is 'this has been spoken'.
Vì nghĩa của nó là "điều này đã được nói ra".
Āmisaññataranti catunnaṃ paccayāmisānaṃ aññataraṃ, ekanti attho.
"One kind of material thing" means one of the four material requisites; the meaning is 'one'.
Āmisaññataraṃ có nghĩa là một trong bốn vật dụng vật chất, tức là một thứ.
Yadidanti nipāto, sabbaliṅgavibhattivacanesu tādisova tattha tattha atthato pariṇāmetabbo.
"That is" (yadidaṃ) is a particle; in all genders, cases, and numbers it should be construed according to the meaning in each respective place.
Yadidaṃ là một trạng từ, cần được điều chỉnh ý nghĩa tùy theo ngữ cảnh, giới tính, cách thức và số lượng.
Idha panāssa yo esoti attho.
Here, however, its meaning is 'that which is'.
Ở đây, nó có nghĩa là "cái này là".
Yo eso piṇḍapāto nāma.
That which is called almsfood.
Cái này được gọi là vật thực (piṇḍapāta).
Idaṃ āmisaññataranti vuttaṃ hoti.
It is said to be 'one kind of material thing'.
Điều này có nghĩa là "một trong những vật chất".
Yaṃnūnāhanti sādhu vatāhaṃ.
"What if I were to" means 'it would be good if I were to'.
Yaṃ nūnāhaṃ có nghĩa là "thật tốt lành nếu ta".
Evanti yathā idāni imaṃ khaṇaṃ vītināmemi, evameva rattindivaṃ.
"Thus" means day and night in the same way that I am now passing this moment.
Evaṃ có nghĩa là "cũng vậy, ngày đêm như ta đang trải qua khoảnh khắc này".
Vītināmeyyanti khepeyyaṃ ativattāpeyyaṃ.
"I would spend" means I would pass, I would cause to pass by.
Vītināmeyyaṃ có nghĩa là "ta sẽ trải qua, ta sẽ vượt qua".
Atha dutiyassāti imasmiṃ pana vāre esa saṅkhepo, sace so bhikkhu, yaṃnūnāhaṃ…pe… vītināmeyyanti cintento evampi cinteyya, pabbajitena kho vāḷamigākule araññe bhesajjaṃ viya pañcakāmaguṇavāḷākule gāme piṇḍapātopi dukkhaṃ pariyesituṃ.
Now, for the second: In this case, this is the summary. If that bhikkhu, while thinking, "What if I were to pass the time…," were to think thus: "Indeed, for one gone forth, it is difficult to seek even alms-food in a village teeming with the wild beasts of the five strands of sensual pleasure, just as it is to seek medicine in a forest teeming with wild beasts."
Atha dutiyassā (đến lượt người thứ hai) nghĩa là: Trong trường hợp này, đây là tóm tắt. Nếu vị Tỳ-khưu đó, suy nghĩ rằng: “Ước gì ta… (vân vân)… có thể trải qua” và cũng suy nghĩ như vậy, thì việc một người xuất gia phải tìm cầu vật thực khất thực trong làng, nơi đầy rẫy năm dục lạc như thú dữ, cũng khó khăn như tìm thuốc trong rừng, nơi đầy rẫy thú dữ.
Ayaṃ pana piṇḍapāto iti pariyesanādīnavavimutto ca sugatātiritto cāti ubhato sujātakhattiyakumāro viya hoti, yehi ca pañcahi kāraṇehi piṇḍapāto na paribhuñjitabbo hoti.
This alms-food, however, is free from the flaws of having to be sought and so on, and it is a leftover from the Sugata; thus, it is like a Khattiya prince of pure birth on both sides. And there are five reasons for which alms-food should not be partaken of.
Tuy nhiên, món vật thực khất thực này lại thoát khỏi những tai hại của việc tìm cầu như vậy, và là phần dư của Đức Sugata; do đó, nó giống như một vị hoàng tử Khattiya sinh ra từ hai dòng dõi thuần khiết.
Seyyathidaṃ, puggalaṃ garahitvā na paribhuñjitabbo hoti ‘‘alajjipuggalassa santako’’ti.
That is to say, it should not be partaken of by censuring the person, thinking, "It belongs to a shameless person."
Và có năm lý do mà vật thực khất thực không nên được thọ dụng. Chẳng hạn, không nên thọ dụng khi chê bai một người, nói rằng: “Đây là của một người vô liêm sỉ.”
Aparisuddhauppattitāya na paribhuñjitabbo hoti ‘‘bhikkhuniparipācanaasantasambhāvanuppanno’’ti.
It should not be partaken of due to impure origin, thinking, "It has arisen from what was prepared by a bhikkhunī or from making a display*."
Không nên thọ dụng vì sự phát sinh không thanh tịnh, nói rằng: “Đây là vật thực phát sinh do sự sắp đặt của Tỳ-khưu-ni hoặc do sự giả vờ không có quả vị cao hơn người thường.”
Sāmikānukampāya na paribhuñjitabbo hoti ‘‘piṇḍapātasāmiko bhikkhu jighacchito’’ti.
It should not be partaken of out of compassion for the owner, thinking, "The bhikkhu who owns the alms-food is hungry."
Không nên thọ dụng vì lòng thương xót chủ nhân, nói rằng: “Vị Tỳ-khưu chủ nhân của vật thực khất thực này đang đói.”
So dhāto tasseva antevāsikādīsu anukampāya na paribhuñjitabbo hoti ‘‘antevāsikā aññe vā tappaṭibaddhā jighacchitā’’ti, tepi dhātā suhitā, apica kho assaddhatāya na paribhuñjitabbo hoti ‘‘piṇḍapātasāmiko bhikkhu assaddho’’ti.
Even if he is satisfied, it should not be partaken of out of compassion for his resident pupils and others, thinking, "The resident pupils or others connected to him are hungry." And even if they are satisfied, it should not be partaken of due to faithlessness, thinking, "The bhikkhu who owns the alms-food is faithless."
Nếu vị ấy đã no đủ, thì không nên thọ dụng vì lòng thương xót các đệ tử hoặc những người khác phụ thuộc vào vị ấy, nói rằng: “Các đệ tử hoặc những người khác có liên quan đang đói.” Nếu họ cũng đã no đủ, thì không nên thọ dụng vì sự thiếu đức tin, nói rằng: “Vị Tỳ-khưu chủ nhân của vật thực khất thực này thiếu đức tin.”
Tehi ca kāraṇehi ayaṃ vimutto.
And this alms-food is free from those reasons.
Món vật thực này thoát khỏi những lý do đó.
Bhagavā hi lajjīnaṃ aggo, parisuddhuppattiko piṇḍapāto, bhagavā ca dhāto suhito, paccāsīsakopi añño puggalo natthi, ye loke saddhā, bhagavā tesaṃ aggoti evaṃ cintetvā ca so taṃ piṇḍapātaṃ bhuñjitvā…pe… vītināmeyya.
For the Blessed One is the foremost of the scrupulous; the alms-food is of pure origin; the Blessed One is satisfied and content; there is no other person who has expectations for it; and of those in the world who have faith, the Blessed One is the foremost. Having reflected thus, he might eat that alms-food and... etc... pass the time.
Thật vậy, Đức Thế Tôn là bậc tối thượng trong số những người có liêm sỉ, vật thực khất thực này có sự phát sinh thanh tịnh, Đức Thế Tôn đã no đủ và hài lòng, không có người nào khác mong đợi, và Đức Thế Tôn là bậc tối thượng trong số những người có đức tin trên thế gian. Suy nghĩ như vậy, vị Tỳ-khưu đó nên thọ dụng món vật thực khất thực đó… (vân vân)… và trải qua ngày đêm đó.
Ettāvatā yopi abhuñjitvā samaṇadhammaṃ karoti, sopi bhuñjitabbakameva piṇḍapātaṃ na bhutto hoti.
By this much, the one who practices the ascetic's duties without eating has not eaten alms-food that should indeed be eaten.
Đến đây, ngay cả vị nào không thọ dụng mà thực hành Pháp Sa-môn, thì vị ấy cũng không thọ dụng món vật thực đáng được thọ dụng.
Yopi bhuñjitvā samaṇadhammaṃ karoti, sopi bhuñjitabbakameva bhutto hoti.
The one who practices the ascetic's duties after eating has eaten what should indeed be eaten.
Và vị nào thọ dụng mà thực hành Pháp Sa-môn, thì vị ấy cũng đã thọ dụng món vật thực đáng được thọ dụng.
Natthi piṇḍapāte viseso.
There is no distinction in the alms-food.
Không có sự khác biệt về vật thực khất thực.
Puggale pana atthi viseso.
But there is a distinction in the person.
Nhưng có sự khác biệt về người.
Tasmā taṃ dassento kiñcāpi sotiādimāha.
Therefore, to show that, he said, "And although, bhikkhus, that bhikkhu..." and so on.
Vì vậy, để chỉ ra điều đó, Đức Thế Tôn đã nói câu bắt đầu bằng kiñcāpi so (mặc dù vị ấy).
Tattha kiñcāpīti anujānanappasaṃsanatthe nipāto.
Therein, "although" is a particle in the sense of permission and praise.
Trong đó, kiñcāpi là một giới từ dùng để cho phép và tán thán.
Kiṃ anujānāti?
What does it permit?
Cho phép điều gì?
Tassa bhikkhuno taṃ anavajjaparibhogaṃ.
It permits that bhikkhu’s blameless partaking of it.
Việc thọ dụng không lỗi lầm đó của vị Tỳ-khưu.
Kiṃ pasaṃsati?
What does it praise?
Tán thán điều gì?
Bhutvā samaṇadhammakaraṇaṃ.
The practice of the ascetic's duties after having eaten.
Việc thực hành Pháp Sa-môn sau khi thọ dụng.
Idaṃ vuttaṃ hoti yadipi so bhikkhu evaṃ bhuñjitabbameva bhuñjitvā kātabbameva kareyya.
This is what is meant: even if that bhikkhu were to do what should be done after eating what should be eaten in this way.
Điều này có nghĩa là, mặc dù vị Tỳ-khưu đó thọ dụng những gì đáng thọ dụng và làm những gì đáng làm.
Atha kho asuyeva me purimo bhikkhūti yo purimo bhikkhu tampi piṇḍapātaṃ paṭikkhipitvā samaṇadhammaṃ karoti, soyeva mama dvīsu sūresu sūrataro viya dvīsu paṇḍitesu paṇḍitataro viya ca pujjataro ca pāsaṃsataro ca, dutiyabhikkhuto atirekena pūjanīyo ca pasaṃsanīyo cāti vuttaṃ hoti.
"Yet that first bhikkhu is more..." means: the first bhikkhu who practices the ascetic's duties after rejecting even that alms-food, he, among two brave men, is the braver, and among two wise men, the wiser, and is more to be revered and more to be praised. This is said to mean that he is more worthy of reverence and praise than the second bhikkhu.
Atha kho asuyeva me purimo bhikkhū (nhưng vị Tỳ-khưu đầu tiên của ta vẫn là người đó) nghĩa là: Vị Tỳ-khưu đầu tiên đã từ chối món vật thực khất thực đó và thực hành Pháp Sa-môn, vị ấy đáng được tôn kính hơn và đáng được tán thán hơn, như người dũng cảm hơn trong hai người dũng cảm, như người thông thái hơn trong hai người thông thái. Điều này có nghĩa là vị ấy đáng được tôn kính và tán thán vượt trội hơn so với vị Tỳ-khưu thứ hai.
Idāni tamatthaṃ kāraṇena sādhento taṃ kissa hetūtiādimāha.
Now, establishing that point with a reason, he said, "For what reason?" and so on.
Bây giờ, để chứng minh ý đó bằng lý do, Đức Thế Tôn đã nói câu bắt đầu bằng taṃ kissa hetū (vì lý do gì).
Tassattho, tattha siyā tumhākaṃ, kasmā so bhikkhu bhagavato pujjataro ca pāsaṃsataro cāti?
The meaning is this: you might wonder, "Why is that bhikkhu more to be revered and praised by the Blessed One?"
Ý nghĩa của nó là: Có lẽ các con sẽ hỏi, tại sao vị Tỳ-khưu đó lại đáng được tôn kính và tán thán hơn Đức Thế Tôn?
Tañhi tassāti yasmā taṃ piṇḍapātapaṭikkhipanaṃ tassa bhikkhuno dīgharattaṃ appicchatāya…pe… vīriyārambhāya saṃvattissati.
"For, bhikkhus, that action of his" means: because that rejection of alms-food will conduce for a long time to that bhikkhu's fewness of wishes... etc... to the arousal of energy.
Tañhi tassā (thật vậy, điều đó đối với vị ấy) nghĩa là: Vì việc từ chối vật thực khất thực đó sẽ dẫn đến sự ít dục… (vân vân)… và sự tinh tấn cho vị Tỳ-khưu đó trong một thời gian dài.
Kathaṃ?
How so?
Bằng cách nào?
Tassa hi sace aparena samayena paccayesu atricchatā vā pāpicchatā vā mahicchatā vā uppajjissati.
If, at a later time, excessive desire, or evil desire, or great desire for requisites should arise in him,
Nếu sau này, lòng tham dục quá mức, ác dục, hoặc đại dục phát sinh đối với các vật dụng.
Tato naṃ iminā piṇḍapātapaṭikkhepaṅkusena nivāressati ‘‘are tvaṃ sugatātirittampi piṇḍapātaṃ paṭikkhipitvā īdisaṃ icchaṃ uppādesī’’ti evaṃ paccavekkhamāno.
then he will restrain it with this goad of rejecting the alms-food, reflecting thus: "Friend, having rejected even the alms-food leftover from the Sugata, have you generated such a desire?"
Khi đó, vị ấy sẽ ngăn chặn nó bằng cái móc của việc từ chối vật thực khất thực này, quán xét rằng: “Này ngươi, ngươi đã từ chối cả vật thực khất thực dư thừa của Đức Sugata, vậy mà lại phát sinh lòng tham dục như thế này sao?”
Esa nayo asantuṭṭhiyā asaṃlekhassa cuppannassa nivāraṇe.
This is the method for restraining arisen discontent and lack of effacement.
Cũng theo cách này để ngăn chặn sự bất mãn và sự không thanh tịnh đã phát sinh.
Evaṃ tāvassa appicchatāya santuṭṭhiyā saṃlekhāya saṃvattissati.
Thus, for him, it will first conduce to fewness of wishes, contentment, and effacement.
Như vậy, điều đó sẽ dẫn đến sự ít dục, sự biết đủ và sự thanh tịnh cho vị ấy.
Subharatāyāti ettha ayaṃ saṃvaṇṇanā – idhekacco attanopi upaṭṭhākānampi dubbharo hoti dupposo.
For being easy to support: Here, this is the explanation: Here, a certain person is difficult to support and difficult to maintain, both for himself and for his supporters.
Subharatāyā (dễ nuôi) – đây là lời giải thích: Ở đây, có người khó nuôi dưỡng chính mình và khó nuôi dưỡng những người hộ độ.
Ekacco attanopi upaṭṭhākānampi subharo hoti suposo.
A certain person is easy to support and easy to maintain, both for himself and for his supporters.
Có người dễ nuôi dưỡng chính mình và dễ nuôi dưỡng những người hộ độ.
Kathaṃ?
How so?
Bằng cách nào?
Yo hi ambilādīni laddhā anambilādīni pariyesati, aññassa ghare laddhaṃ aññassa ghare chaḍḍento sabbaṃ gāmaṃ vicaritvā rittapattova vihāraṃ pavisitvā nipajjati, ayaṃ attano dubbharo.
One who, having received sour foods and so on, searches for non-sour foods; who, leaving what was received at one house at another house, wanders through the whole village and enters the monastery with an empty bowl and lies down—this one is difficult for himself to support.
Thật vậy, vị nào nhận được đồ chua (ambilādīni) mà lại tìm đồ không chua, vứt bỏ những gì đã nhận được ở nhà người này để tìm ở nhà người khác, đi khắp làng rồi về Tịnh xá với bát rỗng mà nằm xuống, vị ấy là người khó nuôi dưỡng chính mình.
Yo pana sālimaṃsodanādīnaṃ patte pūretvā dinnepi dummukhabhāvaṃ anattamanabhāvameva ca dasseti, tesaṃ vā sammukhāva taṃ piṇḍapātaṃ ‘‘kiṃ tumhehi dinna’’nti apasādento sāmaṇeragahaṭṭhādīnampi deti, ayaṃ upaṭṭhākānaṃ dubbharo.
And one who, even when given a bowl filled with rice and meat, shows only a sullen face and displeasure, or who, right in front of them, disparages that alms-food, saying, "What is this you have given?" and gives it to novices, laypeople, and others—this one is difficult for his supporters to support.
Còn vị nào, khi được cúng dường đầy bát cơm gạo ngon với thịt (sālimaṃsodanādīnaṃ), lại tỏ vẻ khó chịu, không hài lòng, hoặc ngay trước mặt họ, chê bai món vật thực khất thực đó rằng: “Các người cúng dường cái gì vậy?” rồi đem cho các Sa-di, cư sĩ, v.v., vị ấy là người khó nuôi dưỡng những người hộ độ.
Etaṃ disvā manussā dūrato parivajjanti dubbharo bhikkhu na sakkā positunti.
Seeing this, people avoid him from afar, thinking, "This bhikkhu is difficult to support; he cannot be maintained."
Thấy vậy, mọi người tránh xa, nói rằng: “Vị Tỳ-khưu này khó nuôi, không thể nuôi dưỡng được.”
Yo pana yaṃkiñci lūkhaṃ vā paṇītaṃ vā laddhā tuṭṭhacittova bhuñjitvā vihāraṃ gantvā attano kammaṃ karoti, ayaṃ attano subharo.
But one who, having received anything, whether coarse or fine, eats with a contented mind and goes to the monastery to do his own work—this one is easy for himself to support.
Còn vị nào, nhận được bất cứ thứ gì, dù thô sơ hay tinh tế, đều vui vẻ thọ dụng, rồi về Tịnh xá làm công việc của mình, vị ấy là người dễ nuôi dưỡng chính mình.
Yo ca paresampi appaṃ vā bahuṃ vā lūkhaṃ vā paṇītaṃ vā dānaṃ ahīḷetvā attamano vippasannamukho hutvā tesaṃ sammukhāva paribhuñjitvā yāti, ayaṃ upaṭṭhākānaṃ subharo.
And one who, not disparaging the gift of others, whether it be little or much, coarse or fine, partakes of it right in front of them with a pleased and serene face and then leaves—this one is easy for his supporters to support.
Và vị nào, không chê bai món cúng dường của người khác, dù ít hay nhiều, dù thô sơ hay tinh tế, mà vui vẻ, mặt mày hoan hỷ, thọ dụng ngay trước mặt họ rồi ra đi, vị ấy là người dễ nuôi dưỡng những người hộ độ.
Etaṃ disvā manussā ativiya vissatthā honti – ‘‘amhākaṃ bhadanto subharo thokenapi tussati, mayameva naṃ posissāmā’’ti paṭiññaṃ katvā posenti.
Seeing this, people become very confident and make a promise, "Our venerable sir is easy to support; he is satisfied with just a little. We ourselves will maintain him," and they support him.
Thấy vậy, mọi người trở nên rất tin tưởng, nói rằng: “Đức Tôn giả của chúng ta dễ nuôi, chỉ một chút ít cũng hài lòng, chúng ta sẽ tự mình nuôi dưỡng Ngài,” rồi họ phát nguyện và nuôi dưỡng.
Tattha sace aparena samayena assa attano vā upaṭṭhākānaṃ vā dubbharatānayena cittaṃ uppajjissati.
In this case, if at a later time a thought should arise in him in the manner of being difficult to support, either for himself or for his supporters,
Trong trường hợp đó, nếu sau này tâm khó nuôi dưỡng chính mình hoặc khó nuôi dưỡng những người hộ độ của vị ấy phát sinh.
Tato naṃ iminā piṇḍapātapaṭikkhepaṅkusena nivāressati – ‘‘are tvaṃ sugatātirittampi piṇḍapātaṃ paṭikkhipitvā īdisaṃ cittaṃ uppādesī’’ti evaṃ paccavekkhamāno, evamassa subharatāya saṃvattissati.
then he will restrain it with this goad of rejecting the alms-food, reflecting thus: "Friend, having rejected even the alms-food leftover from the Sugata, have you generated such a thought?" In this way, it will conduce to his being easy to support.
Khi đó, vị ấy sẽ ngăn chặn nó bằng cái móc của việc từ chối vật thực khất thực này, quán xét rằng: “Này ngươi, ngươi đã từ chối cả vật thực khất thực dư thừa của Đức Sugata, vậy mà lại phát sinh tâm ý như thế này sao?” Như vậy, điều đó sẽ dẫn đến sự dễ nuôi dưỡng cho vị ấy.
Sace panassa kosajjaṃ uppajjissati, tampi etenevaṅkusena nivāressati – ‘‘are tvaṃ nāma tadā sugatātirittampi piṇḍapātaṃ paṭikkhipitvā tathā jighacchādubbalyaparetopi samaṇadhammaṃ katvā ajja kosajjamanuyuñjasī’’ti evaṃ paccavekkhamāno, evamassa vīriyārambhāya saṃvattissati.
And if laziness should arise in him, he will restrain that too with this same goad, reflecting thus: "Friend, you who at that time, having rejected even the alms-food leftover from the Sugata, practiced the ascetic's duties even while afflicted by such hunger and weakness, are you now indulging in laziness?" In this way, it will conduce to the arousal of his energy.
Nếu sự biếng nhác phát sinh cho vị ấy, vị ấy cũng sẽ ngăn chặn nó bằng cái móc đó, quán xét rằng: “Này ngươi, ngươi đã từ chối cả vật thực khất thực dư thừa của Đức Sugata vào lúc đó, và mặc dù bị đói khát và yếu ớt như vậy, ngươi vẫn thực hành Pháp Sa-môn, vậy mà hôm nay ngươi lại buông thả trong sự biếng nhác sao?” Như vậy, điều đó sẽ dẫn đến sự tinh tấn cho vị ấy.
Evamassa idaṃ piṇḍapātapaṭikkhipanaṃ dīgharattaṃ appicchatāya…pe… vīriyārambhāya saṃvattissati.
Thus, for him, this rejection of alms-food will conduce for a long time to fewness of wishes... etc... to the arousal of energy.
Như vậy, việc từ chối vật thực khất thực này sẽ dẫn đến sự ít dục… (vân vân)… và sự tinh tấn cho vị ấy trong một thời gian dài.
Evamassime pañca guṇā paripūrā dasa kathāvatthūni paripūressanti.
In this way, these five qualities in him, being fulfilled, will bring to fulfillment the ten topics of discourse.
Như vậy, năm đức tính này của vị ấy sẽ được viên mãn, và mười chủ đề đàm luận (kathāvatthūni) sẽ được viên mãn.
Kathaṃ?
How so?
Bằng cách nào?
Atra hi pāḷiyaṃyeva appicchatāsantuṭṭhitāvīriyārambhavasena tīṇi āgatāni, sesāni sallekhena saṅgahitāni.
Here, in the Pali text itself, three have been mentioned by way of fewness of wishes, contentment, and arousal of energy; the rest are included under effacement.
Ở đây, trong chính kinh điển, ba điều đã được đề cập liên quan đến sự ít dục, sự biết đủ và sự tinh tấn, còn những điều khác được bao gồm trong sự thanh tịnh (saṃlekha).
Idañhi sabbakathāvatthūnaṃ nāmameva, yadidaṃ sallekho.
For this is just a name for all the topics of discourse, that is, effacement.
Thật vậy, đây là tên gọi của tất cả các chủ đề đàm luận, đó là sự thanh tịnh.
Yathāha – ‘‘yā ca kho ayaṃ, ānanda, kathā abhisallekhikā cetovinīvaraṇasappāyā ekantanibbidāya virāgāya nirodhāya upasamāya abhiññāya sambodhāya nibbānāya saṃvattati.
As it is said: "And, Ānanda, that talk which is for effacement, which is conducive to the dispelling of defilements from the mind, which conduces exclusively to disenchantment, to dispassion, to cessation, to peace, to direct knowledge, to full awakening, to Nibbāna."
Như đã nói: “Này Ānanda, những lời nói nào có tính chất thanh tịnh, thích hợp cho việc loại bỏ các chướng ngại tâm, hoàn toàn dẫn đến sự nhàm chán, ly tham, đoạn diệt, an tịnh, thắng trí, giác ngộ, Niết-bàn.
Seyyathidaṃ, appicchakathā’’ti (ma. ni. 3.189, 192) vitthāro.
"That is to say, talk on fewness of wishes," etc., is the detailed explanation.
Chẳng hạn như lời nói về sự ít dục” (Ma. Ni. 3.189, 192) và chi tiết.
Evaṃ ime pañca guṇā paripūrā dasa kathāvatthūni paripūressanti.
Thus, these five qualities, being complete, will fulfill the ten topics of talk.
Như vậy, khi năm đức tính này được viên mãn, mười đề tài đàm luận (kathāvatthūni) sẽ được viên mãn.
Dasa kathāvatthūni paripūrāni tisso sikkhā paripūressanti.
The ten topics of talk, being complete, will fulfill the three trainings.
Khi mười đề tài đàm luận được viên mãn, ba học giới (tisso sikkhā) sẽ được viên mãn.
Kathaṃ?
How?
Như thế nào?
Etesu hi appicchakathā santosakathā asaṃsaggakathā sīlakathāti imā catasso kathā adhisīlasikkhāsaṅgahitāyeva.
For, among these, the talk on fewness of wishes, the talk on contentment, the talk on non-association, and the talk on virtue—these four talks are included in the training in higher virtue.
Trong số đó, các đề tài đàm luận về ít dục (appicchakathā), tri túc (santosakathā), không giao du (asaṃsaggakathā), và giới luật (sīlakathā) – bốn đề tài này – được bao gồm trong giới học (adhisīlasikkhā).
Pavivekakathā vīriyārambhakathā samādhikathāti imā tisso adhicittasikkhasaṅgahitā.
The talk on seclusion, the talk on arousing energy, and the talk on concentration—these three are included in the training in higher mind.
Các đề tài đàm luận về viễn ly (pavivekakathā), tinh tấn (vīriyārambhakathā), và định (samādhikathā) – ba đề tài này – được bao gồm trong định học (adhicittasikkhā).
Paññākathā vimuttikathā vimuttiñāṇadassanakathāti imā tisso adhipaññāsikkhāsaṅgahitāti.
The talk on wisdom, the talk on liberation, and the talk on the knowledge and vision of liberation—these three are included in the training in higher wisdom.
Các đề tài đàm luận về trí tuệ (paññākathā), giải thoát (vimuttikathā), và giải thoát tri kiến (vimuttiñāṇadassanakathā) – ba đề tài này – được bao gồm trong tuệ học (adhipaññāsikkhā).
Evaṃ dasa kathāvatthūni paripūrāni tisso sikkhā paripūressanti.
Thus, the ten topics of talk, being complete, will fulfill the three trainings.
Như vậy, khi mười đề tài đàm luận được viên mãn, ba học giới sẽ được viên mãn.
Tisso sikkhā paripūrā pañca asekkhadhammakkhandhe paripūressanti.
The three trainings, being complete, will fulfill the five Dhammic aggregates of one beyond training.
Khi ba học giới được viên mãn, năm uẩn vô học (asekkhadhammakkhandhe) sẽ được viên mãn.
Kathaṃ?
How?
Như thế nào?
Paripūrā hi adhisīlasikkhā asekkho sīlakkhandhoyeva hoti, adhicittasikkhā asekkho samādhikkhandho, adhipaññāsikkhā asekkhā paññā-vimutti-vimuttiñāṇadassanakkhandhā evāti evaṃ tisso sikkhā paripūrā pañca asekkhadhammakkhandhe paripūressanti.
For, the fulfilled training in higher virtue is itself the virtue-aggregate of one beyond training; the training in higher mind is the concentration-aggregate of one beyond training; and the training in higher wisdom is itself the aggregates of wisdom, liberation, and knowledge and vision of liberation of one beyond training. Thus, the three trainings, being complete, will fulfill the five Dhammic aggregates of one beyond training.
Vì giới học (adhisīlasikkhā) đã viên mãn chính là giới uẩn vô học (asekkhosīlakkhandho), định học (adhicittasikkhā) chính là định uẩn vô học (asekkosamādhikkhandho), tuệ học (adhipaññāsikkhā) chính là tuệ uẩn, giải thoát uẩn, và giải thoát tri kiến uẩn vô học (asekkhā paññā-vimutti-vimuttiñāṇadassanakkhandhā). Như vậy, khi ba học giới được viên mãn, năm uẩn vô học sẽ được viên mãn.
Pañca dhammakkhandhā paripūrā amataṃ nibbānaṃ paripūressanti.
The five Dhammic aggregates, being complete, will fulfill the deathless Nibbāna.
Khi năm uẩn vô học được viên mãn, Niết Bàn bất tử (amataṃ nibbānaṃ) sẽ được viên mãn.
Seyyathāpi uparipabbate pāvussako mahāmegho abhivuṭṭho pabbatakandarasarasākhā paripūreti.
Just as on a mountaintop, a great monsoon cloud, having rained down heavily, fills the mountain clefts, pools, and streams.
Ví như, một đám mây lớn mưa xuống trên đỉnh núi vào mùa mưa, làm đầy các khe núi, suối và nhánh suối.
Tā paripūrā kusobbhe, kusobbhā mahāsobbhe, mahāsobbhā kunnadiyo, kunnadiyo mahānadiyo, mahānadiyo mahāsamuddasāgaraṃ paripūrenti; evameva tassa bhikkhuno ime pañca guṇā paripūrā dasa kathāvatthuni ādiṃ katvā yāva amataṃ nibbānaṃ paripūressanti.
These being full fill the small chasms; the small chasms, the great chasms; the great chasms, the small rivers; the small rivers, the great rivers; and the great rivers fill the great ocean. In the very same way, for that bhikkhu, these five qualities, being complete, will fulfill everything from the ten topics of talk up to the deathless Nibbāna.
Khi chúng đầy, chúng làm đầy các suối nhỏ; các suối nhỏ đầy, chúng làm đầy các suối lớn; các suối lớn đầy, chúng làm đầy các sông nhỏ; các sông nhỏ đầy, chúng làm đầy các sông lớn; các sông lớn đầy, chúng làm đầy đại dương bao la. Cũng vậy, khi năm đức tính này của vị Tỳ-khưu được viên mãn, bắt đầu từ mười đề tài đàm luận cho đến Niết Bàn bất tử sẽ được viên mãn.
Evamayaṃ bhikkhu dhammadāyādapaṭipadaṃ paṭipanno paramadhammadāyādaṃ labhatīti etamatthaṃ sampassamāno bhagavā ‘‘taṃ kissa hetu tañhi tassa, bhikkhave, bhikkhuno’’tiādimāha.
Thus, this bhikkhu who has entered upon the path of being an heir to the Dhamma obtains the supreme inheritance of the Dhamma. Seeing this matter, the Blessed One said, “For what reason is this? It is because for that bhikkhu, bhikkhus,” and so on.
Khi vị Tỳ-khưu này thực hành con đường thừa kế Chánh pháp, vị ấy đạt được sự thừa kế Chánh pháp tối thượng. Đức Thế Tôn, khi nhìn thấy ý nghĩa này, đã nói: “Này các Tỳ-khưu, lý do là vì vị Tỳ-khưu đó…” và tiếp tục bài giảng.
Evaṃ tassa bhikkhuno pujjatarapāsaṃsatarabhāvaṃ kāraṇena sādhetvā idāni te bhikkhū tathattāya sanniyojento tasmā tiha me bhikkhavetiādimāha.
Having thus established by reason that bhikkhu's state of being more worthy of honor and more praiseworthy, now, to enjoin those bhikkhus to that same state, he said, “Therefore, bhikkhus, be my heirs,” and so on.
Sau khi chứng minh sự đáng kính và đáng tán dương hơn của vị Tỳ-khưu đó bằng lý do này, bây giờ, để khuyến khích các Tỳ-khưu đó đạt được trạng thái đó, Ngài đã nói: “Do đó, này các Tỳ-khưu…” và tiếp tục bài giảng.
Kiṃ vuttaṃ hoti, yasmā yo taṃ piṇḍapātaṃ bhuñjitvā samaṇadhammaṃ kareyya, so imehi pañcahi mūlaguṇehi paribāhiro.
What is meant? Because whoever would practice the ascetic’s duties after eating that almsfood is devoid of these five root-qualities.
Ý nghĩa là gì? Bởi vì, vị Tỳ-khưu nào thọ dụng thức ăn khất thực rồi thực hành pháp Sa-môn, vị ấy bị loại trừ khỏi năm đức tính căn bản này.
Yo pana abhuñjitvā kareyya, so imesaṃ bhāgī hoti – ‘‘tasmā tiha me, bhikkhave…pe… no āmisadāyādā’’ti.
But whoever would practice without eating is a partaker of these. "Therefore, bhikkhus… and so on… not heirs to material things.”
Còn vị Tỳ-khưu nào không thọ dụng mà thực hành, vị ấy là người có phần trong những đức tính này – “Do đó, này các Tỳ-khưu… (v.v.)… không phải là những người thừa kế vật chất.”
Idamavoca bhagavāti idaṃ nidānapariyosānato pabhuti yāva no āmisadāyādāti suttappadesaṃ bhagavā avoca.
“The Blessed One said this” means the Blessed One spoke this portion of the sutta, from the end of the introduction up to “not heirs to material things.”
“Đức Thế Tôn đã nói điều này” – Đức Thế Tôn đã nói đoạn kinh này từ đầu phần dẫn nhập cho đến “không phải là những người thừa kế vật chất.”
Idaṃ vatvāna sugatoti idañca suttappadesaṃ vatvāva sobhanāya paṭipadāya gatattā sugatoti saṅkhaṃ pattoyeva bhagavā.
“Having said this, the Sugata” means having spoken this portion of the sutta, the Blessed One, who had attained the designation “Sugata” because he has gone by a beautiful path,
“Đấng Thiện Thệ đã nói điều này” – Sau khi nói đoạn kinh này, Đức Thế Tôn được gọi là “Đấng Thiện Thệ” (Sugata) vì Ngài đã đi trên con đường tốt đẹp.
Uṭṭhāyāsanā vihāraṃ pāvisī paññattavarabuddhāsanato uṭṭhahitvā vihāraṃ attano mahāgandhakuṭiṃ pāvisi asambhinnāya eva parisāya.
“rising from his seat, entered the monastery.” He rose from the excellent Buddha-seat that had been prepared and entered the monastery, his great fragrant chamber, while the assembly was still gathered.
“Ngài đứng dậy khỏi chỗ ngồi và đi vào tịnh xá” – Ngài đứng dậy từ chỗ ngồi Phật tối thượng đã được sắp đặt và đi vào tịnh xá, tức là đại Hương thất của Ngài, trong khi hội chúng vẫn chưa tan rã.
Kasmā dhammathomanatthaṃ.
Why? To praise the Dhamma.
Tại sao? Để tán dương Chánh pháp.
Buddhā kira apariniṭṭhitāya desanāya vihāraṃ pavisantā dvīhi kāraṇehi pavisanti puggalathomanatthaṃ vā dhammathomanatthaṃ vā.
Indeed, when the Buddhas enter the monastery while a discourse is unfinished, they enter for two reasons: either to praise a person or to praise the Dhamma.
Các Đức Phật, khi đi vào tịnh xá mà bài giảng chưa kết thúc, thì đi vào vì hai lý do: hoặc để tán dương cá nhân, hoặc để tán dương Chánh pháp.
Puggalathomanatthaṃ pavisanto evaṃ cintesi – ‘‘imaṃ mayā saṃkhittena uddesaṃ uddiṭṭhaṃ, vitthārena avibhattaṃ, dhammapaṭiggāhakā bhikkhū uggahetvā ānandaṃ vā kaccānaṃ vā upasaṅkamitvā pucchissanti, te mayhaṃ ñāṇena saṃsandetvā kathessanti, tato dhammapaṭiggāhakā puna maṃ pucchissanti, tesaṃ ahaṃ sukathitaṃ, bhikkhave, ānandena sukathitaṃ kaccānena, maṃ cepi tumhe etamatthaṃ puccheyyātha, ahampi naṃ evameva byākareyyanti evaṃ te puggale thomessāmi, tato tesu gāravaṃ janetvā bhikkhū upasaṅkamissanti, tepi bhikkhū atthe ca dhamme ca niyojessanti, te tehi niyojitā tisso sikkhā paripūrentā dukkhassantaṃ karissantī’’ti.
When entering to praise a person, he considers thus: “This theme that I have briefly stated but not explained in detail, the bhikkhus who are receptive to the Dhamma will take it up and, approaching either Ānanda or Kaccāna, they will ask. They will speak, aligning their explanation with my knowledge. Then the receptive bhikkhus will ask me again. To them I will say, ‘Well spoken, bhikkhus, by Ānanda; well spoken by Kaccāna. If you were to ask me about this matter, I too would explain it in the very same way.’ Thus I will praise those individuals. Then, developing reverence for them, the bhikkhus will approach them, and they in turn will enjoin the bhikkhus in the meaning and the teaching. Enjoined by them, those bhikkhus, by fulfilling the three trainings, will make an end of suffering.”
Khi đi vào để tán dương cá nhân, Ngài suy nghĩ như sau: “Bài tóm tắt này do Ta trình bày, chưa được phân tích chi tiết, các Tỳ-khưu tiếp nhận Chánh pháp sẽ học hỏi và đến hỏi Tôn giả Ānanda hoặc Tôn giả Kaccāna. Các vị ấy sẽ đối chiếu với trí tuệ của Ta mà giảng giải. Sau đó, các Tỳ-khưu tiếp nhận Chánh pháp sẽ lại hỏi Ta. Ta sẽ nói với họ: ‘Này các Tỳ-khưu, Tôn giả Ānanda đã giảng rất hay, Tôn giả Kaccāna đã giảng rất hay. Dù các con có hỏi Ta về ý nghĩa này, Ta cũng sẽ giải thích y như vậy.’ Như vậy, Ta sẽ tán dương những cá nhân đó. Từ đó, các Tỳ-khưu sẽ kính trọng họ và đến gần họ. Các vị ấy sẽ khuyến khích các Tỳ-khưu đó thực hành ý nghĩa và Chánh pháp, và khi được khuyến khích bởi các vị ấy, các Tỳ-khưu đó sẽ viên mãn ba học giới và chấm dứt khổ đau.”
Dhammathomanatthaṃ pavisanto evaṃ cintesi, yathā idheva cintesi – ‘‘mayi vihāraṃ paviṭṭhe tameva āmisadāyādaṃ garahanto dhammadāyādañca thomento imissaṃyeva parisati nisinno sāriputto dhammaṃ desessati, evaṃ dvinnampi amhākaṃ ekajjhāsayāya matiyā desitā ayaṃ desanā aggā ca garukā ca bhavissati pāsāṇacchattasadisā.
When entering to praise the Dhamma, he considers, just as he did here: “After I have entered the monastery, Sāriputta, while seated in this very assembly, will teach the Dhamma, censuring that same inheritance of material things and praising the inheritance of the Dhamma. Thus, this discourse, delivered through the single-minded intention of us both, will be paramount and authoritative, like a stone canopy.
Khi đi vào để tán dương Chánh pháp, Ngài đã suy nghĩ như ở đây: “Khi Ta đã vào tịnh xá, Tôn giả Sāriputta, ngồi ngay trong hội chúng này, sẽ quở trách những người thừa kế vật chất và tán dương những người thừa kế Chánh pháp. Như vậy, bài giảng này, được giảng bởi ý chí đồng thuận của cả hai chúng ta, sẽ trở nên tối thượng và đáng kính trọng, giống như chiếc lọng đá.
Caturoghanittharaṇaṭṭhena titthe ṭhapitā nāvā viya maggagamanaṭṭhena catuyuttaājaññaratho viya ca bhavissati.
It will be like a boat placed at a ford for the purpose of crossing the four floods, and like a chariot yoked with four thoroughbreds for the purpose of travelling the path.
Nó sẽ giống như con thuyền được đặt ở bến để vượt qua bốn dòng nước lũ, và giống như cỗ xe bốn ngựa thiện mã để đi trên con đường.
Yathā ca ‘evaṃ karontassa ayaṃ daṇḍo’ti parisati āṇaṃ ṭhapetvā uṭṭhāyāsanā pāsādaṃ āruḷhe rājini tattheva nisinno senāpati taṃ raññā ṭhapitaṃ āṇaṃ pavatteti; evampi mayā ṭhapitaṃ desanaṃ imissaṃyeva parisati nisinno sāriputto thometvā desessati, evaṃ dvinnampi amhākaṃ matiyā desitā ayaṃ desanā balavatarā majjhanhikasūriyo viya pajjalissatī’’ti.
And just as when a king, after establishing a command in the assembly, saying, ‘This is the penalty for one who does so,’ rises from his seat and ascends to the palace, a general seated right there enforces the command established by the king; in the same way, Sāriputta, seated in this very assembly, will praise and deliver the discourse I have established. Thus, this discourse, delivered with the intention of us both, will become more powerful and will blaze like the midday sun.”
Và cũng như khi nhà vua, sau khi ban bố lệnh trong hội chúng rằng ‘ai làm điều này sẽ bị hình phạt này’ rồi đứng dậy khỏi chỗ ngồi và lên cung điện, thì vị tướng quân ngồi ngay tại đó sẽ thi hành lệnh vua đã ban; cũng vậy, Tôn giả Sāriputta, ngồi ngay trong hội chúng này, sẽ tán dương và giảng giải bài giảng mà Ta đã ban bố. Như vậy, bài giảng này, được giảng bởi ý chí của cả hai chúng ta, sẽ trở nên mạnh mẽ hơn, chiếu sáng như mặt trời giữa trưa.”
Evamidha dhammathomanatthaṃ uṭṭhāyāsanā vihāraṃ pāvisi.
Thus, here he rose from his seat and entered the monastery in order to praise the Dhamma.
Như vậy, ở đây, Ngài đứng dậy khỏi chỗ ngồi và đi vào tịnh xá để tán dương Chánh pháp.
31. Evaṃ paviṭṭhe pana bhagavati bhagavato adhippāyānurūpaṃ taṃ dhammaṃ thometukāmo tatra kho āyasmā sāriputto…pe…etadavoca.
31. Now, after the Blessed One had entered thus, the Venerable Sāriputta, wishing to praise that Dhamma in accordance with the Blessed One’s intention, said, “Then, venerable sirs…” and so on.
31. Khi Đức Thế Tôn đã đi vào như vậy, Tôn giả Sāriputta, muốn tán dương Chánh pháp phù hợp với ý định của Đức Thế Tôn, đã nói: “Này chư Tỳ-khưu, Tôn giả Sāriputta… (v.v.)… đã nói điều này.”
Tattha āyasmāti piyavacanametaṃ.
Therein, “Venerable” is an endearing term.
Trong đó, “Āyasmā” là một lời nói thân ái.
Sāriputtoti tassa therassa nāmaṃ, tañca kho mātito, na pitito.
“Sāriputta” is that elder's name, and it is from his mother, not his father.
“Sāriputta” là tên của vị Trưởng lão đó, và đó là tên theo mẹ, không phải theo cha.
Rūpasāriyā hi brāhmaṇiyā so putto, tasmā sāriputtoti vuccati.
For he was the son of the brahmin lady Rūpasārī; therefore, he is called Sāriputta.
Vì Ngài là con của Bà-la-môn nữ Rūpasārī, nên Ngài được gọi là Sāriputta.
Acirapakkantassāti pakkantassa sato nacirena.
“Soon after he had departed” means not long after he had departed.
“Acirapakkantassa” có nghĩa là không lâu sau khi Ngài đã rời đi.
Āvuso, bhikkhaveti ettha pana buddhā bhagavanto sāvake ālapantā bhikkhaveti ālapanti.
As for “Venerable sirs, bhikkhus,” the Buddhas, the Blessed Ones, when addressing disciples, address them as “bhikkhus.”
Ở đây, khi các Đức Phật, các Đức Thế Tôn gọi các đệ tử, các Ngài gọi là “Bhikkhave”.
Sāvakā pana buddhehi sadisā mā homāti āvusoti paṭhamaṃ vatvā pacchā bhikkhaveti bhaṇanti.
But the disciples, thinking, “Let us not be the same as the Buddhas,” first say “Venerable sirs” and then say “bhikkhus.”
Còn các đệ tử, để không giống với các Đức Phật, trước tiên nói “Āvuso” rồi sau đó mới nói “Bhikkhave”.
Buddhehi ca ālapito bhikkhusaṅgho bhadanteti paṭivacanaṃ deti, sāvakehi āvusoti.
And when addressed by the Buddhas, the Saṅgha of bhikkhus replies with “Venerable Sir,” but when addressed by disciples, with “Venerable sir.”
Khi được các Đức Phật gọi, Tăng chúng Tỳ-khưu đáp lại “Bhadante”; khi được các đệ tử gọi, họ đáp lại “Āvuso”.
Kittāvatā nu kho, āvusoti ettha kittāvatāti paricchedavacanaṃ, kittakenāti vuttaṃ hoti.
In the phrase “To what extent, venerable sirs,” “to what extent” is a term of delimitation; it means “by how much.”
“Kittāvatā nu kho, āvuso” – trong câu này, “kittāvatā” là từ chỉ sự giới hạn, có nghĩa là “bằng bao nhiêu”.
Nukāro pucchāyaṃ.
The particle “nu” is used in a question.
Chữ “nu” dùng để hỏi.
Khokāro nipātamattaṃ.
The particle “kho” is merely an indeclinable.
Chữ “kho” chỉ là một giới từ.
Satthu pavivittassa viharatoti, tīhi vivekehi kāyacittaupadhivivekehi satthuno viharantassa.
“Of the Teacher who is dwelling in seclusion” means of the Teacher who is dwelling with the three kinds of seclusion: physical seclusion, mental seclusion, and seclusion from the bases of existence.
“Satthu pavivittassa viharato” có nghĩa là khi Đức Đạo Sư an trú trong ba sự viễn ly: thân viễn ly, tâm viễn ly, và phiền não viễn ly.
Vivekaṃ nānusikkhantīti tiṇṇaṃ vivekānaṃ aññatarampi nānusikkhanti, āmisadāyādāva hontīti imamatthaṃ āyasmā sāriputto bhikkhū pucchi.
“Do not train in accordance with that seclusion” means they do not train in accordance with any of the three kinds of seclusion; they are merely heirs to material things. With this meaning, the Venerable Sāriputta asked the bhikkhus.
“Vivekaṃ nānusikkhanti” có nghĩa là không thực hành bất kỳ sự viễn ly nào trong ba sự viễn ly, mà chỉ là những người thừa kế vật chất. Tôn giả Sāriputta đã hỏi các Tỳ-khưu về ý nghĩa này.
Esa nayo sukkapakkhepi.
This same method applies to the bright-sided section as well.
Nguyên tắc này cũng áp dụng cho mặt trắng (sukkhapakkha).
Evaṃ vutte tamatthaṃ sotukāmā bhikkhū dūratopi khotiādimāhaṃsu.
When this was said, the bhikkhus, wishing to hear that matter, said, “Even from afar…” and so on.
Khi được nói như vậy, các Tỳ-khưu, muốn nghe ý nghĩa đó, đã nói: “Dù ở xa…” và tiếp tục.
Tattha dūratopīti tiroraṭṭhatopi tirojanapadatopi anekayojanagaṇanatopīti vuttaṃ hoti.
Therein, even from afar means even from another country, even from another province, even from a distance counted in many yojanas, thus it is said.
Ở đó, dūratopī (từ xa) có nghĩa là từ các quốc độ khác, từ các vùng khác, từ nhiều dojana (do tuần) đường.
Santiketi samīpe.
Nearby means in the vicinity.
Santike (gần) có nghĩa là ở gần.
Aññātunti jānituṃ bujjhituṃ.
To know means to understand, to awaken to.
Aññātuṃ (để biết) có nghĩa là để biết, để giác ngộ.
Āyasmantaṃyeva sāriputtaṃ paṭibhātūti āyasmatoyeva sāriputtassa bhāgo hotu, āyasmā pana sāriputto attano bhāgaṃ katvā vibhajatūti vuttaṃ hoti.
Let it be for the venerable Sāriputta to clarify means let it be the venerable Sāriputta's portion; let the venerable Sāriputta, having made it his portion, analyze it, thus it is said.
Āyasmantaṃyeva sāriputtaṃ paṭibhātū (chỉ Tôn giả Sāriputta hãy giải thích) có nghĩa là phần này hãy thuộc về Tôn giả Sāriputta, và Tôn giả Sāriputta hãy phân chia phần của mình.
Āyasmato hi bhāgo yadidaṃ atthakkhānaṃ, amhākaṃ pana savanaṃ bhāgoti ayamettha adhippāyo, evaṃ saddalakkhaṇena sameti.
Indeed, the explanation of the meaning is the venerable one's portion, while our portion is the listening; this is the intention here. In this way, it is consistent with the characteristics of the language.
Vì phần của Tôn giả là việc giải thích ý nghĩa, còn phần của chúng tôi là lắng nghe – đây là ý nghĩa ở đây, và như vậy phù hợp với ngữ pháp.
Keci pana bhaṇanti ‘‘paṭibhātūti dissatū’’ti.
Some, however, say that “let it be clarified” means “let it be seen.”
Một số người nói rằng “ paṭibhātū có nghĩa là hãy xuất hiện (trong tâm).”
Apare ‘‘upaṭṭhātū’’ti.
Others, “let it arise in the mind.”
Những người khác nói “hãy hiện hữu (trong tâm).”
Dhāressantīti uggahessanti pariyāpuṇissanti.
They will bear in mind means they will learn it, they will master it.
Dhāressantī (họ sẽ ghi nhớ) có nghĩa là họ sẽ học thuộc lòng, họ sẽ ghi nhớ.
Tato nesaṃ kathetukāmo thero tena hītiādimāha.
Then, desiring to speak to them, the elder said Then and so on.
Do đó, vị Trưởng lão muốn giảng giải cho họ nên đã nói “ tena hī” (vậy thì) và tiếp tục.
Tattha tenāti kāraṇavacanaṃ.
Therein, then is a word indicating a reason.
Ở đó, tena (thế thì) là một từ chỉ nguyên nhân.
Hikāro nipāto.
The particle hi is a mere particle.
Từ hi là một tiểu từ.
Yasmā sotukāmāttha, yasmā ca mayhaṃ bhāraṃ āropayittha, tasmā suṇāthāti vuttaṃ hoti.
Because you are eager to hear, and because you have placed this burden on me, therefore listen, thus it is said.
Nó có nghĩa là: “Vì các vị muốn nghe, và vì các vị đã đặt gánh nặng lên tôi, nên hãy lắng nghe.”
Tepi bhikkhū therassa vacanaṃ sampaṭicchiṃsu, tenāha ‘‘evamāvusoti…pe…paccassosu’’nti.
Those bhikkhus also consented to the elder's word; therefore, it is said, “Yes, friend… and so on… they paid attention.”
Các vị Tỳ-khưu ấy cũng đã chấp nhận lời của vị Trưởng lão, vì vậy kinh nói: “Thưa Tôn giả, vâng…pe… chúng con sẽ lắng nghe.”
Ettāvatā yañca bhagavā āmisadāyādapaṭipadaṃ garahanto ‘‘tumhepi tena ādiyā bhaveyyāthā’’ti āha, yañca attanā pucchaṃ pucchi ‘‘kittāvatā nu kho…pe… nānusikkhantī’’ti, tassa vitthārato attho suvibhatto hoti.
To this extent, both what the Blessed One said, censuring the practice of inheriting material things—“May you also be censured for that”—and the question he himself asked—“To what extent, friends… and so on… do they not train in accordance with it?”—the meaning of this is well analyzed in detail.
Đến đây, ý nghĩa của điều Đức Thế Tôn đã nói khi quở trách con đường thừa kế vật chất là “các vị cũng có thể trở thành những người thừa kế vật chất”, và câu hỏi mà chính Tôn giả đã hỏi là “đến mức độ nào…pe… không thực hành theo” đã được giải thích chi tiết.
So ca kho bhagavato ādiyabhāvaṃ anāmasitvāva.
And this, moreover, is without alluding to the Blessed One being censured.
Và điều đó đã được giải thích mà không đề cập đến việc Đức Thế Tôn là người đáng quở trách.
Bhagavatoyeva hi yuttaṃ sāvake anuggaṇhantassa ‘‘ahampi tena ādiyo bhavissāmī’’ti vattuṃ, na sāvakānaṃ.
Indeed, it is appropriate for the Blessed One, when censuring the disciples, to say, “I too would be censured for that,” but not for the disciples.
Thật vậy, chỉ Đức Thế Tôn mới thích hợp để nói “ta cũng sẽ là người đáng quở trách” khi Ngài ban ân cho các đệ tử, chứ không phải các đệ tử.
Esa nayo sukkapakkhepi, ayaṃ tāvettha anusandhikkamayojanā.
This same method applies also to the bright side. This, for now, is the application of the method of connection.
Nguyên tắc này cũng áp dụng cho phe trắng (sukkha-pakkhā), đây là cách kết nối và giải thích tuần tự ở đây.
Ayaṃ panatthavaṇṇanā idhāti imasmiṃ sāsane, satthu pavivittassāti satthuno tīhi vivekehi accantapavivittassa.
This, however, is the explanation of the meaning: Here means in this Dispensation; of the Teacher living in seclusion means of the Teacher who is utterly secluded by the three kinds of seclusion.
Đây là lời giải thích ý nghĩa: idha (ở đây) có nghĩa là trong giáo pháp này; satthu pavivittassa (của Bậc Đạo Sư sống độc cư) có nghĩa là của Bậc Đạo Sư hoàn toàn độc cư với ba loại độc cư.
Vivekaṃ nānusikkhantīti kāyavivekaṃ nānusikkhanti, na paripūrentīti vuttaṃ hoti.
They do not train in accordance with seclusion means they do not train in accordance with physical seclusion, they do not fulfill it, thus it is said.
Vivekaṃ nānusikkhantī (họ không thực hành theo sự độc cư) có nghĩa là họ không thực hành theo sự độc cư thân, họ không hoàn thiện nó.
Yadi pana tividhaṃ vivekaṃ sandhāya vadeyya, pucchāya aviseso siyā.
But if he were speaking with reference to the three kinds of seclusion, there would be no distinction in the question.
Nếu nói đến ba loại độc cư, thì câu hỏi sẽ không có sự khác biệt.
Byākaraṇapakkho hi ayaṃ.
For this is the side of the explanation.
Vì đây là phần giải thích.
Tasmā iminā padena kāyavivekaṃ, ‘‘yesañca dhammāna’’ntiādinā cittavivekaṃ, ‘‘bāhulikā’’tiādinā upadhivivekañca dassetīti evamettha saṅkhepato attho veditabbo.
Therefore, it should be understood that by this phrase he shows physical seclusion; by “and those states…” and so on, he shows mental seclusion; and by “given to abundance…” and so on, he shows the seclusion from the upadhis. In this way, the meaning here should be understood in brief.
Do đó, với từ này, nó chỉ ra sự độc cư thân; với “yesañca dhammānaṃ” (và những pháp nào) v.v., nó chỉ ra sự độc cư tâm; và với “bāhulikā” (những người ham muốn nhiều) v.v., nó chỉ ra sự độc cư đối với các u-pādhi (phiền não); ý nghĩa tóm tắt ở đây nên được hiểu như vậy.
Yesañca dhammānanti lobhādayo sandhāyāha, ye parato ‘‘tatrāvuso lobho ca pāpako’’tiādinā nayena vakkhati.
And of those states—he says this referring to greed and so on, which he will speak of later in the manner of “Therein, friends, greed is evil” and so on.
Yesañca dhammāna (và những pháp nào) được nói đến để chỉ tham ái và các pháp tương tự, những pháp mà sau này sẽ được nói đến theo cách “này chư Hiền, tham ái là ác” v.v.
Nappajahantīti na pariccajanti, cittavivekaṃ na paripūrentīti vuttaṃ hoti.
They do not abandon means they do not relinquish; they do not fulfill mental seclusion, thus it is said.
Nappajahantī (họ không từ bỏ) có nghĩa là họ không từ bỏ, họ không hoàn thiện sự độc cư tâm.
Bāhulikāti cīvarādibāhullāya paṭipannā.
Given to abundance means they are committed to an abundance of robes and so on.
Bāhulikā (những người ham muốn nhiều) là những người thực hành theo sự ham muốn nhiều về y phục v.v.
Sāsanaṃ sithilaṃ gaṇhantīti sāthalikā.
They grasp the Dispensation loosely, thus they are lax.
Họ nắm giữ giáo pháp một cách lỏng lẻo, nên được gọi là sāthalikā (những người lỏng lẻo).
Okkamane pubbaṅgamā ti ettha okkamanaṃ vuccanti avagamanaṭṭhena pañca nīvaraṇāni, tena pañcanīvaraṇapubbaṅgamāti vuttaṃ hoti.
In leaders in backsliding, backsliding is a term for the five hindrances, in the sense of descent; thus, it is said that they are leaders in the five hindrances.
Trong okkamane pubbaṅgamā (đi trước trong sự thoái lui), okkamanaṃ (thoái lui) được gọi là năm triền cái theo nghĩa đi xuống; do đó, nó có nghĩa là đi trước năm triền cái.
Paviveketi upadhiviveke nibbāne.
In seclusion means in Nibbāna, the seclusion from the upadhis.
Paviveke (trong sự độc cư) có nghĩa là trong Niết Bàn, sự độc cư đối với các u-pādhi.
Nikkhittadhurāti oropitadhurā, tadadhigamāya ārambhampi akurumānāti, ettāvatā upadhivivekaṃ na paripūrentīti vuttaṃ hoti.
Having laid down the yoke means having cast off the burden; not even making an effort to attain it. To that extent, they do not fulfill the seclusion from the upadhis, thus it is said.
Nikkhittadhurā (những người đã buông bỏ gánh nặng) là những người đã buông bỏ gánh nặng, những người thậm chí không bắt đầu nỗ lực để đạt được điều đó; điều này có nghĩa là họ không hoàn thiện sự độc cư đối với các u-pādhi.
Ettāvatā aniyameneva vatvā idāni desanaṃ niyamento ‘‘tatrāvuso’’tiādimāha.
Having spoken thus far in a general way, he now specifies the teaching by saying Therein, friends, and so on.
Sau khi nói một cách không xác định như vậy, bây giờ để xác định giáo pháp, Tôn giả nói “ tatrāvuso” (này chư Hiền, trong số đó) v.v.
Sāvakā ‘‘tīhi ṭhānehī’’ti evañhi aniyametvāva vuccamāne ‘‘kampi maññe bhaṇati, na amhe’’ti udāsināpi honti.
When it is said in a general way, such as “the disciples, for three reasons,” they might even be indifferent, thinking, “He must be speaking of someone else, not us.”
Nếu được nói một cách không xác định như “chư Tỳ-khưu trong ba trường hợp”, thì các đệ tử có thể thờ ơ, nghĩ rằng “chắc là nói về người khác, không phải chúng tôi.”
‘‘Therā navā majjhimā’’ti evaṃ pana niyametvā vuccamāne amhe bhaṇatīti ādaraṃ karonti.
But when it is specified, such as “the elders, the newly ordained, the middle ones,” they pay attention, thinking, “He is speaking about us.”
Nhưng nếu được nói một cách xác định như “chư Trưởng lão, chư Tỳ-khưu mới và chư Tỳ-khưu trung niên”, thì họ sẽ chú ý, nghĩ rằng “nói về chúng tôi.”
Yathā raññā ‘‘amaccehi nagaravīthiyo sodhetabbā’’ti vuttepi ‘‘kena nu kho sodhetabbā’’ti maññamānā na sodhenti, attano attano gharadvāraṃ sodhetabbanti pana bheriyā nikkhantāya sabbe muhuttena sodhenti ca alaṅkaronti ca, evaṃsampadamidaṃ veditabbaṃ.
It is like when a king says, “The city streets are to be cleaned by the ministers,” but they do not clean them, thinking, “Who is supposed to clean them?” But when the drum is beaten to announce, “Everyone should clean their own doorstep,” they all clean and decorate it in a moment. This analogy should be understood in the same way.
Ví dụ, khi nhà vua nói “các quan phải dọn dẹp các con đường trong thành phố”, họ có thể không dọn dẹp vì nghĩ “ai sẽ dọn dẹp đây?” Nhưng khi tiếng trống được gióng lên rằng mỗi người phải dọn dẹp trước cửa nhà mình, thì tất cả đều dọn dẹp và trang hoàng trong chốc lát; điều này nên được hiểu theo cách tương tự.
Tattha tatrāti tesu sāvakesu.
Therein, therein means among those disciples.
Ở đó, tatrā (trong số đó) có nghĩa là trong số những đệ tử đó.
Therāti dasavasse upādāya vuccanti.
Elders refers to those from ten rains-retreats upwards.
Therā (Trưởng lão) được gọi là những vị có từ mười hạ lạp trở lên.
Tīhi ṭhānehīti tīhi kāraṇehi.
For three reasons means for three causes.
Tīhi ṭhānehī (trong ba trường hợp) có nghĩa là vì ba nguyên nhân.
Ayañhi ṭhānasaddo issariyaṭṭhitikhaṇakāraṇesu dissati.
Indeed, this word ṭhāna is seen in the senses of authority, standing, occasion, and cause.
Thật vậy, từ ṭhāna này được thấy trong các nghĩa quyền lực, sự ổn định, khoảnh khắc và nguyên nhân.
‘‘Kiṃ panāyasmā devānamindo kammaṃ katvā imaṃ ṭhānaṃ patto’’tiādīsu hi issariye dissati.
For in passages such as, “What kamma did the venerable Devānaminda do to attain this position?” it is seen in the sense of authority.
Nó được thấy trong nghĩa quyền lực trong các câu như “Thưa Tôn giả, Đế Thích đã làm nghiệp gì mà đạt được địa vị này?”
‘‘Ṭhānakusalo hoti akkhaṇavedhī’’tiādīsu ṭhitiyaṃ.
In passages such as, “He is skilled in standing, a shooter of the instant,” it is seen in the sense of standing.
Trong nghĩa sự ổn định trong các câu như “người thiện xảo trong vị trí, người bắn trúng mục tiêu trong khoảnh khắc.”
‘‘Ṭhānasovetaṃ tathāgataṃ paṭibhātī’’tiādīsu (ma. ni. 2.87) khaṇe.
In passages such as, “It is an occasion for the Tathāgata to understand this,” it is seen in the sense of occasion.
Trong nghĩa khoảnh khắc trong các câu như “điều đó xuất hiện trước Đức Như Lai trong khoảnh khắc đó.”
‘‘Ṭhānañca ṭhānato aṭṭhānañca aṭṭhānato’’tiādīsu (vibha. 809; ma. ni. 1.148) kāraṇe.
In passages such as, “He understands a reason as a reason and a non-reason as a non-reason,” it is seen in the sense of cause.
Trong nghĩa nguyên nhân trong các câu như “nguyên nhân và không nguyên nhân từ nguyên nhân và không nguyên nhân.”
Idha pana kāraṇeyeva.
Here, however, it is in the sense of cause.
Ở đây, nó chỉ có nghĩa là nguyên nhân.
Kāraṇañhi yasmā tattha phalaṃ tiṭṭhati tadāyattavuttibhāvena, tasmā ṭhānanti vuccati.
Indeed, because the result stands in it, having its existence dependent on it, a cause is called a ṭhāna (standing-place).
Thật vậy, nguyên nhân được gọi là ṭhāna (vị trí) vì kết quả tồn tại ở đó, tùy thuộc vào sự tồn tại của nó.
Iminā paṭhamena ṭhānena therā bhikkhū gārayhāti ettha gārayhāti garahitabbā.
In the passage For this first reason, the elder bhikkhus are censurable, censurable means they are to be censured.
Trong câu iminā paṭhamena ṭhānena therā bhikkhū gārayhā (chư Tỳ-khưu Trưởng lão đáng bị quở trách vì trường hợp thứ nhất này), gārayhā (đáng bị quở trách) có nghĩa là đáng bị khiển trách.
Therā nāma samānā araññavanapatthāni pantāni senāsanāni na upenti, gāmantasenāsanaṃ na muñcanti, saṅgaṇikārāmataṃ vaḍḍhentā viharanti, kāyavivekampi na paripūrenti, navamajjhimakāle kīdisā ahesunti evaṃ ninditabbā honti, imaṃ nindaṃ āvuso labhantīti dasseti.
Although they are called elders, they do not approach the remote forest and wilderness dwellings; they do not leave the dwellings near villages; they live promoting delight in company; they do not even fulfill physical seclusion. What must they have been like in their time as newly ordained and middle ones? Thus they are to be reproached. He shows that they receive this reproach, friends.
Nó chỉ ra rằng: “Này chư Hiền, những vị được gọi là Trưởng lão, mặc dù là Trưởng lão, nhưng không đi đến các trú xứ thanh vắng trong rừng, các khu rừng cây, không rời bỏ các trú xứ gần làng, sống bằng cách gia tăng sự ham thích hội họp, và thậm chí không hoàn thiện sự độc cư thân. Họ đáng bị khiển trách như vậy, rằng ‘họ đã như thế nào vào thời kỳ Tỳ-khưu mới và Tỳ-khưu trung niên?’ Họ nhận sự khiển trách này, này chư Hiền.”
Dutiyena ṭhānenāti etthāpi ime nāma āvuso therāpi samānā yesaṃ dhammānaṃ satthā pahānamāha, te lobhādidhamme na jahanti, accharāsaṅghātamattampi ekamantaṃ nisīditvā cittekaggataṃ na labhanti, navamajjhimakāle kīdisā ahesunti evaṃ ninditabbā honti, imaṃ nindaṃ āvuso labhantīti dassetīti evaṃ yojanā kātabbā.
Regarding For the second reason, here too, the construction should be made thus: Although they are called elders, friends, they do not abandon those states of greed and so on, which the Teacher said are to be abandoned. They do not attain mental concentration even for the duration of a finger-snap while sitting in solitude. What must they have been like in their time as newly ordained and middle ones? Thus they are to be reproached. He shows that they receive this reproach, friends.
Trong câu dutiyena ṭhānenā (vì trường hợp thứ hai), cũng vậy, nên kết nối như sau: “Này chư Hiền, những vị này, mặc dù là Trưởng lão, nhưng không từ bỏ những pháp như tham ái mà Bậc Đạo Sư đã dạy phải từ bỏ, họ không đạt được sự định tâm ngay cả trong một khoảnh khắc ngắn ngủi khi ngồi một mình. Họ đáng bị khiển trách như vậy, rằng ‘họ đã như thế nào vào thời kỳ Tỳ-khưu mới và Tỳ-khưu trung niên?’ Họ nhận sự khiển trách này, này chư Hiền.”
Tatiyena ṭhānenāti etthāpi ime nāmāvuso, therāpi samānā itarītarena na yāpenti, cīvarapattasenāsanapūtikāyamaṇḍanānuyogamanuyuttā viharanti upadhivivekaṃ apūrayamānā, navamajjhimakāle kīdisā ahesunti evaṃ ninditabbā honti, imaṃ nindaṃ, āvuso, labhantīti dassetīti evaṃ yojanā veditabbā.
Regarding For the third reason, here too, the construction should be understood thus: Although they are called elders, friends, they do not subsist on whatever comes their way. They live devoted to the pursuit of adorning their robes, bowls, dwellings, and putrid bodies, not fulfilling the seclusion from the upadhis. What must they have been like in their time as newly ordained and middle ones? Thus they are to be reproached. He shows that they receive this reproach, friends.
Trong câu tatiyena ṭhānenā (vì trường hợp thứ ba), cũng vậy, nên hiểu sự kết nối như sau: “Này chư Hiền, những vị này, mặc dù là Trưởng lão, nhưng không sống với bất cứ thứ gì có sẵn, họ sống bằng cách thực hành trang điểm y phục, bát, trú xứ và thân thể mục nát, không hoàn thiện sự độc cư đối với các u-pādhi. Họ đáng bị khiển trách như vậy, rằng ‘họ đã như thế nào vào thời kỳ Tỳ-khưu mới và Tỳ-khưu trung niên?’ Họ nhận sự khiển trách này, này chư Hiền.”
Esa nayo majjhimanavavāresu.
This is the method for the sections on the middle and newly ordained ones.
Nguyên tắc này cũng áp dụng cho các trường hợp Tỳ-khưu trung niên và Tỳ-khưu mới.
Ayaṃ pana viseso.
This, however, is the distinction.
Đây là một điểm đặc biệt.
Majjhimāti pañcavasse upādāya yāva nava vassā vuccanti.
Middle ones refers to those from five rains-retreats up to nine rains-retreats.
Majjhimā (Tỳ-khưu trung niên) được gọi là những vị có từ năm hạ lạp đến chín hạ lạp.
Navāti ūnapañcavassā vuccanti.
Newly ordained ones refers to those with less than five rains-retreats.
Navā (Tỳ-khưu mới) được gọi là những vị có dưới năm hạ lạp.
Yathā ca tattha navamajjhimakāle kīdisā ahesunti vuttaṃ, evamidha navakāle kīdisā ahesuṃ, therakāle kīdisā bhavissanti, majjhimatherakāle kīdisā bhavissantīti vatvā yojetabbaṃ.
And just as it was said there, “What must they have been like in their time as newly ordained and middle ones?” so here it should be connected by saying: “What must they have been like in their time as newly ordained? What will they be like in their time as elders? What will they be like in their time as middle and elder monks?”
Và như đã nói ở đó rằng “họ đã như thế nào vào thời kỳ Tỳ-khưu mới và Tỳ-khưu trung niên”, thì ở đây, trong các trường hợp Tỳ-khưu trung niên và Tỳ-khưu mới, nên nói và kết nối rằng “họ đã như thế nào vào thời kỳ Tỳ-khưu mới, họ sẽ như thế nào vào thời kỳ Trưởng lão, họ sẽ như thế nào vào thời kỳ Tỳ-khưu trung niên và Trưởng lão.”
32. Imasmiñca kaṇhapakkhe vuttapaccanīkanayena sukkapakkhe attho veditabbo.
32. And in this dark side, the meaning of the bright side should be understood by way of the opposite of what has been said.
32. Và trong phe đen (kaṇha-pakkhā) này, ý nghĩa trong phe trắng (sukkha-pakkhā) nên được hiểu theo cách đối lập với những gì đã nói.
Ayaṃ panettha saṅkhepo.
This is the summary here.
Đây là tóm tắt ở đây.
Ime vata therāpi samānā yojanaparamparāya araññavanapatthāni pantāni senāsanāni sevanti, gāmantasenāsanaṃ upagantuṃ yuttakālepi na upagacchanti, evaṃ jiṇṇasarīrāpi āraddhavīriyā paccayadāyakānaṃ pasādaṃ janenti, navamajjhimakāle kīdisā ahesunti iminā paṭhamena ṭhānena therā pāsaṃsā bhavanti, pasaṃsaṃ labhanti.
Indeed, these monks, even while being elders, frequent remote forest wildernesses that are a succession of leagues away; even when it is a suitable time to go to a dwelling near a village, they do not go. Thus, even with aged bodies, being of roused energy, they generate faith in the donors of requisites. By this first reason, thinking, “What must they have been like in their time as new and middle monks?” the elders are praiseworthy and receive praise.
Những vị Trưởng lão này, dù đã là Trưởng lão, vẫn nương tựa vào các trú xứ rừng sâu, xa xăm, cách xa hàng yojana, và ngay cả vào những lúc thích hợp để đến trú xứ gần làng, họ cũng không đến. Dù thân thể đã già yếu như vậy, họ vẫn tinh tấn, tạo nên niềm tịnh tín cho các thí chủ. Vào thời kỳ tân học và trung học, họ đã như thế nào? Do lý do đầu tiên này, các vị Trưởng lão được tán dương, được nhận lời khen ngợi.
Lobhādayo pahāya cittavivekaṃ pūrenti, ayampi mahāthero saddhivihārikaantevāsikaparivārito hutvā nisīdituṃ yuttakālepi īdisepi vaye vattamāne bhattakiccaṃ katvā paviṭṭho sāyaṃ nikkhamati, sāyaṃ paviṭṭho pāto nikkhamati, kasiṇaparikammaṃ karoti, samāpattiyo nibbatteti, maggaphalāni adhigacchati, sabbathāpi cittavivekaṃ pūretīti iminā dutiyena ṭhānena therā bhikkhū pāsaṃsā bhavanti, pasaṃsaṃ labhanti.
Having abandoned greed and so on, they fulfill seclusion of mind. Even when it is a suitable time for this great elder to sit surrounded by his resident pupils and co-residents, and while being of such an advanced age, having done his meal duties, he enters seclusion and comes out in the evening; having entered in the evening, he comes out in the morning. He does the preliminary kasina work, produces attainments, realizes the paths and fruits. In every way, he fulfills seclusion of mind. By this second reason, the elder monks are praiseworthy and receive praise.
Sau khi từ bỏ lòng tham, v.v., họ hoàn mãn sự ly dục của tâm (cittaviveka). Vị Đại Trưởng lão này, dù được các đệ tử và học trò vây quanh, và ngay cả vào lúc thích hợp để an tọa, khi đã thọ thực xong, vào tuổi đã cao như vậy, nếu vào rừng thì tối lại ra, nếu tối vào thì sáng sớm lại ra. Ngài thực hành kasiṇa, chứng đắc các thiền định (samāpatti), đạt được các Đạo và Quả (maggaphalāni). Bằng mọi cách, ngài hoàn mãn sự ly dục của tâm (cittaviveka). Do lý do thứ hai này, các vị Trưởng lão Tỳ-kheo được tán dương, được nhận lời khen ngợi.
Yasmiṃ kāle therassa paṭṭadukūlakoseyyādīni sukhasamphassāni lahucīvarādīni yuttāni, tasmimpi nāma kāle ayaṃ mahāthero paṃsukūlāni dhāreti, asithilaṃ sāsanaṃ gahetvā vigatanīvaraṇo phalasamāpattiṃ appetvā upadhivivekaṃ paripūrayamāno viharati, navamajjhimakāle kīdiso ahosīti iminā tatiyena ṭhānena therā pāsaṃsā bhavanti, pasaṃsaṃ labhantīti.
At a time when light robes with a pleasant touch, such as those made of linen, cotton, or silk, are suitable for the elder, even at such a time this great elder wears robes made of rags from a dust-heap. Taking up the teaching without laxity, with hindrances gone, having entered into the attainment of fruition, he dwells perfecting the seclusion from the aggregates. By this third reason, thinking, “What must he have been like in his time as a new and middle monk?” the elders are praiseworthy and receive praise.
Vào thời điểm mà các loại y phục mềm mại, nhẹ nhàng như lụa Pattan, vải dukūla, lụa koseyya, v.v., là thích hợp cho vị Trưởng lão, thì vào thời điểm đó, vị Đại Trưởng lão này lại mặc y phấn tảo (paṃsukūla). Ngài giữ vững giáo pháp (sāsana), không còn triền cái (nīvaraṇa), nhập vào quả thiền (phalasamāpatti), sống viên mãn sự ly dục khỏi các yếu tố cấu thành (upadhiviveka). Vào thời kỳ tân học và trung học, ngài đã như thế nào? Do lý do thứ ba này, các vị Trưởng lão được tán dương, được nhận lời khen ngợi.
Esa nayo majjhimanavavāresu.
This is the method for the sections on middle and new monks.
Cách thức này cũng áp dụng cho các trường hợp trung học và tân học.
33. Tatrāvusoti ko anusandhi, evaṃ navahākārehi āmisadāyādapaṭipadaṃ garahanto, navahi dhammadāyādapaṭipadaṃ thomento, aṭṭhārasahākārehi desanaṃ niṭṭhāpetvā, ye te ‘‘yesañca dhammānaṃ satthā pahānamāha, te ca dhamme na pajahantī’’ti evaṃ pahātabbadhammā vuttā.
33. Regarding “There, friends,” what is the connection? Thus, having censured the practice of being an heir to material things in nine ways, and having praised the practice of being an heir to the Dhamma in nine ways, and having concluded the discourse in eighteen ways, those things to be abandoned were spoken of thus: “The Teacher speaks of the abandoning of certain dhammas, but they do not abandon those dhammas.”
33. Thưa các hiền giả (Tatrāvuso): Mối liên hệ là gì? Sau khi chỉ trích con đường thừa tự vật chất bằng chín cách, tán dương con đường thừa tự Pháp bằng chín cách, và hoàn tất bài giảng bằng mười tám cách, những pháp ác đã được nói đến là "những pháp mà Đức Đạo Sư đã nói là cần phải từ bỏ, và họ không từ bỏ những pháp đó".
Te sarūpato ‘‘ime te’’ti dassetumidaṃ ‘‘tatrāvuso, lobho cā’’tiādimāha, ayaṃ anusandhi.
To show them in their own nature as “these are they,” he said this, beginning with “There, friends, both greed…” This is the connection.
Để chỉ rõ bản chất của những pháp đó là "chính những pháp này", Đức Phật đã nói "Thưa các hiền giả, tham lam là ác", v.v. Đây là mối liên hệ.
Tattha tatrāti atītadesanānidassanaṃ, ‘‘satthu pavivittassa viharato sāvakā vivekaṃ nānusikkhantī’’tiādinā nayena vuttadesanāyanti vuttaṃ hoti.
Therein, there is a reference to the preceding teaching. It means in the teaching spoken of in the manner beginning with, “When the Teacher dwells in seclusion, the disciples do not train in seclusion.”
Trong đó, tatrā là sự chỉ dẫn đến bài giảng đã qua, có nghĩa là "trong bài giảng đã được nói theo cách như 'khi Đức Đạo Sư sống độc cư, các đệ tử không tu tập sự độc cư'", v.v.
Lobho ca pāpako, doso ca pāpakoti ime dve dhammā pāpakā lāmakā, ime pahātabbāti dasseti.
Both greed is evil, and hate is evil—this shows that these two dhammas are evil, base, and should be abandoned.
Tham là ác, sân là ác: Hai pháp này là ác, là xấu. Đức Phật chỉ ra rằng chúng cần phải được từ bỏ.
Tattha lubbhanalakkhaṇo lobho.
Therein, greed has the characteristic of coveting.
Trong đó, tham (lobha) có đặc tính là sự ham muốn.
Dussanalakkhaṇo doso.
Hate has the characteristic of corrupting.
Sân (dosa) có đặc tính là sự bất mãn.
Tesu lobho āmisadāyādassa paccayānaṃ lābhe hoti, doso alābhe.
Of these, greed arises in the heir to material things upon the gain of requisites, and hate upon the lack of gain.
Trong hai pháp này, tham phát sinh khi người thừa tự vật chất nhận được các yếu tố hỗ trợ; sân phát sinh khi không nhận được.
Lobhena aladdhaṃ pattheti, dosena alabhanto vighātavā hoti.
Through greed, one yearns for what has not been gained; through hate, one becomes vexed when not gaining it.
Do tham, người ta mong muốn những gì chưa đạt được; do sân, người ta trở nên đau khổ khi không đạt được.
Lobho ca deyyadhamme hoti, doso adāyake vā amanuññadāyake vā.
Greed arises regarding the object to be given, and hate arises toward the non-giver or the one who gives what is unpleasant.
Tham phát sinh đối với các vật cúng dường; sân phát sinh đối với người không dâng cúng hoặc người dâng cúng những vật không vừa ý.
Lobhena navataṇhāmūlake dhamme paripūreti, dosena pañca macchariyāni.
Through greed, one fulfills the nine dhammas rooted in craving; through hate, the five kinds of stinginess.
Do tham, người ta hoàn mãn chín pháp gốc của ái; do sân, người ta hoàn mãn năm sự bỏn xẻn.
Idāni tesaṃ pahānūpāyaṃ dassento lobhassa ca pahānāyātiādimāha.
Now, showing the means for their abandoning, he spoke the passage beginning for the abandoning of greed.
Bây giờ, để chỉ ra phương pháp từ bỏ chúng, Đức Phật đã nói "để từ bỏ tham", v.v.
Tassattho, tassa pana pāpakassa lobhassa ca dosassa ca pahānāya.
Its meaning is: for the abandoning of that evil greed and hate.
Ý nghĩa của điều đó là, để từ bỏ tham ác và sân ác đó.
Atthi majjhimā paṭipadāti maggaṃ sandhāya idaṃ vuttaṃ.
There is a middle path—this was said with reference to the path.
Có một con đường trung đạo (majjhimā paṭipadā): Điều này được nói đến để chỉ con đường (magga).
Maggo hi lobho eko anto, doso eko antoti ete dve ante na upeti, na upagacchati, vimutto etehi antehi, tasmā ‘‘majjhimā paṭipadā’’ti vuccati.
For the path does not approach, does not go toward these two extremes—greed as one extreme, hate as the other extreme; it is free from these extremes. Therefore, it is called the “middle path.”
Con đường này không đi đến, không đạt đến hai cực đoan là tham một cực đoan, sân một cực đoan. Nó thoát ly khỏi hai cực đoan này, do đó được gọi là "con đường trung đạo".
Etesaṃ majjhe bhavattā ‘‘majjhimā, paṭipajjitabbato ca paṭipadāti.
Because it exists in the middle of these, it is “middle,” and because it is to be practiced, it is “path.”
Vì nó nằm giữa những điều này nên gọi là "majjhimā" (trung đạo), và vì nó là con đường cần phải thực hành nên gọi là "paṭipadā".
Tathā kāmasukhallikānuyogo eko anto, attakilamathānuyogo eko anto, sassataṃ eko anto, ucchedo eko antoti purimanayeneva vitthāretabbaṃ.
Similarly, it should be elaborated in the same way as before: the indulgence in sensual pleasures is one extreme, the practice of self-mortification is the other extreme; eternalism is one extreme, annihilationism is the other extreme.
Tương tự, sự đắm mình trong dục lạc là một cực đoan, sự hành hạ thân xác là một cực đoan; thường kiến là một cực đoan, đoạn kiến là một cực đoan. Cần phải giải thích rộng ra theo cách thức trước đó.
Cakkhukaraṇītiādīhi pana tameva paṭipadaṃ thometi.
By terms such as vision-making, he praises that very path.
Còn với cakkhukaraṇī, v.v., thì tán dương chính con đường đó.
Sā hi saccānaṃ dassanāya saṃvattati dassanapariṇāyakaṭṭhenāti cakkhukaraṇī.
For it conduces to the seeing of the truths, in the sense of leading to vision; thus it is vision-making.
Vì con đường đó dẫn đến sự thấy các chân lý, theo nghĩa là dẫn đến sự thấy, nên gọi là cakkhukaraṇī (làm phát sinh mắt).
Saccānaṃ ñāṇāya saṃvattati viditakaraṇaṭṭhenāti ñāṇakaraṇī.
It conduces to the knowledge of the truths, in the sense of making them known; thus it is knowledge-making.
Nó dẫn đến sự biết các chân lý, theo nghĩa là làm cho biết, nên gọi là ñāṇakaraṇī (làm phát sinh trí tuệ).
Rāgādīnañca vūpasamanato upasamāya saṃvattati.
And because it brings about the calming of lust and so on, it conduces to peace.
Vì nó làm lắng dịu tham, v.v., nên dẫn đến sự an tịnh (upasamāya saṃvattati).
Catunnampi saccānaṃ abhiññeyyabhāvadassanato abhiññāya saṃvattati.
Because it shows the state of being directly knowable of the four truths, it conduces to direct knowledge.
Vì nó chỉ ra rằng cả bốn chân lý đều là đối tượng cần phải thắng tri, nên dẫn đến sự thắng tri (abhiññāya saṃvattati).
Sambodho ti maggo, tassatthāya saṃvattanato sambodhāya saṃvattati.
Enlightenment is the path; because it conduces to that, it conduces to enlightenment.
Sambodha là Đạo (magga). Vì nó dẫn đến mục đích của Đạo, nên dẫn đến sự giác ngộ (sambodhāya saṃvattati).
Maggoyeva hi maggatthāya saṃvattati maggena kātabbakiccakaraṇato.
For the path itself conduces to the path, by accomplishing the task that is to be done by the path.
Chính Đạo dẫn đến mục đích của Đạo, vì nó thực hiện chức năng cần phải thực hiện bằng Đạo.
Nibbānaṃ nāma appaccayaṃ tassa pana sacchikiriyāya paccakkhakammāya saṃvattanato nibbānāya saṃvattatīti vuccati.
Nibbāna is the unconditioned; because it conduces to the realization of that, to the direct experience of it, it is said that it conduces to Nibbāna.
Niết Bàn (Nibbāna) là vô điều kiện (appaccayaṃ). Vì nó dẫn đến sự chứng ngộ, sự thực chứng Niết Bàn, nên được gọi là dẫn đến Niết Bàn (nibbānāya saṃvattati).
Ayamettha sāro.
This is the essence here.
Đây là cốt lõi ở đây.
Ito aññathā vaṇṇanā papañcā.
Explanations other than this are proliferation.
Những lời giải thích khác ngoài điều này đều là sự phô trương.
Tattha ayamevāti avadhāraṇavacanaṃ, aññamaggappaṭisedhanatthaṃ, buddhapaccekabuddhabuddhasāvakānaṃ sādhāraṇabhāvadassanatthañca.
Therein, this very is a word of determination, for the purpose of rejecting other paths, and for showing the commonality among Buddhas, Paccekabuddhas, and the disciples of a Buddha.
Trong đó, ayamevā là từ nhấn mạnh, nhằm bác bỏ các con đường khác và để chỉ ra tính phổ quát của con đường này đối với chư Phật, chư Phật Độc Giác và các đệ tử của Phật.
Vuttañcetaṃ ‘‘eseva maggo natthañño dassanassa visuddhiyā’’ti (dha. pa. 274).
And this was said: “This is the only path, there is no other for the purification of vision.”
Điều này đã được nói đến: "Đây chính là con đường, không có con đường nào khác để thanh tịnh sự thấy" (Dhammapada 274).
Svāyaṃ kilesānaṃ ārakattāpi ariyo.
This same path is noble also because it is far from the defilements.
Con đường này cũng là ariyā (cao thượng) vì nó xa lìa các phiền não.
Aripahānāya saṃvattatītipi ariyena desitotipi ariyabhāvappaṭilābhāya saṃvattatītipi ariyo.
It is noble also because it conduces to the abandoning of the enemy, because it was taught by the Noble One, and because it conduces to the attainment of the noble state.
Nó cũng là ariyā vì nó dẫn đến sự từ bỏ kẻ thù (phiền não), hoặc vì nó được các bậc ariyā thuyết giảng, hoặc vì nó dẫn đến sự chứng đắc trạng thái ariyā.
Aṭṭhahi aṅgehi upetattā aṭṭhaṅgiko, na ca aṅgavinimutto pañcaṅgikatūriyādīni viya.
Because it is endowed with eight factors, it is eightfold; and it is not separate from its factors, like a musical instrument with five parts and so on.
Nó là aṭṭhaṅgiko (có tám chi phần) vì nó bao gồm tám chi phần, và không tách rời các chi phần, giống như các nhạc cụ năm chi phần, v.v.
Kilese mārento gacchati, maggati vā nibbānaṃ, maggīyati vā nibbānatthikehi, gammati vā tehi paṭipajjīyatīti maggo.
It is a path because it goes while destroying the defilements, or it is sought by those who desire Nibbāna, or it is gone upon and practiced by them.
Nó đi đến Niết Bàn bằng cách tiêu diệt các phiền não, hoặc nó dẫn đến Niết Bàn, hoặc nó được những người mong cầu Niết Bàn tìm kiếm, hoặc nó được họ thực hành, nên gọi là con đường (maggo).
Seyyathidanti nipāto, tassa katamo so iti ceti attho, katamāni vā tāni aṭṭhaṅgānīti.
That is to say is a particle. Its meaning is, “Which is that path?” or “What are those eight factors?”
Seyyathidaṃ là một từ phụ, có nghĩa là "con đường đó là gì?", hoặc "tám chi phần đó là gì?".
Ekamekañhi aṅgaṃ maggoyeva.
For each single factor is itself a path.
Mỗi chi phần riêng lẻ chính là Đạo.
Yathāha ‘‘sammādiṭṭhi maggo ceva hetu cā’’ti (dha. sa. 1039).
As it is said: “Right view is both a path and a cause.”
Như đã nói: "Chánh kiến là Đạo và cũng là nhân" (Dhammasaṅgaṇī 1039).
Porāṇāpi bhaṇanti – ‘‘dassanamaggo sammādiṭṭhi, abhiniropanamaggo sammāsaṅkappo…pe… avikkhepamaggo sammāsamādhī’’ti.
The ancients also say: “Right view is the path of seeing, right thought is the path of application… and so on… right concentration is the path of non-distraction.”
Các bậc trưởng lão cũng nói: "Chánh kiến là đạo của sự thấy, chánh tư duy là đạo của sự định hướng... chánh định là đạo của sự không phân tán."
Sammādiṭṭhādīsu cetesu sammā dassanalakkhaṇā sammādiṭṭhi.
Among these, beginning with right view, right view has the characteristic of right seeing.
Trong số Chánh kiến, v.v., Chánh kiến (sammādiṭṭhi) có đặc tính là thấy đúng đắn.
Sammā abhiniropanalakkhaṇo sammāsaṅkappo.
Right thought has the characteristic of right application.
Chánh tư duy (sammāsaṅkappo) có đặc tính là định hướng đúng đắn.
Sammā pariggahalakkhaṇā sammāvācā.
Right speech has the characteristic of right embracing.
Chánh ngữ (sammāvācā) có đặc tính là giữ gìn đúng đắn.
Sammā samuṭṭhānalakkhaṇo sammākammanto.
Right action has the characteristic of right originating.
Chánh nghiệp (sammākammanto) có đặc tính là phát khởi đúng đắn.
Sammā vodānalakkhaṇo sammāājīvo.
Right livelihood has the characteristic of right purification.
Chánh mạng (sammāājīvo) có đặc tính là thanh tịnh đúng đắn.
Sammā paggahalakkhaṇo sammāvāyāmo.
Right effort has the characteristic of right exertion.
Chánh tinh tấn (sammāvāyāmo) có đặc tính là nâng đỡ đúng đắn.
Sammā upaṭṭhānalakkhaṇā sammāsati.
Right mindfulness has the characteristic of right establishing.
Chánh niệm (sammāsati) có đặc tính là an trú đúng đắn.
Sammā samādhānalakkhaṇo sammāsamādhi.
Right concentration has the characteristic of right composure.
Chánh định (sammāsamādhi) có đặc tính là an định đúng đắn.
Nibbacanampi nesaṃ sammā passatīti sammādiṭṭhīti eteneva nayena veditabbaṃ.
And their etymology should be understood in this way: “it sees rightly, thus it is right view.”
Sự giải thích về chúng cũng cần được hiểu theo cách tương tự: "Thấy đúng đắn nên gọi là Chánh kiến", v.v.
Evaṃ pahātabbadhammesu lobhadose tappahānupāyañca dassetvā idāni aññepi pahātabbadhamme tesaṃ pahānupāyañca dassento tatrāvuso, kodho cātiādimāha.
Having thus shown, among the states to be abandoned, greed and hatred and the means for their abandonment, he now said, “Therein, friends, anger…” and so on, to show other states to be abandoned and the means for their abandonment.
Sau khi trình bày các pháp cần đoạn trừ như tham và sân, cùng với phương pháp đoạn trừ chúng, giờ đây để trình bày các pháp cần đoạn trừ khác và phương pháp đoạn trừ chúng, đức Phật đã nói "Này các bạn, ở đây, sân (kodho) và..."
Tattha kujjhanalakkhaṇo kodho, caṇḍikkalakkhaṇo vā, āghātakaraṇaraso, dussanapaccupaṭṭhāno.
Therein, anger (kodha) has the characteristic of getting angry, or the characteristic of fierceness; its function is to commit harmful acts; its manifestation is offensiveness.
Trong số đó, sân (kodho) có đặc tính là nổi giận, hoặc đặc tính là hung dữ; có chức năng là gây ra sự thù hận; biểu hiện là sự làm hại.
Upanandhanalakkhaṇo upanāho, vera appaṭinissajjanaraso, kodhānupabandhabhāvapaccupaṭṭhāno.
Hostility (upanāha) has the characteristic of bearing a grudge; its function is not abandoning resentment; its manifestation is the continuous binding of anger.
Oán hận (upanāho) có đặc tính là cột chặt; có chức năng là không buông bỏ sự thù hận; biểu hiện là sự tiếp nối của sân.
Vuttañcetaṃ – ‘‘pubbakāle kodho, aparakāle upanāho’’tiādi (vibha. 891).
And it has been said: “First there is anger, later there is hostility,” and so on.
Điều này đã được nói: "Sân trước, oán hận sau" (Vibh. 891).
Mattabhāvalakkhaṇo mado, madaggāhaṇaraso, ummādapaccupaṭṭhāno.
Intoxication (mada) has the characteristic of being intoxicated; its function is producing an infatuated state; its manifestation is madness.
Say sưa (mado) có đặc tính là sự say sưa; có chức năng là nắm giữ sự say sưa; biểu hiện là sự điên cuồng.
Pañcasu kāmaguṇesu cittavossaggalakkhaṇo pamādo, vossaggānuppadānaraso, sativippavāsapaccupaṭṭhānoti evaṃ imesaṃ dhammānaṃ lakkhaṇādīni veditabbāni.
Heedlessness (pamāda) has the characteristic of letting the mind loose upon the five sense-pleasures; its function is to keep giving it free rein; its manifestation is absence of mindfulness. Thus, the characteristics and so on of these states should be understood.
Phóng dật (pamādo) có đặc tính là tâm buông thả trong năm dục lạc; có chức năng là buông thả và không ngăn chặn; biểu hiện là sự thiếu chánh niệm. Như vậy, các đặc tính của những pháp này cần được hiểu.
Ayamettha saṅkhepo, vitthāro pana ‘‘tattha katamo kodho’’tiādinā vibhaṅge (vibha. 891) vuttanayeneva veditabbo.
This is the summary here; the detailed explanation, however, should be understood in the way stated in the Vibhaṅga, beginning with “Therein, what is anger?”
Đây là phần tóm tắt, còn phần chi tiết cần được hiểu theo cách đã nói trong Vibhāṅga (Vibh. 891), bắt đầu bằng "Ở đây, sân là gì?".
Visesato cettha āmisadāyādo attanā alabhanto aññassa lābhino kujjhati, tassa sakiṃ uppanno kodho kodhoyeva, tatuttari upanāho.
Specifically, in this context, one who is a recipient of material things gets angry at another who receives gain when he himself does not; the anger that arises in him once is simply anger; thereafter it is hostility.
Đặc biệt ở đây, một người thừa kế vật chất, khi không nhận được gì, sẽ nổi giận với người khác đã nhận được. Sân hận một lần phát sinh của người đó là sân (kodho); nếu tiếp tục phát sinh là oán hận (upanāho).
So evaṃ kuddho upanayhanto ca santepi aññassa lābhino guṇe makkheti, ahampi tādisoti ca yugaggāhaṃ gaṇhāti, ayamassa makkho ca paḷāso ca, evaṃ makkhī paḷāsī tassa lābhasakkārādīsu kiṃ imassa imināti issati padussati, ayamassa issā.
Being thus angry and resentful, he denigrates even the existing virtues of the other who receives gain, and he adopts a rivalry, thinking, “I am also like that.” This is his denigration and contempt. Thus, being denigrating and contemptuous, he is envious and hostile regarding the other's gain and honor, thinking, “What is this to him?” This is his envy.
Khi người đó đã nổi giận và oán hận như vậy, anh ta sẽ xóa bỏ những phẩm chất tốt của người khác dù chúng có tồn tại, và tự cho mình là "Tôi cũng như vậy", đó là xóa bỏ (makkho) và xấc xược (paḷāso) của anh ta. Khi đã xóa bỏ và xấc xược như vậy, anh ta sẽ đố kỵ và làm hại người khác về những lợi lộc, sự tôn kính, v.v., của họ, nghĩ rằng "Người này có được những thứ này thì có ích gì?", đó là đố kỵ (issā) của anh ta.
Sace panassa kāci sampatti hoti, tassā tena sādhāraṇabhāvaṃ na sahati, idamassa maccheraṃ.
But if he has some prosperity, he cannot bear to share it with that person. This is his stinginess.
Nếu anh ta có bất kỳ tài sản nào, anh ta không chịu được việc chia sẻ nó với người khác, đó là keo kiệt (maccheraṃ) của anh ta.
Lābhahetu kho pana attano santepi dose paṭicchādeti, ayamassa māyā.
For the sake of gain, however, he conceals his own faults, though they exist. This is his deceit.
Vì lợi lộc, anh ta che giấu những lỗi lầm của mình dù chúng có tồn tại, đó là lừa dối (māyā) của anh ta.
Asantepi guṇe pakāseti.
He proclaims virtues he does not possess.
Anh ta phô bày những phẩm chất không có ở mình.
Idamassa sāṭheyyaṃ.
This is his fraud.
Đó là giả dối (sāṭheyyaṃ) của anh ta.
So evaṃ paṭipanno sace yathādhippāyaṃ lābhaṃ labhati, tena thaddho hoti amuducitto, nayidaṃ evaṃ kātabbanti ovadituṃ asakkuṇeyyo, ayamassa thambho.
Having behaved thus, if he obtains gain as he wishes, he becomes stiff-necked and hard-hearted because of it, unable to be admonished with, “This should not be done in this way.” This is his obstinacy.
Nếu người hành xử như vậy nhận được lợi lộc theo ý muốn, anh ta trở nên cứng nhắc, tâm không mềm mại, không thể được khuyên bảo rằng "Điều này không nên làm như vậy", đó là cứng nhắc (thambho) của anh ta.
Sace pana naṃ koci kiñci vadati ‘‘nayidaṃ evaṃ kātabba’’nti, tena sāraddhacitto hoti bhākuṭikamukho ‘‘ko me tva’’nti pasayha bhāṇī, ayamassa sārambho.
But if someone says anything to him, such as, “This should not be done in this way,” his mind becomes agitated, his face scowls, and he speaks defiantly, “Who are you to me?” This is his presumption.
Nếu có ai đó nói với anh ta rằng "Điều này không nên làm như vậy", anh ta trở nên bực tức, mặt cau có, nói một cách hung hăng "Ngươi là ai mà nói ta?", đó là kiêu căng (sārambho) của anh ta.
Tato thambhena ‘‘ahameva seyyo’’ti attānaṃ maññanto mānī hoti.
Then, through obstinacy, he becomes conceited, thinking, “I alone am superior.”
Từ đó, do cứng nhắc, anh ta tự cho mình là "chỉ có tôi là tốt nhất" và trở nên ngã mạn.
Sārambhena ‘‘ke ime’’ti pare atimaññanto atimānī, ayamassa māno ca atimāno ca.
Through presumption, he becomes arrogant, despising others, thinking, “Who are these people?” This is his conceit and arrogance.
Do kiêu căng, anh ta khinh thường người khác, nghĩ rằng "những kẻ này là ai?", và trở nên quá ngã mạn. Đó là ngã mạn (māno) và quá ngã mạn (atimāno) của anh ta.
So tehi mānātimānehi jātimadādianekarūpaṃ madaṃ janeti.
Through that conceit and arrogance, he generates various forms of intoxication, such as intoxication with birth.
Do ngã mạn và quá ngã mạn đó, anh ta sinh ra nhiều loại say sưa khác nhau như say sưa về dòng dõi, v.v.
Matto samāno kāmaguṇādibhedesu vatthūsu pamajjati, ayamassa mado ca pamādo cāti.
Being intoxicated, he becomes heedless in matters concerning sense-pleasures and so on. This is his intoxication and heedlessness.
Khi đã say sưa, anh ta trở nên phóng dật trong các đối tượng như năm dục lạc, đó là say sưa (mado) và phóng dật (pamādo) của anh ta.
Ñāṇaparicayapāṭavatthaṃ panettha ayaṃ bhedo ca kamo ca bhāvanānayo ca veditabbo.
For the sake of proficiency through familiarity with knowledge, this distinction, this sequence, and this method of development should be understood here.
Để rèn luyện sự khéo léo trong trí tuệ, ở đây cần hiểu sự phân biệt, trình tự và phương pháp tu tập.
Tattha bhedo tāva, ayañhi majjhimā paṭipadā kadāci ariyo aṭṭhaṅgiko maggo hoti, kadāci sattaṅgiko.
Therein, first, as to the distinction: this middle path is sometimes the Noble Eightfold Path, and sometimes the Sevenfold Path.
Trước hết, về sự phân biệt: Con đường trung đạo này đôi khi là Bát Chánh Đạo (ariyo aṭṭhaṅgiko maggo), đôi khi là Thất Chánh Đạo (sattaṅgiko).
Ayañhi lokuttarapaṭhamajjhānavasena uppajjamāno aṭṭhaṅgiko maggo hoti, avasesajjhānavasena sattaṅgiko.
For when it arises by way of the supramundane first jhāna, it is the Eightfold Path; by way of the remaining jhānas, it is the Sevenfold Path.
Khi phát sinh theo đệ nhất thiền siêu thế (lokuttarapaṭhamajjhāna), con đường này là Bát Chánh Đạo; khi phát sinh theo các thiền còn lại, nó là Thất Chánh Đạo.
Ukkaṭṭhaniddesato panidha aṭṭhaṅgikoti vutto.
But here, from the standpoint of the highest exposition, it is called "eightfold."
Tuy nhiên, ở đây nó được gọi là Bát Chánh Đạo theo cách trình bày cao nhất.
Ito parañhi maggaṅgaṃ natthi.
Beyond this, there is no further path factor.
Thật vậy, không có chi phần đạo nào vượt quá điều này.
Evaṃ tāvettha bhedo veditabbo.
Thus, first, the distinction should be understood here.
Như vậy, trước hết, sự phân biệt ở đây cần được hiểu.
Yasmā pana sabbakusalānaṃ sammādiṭṭhi seṭṭhā, yathāha ‘‘paññā hi seṭṭhā kusalā vadantī’’ti (jā. 2.17.81).
And because Right View is the highest of all wholesome states, as it is said, "The wise say that wisdom is the highest of wholesome things."
Vì Chánh Kiến (sammādiṭṭhi) là tối thượng trong tất cả các thiện pháp, như đã nói: "Những người thiện xảo nói rằng trí tuệ là tối thượng" (Jā. 2.17.81).
Kusalavāre ca pubbaṅgamā, yathāha ‘‘kathañca, bhikkhave, sammādiṭṭhi pubbaṅgamā hoti, sammādiṭṭhiṃ sammādiṭṭhīti pajānāti, micchādiṭṭhiṃ micchādiṭṭhīti pajānātī’’ti (ma. ni. 3.136) vitthāro.
In the wholesome phase, it is pre-eminent, as was said: "And how, monks, is right view pre-eminent? One understands right view as right view, one understands wrong view as wrong view." This should be understood in detail.
Trong các pháp thiện, chánh kiến (sammādiṭṭhi) là đi đầu, như đã nói: ‘Này các Tỳ-khưu, chánh kiến đi đầu như thế nào? Người ấy biết chánh kiến là chánh kiến, biết tà kiến là tà kiến.’ – đây là phần giải thích chi tiết.
Yathā cāha ‘‘vijjā ca kho, bhikkhave, pubbaṅgamā kusalānaṃ dhammānaṃ samāpattiyā’’ti.
And as was said: "And true knowledge, monks, is pre-eminent for the attainment of wholesome states."
Và như đã nói: ‘Này các Tỳ-khưu, minh (vijjā) đi đầu trong việc thành tựu các thiện pháp.’
Tappabhavābhinibbattāni sesaṅgāni, yathāha ‘‘sammādiṭṭhissa sammāsaṅkappo pahoti…pe… sammāsatissa sammāsamādhi pahotī’’ti (ma. ni. 3.141).
The remaining factors are produced from it, as was said: "For one with right view, right thought arises… for one with right mindfulness, right concentration arises."
Các chi phần còn lại phát sinh từ đó, như đã nói: ‘Với người có chánh kiến, chánh tư duy phát sinh… (v.v.)… với người có chánh niệm, chánh định phát sinh.’
Tasmā iminā kamena etāni aṅgāni vuttānīti evamettha kamo veditabbo.
Therefore, it should be understood that these factors have been spoken of in this sequence; thus the sequence here should be known.
Vì vậy, các chi phần này được nói theo thứ tự này, do đó thứ tự ở đây cần được hiểu như vậy.
Bhāvanānayoti koci samathapubbaṅgamaṃ vipassanaṃ bhāveti, koci vipassanāpubbaṅgamaṃ samathaṃ.
The method of development: Someone develops insight with calm as its forerunner; someone develops calm with insight as its forerunner.
Phương pháp tu tập (bhāvanānayo) là: có người tu tập thiền quán (vipassanā) có thiền định (samatha) đi trước, có người tu tập thiền định có thiền quán đi trước.
Idhekacco paṭhamaṃ upacārasamādhiṃ vā appanāsamādhiṃ vā uppādeti, ayaṃ samatho; so tañca taṃsampayutte ca dhamme aniccādīhi vipassati, ayaṃ vipassanā.
Here, a certain person first produces either access concentration or absorption concentration; this is calm. He sees that, and the states associated with it, through impermanence and so on; this is insight.
Ở đây, một người trước tiên phát sinh cận định (upacārasamādhi) hoặc an chỉ định (appanāsamādhi), đây là thiền định (samatha); người ấy quán chiếu thiền định đó và các pháp tương ưng với nó bằng vô thường (anicca), khổ (dukkha), vô ngã (anattā), đây là thiền quán (vipassanā).
Iti paṭhamaṃ samatho, pacchā vipassanā.
Thus, first there is calm, afterwards insight.
Như vậy, trước tiên là thiền định, sau đó là thiền quán.
Tena vuccati ‘‘samathapubbaṅgamaṃ vipassanaṃ bhāvetī’’ti.
Therefore, it is said: "one develops insight with calm as its forerunner."
Vì thế, được gọi là ‘tu tập thiền quán có thiền định đi trước’.
Tassa samathapubbaṅgamaṃ vipassanaṃ bhāvayato maggo sañjāyati, so taṃ maggaṃ āsevati bhāveti bahulīkaroti, tassa taṃ maggaṃ āsevato bhāvayato bahulīkaroto saṃyojanāni pahīyanti, anusayā byantīhonti, evaṃ samathapubbaṅgamaṃ vipassanaṃ bhāveti.
For him who develops insight with calm as its forerunner, the path arises. He cultivates, develops, and makes much of that path. For him who cultivates, develops, and makes much of that path, the fetters are abandoned, and the underlying tendencies come to an end. In this way, he develops insight with calm as its forerunner.
Đối với người tu tập thiền quán có thiền định đi trước, con đường (magga) phát sinh; người ấy thực hành, tu tập, làm cho con đường đó trở nên sung mãn; khi người ấy thực hành, tu tập, làm cho con đường đó trở nên sung mãn, các kiết sử (saṃyojana) được đoạn trừ, các tùy miên (anusaya) được diệt tận. Như vậy là tu tập thiền quán có thiền định đi trước.
Idha panekacco vuttappakāraṃ samathaṃ anuppādetvāva pañcupādānakkhandhe aniccādīhi vipassati, ayaṃ vipassanā.
But here, a certain person, without having produced calm of the aforesaid kind, sees the five aggregates of clinging through impermanence and so on; this is insight.
Ở đây, một số người không phát sinh thiền định như đã nói trên mà chỉ quán chiếu năm uẩn chấp thủ (pañcupādānakkhandha) bằng vô thường (anicca), v.v., đây là thiền quán (vipassanā).
Tassa vipassanāpāripūriyā tattha jātānaṃ dhammānaṃ vossaggārammaṇato uppajjati cittassa ekaggatā, ayaṃ samatho.
For him, upon the completion of insight, from taking as object the relinquishment of the states that have arisen there, one-pointedness of mind arises; this is calm.
Nhờ sự viên mãn của thiền quán đó, sự nhất tâm (ekaggatā) của tâm phát sinh từ các pháp đã được sinh khởi ở đó, với Niết Bàn (nibbāna) làm đối tượng giải thoát (vossaggārammaṇa), đây là thiền định (samatha).
Iti paṭhamaṃ vipassanā pacchā samatho.
Thus, first there is insight, afterwards calm.
Như vậy, trước tiên là thiền quán, sau đó là thiền định.
Tena vuccati ‘‘vipassanāpubbaṅgamaṃ samathaṃ bhāvetī’’ti.
Therefore, it is said: "one develops calm with insight as its forerunner."
Vì thế, được gọi là ‘tu tập thiền định có thiền quán đi trước’.
Tassa vipassanāpubbaṅgamaṃ samathaṃ bhāvayato maggo sañjāyati, so taṃ maggaṃ āsevati…pe… bahulīkaroti, tassa taṃ maggaṃ āsevato…pe… anusayā byantīhonti (a. ni. 4.170; paṭi. ma. 2.1), evaṃ vipassanāpubbaṅgamaṃ samathaṃ bhāveti.
For him who develops calm with insight as its forerunner, the path arises. He cultivates… he makes much of that path. For him who cultivates… the underlying tendencies come to an end. In this way, he develops calm with insight as its forerunner.
Đối với người tu tập thiền định có thiền quán đi trước, con đường (magga) phát sinh; người ấy thực hành… (v.v.)… làm cho trở nên sung mãn; khi người ấy thực hành… (v.v.)… các tùy miên (anusaya) được diệt tận. Như vậy là tu tập thiền định có thiền quán đi trước.
34. Evaṃ me sutanti bhayabheravasuttaṃ.
34. Thus have I heard is the Bhayabherava Sutta.
34. Như vầy tôi nghe – đây là kinh Bhayabherava.
Tatrāyaṃ apubbapadavaṇṇanā – athāti avicchedanatthe nipāto.
Herein is the explanation of unprecedented words: athā is a particle in the sense of uninterrupted continuity.
Ở đây, đây là phần giải thích các từ chưa từng được giải thích: Athā là một giới từ biểu thị ý nghĩa không gián đoạn.
Khoti avadhāraṇatthe, bhagavato sāvatthiyaṃ vihāre avicchinneyevāti vuttaṃ hoti.
Kho is in the sense of emphasis; it means that the Blessed One's stay in Sāvatthī was uninterrupted.
Kho là một giới từ biểu thị ý nghĩa xác định; có nghĩa là sự cư trú của Đức Thế Tôn tại Sāvatthī không bị gián đoạn.
Jāṇussoṇīti netaṃ tassa mātāpitūhi katanāmaṃ, apica kho ṭhānantarapaṭilābhaladdhaṃ.
Jāṇussoṇi was not the name given to him by his parents, but rather one acquired through the attainment of a certain position.
Jāṇussoṇī không phải là tên do cha mẹ ông đặt, mà là tên ông có được do nhận được một chức vị.
Jāṇussoṇiṭṭhānaṃ kira nāmetaṃ purohitaṭṭhānaṃ, taṃ tassa raññā dinnaṃ, tasmā ‘‘jānussoṇī’’ti vuccati.
The position of Jāṇussoṇi, it is said, is the position of a royal chaplain. It was given to him by the king, therefore he is called "Jāṇussoṇi".
Chức vị Jāṇussoṇi này được cho là chức vị của vị purohita (tư tế hoàng gia), nó đã được nhà vua ban cho ông; vì vậy ông được gọi là ‘Jāṇussoṇī’.
Brahmaṃ aṇatīti brāhmaṇo, mante sajjhāyatīti attho.
He recites the Veda (brahmaṃ aṇati), thus he is a brahmin; the meaning is that he chants the sacred texts.
Người tụng đọc kinh Veda (brahma) được gọi là brāhmaṇa (Bà-la-môn), tức là người học thuộc lòng các thần chú.
Idameva hi jātibrāhmaṇānaṃ niruttivacanaṃ.
Indeed, this is the etymological explanation for brahmins by birth.
Đây chính là từ nguyên học của những Bà-la-môn theo dòng dõi.
Ariyā pana bāhitapāpattā brāhmaṇāti vuccanti.
Noble ones, however, are called brahmins because they have dispelled evil.
Còn các bậc Thánh (ariya) được gọi là brāhmaṇa vì họ đã loại bỏ được các ác pháp (pāpa).
Yena bhagavā tenupasaṅkamīti yenāti bhummatthe karaṇavacanaṃ, tasmā yattha bhagavā, tattha upasaṅkamīti evamettha attho daṭṭhabbo.
Went up to the Blessed One: yena is an instrumental case form in the locative sense. Therefore, the meaning here should be seen as: "where the Blessed One was, there he went up."
Yena Bhagavā tenupasaṅkamī (đi đến chỗ Đức Thế Tôn ở): từ yena ở đây là một từ chỉ công cụ trong ý nghĩa vị trí, do đó ý nghĩa ở đây cần được hiểu là ‘đi đến nơi Đức Thế Tôn đang ở’.
Yena vā kāraṇena bhagavā devamanussehi upasaṅkamitabbo, tena kāraṇena upasaṅkamīti evamettha attho daṭṭhabbo.
Alternatively, the meaning here should be seen as: "for which reason the Blessed One is to be approached by gods and humans, for that reason he went up."
Hoặc ý nghĩa ở đây cần được hiểu là ‘vì lý do mà Đức Thế Tôn đáng được chư thiên và loài người đến gần, nên ông đã đến gần vì lý do đó’.
Kena ca kāraṇena bhagavā upasaṅkamitabbo?
And for what reason is the Blessed One to be approached?
Và vì lý do nào mà Đức Thế Tôn đáng được đến gần?
Nānappakāraguṇavisesādhigamādhippāyena, sāduphalūpabhogādhippāyena dijagaṇehi niccaphalitamahārukkho viya.
With the intention of attaining various kinds of special qualities, just as a great, ever-fruitful tree is approached by flocks of birds with the intention of enjoying its sweet fruits.
Với ý định đạt được các phẩm chất đặc biệt khác nhau, với ý định hưởng thụ những quả ngọt, giống như một cây đại thụ luôn sai trái được các loài chim đến gần.
Upasaṅkamīti ca gatoti vuttaṃ hoti.
And upasaṅkamī means he went.
Upasaṅkamī cũng có nghĩa là đã đi đến.
Upasaṅkamitvāti upasaṅkamanapariyosānadīpanaṃ.
Upasaṅkamitvā indicates the conclusion of the act of approaching.
Upasaṅkamitvā (sau khi đến) biểu thị sự kết thúc của việc đến gần.
Atha vā evaṃ gato tato āsannataraṃ ṭhānaṃ bhagavato samīpasaṅkhātaṃ gantvātipi vuttaṃ hoti.
Or, having gone thus, it also means that from there he went to a closer place, designated as the vicinity of the Blessed One.
Hoặc cũng có nghĩa là sau khi đi đến một nơi gần hơn, tức là gần Đức Thế Tôn.
Bhagavatā saddhiṃ sammodīti yathā khamanīyādīni pucchanto bhagavā tena, evaṃ sopi bhagavatā saddhiṃ samappavattamodo ahosi, sītodakaṃ viya uṇhodakena sammoditaṃ ekībhāvaṃ agamāsi.
He exchanged greetings with the Blessed One: just as the Blessed One, asking about his well-being and so on, had a pleasant exchange with him, so too did he have a pleasant exchange with the Blessed One; they became united like cold water mixed with hot water.
Bhagavatā saddhiṃ sammodī (đàm luận với Đức Thế Tôn): như Đức Thế Tôn hỏi ông về sự an lạc, v.v., thì ông cũng vui vẻ đàm luận với Đức Thế Tôn như vậy, giống như nước lạnh hòa với nước nóng trở thành một.
Yāya ca ‘‘kacci te, bho gotama, khamanīyaṃ, kacci yāpanīyaṃ, kacci bhoto gotamassa gotamasāvakānañca appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāro’’tiādikāya kathāya sammodi, taṃ pītipāmojjasaṅkhātasammodajananato sammodituṃ yuttabhāvato ca sammodanīyaṃ, atthabyañjanamadhuratāya sucirampi kālaṃ sāretuṃ nirantaraṃ pavattetuṃ araharūpato saritabbabhāvato ca sārāṇīyaṃ.
And the talk with which he exchanged greetings, such as "Is Master Gotama well, is he keeping fit? Do Master Gotama and his disciples have little illness, little affliction, are they of light rising, strong, and dwelling in comfort?", is sammodanīyaṃ (congenial) because it generates delight and joy, and because it is suitable for rejoicing. It is sārāṇīyaṃ (memorable) because it is worthy of being remembered, suitable to be continually brought to mind for a very long time due to the sweetness of its meaning and phrasing.
Và cuộc đàm luận mà ông đã vui vẻ thực hiện, chẳng hạn như: ‘Này Tôn giả Gotama, ngài có khỏe không? Ngài có an lạc không? Tôn giả Gotama và các đệ tử của ngài có ít bệnh tật, ít phiền não, có thể đứng dậy dễ dàng, có sức khỏe, có an lạc không?’ – cuộc đàm luận đó là sammodanīya (đáng vui vẻ) vì nó tạo ra sự hoan hỷ và vui sướng, và vì nó thích hợp để vui vẻ; và nó là sārāṇīya (đáng ghi nhớ) vì sự ngọt ngào của văn tự và ý nghĩa, và vì nó đáng được ghi nhớ để tiếp tục thực hành liên tục trong một thời gian dài.
Suyyamānasukhato ca sammodanīyaṃ, anussariyamānasukhato ca sāraṇīyaṃ.
It is congenial due to the pleasure of hearing it, and memorable due to the pleasure of recollecting it.
Nó là sammodanīya vì sự an lạc khi được nghe, và là sārāṇīya vì sự an lạc khi được hồi tưởng.
Tathā byañjanaparisuddhatāya sammodanīyaṃ, atthaparisuddhatāya sāraṇīyanti evaṃ anekehi pariyāyehi sammodanīyaṃ kathaṃ sāraṇīyaṃ vītisāretvā pariyosāpetvā niṭṭhāpetvā yenatthena āgato, taṃ pucchitukāmo ekamantaṃ nisīdi.
Likewise, it is congenial due to the purity of its phrasing, and memorable due to the purity of its meaning. Thus, having concluded, finished, and completed this congenial and memorable talk in many ways, being desirous of asking about the purpose for which he had come, he sat down to one side.
Tương tự, nó là sammodanīya vì sự trong sáng của văn tự, và là sārāṇīya vì sự trong sáng của ý nghĩa. Sau khi kết thúc cuộc đàm luận sammodanīya và sārāṇīya bằng nhiều cách như vậy, ông ngồi xuống một bên, muốn hỏi về mục đích mà ông đã đến.
Ekamantanti bhāvanapuṃsakaniddeso, ‘‘visamaṃ candimasūriyā parivattantī’’tiādīsu (a. ni. 4.70) viya.
Ekamantaṃ (to one side) is a neuter adverbial expression, as in passages like "the moon and sun revolve unevenly".
Ekamantaṃ là một từ chỉ trạng thái trung tính, như trong các câu ‘mặt trăng và mặt trời xoay chuyển không đều’ (a. ni. 4.70), v.v.
Tasmā yathā nisinno ekamantaṃ nisinno hoti, tathā nisīdīti evamettha attho daṭṭhabbo.
Therefore, the meaning here should be understood as: he sat down in such a way that he was sitting to one side.
Vì vậy, ý nghĩa ở đây cần được hiểu là ‘ông ngồi xuống một bên theo cách mà người ngồi xuống một bên’.
Bhummatthe vā etaṃ upayogavacanaṃ.
Or, this is an accusative case form used in a locative sense.
Hoặc đây là một từ chỉ công cụ trong ý nghĩa vị trí.
Nisīdīti upāvisi.
Nisīdi means he sat down.
Nisīdī là ngồi xuống.
Paṇḍitā hi purisā garuṭṭhāniyaṃ upasaṅkamitvā āsanakusalatāya ekamantaṃ nisīdanti, ayañca nesaṃ aññataro, tasmā ekamantaṃ nisīdi.
Indeed, wise people, having approached someone deserving of respect, sit down to one side with skill in taking a seat, and he was one of them; therefore, he sat down to one side.
Những người trí tuệ, sau khi đến gần một người đáng kính, sẽ ngồi xuống một bên một cách khéo léo; ông này là một trong số họ, vì vậy ông ngồi xuống một bên.
Kathaṃ nisinno pana ekamantaṃ nisinno hotīti.
But how is one sitting to one side?
Thế nào là ngồi xuống một bên?
Cha nisajjadose vajjetvā.
By avoiding the six faults of sitting.
Tránh sáu lỗi khi ngồi.
Seyyathidaṃ, atidūraṃ accāsannaṃ uparivātaṃ unnatapadesaṃ atisammukhaṃ atipacchāti.
That is to say: too far, too near, upwind, in a high place, directly in front, and directly behind.
Đó là: quá xa, quá gần, ngược gió, ở nơi cao hơn, quá đối diện, quá phía sau.
Atidūre nisinno hi sace kathetukāmo hoti, uccāsaddena kathetabbaṃ hoti.
For one sitting too far away, if they wish to speak, they must speak in a loud voice.
Nếu người ngồi quá xa muốn nói chuyện, thì phải nói bằng giọng lớn.
Accāsanne nisinno saṅghaṭṭanaṃ karoti.
One sitting too near causes physical contact.
Người ngồi quá gần sẽ gây va chạm.
Uparivāte nisinno sarīragandhena bādhati.
One sitting upwind causes disturbance with the smell of their body.
Người ngồi ngược gió sẽ làm phiền bằng mùi cơ thể.
Unnatappadese nisinno agāravaṃ pakāseti.
One sitting in a high place displays disrespect.
Người ngồi ở nơi cao hơn sẽ biểu lộ sự thiếu tôn kính.
Atisammukhā nisinno sace daṭṭhukāmo hoti, cakkhunā cakkhuṃ āhacca daṭṭhabbaṃ hoti.
One sitting directly in front, if they wish to look, must look eye to eye.
Nếu người ngồi quá đối diện muốn nhìn, thì mắt phải chạm mắt để nhìn.
Atipacchā nisinno sace daṭṭhukāmo hoti, gīvaṃ pasāretvā daṭṭhabbaṃ hoti.
One sitting directly behind, if they wish to look, must look by stretching out their neck.
Nếu người ngồi quá phía sau muốn nhìn, thì phải vươn cổ để nhìn.
Tasmā ayampi ete cha nisajjadose vajjetvā nisīdi, tena vuttaṃ ‘‘ekamantaṃ nisīdī’’ti.
Therefore, he too sat down avoiding these six faults of sitting. For that reason it is said, "he sat down to one side."
Vì vậy, ông này cũng tránh sáu lỗi khi ngồi này mà ngồi xuống, do đó đã nói ‘ngồi xuống một bên’.
Yemeti ye ime.
Yeme means ye ime (these who).
Yeme là ye ime (những người này).
Kulaputtāti duvidhā kulaputtā jātikulaputtā ācārakulaputtā.
Kulaputtā (clansmen): there are two kinds of clansmen, clansmen by birth and clansmen by conduct.
Kulaputtā (thiện nam tử) có hai loại: thiện nam tử theo dòng dõi và thiện nam tử theo hành vi.
Tattha ‘‘tena kho pana samayena raṭṭhapālo nāma kulaputto tasmiṃyeva thullakoṭṭhike aggakulassa putto’’ti (ma. ni. 2.294) evaṃ āgatā uccākulappasutā jātikulaputtā nāma.
Herein, those born of a high family, who have come in the way of, "At that time, a son of a good family named Raṭṭhapāla was the son of the foremost family in that very Thullakoṭṭhika," are called jātikulaputtā (sons of good family by birth).
Ở đó, những thiện gia nam tử (jātikulaputtā) xuất thân từ gia đình cao quý, như được nói đến: “Vào thời điểm đó, có một thiện gia nam tử tên là Raṭṭhapāla, là con trai của một gia đình danh giá trong thị trấn Thullakoṭṭhita.”
‘‘Ye te kulaputtā saddhā agārasmā anagāriyaṃ pabbajitā’’ti (ma. ni. 3.78) evaṃ āgatā pana yattha katthaci kule pasutāpi ācārasampannā ācārakulaputtā nāma.
But those who have come in the way of, "Those sons of a good family who have gone forth from the household life into homelessness out of faith," though born in any family whatsoever but endowed with good conduct, are called ācārakulaputtā (sons of a good family by conduct).
Còn những người được nói đến như: “Những thiện gia nam tử ấy, với đức tin, đã từ bỏ đời sống gia đình để xuất gia sống đời không gia đình,” thì dù sinh ra trong bất kỳ gia đình nào, nếu có đầy đủ phẩm hạnh, họ được gọi là thiện gia nam tử về phẩm hạnh (ācārakulaputtā).
Idha pana dvīhipi kāraṇehi kulaputtāyeva.
Here, however, they are sons of good family for both reasons.
Tuy nhiên, ở đây, họ là thiện gia nam tử vì cả hai lý do.
Saddhāti saddhāya.
Saddhā means by faith.
Saddhā có nghĩa là với đức tin.
Agārasmāti agārato.
Agārasmā means from the household.
Agārasmā có nghĩa là từ gia đình.
Anagāriyanti pabbajjaṃ bhikkhubhāvañca.
Anagāriyaṃ means the going forth and the state of a bhikkhu.
Anagāriyaṃ có nghĩa là sự xuất gia, và trạng thái tỳ khưu.
Pabbajjāpi hi natthettha agāriyanti anagāriyā, agārassa hitaṃ kasigorakkhādikammamettha natthīti attho.
For going forth is also called anagāriyā because there is no household life in it; the meaning is that the work beneficial to a household, such as agriculture and cattle-herding, does not exist in it.
Thật vậy, đối với sự xuất gia, không có đời sống gia đình ở đây, nên gọi là anagāriyā; nghĩa là không có những công việc như cày cấy, chăn nuôi gia súc, v.v., là những việc có lợi cho đời sống gia đình.
Bhikkhupi natthetassa agāranti anagāro, anagārassa bhāvo anagāriyaṃ.
A bhikkhu, too, is one who has no household, an anagāro; the state of an anagāro is anagāriyaṃ.
Vị tỳ khưu cũng không có đời sống gia đình, nên gọi là anagāro; trạng thái của người không gia đình là anagāriyaṃ.
Pabbajitāti upagatā, evaṃ sabbathāpi anagāriyasaṅkhātaṃ pabbajjaṃ bhikkhubhāvaṃ vā upagatāti vuttaṃ hoti.
Pabbajitā means have undertaken. Thus, in every way, it is said that they have undertaken the going forth or the state of a bhikkhu, which is designated as homelessness.
Pabbajitā có nghĩa là đã đi đến, như vậy có nghĩa là đã đi đến đời sống xuất gia hay trạng thái tỳ khưu, được gọi là anagāriyaṃ, bằng mọi cách.
Pubbaṅgamoti purato gāmī nāyako.
Pubbaṅgamo means a leader who goes before.
Pubbaṅgamo có nghĩa là người đi trước, người dẫn đầu.
Bahukāroti hitakiriyāya bahūpakāro.
Bahukāro means of great help by performing what is beneficial.
Bahukāro có nghĩa là người có nhiều lợi ích trong việc làm điều thiện.
Bhavaṃ tesaṃ gotamo samādapetāti te kulaputte bhavaṃ gotamo adhisīlādīni gāhetā sikkhāpetā.
Bhavaṃ tesaṃ gotamo samādapetā means the venerable Gotama is the one who causes those sons of good family to undertake and train in the higher morality and so on.
Bhavaṃ tesaṃ gotamo samādapetā có nghĩa là Tôn giả Gotama đã khiến những thiện gia nam tử ấy chấp nhận và học hỏi các giới luật cao thượng (adhisīla) và những điều khác.
Sā janatāti so janasamūho.
Sā janatā means that multitude of people.
Sā janatā có nghĩa là đám đông quần chúng ấy.
Diṭṭhānugatiṃ āpajjatīti dassanānugatiṃ paṭipajjati, yandiṭṭhiko bhavaṃ gotamo yaṃkhantiko yaṃruciko, tepi tandiṭṭhikā honti taṃkhantikā taṃrucikāti attho.
Diṭṭhānugatiṃ āpajjatī means they adopt the same course of views; the meaning is that whatever view the venerable Gotama holds, whatever he approves of, whatever he prefers, they too come to hold that view, to approve of that, and to prefer that.
Diṭṭhānugatiṃ āpajjatī có nghĩa là họ noi theo quan điểm, thực hành theo quan điểm; nghĩa là Tôn giả Gotama có quan điểm nào, sự chấp nhận nào, sự ưa thích nào, thì họ cũng có quan điểm ấy, sự chấp nhận ấy, sự ưa thích ấy.
Kasmā panāyaṃ evamāhāti?
Now why did he speak thus?
Tại sao vị ấy lại nói như vậy?
Esa kira pubbe aneke kulaputte agāramajjhe vasante devaputte viya pañcahi kāmaguṇehi paricāriyamāne anto ca bahi ca susaṃvihitārakkhe disvā, te aparena samayena bhagavato madhurarasaṃ dhammadesanaṃ sutvā saddhāya gharā nikkhamma pabbajitvā ghāsacchādanaparamatāya santuṭṭhe āraññakesu senāsanesu kenaci arakkhiyamānepi anussaṅkitāparisaṅkite haṭṭhapahaṭṭhe udaggudagge addasa, disvā ca imesaṃ kulaputtānaṃ ‘‘ayaṃ phāsuvihāro kaṃ nissāya uppanno’’ti cintento ‘‘samaṇaṃ gotama’’nti bhagavati pasādaṃ alattha.
It is said that this brahmin had formerly seen many sons of good family dwelling in the midst of their homes, being ministered to with the five strands of sensual pleasure like sons of the devas, with well-arranged protection both inside and out. Then, at a later time, after hearing the Blessed One's Dhamma-discourse of sweet flavor, they went forth from home out of faith and he saw them, content with the bare minimum of robes and almsfood, dwelling in forest hermitages, unafraid and unalarmed even though unguarded by anyone, joyful and elated, exultant and jubilant. Having seen this and reflecting, "On whose account has this comfortable abiding arisen for these sons of good family?" he gained confidence in the Blessed One, thinking, "The ascetic Gotama."
Vị ấy, trước đây, đã thấy nhiều thiện gia nam tử sống giữa gia đình, được hưởng thụ năm dục lạc như các vị trời, với sự bảo vệ được sắp đặt chu đáo cả trong lẫn ngoài. Sau đó, vị ấy thấy những thiện gia nam tử ấy, sau khi nghe lời thuyết pháp ngọt ngào của Đức Thế Tôn, đã từ bỏ nhà cửa xuất gia với đức tin, hài lòng với sự tối thiểu về đồ ăn thức uống, sống trong các trú xứ trong rừng, không cần ai bảo vệ mà vẫn không nghi ngờ, không sợ hãi, vui vẻ, hân hoan, phấn khởi. Sau khi thấy vậy, vị ấy suy nghĩ: “Sự an lạc này của những thiện gia nam tử này phát sinh nhờ ai?” và đã có niềm tin vào Đức Thế Tôn, vị Sa-môn Gotama.
So taṃ pasādaṃ nivedetuṃ bhagavato santikaṃ āgato, tasmā evamāha.
He came to the Blessed One to express that confidence; therefore he spoke thus.
Vị ấy đã đến gặp Đức Thế Tôn để trình bày niềm tin ấy, vì vậy đã nói như vậy.
Athassa bhagavā taṃ vacanaṃ sampaṭicchanto abbhanumodanto ca evametaṃ brāhmaṇātiādimāha.
Then the Blessed One, accepting and approving of his statement, said evametaṃ brāhmaṇa and so on.
Bấy giờ, Đức Thế Tôn, chấp nhận và hoan hỷ với lời nói ấy của vị ấy, đã nói: “Này Bà-la-môn, đúng là như vậy…” và những lời tiếp theo.
Vacanasampaṭicchanānumodanatthoyeva hi ettha ayaṃ evanti nipāto.
Here, the particle evaṃ is indeed for the purpose of accepting and approving the statement.
Ở đây, tiểu từ evaṃ này chỉ có nghĩa là sự chấp nhận và hoan hỷ lời nói.
Mamaṃ uddissāti maṃ uddissa.
Mamaṃ uddissā means with me as their aim.
Mamaṃ uddissā có nghĩa là nhắm vào Ta.
Saddhāti saddhāyeva.
Saddhā means only by faith.
Saddhā có nghĩa là chỉ vì đức tin.
Na iṇaṭṭhā na bhayaṭṭātiādīni sandhāyāha.
He says this with reference to those who did not go forth on account of debt, on account of fear, and so on.
Lời này được nói để chỉ ra rằng họ không phải vì nợ nần hay vì sợ hãi, v.v.
Īdisānaṃyeva hi bhagavā pubbaṅgamo, na itaresaṃ.
For the Blessed One is the leader only of such persons, not of others.
Thật vậy, Đức Thế Tôn là người dẫn đầu cho những người như vậy, chứ không phải cho những người khác.
Durabhisambhavāni hīti sambhavituṃ dukkhāni dussahāni, na sakkā appesakkhehi ajjhogāhitunti vuttaṃ hoti.
Durabhisambhavāni hīti means they are difficult to accomplish, hard to endure; it is said that they cannot be entered into by those of little merit.
Durabhisambhavāni hī có nghĩa là khó có thể thành tựu, khó có thể chịu đựng; có nghĩa là những người có ít năng lực không thể thâm nhập được.
Araññavanapatthānīti araññāni ca vanapatthāni ca.
Araññavanapatthānīti means forests and woodlands.
Araññavanapatthānī có nghĩa là rừng và những khu rừng hoang dã.
Tattha kiñcāpi abhidhamme nippariyāyena, ‘‘nikkhamitvā bahi indakhilā sabbametaṃ arañña’’nti vuttaṃ, tathāpi yantaṃ ‘‘pañcadhanusatikaṃ pacchima’’nti āraññikaṅganipphādakaṃ senāsanaṃ vuttaṃ, tadeva adhippetanti veditabbaṃ.
Therein, although in the Abhidhamma it is stated without qualification, "Having gone out beyond the city-pillar, all of that is forest," it should be understood that what is intended here is that dwelling which fulfills the ascetic practice of a forest-dweller, which is stated as "a minimum of five hundred bow-lengths away."
Ở đây, mặc dù trong Abhidhamma có nói một cách không ẩn dụ rằng “tất cả những gì bên ngoài cột ranh giới (indakhīla) khi rời khỏi làng đều là rừng (arañña),” tuy nhiên, cần hiểu rằng điều được đề cập đến là trú xứ tạo thành một chi phần của hạnh đầu đà sống trong rừng (āraññikaṅga), tức là “cách xa năm trăm cung (pañcadhanusatikaṃ pacchimaṃ).”
Vanapatthanti gāmantaṃ atikkamitvā manussānaṃ anupacāraṭṭhānaṃ, yattha na kasīyati na vapīyati.
Vanapattha means a place beyond the vicinity of a village, a place not frequented by people, where there is no plowing or sowing.
Vanapatthaṃ có nghĩa là một nơi vượt ra khỏi ranh giới làng, nơi con người không thường xuyên lui tới, nơi không cày cấy, không gieo trồng.
Vuttampi cetaṃ ‘‘vanapatthanti dūrānametaṃ senāsanānaṃ adhivacanaṃ, vanapatthanti vanasaṇḍānametaṃ senāsanānaṃ, vanapatthanti bhiṃsanakānametaṃ, vanapatthanti salomahaṃsānametaṃ, vanapatthanti pariyantānametaṃ, vanapatthanti na manussūpacārānametaṃ senāsanānaṃ adhivacana’’nti.
And this has been said: "'Woodland' is a designation for remote dwellings; 'woodland' is a designation for dwellings in forest groves; 'woodland' is a designation for terrifying places; 'woodland' is a designation for hair-raising places; 'woodland' is a designation for secluded places; 'woodland' is a designation for dwellings not frequented by people."
Cũng có nói rằng: “Vanapatthaṃ là tên gọi của những trú xứ xa xôi; vanapatthaṃ là tên gọi của những trú xứ trong rừng rậm; vanapatthaṃ là tên gọi của những nơi đáng sợ; vanapatthaṃ là tên gọi của những nơi khiến lông tóc dựng đứng; vanapatthaṃ là tên gọi của những nơi tận cùng; vanapatthaṃ là tên gọi của những trú xứ mà con người không lui tới.”
Ettha ca pariyantānanti imamekaṃ pariyāyaṃ ṭhapetvā sesapariyāyehi vanapatthāni veditabbānī.
And here, setting aside this one meaning of pariyantānaṃ, the woodlands should be understood by the remaining meanings.
Ở đây, trừ cách giải thích pariyantānaṃ này, các cách giải thích còn lại đều phải hiểu là vanapatthāni.
Pantānīti pariyantāni atidūrāni.
Pantānīti means secluded, very remote.
Pantānī có nghĩa là những nơi tận cùng, rất xa xôi.
Dukkaraṃ pavivekanti kāyavivekaṃ dukkaraṃ.
Dukkaraṃ pavivekanti means bodily seclusion is difficult to do.
Dukkaraṃ pavivekaṃ có nghĩa là sự độc cư thân (kāyaviveka) khó thực hiện.
Durabhiramanti abhiramituṃ na sukhaṃ.
Durabhiramanti means not easy to delight in.
Durabhiramaṃ có nghĩa là không dễ để vui thích.
Ekatteti ekībhāve.
Ekatteti means in solitude.
Ekatte có nghĩa là trong sự độc cư.
Kiṃ dasseti?
What does this show?
Điều này cho thấy gì?
Kāyaviveke katepi tattha cittaṃ abhiramāpetuṃ dukkaraṃ.
Even when bodily seclusion has been achieved, it is difficult to make the mind delight in it.
Ngay cả khi đã độc cư thân, việc khiến tâm vui thích ở nơi đó vẫn khó khăn.
Dvayaṃdvayārāmo hi ayaṃ lokoti.
For this world delights in pairs.
Vì thế giới này ưa thích sự đôi lứa (dvayaṃdvayārāmo).
Haranti maññeti haranti viya ghasanti viya.
Haranti maññeti means they seem to carry away, they seem to devour.
Haranti maññe có nghĩa là dường như chúng kéo đi, dường như chúng nuốt chửng.
Manoti manaṃ.
Manoti means the mind.
Mano có nghĩa là tâm.
Samādhiṃ alabhamānassāti upacārasamādhiṃ vā appanāsamādhiṃ vā alabhantassa.
Samādhiṃ alabhamānassāti means of one who does not attain access concentration or absorption concentration.
Samādhiṃ alabhamānassā có nghĩa là đối với người không đạt được định cận hành (upacārasamādhi) hoặc định an chỉ (appanāsamādhi).
Kiṃ dasseti?
What does this show?
Điều này cho thấy gì?
Īdisassa bhikkhuno tiṇapaṇṇamigādisaddehi vividhehi ca bhiṃsanakehi vanāni cittaṃ vikkhipanti maññeti, sabbaṃ brāhmaṇo saddhāpabbajitānaṃ kulaputtānaṃ araññavāse (vibha. 529) vimhito āha.
He thinks that for such a bhikkhu, the forests distract the mind with the sounds of grass, leaves, deer, and so on, and with various terrifying things. The brahmin said all this, amazed at the forest-dwelling of the sons of good family who had gone forth out of faith.
Đối với một tỳ khưu như vậy, những khu rừng dường như làm phân tán tâm trí bởi tiếng động của cỏ cây, lá cây, thú vật, v.v., và bởi nhiều cảnh tượng đáng sợ. Vị Bà-la-môn đã nói tất cả những điều này với sự kinh ngạc về cuộc sống trong rừng của các thiện gia nam tử đã xuất gia với đức tin.
Tattha pubbeva sambodhāti sambodhato pubbeva, ariyamaggappattito aparabhāgeyevāti vuttaṃ hoti.
Therein, pubbeva sambodhāti means before the awakening; it is said to mean in the period before attaining the noble path.
Ở đây, pubbeva sambodhā có nghĩa là trước khi đạt được giác ngộ, tức là trước khi đạt đến Thánh đạo.
Anabhisambuddhassāti appaṭividdhacatusaccassa.
Anabhisambuddhassāti means of one who had not penetrated the four truths.
Anabhisambuddhassā có nghĩa là người chưa thấu hiểu Tứ Thánh Đế.
Bodhisattasseva satoti bujjhanakasattasseva sammāsambodhiṃ adhigantuṃ arahasattasseva sato, bodhiyā vā sattasseva laggasseva sato.
Bodhisattasseva satoti means while being a being set on awakening, a being worthy of attaining perfect self-awakening, or while being a being attached to, bound to, awakening.
Bodhisattasseva sato có nghĩa là khi còn là một chúng sinh có khả năng giác ngộ, tức là một chúng sinh xứng đáng đạt đến Chánh Đẳng Giác; hoặc là một chúng sinh đã gắn liền với sự giác ngộ.
Dīpaṅkarassa hi bhagavato pādamūle aṭṭhadhammasamodhānena abhinīhārasamiddhito pabhuti tathāgato bodhiyā satto laggo ‘‘pattabbā mayā esā’’ti tadadhigamāya parakkamaṃ amuñcantoyeva āgato, tasmā bodhisattoti vuccati.
For from the time his aspiration succeeded through the conjunction of eight factors at the feet of the Blessed One Dīpaṅkara, the Tathāgata was a being attached to, bound to, awakening, and he came along never abandoning the effort to attain it, thinking, "This must be attained by me." Therefore he is called a Bodhisatta.
Thật vậy, từ khi sự phát nguyện thành tựu với tám pháp hội tụ dưới chân Đức Phật Dīpaṅkara, Đức Như Lai đã gắn liền với sự giác ngộ, không bao giờ từ bỏ nỗ lực để đạt được sự giác ngộ ấy, với ý nghĩ: “Ta phải đạt được điều này.” Do đó, Ngài được gọi là Bồ-tát (Bodhisatto).
Tassa mayhanti tassa evaṃ bodhisattasseva sato mayhaṃ.
Tassa mayhanti means for me, who was thus a Bodhisatta.
Tassa mayhaṃ có nghĩa là đối với Ta, người đã là một Bồ-tát như vậy.
Ye kho keci samaṇā vā brāhmaṇā vāti ye keci pabbajjūpagatā vā bhovādino vā.
Ye kho keci samaṇā vā brāhmaṇā vāti means whatever ascetics or brahmins.
Ye kho keci samaṇā vā brāhmaṇā vā có nghĩa là bất kỳ ai đã xuất gia hoặc là các Bà-la-môn có cách xưng hô “bhovādī.”
Aparisuddhakāyakammantāti aparisuddhena pāṇātipātādinā kāyakammantena samannāgatā.
Aparisuddhakāyakammantāti means endowed with impure bodily action, such as killing living beings.
Aparisuddhakāyakammantā có nghĩa là những người có hạnh nghiệp thân không thanh tịnh, như sát sinh, v.v.
Aparisuddhakāyakammantasandosahetūti aparisuddhassa kāyakammantasaṅkhātassa attano dosassa hetu, aparisuddhakāyakammantakāraṇāti vuttaṃ hoti.
Aparisuddhakāyakammantasandosahetūti means for the reason of their own fault, which is designated as impure bodily action; it is said to mean because of impure bodily action.
Aparisuddhakāyakammantasandosahetū có nghĩa là nguyên nhân của lỗi lầm trong hạnh nghiệp thân không thanh tịnh của chính mình, tức là nguyên nhân của hạnh nghiệp thân không thanh tịnh.
Haveti ekaṃsavacane nipāto.
Haveti is a particle in the sense of certainty.
Have là một tiểu từ chỉ sự chắc chắn.
Akusalanti sāvajjaṃ akkhemañca.
Akusalanti means blameworthy and unsafe.
Akusalaṃ có nghĩa là có lỗi và không an lạc.
Bhayabheravanti bhayañca bheravañca.
Bhayabheravanti means fear and terror.
Bhayabheravaṃ có nghĩa là sự sợ hãi và sự kinh hoàng.
Cittutrāsassa ca bhayānakārammaṇassa cetaṃ adhivacanaṃ.
This is a designation for mental terror and a frightening object.
Đây là tên gọi của sự sợ hãi trong tâm và đối tượng đáng sợ.
Tatra bhayaṃ sāvajjaṭṭhena akusalaṃ, bheravaṃ akkhemaṭṭhenāti veditabbaṃ.
Therein, bhayaṃ is what is unwholesome in the sense of being blameworthy; bheravaṃ should be understood in the sense of being unsafe.
Ở đó, bhayaṃ (sợ hãi) phải hiểu là bất thiện vì có lỗi, còn bheravaṃ (kinh hoàng) phải hiểu là không an lạc.
Avhāyantīti pakkosanti.
Avhāyantīti means they summon.
Avhāyantī có nghĩa là mời gọi.
Kathaṃ?
How?
Như thế nào?
Te hi pāṇātipātādīni katvā ‘‘mayaṃ ayuttamakamhā, sace no te jāneyyuṃ, yesaṃ aparajjhimhā, idāni anubandhitvā anayabyasanaṃ āpādeyyu’’nti araññaṃ pavisitvā gacchantare vā gumbantare vā nisīdanti.
For they, having done things like the destruction of life, enter the forest and sit inside a thicket or a bush, thinking: "We have done what is improper. If those whom we have wronged were to find out about us, they would now pursue us and bring about our ruin and disaster."
Quả thật, những người ấy đã thực hiện các hành vi như sát sinh, và họ nghĩ: "Chúng ta đã làm điều không đúng. Nếu những người mà chúng ta đã xúc phạm biết được, bây giờ họ sẽ truy đuổi và gây ra sự hủy hoại và bất hạnh cho chúng ta." Với suy nghĩ như vậy, họ đi vào rừng và ngồi trong bụi cây lớn có gai hoặc trong bụi cây nhỏ.
Te ‘‘appamattakampi tiṇasaddaṃ vā paṇṇasaddaṃ vā sutvā, idānimhā naṭṭhā’’ti tasanti vittasanti, āgantvā parehi parivāritā viya baddhā vadhitā viya ca honti.
Upon hearing even the slightest sound of grass or a leaf, they are startled and terrified, thinking, "Now we are lost!" It is as if others have come, surrounded them, and have them bound and beaten.
Nghe thấy một tiếng động nhỏ của cỏ hay lá cây, những người ấy nghĩ: "Bây giờ chúng ta đã tiêu vong rồi!" Họ sợ hãi và kinh hoàng, và khi những người khác đến, họ cảm thấy như bị bao vây, bị trói buộc và bị đánh đập.
Evaṃ taṃ bhayabheravaṃ attani samāropanaṭṭhena avhāyanti pakkosanti.
In this way, by projecting it onto themselves, they invite and summon that fear and terror.
Như vậy, họ tự mình triệu gọi và mời gọi sự sợ hãi và kinh hoàng đó đến với mình.
Na kho panāhaṃ…pe… paṭisevāmīti ahaṃ kho pana aparisuddhakāyakammanto hutvā araññavanapatthāni pantāni senāsanāni na paṭisevāmi.
But I do not…pe… resort to: But I, being one with impure bodily conduct, do not resort to remote forest and wilderness dwellings.
Na kho panāhaṃ…pe… paṭisevāmīti: Ta không thực hành những nơi cư ngụ xa xôi, rừng núi, hoang vắng khi thân nghiệp chưa thanh tịnh.
Ye hi voti ettha voti nipātamattaṃ.
Whatever ones: Herein, vo is merely a particle.
Ye hi voti: Ở đây, vo chỉ là một từ phụ.
Ariyā vuccanti buddhā ca buddhasāvakā ca.
Noble ones refers to Buddhas and the disciples of the Buddha.
Ariyā được gọi là chư Phật và các đệ tử của Phật.
Parisuddhakāyakammantāti īdisā hutvā.
Of pure bodily conduct: Being of this kind.
Parisuddhakāyakammantāti: Đã trở thành những người như vậy.
Tesamahaṃ aññataroti tesaṃ ahampi eko aññataro.
I am one of them: I, too, am one among them.
Tesamahaṃ aññataroti: Ta cũng là một trong số họ.
Bodhisatto hi gahaṭṭhopi pabbajitopi parisuddhakāyakammantova hoti.
For a Bodhisatta, whether a householder or one gone forth, is indeed of pure bodily conduct.
Quả thật, Bồ-tát, dù là cư sĩ hay xuất gia, đều có thân nghiệp thanh tịnh.
Bhiyyoti atirekatthe nipāto.
Further: A particle in the sense of ‘exceedingly’.
Bhiyyoti: Là một từ phụ chỉ ý "hơn nữa", "thêm vào".
Pallomanti pannalomataṃ, khemaṃ sotthibhāvanti attho.
Pallomaṃ: Means the state of having hair lying flat; the meaning is security, a state of well-being.
Pallomanti: Tức là lông rụng, nghĩa là sự an toàn, sự bình an.
Āpādinti āpajjiṃ, atirekaṃ sotthibhāvaṃ atirekena vā sotthibhāvamāpajjinti vuttaṃ hoti.
I have obtained: Means ‘I have attained’. It is said to mean: "I have attained a state of exceeding well-being," or "I have attained a state of well-being through an exceeding degree."
Āpādinti: Ta đã đạt được, tức là đã đạt được sự bình an tuyệt đối hoặc sự bình an hơn mức bình thường.
Araññe vihārāyāti araññe vihāratthāya.
For dwelling in the forest: For the purpose of dwelling in the forest.
Araññe vihārāyāti: Để cư ngụ trong rừng.
36. Esa nayo sabbattha.
36. This method applies everywhere.
Nguyên tắc này áp dụng cho tất cả các phần.
Ayaṃ pana viseso, vacīkammantavāre tāva aparisuddhavacīkammantāti aparisuddhena musāvādādinā vacīkammantena samannāgatā.
This, however, is the specific detail: In the section on verbal conduct, of impure verbal conduct means possessed of impure verbal conduct, such as false speech.
Tuy nhiên, có một điểm đặc biệt: trong phần khẩu nghiệp, aparisuddhavacīkammantāti là những người có khẩu nghiệp không thanh tịnh, như nói dối, v.v.
Te kathaṃ bhayabheravaṃ avhāyanti?
How do they invite fear and terror?
Họ triệu gọi sự sợ hãi và kinh hoàng như thế nào?
Te musāvādena parassa atthaṃ bhañjitvā, pisuṇavācāya mittabhedaṃ katvā pharusavācāya paresaṃ parisamajjhe mammāni tuditvā niratthakavācāya parasattānaṃ kammante nāsetvā ‘‘mayaṃ ayuttamakamhā, sace no te jāneyyuṃ, yesaṃ aparajjhimhā, idāni anubandhitvā anayabyasanaṃ pāpeyyu’’nti araññaṃ pavisitvā gacchantare vā gumbantare vā nisīdanti.
They, having destroyed another's welfare through false speech, having created division between friends through slanderous speech, having pierced others to the quick in the midst of an assembly with harsh speech, and having ruined the work of other beings with pointless talk, enter the forest and sit inside a thicket or a bush, thinking: "We have done what is improper. If those whom we have wronged were to find out about us, they would now pursue us and lead us to ruin and disaster."
Những người ấy, sau khi dùng lời nói dối để phá hoại lợi ích của người khác, dùng lời nói chia rẽ để phá vỡ tình bạn, dùng lời nói thô tục để chọc vào chỗ yếu của người khác giữa hội chúng, dùng lời nói vô ích để làm hỏng công việc của chúng sinh khác, họ nghĩ: "Chúng ta đã làm điều không đúng. Nếu những người mà chúng ta đã xúc phạm biết được, bây giờ họ sẽ truy đuổi và gây ra sự hủy hoại và bất hạnh cho chúng ta." Với suy nghĩ như vậy, họ đi vào rừng và ngồi trong bụi cây lớn hoặc trong bụi cây nhỏ.
Te ‘‘appamattakampi tiṇasaddaṃ vā paṇṇasaddaṃ vā sutvā idānimhā naṭṭhā’’ti tasanti vittasanti āgantvā parehi parivāritā viya baddhā vadhitā viya ca honti.
Upon hearing even the slightest sound of grass or a leaf, they are startled and terrified, thinking, "Now we are lost!" It is as if others have come, surrounded them, and have them bound and beaten.
Nghe thấy một tiếng động nhỏ của cỏ hay lá cây, họ nghĩ: "Bây giờ chúng ta đã tiêu vong rồi!" Họ sợ hãi và kinh hoàng, và khi những người khác đến, họ cảm thấy như bị bao vây, bị trói buộc và bị đánh đập.
Evaṃ taṃ bhayabheravaṃ attani samāropanaṭṭhena avhāyanti, pakkosanti.
In this way, by projecting it onto themselves, they invite and summon that fear and terror.
Như vậy, họ tự mình triệu gọi và mời gọi sự sợ hãi và kinh hoàng đó đến với mình.
Manokammantavāre aparisuddhamanokammantāti aparisuddhena abhijjhādinā manokammantena samannāgatā.
In the section on mental conduct, of impure mental conduct means possessed of impure mental conduct, such as covetousness.
Trong phần ý nghiệp, aparisuddhamanokammantāti là những người có ý nghiệp không thanh tịnh, như tham lam, v.v.
Te kathaṃ bhayabheravaṃ avhāyanti?
How do they invite fear and terror?
Họ triệu gọi sự sợ hãi và kinh hoàng như thế nào?
Te paresaṃ rakkhitagopitesu bhaṇḍesu abhijjhāvisamalobhaṃ uppādetvā parassa kujjhitvā parasatte micchādassanaṃ gāhāpetvā mayaṃ ayuttamakamhā…pe… attani samāropanaṭṭhena avhāyanti pakkosanti.
They, having generated covetousness and unrighteous greed for the guarded and protected goods of others, having become angry at another, and having made other beings adopt wrong view, thinking, "We have done what is improper…" and so on… by projecting it onto themselves, they invite and summon.
Những người ấy, sau khi khởi lên lòng tham bất chính đối với tài sản được người khác bảo vệ và giữ gìn, tức giận với người khác, và khiến chúng sinh khác chấp giữ tà kiến, họ nghĩ: "Chúng ta đã làm điều không đúng... (v.v.) ... tự mình triệu gọi và mời gọi sự sợ hãi và kinh hoàng đó đến với mình."
Ājīvavāre aparisuddhājīvāti aparisuddhena vejjakammadūtakammavaḍḍhipayogādinā ekavīsatianesanabhedena ājīvena samannāgatā.
In the section on livelihood, of impure livelihood means possessed of an impure livelihood of the twenty-one kinds of wrong livelihood, such as the practice of medicine, acting as a messenger, and the use of usury.
Trong phần sinh kế, aparisuddhājīvāti là những người có sinh kế không thanh tịnh, như hành nghề y, làm sứ giả, cho vay nặng lãi, v.v., tức là có hai mươi mốt loại sinh kế bất chính.
Te kathaṃ bhayabheravaṃ avhāyanti?
How do they invite fear and terror?
Họ triệu gọi sự sợ hãi và kinh hoàng như thế nào?
Te evaṃ jīvikaṃ kappetvā suṇanti – ‘‘sāsanasodhakā kira tepiṭakā bhikkhū sāsanaṃ sodhetuṃ nikkhantā, ajja vā sve vā idhāgamissantī’’ti araññaṃ pavisitvā gacchantare vā…pe… tasanti vittasanti.
Having sustained their life in this way, they hear: "It is said that monks learned in the Tipiṭaka, purifiers of the Teaching, have set out to purify the Teaching and will arrive here today or tomorrow." They then enter the forest and sit inside a thicket or…pe… they are startled and terrified.
Những người ấy, sau khi sống bằng cách đó, nghe nói: "Có những Tỳ-khưu Tam Tạng đang thanh lọc Giáo pháp đã xuất hành để thanh lọc Giáo pháp. Hôm nay hoặc ngày mai họ sẽ đến đây." Rồi họ đi vào rừng và ngồi trong bụi cây lớn... (v.v.) ... sợ hãi và kinh hoàng.
Te hi āgantvā parivāretvā gahitā viya odātavatthanivāsitā viya ca hontīti.
For it is as if those monks have come, surrounded, and seized them, and as if they have been made to wear white clothes.
Khi những người ấy đến, họ cảm thấy như bị bao vây và bị bắt giữ, hoặc như bị bắt mặc y phục trắng.
Sesaṃ tādisameva.
The rest is similar.
Phần còn lại cũng tương tự như vậy.
37. Ito paraṃ abhijjhālūtiādīsu kiñcāpi abhijjhābyāpādā manokammantena saṅgahitā tathāpi nīvaraṇavasena puna vuttāti veditabbā.
37. Hereafter, in such passages as covetous, although covetousness and ill will are included in mental conduct, it should be understood that they are mentioned again in the context of the hindrances.
Từ đây trở đi, mặc dù tham lam và sân hận được bao gồm trong ý nghiệp, nhưng chúng được nhắc lại theo cách của các triền cái.
Tattha abhijjhālūti parabhaṇḍādiabhijjhāyanasīlā.
Therein, covetous means habitually coveting the belongings of others.
Ở đây, abhijjhālūti là những người có thói quen tham lam tài sản của người khác, v.v.
Kāmesu tibbasārāgāti vatthukāmesu bahalakilesarāgā, te kathaṃ bhayabheravaṃ avhāyanti?
With intense passion for sensual pleasures means having thick defilement-passion for objects of sensual pleasure. How do they invite fear and terror?
Kāmesu tibbasārāgāti là những người có dục ái mãnh liệt đối với các dục lạc vật chất. Họ triệu gọi sự sợ hãi và kinh hoàng như thế nào?
Te avavatthitārammaṇā honti, tesaṃ avavatthitārammaṇānaṃ araññe viharantānaṃ divā diṭṭhaṃ rattiṃ bhayabheravaṃ hutvā upaṭṭhāti – ‘‘te ākulacittā appamattakenapi tasanti vittasanti, rajjuṃ vā lataṃ vā disvā sappasaññino honti, khāṇuṃ disvā yakkhasaññino, thalaṃ vā pabbataṃ vā disvā hatthisaññino sappādīhi anayabyasanaṃ āpāditā viya hontī’’ti.
They have an unsettled object of mind. For those with an unsettled object of mind dwelling in the forest, what was seen by day appears at night as a fear and terror. "With agitated minds, they are startled and terrified by the slightest thing. Seeing a rope or a vine, they perceive it as a snake; seeing a tree stump, they perceive it as a yakkha; seeing a mound of earth or a mountain, they perceive it as an elephant. It is as if ruin and disaster were brought upon them by snakes and other creatures."
Họ có những đối tượng không ổn định. Khi những người có đối tượng không ổn định này sống trong rừng, những gì họ nhìn thấy ban ngày sẽ trở thành sự sợ hãi và kinh hoàng vào ban đêm. "Tâm trí họ hỗn loạn, họ sợ hãi và kinh hoàng ngay cả với những điều nhỏ nhặt nhất. Họ nhìn thấy một sợi dây hay một dây leo và nghĩ đó là một con rắn. Họ nhìn thấy một gốc cây và nghĩ đó là một con quỷ. Họ nhìn thấy một gò đất hay một ngọn núi và nghĩ đó là một con voi, và họ cảm thấy như bị rắn và các loài khác gây ra sự hủy hoại và bất hạnh."
Sesaṃ tādisameva.
The rest is similar.
Phần còn lại cũng tương tự như vậy.
38. Byāpannacittāti pakatibhāvavijahanena vipannacittā.
38. With a corrupted mind means a mind that is ruined by abandoning its natural state.
Byāpannacittāti: Tâm bị hư hoại do từ bỏ trạng thái tự nhiên.
Kilesānugatañhi cittaṃ pakatibhāvaṃ vijahati, purāṇabhattabyañjanaṃ viya pūtikaṃ hoti.
For a mind that follows after defilements abandons its natural state; it becomes putrid like old rice and curry.
Quả thật, tâm bị phiền não chi phối sẽ từ bỏ trạng thái tự nhiên, trở nên thối rữa như thức ăn thừa đã cũ.
Paduṭṭhamanasaṅkappāti paduṭṭhacittasaṅkappā, abhadrakena paresaṃ anatthajanakena cittasaṅkappena samannāgatāti vuttaṃ hoti.
With corrupt mental intentions means having corrupt intentions of mind; it is said to mean being possessed of a vile intention of mind that brings about the misfortune of others.
Paduṭṭhamanasaṅkappāti: Ý nghĩ ác độc, tức là có những ý nghĩ ác độc, gây hại cho người khác.
Te kathaṃ bhayabheravaṃ avhāyanti?
How do they invite fear and terror?
Họ triệu gọi sự sợ hãi và kinh hoàng như thế nào?
Bhayabheravāvhāyanaṃ ito pabhuti abhijjhāluvāre vuttanayeneva veditabbaṃ.
From this point onward, the inviting of fear and terror should be understood in the same way as described in the section on the covetous.
Từ đây trở đi, việc triệu gọi sự sợ hãi và kinh hoàng cần được hiểu theo cách đã nói trong phần tham lam.
Yattha pana viseso bhavissati, tattha vakkhāma.
However, wherever there is a specific detail, we shall state it there.
Chúng ta sẽ nói về những điểm đặc biệt ở những nơi có.
Na kho panāhaṃ byāpannacittoti ettha pana mettacitto ahaṃ hitacittoti dasseti, īdisā hi bodhisattā honti.
But here, in But I do not have a corrupted mind, it shows: "I have a mind of loving-kindness, a mind of goodwill." For Bodhisattas are of this kind.
Ở đây, trong Na kho panāhaṃ byāpannacittoti, Bồ-tát thể hiện rằng Ngài có tâm từ bi, tâm lợi tha. Quả thật, các Bồ-tát là những người như vậy.
Evaṃ sabbattha vuttadosapaṭipakkhavasena bodhisattassa guṇā vaṇṇetabbā.
Thus, in every case, the qualities of the Bodhisatta should be described by way of the opposite of the stated faults.
Như vậy, ở khắp mọi nơi, các đức tính của Bồ-tát cần được ca ngợi theo cách đối lập với những lỗi lầm đã nói.
42. Attukkaṃsanakā paravambhīti ye attānaṃ ukkaṃsenti ukkhipanti, ucce ṭhāne ṭhapenti, parañca vambhenti garahanti nindanti, nīce ṭhāne ṭhapenti, tesametaṃ adhivacanaṃ.
42. One who extols oneself and disparages others: This is a designation for those who extol and elevate themselves, placing themselves in a high position, and who disparage, censure, and condemn others, placing them in a low position.
Attukkaṃsanakā paravambhīti: Những người tự đề cao, nâng mình lên vị trí cao, và chê bai, chỉ trích, hạ thấp người khác xuống vị trí thấp. Đó là tên gọi của họ.
Te kathaṃ bhayabheravaṃ avhāyanti?
How do they invite fear and terror?
Họ triệu gọi sự sợ hãi và kinh hoàng như thế nào?
Te parehi ‘‘asuko ca kira asuko ca attānaṃ ukkaṃsenti, amhe garahanti, dāse viya karonti, gaṇhatha ne’’ti anubaddhā palāyitvā araññaṃ pavisitvā gacchantare vā gumbantare vāti kāyakammantasadisaṃ vitthāretabbaṃ.
When pursued by others saying, "So-and-so and so-and-so are said to be extolling themselves and censuring us, treating us like slaves. Seize them!", they flee, enter the forest, and stay inside a thicket or a bush. This should be elaborated in a way similar to the section on bodily conduct.
Những người ấy, khi bị người khác truy đuổi vì "người này và người kia tự đề cao mình, chê bai chúng ta, đối xử với chúng ta như nô lệ, hãy bắt họ!", họ bỏ chạy vào rừng và ẩn mình trong bụi cây lớn hoặc bụi cây nhỏ. Phần này cần được mở rộng tương tự như phần thân nghiệp.
44. Lābhasakkārasilokanti ettha labbhatīti lābho, catunnaṃ paccayānametaṃ adhivacanaṃ.
44. In the phrase gain, honor, and fame, gain is so called because it is gained; this is a designation for the four requisites.
44. Lābhasakkārasiloka (lợi lộc, cung kính, danh tiếng): Ở đây, labbhatī (được nhận) nên gọi là lābha (lợi lộc). Đây là tên gọi của bốn vật tư.
Sakkāroti sundarakāro, paccayā eva hi paṇītapaṇītā sundarasundarā ca abhisaṅkharitvā katā sakkārāti vuccanti.
Honor means a fine deed, for it is the requisites themselves, when refined, excellent, beautiful, and well-prepared, that are called honor.
Sakkāra (cung kính) có nghĩa là sự sắp đặt tốt đẹp. Quả thật, các vật tư được sắp đặt một cách tinh tế và đẹp đẽ thì được gọi là sakkāra.
Yā ca parehi attano gāravakiriyā pupphādīhi vā pūjā.
It is also the reverence shown by others to oneself, or veneration with flowers and so on.
Hoặc là hành động tôn kính của người khác đối với mình, hoặc là sự cúng dường bằng hoa và các thứ khác.
Silokoti vaṇṇabhaṇanaṃ etaṃ, lābhañca sakkārañca silokañca lābhasakkārasilokaṃ.
Fame means the speaking of praise; gain, honor, and fame refers to gain, honor, and fame.
Siloka (danh tiếng) là lời tán thán. Lābha, sakkāra và siloka là lābhasakkārasiloka.
Nikāmayamānāti patthayamānā.
Desiring means wishing for.
Nikāmayamānā có nghĩa là mong muốn.
Bhayabheravāvhāyanaṃ abhijjhāluvārasadisameva.
The summoning of fear and terror is just like the section on the covetous.
Sự kêu gọi nỗi sợ hãi và kinh hoàng cũng giống như trường hợp của người có tâm tham lam.
Tadatthadīpakaṃ panettha piyagāmikavatthuṃ kathenti –
Here, to illuminate that meaning, they tell the story of Piyagāmika.
Để làm sáng tỏ ý nghĩa này, họ kể câu chuyện về Tỳ-kheo Piyagāmika:
Eko kira piyagāmiko nāma bhikkhu samādinnadhutaṅgānaṃ bhikkhūnaṃ lābhaṃ disvā ‘‘ahampi dhutaṅgaṃ samādiyitvā lābhaṃ uppādemī’’ti cintetvā sosānikaṅgaṃ samādāya susāne vasati.
It is said that a certain monk named Piyagāmika, seeing the gain of the monks who had undertaken the ascetic practices, thought, “I, too, will undertake the ascetic practices and generate gain,” and undertaking the charnel-ground-dweller’s practice, he lived in a charnel ground.
Nghe nói có một Tỳ-kheo tên là Piyagāmika, thấy các Tỳ-kheo đang thực hành hạnh đầu đà được lợi lộc, liền nghĩ: “Mình cũng sẽ thực hành hạnh đầu đà để tạo ra lợi lộc”, rồi thọ trì hạnh đầu đà ở nghĩa địa và sống trong nghĩa địa.
Athekadivasaṃ eko kammamutto jaraggavo divā gocare caritvā rattiṃ tasmiṃ susāne pupphagumbe sīsaṃ katvā romanthayamāno aṭṭhāsi.
Then one day, an old ox, released from work, after grazing in the pasture by day, stood at night in that charnel ground, resting its head in a thicket of flowers and ruminating.
Rồi một hôm, một con bò già đã hết tuổi lao động, ban ngày ăn cỏ, ban đêm nằm đầu vào bụi hoa trong nghĩa địa đó mà nhai lại.
Piyagāmiko rattiṃ caṅkamanā nikkhanto tassa hanusaddaṃ sutvā cintesi ‘‘addhā maṃ lābhagiddho esa susāne vasatīti ñatvā devarājā viheṭhetuṃ āgato’’ti, so jaraggavassa purato añjaliṃ paggahetvā ‘‘sappurisa devarāja ajja me ekarattiṃ khama, sve paṭṭhāya na evaṃ karissāmī’’ti namassamāno sabbarattiṃ yācanto aṭṭhāsi.
When Piyagāmika came out from his walking meditation at night and heard the sound of its jaw, he thought, “Surely the king of the devas, knowing ‘This one is living in the charnel ground out of greed for gain,’ has come to harass me.” Raising his joined hands before the old ox, he stood all night pleading, “Good Sir, King of the Devas, please forgive me for this one night. From tomorrow onwards, I will not do so again,” while paying homage.
Tỳ-kheo Piyagāmika ban đêm đi kinh hành trở ra, nghe tiếng nhai của con bò, liền nghĩ: “Chắc chắn vị thiên vương này, vì tham lợi lộc, biết mình sống ở nghĩa địa nên đã đến quấy nhiễu mình”. Vị ấy liền chắp tay trước con bò già và nói: “Thưa thiện nhân thiên vương, xin hãy tha thứ cho con đêm nay, từ ngày mai con sẽ không làm như vậy nữa”. Vị ấy đứng cầu xin suốt đêm.
Tato sūriye uṭṭhite taṃ disvā kattarayaṭṭhiyā paharitvā palāpesi ‘‘sabbarattiṃ maṃ bhiṃsāpesī’’ti.
Then, when the sun rose, seeing it, he struck it with a bamboo staff and drove it away, saying, “It terrified me all night long.”
Sau đó, khi mặt trời mọc, thấy con bò, vị ấy liền dùng gậy tre đánh đuổi đi và nói: “Ngươi đã dọa ta suốt đêm!”
45. Kusītāti kosajjānugatā.
45. Lazy means given to idleness.
45. Kusītā có nghĩa là những người chìm đắm trong sự lười biếng.
Hīnavīriyāti hīnā vīriyena virahitā viyuttā, nibbīriyāti vuttaṃ hoti.
Of inferior energy means inferior, bereft, and destitute of energy; it means they are without energy.
Hīnavīriyā có nghĩa là những người có tinh tấn thấp kém, thiếu vắng, không có tinh tấn.
Tattha kusītā kāyikavīriyārambhavirahitā honti, hīnavīriyā cetasikavīriyārambhavirahitā.
Therein, the lazy are those who lack the undertaking of bodily energy, while those of inferior energy are those who lack the undertaking of mental energy.
Trong số đó, kusītā là những người thiếu tinh tấn thân thể; hīnavīriyā là những người thiếu tinh tấn tâm ý.
Te ārammaṇavavatthānamattampi kātuṃ na sakkonti.
They are not able even to make a determination of the object.
Họ không thể thực hiện dù chỉ là sự phân định đối tượng.
Tesaṃ avavatthitārammaṇānanti sabbaṃ pubbasadisameva.
For them, whose object is undetermined, and so on—all is the same as before.
Đối với những người có đối tượng không được phân định, tất cả đều giống như đã nói ở trên.
46. Muṭṭhassatīti naṭṭhassatī.
46. Of lapsed mindfulness means of lost mindfulness.
46. Muṭṭhassatī có nghĩa là mất chánh niệm.
Asampajānāti paññārahitā, imassa ca paṭipakkhe ‘‘upaṭṭhitassatīhamasmī’’ti vacanato satibhājaniyamevetaṃ.
Unclearly comprehending means lacking wisdom. And in the counterpart to this, it is said, “I am one of established mindfulness,” from which this is to be apportioned to mindfulness.
Asampajānā có nghĩa là thiếu trí tuệ. Đối lập với điều này, theo lời dạy “Ta là người có chánh niệm hiện tiền”, đây là một sự phân chia về chánh niệm.
Paññā panettha satidubbalyadīpanatthaṃ vuttā.
Wisdom is mentioned here to show the weakness of mindfulness.
Trí tuệ ở đây được nói đến để chỉ ra sự yếu kém của chánh niệm.
Duvidhā hi sati paññāsampayuttā paññāvippayuttā ca.
For mindfulness is of two kinds: that associated with wisdom and that dissociated from wisdom.
Chánh niệm có hai loại: tương ưng với trí tuệ và không tương ưng với trí tuệ.
Tattha paññāsampayuttā balavatī, vippayuttā dubbalā, tasmā yadāpi tesaṃ sati hoti, tadāpi asampajānantā muṭṭhassatīyeva te, dubbalāya satiyā satikiccābhāvatoti etamatthaṃ dīpetuṃ ‘‘asampajānā’’ti vuttaṃ.
Therein, that associated with wisdom is strong, while that dissociated is weak. Therefore, even when they have mindfulness, they are still unclearly comprehending and of lapsed mindfulness, because weak mindfulness lacks the function of mindfulness. To explain this meaning, it is said unclearly comprehending.
Trong số đó, chánh niệm tương ưng với trí tuệ thì mạnh mẽ, còn chánh niệm không tương ưng thì yếu kém. Do đó, ngay cả khi họ có chánh niệm, họ vẫn là những người mất chánh niệm vì thiếu trí tuệ, bởi vì chánh niệm yếu kém không thực hiện được chức năng của chánh niệm. Để làm sáng tỏ ý nghĩa này, từ “asampajānā” đã được nói đến.
Te evaṃ muṭṭhassatī asampajānā ārammaṇavavatthānamattampi kātuṃ na sakkontīti sabbaṃ pubbasadisameva.
They, being thus of lapsed mindfulness and unclearly comprehending, are not able even to make a determination of the object, and so on—all is the same as before.
Những người như vậy, vì mất chánh niệm và thiếu trí tuệ, không thể thực hiện dù chỉ là sự phân định đối tượng. Tất cả đều giống như đã nói ở trên.
47. Asamāhitāti upacārappanāsamādhivirahitā.
47. Unconcentrated means lacking access and absorption concentration.
47. Asamāhitā có nghĩa là thiếu vắng samādhi cận định và samādhi an định.
Vibbhantacittāti ubbhantacittā.
Of wandering mind means of unsettled mind.
Vibbhantacittā có nghĩa là tâm bị xao động.
Samādhivirahena laddhokāsena uddhaccena tesaṃ samādhivirahānaṃ cittaṃ nānārammaṇesu paribbhamati, vanamakkaṭo viya vanasākhāsu uddhaccena ekārammaṇe vipphandati.
Due to restlessness, which finds its opportunity through the lack of concentration, the minds of those lacking concentration wander among various objects; like a forest monkey among the forest branches, it flits from one object due to restlessness.
Do thiếu samādhi, sự phóng dật có cơ hội phát sinh, khiến tâm của những người thiếu samādhi lang thang trên nhiều đối tượng khác nhau, giống như một con khỉ rừng nhảy nhót trên các cành cây rừng do sự phóng dật, và xao động trên một đối tượng duy nhất.
Pubbe vuttanayenena te evaṃ asamāhitā vibbhantacittā ārammaṇavavatthānamattampi kātuṃ na sakkontīti sabbaṃ pubbasadisameva.
In the manner previously stated, they, being thus unconcentrated and of wandering mind, are not able even to make a determination of the object, and so on—all is the same as before.
Theo cách đã nói ở trên, những người như vậy, vì tâm không định tĩnh và xao động, không thể thực hiện dù chỉ là sự phân định đối tượng. Tất cả đều giống như đã nói ở trên.
48. Duppaññāti nippaññānametaṃ adhivacanaṃ.
48. Of poor wisdom is a designation for those without wisdom.
48. Duppaññā là tên gọi của những người không có trí tuệ.
Paññā pana duṭṭhā nāma natthi.
But there is no such thing as corrupted wisdom.
Tuy nhiên, không có trí tuệ nào gọi là xấu xa.
Eḷamūgāti elamukhā, kha-kārassa ga-kāro kato.
Eḷamūgā means elamukhā (of flawed speech); the letter ‘kha’ has become ‘ga’.
Eḷamūgā có nghĩa là elamukhā, chữ ‘kha’ được đổi thành ‘ga’.
Lālamukhāti vuttaṃ hoti.
It means having slobbering speech.
Điều đó có nghĩa là lālamukhā (miệng chảy nước dãi).
Duppaññānañhi kathentānaṃ lālā mukhato galati, lālā ca elāti vuccati.
For when those of poor wisdom speak, slobber trickles from their mouths, and slobber is called elā.
Thật vậy, khi những người kém trí tuệ nói chuyện, nước dãi chảy ra từ miệng họ, và nước dãi được gọi là ela.
Yathāha ‘‘passelamūgaṃ uragaṃ dujjivha’’nti.
As it is said: “See the slobbering, fork-tongued serpent.”
Như đã nói: “Hãy nhìn con rắn elamūga (miệng chảy nước dãi), lưỡi đôi”.
Tasmā te ‘‘eḷamūgā’’ti vuccanti.
Therefore, they are called eḷamūgā.
Do đó, họ được gọi là “eḷamūgā”.
‘‘Elamukhā’’tipi pāṭho.
There is also the reading elamukhā.
Cũng có bản đọc là “Elamukhā”.
‘‘Elamugā’’ti keci paṭhanti, apare ‘‘elamukā’’tipi, sabbattha ‘‘elamukhā’’ti attho.
Some read it as elamugā, others as elamukā; in all cases, the meaning is elamukhā.
Một số người đọc là “Elamugā”, những người khác đọc là “Elamukā”, nhưng trong tất cả các trường hợp, ý nghĩa là “Elamukhā”.
Te kathaṃ bhayabheravaṃ avhāyanti?
How do they summon fear and terror?
Họ kêu gọi sự sợ hãi và kinh hoàng như thế nào?
Te duppaññā eḷamūgā ārammaṇavavatthānamattampi kātuṃ na sakkonti.
They, being of poor wisdom and slobbering speech, are not able even to make a determination of the object.
Những người kém trí tuệ, miệng chảy nước dãi đó, không thể thực hiện dù chỉ là sự phân định đối tượng.
Tesaṃ avavatthitārammaṇānaṃ araññe viharantānaṃ divā diṭṭhaṃ rattiṃ bhayabheravaṃ hutvā upaṭṭhāti ‘‘te ākulacittā appamattakenapi tasanti vittasanti, rajjuṃ vā lataṃ vā disvā sappasaññino honti, khāṇuṃ disvā yakkhasaññino, thalaṃ vā pabbataṃ vā disvā hatthisaññino sappādīhi anayavyasanaṃ āpāditā viya hontī’’ti.
For them, whose object is undetermined, while living in the forest, what was seen by day appears at night as a cause of fear and terror. “With agitated minds, they are startled and terrified by the slightest thing; seeing a rope or a vine, they perceive it as a snake; seeing a tree stump, they perceive it as a yakkha; seeing level ground or a mountain, they perceive it as an elephant; they are as if brought to ruin and disaster by snakes and the like.”
Khi những người có đối tượng không được phân định đó sống trong rừng, những gì họ thấy ban ngày sẽ hiện ra vào ban đêm như những điều đáng sợ và kinh hoàng, “tâm trí họ hỗn loạn và họ sợ hãi, kinh hoàng ngay cả với những điều nhỏ nhặt nhất. Họ thấy dây thừng hay dây leo thì tưởng là rắn, thấy gốc cây thì tưởng là yêu quỷ, thấy đất liền hay núi non thì tưởng là voi, như thể họ bị rắn và các loài khác gây ra tai họa và bất hạnh”.
Evaṃ taṃ bhayabheravaṃ attani samāropanaṭṭhena avhāyanti pakkosanti.
In this way, by projecting that fear and terror onto themselves, they summon and invite it.
Như vậy, họ kêu gọi, mời gọi sự sợ hãi và kinh hoàng đó bằng cách tự gán cho mình.
Paññāsampannohamasmīti ettha paññāsampannoti paññāya sampanno samannāgato, no ca kho vipassanāpaññāya, na maggapaññāya, apica kho pana imesu soḷasasu ṭhānesu ārammaṇavavatthānapaññāyāti attho.
Herein, in the phrase I am endowed with wisdom, endowed with wisdom means endowed with, possessed of, wisdom—not, however, with insight-wisdom, nor with path-wisdom, but rather with the wisdom of determining the object in these sixteen instances. This is the meaning.
Trong cụm từ Paññāsampannohamasmi (Tôi có đầy đủ trí tuệ), paññāsampanno có nghĩa là đầy đủ, được trang bị trí tuệ, nhưng không phải trí tuệ tuệ quán, không phải trí tuệ đạo, mà là trí tuệ phân định đối tượng trong mười sáu trường hợp này.
Sesaṃ sabbattha vuttanayamevāti.
The rest is in every case as has been explained.
Phần còn lại đều giống như cách đã nói ở khắp nơi.
Tattha yā tāti ubhayametaṃ rattīnaṃyeva uddesaniddesavacanaṃ.
Therein, both yā tā are words indicating and specifying the nights.
Trong đó, yā tā là cả hai từ chỉ định và giải thích cho các đêm.
Abhiññātāti ettha abhīti lakkhaṇatthe upasaggo.
In recognized, the prefix abhi- is in the sense of a characteristic.
Trong abhiññātā, tiếp đầu ngữ abhī có nghĩa là dấu hiệu.
Tasmā abhiññātāti candapāripūriyā candaparikkhayenāti evamādīhi lakkhaṇehi ñātāti veditabbā.
Therefore, recognized should be understood as ‘known by characteristics’ such as the fullness of the moon, the waning of the moon, and so on.
Do đó, abhiññātā nên được hiểu là được biết đến bằng các dấu hiệu như trăng tròn, trăng khuyết, v.v.
Abhilakkhitāti ettha upasaggamattameva, tasmā abhilakkhitāti lakkhaṇīyā icceva attho, uposathasamādānadhammassavanapūjāsakkārādikaraṇatthaṃ lakkhetabbā sallakkhetabbā upalakkhetabbāti vuttaṃ hoti.
In marked, it is merely a prefix. Therefore, marked simply means ‘markable’. It is said that they are to be marked, noted, and observed for the purpose of undertaking the Uposatha, listening to the Dhamma, making offerings and showing respect, and so on.
Trong abhilakkhitā, chỉ có tiếp đầu ngữ. Do đó, abhilakkhitā có nghĩa là đáng được đánh dấu. Điều đó có nghĩa là đáng được đánh dấu, đáng được ghi nhớ, đáng được nhận biết để thực hiện việc thọ trì giới uposatha, nghe Pháp, cúng dường, cung kính, v.v.
Cātuddasīti pakkhassa paṭhamadivasato pabhuti catuddasannaṃ pūraṇī ekā ratti.
The fourteenth is the one night that completes the fourteen from the first day of the lunar fortnight.
Cātuddasī là một đêm trăng khuyết hoặc trăng tròn thứ mười bốn kể từ ngày đầu tiên của nửa tháng.
Evaṃ pañcadasī aṭṭhamī ca.
Likewise for the fifteenth and the eighth.
Tương tự, pañcadasī (ngày rằm) và aṭṭhamī (ngày mùng tám).
Pakkhassāti sukkapakkhassa kaṇhapakkhassa ca.
Of the fortnight means of the waxing fortnight and the waning fortnight.
Pakkhassa (của nửa tháng) có nghĩa là của nửa tháng tăng và nửa tháng giảm.
Etā tisso tisso katvā cha rattiyo, tasmā sabbattha pakkhavacanaṃ yojetabbaṃ ‘‘pakkhassa cātuddasī pakkhassa pañcadasī pakkhassa aṭṭhamī’’ti.
These are six nights, taking three at a time. Therefore, the word ‘fortnight’ should be applied everywhere: “the fourteenth of the fortnight, the fifteenth of the fortnight, the eighth of the fortnight.”
Có sáu đêm như vậy, ba đêm cho mỗi nửa tháng. Do đó, từ pakkhassa phải được ghép vào tất cả các trường hợp: “ngày mười bốn của nửa tháng, ngày rằm của nửa tháng, ngày mùng tám của nửa tháng”.
Atha pañcamī kasmā na gahitāti?
Then why was the fifth not included?
Vậy tại sao ngày mùng năm lại không được đề cập?
Asabbakālikattā.
Because it is not a regular observance day.
Vì nó không phải lúc nào cũng được đánh dấu.
Buddhe kira bhagavati anuppannepi uppajjitvā aparinibbutepi pañcamī anabhilakkhitāyeva, parinibbute pana dhammasaṅgāhakattherā cintesuṃ ‘‘dhammassavanaṃ cirena hotī’’ti.
It is said that the fifth was not marked either before the Blessed Buddha had arisen or after he had arisen but not yet attained final Nibbāna. After his final Nibbāna, however, the elders who compiled the Dhamma considered, “Listening to the Dhamma happens too infrequently.”
Nghe nói, ngay cả khi Đức Phật chưa xuất hiện, hoặc đã xuất hiện nhưng chưa nhập Niết-bàn, ngày mùng năm vẫn không được đánh dấu. Nhưng sau khi Đức Phật nhập Niết-bàn, các trưởng lão kết tập Pháp đã nghĩ: “Việc nghe Pháp diễn ra hiếm hoi”.
Tato sammannitvā pañcamīti dhammassavanadivasaṃ ṭhapesuṃ, tato pabhuti sā abhilakkhitā jātā, evaṃ asabbakālikattā ettha na gahitāti.
Then, having agreed, they established the fifth as a day for hearing the Dhamma. From that time on, it became a marked day. Thus, because it was not from all time, it is not included here.
Từ đó, sau khi thỏa thuận, họ đã ấn định ngày nghe Pháp là ngày mùng năm, từ đó ngày đó trở nên được ghi nhận. Vì vậy, do không phải lúc nào cũng có, nên nó không được đề cập ở đây.
Tathārūpāsūti tathāvidhāsu.
In such kinds of places: in such types of places.
Tathārūpāsu có nghĩa là những nơi như vậy.
Ārāmacetiyānīti pupphārāmaphalārāmādayo ārāmā eva ārāmacetiyāni.
Shrines in parks: parks themselves, such as flower parks and fruit parks, are shrines in parks.
Ārāmacetiyāni là những khu vườn như vườn hoa, vườn cây ăn quả, v.v., chính những khu vườn đó là các āramacetiyāni.
Cittīkataṭṭhena hi cetiyānīti vuccanti, pūjanīyaṭṭhenāti vuttaṃ hoti.
For, because they are revered, they are called shrines; this means, because they are venerable.
Chúng được gọi là cetiyāni vì chúng được tôn kính, tức là chúng đáng được cúng dường.
Vanacetiyānīti baliharaṇavanasaṇḍasubhagavanadevasālavanādīni vanāniyeva vanacetiyāni.
Shrines in forests: forests themselves, such as groves for making offerings, beautiful forest groves, and groves of divine sāla trees, are shrines in forests.
Vanacetiyāni là những khu rừng như rừng cúng dường, rừng đẹp, rừng cây sāla của chư thiên, v.v., chính những khu rừng đó là các vanacetiyāni.
Rukkhacetiyānīti gāmanigamādidvāresu pūjanīyarukkhāyeva rukkhacetiyāni.
Shrines at trees: venerable trees themselves at the gates of villages, towns, etc., are shrines at trees.
Rukkhacetiyāni là những cây đáng được cúng dường ở cổng làng, thị trấn, v.v., chính những cây đó là các rukkhacetiyāni.
Lokiyā hi dibbādhivatthāti vā maññamānā tesuyeva vā dibbasaññino hutvā ārāmavanarukkhe cittīkaronti, pūjenti, tena te sabbepi cetiyānīti vuccanti.
Indeed, worldly people, thinking, "They are inhabited by divine beings," or having a perception of the divine in them, revere and worship the parks, forests, and trees. Therefore, all of them are called shrines.
Người đời, hoặc nghĩ rằng chúng được chư thiên trú ngụ, hoặc có nhận thức về chư thiên trong chính những khu vườn, rừng, cây cối đó, thì tôn kính và cúng dường chúng. Vì vậy, tất cả những nơi đó đều được gọi là cetiyāni.
Bhiṃsanakānīti bhayajanakāni, passatopi suṇatopi bhayaṃ janenti.
Terrifying: fear-inspiring; they inspire fear in one who sees or hears them.
Bhiṃsanakāni có nghĩa là những nơi gây sợ hãi, chúng gây sợ hãi cho cả người nhìn và người nghe.
Salomahaṃsānīti saheva lomahaṃsena vattanti, pavisamānasseva lomahaṃsajananato.
Causing hair to stand on end: they occur together with hair-raising, because they cause the hair of one who is just entering to stand on end.
Salomahaṃsāni có nghĩa là chúng xảy ra cùng với sự dựng tóc gáy, vì chúng gây ra sự dựng tóc gáy ngay khi bước vào.
Appeva nāma passeyyanti api nāma taṃ bhayabheravaṃ passeyyameva.
Perhaps I might see: Perhaps I might indeed see that fear and terror.
Appeva nāma passeyyaṃ có nghĩa là có lẽ tôi sẽ thấy sự đáng sợ đó.
Aparena samayenāti, ‘‘etadahosi yaṃnūnāha’’nti evaṃ cintitakālato paṭṭhāya aññena kālena.
On a later occasion: at another time, starting from the time of thinking, "It occurred to me: 'What if I...'"
Aparena samayena có nghĩa là vào một thời điểm khác, kể từ khi có ý nghĩ "Ước gì tôi...".
Tattha ca me brāhmaṇa viharatoti tathārūpesu senāsanesu yaṃ yaṃ manussānaṃ āyācanaupahārakaraṇārahaṃ yakkhaṭṭhānaṃ pupphadhūpamaṃsaruhiravasāmedapihakapapphāsasurāmerayādīhi okiṇṇakilinnadharaṇitalaṃ ekanipātaṃ viya yakkharakkhasapisācānaṃ, yaṃ divāpi passantānaṃ hadayaṃ maññe phalati, taṃ ṭhānaṃ sandhāyāha ‘‘tattha ca me, brāhmaṇa, viharato’’ti.
And while I was dwelling there, brahmin: referring to that place—in such lodgings, whatever shrine of a yakkha was a place for people to make requests and offerings, its ground scattered and moist with flowers, incense, meat, blood, fat, marrow, entrails, lungs, liquor, spirits, and so on, like a gathering place for yakkhas, rakkhasas, and pisācas; a place the sight of which, even in the daytime, one might think would make the heart burst—he said, "And while I was dwelling there, brahmin."
Tattha ca me brāhmaṇa viharato có nghĩa là khi tôi, này Bà-la-môn, đang trú ngụ ở những nơi ở như vậy, những nơi thờ cúng của dạ-xoa đáng được con người cầu xin và cúng dường, với nền đất đầy hoa, hương, thịt, máu, mỡ, tủy, lá lách, phổi, rượu, bia, v.v., như một nơi tụ tập của dạ-xoa, la-sát, quỷ, nơi mà ngay cả khi nhìn vào ban ngày, trái tim dường như vỡ tan, thì ý muốn nói đến nơi đó là "khi tôi, này Bà-la-môn, đang trú ngụ ở đó".
Mago vā āgacchatīti siṅgāni vā khurāni vā koṭṭento gokaṇṇakhaggadīpivarāhādibhedo mago vā āgacchati, sabbacatuppadānañhi idha magoti nāmaṃ.
A beast might approach: A beast, such as a gokaṇṇa, a rhinoceros, a leopard, or a boar, might approach, striking its horns or hooves. For here, the name beast applies to all four-footed creatures.
Mago vā āgacchati có nghĩa là một con thú rừng, như bò rừng, tê giác, báo, lợn rừng, v.v., đến, đang húc sừng hoặc cào móng. Ở đây, mago là tên gọi chung cho tất cả các loài bốn chân.
Katthaci pana kāḷasiṅgālopi vuccati.
In some places, however, it also refers to a black jackal.
Ở một số nơi, nó cũng được gọi là chó rừng đen.
Yathāha –
As it is said:
Như đã nói:
Moro vā kaṭṭhaṃ pātetīti moro vā sukkhakaṭṭhaṃ rukkhato cāletvā pāteti.
Or a peacock might drop a twig: Or a peacock, shaking a dry twig from a tree, might cause it to fall.
Moro vā kaṭṭhaṃ pātetī có nghĩa là một con công hoặc một con chim khác làm rụng cành cây khô từ trên cây.
Moraggahaṇena ca idha sabbapakkhiggahaṇaṃ adhippetaṃ, tena yo koci pakkhīti vuttaṃ hoti.
And here, by the mention of a peacock, the inclusion of all birds is intended. Thus, "any bird" is what is meant.
Và ở đây, việc đề cập đến con công có ý nghĩa bao gồm tất cả các loài chim, tức là bất kỳ loài chim nào.
Atha vā moro vāti vā saddena añño vā koci pakkhīti.
Alternatively, by the word "or" in "or a peacock," it means "or some other bird."
Hoặc, với từ vā trong moro vā, có nghĩa là bất kỳ loài chim nào khác.
Esa nayo purime magaggahaṇepi.
This same method applies to the previous mention of a beast.
Tương tự cũng áp dụng cho việc đề cập đến thú rừng trước đó.
Vāto vā paṇṇakasaṭaṃ eretīti vāto vā paṇṇakacavaraṃ ghaṭṭeti.
Or the wind might rustle a heap of leaves: Or the wind might stir a pile of leaves and rubbish.
Vāto vā paṇṇakasaṭaṃ eretī có nghĩa là gió thổi lá khô.
Etaṃ nūna taṃ bhayabheravaṃ āgacchatīti yametaṃ āgacchati, taṃ bhayabheravaṃ nūnāti.
Surely this is that fear and terror coming: That which is coming, surely it is that fear and terror.
Etaṃ nūna taṃ bhayabheravaṃ āgacchati có nghĩa là cái đang đến đó chắc chắn là sự đáng sợ.
Ito pabhuti ca ārammaṇameva bhayabheravanti veditabbaṃ.
From this point on, it should be understood that the object itself is the fear and terror.
Từ đây trở đi, cần hiểu rằng chỉ có đối tượng là đáng sợ.
Parittassa ca adhimattassa ca bhayassa ārammaṇattā sukhārammaṇaṃ rūpaṃ sukhamiva.
Just as a pleasant form, being a pleasant object, is itself pleasure, this is because it is the object of both slight and intense fear.
Vì là đối tượng của nỗi sợ hãi nhỏ và nỗi sợ hãi lớn, nên sắc pháp là đối tượng của sự an lạc cũng giống như sự an lạc.
Kiṃ nu kho ahaṃ aññadatthu bhayapaṭikaṅkhī viharāmīti ahaṃ kho kiṃ kāraṇaṃ ekaṃseneva bhayaṃ ākaṅkhamāno icchamāno hutvā viharāmi.
Why do I dwell always expecting fear?: For what reason do I dwell, being one who constantly anticipates and wishes for fear?
Kiṃ nu kho ahaṃ aññadatthu bhayapaṭikaṅkhī viharāmī có nghĩa là tại sao tôi lại sống trong sự mong đợi nỗi sợ hãi một cách chắc chắn như vậy?
Yathābhūtaṃ yathābhūtassāti yena yena iriyāpathena bhūtassa bhavitassa sato vattamānassa samaṅgībhūtassa vā.
In whatever state it occurred: in whatever posture it happened, existed, was present, or was possessed.
Yathābhūtaṃ yathābhūtassā có nghĩa là bằng bất kỳ oai nghi nào của chúng sinh đã tồn tại, đang tồn tại, hoặc đã đạt được.
Meti mama santike.
To me: in my presence.
Me có nghĩa là ở nơi tôi.
Tathābhūtaṃ tathābhūto vāti tena teneva iriyāpathena bhūto bhavito santo vattamāno samaṅgībhūto vāti attho.
In that same state: The meaning is, being in that very same posture, existing, present, or possessed.
Tathābhūtaṃ tathābhūto vā có nghĩa là đã tồn tại, đang tồn tại, hoặc đã đạt được bằng chính oai nghi đó.
So kho ahaṃ…pe… paṭivinemīti bodhisattassa kira caṅkamantassa tasmiṃ magasiṅgakhurasaddādibhede bhayabheravārammaṇe āgate neva mahāsatto tiṭṭhati, na nisīdati na sayati, atha kho caṅkamantova parivīmaṃsanto parivicinanto bhayabheravaṃ na passati, magasiṅgakhurasaddādimattameva cetaṃ hoti, so taṃ ñatvā idaṃ nāmetaṃ, na bhayabheravanti tato tiṭṭhati vā nisīdati vā sayati vā.
Then I... dispelled it: When that object of fear and terror—differentiated as the sound of a beast's horns, hooves, and so on—appeared to the Bodhisatta while he was walking, the great being, it is said, did not stand still, did not sit down, did not lie down. Instead, while still walking, he investigated and examined it, but did not see any fear and terror. It was merely the sound of a beast's horns, hooves, and so on. Realizing this, he thought, "This is just its name; it is not fear and terror," and then he would stand, sit, or lie down.
So kho ahaṃ…pe… paṭivinemī có nghĩa là khi đối tượng đáng sợ như tiếng sừng, tiếng móng của thú rừng, v.v., xuất hiện trong khi Bồ-tát đang đi kinh hành, Đại Bồ-tát không đứng, không ngồi, không nằm, mà chỉ đi kinh hành, xem xét và suy xét, không thấy sự đáng sợ. Đó chỉ là tiếng sừng, tiếng móng của thú rừng, v.v. Sau khi biết điều đó, Ngài nghĩ: "Đây là tiếng này, không phải là sự đáng sợ," rồi Ngài đứng, ngồi, hoặc nằm.
Etamatthaṃ dassento ‘‘so kho aha’’ntiādimāha.
To show this meaning, he said, "Then I..." and so on.
Để chỉ rõ ý nghĩa này, Ngài nói: "So kho ahaṃ" và tiếp tục.
Esa nayo sabbapeyyālesu.
This is the method in all the abbreviated passages.
Nguyên tắc này áp dụng cho tất cả các đoạn văn tương tự.
Ito parañca iriyāpathapaṭipāṭiyā avatvā āsannapaṭipāṭiyā iriyāpathā vuttāti veditabbā, caṅkamantassa hi bhayabherave āgate na ṭhito na nisinno na nipanno ṭhitassāpi āgate na caṅkamīti evaṃ tassa āsannapaṭipāṭiyā vuttāti.
Hereafter, it should be understood that the postures are mentioned not in their sequential order but in the order of their proximity. For when fear and terror arose while he was walking, he did not stand, sit, or lie down. And when it arose while he was standing, he did not walk. Thus, they are spoken of in the order of their proximity for him.
Từ đây trở đi, cần hiểu rằng các oai nghi được nói theo thứ tự gần nhất, chứ không phải theo thứ tự thông thường của các oai nghi. Thật vậy, khi sự đáng sợ xuất hiện trong khi đang đi kinh hành, thì không đứng, không ngồi, không nằm; khi sự đáng sợ xuất hiện trong khi đang đứng, thì không đi kinh hành. Như vậy, các oai nghi được nói theo thứ tự gần nhất của Ngài.
Tattha santīti atthi saṃvijjanti upalabbhanti.
Therein, there are: they exist, are found, are met with.
Ở đó, santi có nghĩa là có, tồn tại, được tìm thấy.
Rattiṃyeva samānanti rattiṃyeva santaṃ, divāti sañjānantīti ‘‘divaso aya’’nti sañjānanti.
When it is night: while it is night, they perceive it as day: they perceive, "This is daytime."
Rattiṃyeva samānaṃ có nghĩa là khi là ban đêm, divāti sañjānanti có nghĩa là họ nhận biết "đây là ban ngày".
Divāyeva samānanti divasaṃyeva santaṃ.
When it is day: while it is daytime.
Divāyeva samānaṃ có nghĩa là khi là ban ngày.
Rattīti sañjānantīti ‘‘ratti aya’’nti sañjānanti.
They perceive it as night: they perceive, "This is nighttime."
Rattīti sañjānanti có nghĩa là họ nhận biết "đây là ban đêm".
Kasmā panete evaṃsaññino hontīti.
But why do they have such perceptions?
Tại sao những người này lại có nhận thức như vậy?
Vuṭṭhānakosallābhāvato vā sakuṇarutato vā.
Either due to a lack of skill in emerging from meditation or due to the sound of birds.
Hoặc do thiếu kỹ năng xuất thiền, hoặc do tiếng chim.
Kathaṃ?
How so?
Như thế nào?
Idhekacco odātakasiṇalābhī divā parikammaṃ katvā divā samāpanno divāyeva vuṭṭhahāmīti manasikāraṃ uppādeti, no ca kho addhānaparicchede kusalo hoti.
Here, a certain person who has attained the white kasiṇa, having done the preliminary work during the day and entered into attainment during the day, forms the intention, "I will emerge during the day," but he is not skilled in discerning the passage of time.
Ở đây, một người đã chứng kasiṇa trắng, sau khi thực hành chuẩn bị vào ban ngày, nhập thiền vào ban ngày, phát sinh ý niệm "tôi sẽ xuất thiền vào ban ngày", nhưng lại không thành thạo trong việc xác định thời gian.
So divasaṃ atikkamitvā rattibhāge vuṭṭhāti.
He passes the day and emerges in the night.
Người đó vượt quá ban ngày và xuất thiền vào ban đêm.
Odātakasiṇapharaṇavasena cassa visadaṃ hoti vibhūtaṃ suvibhūtaṃ.
And due to the pervasion of the white kasiṇa, it is clear, distinct, and very distinct for him.
Và do sự lan tỏa của kasiṇa trắng, tâm người đó trở nên trong sáng, rõ ràng, rất rõ ràng.
So, divā vuṭṭhahāmīti uppāditamanasikāratāya odātakasiṇapharaṇavisadavibhūtatāya ca rattiṃyeva samānaṃ divāti sañjānāti.
Because of the intention he had formed, "I will emerge during the day," and because of the clarity and distinctness from the pervasion of the white kasiṇa, while it is still night, he perceives it as day.
Do ý niệm đã phát sinh là "tôi sẽ xuất thiền vào ban ngày" và do sự trong sáng, rõ ràng của kasiṇa trắng lan tỏa, người đó nhận biết ban đêm là ban ngày.
Idha panekacco nīlakasiṇalābhī rattiṃ parikammaṃ katvā rattiṃ samāpanno rattiṃyeva vuṭṭhahāmīti manasikāraṃ uppādeti, no ca kho addhānaparicchede kusalo hoti.
Then there is a certain person who has attained the blue kasiṇa, having done the preliminary work at night and entered into attainment at night, forms the intention, "I will emerge at night," but he is not skilled in discerning the passage of time.
Ở đây, một người đã chứng kasiṇa xanh, sau khi thực hành chuẩn bị vào ban đêm, nhập thiền vào ban đêm, phát sinh ý niệm "tôi sẽ xuất thiền vào ban đêm", nhưng lại không thành thạo trong việc xác định thời gian.
So rattiṃ atikkamitvā divasabhāge vuṭṭhāti.
He passes the night and emerges in the daytime.
Người đó vượt quá ban đêm và xuất thiền vào ban ngày.
Nīlakasiṇapharaṇavasena cassa avisadaṃ hoti avibhūtaṃ.
And due to the suffusion of the blue kasina, it is unclear and indistinct for him.
Và do sự lan tỏa của kasiṇa xanh, tâm người đó trở nên không trong sáng, không rõ ràng.
So rattiṃ vuṭṭhahāmīti uppāditamanasikāratāya nīlakasiṇapharaṇāvisadāvibhūtatāya ca divāyeva samānaṃ rattīti sañjānāti.
Due to the attention he had produced, ‘I will emerge at night,’ and due to the unclearness and indistinctness from the suffusion of the blue kasina, he perceives it as night even though it is day.
Do ý niệm đã phát sinh là "tôi sẽ xuất thiền vào ban đêm" và do sự không trong sáng, không rõ ràng của kasiṇa xanh lan tỏa, người đó nhận biết ban ngày là ban đêm.
Evaṃ tāva vuṭṭhānakosallābhāvato evaṃsaññino honti.
Thus, firstly, they have such a perception due to a lack of skill in emerging.
Như vậy, trước hết, do thiếu kỹ năng xuất thiền, họ có nhận thức như vậy.
Sakuṇarutato pana idhekacco antosenāsane nisinno hoti.
Furthermore, on account of the sound of a bird, someone here might be sitting inside his lodging.
Còn do tiếng chim, ở đây có một người đang ngồi bên trong nơi ở.
Atha divā ravanakasakuṇā kākādayo candālokena divāti maññamānā rattiṃ ravanti, aññehi vā kāraṇehi.
Then birds that cry during the day, such as crows, thinking it is day because of the moonlight, cry at night, or for other reasons.
Rồi những con chim hót vào ban ngày, như quạ, v.v., do ánh trăng mà nghĩ là ban ngày, nên hót vào ban đêm, hoặc do những lý do khác.
So tesaṃ saddaṃ sutvā rattiṃyeva samānaṃ divāti sañjānāti.
Hearing their sound, he perceives it as day even though it is night.
Người đó nghe tiếng chúng và nhận biết ban đêm là ban ngày.
Idha panekacco pabbatantare gambhīrāya ghanavanappaṭicchannāya giriguhāya sattāhavaddalikāya vattamānāya antarahitasūriyāloke kāle nisinno hoti.
Or again, someone here might be sitting between mountains, in a deep mountain cave covered by a dense forest, at a time when the sunlight is hidden by a seven-day period of continuous rain.
Ở đây, một người đang ngồi trong một hang núi sâu, được bao phủ bởi rừng rậm, trong thời gian bảy ngày mưa lớn, khi ánh sáng mặt trời bị che khuất.
Atha rattiṃ ravanakasakuṇā ulūkādayo majjhanhikasamayepi tattha tattha samandhakāre nilīnā rattisaññāya vā aññehi vā kāraṇehi ravanti.
Then, birds that make sounds, such as owls, which cry at night, even at midday, while hidden here and there in deep darkness, make sounds either with the perception of it being night or for other reasons.
Rồi vào ban đêm, các loài chim kêu như cú, v.v., ngay cả vào giữa trưa, chúng ẩn mình trong bóng tối dày đặc ở khắp nơi, do nhận thức là ban đêm hoặc do các nguyên nhân khác mà chúng kêu.
So tesaṃ saddaṃ sutvā divāyeva samānaṃ rattīti sañjānāti.
Having heard their sound, he perceives it as night, although it is day.
Người ấy nghe tiếng của chúng, dù là ban ngày, lại nhận thức là ban đêm.
Evaṃ sakuṇarutato evaṃsaññino hontīti.
Thus, they have such perceptions from the sound of birds.
Như vậy, do tiếng chim kêu mà họ có nhận thức như thế.
Idamahanti idaṃ ahaṃ evaṃ sañjānanaṃ.
This I: This is my perception in this way.
Idamahaṃ (cái này tôi) là sự nhận thức như vậy.
Sammohavihārasmiṃ vadāmīti sammohavihārapariyāpannaṃ antogadhaṃ, sammohavihārānaṃ aññataraṃ vadāmīti vuttaṃ hoti.
I say is in a state of delusion: It is included within, pertaining to a state of delusion; it means, I say it is one of the states of delusion.
Sammohavihārasmiṃ vadāmīti (tôi nói về sự an trú mê lầm) có nghĩa là bao gồm, thuộc về sự an trú mê lầm, là một trong những sự an trú mê lầm.
Ahaṃ kho pana brāhmaṇa…pe… sañjānāmīti pākaṭo bodhisattassa rattindivaparicchedo sattāhavaddalepi candimasūriyesu adissamānesupi jānātiyeva ‘‘ettakaṃ purebhattakālo gato, ettakaṃ pacchābhattakālo, ettakaṃ paṭhamayāmo, ettakaṃ majjhimayāmo, ettakaṃ pacchimayāmo’’ti, tasmā evamāha.
But as for me, Brahmin… I perceive: The Bodhisatta’s distinction between night and day was clear. Even during a seven-day rainstorm, when the moon and sun were not visible, he knew, “This much of the pre-meal time has passed, this much of the post-meal time; this much of the first watch, this much of the middle watch, this much of the last watch.” Therefore, he spoke thus.
Ahaṃ kho pana brāhmaṇa…pe… sañjānāmīti (nhưng này Bà-la-môn, tôi…pe… nhận biết) là sự phân biệt ngày đêm của Bồ-tát rõ ràng. Ngài biết rõ ngay cả khi mặt trăng và mặt trời không xuất hiện trong bảy ngày mưa dầm, rằng: “Bấy nhiêu thời gian trước bữa ăn đã trôi qua, bấy nhiêu thời gian sau bữa ăn đã trôi qua, bấy nhiêu thời gian của canh đầu, bấy nhiêu thời gian của canh giữa, bấy nhiêu thời gian của canh cuối.” Vì vậy, Ngài đã nói như vậy.
Anacchariyañcetaṃ yaṃ pūritapāramī bodhisatto evaṃ jānāti.
And it is not surprising that the Bodhisatta who had fulfilled the perfections knows thus.
Và việc Bồ-tát đã viên mãn Ba-la-mật biết như vậy không phải là điều kỳ diệu.
Padesañāṇe ṭhitānaṃ sāvakānampi hi rattindivaparicchedo pākaṭo hoti.
For even for disciples who stand in partial knowledge, the distinction between night and day is clear.
Thật vậy, ngay cả đối với các đệ tử đã đạt được một phần tri kiến, sự phân biệt ngày đêm cũng rõ ràng.
Kalyāṇiyamahāvihāre kira godattatthero dvaṅgulakāle bhattaṃ gahetvā aṅgulakāle bhuñjati.
It is said that in the Kalyāṇiya Mahāvihāra, the Elder Godatta would take his meal when the shadow was two finger-breadths long and eat it when it was one finger-breadth long.
Nghe nói rằng, tại Đại Tự viện Kalyāṇiya, Trưởng lão Godatta nhận cơm vào lúc bóng đổ hai ngón tay và thọ thực vào lúc bóng đổ một ngón tay.
Sūriye adissamānepi pātoyeva senāsanaṃ pavisitvā tāya velāya nikkhamati.
Even when the sun was not visible, he would enter his dwelling early in the morning and emerge at that time.
Ngay cả khi mặt trời không xuất hiện, Ngài vẫn vào tịnh xá vào buổi sáng sớm và ra khỏi vào đúng thời điểm đó.
Ekadivasaṃ ārāmikā ‘‘sve therassa nikkhamanakāle passāmā’’ti bhattaṃ sampādetvā kālatthambhamūle nisīdiṃsu.
One day, the monastery attendants, thinking, “Tomorrow, let’s watch for the time the elder emerges,” prepared the meal and sat at the base of the time-post.
Một ngày nọ, các người làm vườn nói: “Ngày mai chúng ta sẽ xem lúc Trưởng lão ra,” rồi họ chuẩn bị bữa ăn và ngồi dưới gốc cột thời gian.
Thero dvaṅgulakāleyeva nikkhamati.
The elder emerged precisely when the shadow was two finger-breadths long.
Trưởng lão ra vào lúc bóng đổ hai ngón tay.
Tato pabhuti kira sūriye adissamānepi therassa nikkhamanasaññāya eva bheriṃ ākoṭenti.
It is said that from then on, even when the sun was not visible, they would strike the drum based solely on the sign of the elder's emergence.
Từ đó trở đi, ngay cả khi mặt trời không xuất hiện, họ vẫn đánh trống theo sự nhận biết về thời gian Trưởng lão ra.
Ajagaravihārepi kāḷadevatthero antovasse yāmagaṇḍikaṃ paharati, āciṇṇametaṃ therassa.
Also, in the Ajagara Vihāra, the Elder Kāḷadeva would strike the watch-gong during the rains retreat; this was the elder's custom.
Tại Tịnh xá Ajagara, Trưởng lão Kāḷadeva cũng đánh chuông canh trong mùa an cư, đó là thói quen của Trưởng lão.
Na ca yāmayantanāḷikaṃ payojeti, aññe bhikkhū payojenti.
And he did not use a mechanical water clock for the watches; other monks used them.
Ngài không sử dụng đồng hồ nước, nhưng các Tỳ-khưu khác thì có.
Atha nikkhante paṭhame yāme there muggaraṃ gahetvā ṭhitamatteyeva ekaṃ dve vāre paharanteyeva vā yāmayantaṃ patati, evaṃ tīsu yāmesu samaṇadhammaṃ katvā thero pātoyeva gāmaṃ pavisitvā piṇḍapātaṃ ādāya vihāraṃ āgantvā bhojanavelāya pattaṃ gahetvā divā vihāraṭṭhānaṃ gantvā samaṇadhammaṃ karoti.
Then, when the first watch had passed, just as the elder took the mallet and stood, or as he was striking it once or twice, the watch-mechanism would activate. In this way, after practicing the ascetic's duties for the three watches, the elder would enter the village early in the morning, take his alms food, return to the monastery, take his bowl at mealtime, go to his day-dwelling, and practice the ascetic's duties.
Rồi khi canh đầu đã qua, ngay khi Trưởng lão cầm chày đứng lên hoặc đánh một hai lần, đồng hồ nước liền rơi xuống. Như vậy, sau khi thực hành pháp Sa-môn trong ba canh, Trưởng lão vào làng vào buổi sáng sớm, nhận thực phẩm khất thực, trở về tịnh xá, và vào giờ ăn, cầm bát đi đến nơi ở ban ngày để thực hành pháp Sa-môn.
Bhikkhū kālatthambhaṃ disvā therassa adisvā āgamanatthāya pesenti.
The monks, seeing the time-post, would send for the elder to come without his seeing it.
Các Tỳ-khưu nhìn thấy cột thời gian và cử người đi đón Trưởng lão.
So bhikkhu theraṃ divā vihāraṭṭhānā nikkhamantameva vā antarāmagge vā passati.
That monk would see the elder either just as he was leaving the day-dwelling or on the path in between.
Vị Tỳ-khưu đó thấy Trưởng lão đang rời khỏi nơi ở ban ngày hoặc đang ở giữa đường.
Evaṃ padesañāṇe ṭhitānaṃ sāvakānampi rattindivaparicchedo pākaṭo hoti, kimaṅgaṃ pana bodhisattānanti.
Thus, even for disciples established in partial knowledge, the distinction between night and day is clear; what then needs to be said of Bodhisattas?
Như vậy, ngay cả đối với các đệ tử đã đạt được một phần tri kiến, sự phân biệt ngày đêm cũng rõ ràng, huống chi là đối với các Bồ-tát!
Yaṃ kho taṃ brāhmaṇa…pe… vadeyyāti ettha pana ‘‘yaṃ kho taṃ, brāhmaṇa, asammohadhammo satto loke uppanno…pe… sukhāya devamanussāna’’nti vacanaṃ vadamāno koci sammā vadeyya, sammā vadamāno siyā, na vitathavādī assa.
Whatever, Brahmin… one might say: Here, someone speaking the words, “Whatever, Brahmin, being of undeluded nature has arisen in the world… for the happiness of gods and humans,” would be speaking rightly, would be one who speaks rightly, not one who speaks falsely.
Trong câu Yaṃ kho taṃ brāhmaṇa…pe… vadeyyāti (Này Bà-la-môn, nếu ai…pe… nói), cần hiểu rằng: nếu có ai nói rằng “Này Bà-la-môn, một chúng sanh không mê lầm đã xuất hiện trên đời…pe… vì hạnh phúc của chư thiên và loài người,” thì người ấy nói đúng, người ấy là người nói đúng, không phải là người nói sai.
Mameva taṃ vacanaṃ vadamāno sammā vadeyya, sammā vadamāno siyā, na vitathavādī assāti evaṃ padasambandho veditabbo.
Speaking those words, one would be speaking rightly of me; being one who speaks rightly, one would not be a speaker of falsehood. Thus the connection of the words should be understood.
Khi nói lời đó về chính tôi, người ấy nói đúng, người ấy là người nói đúng, không phải là người nói sai. Cần hiểu sự liên kết từ ngữ như vậy.
Tattha asammohadhammoti asammohasabhāvo.
Therein, of undeluded nature means of undeluded disposition.
Ở đây, asammohadhammo có nghĩa là bản chất không mê lầm.
Loketi manussaloke.
In the world means in the human world.
Loke có nghĩa là trong cõi người.
Bahujanahitāyāti bahujanassa hitatthāya, paññāsampattiyā diṭṭhadhammikasamparāyikahitūpadesakoti.
For the welfare of many people means for the benefit of many people; through the accomplishment of wisdom, he is an instructor in the welfare of this life and the next.
Bahujanahitāyā có nghĩa là vì lợi ích của nhiều người, tức là bậc chỉ dạy lợi ích hiện tại và tương lai bằng sự đầy đủ về trí tuệ.
Bahujanasukhāyāti bahujanassa sukhatthāya, cāgasampattiyā upakaraṇasukhassa dāyakoti.
For the happiness of many people means for the happiness of many people; through the accomplishment of generosity, he is a giver of the happiness of requisites.
Bahujanasukhāyā có nghĩa là vì hạnh phúc của nhiều người, tức là bậc ban cho hạnh phúc về vật chất bằng sự đầy đủ về bố thí.
Lokānukampāyāti lokassa anukampatthāya, mettākaruṇāsampattiyā mātāpitaro viya lokassa rakkhitā gopayitāti.
Out of compassion for the world means for the sake of compassion for the world; through the accomplishment of loving-kindness and compassion, he is a protector and guardian of the world like a mother and father.
Lokānukampāyā có nghĩa là vì lòng thương xót thế gian, tức là bậc che chở, bảo vệ thế gian như cha mẹ đối với con cái bằng sự đầy đủ về từ bi.
Atthāya hitāya sukhāya devamanussānanti idha devamanussaggahaṇena ca bhabbapuggalaveneyyasatteyeva gahetvā tesaṃ nibbānamaggaphalādhigamāya attano uppattiṃ dassetīti veditabbo.
For the good, for the welfare, for the happiness of gods and humans: Here, by the inclusion of gods and humans, it should be understood that by taking only beings who are suitable persons to be taught, he shows his own arising for their attainment of the path and fruit of Nibbāna.
Atthāya hitāya sukhāya devamanussānanti (vì lợi ích, vì hạnh phúc, vì an lạc của chư thiên và loài người): Ở đây, cần hiểu rằng việc đề cập đến chư thiên và loài người là để chỉ những chúng sanh có khả năng giác ngộ, những người có thể được giáo hóa, và để cho thấy sự xuất hiện của Ngài là để họ đạt được Đạo quả Niết-bàn.
Atthāyāti hi vutte paramatthatthāya nibbānāyāti vuttaṃ hoti.
For when for the good is said, it means for the ultimate good, for Nibbāna.
Khi nói Atthāyā, tức là nói đến mục đích tối thượng, Niết-bàn.
Hitāyāti vutte taṃ sampāpakamaggatthāyāti vuttaṃ hoti, nibbānasampāpakamaggato hi uttari hitaṃ nāma natthi.
When for the welfare is said, it means for the path that leads to it; for there is no higher welfare than the path that leads to Nibbāna.
Khi nói Hitāyā, tức là nói đến con đường dẫn đến Niết-bàn, vì không có lợi ích nào cao hơn con đường dẫn đến Niết-bàn.
Sukhāyāti vutte phalasamāpattisukhatthāyāti vuttaṃ hoti, tato uttari sukhābhāvato.
When for the happiness is said, it means for the happiness of the attainment of the fruit, because there is no happiness higher than that.
Khi nói Sukhāyā, tức là nói đến hạnh phúc của sự nhập quả, vì không có hạnh phúc nào cao hơn hạnh phúc đó.
Vuttañcetaṃ ‘‘ayaṃ samādhi paccuppannasukho ceva āyatiñca sukhavipāko’’ti (dī. ni. 3.355; a. ni. 5.27; vibha. 804).
And it has been said: “This concentration is pleasant in the present and has a pleasant result in the future.”
Và điều này đã được nói: “Thiền định này mang lại hạnh phúc hiện tại và quả báo hạnh phúc trong tương lai” (Dī. Ni. 3.355; A. Ni. 5.27; Vibha. 804).
Tattha āraddhaṃ kho pana me, brāhmaṇa, vīriyaṃ ahosīti, brāhmaṇa, na mayā ayaṃ uttamo asammohavihāro kusītena muṭṭhassatinā sāraddhakāyena vikkhittacittena vā adhigato, apica kho tadadhigamāya āraddhaṃ kho pana me vīriyaṃ ahosi, bodhimaṇḍe nisinnena mayā caturaṅgavīriyaṃ āraddhaṃ ahosi, paggahitaṃ asithilappavattitanti vuttaṃ hoti.
Therein, But, Brahmin, my energy was aroused means: Brahmin, this supreme state of non-delusion was not attained by me through laziness, with lapsed mindfulness, with an agitated body, or with a distracted mind. Rather, for its attainment, my energy was indeed aroused. This means that, seated at the foot of the Bodhi tree, my four-factored energy was aroused, upheld, and unslacking in its progression.
Ở đây, āraddhaṃ kho pana me, brāhmaṇa, vīriyaṃ ahosīti (nhưng này Bà-la-môn, tôi đã tinh tấn) có nghĩa là: Này Bà-la-môn, tôi không đạt được sự an trú không mê lầm tối thượng này bằng sự lười biếng, mất chánh niệm, thân thể uể oải, hay tâm tán loạn. Trái lại, để đạt được điều đó, tôi đã tinh tấn. Khi ngồi dưới cội Bồ-đề, tôi đã tinh tấn với bốn chi phần, tức là sự tinh tấn được thúc đẩy, không chùng xuống.
Āraddhattāyeva ca metaṃ asallīnaṃ ahosi.
And precisely because it was aroused, it was unshrinking.
Và chính vì sự tinh tấn đó mà tâm tôi asallīnaṃ (không co rút).
Upaṭṭhitā sati asammuṭṭhāti na kevalañca vīriyameva, satipi me ārammaṇābhimukhībhāvena upaṭṭhitā ahosi.
My mindfulness was established, unmuddled: Not only energy, but my mindfulness was also established by facing the object.
Upaṭṭhitā sati asammuṭṭhāti (chánh niệm hiện tiền, không bị lãng quên): Không chỉ có tinh tấn, mà chánh niệm của tôi cũng hiện tiền, hướng về đối tượng.
Upaṭṭhitattāyeva ca asammuṭṭhā.
And precisely because it was established, it was unmuddled.
Và chính vì hiện tiền mà không bị lãng quên.
Passaddho kāyoti kāyacittappassaddhisambhavena kāyopi me passaddho ahosi.
My body was tranquil: Due to the arising of tranquility of the mental and physical body, my body, too, was tranquil.
Passaddho kāyoti (thân thể an tịnh): Do sự an tịnh của thân và tâm, thân tôi cũng an tịnh.
Tattha yasmā nāmakāye passaddhe rūpakāyopi passaddhoyeva hoti, tasmā nāmakāyo rūpakāyoti avisesetvāva passaddho kāyoti vuttaṃ.
Therein, because when the mental body is tranquil, the physical body is also tranquil, it is said, "my body was tranquil," without specifying "mental body" or "physical body."
Ở đây, vì khi danh thân an tịnh thì sắc thân cũng an tịnh, nên không phân biệt danh thân và sắc thân mà chỉ nói “thân thể an tịnh.”
Asāraddhoti so ca kho passaddhattāyeva asāraddho, vigatadarathoti vuttaṃ hoti.
Unagitated: And that, precisely because it was tranquil, was unagitated; it means it was free from distress.
Asāraddhoti (không xao động): Và chính vì an tịnh mà không xao động, tức là đã loại bỏ sự bồn chồn.
Samāhitaṃ cittaṃ ekagganti cittampi me sammā āhitaṃ suṭṭhu ṭhapitaṃ appitaṃ viya ahosi.
My mind was concentrated, one-pointed: My mind, too, was well-placed, rightly established, as if in absorption.
Samāhitaṃ cittaṃ ekagganti (tâm định tĩnh, nhất tâm): Tâm tôi cũng được an định đúng đắn, được đặt vững chắc như được an trú.
Samāhitattā eva ca ekaggaṃ acalaṃ nipphandananti, ettāvatā jhānassa pubbabhāgapaṭipadā kathitā hoti.
And precisely because it was concentrated, it was one-pointed, unshakable, and still. By this much, the preliminary practice for jhāna is described.
Và chính vì được an định mà nhất tâm, bất động, không dao động. Đến đây, con đường thực hành sơ khởi của thiền đã được trình bày.
Idāni imāya paṭipadāya adhigataṃ paṭhamajjhānaṃ ādiṃ katvā vijjāttayapariyosānaṃ visesaṃ dassento so kho ahantiādimāha.
Now, to show the special attainments, beginning with the first jhāna and ending with the three knowledges, that were attained through this practice, he said, I, indeed, etc.
Bây giờ, để chỉ ra sự đặc biệt từ sơ thiền cho đến tam minh, được đạt được bằng con đường thực hành này, Ngài đã nói so kho ahantiādimāha (tôi đã), v.v.
Tattha vivicceva kāmehi…pe… catutthajjhānaṃ upasampajja vihāsinti ettha tāva yaṃ vattabbaṃ siyā, taṃ sabbaṃ visuddhimagge pathavīkasiṇakathāyaṃ vuttaṃ.
Therein, whatever should be said regarding quite secluded from sensual pleasures… entering and abiding in the fourth jhāna, all of that has been said in the Visuddhimagga in the section on the earth kasiṇa.
Ở đây, tất cả những gì cần nói về vivicceva kāmehi…pe… catutthajjhānaṃ upasampajja vihāsinti (ly dục…pe… chứng và an trú tứ thiền) đã được trình bày trong Visuddhimagga, phần chú giải về kasina đất.
Kevalañhi tattha ‘‘upasampajja viharatī’’ti āgataṃ, idha ‘‘vihāsi’’nti, ayameva viseso.
The only difference is that there it appears as “entering and abides,” whereas here it is “abode”; this is the only distinction.
Chỉ có sự khác biệt là ở đó nói “upasampajja viharatī” (chứng và an trú), còn ở đây nói “vihāsi” (đã an trú), đó là sự khác biệt duy nhất.
Kiṃ katvā pana bhagavā imāni jhānāni upasampajja vihāsīti, kammaṭṭhānaṃ bhāvetvā.
But by doing what did the Blessed One enter and dwell in these jhānas? Having developed a meditation subject.
Đức Thế Tôn đã làm gì để chứng đắc và an trú trong các thiền này? – Ngài đã tu tập pháp hành (kammaṭṭhāna).
Kataraṃ?
Which one?
Pháp hành nào?
Ānāpānassatikammaṭṭhānaṃ.
The meditation subject of mindfulness of breathing.
Pháp hành niệm hơi thở vào ra (ānāpānassati kammaṭṭhāna).
Imāni ca pana cattāri jhānāni kesañci cittekaggatatthāni honti, kesañci vipassanāpādakāni, kesañci abhiññāpādakāni, kesañci nirodhapādakāni, kesañci bhavokkamanatthāni.
Furthermore, these four jhānas are for the purpose of one-pointedness of mind for some, are the basis for insight for some, are the basis for the direct knowledges for some, are the basis for the attainment of cessation for some, and are for the purpose of proceeding to a new existence for some.
Bốn thiền này, đối với một số người, là để tâm chuyên nhất; đối với một số người, là nền tảng cho tuệ quán (vipassanā); đối với một số người, là nền tảng cho thắng trí (abhiññā); đối với một số người, là nền tảng cho diệt thọ tưởng định (nirodhasamāpatti); đối với một số người, là để tái sinh vào cõi Phạm thiên (brahmaloka).
Tattha khīṇāsavānaṃ cittekaggatatthāni honti.
Among these, for those with destroyed taints, they are for the purpose of one-pointedness of mind.
Trong số đó, đối với các bậc lậu tận (khīṇāsava), các thiền này là để tâm chuyên nhất.
Te hi samāpajjitvā ekaggacittā sukhaṃ divasaṃ viharissāmāti iccevaṃ kasiṇaparikammaṃ katvā aṭṭha samāpattiyo nibbattenti.
For having entered the attainment, they generate the eight attainments with just the wish, “With a one-pointed mind, we will dwell happily for the day,” after doing the preliminary work on a kasiṇa.
Thật vậy, các vị ấy chứng nhập thiền, rồi thực hành biến xứ (kasiṇa parikamma) với ý muốn rằng: “Chúng ta sẽ an trú an lạc cả ngày với tâm chuyên nhất”, và như vậy, các vị ấy phát sinh tám bậc thiền chứng (aṭṭha samāpatti).
Sekkhaputhujjanānaṃ samāpattito vuṭṭhāya samāhitena cittena vipassissāmāti nibbattentānaṃ vipassanāpādakāni honti.
For trainees and ordinary persons who generate them thinking, “Having emerged from the attainment, we will practice insight with a concentrated mind,” they are the basis for insight.
Đối với các bậc Hữu học (sekkhaputhujjana) và phàm phu (puthujjana), các thiền này là nền tảng cho tuệ quán, khi các vị ấy phát sinh thiền với ý muốn rằng: “Chúng ta sẽ xuất định và quán chiếu với tâm định tĩnh”.
Ye pana aṭṭha samāpattiyo nibbattetvā abhiññāpādakajjhānaṃ samāpajjitvā samāpattito vuṭṭhāya ‘‘ekopi hutvā bahudhā hotī’’ti (dī. ni. 1.238; paṭi. ma. 1.102) vuttanayā abhiññāyo patthentā nibbattenti, tesaṃ abhiññāpādakāni honti.
But for those who, having generated the eight attainments, enter the jhāna that is the basis for the direct knowledges, and having emerged from the attainment, generate them while aspiring for the direct knowledges in the manner stated, “Being one, he becomes many,” they are the basis for the direct knowledges.
Còn những ai đã phát sinh tám bậc thiền chứng, rồi chứng nhập thiền làm nền tảng cho thắng trí, xuất định và phát sinh các thắng trí theo cách đã nói như: “một thân hiện ra nhiều thân” (Dī. Ni. 1.238; Paṭi. Ma. 1.102), thì đối với các vị ấy, các thiền này là nền tảng cho thắng trí.
Ye pana aṭṭha samāpattiyo nibbattetvā nirodhasamāpattiṃ samāpajjitvā sattāhaṃ acittā hutvā diṭṭheva dhamme nirodhaṃ nibbānaṃ patvā sukhaṃ viharissāmāti nibbattenti, tesaṃ nirodhapādakāni honti.
But for those who, having generated the eight attainments, generate them thinking, “Having entered the attainment of cessation and become without a mind for seven days, we will dwell happily, having attained cessation, which is Nibbāna, in this very life,” for them they are the basis for the attainment of cessation.
Những ai đã phát sinh tám bậc thiền chứng, rồi chứng nhập Diệt thọ tưởng định, an trú vô tâm trong bảy ngày, và phát sinh Diệt độ (Nibbāna) trong hiện tại, an trú an lạc, thì đối với các vị ấy, các thiền này là nền tảng cho Diệt thọ tưởng định.
Ye pana aṭṭha samāpattiyo nibbattetvā aparihīnajjhānā brahmaloke uppajjissāmāti nibbattenti, tesaṃ bhavokkamanatthāni honti.
But for those who, having generated the eight attainments, generate them thinking, “Without having lost the jhāna, we will be reborn in the brahma world,” for them they are for the purpose of proceeding to a new existence.
Những ai đã phát sinh tám bậc thiền chứng, rồi với thiền không bị thoái thất (aparihīnajjhāna) mà phát sinh ý muốn tái sinh vào cõi Phạm thiên, thì đối với các vị ấy, các thiền này là để tái sinh vào cõi Phạm thiên.
52. Yesañca guṇānaṃ dāyakaṃ ahosi, tesaṃ ekadesaṃ dassento so evaṃ samāhite cittetiādimāha.
52. And showing a portion of those qualities of which it was the bestower, he said, so evaṃ samāhite citte, and so on.
Để chỉ ra một phần của những công đức mà thiền đã ban tặng, Đức Thế Tôn đã nói: “Này các Bà-la-môn, khi tâm ta đã định tĩnh như vậy…” và tiếp theo.
Tattha dvinnaṃ vijjānaṃ anupadavaṇṇanā ceva bhāvanānayo ca visuddhimagge vitthārito.
Therein, both the word-by-word explanation of the two knowledges and the method of development have been detailed in the Visuddhimagga.
Trong đó, phần giải thích từng từ (anupadavaṇṇanā) và phương pháp tu tập (bhāvanānaya) của hai loại minh (vijjā) đã được trình bày chi tiết trong Thanh Tịnh Đạo (Visuddhimagga).
Kevalañhi tattha ‘‘so evaṃ samāhite citte…pe… abhininnāmetī’’ti vuttaṃ, idha ‘‘abhininnāmesi’’nti.
It is only that there it is said, “so evaṃ samāhite citte… and so on… abhininnāmeti,” whereas here it is “abhininnāmesi.”
Tuy nhiên, ở đó chỉ nói “so evaṃ samāhite citte…pe… abhininnāmetī” (khi tâm đã định tĩnh như vậy… hướng đến), còn ở đây nói “abhininnāmesiṃ” (tôi đã hướng đến).
Ayaṃ kho me brāhmaṇāti ayañca appanāvāro tattha anāgatoti ayameva viseso.
This is the only difference, and also that this absorption section, Ayaṃ kho me brāhmaṇā, does not appear there.
Và đoạn “Ayaṃ kho me brāhmaṇā” (Này các Bà-la-môn, đây là của ta) này không có ở đó, nên đây là điểm khác biệt.
Tattha soti so ahaṃ.
Therein, so means ‘that I’.
Trong đó, “so” (này) có nghĩa là “so ahaṃ” (này là ta).
Abhininnāmesinti abhinīhariṃ.
Abhininnāmesi means ‘I directed’.
“Abhininnāmesiṃ” (tôi đã hướng đến) có nghĩa là “abhinīhariṃ” (tôi đã hướng tâm).
Abhininnāmesinti ca vacanato soti ettha so ahanti evamattho veditabbo.
And from the word abhininnāmesi, the meaning of so should be understood here as ‘that I’.
Vì có lời nói “abhininnāmesiṃ”, nên ý nghĩa của từ “so” ở đây phải được hiểu là “so ahaṃ” (này là ta).
Yasmā cidaṃ bhagavato vasena pubbenivāsānussatiñāṇaṃ āgataṃ, tasmā ‘‘so tato cuto idhūpapanno’’ti ettha evaṃ yojanā veditabbā.
And since this knowledge of recollecting former abodes came by way of the Blessed One, the connection in “so tato cuto idhūpapanno” should be understood in this way.
Vì túc mạng trí (pubbenivāsānussatiñāṇa) này được đề cập theo cách của Đức Thế Tôn, nên sự kết nối trong câu “so tato cuto idhūpapanno” (vị ấy từ đó chết đi, rồi tái sinh ở đây) phải được hiểu như sau:
Ettha hi so tato cutoti paṭinivattantassa paccavekkhaṇaṃ.
For here, so tato cuto is the reviewing of one who is recollecting in reverse order.
Ở đây, “so tato cuto” (vị ấy từ đó chết đi) là sự quán xét của vị Bồ-tát đang hồi tưởng.
Tasmā idhūpapannoti imissā idhūpapattiyā anantaraṃ.
Therefore, after idhūpapanno, which means this arising here,
Do đó, “idhūpapanno” (tái sinh ở đây) là ngay sau sự tái sinh này.
Amutra udapādinti tusitabhavanaṃ sandhāyāhāti veditabbo.
it should be understood that he said amutra udapādiṃ with reference to the Tusita heaven.
“Amutra udapādiṃ” (tôi đã tái sinh ở đó) phải được hiểu là đề cập đến cõi trời Đâu Suất (Tusitabhavana).
Tatrāpāsiṃ evaṃnāmoti tatrāpi tusitabhavane setaketu nāma devaputto ahosiṃ.
Tatrāpāsiṃ evaṃnāmo means: there, in the Tusita heaven, I was a deva-son named Setaketu.
“Tatrāpāsiṃ evaṃnāmo” (ở đó tôi có tên như vậy) có nghĩa là: ở đó, tại cõi trời Đâu Suất, tôi là một vị thiên tử tên là Setaketu.
Evaṃgottoti tāhi devatāhi saddhiṃ ekagotto.
Evaṃgotto means: of the same clan as those devas.
“Evaṃgotto” (có dòng họ như vậy) có nghĩa là: cùng dòng họ với các vị trời ấy.
Evaṃvaṇṇoti suvaṇṇavaṇṇo.
Evaṃvaṇṇo means: of a golden complexion.
“Evaṃvaṇṇo” (có sắc diện như vậy) có nghĩa là: có sắc diện vàng ròng.
Evamāhāroti dibbasudhāhāro.
Evamāhāro means: my food was the divine ambrosia.
“Evamāhāro” (có thức ăn như vậy) có nghĩa là: có thức ăn là cam lồ của chư thiên.
Evaṃsukhadukkhappaṭisaṃvedīti evaṃ dibbasukhapaṭisaṃvedī.
Evaṃsukhadukkhappaṭisaṃvedī means: I thus experienced divine bliss.
“Evaṃsukhadukkhappaṭisaṃvedī” (kinh nghiệm khổ lạc như vậy) có nghĩa là: kinh nghiệm sự an lạc của chư thiên như vậy.
Dukkhaṃ pana saṅkhāradukkhamattameva.
As for suffering, it was only the suffering of conditioned phenomena.
Còn khổ chỉ là khổ của các hành (saṅkhāra-dukkha) mà thôi.
Evamāyupariyantoti evaṃ sattapaññāsavassakoṭisaṭṭhivassasatasahassāyupariyanto.
Evamāyupariyanto means: thus my lifespan’s limit was fifty-seven crores and sixty hundred thousand years.
“Evamāyupariyanto” (có tuổi thọ đến mức như vậy) có nghĩa là: có tuổi thọ đến mức bảy mươi lăm triệu sáu mươi vạn năm.
So tato cutoti so ahaṃ tato tusitabhavanato cuto.
So tato cuto means: that I, having passed away from that Tusita heaven,
“So tato cuto” (tôi từ đó chết đi) có nghĩa là: tôi, từ cõi trời Đâu Suất, đã chết đi.
Idhūpapannoti idha mahāmāyāya deviyā kucchimhi nibbatto.
Idhūpapanno means: was conceived here in the womb of Queen Mahāmāyā.
“Idhūpapanno” (tái sinh ở đây) có nghĩa là: tái sinh trong bụng của Hoàng hậu Mahāmāyā ở đây.
Ayaṃ kho me brāhmaṇātiādīsu meti mayā.
In Ayaṃ kho me brāhmaṇā, etc., me means ‘by me’.
Trong câu “Ayaṃ kho me brāhmaṇā” và các câu tiếp theo, “me” (của ta) có nghĩa là “mayā” (bởi ta).
Vijjāti viditakaraṇaṭṭhena vijjā.
Vijjā: it is vijjā in the sense of making known.
“Vijjā” (minh) được gọi là minh vì nó có ý nghĩa làm cho biết rõ.
Kiṃ viditaṃ karoti?
What does it make known?
Nó làm cho biết rõ điều gì?
Pubbenivāsaṃ.
The former abodes.
Túc mạng (pubbenivāsa).
Avijjāti tasseva pubbenivāsassa aviditakaraṇaṭṭhena tappaṭicchādako moho vuccati.
Avijjā: delusion that conceals those former abodes is called ‘avijjā’ in the sense of making them not known.
“Avijjā” (vô minh) được gọi là sự si mê che lấp túc mạng ấy, vì nó có ý nghĩa làm cho không biết rõ túc mạng ấy.
Tamoti sveva moho paṭicchādakaṭṭhena ‘‘tamo’’ti vuccati.
Tamo: that very same delusion is called ‘tamo’ (darkness) in the sense of concealing.
“Tamo” (tối tăm) cũng chính là sự si mê ấy, được gọi là “tamo” vì nó có ý nghĩa che lấp.
Ālokoti sāyeva vijjā obhāsakaraṇaṭṭhena ‘‘āloko’’ti vuccati.
Āloko: that very same knowledge is called ‘āloko’ (light) in the sense of illuminating.
“Āloko” (ánh sáng) cũng chính là minh ấy, được gọi là “āloko” vì nó có ý nghĩa làm cho sáng tỏ.
Ettha ca vijjā adhigatāti ayaṃ attho, sesaṃ pasaṃsāvacanaṃ.
And here, the meaning is that knowledge was attained; the rest is a statement of praise.
Và ở đây, ý nghĩa là minh đã được chứng đắc, phần còn lại là lời tán thán.
Yojanā panettha ayaṃ kho me vijjā adhigatā, tassa me adhigatavijjassa avijjā vihatā, vinaṭṭhāti attho.
The connection here is: This knowledge was attained by me; for me who had attained the knowledge, ignorance was destroyed—the meaning is, it perished.
Sự kết nối ở đây là: “Này các Bà-la-môn, minh này đã được ta chứng đắc. Đối với ta, người đã chứng đắc minh, vô minh đã bị tiêu diệt, đã bị hủy hoại”.
Yasmā vijjā uppannā.
Because knowledge arose.
Vì minh đã phát sinh.
Esa nayo itarasmimpi padadvaye.
This is the method in the other two pairs of terms as well.
Nguyên tắc này cũng tương tự đối với hai cặp từ còn lại.
Yathā tanti ettha yathāti opamme.
In Yathā taṃ, the word yathā is used in a comparison.
Trong câu “Yathā taṃ”, “yathā” là để ví von.
Tanti nipāto.
The word taṃ is a particle.
“Taṃ” là một giới từ (nipāta).
Satiyā avippavāsena appamattassa.
Appamattassa (of one who is diligent) because of the non-departure of mindfulness.
“Appamattassa” (người không phóng dật) là do không xa lìa chánh niệm (sati).
Vīriyātāpena ātāpino.
Ātāpino (of one who is ardent) because of the heat of energy.
“Ātāpino” (người tinh cần) là do sự nung nấu của tinh tấn (vīriya).
Kāye ca jīvite ca anapekkhatāya pahitattassa, pesitattassāti attho.
Pahitattassa (of one who is resolute) because of having no concern for the body and life; the meaning is, of one whose self is sent forth.
“Pahitattassa” (người đã hướng tâm) là do không bận tâm đến thân và mạng sống, có nghĩa là người đã gửi gắm tâm mình.
Idaṃ vuttaṃ hoti ‘‘yathā appamattassa ātāpino pahitattassa viharato avijjā vihaññeyya, vijjā uppajjeyya.
This is what is meant: “Just as for one dwelling diligent, ardent, and resolute, ignorance would be destroyed and knowledge would arise,
Điều này có nghĩa là: “Cũng như vô minh sẽ bị tiêu diệt và minh sẽ phát sinh, tối tăm sẽ bị tiêu diệt và ánh sáng sẽ phát sinh, đối với người không phóng dật, tinh cần và đã hướng tâm khi an trú.
Tamo vihaññeyya, āloko uppajjeyya.
darkness would be destroyed and light would arise,
Tối tăm sẽ bị tiêu diệt, ánh sáng sẽ phát sinh.
Evameva mama avijjā vihatā, vijjā uppannā.
just so for me ignorance was destroyed and knowledge arose,
Cũng vậy, vô minh của ta đã bị tiêu diệt, minh đã phát sinh.
Tamo vihato, āloko uppanno.
darkness was destroyed and light arose.
Tối tăm đã bị tiêu diệt, ánh sáng đã phát sinh.
Etassa me padhānānuyogassa anurūpameva phalaṃ laddha’’nti.
For my application to striving, a corresponding fruit has been obtained.”
Quả này đã được ta đạt được tương xứng với sự tinh tấn tu tập của ta.”
Ettha pana vijjāti dibbacakkhuñāṇavijjā.
Here, however, vijjā is the knowledge of the divine eye.
Ở đây, “vijjā” (minh) là thiên nhãn trí (dibbacakkhuñāṇa vijjā).
Avijjāti sattānaṃ cutipaṭisandhipaṭicchādikā avijjā.
Avijjā is the ignorance that conceals the passing away and rebirth of beings.
“Avijjā” (vô minh) là vô minh che lấp sự chết và tái sinh của chúng sanh.
Sesaṃ vuttanayamevāti.
The rest is according to the method already stated.
Phần còn lại tương tự như đã nói.
Yasmā ca pūritapāramīnaṃ mahāsattānaṃ parikammakiccaṃ nāma natthi.
And since for great beings who have fulfilled the perfections, there is no such task as preliminary work,
Và vì các vị Đại Bồ-tát đã viên mãn các Ba-la-mật (pāramī) không có việc chuẩn bị (parikamma) nào.
Te hi citte abhininnāmitamatteyeva anekavihitaṃ pubbenivāsaṃ anussaranti, dibbena cakkhunā satte passanti.
for as soon as they have directed their minds, they recollect their manifold former abodes and see beings with the divine eye.
Thật vậy, chỉ cần hướng tâm, các vị ấy có thể nhớ lại vô số đời quá khứ (pubbenivāsa), và thấy chúng sanh bằng thiên nhãn.
Tasmā yo tattha parikammaṃ ādiṃ katvā bhāvanānayo vutto, na tena idha atthoti.
Therefore, the method of development, starting with the preliminary work, which was described there, is not relevant here.
Do đó, phương pháp tu tập đã được nói ở đó, bắt đầu bằng sự chuẩn bị, không có ý nghĩa ở đây.
54. Tatiyavijjāya so evaṃ samāhite citteti vipassanāpādakaṃ catutthajjhānacittaṃ veditabbaṃ.
54. In the third knowledge, so evaṃ samāhite citte should be understood as the fourth jhāna mind, which is the basis for insight.
Trong minh thứ ba, “so evaṃ samāhite citte” (khi tâm đã định tĩnh như vậy) phải được hiểu là tâm thiền thứ tư làm nền tảng cho tuệ quán.
Āsavānaṃ khayañāṇāyāti arahattamaggañāṇatthāya.
Āsavānaṃ khayañāṇāya means for the sake of the knowledge of the path of arahatship.
“Āsavānaṃ khayañāṇāya” (để đạt được trí tuệ diệt trừ các lậu hoặc) là để đạt được trí tuệ của Đạo Quả A-la-hán (arahattamaggañāṇa).
Arahattamaggo hi āsavavināsanato āsavānaṃ khayoti vuccati, tatra cetaṃ ñāṇaṃ, tappariyāpannattāti.
For the path of arahatship is called the destruction of the taints because it destroys the taints, and this knowledge is therein, because it is included in it.
Đạo Quả A-la-hán được gọi là sự diệt trừ các lậu hoặc (āsavānaṃ khaya) vì nó tiêu diệt các lậu hoặc, và trí tuệ này thuộc về nó.
Cittaṃ abhininnāmesinti vipassanācittaṃ abhinīhariṃ.
Cittaṃ abhininnāmesi means I directed the insight mind.
“Cittaṃ abhininnāmesiṃ” (tôi đã hướng tâm) có nghĩa là tôi đã hướng tâm tuệ quán.
So idaṃ dukkhanti evamādīsu ‘‘ettakaṃ dukkhaṃ, na ito bhiyyo’’ti sabbampi dukkhasaccaṃ sarasalakkhaṇapaṭivedhena yathābhūtaṃ abbhaññāsiṃ jāniṃ paṭivijjhiṃ.
In So idaṃ dukkhaṃ, and so on: ‘So much is suffering, no more than this’—thus I truly understood, knew, and penetrated the entire truth of suffering as it really is, through the penetration of its essence and characteristic.
Trong câu “So idaṃ dukkhaṃ” (Tôi biết đây là khổ) và các câu tương tự, tôi đã chứng ngộ, biết rõ, thâm nhập một cách đúng đắn toàn bộ Khổ Thánh Đế (dukkhasacca) bằng cách thấu hiểu đặc tính riêng của nó, rằng “khổ chỉ đến mức này, không hơn nữa”.
Tassa ca dukkhassa nibbattikaṃ taṇhaṃ ayaṃ dukkhasamudayoti.
And the craving that produces that suffering as ayaṃ dukkhasamudayo.
Và tham ái (taṇhā) là nguyên nhân phát sinh khổ ấy, đó là “đây là Khổ Tập Thánh Đế (dukkhasamudaya)”.
Tadubhayampi yaṃ ṭhānaṃ patvā nirujjhati, taṃ tesaṃ appavattiṃ nibbānaṃ ayaṃ dukkhanirodhoti.
And the state upon reaching which both of them cease, that Nibbāna which is their non-occurrence, as ayaṃ dukkhanirodho.
Nơi mà cả hai (khổ và tập) đều chấm dứt, sự không còn hiện hữu của chúng, tức là Nibbāna, đó là “đây là Khổ Diệt Thánh Đế (dukkhanirodha)”.
Tassa sampāpakaṃ ariyamaggaṃ ayaṃ dukkhanirodhagāminī paṭipadāti sarasalakkhaṇapaṭivedhena yathābhūtaṃ abbhaññāsiṃ jāniṃ paṭivijjhinti evamattho veditabbo.
The meaning should be understood thus: ‘I directly knew, I knew, I penetrated as it really is, through the penetration of its essential characteristic, the noble path that leads to that* as “this is the path leading to the cessation of suffering.”’
Con đường Thánh đưa đến sự chấm dứt ấy, "Đây là con đường đưa đến sự diệt khổ", tôi đã thấu hiểu, đã biết, đã xuyên suốt như thật với sự thấu đạt các đặc tính riêng. Ý nghĩa này nên được hiểu như vậy.
Evaṃ sarūpato saccāni dassetvā idāni kilesavasena pariyāyato dassento ime āsavātiādimāha.
Having thus shown the truths in terms of their intrinsic nature, now, showing them indirectly in terms of the defilements, he said, “These are the taints,” and so on.
Sau khi trình bày các Chân lý theo bản chất như vậy, bây giờ, Đức Phật muốn trình bày theo phương tiện, dựa trên các phiền não, nên Ngài đã nói “các lậu hoặc này” và tiếp theo.
Tassa me evaṃ jānato evaṃ passatoti tassa mayhaṃ evaṃ jānantassa evaṃ passantassa.
As I thus knew and thus saw: for me who thus knew and thus saw.
Tassa me evaṃ jānato evaṃ passato (Khi tôi biết như vậy, thấy như vậy) có nghĩa là: khi tôi biết như vậy, khi tôi thấy như vậy.
Saha vipassanāya koṭippattaṃ maggaṃ katheti.
It speaks of the path that has reached its culmination, together with insight.
Điều này nói về con đường đã đạt đến đỉnh cao cùng với tuệ quán.
Kāmāsavāti kāmāsavato.
From the taint of sensuality: from the taint of sensuality.
Kāmāsavā (từ lậu hoặc dục) có nghĩa là từ lậu hoặc dục.
Vimuccitthāti iminā phalakkhaṇaṃ dasseti, maggakkhaṇe hi cittaṃ vimuccati, phalakkhaṇe vimuttaṃ hoti.
Was liberated: by this, he shows the moment of fruition. For, at the moment of the path, the mind is being liberated; at the moment of fruition, it has been liberated.
Với từ vimuccitthā (đã giải thoát), Ngài trình bày khoảnh khắc của quả vị. Bởi vì, tại khoảnh khắc của đạo, tâm được giải thoát, và tại khoảnh khắc của quả, tâm đã được giải thoát.
Vimuttasmiṃ vimuttamiti ñāṇanti iminā paccavekkhaṇañāṇaṃ dasseti.
In the liberated, the knowledge arose, “It is liberated”: by this, he shows the reviewing knowledge.
Với từ vimuttasmiṃ vimuttamiti ñāṇaṃ (tri kiến về sự giải thoát), Ngài trình bày tri kiến quán xét.
Khīṇā jātītiādīhi tassa bhūmiṃ, tena hi ñāṇena bhagavā paccavekkhanto ‘‘khīṇā jātī’’tiādīni abbhaññāsi.
Birth is destroyed, etc.: with these words, he shows the domain of that*. For, by that knowledge, the Blessed One, while reviewing, directly knew, “Birth is destroyed,” and so on.
Với các từ khīṇā jātī (sự tái sinh đã tận diệt) và tiếp theo, Ngài trình bày nền tảng của tri kiến ấy. Bởi vì, với tri kiến ấy, Đức Thế Tôn khi quán xét đã thấu hiểu rằng “sự tái sinh đã tận diệt” và những điều tương tự.
Katamā pana bhagavato jāti khīṇā, kathañca naṃ abbhaññāsīti?
But which birth of the Blessed One was destroyed, and how did he directly know it?
Vậy thì, sự tái sinh nào của Đức Thế Tôn đã tận diệt? Và Ngài đã thấu hiểu điều ấy như thế nào?
Na tāvassa atītā jāti khīṇā, pubbeva khīṇattā, na anāgatā, anāgate vāyāmābhāvato, na paccuppannā, vijjamānattā.
First, his past birth was not destroyed, because it had already been destroyed before. Not the future one, because there is no effort in the future. Not the present one, because it still exists.
Không phải sự tái sinh trong quá khứ của Ngài đã tận diệt, vì nó đã tận diệt từ trước. Cũng không phải sự tái sinh trong tương lai, vì không có sự nỗ lực trong tương lai. Cũng không phải sự tái sinh trong hiện tại, vì nó đang tồn tại.
Yā pana maggassa abhāvitattā uppajjeyya ekacatupañcavokārabhavesu ekacatupañcakkhandhabhedā jāti, sā maggassa bhāvitattā anuppādadhammataṃ āpajjanena khīṇā, taṃ so maggabhāvanāya pahīnakilese paccavekkhitvā ‘‘kilesābhāve vijjamānampi kammaṃ āyatiṃ appaṭisandhikaṃ hotī’’ti jānanto abbhaññāsi.
But that birth—distinguished as the one-, four-, or five-constituent* in the one-, four-, or five-constituent existences—which would have arisen because the path had not been developed, that birth was destroyed by reaching the state of non-arising due to the path having been developed. He, having reviewed the defilements abandoned through the development of the path, directly knew this, knowing, “In the absence of defilements, even existing kamma becomes non-rebirth-linking in the future.”
Nhưng sự tái sinh, tức là sự phân loại một, bốn hoặc năm uẩn trong các cõi một, bốn hoặc năm uẩn, mà đáng lẽ sẽ phát sinh do con đường chưa được tu tập, thì nay đã tận diệt do con đường đã được tu tập, khiến nó không còn khả năng phát sinh nữa. Đức Thế Tôn, sau khi quán xét các phiền não đã được đoạn trừ nhờ sự tu tập con đường, đã thấu hiểu điều đó khi Ngài biết rằng “khi không còn phiền não, nghiệp dù đang tồn tại cũng không còn khả năng tái sinh trong tương lai”.
Vusitanti vutthaṃ parivutthaṃ, kataṃ caritaṃ niṭṭhitanti attho.
Lived: lived, fully lived. The meaning is: done, practiced, completed.
Vusitaṃ (đã sống phạm hạnh) có nghĩa là đã sống, đã hoàn thành, đã thực hành, đã xong.
Brahmacariyanti maggabrahmacariyaṃ, puthujjanakalyāṇakena hi saddhiṃ sattasekkhā brahmacariyavāsaṃ vasanti nāma, khīṇāsavo vutthavāso.
The holy life: the holy life of the path. For, together with the virtuous worldling, the seven learners are said to be living the holy life; the one whose taints are destroyed has lived the life.
Brahmacariyaṃ (phạm hạnh) là phạm hạnh đạo. Quả thật, các thiện nam tử phàm phu và bảy bậc hữu học được gọi là đang sống phạm hạnh, còn bậc A-la-hán là bậc đã sống phạm hạnh.
Tasmā bhagavā attano brahmacariyavāsaṃ paccavekkhanto ‘‘vusitaṃ brahmacariya’’nti abbhaññāsi.
Therefore, the Blessed One, reviewing his own living of the holy life, directly knew, “The holy life has been lived.”
Vì vậy, Đức Thế Tôn, khi quán xét sự sống phạm hạnh của mình, đã thấu hiểu rằng “phạm hạnh đã được sống”.
Kataṃ karaṇīyanti catūsu saccesu catūhi maggehi pariññāpahānasacchikiriyābhāvanāvasena soḷasavidhampi kiccaṃ niṭṭhāpitanti attho.
Done what had to be done: the meaning is that the sixteen-fold duty in the four truths—by way of full understanding, abandoning, realizing, and developing through the four paths—has been completed.
Kataṃ karaṇīyaṃ (việc cần làm đã làm xong) có nghĩa là mười sáu loại công việc trong bốn Chân lý, qua sự thấu triệt, đoạn trừ, chứng ngộ và tu tập bằng bốn đạo, đã được hoàn tất.
Puthujjanakalyāṇakādayo hi taṃ kiccaṃ karonti, khīṇāsavo katakaraṇīyo.
For the virtuous worldlings and others are* doing that duty; the one whose taints are destroyed has done what had to be done.
Quả thật, các thiện nam tử phàm phu và những người khác đang thực hiện công việc ấy, còn bậc A-la-hán là bậc đã làm xong việc cần làm.
Tasmā bhagavā attano karaṇīyaṃ paccavekkhanto ‘‘kataṃ karaṇīya’’nti abbhaññāsi.
Therefore, the Blessed One, reviewing his own duty, directly knew, “What had to be done is done.”
Vì vậy, Đức Thế Tôn, khi quán xét việc cần làm của mình, đã thấu hiểu rằng “việc cần làm đã làm xong”.
Nāparaṃ itthattāyāti idāni puna itthabhāvāya evaṃsoḷasakiccabhāvāya, kilesakkhayāya vā maggabhāvanākiccaṃ me natthīti abbhaññāsi.
No further for this state of being: He directly knew, ‘Now, for me there is no further task of developing the path for such a state of being, for such a state of the sixteen duties, or for the destruction of defilements.’
Nāparaṃ itthattāyā (không còn tái sinh nữa) có nghĩa là: bây giờ, tôi không còn việc tu tập đạo để tái sinh nữa, hoặc để đạt được mười sáu công việc như vậy, hoặc để diệt trừ phiền não. Ngài đã thấu hiểu điều đó.
Atha vā itthattāyāti itthabhāvato imasmā evaṃpakārā idāni vattamānakkhandhasantānā aparaṃ khandhasantānaṃ mayhaṃ natthi.
Alternatively, for this state of being means: from this state of being, from this very kind of present continuum of aggregates, there is no other continuum of aggregates for me.
Hoặc itthattāyā (để tái sinh) có nghĩa là: từ trạng thái hiện hữu này, tức là dòng chảy các uẩn đang tồn tại này, tôi không còn dòng chảy các uẩn nào khác nữa.
Ime pana pañcakkhandhā pariññātā tiṭṭhanti chinnamūlakā rukkhā viya.
These five aggregates, however, stand fully understood, like trees with their roots cut.
Nhưng năm uẩn này đã được thấu triệt vẫn còn tồn tại như những cái cây đã bị chặt gốc.
Te carimakaviññāṇanirodhena anupādāno viya jātavedo nibbāyissantīti abbhaññāsi.
He directly knew, ‘With the cessation of the final consciousness, they will be extinguished, like a fire without fuel.’
Ngài đã thấu hiểu rằng chúng sẽ diệt tận khi thức cuối cùng diệt, giống như ngọn lửa không còn nhiên liệu sẽ tắt.
Idāni evaṃ paccavekkhaṇañāṇapariggahitaṃ āsavānaṃ khayañāṇādhigamaṃ brāhmaṇassa dassento, ayaṃ kho me brāhmaṇātiādimāha.
Now, showing the brahmin the attainment of the knowledge of the destruction of the taints, which was grasped by such reviewing knowledge, he said, “This, O brahmin, was the first knowledge attained by me,” and so on.
Bây giờ, để trình bày cho vị Bà-la-môn về sự chứng đắc tri kiến diệt trừ các lậu hoặc, được bao gồm bởi tri kiến quán xét như vậy, Ngài nói: Ayaṃ kho me brāhmaṇā (Này Bà-la-môn, đây là) và tiếp theo.
Tattha vijjāti arahattamaggañāṇavijjā.
Therein, knowledge is the knowledge of the path of Arahantship.
Trong đó, vijjā (minh) là tri kiến A-la-hán đạo.
Avijjāti catusaccapaṭicchādikā avijjā.
Ignorance is the ignorance that conceals the four truths.
Avijjā (vô minh) là vô minh che lấp bốn Chân lý.
Sesaṃ vuttanayameva.
The rest is just as has been explained.
Phần còn lại cũng theo cách đã nói.
Ettāvatā ca pubbenivāsañāṇena atītaṃsañāṇaṃ, dibbacakkhunā paccuppannānāgataṃsañāṇaṃ, āsavakkhayena sakalalokiyalokuttaraguṇanti evaṃ tīhi vijjāhi sabbepi sabbaññuguṇe saṅgahetvā pakāsento attano asammohavihāraṃ brāhmaṇassa dassesi.
And to this extent, by showing knowledge of the past through the knowledge of previous existences, knowledge of the present and future through the divine eye, and all worldly and supramundane qualities through the destruction of the taints—thus, by gathering and revealing all the qualities of an omniscient one through the three knowledges—he showed the brahmin his own state of non-delusion.
Đến đây, Đức Thế Tôn đã trình bày sự an trú không lầm lạc của mình cho vị Bà-la-môn bằng cách bao gồm tất cả các phẩm chất Toàn Giác trong ba minh: tri kiến về túc mạng minh (pubbenivāsañāṇa) là tri kiến về quá khứ, thiên nhãn minh (dibbacakkhu) là tri kiến về hiện tại và vị lai, và tri kiến diệt tận lậu hoặc (āsavakkhaya) là tất cả các phẩm chất thế gian và xuất thế gian.
55. Evaṃ vutte kira brāhmaṇo cintesi – ‘‘samaṇo gotamo sabbaññutaṃ paṭijānāti, ajjāpi ca araññavāsaṃ na vijahati, atthi nu khvassa aññampi kiñci karaṇīya’’nti.
55. When this was said, the brahmin apparently thought: “The ascetic Gotama claims omniscience, yet even now he does not abandon dwelling in the forest. Could it be that he still has something else to do?”
55. Nghe vậy, vị Bà-la-môn suy nghĩ: “Sa-môn Gotama tự nhận là bậc Toàn Giác, nhưng đến nay vẫn không từ bỏ việc sống trong rừng. Có lẽ Ngài còn việc gì khác cần làm chăng?”
Athassa bhagavā ajjhāsayaṃ viditvā iminā ajjhāsayānusandhinā, siyā kho pana tetiādimāha.
Then the Blessed One, knowing his intention, spoke in connection with this intention, saying, “It might be, brahmin,” and so on.
Khi ấy, Đức Thế Tôn biết được ý nghĩ của ông, và với sự liên kết ý nghĩ này, Ngài nói: Siyā kho pana te (Có lẽ, này) và tiếp theo.
Tattha siyā kho pana te, brāhmaṇa, evamassāti, brāhmaṇa, kadāci tuyhaṃ evaṃ bhaveyya.
Therein, it might be, brahmin, that it occurs to you thus: brahmin, it might sometimes occur to you thus.
Trong đó, Siyā kho pana te, brāhmaṇa, evamassā (Có lẽ, này Bà-la-môn, ông sẽ nghĩ như vậy) có nghĩa là: Này Bà-la-môn, có lúc ông có thể nghĩ như vậy.
Na kho panetaṃ brāhmaṇa evaṃ daṭṭhabbanti etaṃ kho pana, brāhmaṇa, tayā mayhaṃ pantasenāsanapaṭisevanaṃ avītarāgāditāyāti evaṃ na daṭṭhabbaṃ.
But, brahmin, it should not be seen like this: But, brahmin, this resorting to secluded lodgings by me should not be seen by you as being due to not being free from passion and so on.
Na kho panetaṃ brāhmaṇa evaṃ daṭṭhabbaṃ (Nhưng, này Bà-la-môn, điều này không nên được thấy như vậy) có nghĩa là: Này Bà-la-môn, việc tôi sống ở nơi thanh vắng không nên được xem là do tôi chưa đoạn trừ tham ái, v.v.
Evaṃ pantasenāsanapaṭisevane akāraṇaṃ paṭikkhipitvā kāraṇaṃ dassento dve kho ahantiādimāha.
Having thus rejected the non-reason for resorting to secluded lodgings, to show the reason, he said, “It is for two reasons, brahmin, that I,” and so on.
Sau khi bác bỏ lý do không đúng cho việc sống ở nơi thanh vắng như vậy, Ngài trình bày lý do đúng bằng cách nói: Dve kho ahaṃ (Thật vậy, tôi có hai) và tiếp theo.
Tattha atthoyeva atthavaso.
Therein, ‘atthavasa’ is simply ‘attha’ (reason, benefit).
Trong đó, atthoyeva là atthavaso.
Tasmā dve kho ahaṃ, brāhmaṇa, atthavaseti ahaṃ kho, brāhmaṇa, dve atthe dve kāraṇāni sampassamānoti vuttaṃ hoti.
Therefore, “It is for two reasons, brahmin, that I” means: ‘I, brahmin, seeing two benefits, two reasons.’
Vì vậy, Dve kho ahaṃ, brāhmaṇa, atthavase (Này Bà-la-môn, tôi thấy hai mục đích) có nghĩa là: Này Bà-la-môn, tôi đang quán sát hai mục đích, hai lý do.
Attano ca diṭṭhadhammasukhavihāranti ettha diṭṭhadhammo nāma ayaṃ paccakkho attabhāvo.
And for my own pleasant abiding in the here-and-now: here, the here-and-now means this present personality.
Trong câu Attano ca diṭṭhadhammasukhavihāra (và sự an lạc trong hiện tại của chính mình), diṭṭhadhammo (hiện tại) là thân thể hiện tại này.
Sukhavihāro nāma catunnampi iriyāpathavihārānaṃ phāsutā, ekakassa hi araññe antamaso uccārapassāvakiccaṃ upādāya sabbeva iriyāpathā phāsukā honti, tasmā diṭṭhadhammassa sukhavihāranti ayamattho veditabbo.
Pleasant abiding means the comfort of the four postures. For one dwelling alone in the forest, all postures are comfortable, even down to the act of urination and defecation. Therefore, the meaning should be understood as: for the pleasant abiding of the here-and-now.
Sukhavihāro (sự an lạc) là sự thoải mái của cả bốn oai nghi. Quả thật, đối với một người sống một mình trong rừng, ngay cả việc đại tiện, tiểu tiện cũng trở nên thoải mái; tất cả các oai nghi đều thoải mái. Vì vậy, ý nghĩa của diṭṭhadhammassa sukhavihāranti (sự an lạc trong hiện tại) nên được hiểu như vậy.
Pacchimañca janataṃ anukampamānoti kathaṃ araññavāsena pacchimā janatā anukampitā hoti?
And out of compassion for the future generation: How is the future generation shown compassion through dwelling in the forest?
Pacchimañca janataṃ anukampamāno (và lòng từ bi đối với những thế hệ sau): Làm thế nào mà việc sống trong rừng lại thể hiện lòng từ bi đối với những thế hệ sau?
Saddhāpabbajitā hi kulaputtā bhagavato araññavāsaṃ disvā bhagavāpi nāma araññasenāsanāni na muñcati, yassa nevatthi pariññātabbaṃ na pahātabbaṃ na bhāvetabbaṃ na sacchikātabbaṃ, kimaṅgaṃ pana mayanti cintetvā tattha vasitabbameva maññissanti.
When clansmen who have gone forth out of faith see the Blessed One’s dwelling in the forest, they will think, “Even the Blessed One, for whom there is nothing to be fully understood, nothing to be abandoned, nothing to be developed, and nothing to be realized, does not give up forest and secluded lodgings. What then of us?” And thinking thus, they will consider it necessary to dwell there.
Các thiện nam tử xuất gia vì lòng tin, khi thấy Đức Thế Tôn sống trong rừng, sẽ suy nghĩ: “Ngay cả Đức Thế Tôn, người không còn gì để thấu triệt, để đoạn trừ, để tu tập, để chứng ngộ, mà còn không từ bỏ các trú xứ trong rừng, huống chi chúng ta!” và họ sẽ nghĩ rằng mình cũng nên sống ở đó.
Evaṃ khippameva dukkhassantakarā bhavissanti.
In this way, they will swiftly make an end of suffering.
Như vậy, họ sẽ nhanh chóng chấm dứt khổ đau.
Evaṃ pacchimā janatā anukampitā hoti.
Thus, the future generation is shown compassion.
Bằng cách này, những thế hệ sau được ban rải lòng từ bi.
Etamatthaṃ dassento āha ‘‘pacchimañca janataṃ anukampamāno’’ti.
To show this meaning, he said, “and out of compassion for the future generation.”
Để trình bày ý nghĩa này, Ngài nói: “và lòng từ bi đối với những thế hệ sau”.
56. Taṃ sutvā attamano brāhmaṇo anukampitarūpātiādimāha.
56. Having heard that, the delighted brahmin said, “The people have indeed been shown compassion,” and so on.
56. Nghe vậy, vị Bà-la-môn hoan hỷ nói: Anukampitarūpā (Thật đáng thương xót) và tiếp theo.
Tattha anukampitarūpāti anukampitajātikā anukampitasabhāvā.
Therein, have been shown compassion means: are of a nature to be shown compassion, have the quality of having been shown compassion.
Trong đó, anukampitarūpā (đáng thương xót) có nghĩa là: có bản chất đáng thương xót, có tính chất đáng thương xót.
Janatāti janasamūho.
The people means the assembly of people.
Janatā (quần chúng) là tập hợp người.
Yathā taṃ arahatā sammāsambuddhenāti yathā arahaṃ sammāsambuddho anukampeyya, tatheva anukampitarūpāti.
Just as by one who is an Arahant, a Perfectly Enlightened One: they have been shown compassion in the very way that an Arahant, a Perfectly Enlightened One would show compassion.
Yathā taṃ arahatā sammāsambuddhenā (như bậc A-la-hán, Chánh Đẳng Giác đã thương xót) có nghĩa là: như bậc A-la-hán, Chánh Đẳng Giác đã thương xót, thì đúng như vậy, thật đáng thương xót.
Evañca pana vatvā puna taṃ bhagavato dhammadesanaṃ abbhanumodamāno bhagavantaṃ etadavoca abhikkantaṃ, bho gotama, abhikkantaṃ, bho gotamāti.
And having said this, again expressing his appreciation for the Blessed One’s Dhamma discourse, he said this to the Blessed One: “Excellent, Master Gotama! Excellent, Master Gotama!”
Và sau khi nói như vậy, vị ấy lại tán thán giáo pháp của Đức Thế Tôn và thưa với Ngài rằng: Abhikkantaṃ, bho Gotama, abhikkantaṃ, bho Gotamā (Thật tuyệt vời, thưa Tôn giả Gotama! Thật tuyệt vời, thưa Tôn giả Gotama!).
Tatthāyaṃ abhikkantasaddo khayasundarābhirūpaabbhanumodanesu dissati.
Therein, this word ‘abhikkanta’ is seen in the senses of passing away, excellence, beauty, and appreciation.
Ở đây, từ abhikkanta này được thấy trong các nghĩa như: đã qua, tốt đẹp, tuyệt vời, và hoan hỷ.
‘‘Abhikkantā, bhante, ratti, nikkhanto paṭhamo yāmo, ciranisinno bhikkhusaṅgho’’tiādīsu (cūḷava. 383; a. ni. 8.20) hi khaye dissati.
For in passages such as, “Venerable sir, the night has passed, the first watch is over, the community of bhikkhus has been seated for a long time,” it is seen in the sense of passing away.
Ví dụ, trong các câu như “Thưa Tôn giả, đêm đã qua, canh đầu đã trôi qua, Tăng chúng đã ngồi lâu” (cūḷava. 383; a. ni. 8.20), nó được thấy với nghĩa đã qua.
‘‘Ayaṃ imesaṃ catunnaṃ puggalānaṃ abhikkantataro ca paṇītataro cā’’tiādīsu (a. ni. 4.100) sundare.
In passages such as, “This one is more excellent and more sublime than these four persons,” it is seen in the sense of excellence.
Trong các câu như “Người này trong số bốn hạng người này là tốt đẹp hơn và cao quý hơn” (a. ni. 4.100), nó được thấy với nghĩa tốt đẹp.
Ādīsu (vi. va. 857) abhirūpe.
In passages beginning with this, it is in the sense of being exceedingly beautiful.
Trong những đoạn như trên, (ám chỉ) vẻ đẹp vượt trội.
‘‘Abhikkantaṃ, bhante’’tiādīsu (dī. ni. 1.250; pārā. 15) abbhanumodane.
In passages beginning with “‘Excellent, venerable sir!’”, it is in the sense of joyful approval.
Trong những đoạn như “Bạch Thế Tôn, thật tuyệt vời!” (ám chỉ) sự tán thán.
Idhāpi abbhanumodaneyeva.
Here, too, it is indeed in the sense of joyful approval.
Ở đây cũng là sự tán thán.
Yasmā ca abbhanumodane, tasmā sādhu sādhu bho, gotamāti vuttaṃ hotīti veditabbaṃ.
And because it is in the sense of joyful approval, it should be understood to mean, “Good, good, Master Gotama!”
Vì là sự tán thán, nên cần phải hiểu rằng điều đó có nghĩa là: “Lành thay, lành thay, này Gotama!”
Tattha ekena abhikkantasaddena desanaṃ thometi, ekena attano pasādaṃ.
Therein, with one word “excellent” he praises the discourse, and with one, his own confidence.
Điều đó có nghĩa là: rất đáng mong muốn, rất đáng hài lòng, rất đẹp.
Ayañhettha adhippāyo – abhikkantaṃ, bho gotama, yadidaṃ bhoto gotamassa dhammadesanā, abhikkantaṃ yadidaṃ bhoto gotamassa dhammadesanaṃ āgamma mama pasādoti.
Indeed, this is the intention here: Excellent, Master Gotama, is this discourse of Master Gotama; excellent is the confidence that has arisen in me on account of Master Gotama's discourse.
Trong đó, một từ abhikkantaṃ dùng để tán thán bài giảng, và một từ dùng để tán thán sự thanh tịnh của chính mình.
Bhagavatoyeva vā vacanaṃ dve dve atthe sandhāya thometi – bhoto gotamassa vacanaṃ abhikkantaṃ dosanāsanato, abhikkantaṃ guṇādhigamanato, tathā saddhājananato, paññājananato, sātthato, sabyañjanato, uttānapadato, gambhīratthato, kaṇṇasukhato, hadayaṅgamato, anattukkaṃsanato, aparavambhanato, karuṇāsītalato, paññāvadātato, āpātharamaṇīyato, vimaddakkhamato, suyyamānasukhato, vīmaṃsīyamānahitatoti evamādīhi yojetabbaṃ.
Or, he praises the Blessed One’s speech itself, referring to two meanings for each pair: The speech of Master Gotama is excellent for its dispelling of faults and excellent for its attainment of virtues; likewise, for its generation of faith and its generation of wisdom; for being with meaning and with phrasing; for its clear terms and its profound meaning; for being pleasant to the ear and for going to the heart; for not praising oneself and for not disparaging others; for being cool with compassion and for being purified by wisdom; for being pleasing on first hearing and for being able to withstand scrutiny; for being pleasant while being heard and for being beneficial when investigated—it should be connected in these and other similar ways.
Đây là ý nghĩa ở đây: “Thật tuyệt vời, này Gotama, đó là bài pháp của ngài Gotama; thật tuyệt vời, đó là sự thanh tịnh của tôi phát sinh nhờ bài pháp của ngài Gotama.” Hoặc là, lời nói của chính Thế Tôn được tán thán bằng cách ám chỉ hai ý nghĩa: lời nói của ngài Gotama thật tuyệt vời vì nó tiêu diệt các phiền não, thật tuyệt vời vì nó đưa đến sự thành tựu các đức tính; tương tự, thật tuyệt vời vì nó sinh ra đức tin, sinh ra trí tuệ, có ý nghĩa, có văn chương, có lời lẽ rõ ràng, có ý nghĩa sâu sắc, êm tai, đi vào lòng người, không tự đề cao, không khinh miệt người khác, mát mẻ vì lòng bi mẫn, trong sáng vì trí tuệ, đẹp đẽ ngay từ cái nhìn đầu tiên, chịu đựng được sự xem xét kỹ lưỡng, dễ chịu khi được nghe, lợi ích khi được suy xét; nên cần phải kết hợp theo những cách như vậy.
Tato parampi catūhi upamāhi desanaṃyeva thometi.
After that, he praises the discourse with four similes.
Sau đó, bài giảng được tán thán bằng bốn ví dụ.
Tattha nikkujjitanti adhomukhaṭhapitaṃ, heṭṭhāmukhajātaṃ vā.
Therein, what was overturned means what has been placed face down, or what has become face down.
Trong đó, nikkujjitaṃ có nghĩa là úp xuống, hoặc tự nhiên hướng mặt xuống dưới.
Ukkujjeyyāti upari mukhaṃ kareyya.
Would set upright means he would make it face up.
Ukkujjeyyāti có nghĩa là ngửa mặt lên trên.
Paṭicchannanti tiṇapaṇṇādicchāditaṃ.
What was hidden means what is covered by grass, leaves, and so on.
Paṭicchannaṃ có nghĩa là bị che phủ bởi cỏ, lá, v.v.
Vivareyyāti ugghāṭeyya.
Would reveal means he would uncover it.
Vivareyyāti có nghĩa là mở ra.
Mūḷhassāti disāmūḷhassa.
To one who was lost means to one who has lost their way.
Mūḷhassāti có nghĩa là người bị lạc đường.
Maggaṃ ācikkheyyāti hatthe gahetvā ‘‘esa maggo’’ti vadeyya.
He would point out the path means, taking him by the hand, he would say, “This is the path.”
Maggaṃ ācikkheyyāti có nghĩa là nắm tay và nói: “Đây là con đường.”
Andhakāreti kāḷapakkhacātuddasīaḍḍharattaghanavanasaṇḍameghapaṭalehi caturaṅge tame, ayaṃ tāva anuttānapadattho.
In the darkness means in a darkness of four components: the fourteenth day of the dark fortnight, the middle of the night, a dense forest grove, and a covering of clouds. This, first, is the meaning of the less obvious words.
Andhakāreti có nghĩa là trong bóng tối tứ chi (bốn yếu tố) do đêm mười bốn âm lịch, nửa đêm, rừng rậm dày đặc, và mây đen che phủ; đây là ý nghĩa sơ khởi của từ ngữ không rõ ràng này.
Ayaṃ pana adhippāyayojanā – yathā koci nikkujjitaṃ ukkujjeyya, evaṃ saddhammavimukhaṃ asaddhamme patitaṃ maṃ asaddhammā vuṭṭhāpentena, yathā paṭicchannaṃ vivareyya.
This, however, is the application of the intended meaning: Just as someone would set upright what was overturned, so too, by lifting me—who was turned away from the true Dhamma and had fallen into what is not the true Dhamma—out of what is not the true Dhamma; just as one would reveal what was hidden,
Tuy nhiên, đây là sự kết hợp ý nghĩa: Như một người làm cho cái bị úp xuống được ngửa lên, thì ngài đã nâng tôi, người quay lưng lại với Chánh Pháp và rơi vào tà pháp, thoát khỏi tà pháp; như một người mở ra cái bị che đậy, thì ngài đã mở ra giáo pháp bị che đậy bởi rừng rậm tà kiến kể từ khi giáo pháp của Đức Phật Kassapa biến mất; như một người chỉ đường cho kẻ lạc lối, thì ngài đã chỉ cho tôi, người đang đi trên con đường sai lầm, con đường tà đạo, con đường đến cõi trời và giải thoát; như một người thắp đèn dầu trong bóng tối, thì ngài Gotama đã thắp sáng ngọn đèn giáo pháp tiêu diệt bóng tối si mê che phủ, khiến tôi, người chìm trong bóng tối si mê, không thấy được hình tướng của Tam Bảo, v.v., bằng cách này, ngài đã tuyên thuyết Pháp cho tôi bằng nhiều phương cách.
Evaṃ kassapassa bhagavato sāsanantaradhānato pabhuti micchādiṭṭhigahanapaṭicchannaṃ sāsanaṃ vivarantena, yathā mūḷhassa maggaṃ ācikkheyya, evaṃ kummaggamicchāmaggappaṭipannassa me saggamokkhamaggaṃ ācikkhantena, yathā andhakāre telapajjotaṃ dhāreyya, evaṃ mohandhakāre nimuggassa me buddhādiratanarūpāni apassato tappaṭicchādakamohandhakāraviddhaṃsakadesanāpajjotadhāraṇena mayhaṃ bhotā gotamena etehi pariyāyehi pakāsitattā anekapariyāyena dhammo pakāsitoti.
so too, by revealing the teaching that has been hidden by the thicket of wrong views since the disappearance of the teaching of the Blessed One Kassapa; just as one would point out the path to one who was lost, so too, by pointing out the path to heaven and liberation to me, who had undertaken a wrong course and a wrong path; just as one would hold up an oil lamp in the darkness, so too, by holding up the lamp of the discourse that dispels the darkness of ignorance that conceals them, for me, who was submerged in the darkness of ignorance and unable to see the forms of the gems such as the Buddha—because it was thus illuminated by these methods by you, Master Gotama, for me, the Dhamma has been proclaimed in many ways.
Hoàn tất phần diễn giải về sự tán thán bài giảng.
Evaṃ desanaṃ thometvā imāya desanāya ratanattayapasannacitto pasannākāraṃ karonto esāhantiādimāha.
Having thus praised the discourse, with a mind confident in the Triple Gem through this discourse, expressing his confidence, he said, “It is I,” and so on.
Trong đó, esāhaṃ có nghĩa là: đây là tôi.
Tattha esāhanti eso ahaṃ.
Therein, “It is I” means “It is I.”
Bhavantaṃ Gotamaṃ saraṇaṃ gacchāmīti có nghĩa là: Ngài Gotama là nơi nương tựa, là chỗ ẩn náu của tôi, là đấng che chở khỏi hiểm nguy và mang lại lợi ích. Với ý nghĩa này, tôi đến với ngài Gotama, tôi phụng sự, tôi thờ phụng, tôi gần gũi ngài, hoặc tôi hiểu biết, tôi giác ngộ như vậy.
Bhavantaṃ gotamaṃ saraṇaṃ gacchāmīti bhavaṃ me gotamo saraṇaṃ parāyaṇaṃ, aghassa tātā, hitassa ca vidhātāti iminā adhippāyena bhavantaṃ gotamaṃ gacchāmi, bhajāmi, sevāmi, payirupāsāmi, evaṃ vā jānāmi, bujjhāmīti.
“I go to the venerable Gotama for refuge” means with the intention that “The venerable Gotama is my refuge, my ultimate resort, a protector from harm, and a provider of welfare,” I go to the venerable Gotama, I resort to him, I attend on him, I wait upon him, or I know him thus, I understand him thus.
Vì ý nghĩa của các gốc từ có nghĩa là "đi", thì "biết" cũng là ý nghĩa của chúng.
Yesañhi dhātūnaṃ gatiattho, buddhipi tesaṃ attho.
For those verbal roots that have the meaning of going, understanding is also their meaning.
Do đó, ý nghĩa của "gacchāmi" (tôi đi) được nói là "jānāmi" (tôi biết), "bujjāmi" (tôi giác ngộ).
Tasmā gacchāmīti imassa jānāmi, bujjhāmīti ayamattho vutto.
Therefore, for this word “I go,” the meaning “I know, I understand” is stated.
Trong cụm từ Dhammañca bhikkhusaṅghañcāti (và Pháp và Tăng đoàn chư Tỳ-khưu), Dhamma (Pháp) là thứ giữ gìn những người đã đạt được Đạo (magga), đã chứng ngộ Niết-bàn (nirodha), và những người thực hành đúng theo lời giáo huấn, không rơi vào các cõi khổ (apāya). Về mặt ý nghĩa, đó là Bát Chánh Đạo và Niết-bàn.
Dhammañca bhikkhusaṅghañcāti ettha pana adhigatamagge sacchikatanirodhe yathānusiṭṭhaṃ paṭipajjamāne ca apāyesu apatamāne dhāretīti dhammo, so atthato ariyamaggo ceva nibbānañca.
As for “and to the Dhamma and to the Bhikkhu Saṅgha,” here, because it supports those who have attained the path, have realized cessation, and are practicing as instructed, by not letting them fall into the lower realms, it is the Dhamma. In terms of its essence, it is the noble path and Nibbāna.
Điều này đã được nói: “Này các Tỳ-khưu, trong tất cả các pháp hữu vi, Bát Chánh Đạo cao quý được tuyên bố là tối thượng.”
Vuttañhetaṃ – ‘‘yāvatā, bhikkhave, dhammā saṅkhatā, ariyo aṭṭhaṅgiko maggo tesaṃ aggamakkhāyatī’’ti (a. ni. 4.34) vitthāro.
For it has been said: “As many as there are, monks, conditioned phenomena, the noble eightfold path is declared the chief among them.” The detailed explanation may be found there.
Không chỉ Bát Chánh Đạo và Niết-bàn, mà còn cả Pháp học (pariyatti-dhamma) cùng với các quả thánh (ariyaphala) cũng là Pháp.
Na kevalañca ariyamaggo ceva nibbānañca, apica kho ariyaphalehi saddhiṃ pariyattidhammopi.
And it is not only the noble path and Nibbāna, but also the Dhamma of the scriptures along with the noble fruits.
Điều này đã được nói trong Chattamāṇavaka-vimāna:
Vuttañhetaṃ chattamāṇavakavimāne –
For this has been said in the discourse on the celestial mansion of the young brahmin Chatta:
“Hãy nương tựa Pháp này,
Ettha rāgavirāgoti maggo kathito.
Here, dispassion from lust refers to the path.
Ở đây, rāgavirāgo (sự ly tham) được nói đến là Đạo.
Anejamasokanti phalaṃ.
Unshakeable, sorrowless refers to the fruit.
Anejamasokaṃ (không lay chuyển, không sầu muộn) là Quả.
Dhammamasaṅkhatanti nibbānaṃ.
Unconditioned Dhamma refers to Nibbāna.
Dhammamasaṅkhataṃ (Pháp vô vi) là Niết-bàn.
Appaṭikūlaṃ madhuramimaṃ paguṇaṃ suvibhattanti piṭakattayena vibhattā sabbadhammakkhandhāti.
Unblemished, this sweet, proficient, and well-expounded refers to all the divisions of the Dhamma as classified in the three Piṭakas.
Appaṭikūlaṃ madhuramimaṃ paguṇaṃ suvibhattaṃ (không chướng ngại, ngọt ngào, thành thạo, được phân chia rõ ràng) là tất cả các pháp uẩn được phân chia trong Tam Tạng Pāli.
Diṭṭhisīlasaṅghātena saṃhatoti saṅgho, so atthato aṭṭha ariyapuggalasamūho.
United by the conjunction of view and virtue, it is a Saṅgha. In terms of its essence, it is the community of the eight noble individuals.
Saṅgho (Tăng đoàn) là tập hợp của những người có cùng quan điểm (diṭṭhi) và giới luật (sīla). Về mặt ý nghĩa, đó là tập hợp của tám bậc Thánh nhân (ariya-puggala).
Vuttañhetaṃ tasmiṃyeva vimāne.
For this has been said in that very same discourse on the celestial mansion:
Điều này đã được nói trong cùng Vimāna đó:
Idāni tesu saraṇagamanesu kosallatthaṃ saraṇaṃ, saraṇagamanaṃ.
Now, to gain proficiency in these goings for refuge, the refuge, the going for refuge,
Diễn giải về sự quy y
Yo ca saraṇaṃ gacchati, saraṇagamanappabhedo, saraṇagamanassa phalaṃ, saṃkileso, bhedoti ayaṃ vidhi veditabbo.
the one who goes for refuge, the classification of going for refuge, the fruit of going for refuge, its defilement, and its breaking—this method should be understood.
Bây giờ, để khéo léo trong những sự quy y đó, cần phải biết về nơi nương tựa (saraṇa), sự quy y (saraṇagamana), người quy y, các loại quy y, quả của sự quy y, sự ô nhiễm và sự phá vỡ (của quy y).
Seyyathidaṃ – padatthato tāva hiṃsatīti saraṇaṃ, saraṇagatānaṃ teneva saraṇagamanena bhayaṃ santāsaṃ dukkhaṃ duggatiparikilesaṃ hanati vināsetīti attho, ratanattayassevetaṃ adhivacanaṃ.
That is to say, in terms of the word’s meaning, it destroys, thus it is a refuge. The meaning is that, for those who have gone for refuge, through that very act of going for refuge, it destroys and eliminates fear, terror, suffering, and the defilements of a bad destination. This is a designation for the Triple Gem itself.
Cụ thể là: về mặt ý nghĩa của từ, saraṇa (nơi nương tựa) là thứ làm hại (hiṃsati). Điều đó có nghĩa là, đối với những người đã quy y, chính sự quy y đó tiêu diệt, loại bỏ nỗi sợ hãi, sự lo lắng, khổ đau, và mọi phiền não trong các cõi khổ. Đây là một tên gọi khác của Tam Bảo.
Atha vā hite pavattanena ahitā ca nivattanena sattānaṃ bhayaṃ hiṃsati buddho.
Alternatively, the Buddha destroys the fear of beings by engaging them in what is beneficial and restraining them from what is unbeneficial.
Hoặc là, Đức Phật làm hại nỗi sợ hãi của chúng sinh bằng cách thúc đẩy điều lợi ích và ngăn chặn điều bất lợi.
Bhavakantārā uttāraṇena assāsadānena ca dhammo.
The Dhamma, by leading them out of the wilderness of existence and by giving them solace.
Pháp (Dhamma) làm hại nỗi sợ hãi bằng cách đưa chúng sinh thoát khỏi sa mạc luân hồi và ban cho sự an ủi.
Appakānampi kārānaṃ vipulaphalapaṭilābhakaraṇena saṅgho.
The Saṅgha, by causing the attainment of abundant fruit even from small offerings.
Tăng đoàn (Saṅgha) làm hại nỗi sợ hãi bằng cách mang lại quả báo lớn cho những hành động nhỏ nhặt.
Tasmā imināpi pariyāyena ratanattayaṃ saraṇaṃ.
Therefore, by this method too, the Triple Gem is a refuge.
Do đó, theo cách này, Tam Bảo cũng là nơi nương tựa.
Tappasādataggarutāhi vihatakileso tapparāyaṇatākārappavatto cittuppādo saraṇagamanaṃ.
The arising of a state of mind that has its defilements destroyed through confidence and reverence towards it, and that proceeds in the manner of having that as its ultimate resort, is the going for refuge.
Tâm sinh khởi (cittuppāda) được thúc đẩy bởi thái độ quy y, với các phiền não đã được loại bỏ nhờ sự thanh tịnh và sự tôn kính đối với Tam Bảo, chính là sự quy y (saraṇagamana).
Taṃsamaṅgisatto saraṇaṃ gacchati, vuttappakārena cittuppādena etāni me tīṇi saraṇāni saraṇaṃ, etāni parāyaṇanti evaṃ upetīti attho.
A being endowed with that goes for refuge. The meaning is that, with a state of mind of the kind described, one approaches it thus: “These three gems are a refuge for me, these are my ultimate resort.”
Chúng sinh đầy đủ tâm đó quy y. Điều đó có nghĩa là, với tâm sinh khởi đã được nói, chúng sinh đến với ý nghĩ: “Ba nơi nương tựa này là nơi ẩn náu của tôi, chúng là nơi nương tựa tối thượng của tôi.”
Evaṃ tāva saraṇaṃ saraṇagamanaṃ yo ca saraṇaṃ gacchatīti idaṃ tayaṃ veditabbaṃ.
Thus, first, the refuge, the going for refuge, and the one who goes for refuge—this triad should be understood.
Như vậy, ba điều này – nơi nương tựa (saraṇa), sự quy y (saraṇagamana), và người quy y – cần phải được hiểu rõ.
Saraṇagamanappabhede pana duvidhaṃ saraṇagamanaṃ lokuttaraṃ lokiyañca.
Regarding the classification of going for refuge, the going for refuge is twofold: supramundane and mundane.
Về các loại quy y, có hai loại quy y: siêu thế (lokuttara) và thế gian (lokiya).
Tattha lokuttaraṃ diṭṭhasaccānaṃ maggakkhaṇe saraṇagamanupakkilesasamucchedena ārammaṇato nibbānārammaṇaṃ hutvā kiccato sakalepi ratanattaye ijjhati.
Therein, the supramundane going for refuge for those who have seen the truths, at the moment of the path, succeeds in its function with regard to the entire Triple Gem by having Nibbāna as its object, through the cutting off of the corruptions of going for refuge.
Trong đó, quy y siêu thế, đối với những người đã thấy sự thật, được thành tựu trong khoảnh khắc Đạo (magga), bằng cách đoạn trừ các ô nhiễm của sự quy y, và lấy Niết-bàn làm đối tượng, có hiệu quả trong toàn bộ Tam Bảo.
Lokiyaṃ puthujjanānaṃ saraṇagamanupakkilesavikkhambhanena ārammaṇato buddhādiguṇārammaṇaṃ hutvā ijjhati, taṃ atthato buddhādīsu vatthūsu saddhāpaṭilābho, saddhāmūlikā ca sammādiṭṭhi dasasu puññakiriyavatthūsu diṭṭhijukammanti vuccati.
The worldly going for refuge succeeds for ordinary people by suppressing the corruptions of going for refuge, having the qualities of the Buddha and so on as its object. In terms of its essence, it is the attainment of faith in the bases such as the Buddha. And right view, which has faith as its root, is called the straightening of views among the ten bases of meritorious deeds.
Sự quy y thế gian của phàm phu được thành tựu nhờ sự trấn áp các cấu uế của sự quy y, lấy các đức của Phật v.v. làm đối tượng. Về ý nghĩa, đó là sự đạt được niềm tin vào các đối tượng như Phật v.v., và chánh kiến có gốc rễ từ niềm tin được gọi là sự làm cho tà kiến trở nên ngay thẳng trong mười căn bản phước nghiệp.
Tayidaṃ catudhā pavattati attasanniyyātanena tapparāyaṇatāya sissabhāvūpagamanena paṇipātenāti.
This occurs in four ways: through self-dedication, through making them one's final resort, through assuming the state of a disciple, and through prostration.
Sự quy y này diễn ra theo bốn cách: bằng sự hiến dâng tự thân, bằng sự nương tựa, bằng sự trở thành đệ tử, và bằng sự đảnh lễ.
Tattha attasanniyyātanaṃ nāma ‘‘ajja ādiṃ katvā ahaṃ attānaṃ buddhassa niyyātemi, dhammassa, saṅghassā’’ti evaṃ buddhādīnaṃ attapariccajanaṃ.
Therein, self-dedication is the abandoning of oneself to the Buddha and so on, in this way: “Starting from today, I dedicate myself to the Buddha, to the Dhamma, to the Sangha.”
Trong đó, sự hiến dâng tự thân có nghĩa là sự hiến dâng bản thân cho Phật, Pháp, Tăng, như câu: “Bắt đầu từ hôm nay, tôi xin hiến dâng bản thân cho Phật, cho Pháp, cho Tăng.”
Tapparāyaṇatā nāma ‘‘ajja ādiṃ katvā ahaṃ buddhaparāyaṇo, dhammaparāyaṇo, saṅghaparāyaṇo iti maṃ dhārethā’’ti evaṃ tapparāyaṇabhāvo.
Making them one's final resort is the state of making them one's final resort, in this way: “Starting from today, may you hold me as one who has the Buddha as my final resort, the Dhamma as my final resort, the Sangha as my final resort.”
Sự nương tựa có nghĩa là sự nương tựa vào Phật, Pháp, Tăng, như câu: “Bắt đầu từ hôm nay, tôi nương tựa Phật, nương tựa Pháp, nương tựa Tăng; xin hãy ghi nhận tôi như vậy.”
Sissabhāvūpagamanaṃ nāma ‘‘ajja ādiṃ katvā ahaṃ buddhassa antevāsiko, dhammassa, saṅghassāti maṃ dhārethā’’ti evaṃ sissabhāvūpagamo.
Assuming the state of a disciple is the assumption of the state of a disciple, in this way: “Starting from today, may you hold me as a disciple of the Buddha, of the Dhamma, of the Sangha.”
Sự trở thành đệ tử có nghĩa là sự trở thành đệ tử của Phật, Pháp, Tăng, như câu: “Bắt đầu từ hôm nay, tôi là đệ tử của Phật, của Pháp, của Tăng; xin hãy ghi nhận tôi như vậy.”
Paṇipāto nāma ‘‘ajja ādiṃ katvā ahaṃ abhivādanapaccuṭṭhānaañjalikammasāmīcikammaṃ buddhādīnaṃyeva tiṇṇaṃ vatthūnaṃ karomi, iti maṃ dhārethā’’ti evaṃ buddhādīsu paramanipaccakāro.
Prostration is the utmost reverence towards the Buddha and so on, in this way: “Starting from today, I will perform acts of homage, rising up, raising my hands in reverence, and respectful conduct only to the three bases, namely the Buddha and so on. May you hold me thus.”
Sự đảnh lễ có nghĩa là sự cung kính tối thượng đối với Phật, Pháp, Tăng, như câu: “Bắt đầu từ hôm nay, tôi thực hiện các hành động đảnh lễ, đứng dậy chào đón, chắp tay và cung kính chỉ đối với ba đối tượng là Phật v.v.; xin hãy ghi nhận tôi như vậy.”
Imesañhi catunnaṃ ākārānaṃ aññatarampi karontena gahitaṃyeva hoti saraṇagamanaṃ.
Indeed, for one who performs even one of these four modes, the going for refuge is certainly taken.
Thật vậy, dù thực hiện bất kỳ một trong bốn cách này, sự quy y cũng đã được thọ trì.
Apica bhagavato attānaṃ pariccajāmi, dhammassa, saṅghassa attānaṃ pariccajāmi.
Furthermore, I renounce myself to the Blessed One, I renounce myself to the Dhamma, I renounce myself to the Sangha.
Hơn nữa, tôi xin hiến dâng bản thân cho Đức Thế Tôn, tôi hiến dâng bản thân cho Pháp, cho Tăng.
Jīvitaṃ pariccajāmi, pariccattoyeva me attā, pariccattaṃyeva me jīvitaṃ, jīvitapariyantikaṃ buddhaṃ saraṇaṃ gacchāmi, buddho me saraṇaṃ leṇaṃ tāṇanti evampi attasanniyyātanaṃ veditabbaṃ.
I renounce my life; my self is indeed renounced, my life is indeed renounced. For as long as my life lasts, I go for refuge to the Buddha. The Buddha is my refuge, my shelter, my protection. In this way too, self-dedication should be understood.
Tôi hiến dâng sinh mạng, bản thân tôi đã được hiến dâng, sinh mạng tôi đã được hiến dâng, tôi quy y Phật đến trọn đời, Phật là nơi nương tựa, nơi ẩn náu, nơi che chở của tôi – sự hiến dâng tự thân cũng nên được hiểu như vậy.
‘‘Satthārañca vatāhaṃ passeyyaṃ bhagavantameva passeyyaṃ, sugatañca vatāhaṃ passeyyaṃ bhagavantameva passeyyaṃ, sammāsambuddhañca vatāhaṃ passeyyaṃ bhagavantameva passeyya’’nti (saṃ. ni. 2.154) evampi mahākassapassa saraṇagamanaṃ viya sissabhāvūpagamanaṃ daṭṭhabbaṃ.
“Oh, that I might see the Teacher! I would see only the Blessed One. Oh, that I might see the Sugata! I would see only the Blessed One. Oh, that I might see the Perfectly Enlightened One! I would see only the Blessed One.” In this way, like Mahākassapa's going for refuge, the assumption of the state of a disciple should be seen.
“Ôi, ước gì tôi được thấy Đức Đạo Sư, tôi được thấy Đức Thế Tôn! Ôi, ước gì tôi được thấy Đức Thiện Thệ, tôi được thấy Đức Thế Tôn! Ôi, ước gì tôi được thấy Đức Chánh Đẳng Giác, tôi được thấy Đức Thế Tôn!” – sự trở thành đệ tử cũng nên được xem như sự quy y của Đại Ca Diếp.
Evampi āḷavakādīnaṃ saraṇagamanaṃ viya tapparāyaṇatā veditabbā.
In this way, like the going for refuge of Āḷavaka and others, making them one's final resort should be understood.
Sự nương tựa cũng nên được hiểu như sự quy y của Aḷavaka v.v.
‘‘Atha kho brahmāyu brāhmaṇo uṭṭhāyāsanā ekaṃsaṃ uttarāsaṅgaṃ karitvā bhagavato pādesu sirasā nipatitvā bhagavato pādāni mukhena ca paricumbati, pāṇīhi ca parisambāhati, nāmañca sāveti brahmāyu ahaṃ, bho gotama, brāhmaṇo, brahmāyu ahaṃ, bho gotama, brāhmaṇo’’ti (ma. ni. 2.394) evampi paṇipāto daṭṭhabbo.
“Then the brahmin Brahmāyu rose from his seat, arranged his upper robe over one shoulder, and fell with his head at the Blessed One's feet. He kissed the Blessed One's feet with his mouth and massaged them with his hands, and announced his name, ‘I am Brahmāyu, Master Gotama, the brahmin; I am Brahmāyu, Master Gotama, the brahmin.’” In this way, prostration should be seen.
“Rồi, Bà-la-môn Brahmāyu đứng dậy khỏi chỗ ngồi, vắt y vai bên trái, cúi đầu đảnh lễ chân Đức Thế Tôn, hôn chân Đức Thế Tôn bằng miệng, xoa bóp bằng tay, và xướng tên: ‘Bạch Đức Gotama, tôi là Bà-la-môn Brahmāyu, bạch Đức Gotama, tôi là Bà-la-môn Brahmāyu’” – sự đảnh lễ cũng nên được xem như vậy.
So panesa ñātibhayācariyadakkhiṇeyyavasena catubbidho hoti.
Now this is fourfold, by way of kin, fear, teacher, and one worthy of offerings.
Sự đảnh lễ này có bốn loại: theo kiểu thân quyến, kiểu sợ hãi, kiểu thầy trò, và kiểu đáng cúng dường.
Tattha dakkhiṇeyyapaṇipātena saraṇagamanaṃ hoti, na itarehi.
Therein, the going for refuge occurs through a prostration to one worthy of offerings, not through the others.
Trong đó, sự quy y chỉ được thọ trì thông qua sự đảnh lễ kiểu đáng cúng dường, không phải các kiểu khác.
Seṭṭhavaseneva hi saraṇaṃ gayhati, seṭṭhavasena bhijjati, tasmā yo sākiyo vā koliyo vā ‘‘buddho amhākaṃ ñātako’’ti vandati, aggahitameva hoti saraṇaṃ.
For a refuge is taken by way of what is highest, and it is broken by way of what is highest. Therefore, if a Sākiyan or a Koliyan pays homage thinking, “The Buddha is our kinsman,” the refuge is not taken at all.
Sự quy y được thọ trì theo cách tối thượng, và bị phá vỡ cũng theo cách tối thượng. Do đó, người Sākiya hay Koliya nào đảnh lễ với ý nghĩ “Đức Phật là thân quyến của chúng ta” thì sự quy y vẫn chưa được thọ trì.
Yo vā ‘‘samaṇo gotamo rājapūjito mahānubhāvo, avandiyamāno anatthampi kareyyā’’ti bhayena vandati, aggahitameva hoti saraṇaṃ.
Or if one pays homage out of fear, thinking, “The ascetic Gotama is honored by kings and is of great power; if not paid homage, he might even cause harm,” the refuge is not taken at all.
Hoặc người nào đảnh lễ vì sợ hãi với ý nghĩ “Sa-môn Gotama được vua chúa tôn kính, có uy lực lớn, nếu không đảnh lễ có thể gây ra tai họa” thì sự quy y vẫn chưa được thọ trì.
Yo vā bodhisattakāle bhagavato santike kiñci uggahitaṃ saramāno buddhakāle vā –
Or if someone, remembering having learned something from the Blessed One in the time he was a Bodhisatta, or during the time of the Buddha—
Hoặc người nào, nhớ lại điều gì đã học được từ Đức Thế Tôn khi Ngài còn là Bồ-tát, hoặc khi Ngài đã thành Phật –
Evaṃ gahitasaraṇassa ca upāsakassa vā upāsikāya vā aññatitthiyesu pabbajitampi ñātiṃ ‘‘ñātako me aya’’nti vandato saraṇagamanaṃ na bhijjati, pageva apabbajitaṃ.
For a male or female lay follower who has thus taken refuge, the going for refuge is not broken by paying homage to a kinsman who has gone forth among other sectarians, thinking, “This is my kinsman,” let alone to one who has not gone forth.
Khi một cận sự nam hay cận sự nữ đã thọ trì quy y như vậy, việc đảnh lễ một người thân đã xuất gia theo ngoại đạo với ý nghĩ “Người này là thân quyến của tôi” không làm mất đi sự quy y, huống hồ là người chưa xuất gia.
Tathā rājānaṃ bhayavasena vandato, so hi raṭṭhapūjitattā avandiyamāno anatthampi kareyyāti.
Likewise, it is not broken for one who pays homage to a king out of fear, for if not paid homage, he, being honored by the country, might even cause harm.
Cũng vậy, việc đảnh lễ vua chúa vì sợ hãi cũng không làm mất đi sự quy y, vì vị vua đó được cả nước tôn kính, nếu không đảnh lễ có thể gây ra tai họa.
Tathā yaṃkiñci sippaṃ sikkhāpakaṃ titthiyaṃ ‘‘ācariyo me aya’’nti vandatopi na bhijjatīti evaṃ saraṇagamanappabhedo veditabbo.
Likewise, it is not broken even for one who pays homage to a sectarian who teaches some kind of skill, thinking, “This is my teacher.” In this way, the distinction in going for refuge should be understood.
Tương tự, việc đảnh lễ một vị ngoại đạo đã dạy cho mình bất kỳ nghề thủ công nào với ý nghĩ “Người này là thầy của tôi” cũng không làm mất đi sự quy y. Sự phân loại quy y nên được hiểu như vậy.
Apica niccato anupagamanādivasena petassa ānisaṃsaphalaṃ veditabbaṃ.
Moreover, the fruit as a benefit for this should be understood through not approaching things as permanent, and so on.
Hơn nữa, quả lợi ích của quy y siêu thế cũng nên được hiểu theo cách không chấp thủ mọi thứ là thường còn v.v.
Vuttañhetaṃ, ‘‘aṭṭhānametaṃ, bhikkhave, anavakāso, yaṃ diṭṭhisampanno puggalo kañci saṅkhāraṃ niccato upagaccheyya, sukhato upagaccheyya, kañci dhammaṃ attato upagaccheyya, mātaraṃ jīvitā voropeyya, pitaraṃ arahantaṃ jīvitā voropeyya, duṭṭhacitto tathāgatassa lohitaṃ uppādeyya, saṅghaṃ bhindeyya, aññaṃ satthāraṃ uddiseyya, netaṃ ṭhānaṃ vijjatī’’ti (ma. ni. 3.128; a. ni. 1.268-276).
For it has been said, “Monks, it is impossible, it cannot happen, that a person endowed with right view would approach any conditioned thing as permanent, would approach it as pleasant, would approach any phenomenon as self; that he would deprive his mother of life, his father, an Arahant; that with a mind of ill will he would cause the Tathāgata's blood to flow; that he would cause a schism in the Sangha; that he would point to another teacher. This cannot happen.”
Điều này đã được nói: “Này các Tỳ-khưu, đây là điều không thể có, không có cơ hội, một người đầy đủ chánh kiến lại chấp thủ bất kỳ hành nào là thường còn, là an lạc, lại chấp thủ bất kỳ pháp nào là tự ngã, lại giết mẹ, giết cha A-la-hán, với tâm ác ý làm Phật chảy máu, chia rẽ Tăng-già, lại chỉ định một vị Đạo sư khác. Điều đó không thể có.”
Aparampi vuttaṃ ‘‘atha kho sakko devānamindo asītiyā devatāsahassehi saddhiṃ yenāyasmā mahāmoggallāno, tenupasaṅkami…pe… ekamantaṃ ṭhitaṃ kho sakkaṃ devānamindaṃ āyasmā mahāmoggallāno etadavoca ‘sādhu kho devānaminda buddhaṃ saraṇagamanaṃ hoti, buddhaṃ saraṇagamanahetu kho devānaminda evamidhekacce sattā kāyassa bhedā paraṃ maraṇā sugatiṃ saggaṃ lokaṃ upapajjantī’ti.
And again it was said: “Then Sakka, the lord of the devas, together with eighty thousand devas, approached the Venerable Mahāmoggallāna… Then the Venerable Mahāmoggallāna said this to Sakka, the lord of the devas, who was standing to one side: ‘It is good, lord of the devas, to go for refuge to the Buddha. For, lord of the devas, because of going for refuge to the Buddha, some beings here, on the breakup of the body, after death, are reborn in a good destination, in a heavenly world.
Một điều khác cũng đã được nói: “Rồi, Thiên chủ Sakka cùng với tám mươi ngàn chư thiên đi đến chỗ Tôn giả Mahā Moggallāna… (lược)… Thiên chủ Sakka đứng sang một bên, Tôn giả Mahā Moggallāna nói với Thiên chủ Sakka rằng: ‘Này Thiên chủ, quy y Phật là điều tốt đẹp. Này Thiên chủ, vì quy y Phật mà một số chúng sanh, sau khi thân hoại mạng chung, sanh vào thiện thú, cõi trời.’
Te aññe deve dasahi ṭhānehi adhigaṇhanti dibbena āyunā dibbena vaṇṇena sukhena yasena ādhipateyyena dibbehi rūpehi saddehi gandhehi rasehi phoṭṭhabbehī’’ti (saṃ. ni. 4.341).
They surpass other devas in ten respects: in divine lifespan, divine beauty, happiness, renown, sovereignty, and in divine forms, sounds, smells, tastes, and tangible objects.’”
Họ vượt trội các vị trời khác ở mười phương diện: tuổi thọ thần thánh, sắc đẹp thần thánh, an lạc thần thánh, danh tiếng thần thánh, quyền lực thần thánh, sắc thần thánh, âm thanh thần thánh, hương thần thánh, vị thần thánh, và xúc thần thánh.”
Esa nayo dhamme saṅghe ca.
The same method applies to the Dhamma and the Sangha.
Điều này cũng áp dụng cho Pháp và Tăng.
Apica velāmasuttādivasenāpi (a. ni. 9.20) saraṇagamanassa phalaviseso veditabbo.
Moreover, the specific fruit of going for refuge should be understood by way of the Velāma Sutta and others.
Hơn nữa, các loại quả đặc biệt của sự quy y cũng nên được hiểu từ kinh Velāma v.v.
Evaṃ saraṇagamanaphalaṃ veditabbaṃ.
In this way, the fruit of going for refuge should be understood.
Quả của sự quy y nên được hiểu như vậy.
Tattha lokiyasaraṇagamanaṃ tīsu vatthūsu aññāṇasaṃsayamicchāñāṇādīhi saṃkilissati, na mahājutikaṃ hoti, na mahāvipphāraṃ.
Therein, the worldly going for refuge is defiled by ignorance, doubt, wrong knowledge, etc., regarding the three objects; it is not of great brilliance, not of great pervasiveness.
Trong đó, sự quy y thế gian (lokiyasaraṇagamana) bị ô nhiễm bởi sự vô minh (aññāṇa), hoài nghi (saṃsaya), tà kiến (micchāñāṇa), v.v., đối với Ba Ngôi Báu; không có đại oai lực, không có đại quang minh.
Lokuttarassa natthi saṃkileso.
For the supramundane, there is no defilement.
Còn đối với sự quy y siêu thế (lokuttarasaraṇagamana) thì không có sự ô nhiễm.
Lokiyassa ca saraṇagamanassa duvidho bhedo sāvajjo anavajjo ca.
And for the worldly going for refuge, there are two kinds of breaking: that with fault and that without fault.
Và sự quy y thế gian có hai loại sự đoạn tuyệt: có tội lỗi (sāvajja) và không có tội lỗi (anavajja).
Tattha sāvajjo aññasatthārādīsu attasanniyyātanādīhi hoti, so aniṭṭhaphalo.
Therein, that with fault occurs through self-surrender, etc., to other teachers and so on; it has an undesirable result.
Trong đó, sự đoạn tuyệt có tội lỗi là do việc dâng hiến tự ngã cho các bậc đạo sư khác, v.v., và điều đó mang lại quả báo không mong muốn.
Anavajjo kālaṃ kiriyāya, so avipākattā aphalo.
That without fault is through the act of death; because it has no result, it is fruitless.
Sự đoạn tuyệt không có tội lỗi là do hết tuổi thọ, và vì không có quả báo nên nó không có kết quả.
Lokuttarassa pana nevatthi bhedo.
But for the supramundane, there is no breaking at all.
Tuy nhiên, đối với sự quy y siêu thế thì không có sự đoạn tuyệt.
Bhavantarepi hi ariyasāvako aññasatthāraṃ na uddisatīti evaṃ saraṇagamanassa saṃkileso ca bhedo ca veditabboti.
For even in another existence, a noble disciple does not designate another as his teacher. Thus, the defilement and breaking of the going for refuge should be understood.
Thật vậy, một Thánh đệ tử (ariyasāvaka) dù ở kiếp sống khác cũng không quy y các bậc đạo sư khác. Như vậy, sự ô nhiễm và sự đoạn tuyệt của sự quy y cần phải được hiểu rõ.
Upāsakaṃ maṃ bhavaṃ gotamo dhāretūti maṃ bhavaṃ gotamo ‘‘upāsako aya’’nti evaṃ dhāretu, jānātūti attho.
May the honorable Gotama remember me as a lay follower means: may the honorable Gotama remember, that is, may he know me thus, “This is a lay follower.”
“Bạch Thế Tôn Gotama, xin Ngài hãy ghi nhận con là một cận sự nam (upāsaka)” có nghĩa là: “Bạch Thế Tôn Gotama, xin Ngài hãy biết con là một cận sự nam.”
Kimassa sīlanti pañca veramaṇiyo.
What is his virtue? The five abstinences.
Giới của người ấy là gì? Là năm điều kiêng cữ.
Yathāha ‘‘yato kho mahānāma upāsako pāṇātipātā paṭivirato hoti adinnādānā, kāmesu micchācārā, musāvādā, surāmerayamajjapamādaṭṭhānā paṭivirato hoti.
As it is said: “When, Mahānāma, a lay follower has abstained from destroying living beings, from taking what is not given, from sexual misconduct, from false speech, from the basis for heedlessness which is fermented and distilled intoxicants;
Như đã nói: “Này Mahānāma, khi một cận sự nam đã từ bỏ sát sinh, từ bỏ trộm cắp, từ bỏ tà dâm, từ bỏ nói dối, từ bỏ dùng rượu, bia và các chất say gây lơ đễnh.
Ettāvatā kho mahānāma upāsako sīlavā hotī’’ti (saṃ. ni. 5.1033).
to this extent, Mahānāma, a lay follower is virtuous” (saṃ. ni. 5.1033).
Này Mahānāma, chỉ với chừng đó, cận sự nam ấy là người giữ giới.”
Ko ājīvoti pañca micchāvaṇijjā pahāya dhammena samena jīvitakappanaṃ.
What is his livelihood? Having abandoned the five wrong kinds of trade, making a living righteously and equitably.
Sinh kế của người ấy là gì? Là từ bỏ năm nghề buôn bán sai trái và duy trì đời sống một cách hợp pháp và chân chính.
Vuttañhetaṃ ‘‘pañcimā, bhikkhave, vaṇijjā upāsakena akaraṇīyā.
For it has been said: “Bhikkhus, these five kinds of trade should not be engaged in by a lay follower.
Điều này đã được nói: “Này các Tỳ-khưu, có năm nghề buôn bán mà một cận sự nam không nên làm.
Katamā pañca?
Which five?
Năm nghề nào?
Satthavaṇijjā, sattavaṇijjā, maṃsavaṇijjā, majjavaṇijjā, visavaṇijjā.
Trade in weapons, trade in living beings, trade in meat, trade in intoxicants, and trade in poisons.
Buôn bán vũ khí, buôn bán sinh vật, buôn bán thịt, buôn bán rượu, buôn bán thuốc độc.
Imā kho, bhikkhave, pañca vaṇijjā upāsakena akaraṇīyā’’ti (a. ni. 5.177).
These, bhikkhus, are the five kinds of trade that should not be engaged in by a lay follower” (a. ni. 5.177).
Này các Tỳ-khưu, đây là năm nghề buôn bán mà một cận sự nam không nên làm.”
Kā vipattīti yā tasseva sīlassa ca ājīvassa ca vipatti, ayamassa vipatti.
What is his failure? The failure of that same virtue and livelihood is his failure.
Sự bại hoại là gì? Đó là sự bại hoại của chính giới và sinh kế ấy, đây là sự bại hoại của người ấy.
Apica yāya esa caṇḍālo ceva hoti malañca patikuṭṭho ca.
Moreover, that by which he becomes an outcaste, a stain, and a despised one,
Hơn nữa, thông qua điều đó, người ấy trở thành một kẻ hạ tiện (caṇḍāla), một vết nhơ (mala), và một kẻ đáng khinh.
Sāpissa vipattīti veditabbā.
that too should be understood as his failure.
Điều đó cũng cần được hiểu là sự bại hoại của người ấy.
Te ca atthato assaddhiyādayo pañca dhammā honti.
And those, in essence, are the five things beginning with lack of faith.
Và về mặt ý nghĩa, đó là năm pháp: vô tín, v.v.
Yathāha ‘‘pañcahi, bhikkhave, dhammehi samannāgato upāsako upāsakacaṇḍālo ca hoti upāsakamalañca upāsakapatikuṭṭho ca.
As it is said: “Bhikkhus, endowed with five things, a lay follower is a lay follower-outcaste, a lay follower-stain, and a lay follower-despised one.
Như đã nói: “Này các Tỳ-khưu, một cận sự nam đầy đủ năm pháp thì là một cận sự nam hạ tiện, một vết nhơ của cận sự nam, và một cận sự nam đáng khinh.
Katamehi pañcahi?
With which five?
Năm pháp nào?
Assaddho hoti, dussīlo hoti, kotūhalamaṅgaliko hoti, maṅgalaṃ pacceti no kammaṃ, ito ca bahiddhā dakkhiṇeyyaṃ pariyesati tattha ca pubbakāraṃ karotī’’ti (a. ni. 5.175).
He is faithless, immoral, given to omens and signs, trusts in signs not in kamma, and seeks for one worthy of offerings outside of here and performs his first service there” (a. ni. 5.175).
Người ấy vô tín, người ấy phá giới, người ấy mê tín dị đoan, người ấy tin vào điềm lành chứ không tin vào nghiệp, và người ấy tìm kiếm bậc đáng cúng dường bên ngoài giáo pháp này và thực hiện sự cúng dường đầu tiên ở đó.”
Kā sampattīti yā cassa sīlasampadā ca ājīvasampadā ca, sā sampatti.
What is his success? The accomplishment in virtue and the accomplishment in livelihood, that is his success.
Sự thành tựu là gì? Đó là sự thành tựu về giới và sự thành tựu về sinh kế của người ấy, đó là sự thành tựu.
Ye cassa ratanabhāvādikarā saddhādayo pañca dhammā.
And also the five things beginning with faith, which make him a jewel and so on.
Và năm pháp như tín, v.v., khiến người ấy trở thành một viên ngọc quý.
Yathāha ‘‘pañcahi, bhikkhave, dhammehi samannāgato upāsako upāsakaratanañca hoti upāsakapadumañca upāsakapuṇḍarīkañca.
As it is said: “Bhikkhus, endowed with five things, a lay follower is a lay follower-jewel, a lay follower-lotus, and a lay follower-white lotus.
Như đã nói: “Này các Tỳ-khưu, một cận sự nam đầy đủ năm pháp thì là một cận sự nam quý báu như ngọc (upāsakaratana), một cận sự nam như hoa sen hồng (upāsakapaduma), và một cận sự nam như hoa sen trắng (upāsakapuṇḍarīka).
Katamehi pañcahi?
With which five?
Năm pháp nào?
Saddho hoti, sīlavā hoti, na kotūhalamaṅgaliko hoti, kammaṃ pacceti no maṅgalaṃ, na ito bahiddhā dakkhiṇeyyaṃ gavesati, idha ca pubbakāraṃ karotī’’ti (a. ni. 5.175).
He has faith, is virtuous, is not given to omens and signs, trusts in kamma not in signs, does not seek for one worthy of offerings outside of here, and performs his first service here” (a. ni. 5.175).
Người ấy có tín, người ấy giữ giới, người ấy không mê tín dị đoan, người ấy tin vào nghiệp chứ không tin vào điềm lành, người ấy không tìm kiếm bậc đáng cúng dường bên ngoài giáo pháp này, và người ấy thực hiện sự cúng dường đầu tiên ở đây.”
Ajjataggeti ettha ayaṃ aggasaddo ādikoṭikoṭṭhāsaseṭṭhesu dissati.
From this day forward: here, this word agga is seen in the senses of beginning, tip, portion, and best.
Trong cụm từ ajjatagge, từ agga này được thấy có nghĩa là điểm khởi đầu, điểm cuối, phần, và tối thượng.
‘‘Ajjatagge, samma dovārika, āvarāmi dvāraṃ nigaṇṭhānaṃ nigaṇṭhīna’’ntiādīsu (ma. ni. 2.70) hi ādimhi dissati.
In passages such as, “From this day forward, friend doorkeeper, I close the door to the Nigaṇṭhas, male and female” (ma. ni. 2.70), it is seen in the sense of beginning.
Trong các câu như “Này người gác cổng, kể từ hôm nay, ta đóng cửa đối với các Ni-kiền-tử và Ni-kiền-tử-ni,” nó được thấy có nghĩa là điểm khởi đầu.
‘‘Teneva aṅgulaggena taṃ aṅgulaggaṃ parāmaseyya, (kathā. 441) ucchaggaṃ veḷagga’’ntiādīsu koṭiyaṃ.
In passages such as, “With that very fingertip he would touch that fingertip” (kathā. 441), “the tip of a sugarcane,” “the tip of a bamboo,” it is seen in the sense of tip.
Trong các câu như “Người ấy nên chạm ngón tay đó bằng đầu ngón tay đó, đầu mía, đầu tre,” nó có nghĩa là điểm cuối.
‘‘Ambilaggaṃ vā madhuraggaṃ vā tittakaggaṃ vā (saṃ. ni. 5.374), anujānāmi, bhikkhave, vihāraggena vā pariveṇaggena vā bhājetu’’ntiādīsu (cūḷava. 318) koṭṭhāse.
In passages such as, “The sour portion, or the sweet portion, or the bitter portion” (saṃ. ni. 5.374), and “I allow, bhikkhus, to divide by monastery portion or by monastic-cell portion” (cūḷava. 318), it is seen in the sense of portion.
Trong các câu như “Này các Tỳ-khưu, ta cho phép phân chia theo phần chua, hoặc phần ngọt, hoặc phần đắng, hoặc theo phần tịnh xá, hoặc theo phần khu vực,” nó có nghĩa là phần.
‘‘Yāvatā, bhikkhave, sattā apadā vā…pe… tathāgato tesaṃ aggamakkhāyatī’’tiādīsu (a. ni. 4.34) seṭṭhe.
In passages such as, “Bhikkhus, whatever beings there are, whether footless… etc.… the Tathāgata is declared the best among them” (a. ni. 4.34), it is seen in the sense of best.
Trong các câu như “Này các Tỳ-khưu, trong số tất cả chúng sinh không chân… v.v… Đức Như Lai được xưng là tối thượng của họ,” nó có nghĩa là tối thượng.
Idha panāyaṃ ādimhi daṭṭhabbo.
But here it should be seen in the sense of beginning.
Tuy nhiên, ở đây, nó nên được xem là điểm khởi đầu.
Tasmā ajjataggeti ajjataṃ ādiṃ katvā, evamettha attho veditabbo.
Therefore, ajjatagge means having made today the beginning; thus the meaning should be understood here.
Do đó, ajjatagge có nghĩa là “bắt đầu từ hôm nay,” ý nghĩa này nên được hiểu ở đây.
Ajjatanti ajjabhāvaṃ.
Ajjataṃ means the state of being today.
Ajjataṃ có nghĩa là “hôm nay.”
Ajjadaggeti vā pāṭho, da-kāro padasandhikaro, ajja aggaṃ katvāti attho.
Or the reading is ajjadagge; the letter da is for euphonic conjunction; the meaning is having made today the beginning.
Hoặc cũng có thể đọc là Ajjadaggeti, chữ ‘da’ là chữ nối giữa các từ, có nghĩa là “bắt đầu từ hôm nay.”
Pāṇupetanti pāṇehi upetaṃ, yāva me jīvitaṃ pavattati, tāva upetaṃ.
As long as life lasts means endowed with life, for as long as my life continues, so long I am endowed.
Pāṇupetaṃ có nghĩa là “cùng với sinh mạng,” tức là “chừng nào mạng sống của con còn tồn tại.”
Anaññasatthukaṃ tīhi saraṇagamanehi saraṇaṃ gataṃ upāsakaṃ kappiyakārakaṃ maṃ bhavaṃ gotamo dhāretu jānātu.
May the honorable Gotama remember, may he know me as a lay follower, a suitable helper, who has gone for refuge through the three goings for refuge, with no other teacher.
Bạch Thế Tôn Gotama, xin Ngài hãy ghi nhận con là một cận sự nam đã quy y Tam Bảo, không có đạo sư nào khác, và là người thực hiện những điều phù hợp.
Ahañhi sacepi me tikhiṇena asinā sīsaṃ chindeyya, neva buddhaṃ ‘‘na buddho’’ti vā dhammaṃ ‘‘na dhammo’’ti vā, saṅghaṃ ‘‘na saṅgho’’ti vā vadeyyanti.
For even if someone were to cut off my head with a sharp sword, I would never say of the Buddha that he is “not the Buddha,” or of the Dhamma that it is “not the Dhamma,” or of the Saṅgha that it is “not the Saṅgha.”
Vì con, dù có bị chặt đầu bằng một thanh kiếm sắc bén, cũng sẽ không nói rằng Đức Phật “không phải là Phật,” hoặc Giáo Pháp “không phải là Pháp,” hoặc Tăng đoàn “không phải là Tăng.”
Evaṃ attasanniyyātanena saraṇaṃ gantvā catūhi ca paccayehi pavāretvā uṭṭhāyāsanā bhagavantaṃ abhivādetvā tikkhattuṃ padakkhiṇaṃ katvā pakkāmīti.
Having thus gone for refuge with self-surrender, and having invited him with the four requisites, he rose from his seat, paid homage to the Blessed One, circumambulated him three times, and departed.
Như vậy, sau khi đã quy y bằng cách dâng hiến tự ngã và đã dâng cúng tứ vật dụng, ông ấy đứng dậy khỏi chỗ ngồi, đảnh lễ Đức Thế Tôn, đi nhiễu ba vòng và ra đi.
Buddhassa bhagavato duvidhā desanā sammutidesanā, paramatthadesanā cāti.
The teaching of the Buddha, the Blessed One, is twofold: conventional teaching and ultimate teaching.
Giáo pháp của Đức Thế Tôn có hai loại: giáo pháp quy ước (sammutidesanā) và giáo pháp tối hậu (paramatthadesanā).
Tattha puggalo satto itthī puriso khattiyo brāhmaṇo devo māroti evarūpā sammutidesanā.
Therein, teaching of such a kind as individual, being, woman, man, khattiya, brahmin, deva, Māra is conventional teaching.
Trong đó, các khái niệm như cá nhân (puggalo), chúng sinh (satto), nữ (itthī), nam (puriso), chiến sĩ (khattiyo), Bà-la-môn (brāhmaṇo), chư thiên (devo), Ma-vương (māro) là giáo pháp quy ước.
Aniccaṃ dukkhaṃ anattā, khandhā dhātū āyatanāni satipaṭṭhānāti evarūpā paramatthadesanā.
Teaching of such a kind as impermanent, suffering, not-self, aggregates, elements, sense bases, foundations of mindfulness is ultimate teaching.
Các khái niệm như vô thường (aniccaṃ), khổ (dukkhaṃ), vô ngã (anattā), uẩn (khandhā), giới (dhātū), xứ (āyatanāni), niệm xứ (satipaṭṭhānā) là giáo pháp tối hậu.
Tattha bhagavā ye sammutivasena desanaṃ sutvā atthaṃ paṭivijjhitvā mohaṃ pahāya visesaṃ adhigantuṃ samatthā, tesaṃ sammutidesanaṃ deseti.
Therein, the Blessed One gives the conventional teaching to those who, upon hearing a teaching by way of convention, are capable of penetrating the meaning, abandoning delusion, and attaining a special state.
Trong đó, Đức Thế Tôn giảng dạy giáo pháp quy ước cho những ai có khả năng nghe giáo pháp theo cách quy ước, thấu hiểu ý nghĩa, từ bỏ si mê và đạt được sự đặc biệt.
Ye pana paramatthavasena desanaṃ sutvā atthaṃ paṭivijjhitvā mohaṃ pahāya visesamadhigantuṃ samatthā, tesaṃ paramatthadesanaṃ deseti.
But he gives the ultimate teaching to those who, upon hearing a teaching by way of the ultimate, are capable of penetrating the meaning, abandoning delusion, and attaining a special state.
Còn những ai có khả năng nghe giáo pháp theo cách tối hậu, thấu hiểu ý nghĩa, từ bỏ si mê và đạt được sự đặc biệt, Ngài giảng dạy giáo pháp tối hậu cho họ.
Tatthāyaṃ upamā, yathā hi desabhāsākusalo tiṇṇaṃ vedānaṃ atthasaṃvaṇṇanako ācariyo ye damiḷabhāsāya vutte atthaṃ jānanti, tesaṃ damiḷabhāsāya ācikkhati.
Herein, this is a simile: just as a teacher who is skilled in the local language and explains the meaning of the three Vedas, teaches in the Damiḷa language to those who understand the meaning when it is spoken in the Damiḷa language.
Ở đây có một ví dụ, như một vị đạo sư thông thạo ngôn ngữ địa phương, người giải thích ý nghĩa của ba bộ Veda, sẽ giảng bằng tiếng Damila cho những ai hiểu ý nghĩa khi được nói bằng tiếng Damila.
Ye andhakabhāsādīsu aññatarāya, tesaṃ tāya tāya bhāsāya.
And to those who understand one of the languages like Andhaka, he teaches in that respective language.
Những ai hiểu bằng một trong các ngôn ngữ như tiếng Andhaka, thì Ngài sẽ giảng bằng ngôn ngữ đó.
Evaṃ te māṇavakā chekaṃ byattaṃ ācariyamāgamma khippameva sippaṃ uggaṇhanti.
In this way, those young students, by approaching a skilled and discerning teacher, quickly learn the art.
Như vậy, những học trò đó, nhờ có vị đạo sư tài giỏi và khéo léo, sẽ nhanh chóng nắm vững nghề nghiệp.
Tattha ācariyo viya buddho bhagavā.
Therein, the Blessed Buddha is like the teacher.
Trong đó, Đức Phật, Thế Tôn, ví như vị đạo sư.
Tayo vedā viya kathetabbabhāvena ṭhitāni tīṇi piṭakāni.
The three Piṭakas, standing as the subject to be taught, are like the three Vedas.
Ba bộ Piṭaka, tồn tại dưới dạng cần được thuyết giảng, ví như ba bộ Veda.
Desabhāsākosallamiva sammutiparamatthakosallaṃ.
Skill in conventional and ultimate truth is like skill in the local language.
Sự khéo léo trong chân lý ước lệ và chân lý tối hậu ví như sự thông thạo ngôn ngữ địa phương.
Nānādesabhāsā māṇavakā viya sammutiparamatthadesanāpaṭivijjhanasamatthā veneyyasattā.
The trainable beings, who are capable of penetrating the teachings on conventional and ultimate truth, are like the young students of various local languages.
Các chúng sinh có thể được giáo hóa, có khả năng thấu hiểu giáo pháp ước lệ và tối hậu, ví như những học trò đến từ các vùng đất và ngôn ngữ khác nhau.
Ācariyassa damiḷabhāsādiācikkhanaṃ viya bhagavato sammutiparamatthavasena desanā veditabbā.
The Blessed One’s teaching in terms of conventional and ultimate truth should be understood as being like the teacher’s teaching in the Damiḷa language and others.
Việc Thế Tôn thuyết giảng theo chân lý ước lệ và chân lý tối hậu cần được hiểu ví như việc vị đạo sư giảng bằng tiếng Damila, v.v.
Āha cettha –
And it is said in this regard:
Và ở đây, Ngài đã nói:
Apica aṭṭhahi kāraṇehi bhagavā puggalakathaṃ katheti – hirottappadīpanatthaṃ, kammassakatādīpanatthaṃ, paccattapurisakāradīpanatthaṃ, ānantariyadīpanatthaṃ, brahmavihāradīpanatthaṃ, pubbenivāsadīpanatthaṃ, dakkhiṇāvisuddhidīpanatthaṃ, lokasammutiyā appahānatthañcāti.
Furthermore, the Blessed One gives a talk on individuals for eight reasons: to explain moral shame and moral fear, to explain ownership of kamma, to explain individual effort, to explain the immediately effective actions, to explain the divine abidings, to explain recollection of past lives, to explain the purity of the offering, and for the sake of not abandoning worldly convention.
Hơn nữa, Thế Tôn thuyết giảng về cá nhân (puggala) vì tám lý do: để làm sáng tỏ sự hổ thẹn và ghê sợ tội lỗi (hirī-ottappa), để làm sáng tỏ sự sở hữu nghiệp (kammassakatā), để làm sáng tỏ sự nỗ lực cá nhân (paccatta-purisakāra), để làm sáng tỏ các nghiệp nặng không gián đoạn (ānantariya), để làm sáng tỏ các Phạm trú (brahmavihāra), để làm sáng tỏ ký ức về các kiếp sống trước (pubbenivāsa), để làm sáng tỏ sự thanh tịnh của phước báu cúng dường (dakkhiṇāvisuddhi), và để không từ bỏ quy ước thế gian (lokasammuti).
‘‘Khandhadhātuāyatanāni hirīyanti ottappantī’’ti hi vutte mahājano na jānāti, sammohamāpajjati, paṭisattu hoti ‘‘kimidaṃ khandhadhātuāyatanāni hirīyanti ottappanti nāmā’’ti.
For if it were said, “The aggregates, elements, and sense bases feel moral shame and moral fear,” the populace would not understand, would fall into confusion, and would become hostile, thinking, “What is this called, ‘the aggregates, elements, and sense bases feel moral shame and moral fear’?”
Nếu nói rằng “các uẩn (khandha), giới (dhātu), xứ (āyatana) hổ thẹn và ghê sợ tội lỗi”, thì đại chúng không hiểu, trở nên hoang mang, và trở thành kẻ thù, nghĩ rằng “cái gì gọi là các uẩn, giới, xứ hổ thẹn và ghê sợ tội lỗi?”
‘‘Itthī hirīyati ottappati puriso khattiyo brāhmaṇo devo māro’’ti vutte pana jānāti, na sammohamāpajjati, na paṭisattu hoti.
But when it is said, “A woman feels moral shame and moral fear, a man, a khattiya, a brahmin, a deva, Māra,” they understand, do not fall into confusion, and do not become hostile.
Nhưng khi nói rằng “người phụ nữ hổ thẹn và ghê sợ tội lỗi, người đàn ông, người thuộc dòng Sát-đế-lợi, Bà-la-môn, chư thiên, Ma-vương”, thì họ hiểu, không hoang mang, và không trở thành kẻ thù.
Tasmā bhagavā hirottappadīpanatthaṃ puggalakathaṃ katheti.
Therefore, the Blessed One gives a talk on individuals to explain moral shame and moral fear.
Do đó, Thế Tôn thuyết giảng về cá nhân để làm sáng tỏ sự hổ thẹn và ghê sợ tội lỗi.
‘‘Khandhā mātaraṃ jīvitā voropenti pitaraṃ arahantaṃ ruhiruppādakammaṃ karonti, saṅghabhedakammaṃ karonti, dhātuyo āyatanānī’’ti vuttepi eseva nayo.
The same method applies if it were said, “The aggregates deprive a mother of life, a father, an arahant, they perform the act of shedding the Buddha’s blood, they perform the act of creating a schism in the Saṅgha, as do the elements and the sense bases.”
Khi nói rằng “các uẩn cướp mạng mẹ, cướp mạng cha, cướp mạng A-la-hán, gây ra máu Phật, gây ra chia rẽ Tăng đoàn, các giới, các xứ”, thì cũng theo cách tương tự.
Tasmā bhagavā ānantariyadīpanatthaṃ puggalakathaṃ katheti.
Therefore, the Blessed One gives a talk on individuals to explain the immediately effective actions.
Do đó, Thế Tôn thuyết giảng về cá nhân để làm sáng tỏ các nghiệp nặng không gián đoạn.
‘‘Khandhā mettāyanti dhātuyo āyatanānī’’ti vuttepi eseva nayo.
The same method applies if it were said, “The aggregates feel loving-kindness, as do the elements and the sense bases.”
Khi nói rằng “các uẩn khởi tâm từ, các giới khởi tâm từ, các xứ khởi tâm từ”, thì cũng theo cách tương tự.
Tasmā bhagavā brahmavihāradīpanatthaṃ puggalakathaṃ katheti.
Therefore, the Blessed One gives a talk on individuals to explain the divine abidings.
Do đó, Thế Tôn thuyết giảng về cá nhân để làm sáng tỏ các Phạm trú.
‘‘Khandhā pubbenivāsamanussaranti dhātuyo āyatanānī’’ti vuttepi eseva nayo.
The same method applies if it were said, “The aggregates recollect past lives, as do the elements and the sense bases.”
Khi nói rằng “các uẩn nhớ lại các kiếp sống trước, các giới nhớ lại các kiếp sống trước, các xứ nhớ lại các kiếp sống trước”, thì cũng theo cách tương tự.
Tasmā bhagavā pubbenivāsadīpanatthaṃ puggalakathaṃ katheti.
Therefore, the Blessed One gives a talk on individuals to explain recollection of past lives.
Do đó, Thế Tôn thuyết giảng về cá nhân để làm sáng tỏ ký ức về các kiếp sống trước.
‘‘Khandhā dānaṃ paṭiggaṇhanti dhātuyo āyatanānī’’ti vuttepi mahājano na jānāti, sammohamāpajjati, paṭisattu hoti ‘‘kimidaṃ khandhadhātuāyatanāni paṭiggaṇhanti nāmā’’ti.
If it were said, “The aggregates receive a gift, as do the elements and the sense bases,” the populace would not understand, would fall into confusion, and would become hostile, thinking, “What is this called, ‘the aggregates, elements, and sense bases receive a gift’?”
Khi nói rằng “các uẩn thọ nhận vật cúng dường, các giới thọ nhận vật cúng dường, các xứ thọ nhận vật cúng dường”, thì đại chúng không hiểu, trở nên hoang mang, và trở thành kẻ thù, nghĩ rằng “cái gì gọi là các uẩn, giới, xứ thọ nhận vật cúng dường?”
‘‘Puggalā paṭiggaṇhanti sīlavanto kalyāṇadhammā’’ti vutte pana jānāti, na sammohamāpajjati, na paṭisattu hoti.
But when it is said, “Individuals receive it, those who are virtuous, of good character,” they understand, do not fall into confusion, and do not become hostile.
Nhưng khi nói rằng “các cá nhân (puggala) có giới hạnh, có pháp lành thọ nhận vật cúng dường”, thì họ hiểu, không hoang mang, và không trở thành kẻ thù.
Tasmā bhagavā dakkhiṇāvisuddhidīpanatthaṃ puggalakathaṃ katheti.
Therefore, the Blessed One gives a talk on individuals to explain the purity of the offering.
Do đó, Thế Tôn thuyết giảng về cá nhân để làm sáng tỏ sự thanh tịnh của phước báu cúng dường.
Lokasammutiñca buddhā bhagavanto nappajahanti, lokasamaññāya lokaniruttiyaṃ lokābhilāpe ṭhitāyeva dhammaṃ desenti.
The Blessed Buddhas do not abandon worldly convention; they teach the Dhamma while standing on worldly usage, worldly parlance, and worldly terminology.
Và chư Phật, chư Thế Tôn, không từ bỏ quy ước thế gian, mà vẫn thuyết giảng Pháp trong các danh xưng, cách diễn đạt, và lời nói thông thường của thế gian.
Tasmā bhagavā lokasammutiyā appahānatthampi puggalakathaṃ katheti.
Therefore, the Blessed One also gives a talk on individuals for the sake of not abandoning worldly convention.
Do đó, Thế Tôn thuyết giảng về cá nhân cũng để không từ bỏ quy ước thế gian.
Tasmā ayampi āyasmā lokavohārakusalatāya buddhassa bhagavato desanaṃ avilomento lokasammutiyaṃ ṭhatvāva cattārome, āvuso, puggalāti āha.
Therefore, this Venerable One too, due to his skill in worldly usage, not contradicting the teaching of the Blessed Buddha, and standing on worldly convention, said, “Friends, there are these four individuals.”
Vì vậy, vị Tôn giả này, do khéo léo trong cách dùng ngôn ngữ thế gian, không làm trái lời dạy của Đức Phật, Thế Tôn, mà vẫn đứng trên quy ước thế gian để nói rằng “Này chư Hiền, có bốn hạng cá nhân này”.
Tasmā ettha paramatthavasena aggahetvā sammutivaseneva puggalo veditabbo.
Therefore, here the individual should be understood not in an ultimate sense but only in a conventional sense.
Do đó, ở đây, cá nhân cần được hiểu theo nghĩa quy ước, không phải theo nghĩa tối hậu.
Santo saṃvijjamānāti lokasaṅketavasena atthi upalabbhamānā.
Existing, being present means they exist and are found in the sense of worldly convention.
“Có mặt, hiện hữu” (santo saṃvijjamānā) nghĩa là có, được tìm thấy theo quy ước thế gian.
Lokasminti sattaloke.
In the world means in the world of beings.
“Trong thế gian” (lokasmiṃ) là trong thế gian chúng sinh.
Sāṅgaṇova samānotiādīsu pana aṅgaṇanti katthaci kilesā vuccanti.
Now, in phrases such as “while being one with a blemish,” aṅgaṇa sometimes refers to defilements.
Trong các đoạn như “còn có vết nhơ” (sāṅgaṇova samāno), v.v., “vết nhơ” (aṅgaṇa) đôi khi được dùng để chỉ các phiền não.
Yathāha ‘‘tattha katamāni tīṇi aṅgaṇāni?
As it is said: “There, what are the three blemishes?”
Như đã nói: “Trong đó, ba vết nhơ nào? Tham là vết nhơ, sân là vết nhơ, si là vết nhơ.”
Rāgo aṅgaṇaṃ, doso aṅgaṇaṃ, moho aṅgaṇa’’nti (vibha. 924).
“Greed is a blemish, hatred is a blemish, delusion is a blemish.”
“Tham là nhơ bẩn, sân là nhơ bẩn, si là nhơ bẩn”.
Katthaci yaṃkiñci malaṃ vā paṅko vā, yathāha ‘‘tasseva rajassa vā aṅgaṇassa vā pahānāya vāyamatī’’ti.
Sometimes it refers to any kind of stain or mud, as it is said: “He strives for the removal of that very dust or blemish.”
Đôi khi, nó chỉ bất kỳ sự dơ bẩn hay bùn nhơ nào, như đã nói: “Người ấy nỗ lực để loại bỏ bụi bẩn hay vết nhơ đó.”
Katthaci tathārūpo bhūmibhāgo, so bodhiyaṅgaṇaṃ cetiyaṅgaṇantiādīnaṃ vasena veditabbo.
Sometimes it refers to a particular area of land; this should be understood in terms of the Bodhi-courtyard, the cetiya-courtyard, and so on.
Đôi khi, nó chỉ một khu vực đất như vậy, cần được hiểu theo nghĩa sân Bồ-đề, sân tháp, v.v.
Idha pana nānappakārā tibbakilesā ‘‘aṅgaṇa’’nti adhippetā.
Here, however, various kinds of intense defilements are intended by “aṅgaṇa.”
Ở đây, “vết nhơ” (aṅgaṇa) được hiểu là các phiền não mãnh liệt, đa dạng.
Tathā hi vakkhati ‘‘pāpakānaṃ kho etaṃ, āvuso, akusalānaṃ icchāvacarānaṃ adhivacanaṃ, yadidaṃ aṅgaṇa’’nti (ma. ni. 1.60).
For indeed, it will be said: “Friends, this is a designation for evil, unwholesome states subject to wishes, that is, ‘blemish.’”
Quả thật, Ngài sẽ nói: “Này chư Hiền, đây là tên gọi của những ác pháp bất thiện, những dục vọng, tức là vết nhơ.”
Saha aṅgaṇena sāṅgaṇo.
With a blemish is sāṅgaṇo.
Cùng với vết nhơ là sāṅgaṇo (còn vết nhơ).
Sāṅgaṇova samānoti sakilesoyeva santo.
While being one with a blemish means while being with defilements.
“Còn có vết nhơ” (sāṅgaṇova samāno) nghĩa là còn có phiền não.
Atthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ nappajānātīti mayhaṃ attano cittasantāne kileso atthītipi na jānāti.
He does not know as it really is, ‘There is an internal blemish in me’ means he does not know that there is a defilement in his own stream of consciousness.
“Không như thật biết rằng ‘Ta có vết nhơ bên trong’” (atthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ nappajānāti) nghĩa là người ấy không biết rằng “có phiền não trong dòng tâm thức của chính mình”.
‘‘Ime kilesā nāma kakkhaḷā vāḷā jahitabbā na gahitabbā visaduṭṭhasallasadisā’’ti evaṃ yāthāvasarasatopi na jānāti.
He does not know, in accordance with reality, that “These things called defilements are harsh and savage; they should be abandoned, not clung to; they are like a poisoned arrow.”
Người ấy cũng không như thật biết rằng “những phiền não này thô bạo, hung ác, cần phải từ bỏ, không nên nắm giữ, giống như mũi tên độc hại”.
Yo atthīti ca jānāti, evañca jānāti.
One who knows both that it exists and knows it in this way,
Người nào biết rằng có phiền não, và biết như vậy,
So ‘‘atthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ pajānātī’’ti vuccati.
he is said to be one who “knows as it really is, ‘There is an internal blemish in me.’”
Người đó được gọi là “như thật biết rằng ‘Ta có vết nhơ bên trong’” (atthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ pajānāti).
Yassa pana na ca maggena samūhatā kilesā, na ca uppajjanti yena vā tena vā vāritattā, ayamidha anaṅgaṇoti adhippeto.
But one for whom the defilements have not been eradicated by the path, nor do they arise because they have been checked in one way or another, is here intended as one without a blemish.
Còn người nào mà phiền não chưa được nhổ tận gốc bằng đạo, và cũng không phát sinh do đã được ngăn chặn bằng cách này hay cách khác, thì ở đây được hiểu là không có vết nhơ (anaṅgaṇa).
Natthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ nappajānātīti ‘‘mayhaṃ kilesā yena vā tena vā vāritattā natthi, na maggena samūhatattā’’ti na jānāti, ‘‘te uppajjamānā mahāanatthaṃ karissanti kakkhaḷā vāḷā visaduṭṭhasallasadisā’’ti evaṃ yāthāvasarasatopi na jānāti.
He does not know as it really is, ‘There is no internal blemish in me’ means he does not know that “My defilements are absent because they have been checked in one way or another, not because they have been eradicated by the path,” and he does not know, in accordance with reality, that “If they arise, they will cause great harm, being harsh, savage, and like a poisoned arrow.”
“Không như thật biết rằng ‘Ta không có vết nhơ bên trong’” (natthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ nappajānāti) nghĩa là người ấy không biết rằng “phiền não của ta không có do đã được ngăn chặn bằng cách này hay cách khác, chứ không phải do đã được nhổ tận gốc bằng đạo”, người ấy cũng không như thật biết rằng “nếu chúng phát sinh, chúng sẽ gây ra tai họa lớn, chúng thô bạo, hung ác, giống như mũi tên độc hại”.
Yo pana ‘‘iminā kāraṇena natthī’’ti ca jānāti, evañca jānāti, so ‘‘natthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ pajānātī’’ti vuccati.
But whoever knows, "It does not exist for this reason," and knows it thus, is said to be one who "understands in accordance with reality that 'there is no stain internally for me.'"
Còn người nào biết rằng “không có phiền não vì lý do này”, và biết như vậy, thì người đó được gọi là “như thật biết rằng ‘Ta không có vết nhơ bên trong’” (natthi me ajjhattaṃ aṅgaṇanti yathābhūtaṃ pajānāti).
Tatrāti tesu catūsu puggalesu, tesu vā dvīsu sāṅgaṇesu, yvāyanti yo ayaṃ, yāyantipi pāṭho.
Tatrā: Among those four persons, or among those two who have stains. Yvāyaṃ: The resolution of the words is yo ayaṃ. There is also the reading yāyaṃ.
“Trong đó” (tatrā) nghĩa là trong bốn hạng cá nhân đó, hoặc trong hai hạng có vết nhơ đó, “người nào” (yvāyaṃ) là yo ayaṃ (người nào này), cũng có bản đọc là yāyanti.
58. Ko nu kho, āvuso, sāriputta, hetu ko paccayoti ubhayenāpi kāraṇameva pucchati.
58. Friend Sāriputta, what now is the reason, what is the cause: With both terms, he is asking for the very cause.
58. “Này Hiền giả Sāriputta, nguyên nhân nào, điều kiện nào?” (Ko nu kho, āvuso, sāriputta, hetu ko paccayo) là hỏi về nguyên nhân bằng cả hai cách.
Yenimesanti yena hetunā yena paccayena imesaṃ dvinnaṃ eko seṭṭhapuriso eko hīnapurisoti akkhāyati, so ko hetu ko paccayoti evamettha sambandho veditabbo.
Yenimesaṃ: "By what reason, by what cause, is one of these two proclaimed as a superior person and the other as an inferior person?" — the connection here should be understood in this way: "What is that reason, what is that cause?"
“Vì lý do nào, vì điều kiện nào, trong số hai người này, một người được gọi là người cao quý, một người được gọi là người thấp kém?” (Yenimesaṃ) – mối liên hệ ở đây cần được hiểu là: “Nguyên nhân nào, điều kiện nào khiến trong số hai người này, một người được gọi là người cao quý, một người được gọi là người thấp kém?”
Tattha kiñcāpi ‘‘nappajānāti pajānātī’’ti evaṃ vuttaṃ, pajānanā nappajānanāti idameva ubhayaṃ hetu ceva paccayo ca.
Although it is stated as "does not understand" and "understands," these two — understanding and not understanding — are themselves both the reason and the cause.
Tuy rằng ở đây đã nói là "không biết, biết", nhưng chính sự biết và không biết này là cả hai nhân và duyên.
59. Thero pana attano vicitrapaṭibhānatāya taṃ pākaṭataraṃ katvā dassetuṃ puna tatrāvusotiādimāha.
59. But the Elder, due to his diverse brilliance, said Tatrāvuso and so on to explain it by making it even clearer.
Tuy nhiên, vị Trưởng lão đã làm cho điều đó rõ ràng hơn bằng sự tài trí phong phú của mình, nên Ngài lại nói: Thưa hiền giả, ở đây và tiếp theo.
Tattha tassetaṃ pāṭikaṅkhanti tassa puggalassa etaṃ pāṭikaṅkhitabbaṃ.
Therein, tassetaṃ pāṭikaṅkhaṃ: For that person, this is to be expected.
Ở đây, điều này đáng được mong đợi nơi người ấy có nghĩa là điều này đáng được mong đợi nơi người ấy.
Idameva esa pāpuṇissati, na aññanti icchitabbaṃ, avassaṃ bhāvīti vuttaṃ hoti.
It should be desired that "This is what he will attain, not another." It means it is inevitable.
Người ấy sẽ đạt được chính điều này, chứ không phải điều khác, có nghĩa là điều đó chắc chắn sẽ xảy ra.
‘‘Na chandaṃ janessatī’’tiādinā nayena vuttaṃ achandajananādiṃ sandhāyāha.
He said this referring to not generating desire, etc., which was spoken by the method beginning with, "He will not generate desire."
Lời này được nói ra để chỉ sự không phát sinh dục vọng, v.v., như đã nói trong cách diễn đạt "sẽ không phát sinh dục vọng" và tiếp theo.
Tattha ca na chandaṃ janessatīti appajānanto tassa aṅgaṇassa pahānatthaṃ kattukamyatāchandaṃ na janessati.
And there, na chandaṃ janessati: Not understanding, he will not generate the desire to act for the purpose of abandoning that stain.
Ở đây, sẽ không phát sinh dục vọng nghĩa là người không biết sẽ không phát sinh dục vọng muốn làm để đoạn trừ cấu uế đó.
Na vāyamissatīti tato balavataraṃ vāyāmaṃ na karissati, na vīriyaṃ ārabhissatīti thāmagatavīriyaṃ pana neva ārabhissati, na pavattessatīti vuttaṃ hoti.
Na vāyamissati: He will not make an effort stronger than that. Na vīriyaṃ ārabhissatī: He will certainly not arouse effort that has reached its full strength; this means he will not set it in motion.
Sẽ không tinh tấn nghĩa là sẽ không thực hiện sự tinh tấn mạnh mẽ hơn; sẽ không khởi phát tinh tấn nghĩa là sẽ không khởi phát, không duy trì sự tinh tấn mạnh mẽ.
Sāṅgaṇoti imehi rāgādīhi aṅgaṇehi sāṅgaṇo.
Sāṅgaṇo: He has stains from these stains of lust and so on.
Có cấu uế nghĩa là có cấu uế bởi những tham ái, v.v. này.
Saṃkiliṭṭhacittoti tehiyeva suṭṭhutaraṃ kiliṭṭhacitto malīnacitto vibādhitacitto upatāpitacitto ca hutvā.
Saṃkiliṭṭhacitto: Having a greatly defiled mind, a stained mind, an afflicted mind, and a tormented mind from those very things.
Với tâm ô nhiễm nghĩa là với tâm bị ô nhiễm một cách sâu sắc hơn bởi chính những điều đó, tâm bị vẩn đục, tâm bị quấy nhiễu, tâm bị nung đốt.
Kālaṃ karissatīti marissati.
Kālaṃ karissatī: He will die.
Sẽ chết nghĩa là sẽ chết.
Seyyathāpīti yathā nāma.
Seyyathāpi: Just as.
Ví như nghĩa là như thế nào.
Kaṃsapātīti kaṃsalohabhājanaṃ.
Kaṃsapātī: A vessel made of bronze.
Bát đồng nghĩa là đồ dùng bằng hợp kim đồng.
Ābhatāti ānītā.
Ābhatā: Brought.
Được mang đến nghĩa là được mang đến.
Āpaṇā vā kammārakulā vāti āpaṇato vā kaṃsapātikārakānaṃ kammārānaṃ gharato vā.
Āpaṇā vā kammārakulā vā: From a shop or from the house of bronze-smiths.
Từ chợ hay từ nhà thợ rèn nghĩa là từ chợ hoặc từ nhà của những người thợ rèn làm bát đồng.
Rajenāti āgantukarajena paṃsuādinā.
Rajenā: With extraneous dust, such as dirt.
Bởi bụi nghĩa là bởi bụi bẩn từ bên ngoài, như đất cát, v.v.
Malenāti tattheva uṭṭhitena lohamalena.
Malenā: With metallic tarnish that has formed on it.
Bởi cáu bẩn nghĩa là bởi rỉ đồng sinh ra ngay tại đó.
Pariyonaddhāti sañchannā.
Pariyonaddhā: Covered over.
Bị bao phủ nghĩa là bị che phủ.
Na ceva paribhuñjeyyunti udakakhādanīyapakkhipanādīhi paribhogaṃ na kareyyuṃ.
Na ceva paribhuñjeyyuṃ: They would not use it by putting water, food, and so on in it.
Không sử dụng nghĩa là không sử dụng để đựng nước, thức ăn, v.v.
Na ca pariyodapeyyunti dhovanaghaṃsanādīhi na parisuddhaṃ kārāpeyyuṃ.
Na ca pariyodapeyyuṃ: They would not have it cleaned by washing, scouring, and so on.
Không làm sạch nghĩa là không làm cho sạch sẽ bằng cách rửa, chà xát, v.v.
Rajāpatheti rajapathe.
Rajāpathe: In a dusty place.
Trên đường bụi nghĩa là trên đường bụi.
Ayameva vā pāṭho, rajassa āgamanaṭṭhāne vā vuṭṭhānuṭṭhāne vā heṭṭhāmañce vā thusakoṭṭhake vā bhājanantare vā, yattha rajena okirīyatīti attho.
Or this is the reading: in a place where dust comes from, where it rises, under a bed, in a chaff storeroom, or among other vessels; the meaning is, wherever it is covered with dust.
Hoặc đây là cách đọc đúng, hoặc là nơi bụi đến, hoặc nơi bụi bay lên hay lắng xuống, hoặc dưới gầm giường, hoặc trong kho trấu, hoặc giữa các đồ vật, nghĩa là nơi bị bụi bẩn phủ đầy.
Saṃkiliṭṭhatarā assa malaggahitāti ettha rajāpathe nikkhipanena saṃkiliṭṭhatarā, aparibhogāpariyodapanehi malaggahitatarāti vuttaṃ hoti, paṭipucchāvacanañcetaṃ.
Saṃkiliṭṭhatarā assa malaggahitā: Here it is said that it is "more defiled" from being placed in a dusty place, and "more covered in grime" from not being used or cleaned. This is a question in response.
Ở đây, càng ô nhiễm hơn, càng bám bẩn hơn, có nghĩa là do đặt trên đường bụi nên càng ô nhiễm hơn, và do không sử dụng, không làm sạch nên càng bám bẩn hơn. Đây là lời vấn đáp.
Tenassa evamattho veditabbo, āvuso, sā kaṃsapāti evaṃ karīyamānā aparena kālena saṃkiliṭṭhatarā ca malaggahitatarā ca mattikapātīti vā kaṃsapātīti vā itipi dujjānā bhaveyya nu kho noti, thero taṃ paṭijānanto āha ‘‘evamāvuso’’ti.
Therefore, its meaning should be understood thus: "Friend, if that bronze bowl were treated in this way, would it in time become so much more defiled and more covered in grime that it would be difficult to know whether it is an earthenware bowl or a bronze bowl, or not?" The Elder, agreeing to this, said, "So it is, friend."
Do đó, ý nghĩa của lời này nên được hiểu như sau: "Thưa hiền giả, cái bát đồng đó, nếu được làm như vậy, sau một thời gian, liệu có trở nên ô nhiễm hơn và bám bẩn hơn đến mức khó mà biết được đó là bát đất hay bát đồng không?" Vị Trưởng lão chấp nhận điều đó và nói: "Thưa hiền giả, đúng vậy."
Puna dhammasenāpati opammaṃ sampaṭipādento, evameva khotiādimāha.
Then the General of the Dhamma, to establish the simile, said, Evameva kho, and so on.
Sau đó, Dhammasenāpati (Tôn giả Sāriputta), khi đưa ra ví dụ, đã nói: Cũng vậy, này và tiếp theo.
Tatthevaṃ opammasaṃsandanā veditabbā – kiliṭṭhakaṃsapātisadiso sāṅgaṇo puggalo.
Therein, the correspondence of the simile should be understood as follows: a person with stains is like a dirty bronze bowl.
Ở đây, sự so sánh ví dụ nên được hiểu như sau: Người có cấu uế giống như cái bát đồng bị ô nhiễm.
Saṃkiliṭṭhakaṃsapātiyā naparibhuñjanamādiṃ katvā rajāpathanikkhepo viya tassa puggalassa pabbajjaṃ labhamānassa vejjakammādīsu pasutapuggalasantike pabbajjāpaṭilābho.
Receiving ordination in the presence of a person engaged in activities like practicing medicine is, for a person receiving ordination, like placing a dirty bronze bowl in a dusty place after not using it and so on.
Việc người ấy nhận được sự xuất gia từ những người chuyên làm nghề y, v.v., giống như việc cái bát đồng bị ô nhiễm không được sử dụng và bị vứt trên đường bụi.
Saṃkiliṭṭhakaṃsapātiyā puna saṃkiliṭṭhatarabhāvo viya tassa puggalassa anukkamena ācariyupajjhāyānaṃ anusikkhato vejjakammādikaraṇaṃ, ettha ṭhitassa sāṅgaṇakālakiriyā.
Like a dirty bronze bowl becoming even more defiled, so for that person, while following the example of his teachers and preceptors, is the gradual act of practicing medicine and so on. Remaining in this state, he dies with stains.
Việc người ấy dần dần làm nghề y, v.v. khi học theo các vị A-xà-lê và Upajjhāya, giống như việc cái bát đồng bị ô nhiễm lại càng trở nên ô nhiễm hơn. Việc người ấy chết với cấu uế khi ở trong tình trạng này.
Atha vā anukkamena dukkaṭadubbhāsitavītikkamanaṃ, ettha ṭhitassa sāṅgaṇakālakiriyā.
Or, it is the gradual transgression of wrong conduct and wrong speech. Remaining in this state, he dies with stains.
Hoặc, việc người ấy dần dần vi phạm các lỗi Dukkata và Dubbhāsita, việc người ấy chết với cấu uế khi ở trong tình trạng này.
Atha vā anukkamena pācittiyathullaccayavītikkamanaṃ, saṅghādisesavītikkamanaṃ, pārājikavītikkamanaṃ, mātughātādiānantariyakaraṇaṃ, ettha ṭhitassa sāṅgaṇakālakiriyāti.
Or, it is the gradual transgression of pācittiya and thullaccaya offenses, the transgression of saṅghādisesa offenses, the transgression of pārājika offenses, the commission of heinous acts such as matricide. Remaining in this state, he dies with stains.
Hoặc, việc người ấy dần dần vi phạm các lỗi Pācittiya và Thullaccaya, vi phạm lỗi Saṅghādisesa, vi phạm lỗi Pārājika, thực hiện các tội Ānantariya như giết mẹ, v.v., việc người ấy chết với cấu uế khi ở trong tình trạng này.
Dutiyavāre pariyodapeyyunti dhovanaghaṃsanasaṇhachārikāparimajjanādīhi parisuddhaṃ ādāsamaṇḍalasadisaṃ kareyyuṃ.
In the second case, pariyodapeyyuṃ: They would make it clean, like the surface of a mirror, by washing, scouring, rubbing with fine ash, and so on.
Ở lần thứ hai, sẽ làm sạch nghĩa là sẽ làm cho nó tinh khiết, giống như một tấm gương tròn, bằng cách rửa, chà xát, lau bằng tro mịn, v.v.
Na ca naṃ rajāpatheti pubbe vuttappakāre ṭhāne anikkhipitvā karaṇḍamañjūsādīsu vā ṭhapeyyuṃ, paliveṭhetvā vā nāgadante lageyyuṃ.
Na ca naṃ rajāpathe: Not placing it in the type of place mentioned before, they would place it in a box, a chest, or the like, or they would wrap it and hang it on a peg.
Không để nó trên đường bụi nghĩa là không đặt nó ở nơi đã nói trước đây, mà đặt trong giỏ, hộp, v.v., hoặc quấn lại và treo trên ngà voi.
Sesaṃ vuttanayānusāreneva gahetabbaṃ.
The rest should be understood according to the method already explained.
Phần còn lại nên được hiểu theo cách đã nói.
Upamāsaṃsandanā cettha evaṃ veditabbā – kiliṭṭhakaṃsapātisadiso sāṅgaṇo bhabbapuggalo.
And here the correspondence of the simile should be understood as follows: a person with stains who is capable of progress is like a dirty bronze bowl.
Ở đây, sự so sánh ví dụ nên được hiểu như sau: Người có cấu uế, nhưng có khả năng giác ngộ, giống như cái bát đồng bị ô nhiễm.
Kiliṭṭhakaṃsapātiyā paribhuñjanamādiṃ katvā suddhaṭṭhāne ṭhapanaṃ viya tassa puggalassa pabbajjaṃ labhamānassa pesalabhikkhūnaṃ santike pabbajjāpaṭilābho.
Receiving ordination in the presence of virtuous bhikkhus is, for that person receiving ordination, like placing the dirty bronze bowl in a clean place after using it and so on.
Việc người ấy nhận được sự xuất gia từ các vị Tỳ-khưu thanh tịnh khi xuất gia, giống như việc cái bát đồng bị ô nhiễm được sử dụng và đặt ở nơi sạch sẽ.
Ye ovadanti anusāsanti appamattakampi pamādaṃ disvā daṇḍakammaṃ katvā punappunaṃ sikkhāpenti, saṃkiliṭṭhakaṃsapātiyā aparakāle parisuddhapariyodātabhāvo viya tassa puggalassa ācariyupajjhāyānaṃ anusikkhato anukkamena sammāvattapaṭipatti, ettha ṭhitassa anaṅgaṇakālakiriyā.
They are the ones who advise and instruct; upon seeing even the slightest heedlessness, they impose a penalty and repeatedly train him. For that person following the example of his teachers and preceptors, there is gradually correct practice. Remaining in this state, he dies without stains, which is like the dirty bronze bowl later becoming pure and bright.
Những vị A-xà-lê và Upajjhāya khuyên bảo, giáo huấn, khi thấy dù chỉ một chút phóng dật cũng trừng phạt và liên tục rèn luyện, việc người ấy dần dần thực hành đúng đắn, việc người ấy chết không cấu uế khi ở trong tình trạng này, giống như việc cái bát đồng bị ô nhiễm sau đó trở nên tinh khiết và trong sáng.
Atha vā anukkamena parisuddhe sīle patiṭṭhāya attano anurūpaṃ buddhavacanaṃ uggaṇhitvā dhutaṅgāni samādāya attano anukūlakammaṭṭhānaṃ gahetvā gāmantasenāsanavāsaṃ muñcitvā pantasenāsanavāso, ettha ṭhitassa anaṅgaṇakālakiriyā.
Or, gradually being established in pure virtue, having learned the word of the Buddha appropriate for himself, having undertaken the ascetic practices, having taken a meditation subject suitable for himself, having given up dwelling in a residence near a village, he dwells in a secluded residence. Remaining in this state, he dies without stains.
Hoặc, việc người ấy dần dần an trú trong Giới thanh tịnh, học Phật ngôn phù hợp với mình, thực hành các pháp Dhutaṅga, chọn đề mục thiền phù hợp với mình, rời bỏ nơi cư trú gần làng để ở nơi cư trú hẻo lánh, việc người ấy chết không cấu uế khi ở trong tình trạng này.
Atha vā anukkamena kasiṇaparikammaṃ katvā aṭṭhasamāpattinibbattanena kilesavikkhambhanaṃ, vipassanāpādakajjhānā vuṭṭhāya vipassanāya kilesānaṃ tadaṅganivāraṇaṃ, sotāpattiphalādhigamo…pe… arahattasacchikiriyāti ettha ṭhitassa accantaṃ anaṅgaṇakālakiriyā eva.
Or, gradually, having done the preliminary work for a kasiṇa and having suppressed the defilements by producing the eight attainments; having risen from the jhāna that is the basis for insight, having temporarily removed the defilements with insight; the attainment of the fruit of stream-entry... and so on... the realization of arahantship. Remaining in this state, he absolutely dies without stains.
Hoặc, việc người ấy dần dần thực hiện Kāsiṇa-parikamma, đoạn trừ phiền não bằng cách thành tựu Tám Thiền Định, xuất khỏi thiền định làm nền tảng cho Vipassanā, đoạn trừ phiền não bằng Vipassanā theo từng phần, chứng đắc quả Tu-đà-hoàn... cho đến chứng đắc quả A-la-hán, việc người ấy chết hoàn toàn không cấu uế khi ở trong tình trạng này.
Tatiyavāre subhanimittanti rāgaṭṭhāniyaṃ iṭṭhārammaṇaṃ.
In the third case, subhanimitta: A desirable object that is a basis for lust.
Ở lần thứ ba, tướng tốt nghĩa là đối tượng khả ái là chỗ phát sinh tham ái.
Manasi karissatīti tasmiṃ vipannassati taṃ nimittaṃ āvajjissati.
Manasi karissatī: When it arises in him, he will pay attention to that sign.
Sẽ tác ý nghĩa là khi có niệm sai lầm đó, người ấy sẽ chú ý đến tướng đó.
Tassa subhanimittassa manasikārāti tassa puggalassa subhanimittamanasikārakāraṇā.
Tassa subhanimittassa manasikārā: Due to that person's attention to the beautiful sign.
Do tác ý tướng tốt đó nghĩa là do nguyên nhân tác ý tướng tốt của người ấy.
Anuddhaṃsessatīti hiṃsissati adhibhavissati.
Anuddhaṃsessatī: It will harm him, it will overwhelm him.
Sẽ hủy hoại nghĩa là sẽ làm hại, sẽ chế ngự.
Rāgo hi uppajjanto kusalavāraṃ pacchinditvā sayameva akusalajavanaṃ hutvā tiṭṭhanto kusalacittaṃ anuddhaṃsetīti veditabbo.
It should be understood that when lust arises, it cuts off the wholesome turn and, standing as an unwholesome impulsion itself, it ruins the wholesome consciousness.
Tham ái khi phát sinh, cắt đứt cơ hội thiện pháp, tự nó trở thành tâm tốc hành bất thiện và tồn tại, hủy hoại tâm thiện.
Sesaṃ vuttanayānusāreneva gahetabbaṃ.
The remainder should be understood according to the method already stated.
Phần còn lại nên được hiểu theo cách đã nói.
60. Idāni taṃ aṅgaṇaṃ nānappakārato pākaṭaṃ kārāpetukāmenāyasmatā mahāmoggallānena ‘‘aṅgaṇaṃ aṅgaṇa’’ntiādinā nayena puṭṭho taṃ byākaronto pāpakānaṃ kho etaṃ, āvusotiādimāha.
Now, desiring to have that aṅgaṇa made evident in various ways, the Venerable Mahāmoggallāna asked in the manner beginning "Aṅgaṇa, aṅgaṇa," and answering that, the Venerable Sāriputta said, Friend, this is for evil ones, and so on.
60. Giờ đây, Ngài Đại Moggalāna, với mong muốn làm rõ hơn về vết nhơ (aṅgaṇa) ấy bằng nhiều cách khác nhau, đã hỏi theo cách “vết nhơ, vết nhơ” v.v. Để giải thích điều đó, Ngài Xāriputta đã nói: “Này chư hiền, đây chính là của những kẻ xấu ác” v.v.
Tattha icchāvacarānanti icchāya avacarānaṃ, icchāvasena otiṇṇānaṃ pavattānaṃ nānappakārānaṃ kopaappaccayānanti attho.
Therein, of those who are subject to wishes means of those who follow wishes, of various kinds of kopa and appaccayo that have descended and arisen according to wishes; this is the meaning.
Trong đó, icchāvacarānaṃ có nghĩa là của những kẻ theo ý muốn, của những loại sân hận và bất mãn khác nhau đã khởi lên do sự chi phối của ý muốn.
Yaṃ idhekaccassāti yena idhekaccassa evaṃ icchā uppajjeyya, taṃ ṭhānaṃ taṃ kāraṇaṃ vijjati atthi, upalabbhatīti vuttaṃ hoti.
That herein a certain one means: that by which such a wish would arise for a certain one here—that situation, that reason exists, is found; this is what is said.
Yaṃ idhekaccassā có nghĩa là có một trường hợp, một nguyên nhân mà do đó một số người ở đây có thể phát sinh ý muốn như vậy; điều đó được nói là có tồn tại, có thể tìm thấy.
Āpanno assanti āpanno bhaveyyaṃ.
I might have transgressed means: I might be a transgressor.
Āpanno assaṃ có nghĩa là tôi có thể phạm tội (āpatti).
Na ca maṃ bhikkhū jāneyyunti bhikkhū ca maṃ na jāneyyuṃ.
And the monks might not know me means: and the monks might not know me.
Na ca maṃ bhikkhū jāneyyuṃ có nghĩa là các tỳ khưu cũng không biết tôi.
Kiṃ panettha ṭhānaṃ, lābhatthikatā.
What is the situation here? The state of desiring gain.
Nguyên nhân ở đây là gì? Là sự ham muốn lợi lộc.
Lābhatthiko hi bhikkhu pakatiyāpi ca katapuñño manussehi sakkato garukato evaṃ cinteti ‘‘āpattiṃ āpannaṃ bhikkhuṃ therā ñatvā majjhimānaṃ ārocenti, te navakānaṃ, navakā vihāre vighāsādādīnaṃ, te ovādaṃ āgatānaṃ bhikkhunīnaṃ, evaṃ kamena catasso parisā jānanti.
Indeed, a monk desirous of gain, who is also naturally one who has made merit and is honored and respected by people, thinks thus: "When the elders know that a monk has transgressed an offense, they inform the middle ones; they inform the new ones; the new ones inform the leftovers-eaters and others in the monastery; they inform the nuns who have come for instruction. In this way, the four assemblies come to know."
Thật vậy, một tỳ khưu ham muốn lợi lộc, vốn dĩ đã tạo phước và được mọi người tôn kính, trọng vọng, sẽ suy nghĩ như sau: “Khi các trưởng lão biết một tỳ khưu phạm tội, họ sẽ báo cho các tỳ khưu trung niên, các tỳ khưu trung niên báo cho các tỳ khưu tân học, các tỳ khưu tân học báo cho những người ăn thức ăn thừa trong tịnh xá v.v., những người đó báo cho các tỳ khưu ni đến để được giáo huấn. Cứ thế, bốn hội chúng sẽ biết.
Evamassa lābhantarāyo hoti.
In this way, there is an obstacle to his gain.
Như vậy, sẽ có một trở ngại cho lợi lộc của vị ấy.
Aho vatāhaṃ āpattiñca vata āpanno assaṃ, na ca maṃ bhikkhū jāneyyu’’nti.
"Oh, that I might indeed have transgressed an offense, and the monks might not know me!"
Ôi! Ước gì tôi có thể phạm tội, nhưng các tỳ khưu sẽ không biết tôi!”
Yaṃ taṃ bhikkhuṃ bhikkhū jāneyyunti yena kāraṇena taṃ bhikkhuṃ aññe bhikkhū jāneyyuṃ, taṃ kāraṇaṃ vijjati kho pana atthiyeva, no natthi.
That the monks might know that monk means: that reason by which other monks might know that monk, that reason certainly does exist; it is not non-existent.
Yaṃ taṃ bhikkhuṃ bhikkhū jāneyyuṃ có nghĩa là nguyên nhân mà các tỳ khưu khác sẽ biết vị tỳ khưu ấy, nguyên nhân ấy thực sự có tồn tại, không phải là không có.
Therā hi ñatvā majjhimānaṃ ārocenti.
For the elders, having known, inform the middle ones.
Thật vậy, các trưởng lão khi biết sẽ báo cho các tỳ khưu trung niên.
Evaṃ so pubbe vuttanayena catūsu parisāsu pākaṭo hoti.
Thus, he becomes known among the four assemblies in the way previously stated.
Như vậy, vị ấy sẽ trở nên nổi tiếng trong bốn hội chúng theo cách đã nói ở trên.
Evaṃ pākaṭo ca ayasābhibhūto gāmasatampi pavisitvā ummārasatesu ṭhānesu uñchitvā yathādhotena pattena nikkhamati.
Having thus become known and being overcome by disgrace, he enters even a hundred villages and, gleaning at a hundred doorsteps, departs with his bowl just as it was when washed.
Khi đã nổi tiếng như vậy và bị sự bất danh (ayasa) chi phối, vị ấy dù đi vào hàng trăm ngôi làng, đứng ở hàng trăm ngưỡng cửa để khất thực, rồi đi ra với bát đã rửa sạch.
Tato jānanti maṃ bhikkhū āpattiṃ āpannoti tehi camhi evaṃ nāsitoti cintetvā, iti so kupito hoti appatīto so iminā kāraṇena kupito ceva hoti kodhābhibhūto appatīto ca domanassābhibhūto.
Then, thinking, "The monks know that I have transgressed an offense," and, "I have been ruined by them in this way," thus he is angry and displeased—for this reason he is both angry, overcome by anger, and displeased, overcome by dejection.
Do đó, vị ấy suy nghĩ: “Các tỳ khưu biết tôi đã phạm tội,” và “Tôi bị họ hủy hoại như thế này.” Iti so kupito hoti appatīto – vì lý do này, vị ấy trở nên sân hận, bị sự sân hận chi phối, và bất mãn, bị sự ưu phiền chi phối.
Yo ceva kho, āvuso, kopo yo ca appaccayo ubhayametaṃ aṅgaṇanti, āvuso, yo cāyaṃ saṅkhārakkhandhasaṅgahito kopo, yo ca vedanākkhandhasaṅgahito appaccayo, etaṃ ubhayaṃ aṅgaṇanti evamettha attho daṭṭhabbo.
Friend, both the kopa and the appaccayo, both of these are aṅgaṇa, means: Friend, this kopa which is included in the aggregate of mental formations, and this appaccayo which is included in the aggregate of feeling—both of these are aṅgaṇa. Thus the meaning should be understood here.
Yo ceva kho, āvuso, kopo yo ca appaccayo ubhayametaṃ aṅgaṇaṃ có nghĩa là, này chư hiền, sự sân hận này thuộc về uẩn hành (saṅkhārakkhandha) và sự bất mãn này thuộc về uẩn thọ (vedanākkhandha), cả hai điều này là vết nhơ (aṅgaṇa). Ý nghĩa ở đây nên được hiểu như vậy.
Idañca tādisānaṃ puggalānaṃ vasena vuttaṃ.
And this is spoken in reference to such individuals.
Và điều này được nói theo cách của những hạng người như vậy.
Lobho pana imassa aṅgaṇassa pubbabhāgavasena, moho sampayogavasenāpi gahitoyeva hoti.
Greed, however, is included as the preliminary part of this aṅgaṇa, and delusion is also included by way of association.
Tuy nhiên, tham (lobha) đã được bao gồm theo nghĩa là phần trước của vết nhơ này, và si (moha) đã được bao gồm theo nghĩa là đồng sanh (sampayoga).
Anuraho manti purimasadisameva bhikkhuṃ gahetvā vihārapaccante senāsanaṃ pavesetvā dvāraṃ thaketvā codente icchati.
Me in private means: taking a monk similar to the previous one, leading him into a dwelling on the outskirts of the monastery, closing the door, he wishes that they admonish him.
Anuraho maṃ có nghĩa là, tương tự như trường hợp trước, vị tỳ khưu ấy muốn được chất vấn một cách kín đáo, bằng cách đưa vị ấy vào một chỗ ở (senāsana) ở vùng biên của tịnh xá, đóng cửa lại rồi chất vấn.
Ṭhānaṃ kho panetanti etaṃ kāraṇaṃ vijjati, yaṃ taṃ bhikkhuṃ catuparisamajjhe ānetvā byattā vinītā ‘‘tayā asukamhi nāma ṭhāne vejjakammaṃ kata’’ntiādinā nayena codeyyuṃ.
But this is a situation means: this reason exists, that having brought that monk into the midst of the four assemblies, competent and disciplined monks might admonish him in the manner beginning, "You performed medical practice at such and such a place."
Ṭhānaṃ kho panetaṃ có nghĩa là, có một lý do mà các tỳ khưu thông minh và đã được huấn luyện có thể đưa vị tỳ khưu ấy ra giữa bốn hội chúng và chất vấn theo cách: “Ngài đã làm nghề y ở nơi này” v.v.
So catūsu parisāsu pākaṭo hoti.
He becomes known among the four assemblies.
Vị ấy trở nên nổi tiếng trong bốn hội chúng.
Evaṃ pākaṭo ca ayasābhibhūtoti sabbaṃ purimasadisameva.
Being thus known and overcome by disgrace—all this is the same as before.
Khi đã nổi tiếng như vậy và bị sự bất danh (ayasa) chi phối, tất cả đều giống như trường hợp trước.
Sappaṭipuggaloti samāno puggalo.
With a corresponding person means an equal person.
Sappaṭipuggalo có nghĩa là một người tương đương.
Samānoti sāpattiko.
Equal means one with an offense.
Samāno có nghĩa là người phạm tội.
Paṭipuggaloti codako.
Corresponding person means the admonisher.
Paṭipuggalo có nghĩa là người chất vấn.
Ayaṃ sāpattikeneva codanaṃ icchati, tvampi imañcimañca āpattiṃ āpanno, taṃ tāva paṭikarohi pacchā maṃ codessasīti vattuṃ sakkāti maññamāno.
This one wishes for admonishment only by one who has a similar offense, thinking it possible to say, "You too have committed this and that offense. First, you should make amends for that; afterwards you can admonish me."
Vị ấy muốn được chất vấn bởi một người cũng phạm tội, vì nghĩ rằng có thể nói: “Ngài cũng đã phạm tội này và tội kia; hãy sám hối tội đó trước, rồi sau đó hãy chất vấn tôi.”
Apica jātiādīhipi samāno puggalo sappaṭipuggalo.
Moreover, a person who is equal in terms of birth and so on is a "corresponding person."
Hơn nữa, một người tương đương về giới tính v.v. cũng là sappaṭipuggalo.
Ayañhi attano jātiyā kulena bāhusaccena byattatāya dhutaṅgenāti evamādīhipi samāneneva codanaṃ icchati, tādisena vuttaṃ nātidukkhaṃ hotīti maññamāno.
Indeed, this one wishes for admonishment only by someone who is equal in birth, family, great learning, competence, ascetic practices, and so on, thinking, "What is said by such a one is not too painful."
Vị ấy muốn được chất vấn bởi một người tương đương về giới tính, dòng dõi, sự học rộng, sự tháo vát, sự hành trì khổ hạnh (dhutaṅga) v.v., vì nghĩ rằng lời nói của một người như vậy sẽ không quá đau khổ.
Appaṭipuggaloti ettha ayutto paṭipuggalo appaṭipuggalo.
Without a corresponding person means: here, an unsuitable corresponding person is a "non-corresponding person."
Trong appaṭipuggalo, người chất vấn không phù hợp là appaṭipuggalo.
Imehi āpattādīhi asadisattā paṭisattu paṭisallo codako bhavituṃ ayuttoti vuttaṃ hoti.
It is said that because of being dissimilar in regard to these offenses and so on, an admonisher who is an adversary, a thorn, is unsuitable to be one.
Điều đó có nghĩa là, vì không tương đồng về tội lỗi v.v., nên người chất vấn không phù hợp để trở thành đối thủ, trở thành gai nhọn.
Iti so kupitoti iti so imāya appaṭipuggalacodanāya evaṃ kupito hoti.
Thus he is angry means: thus he becomes angry on account of this admonishment by a non-corresponding person.
Iti so kupito có nghĩa là, vì sự chất vấn của người không tương đồng này, vị ấy trở nên sân hận như vậy.
Catutthavāre aho vatāti ‘‘aho vata re amhākaṃ paṇḍitakā, aho vata re amhākaṃ bahussutakā tevijjakā’’ti (dī. ni. 1.291) garahāyaṃ dissati.
In the fourth case, Oh, that! is seen in a sense of reproach in "Oh, that our 'wise ones'! Oh, that our 'learned ones,' our 'knowers of the three Vedas'!"
Trong trường hợp thứ tư, aho vata được thấy trong ngữ cảnh chỉ trích, như trong “Ôi! Những người trí giả của chúng ta, ôi! Những người đa văn, tam minh của chúng ta!”
‘‘Aho vata maṃ daharaṃyeva samānaṃ rajje abhisiñceyyu’’nti (mahāva. 57) patthanāyaṃ.
It is seen in a sense of aspiration in "Oh, that they would anoint me in the kingdom while I am still young!"
Trong “Ôi! Ước gì họ sẽ tấn phong tôi làm vua khi tôi còn trẻ,” thì đó là sự mong ước.
Idha patthanāyameva.
Here it is in the sense of aspiration.
Ở đây, cũng là sự mong ước.
Paṭipucchitvā paṭipucchitvāti punappunaṃ pucchitvā.
Having questioned repeatedly means having asked again and again.
Paṭipucchitvā paṭipucchitvā có nghĩa là hỏi đi hỏi lại nhiều lần.
Ayaṃ bhikkhu lābhatthiko bhagavato attānaṃ paṭipucchitabbaṃ icchati, tañca kho anumatipucchāya, no maggaṃ vā phalaṃ vā vipassanaṃ vā antaraṃ katvā.
This monk, desirous of gain, wishes for himself to be questioned by the Blessed One, and that too with a question seeking agreement, not one concerning the path, fruition, or insight.
Vị tỳ khưu này, vì ham muốn lợi lộc, muốn được Thế Tôn hỏi mình, nhưng đó là hỏi theo kiểu đồng ý, không phải hỏi về đạo, quả hay thiền quán.
Ayañhi passati bhagavantaṃ sāriputtādayo mahāthere ‘‘taṃ kiṃ maññasi, sāriputta, moggallāna, kassapa, rāhula cakkhuṃ niccaṃ vā aniccaṃ vā’’ti evaṃ parisamajjhe paṭipucchitvā paṭipucchitvā dhammaṃ desentaṃ, manusse ca ‘‘tesa paṇḍitā therā satthu cittaṃ ārādhentī’’ti vaṇṇaṃ bhaṇante, lābhasakkārañca upaharante.
For he sees the Blessed One teaching the Dhamma in the midst of the assembly, repeatedly questioning the great elders such as Sāriputta, saying, "What do you think, Sāriputta, Moggallāna, Kassapa, Rāhula, is the eye permanent or impermanent?"; and he sees people speaking praise, "Their elders are wise; they please the Teacher's mind," and bringing gains and honor.
Thật vậy, vị ấy thấy Thế Tôn hỏi đi hỏi lại các trưởng lão như Xāriputta, Moggalāna, Kassapa, Rāhula: “Này Xāriputta, Moggalāna, Kassapa, Rāhula, các ông nghĩ sao, mắt là thường hay vô thường?” và thuyết pháp như vậy giữa hội chúng, còn mọi người thì ca ngợi: “Các trưởng lão trí giả ấy làm hài lòng tâm ý của Bậc Đạo Sư,” và cúng dường lợi lộc, sự tôn kính.
Tasmā taṃ lābhasakkāraṃ icchanto evaṃ cintetvā nikhaṇitvā ṭhapitakhāṇu viya bhagavato puratova hoti.
Therefore, desiring that gain and honor, and having thought thus, he is always right in front of the Blessed One, like a stake driven into the ground.
Do đó, vì mong muốn lợi lộc và sự tôn kính ấy, vị ấy suy nghĩ như vậy và đứng trước Thế Tôn như một cái cọc đã được đóng chặt.
Iti so kupitoti atha bhagavā taṃ amanasikaritvāva aññaṃ theraṃ paṭipucchitvā dhammaṃ deseti, tena so kupito hoti bhagavato ca therassa ca.
Thus he is angry means: then the Blessed One, paying him no mind, teaches the Dhamma by questioning another elder. Because of that, he becomes angry with the Blessed One and with the elder.
Iti so kupito có nghĩa là, Thế Tôn khi đó không chú ý đến vị ấy mà hỏi một trưởng lão khác và thuyết pháp; do đó, vị ấy trở nên sân hận với cả Thế Tôn và trưởng lão kia.
Kathaṃ bhagavato kuppati?
How is he angry with the Blessed One?
Làm sao lại sân hận với Thế Tôn?
‘‘Ahaṃ pabbajitakālato pabhuti gandhakuṭipariveṇato bahinikkhamanaṃ na jānāmi, sabbakālaṃ chāyāva na vijahāmi, maṃ nāma pucchitvā dhammadesanāmattampi natthi.
"From the time I went forth, I have not known what it is to go outside the grounds of the Fragrant Chamber. I do not leave his side at any time, just like a shadow. Yet there is not even so much as a teaching of the Dhamma after questioning me by name."
“Từ khi tôi xuất gia, tôi chưa từng ra khỏi khu vực hương thất (gandhakuṭi); tôi không bao giờ rời xa Ngài, luôn ở bên như bóng với hình. Thế mà, không có một lời thuyết pháp nào được hỏi tôi.
Taṃmuhuttaṃ diṭṭhamattakameva theraṃ pucchitvā dhammaṃ desetī’’ti evaṃ bhagavato kuppati.
"He teaches the Dhamma after questioning an elder whom he has just seen for a moment." In this way, he is angry with the Blessed One.
Ngài lại hỏi một trưởng lão vừa mới gặp mặt và thuyết pháp!” – Vị ấy sân hận Thế Tôn như vậy.
Kathaṃ therassa kuppati?
How is he angry with the elder?
Làm sao lại sân hận với trưởng lão kia?
‘‘Ayaṃ mahallakatthero bhagavato purato khāṇu viya nisīdati, kadā nu kho imaṃ dhammakammikā abhabbaṭṭhānaṃ pāpetvā nīharissanti, ayañhi yadi imasmiṃ vihāre na bhaveyya, avassaṃ bhagavā mayā saddhiṃ sallapeyyā’’ti evaṃ therassa kuppati.
"This old elder sits before the Blessed One like a stake. When will those who uphold the Dhamma-kamma bring him to an unworthy state and expel him? For if he were not in this monastery, the Blessed One would surely speak with me." In this way, he is angry with the elder.
“Vị trưởng lão già này ngồi trước Thế Tôn như một cái cọc. Chừng nào thì các tỳ khưu hành pháp (dhammakammika) mới đưa vị này đến chỗ không xứng đáng và trục xuất khỏi giáo pháp? Nếu vị này không có mặt trong tịnh xá này, chắc chắn Thế Tôn sẽ nói chuyện với tôi!” – Vị ấy sân hận trưởng lão kia như vậy.
Purakkhatvā purakkhatvāti purato purato katvā, samparivāretvāti vuttaṃ hoti.
Having put in front means having placed in front, having surrounded; this is what is said.
Purakkhatvā purakkhatvā có nghĩa là đặt trước mặt, bao quanh.
Ayampi lābhatthikoyeva, ayañhi passati bahussute bhikkhū mahāparivārena gāmaṃ pavisante, cetiyaṃ vandante, tesañca taṃ sampattiṃ disvā upāsake pasanne pasannākāraṃ karonte.
This one is also desirous of gain. For he sees learned monks entering a village with a large retinue and paying homage to a cetiya, and upon seeing their fortune, laypeople become inspired and show signs of inspiration.
Vị này cũng là người ham muốn lợi lộc. Vị ấy thấy các tỳ khưu đa văn đi vào làng với đoàn tùy tùng đông đảo, đảnh lễ các bảo tháp, và khi thấy sự thịnh vượng đó, các cư sĩ trở nên hoan hỷ và biểu lộ sự hoan hỷ.
Tasmā evaṃ icchati.
Therefore, he wishes for this.
Vì vậy, vị ấy mong muốn như vậy.
Kupitoti ayampi dvīsu ṭhānesu kuppati bhikkhūnaṃ therassa ca.
Is angry means: this one also becomes angry on two counts: with the monks and with the elder.
Kupito có nghĩa là vị này cũng sân hận ở hai nơi: với các tỳ khưu và với trưởng lão.
Kathaṃ bhikkhūnaṃ?
How with the monks?
Sân hận với các tỳ khưu như thế nào?
‘‘Ime yadeva mayhaṃ uppajjati cīvaraṃ vā piṇḍapāto vā, taṃ gahetvā paribhuñjanti, mayhaṃ pana pattacīvaraṃ gahetvā piṭṭhito āgacchantopi natthī’’ti evaṃ bhikkhūnaṃ kuppati.
"Whatever robe or almsfood arises for me, they take it and use it, but there is no one to even take my bowl and robe and follow behind me." In this way, he is angry with the monks.
“Những người này, bất cứ y phục hay thức ăn khất thực nào của tôi, họ đều lấy và thọ dụng. Còn tôi thì không có ai mang bát và y theo sau cả!” – Vị ấy sân hận các tỳ khưu như vậy.
Kathaṃ therassa?
How with the elder?
Sân hận với trưởng lão như thế nào?
‘‘Eso mahallakatthero tesu tesu ṭhānesu sayameva paññāyati, kudāssu nāma naṃ dhammakammikā nikkaḍḍhissanti, imasmiṃ asati avassaṃ maṃyeva parivāressantī’’ti.
"This old elder is prominent by himself in these various places. When will those who carry out the formal act according to the Dhamma expel him? When he is not here, they will surely attend upon me."
“Trưởng lão Tỳ-kheo già này tự hiển lộ ở những nơi đó, bao giờ thì các vị chấp sự Pháp sự mới trục xuất ông ta đây? Nếu không có ông ta, chắc chắn các Tỳ-kheo sẽ vây quanh ta thôi.”
Bhattaggeti bhojanaṭṭhāne.
At the meal hall means at the place of eating.
Bhattagge có nghĩa là nơi ăn uống.
Aggāsananti saṅghattherāsanaṃ.
The chief seat means the seat of the Saṅgha elder.
Aggāsana là chỗ ngồi của Trưởng lão Tăng.
Aggodakanti dakkhiṇodakaṃ.
The chief water means the dedicatory water.
Aggodaka là nước cúng dường.
Aggapiṇḍanti saṅghattherapiṇḍaṃ.
The chief almsfood means the almsfood of the Saṅgha elder.
Aggapiṇḍa là vật thực cúng dường cho Trưởng lão Tăng.
Sabbattha vā agganti paṇītādhivacanametaṃ.
Or in all instances, chief is a term for what is excellent.
Hoặc agga ở tất cả các chỗ này là từ ngữ chỉ sự thượng hảo.
Tattha ahameva labheyyanti icchā nātimahāsāvajjā.
Therein, the desire "May I alone receive it" is not greatly blameworthy.
Trong đó, ý muốn chỉ có ta được thì không có tội lỗi lớn lắm.
Na añño bhikkhu labheyyāti pana atimahāsāvajjā.
But the desire "May no other bhikkhu receive it" is extremely blameworthy.
Nhưng ý muốn không Tỳ-kheo nào khác được thì có tội lỗi rất lớn.
Ayampi lābhatthiko pāsādiko hoti cīvaradhāraṇādīhi, kadāci pabbajati, kadāci vibbhamati.
This gain-seeker is also graceful in his wearing of the robes and so on; sometimes he goes forth, sometimes he disrobes.
Tỳ-kheo này cũng là người tham lợi, có vẻ ngoài đoan trang nhờ việc mặc y v.v., đôi khi xuất gia, đôi khi hoàn tục.
Tena so pubbe laddhapubbaṃ āsanādiṃ pacchā alabhanto evaṃ cintesi.
Therefore, not receiving later the seat and so on that he had previously received, he thought in this way.
Vì thế, khi không còn được những chỗ ngồi v.v. đã từng được trước đây, ông ta suy nghĩ như vậy.
Na so bhikkhu labheyyāti na so bhikkhu therānaṃ aggāsanādīsu tadanusārena majjhimānaṃ aññesañca navānaṃ kadāci yaṃ vā taṃ vā sabbanihīnaṃ āsanādiṃ labhati.
"That bhikkhu would not receive" means: that bhikkhu receives whatever lowly seat, and so on, is available at times, but does not receive the seat of the elders, or following that, the seat of the middle ones or the other new ones.
Na so bhikkhu labheyyā có nghĩa là vị Tỳ-kheo đó không được chỗ ngồi đầu v.v. của các Trưởng lão, và theo đó, các chỗ ngồi của các Tỳ-kheo trung cấp và các Tỳ-kheo mới khác, đôi khi ông ta chỉ được chỗ ngồi thấp kém nhất.
Kupitoti ayampi dvīsu ṭhānesu kuppati manussānañca therānañca.
Being angry: he too becomes angry in two instances, with the laypeople and with the elders.
Kupito (tức giận) có nghĩa là vị này cũng tức giận ở hai nơi: đối với con người và đối với các Trưởng lão.
Kathaṃ manussānaṃ?
How with the laypeople?
Thế nào là tức giận đối với con người?
‘‘Ime maṅgalādīsu maṃ nissāya bhikkhū labhanti, ete, ‘bhante, ettake bhikkhū gahetvā amhākaṃ anukampaṃ karothā’ti vadanti, idāni taṃmuhuttaṃ diṭṭhamattakaṃ mahallakattheraṃ gahetvā gatā, hotu idāni, nesaṃ kicce uppanne jānissāmī’’ti evaṃ manussānaṃ kuppati.
"These people get bhikkhus for auspicious events and so on by relying on me. They say, 'Venerable sir, please have compassion on us by taking this many bhikkhus.' Now they have gone and taken an old elder whom they have just seen for a moment. So be it. I will know what to do when their needs arise." In this way, he is angry with the laypeople.
“Những người này nhờ ta mà các Tỳ-kheo được lợi lộc trong các lễ hội v.v. Họ nói: ‘Bạch Thế Tôn, xin hãy dẫn chừng ấy Tỳ-kheo và ban ân huệ cho chúng con.’ Bây giờ, họ lại dẫn vị Trưởng lão Tỳ-kheo già vừa mới gặp đi. Thôi được, khi nào họ có việc, ta sẽ biết!” Ông ta tức giận với con người như vậy.
Kathaṃ therānaṃ?
How with the elders?
Thế nào là tức giận đối với các Trưởng lão?
‘‘Ime nāma yadi na bhaveyyuṃ, maṃyeva manussā nimanteyyu’’nti evaṃ therānaṃ kuppati.
"If these elders did not exist, the laypeople would invite only me." In this way, he is angry with the elders.
“Nếu những Trưởng lão này không có mặt, thì chính ta sẽ được mọi người thỉnh mời.” Ông ta tức giận với các Trưởng lão như vậy.
Anumodeyyanti anumodanaṃ kareyyaṃ.
Would give thanks means I would perform the giving of thanks.
Anumodeyya có nghĩa là sẽ tùy hỷ.
Ayampi lābhatthiko yaṃ vā taṃ vā khaṇḍānumodanaṃ jānāti, ‘‘so anumodanaṭṭhāne bahū mātugāmā āgacchanti, tā maṃ sañjānitvā tato pabhuti thālakabhikkhaṃ dassantī’’ti patthento evaṃ cintesi.
This gain-seeker also knows some sort of fragmented giving of thanks. He thought in this way, hoping that, "At the place of giving thanks, many women come. Recognizing me, they will give me bowl-alms from then on."
Vị này cũng là người tham lợi, biết một phần tùy hỷ nào đó, ông ta nghĩ rằng: “Ở nơi tùy hỷ, có nhiều phụ nữ đến. Họ sẽ nhận ra ta và từ đó sẽ cúng dường vật thực trong bát cho ta.” Với ý muốn đó, ông ta suy nghĩ như vậy.
Ṭhānanti bahussutānaṃ anumodanā bhāro, tena bahussuto anumodeyyāti vuttaṃ hoti.
It is proper: the giving of thanks is the responsibility of the learned. Therefore, it is said, "the learned one should give thanks."
Ṭhāna có nghĩa là việc tùy hỷ là trách nhiệm của những người đa văn, vì vậy có nghĩa là người đa văn nên tùy hỷ.
Kupitoti ayampi tīsu ṭhānesu kuppati manussānaṃ therassa dhammakathikassa ca.
Being angry: he too becomes angry in three instances: with the laypeople, with the elder, and with the Dhamma-preacher.
Kupito (tức giận) có nghĩa là vị này cũng tức giận ở ba nơi: đối với con người, đối với Trưởng lão và đối với vị thuyết pháp.
Kathaṃ manussānaṃ?
How with the laypeople?
Thế nào là tức giận đối với con người?
‘‘Ime pubbe maṃyeva upasaṅkamitvā yācanti ‘amhākaṃ nāgatthero amhākaṃ sumanatthero anumodatū’ti, ajja pana nāvocu’’nti evaṃ manussānaṃ kuppati.
"Previously, these people would approach only me and request, 'May our Elder Nāga, our Elder Sumana, give the thanks.' But today they did not say it." In this way, he is angry with the laypeople.
“Trước đây, những người này thường đến thỉnh cầu ta: ‘Bạch Tôn giả, xin Trưởng lão Nāga, Trưởng lão Sumana của chúng con hãy tùy hỷ.’ Nhưng hôm nay họ lại không nói gì.” Ông ta tức giận với con người như vậy.
Kathaṃ therassa?
How with the elder?
Thế nào là tức giận đối với Trưởng lão?
‘‘Ayaṃ saṅghatthero ‘tumhākaṃ kulupakaṃ nāgattheraṃ sumanattheraṃ upasaṅkamatha, ayaṃ anumodissatī’ti na bhaṇatī’’ti evaṃ therassa kuppati.
"This Saṅgha elder does not say, 'Approach your family-attendant, Elder Nāga, Elder Sumana; he will give the thanks.'" In this way, he is angry with the elder.
“Vị Trưởng lão Tăng này không nói: ‘Các ông hãy đến gặp Trưởng lão Nāga, Trưởng lão Sumana, vị Tỳ-kheo thân cận của gia đình các ông, vị ấy sẽ tùy hỷ.’” Ông ta tức giận với Trưởng lão như vậy.
Kathaṃ dhammakathikassa?
How with the Dhamma-preacher?
Thế nào là tức giận đối với vị thuyết pháp?
‘‘Therena vuttamatteyeva pahāraṃ laddhakukkuṭo viya turitaturitaṃ vassati, imaṃ nāma nikkaḍḍhantā natthi, imasmiñhi asati ahameva anumodeyya’’nti evaṃ dhammakathikassa kuppati.
"As soon as the elder speaks, he preaches with great haste like a spurred cock. There is no one to expel this man. For if he were absent, I alone would give the thanks." In this way, he is angry with the Dhamma-preacher.
“Vừa được Trưởng lão nói, vị này đã vội vàng nói như con gà bị đánh, không có ai trục xuất vị này cả. Nếu không có vị này thì chính ta sẽ tùy hỷ.” Ông ta tức giận với vị thuyết pháp như vậy.
Ārāmagatānanti vihāre sannipatitānaṃ.
Of those who have gone to the monastery means of those assembled in the monastery.
Ārāmagatānaṃ có nghĩa là những vị Tỳ-kheo đã tập hợp tại tu viện.
Ayampi lābhatthiko yaṃ vā taṃ vā khaṇḍadhammakathaṃ jānāti, so passati tādisesu ṭhānesu dviyojanatiyojanato sannipatitvā bhikkhū sabbarattikāni dhammassavanāni suṇante, tuṭṭhacitte ca dahare vā sāmaṇere vā sādhu sādhūti mahāsaddena sādhukāraṃ dente, tato dutiyadivase antogāmagate bhikkhū upāsakā pucchanti ‘‘ke, bhante, dhammaṃ kathesu’’nti.
This gain-seeker also knows some sort of fragmented Dhamma-talk. He sees bhikkhus who have gathered from two or three yojanas away at such places, listening to all-night Dhamma-sermons. He sees pleased young bhikkhus or sāmaṇeras giving a great shout of "Sādhu! Sādhu!" Then, on the second day, lay devotees ask the bhikkhus who have gone into the village, "Venerable sirs, who preached the Dhamma?"
Vị này cũng là người tham lợi, biết một phần pháp thoại nào đó. Ông ta thấy các Tỳ-kheo tập hợp từ hai, ba dojana để nghe pháp suốt đêm, và các Tỳ-kheo trẻ hoặc Sa-di với tâm hoan hỷ lớn tiếng tán thán “Lành thay! Lành thay!” Sau đó, vào ngày thứ hai, các cư sĩ hỏi các Tỳ-kheo đi vào làng: “Bạch chư Tôn giả, ai đã thuyết pháp?”
Te bhaṇanti ‘‘asuko ca asuko cā’’ti.
They say, "So-and-so and so-and-so."
Các vị ấy nói: “Tôn giả này và Tôn giả kia.”
Taṃ sutvā pasannā manussā dhammakathikānaṃ mahāsakkāraṃ karonti.
Hearing that, the pleased laypeople make great offerings to the Dhamma-preachers.
Nghe vậy, những người có đức tin hoan hỷ và cúng dường lớn cho các vị thuyết pháp.
So taṃ icchamāno evaṃ cintesi.
Desiring that, he thought in this way.
Vì mong muốn điều đó, ông ta suy nghĩ như vậy.
Ṭhānanti bahussutānaṃ vinicchayakusalānaṃ dhammadesanā bhāro, tena bahussuto deseyyāti vuttaṃ hoti.
It is proper: preaching the Dhamma is the responsibility of the learned who are skilled in judgment. Therefore, it is said, "the learned one should preach."
Ṭhāna có nghĩa là việc thuyết pháp là trách nhiệm của những người đa văn, thiện xảo trong việc phân định pháp, vì vậy có nghĩa là người đa văn nên thuyết pháp.
Kupitoti catuppadikaṃ gāthampi vattuṃ okāsaṃ alabhamāno kupito hoti attano mandabhāvassa ‘‘ahañhi mando duppañño kuto labhissāmi desetu’’nti.
Being angry: not getting an opportunity to speak even a four-lined verse, he becomes angry due to his own dullness, thinking, "I am dull and witless, how could I get to preach?"
Kupito (tức giận) có nghĩa là ông ta tức giận vì không có cơ hội để nói dù chỉ một bài kệ bốn câu, tức giận vì sự yếu kém của mình: “Ta là người ngu dốt, kém trí tuệ, làm sao ta có thể thuyết pháp được?”
Bhikkhunīnanti ovādatthaṃ vā uddesatthaṃ vā paripucchatthaṃ vā pūjākaraṇatthaṃ vā ārāmaṃ āgantvā sannipatitabhikkhunīnaṃ.
Of the bhikkhunīs means of the bhikkhunīs who have come to the monastery and assembled for an exhortation, for recitation, for inquiry, or for making offerings.
Bhikkhunīnaṃ có nghĩa là các Tỳ-kheo-ni tập hợp tại tu viện để nhận lời khuyên, học kinh, hỏi han hoặc cúng dường.
Ayampi lābhatthiko, tassevaṃ hoti imā mahākulā pabbajitā bhikkhuniyo, tāsu kulesu pavisetvā nisinnāsu manussā pucchissanti ‘‘kassa santike ovādaṃ vā uddesaṃ vā paripucchaṃ vā gaṇhathā’’ti.
This one is also a gain-seeker. It occurs to him: "These bhikkhunīs have gone forth from great families. When they have entered their family homes and are seated, people will ask, 'From whom do you receive exhortation, recitation, or inquiry?'"
Vị này cũng là người tham lợi. Ông ta nghĩ: “Những Tỳ-kheo-ni này xuất gia từ các gia đình quyền quý. Khi họ vào các gia đình và ngồi xuống, mọi người sẽ hỏi: ‘Các vị nhận lời khuyên, học kinh, hay hỏi han từ ai?’”
Tato vakkhanti ‘‘asuko nāma ayyo bahussuto, tassa detha karothā’’ti, tenassa evaṃ icchā uppajjati.
"Then they will say, 'A certain venerable one is very learned. Give to him, honor him.' Thus, this desire arises in him."
Rồi họ sẽ nói: “Vị Tôn giả tên là… là người đa văn, hãy cúng dường và tôn kính vị ấy.” Vì thế, ông ta nảy sinh ý muốn như vậy.
Ṭhānanti ovādādayo nāma bahussutānaṃ bhāro, tena bahussuto deseyyāti vuttaṃ hoti.
It is proper: exhortation and so on are the responsibility of the learned. Therefore, it is said, "the learned one should preach."
Ṭhāna có nghĩa là việc khuyên dạy v.v. là trách nhiệm của những người đa văn, vì vậy có nghĩa là người đa văn nên thuyết pháp.
Kupitoti ayampi dvīsu ṭhānesu kuppati, tāsañca bhikkhunīnaṃ ‘‘imā pubbe maṃ nissāya uposathappavāraṇādīni labhanti, tā idāni taṃmuhuttaṃ diṭṭhamattakamahallakattherassa santikaṃ gatā’’ti.
Being angry: he too becomes angry in two instances: with those bhikkhunīs, thinking, "Previously, these women received the uposatha, pavāraṇā, and so on, relying on me. Now they have gone to an old elder whom they have just seen for a moment."
Kupito (tức giận) có nghĩa là vị này cũng tức giận ở hai nơi: đối với các Tỳ-kheo-ni, “Trước đây, những vị này nhờ ta mà được thọ giới Bố-tát, Pāvāraṇā v.v., bây giờ họ lại đến gặp vị Trưởng lão Tỳ-kheo già vừa mới gặp,”
Dhammakathikassa ca ‘‘esa imāsaṃ sahasā ovādaṃ adāsiyevā’’ti.
And with the Dhamma-preacher, thinking, "He gave them the exhortation so hastily."
và đối với vị thuyết pháp, “Vị này đã vội vàng khuyên dạy các Tỳ-kheo-ni này.”
Upāsakānanti, ārāmagatānaṃ upāsakānaṃ.
Of the male lay followers means, of the male lay followers who have come to the monastery.
Upāsakānaṃ có nghĩa là các cư sĩ đã đến tu viện.
Nissaṭṭhakammantā nāma mahāupāsakā honti, te puttabhātukānaṃ kammaṃ niyyātetvā dhammaṃ suṇantā vicaranti, ayaṃ tesaṃ desetuṃ icchati, kiṃ kāraṇā?
There are great male lay followers who have set aside their work. Having handed over their work to their sons and brothers, they wander about listening to the Dhamma. This one wishes to preach to them. For what reason?
Các đại cư sĩ là những người đã từ bỏ công việc, giao phó công việc cho con cái và anh em, rồi đi nghe pháp. Vị này muốn thuyết pháp cho họ. Vì lý do gì?
Ime pasīditvā upāsikānampi ārocessanti, tato saddhiṃ upāsikāhi mayhameva lābhasakkāraṃ upaharissantīti.
"If these men are pleased, they will tell the female lay followers too. Then, together with the female lay followers, they will bring me gains and honor."
“Những người này sẽ hoan hỷ và nói cho các nữ cư sĩ biết, rồi cùng với các nữ cư sĩ sẽ mang lợi lộc và sự tôn kính đến cho ta.”
Ṭhānaṃ bahussuteneva yojetabbaṃ.
"It is proper" should be connected with "the learned one."
Từ Ṭhāna nên được kết nối với người đa văn.
Kupitoti ayampi dvīsu ṭhānesu kuppati, upāsakānañca ‘‘ime aññattha suṇanti, amhākaṃ kulupakassa santike suṇāmāti nāgacchanti, hotu idāni, tesaṃ uppanne kicce jānissāmī’’ti dhammakathikassa ca, ‘‘ayametesaṃ desetī’’ti.
Being angry: he too becomes angry in two instances: with the male lay followers, thinking, "These men listen elsewhere. They do not come thinking, 'Let us listen at the feet of our family-attendant.' So be it. I will know what to do when their needs arise"; and with the Dhamma-preacher, thinking, "This one preaches to them."
Kupito (tức giận) có nghĩa là vị này cũng tức giận ở hai nơi: đối với các cư sĩ, “Những người này đi nghe pháp ở nơi khác, không đến chỗ vị Tỳ-kheo thân cận của gia đình ta để nghe. Thôi được, khi nào họ có việc, ta sẽ biết!” và đối với vị thuyết pháp, “Vị này thuyết pháp cho họ.”
Sakkareyyunti sakkaccañca kareyyuṃ, sundarañca kareyyuṃ.
Would respect means they would act with respect and they would act well.
Sakkareyyuṃ có nghĩa là họ nên làm một cách cung kính và làm một cách tốt đẹp.
Iminā attani kāraṃ karīyamānaṃ sakkaccaṃ katañca sundarañca pattheti.
By this, he wishes for the service done to himself to be done respectfully and well.
Với điều này, ông ta mong muốn mình được đối xử một cách cung kính, tốt đẹp.
Garuṃ kareyyunti bhāriyaṃ kareyyuṃ.
Would revere means they would treat him as weighty.
Garuṃ kareyyuṃ có nghĩa là họ nên tôn trọng.
Iminā bhikkhūhi attānaṃ garuṭṭhāne ṭhapīyamānaṃ pattheti.
By this, he wishes to be placed in a position of reverence by the bhikkhus.
Với điều này, ông ta mong muốn mình được các Tỳ-kheo đặt ở vị trí đáng tôn kính.
Māneyyunti piyāyeyyuṃ.
Would esteem means they would hold him dear.
Māneyyuṃ có nghĩa là họ nên yêu mến.
Pūjeyyunti evaṃ sakkarontā garuṃ karontā mānentā paccayehi pūjeyyunti paccayapūjaṃ pattheti.
Would honor means that while respecting, revering, and esteeming him, they would honor him with requisites. Thus he wishes for the honor of requisites.
Pūjeyyuṃ có nghĩa là khi tôn kính, tôn trọng, yêu mến như vậy, họ nên cúng dường bằng các vật dụng. Ông ta mong muốn sự cúng dường bằng vật dụng.
Ṭhānanti ‘‘piyo garu bhāvaniyo’’ti vuttappakāro bahussuto ca sīlavā ca etaṃ vidhiṃ arahati tena bhikkhū evarūpaṃ evaṃ kareyyunti vuttaṃ hoti.
It is proper: A learned and virtuous one of the type described as "dear, reverent, and to be developed" is worthy of this kind of treatment. Therefore, it is said that bhikkhus should act in this way towards such a person.
Ṭhāna có nghĩa là một người đa văn và giữ giới, được gọi là “được yêu mến, đáng tôn kính, đáng được phát triển,” xứng đáng với cách đối xử này. Vì vậy, có nghĩa là các Tỳ-kheo nên đối xử với người như vậy theo cách này.
Kupitoti ayampi dvīsu ṭhānesu kuppati bhikkhūnañca ‘‘ime etaṃ sakkarontī’’ti therassa ca ‘‘imasmiṃ asati maṃyeva sakkareyyu’’nti.
Being angry: he too becomes angry in two instances: with the bhikkhus, thinking, "These bhikkhus respect him"; and with the elder, thinking, "If he were not here, they would respect only me."
Kupito (tức giận) có nghĩa là vị này cũng tức giận ở hai nơi: đối với các Tỳ-kheo, “Những vị này tôn kính vị ấy,” và đối với Trưởng lão, “Nếu không có vị này, thì chính ta sẽ được tôn kính.”
Esa nayo ito paresu tīsu vāresu.
This is the method in the three cases that follow.
Cách giải thích này cũng áp dụng cho ba phần tiếp theo.
Paṇītānaṃ piṇḍapātānanti sappitelamadhusakkarādipūritānaṃ seṭṭhapiṇḍapātānaṃ.
Of fine almsfood means the best almsfood, filled with ghee, oil, honey, sugar, and so on.
Thức ăn khất thực cao cấp (Paṇītānaṃ piṇḍapātānaṃ) là những thức ăn khất thực thượng hạng, đầy đủ bơ sữa, dầu, mật, đường, v.v.
Paṇītānaṃ senāsanānanti anekasatasahassagghanakānaṃ mañcapīṭhādīnaṃ paṇītānaṃ.
Of fine lodgings means fine lodgings such as beds and chairs worth many hundreds of thousands.
Chỗ ở cao cấp (Paṇītānaṃ senāsanānaṃ) là những chỗ ở thượng hạng như giường, ghế, v.v., có giá trị hàng trăm ngàn (đồng tiền).
Gilānappaccayabhesajjaparikkhārānanti sappitelamadhuphāṇitādīnaṃ uttamabhesajjānaṃ.
Of requisites of medicinal support for the sick means the best medicines, such as ghee, oil, honey, molasses, and so on.
Dược phẩm và vật dụng cần thiết cho người bệnh (Gilānappaccayabhesajjaparikkhārānaṃ) là những loại thuốc tối thượng như bơ sữa, dầu, mật, đường phèn, v.v.
Sabbatthāpi ṭhānaṃ bahussutehi puññavantehi ca yojetabbaṃ.
In all cases, the instance should be connected with those who are learned and meritorious.
Ở tất cả các trường hợp, chỗ này nên được kết hợp với những vị đa văn và có phước báu.
Kupitoti sabbatthāpi dvīsu ṭhānesu kuppati, manussānañca ‘‘imesaṃ nāma paricitabhāvopi natthi, dīgharattaṃ ekato vasantassa paṃsukūlatthāya vā piṇḍapātatthāya vā sappitelādikāraṇā vā gharapaṭipāṭiyā carantassāpi me ekadivasampi kiñci paṇītaṃ paccayaṃ na denti.
He is angry: In all cases, he gets angry in two instances. Towards the laypeople: “These people have no sense of familiarity at all. Though I have lived together with them for a long time, and though I go about in order of houses for the sake of a rags-robe, or for almsfood, or for the purpose of getting ghee, oil, etc., they do not give me any fine requisite even for a single day.
Nổi giận (Kupito) – ở tất cả các trường hợp, vị ấy nổi giận ở hai điểm: đối với con người, (vị ấy nghĩ): “Những người này không có lòng quen biết gì cả, dù tôi đã sống chung với họ lâu ngày, đi khất thực theo thứ tự từng nhà vì y phấn tảo, vì thức ăn khất thực, vì bơ sữa, v.v., vậy mà họ chưa bao giờ dâng cho tôi bất cứ vật dụng cao cấp nào.
Āgantukaṃ mahallakaṃ pana disvāva yaṃ icchati, taṃ dentī’’ti, therassa ca ‘‘ayampi mahallako imesaṃ attānaṃ dassentoyeva carati, kudāssu nāma naṃ dhammakammikā nikkaḍḍheyyuṃ, evaṃ imasmiṃ asati ahameva lābhī assa’’nti.
But as soon as they see a visiting elder, they give whatever he wants.” And towards the elder: “This elder also goes about just showing himself off to these people. When will the Dhamma officials ever expel him? When he is gone, I alone will be the recipient.”
Nhưng khi thấy một vị trưởng lão khách, họ liền dâng cúng bất cứ thứ gì vị ấy muốn.” Và đối với vị trưởng lão, (vị ấy nghĩ): “Vị trưởng lão này cũng cứ đi khoe khoang bản thân mình với những người này, bao giờ thì các vị Tỳ-khưu làm pháp sự sẽ trục xuất ông ta đi? Nếu ông ta không còn ở đây, thì chính tôi sẽ là người được lợi lộc.”
61. Dissanti ceva sūyanti cāti na icchāvacarā cakkhunā dissanti, na sotena sūyanti, manoviññāṇavisayattā.
61. Are seen and are heard: The domains of desire are not seen with the eye, nor are they heard with the ear, because they are the domain of mind-consciousness.
61. Được thấy và được nghe (Dissanti ceva sūyanti cā) – những ước muốn không thể được thấy bằng mắt hay được nghe bằng tai, vì chúng là đối tượng của ý thức.
Appahīnaicchāvacarassa pana puggalassa icchāvacaravasena pavattakāyakammaṃ disvā diṭṭhā viya vacīkammaṃ sutvā sutā viya ca honti, tena vuttaṃ ‘‘dissanti ceva sūyanti cā’’ti.
But for a person whose domains of desire are unabandoned, upon seeing the bodily action that occurs due to the domains of desire, they are as if seen; and upon hearing the verbal action, they are as if heard. Therefore it is said, “are seen and are heard.”
Tuy nhiên, khi thấy hành động thân thể của một người chưa đoạn trừ ước muốn, hoặc nghe lời nói của người đó, thì những ước muốn đó được xem như đã được thấy hoặc được nghe. Vì vậy, đã nói rằng: “được thấy và được nghe”.
Paccakkhakāle dissanti, ‘‘asuko kira bhikkhu īdiso’’ti tirokkhakāle sūyanti.
In the present they are seen; in the case of what is out of sight, they are heard, as in “It is said that a certain bhikkhu is of such a nature.”
Chúng được thấy trong hiện tại, và được nghe trong quá khứ, như: “Vị Tỳ-khưu đó hình như là người như vậy.”
Kiñcāpīti anuggahagarahavacanaṃ.
Although: this is a word of approval and censure.
Mặc dù (Kiñcāpi) là một từ vừa mang ý nghĩa tán thán vừa mang ý nghĩa quở trách.
Tena āraññikattaṃ anuggaṇhāti, icchāvacarānaṃ appahānaṃ garahati.
By it, he approves of the state of being a forest-dweller; he censures the non-abandonment of the domains of desire.
Do đó, nó tán thán việc sống ở rừng, và quở trách việc chưa đoạn trừ các ước muốn.
Tatrāyaṃ yojanā, kiñcāpi so bhikkhu gāmantasenāsanaṃ paṭikkhipitvā āraññiko hoti, ante pantasenāsane vasati, ime cassa ettakā icchāvacarā appahīnā.
Herein, this is the connection: although that bhikkhu, having rejected a lodging near a village, becomes a forest-dweller and lives in a remote lodging at the border, yet these many domains of desire of his are unabandoned.
Ở đây, sự kết hợp là: mặc dù vị Tỳ-khưu đó từ bỏ chỗ ở gần làng và sống ở rừng, cư trú ở chỗ ở xa xôi hẻo lánh, nhưng những ước muốn này của vị ấy vẫn chưa được đoạn trừ.
Kiñcāpi so atirekalābhaṃ paṭikkhipitvā piṇḍapātiko hoti.
Although, having rejected extra gains, he becomes an alms-goer.
Mặc dù vị ấy từ bỏ lợi lộc dư thừa và sống bằng thức ăn khất thực.
Kiñcāpi so loluppacāraṃ vajjetvā sapadānacārī hoti.
Although, having avoided greedy behavior, he becomes one who goes on an uninterrupted alms-round.
Mặc dù vị ấy tránh cách đi khất thực tham lam và đi khất thực theo thứ tự từng nhà.
Kiñcāpi so gahapaticīvaraṃ paṭikkhipitvā paṃsukūliko hoti.
Although, having rejected a robe from a householder, he becomes a wearer of rags-robes.
Mặc dù vị ấy từ bỏ y phục của gia chủ và sống bằng y phấn tảo.
Lūkhacīvaradharoti ettha pana lūkhanti satthalūkhaṃ suttalūkhaṃ rajanalūkhanti tīhi kāraṇehi lūkhaṃ veditabbaṃ.
A wearer of coarse robes: Here, however, coarse should be understood as coarse for three reasons: coarse by the knife, coarse by the thread, and coarse by the dye.
Trong cụm từ mặc y thô xấu (Lūkhacīvaradharo), từ thô xấu (lūkhaṃ) nên được hiểu là thô xấu do cắt, thô xấu do chỉ, và thô xấu do nhuộm, là ba nguyên nhân.
Tattha satthena khaṇḍākhaṇḍikaṃ chinnaṃ satthalūkhaṃ nāma, taṃ agghena parihāyati, thūladīghasuttakena sibbitaṃ suttalūkhaṃ nāma, taṃ phassena parihāyati kharasamphassaṃ hoti.
Therein, what is cut into pieces with a knife is called coarse by the knife; it is diminished in value. What is sewn with thick, long thread is called coarse by the thread; it is diminished in touch, having a rough texture.
Trong đó, y phục bị cắt thành từng mảnh nhỏ bằng dao thì gọi là thô xấu do cắt (satthalūkhaṃ), nó bị giảm giá trị; y phục được may bằng chỉ thô dài thì gọi là thô xấu do chỉ (suttalūkhaṃ), nó bị giảm giá trị về cảm giác, trở nên thô ráp khi chạm vào.
Rajanena rattaṃ rajanalūkhaṃ nāma, taṃ vaṇṇena parihāyati dubbaṇṇaṃ hoti.
What is colored with dye is called coarse by the dye; it is diminished in color, having a poor appearance.
Y phục được nhuộm bằng thuốc nhuộm thì gọi là thô xấu do nhuộm (rajanalūkhaṃ), nó bị giảm giá trị về màu sắc, trở nên xấu màu.
Kiñcāpi so bhikkhu evaṃ satthalūkhasuttalūkharajanalūkhacīvaradharo hoti, ime cassa ettakā icchāvacarā appahīnā dissanti ceva sūyanti ca, atha kho naṃ viññū sabrahmacārī neva sakkaronti…pe… na pūjentīti.
Although that bhikkhu is a wearer of a robe that is thus coarse by the knife, coarse by the thread, and coarse by the dye, yet these many domains of desire of his are unabandoned, are seen and are heard. Then the wise fellow monastics neither honor him… and so on… nor do they venerate him.
Mặc dù vị Tỳ-khưu đó mặc y phục thô xấu do cắt, thô xấu do chỉ, thô xấu do nhuộm như vậy, nhưng những ước muốn này của vị ấy vẫn chưa được đoạn trừ, được thấy và được nghe, thì những vị đồng phạm hạnh có trí tuệ không kính trọng… (v.v.)… không cúng dường vị ấy.
Taṃ kissa hetūti ettha tanti nipātamattaṃ, kissa hetūti kiṃ kāraṇā.
For what reason?: Here taṃ is just a particle; kissa hetu means for what reason.
Trong cụm từ Tại sao vậy (Taṃ kissa hetū), từ taṃ chỉ là một giới từ, kissa hetū có nghĩa là “vì lý do gì”.
Te hi tassa…pe… sūyanti ca yasmā tassa te pāpakā sūyanti cāti vuttaṃ hoti.
For his… and so on… are heard: it means, because those evil things of his are heard.
Vì đã nói rằng “ Vì những điều xấu ác đó của vị ấy… (v.v.)… được nghe (Te hi tassa…pe… sūyanti ca)”.
Imesaṃ icchāvacarānaṃ appahīnattāti ayamettha adhippāyo.
“Because these domains of desire are unabandoned”—this is the intention here.
Ý nghĩa ở đây là do những ước muốn này chưa được đoạn trừ.
Idāni tamatthaṃ upamāya pākaṭaṃ karonto seyyathāpītiādimāha.
Now, making that meaning clear with a simile, he said Just as, and so on.
Bây giờ, để làm rõ ý nghĩa đó bằng ví dụ, Đức Phật đã nói: Ví như (seyyathāpi) và tiếp theo.
Tattha kuṇapanti matakaḷevaraṃ.
Therein, carcass means a dead body.
Trong đó, xác chết (kuṇapaṃ) là thi thể đã chết.
Ahissa kuṇapaṃ ahikuṇapaṃ.
The carcass of a snake is a snake-carcass.
Xác chết của rắn là xác rắn (ahissa kuṇapaṃ ahikuṇapaṃ).
Evaṃ itarāni.
Likewise for the others.
Tương tự với những cái khác.
Atipaṭikūlajigucchanīyabhāvato cettha imāneva tīṇi vuttānīti veditabbāni.
And it should be understood that these three are mentioned here because of their extremely repulsive and disgusting nature.
Ở đây, nên hiểu rằng chỉ ba loại này được nói đến vì chúng cực kỳ ghê tởm và đáng kinh tởm.
Aññesañhi sasasūkarādīnaṃ kuṇapaṃ manussā kaṭukabhaṇḍādīhi abhisaṅkharitvā paribhuñjantipi.
For people may prepare with spices and so on the carcasses of other animals, such as rabbits and pigs, and even eat them.
Vì xác chết của các loài khác như thỏ, heo, v.v., con người có thể chế biến bằng các loại gia vị và ăn.
Imesaṃ pana kuṇapaṃ abhinavampi jigucchantiyeva, ko pana vādo kālātikkamena pūtibhūte.
But the carcasses of these are disgusting even when fresh; what then needs to be said when they have become putrid over time?
Nhưng xác chết của những loài này (rắn, chó, người) dù mới cũng đã đáng ghê tởm rồi, huống chi là khi đã thối rữa sau một thời gian dài.
Racayitvāti vaḍḍhetvā, paripūretvāti attho, kuṇapaṃ gahetvā kaṃsapātiyaṃ pakkhipitvāti vuttaṃ hoti.
Having arranged: means having increased, having filled up; it means, having taken a carcass and put it in a bronze bowl.
Đặt vào (Racayitvā) nghĩa là chất chồng lên, làm cho đầy. Tức là, lấy xác chết và đặt vào trong bát đồng.
Aññissāti aparāya.
With another: with another one.
Một cái khác (Aññissā) là một cái khác.
Paṭikujjitvāti pidahitvā.
Having covered: having closed.
Đậy lại (Paṭikujjitvā) là che đậy.
Antarāpaṇanti āpaṇānamantare mahājanasaṃkiṇṇaṃ racchāmukhaṃ.
In the middle of the market: at the entrance of a street crowded with many people, between the market stalls.
Giữa chợ (Antarāpaṇaṃ) là con đường đông đúc giữa các cửa hàng, nơi có nhiều người qua lại.
Paṭipajjeyyunti gaccheyyuṃ.
They would proceed: they would go.
Đi qua (Paṭipajjeyyuṃ) nghĩa là đi.
Jaññajaññaṃ viyāti cokkhacokkhaṃ viya manāpamanāpaṃ viya.
Like a worthy gift: like a very pure thing, like a very pleasing thing.
Như một thứ đáng giá (Jaññajaññaṃ viyā) nghĩa là như một thứ rất sạch sẽ, như một thứ rất dễ chịu.
Apica vadhukāpaṇṇākāraṃ viyāti vuttaṃ hoti.
Moreover, it means like a gift for a bride.
Hoặc, có nghĩa là như một món quà cưới.
Vadhukāti janetti vuccati, tassā nīyamānaṃ paṇṇākāraṃ jaññaṃ, ubhayatthāpi ādaravasena vā pasaṃsāvasena vā punaruttaṃ.
Vadhukā refers to a mother; a gift being brought to her is jañña. In both cases, the repetition is for the sake of respect or praise.
Vadhukā được gọi là cô dâu, món quà được mang đến cho cô dâu là jaññaṃ. Ở cả hai trường hợp, sự lặp lại là do sự kính trọng hoặc sự tán thán.
‘‘Jaññajaññaṃ byā’’tipi pāṭho.
There is also the reading “jaññajaññaṃ byā.”
Cũng có bản đọc là “Jaññajaññaṃ byā”.
Apāpuritvāti vivaritvā.
Having uncovered: having opened.
Mở ra (Apāpuritvā) là mở.
Tassa saha dassanena amanāpatā ca saṇṭhaheyyāti tassa kuṇapassa dassanena saheva tassa janassa amanāpatā tiṭṭheyya.
And upon seeing it, unpleasantness would arise: with the very sight of that carcass, unpleasantness would arise for that person.
Sự không hài lòng sẽ xuất hiện ngay khi nhìn thấy (Tassa saha dassanena amanāpatā ca saṇṭhaheyyā) nghĩa là ngay khi nhìn thấy xác chết đó, sự không hài lòng của người đó sẽ xuất hiện.
Amanāpatāti ca ‘‘amanāpamida’’nti uppannacittacetasikānametaṃ adhivacanaṃ.
And unpleasantness is a term for the mental states that have arisen, thinking “this is unpleasant.”
Sự không hài lòng (Amanāpatā) là từ dùng để chỉ các tâm và tâm sở phát sinh với ý nghĩ “Điều này thật không dễ chịu”.
Esa nayo paṭikulyajegucchatāsu.
This is the same method for repulsiveness and disgust.
Nguyên tắc này cũng áp dụng cho sự ghê tởm và kinh tởm (paṭikulyajegucchatāsu).
Jighacchitānampīti chātānampi.
Even for the hungry: even for those who are famished.
Ngay cả những người đói (Jighacchitānampi) là những người đói khát.
Na bhottukamyatā assāti bhuñjitukāmatā na bhaveyya.
There would be no desire to eat: there would be no wish to eat.
Không có ý muốn ăn (Na bhottukamyatā assā) nghĩa là không có ý muốn ăn.
Pageva suhitānanti dhātānaṃ pana paṭhamatarameva bhuñjitukāmatā na bhaveyyāti vuttaṃ hoti.
Let alone for the satiated: it means that for those who are full, there would be no desire to eat from the very beginning.
Huống chi những người đã no bụng (Pageva suhitānaṃ) nghĩa là huống chi những người đã no bụng thì càng không có ý muốn ăn.
62. Sukkapakkhe pana, kiñcāpīti anuggahapasaṃsāvacanaṃ, tena āraññikattaṃ anuggaṇhāti, icchāvacarappahānaṃ pasaṃsati.
62. In the bright section, however, although is a word of approval and praise; by it, he approves of the state of being a forest-dweller and praises the abandonment of the domains of desire.
62. Trong trường hợp bên thiện, mặc dù (kiñcāpi) là một từ tán thán và khen ngợi. Nó tán thán việc sống ở rừng và khen ngợi việc đoạn trừ các ước muốn.
Nemantanikoti nimantanapaṭiggāhako.
One who accepts invitations: a recipient of an invitation.
Người được mời (Nemantaniko) là người chấp nhận lời mời.
Vicitakāḷakanti vicinitvā apanītakāḷakaṃ.
With the dark grains picked out: from which the dark grains have been selected and removed.
Đã chọn lọc và loại bỏ những hạt đen (Vicitakāḷakaṃ) là đã chọn lọc và loại bỏ những hạt gạo đen.
Anekasūpaṃ anekabyañjananti ettha sūpo nāma hatthahāriyo vuccati.
With many soups and many curries: here, soup refers to what is served by hand.
Trong cụm từ nhiều món canh, nhiều món ăn kèm (anekasūpaṃ anekabyañjanaṃ), sūpa được gọi là món canh có thể dùng tay bốc ăn.
Byañjananti uttaribhaṅgaṃ, tena macchamaṃsamuggasūpādīhi anekasūpaṃ, nānappakāramaṃsādibyañjanehi anekabyañjananti vuttaṃ hoti.
Curry means an accompaniment. By this it is said: with many soups, such as fish, meat, and bean soup; and with many curries, with various kinds of meat and other curries.
Byañjana là món ăn kèm thêm. Do đó, đã nói rằng “nhiều món canh” với các loại canh cá, thịt, đậu xanh, v.v., và “nhiều món ăn kèm” với các loại thịt, v.v.
Sesaṃ vuttanayeneva veditabbaṃ.
The rest should be understood in the way already stated.
Phần còn lại nên được hiểu theo cách đã nói.
63. Upamā maṃ, āvuso sāriputta, paṭibhātīti mayhaṃ, āvuso sāriputta, upamā upaṭṭhāti.
63. A simile occurs to me, friend Sāriputta means: friend Sāriputta, a simile appears to me.
63. Này Hiền giả Sāriputta, một ví dụ đã khởi lên trong tôi có nghĩa là, này Hiền giả Sāriputta, một ví dụ đã hiện ra trong tôi.
Ekaṃ upamaṃ vattukāmo ahanti adhippāyo.
The intention is: I wish to state one simile.
Ý nghĩa là: Tôi muốn nói một ví dụ.
Paṭibhātu tanti tuyhaṃ paṭibhātu upaṭṭhātu, vada tvanti adhippāyo.
Let it occur to you means: let it occur to you, let it appear to you, you may speak. That is the intention.
Mong rằng nó khởi lên trong Hiền giả có nghĩa là, mong rằng nó khởi lên trong Hiền giả, mong rằng nó hiện ra, Hiền giả hãy nói đi. Đó là ý nghĩa.
Ekamidāhanti ettha idāti nipātamattaṃ, ekasmiṃ samaye ahanti vuttaṃ hoti, bhummatthe upayogavacanaṃ.
Here, in ekamidāhaṃ, idā is just a particle; it means "at one time, I." It is an accusative case in the sense of the locative case.
Trong cụm từ Ekamidāhaṃ, từ idā chỉ là một giới từ (nipāta). Nó có nghĩa là: Một thời gian nọ, tôi. Đây là cách dùng từ ở vị trí sở thuộc (bhummattha).
Rājagahe viharāmi giribbajeti, rājagahanti tassa nagarassa nāmaṃ.
I was dwelling in Rājagaha, in Giribbaja: Rājagaha is the name of that city.
Tôi đang sống ở Rājagaha, tại Giribbaja. Rājagaha là tên của thành phố đó.
Samantato pana giriparikkhepena vajo viya saṇṭhitattā giribbajanti vuccati.
But because it is situated like an enclosure, being surrounded by mountains on all sides, it is called Giribbaja.
Vì nó được bao quanh bởi núi non như một chuồng gia súc, nên nó được gọi là Giribbaja.
Tasmiṃ nagare viharāmi, taṃ nissāya ahaṃ viharāmīti vuttaṃ hoti.
I was dwelling in that city; it means, I was dwelling dependent on it.
Nó có nghĩa là: Tôi đang sống trong thành phố đó, tôi đang sống nương tựa vào thành phố đó.
Atha khvāhanti atha kho ahaṃ.
Then I means: then I.
Atha khvāhaṃ là atha kho ahaṃ.
Ettha ca athāti aññādhikāravacanārambhe nipāto.
And here, atha is a particle at the beginning of a statement on a different topic.
Ở đây, athā là một giới từ dùng để bắt đầu một chủ đề khác.
Khoti padapūraṇamatte.
Kho is merely a filler word.
Kho chỉ là một từ đệm (padapūraṇa).
Pubbaṇhasamayanti divasassa pubbabhāgasamayaṃ.
In the forenoon means: at the time of the first part of the day.
Pubbaṇhasamayaṃ có nghĩa là thời gian buổi sáng của một ngày.
Pubbaṇhasamayeti attho, pubbaṇhe vā samayaṃ pubbaṇhasamayaṃ, pubbaṇhe ekaṃ khaṇanti vuttaṃ hoti, evaṃ accantasaṃyoge upayogavacanaṃ labbhati.
The meaning is "in the forenoon"; or, the time in the forenoon is pubbaṇhasamayaṃ; it means "for a moment in the forenoon." In this way, the accusative case is used in the sense of continuous connection.
Nó có nghĩa là: vào buổi sáng. Hoặc, buổi sáng là thời điểm buổi sáng, tức là một khoảnh khắc vào buổi sáng. Đây là cách dùng từ trong trường hợp liên hệ tuyệt đối (accantasaṃyoga).
Nivāsetvāti paridahitvā, vihāranivāsanaparivattanavasenetaṃ veditabbaṃ.
Having dressed means: having put on. This should be understood in the sense of changing the robe worn in the monastery.
Nivāsetvā có nghĩa là mặc y vào. Điều này nên được hiểu theo cách mặc y thay đổi khi ở trong tu viện.
Gāmappavesanatthāya vā saṇṭhapetvā nivāsanavasena, na hi so tato pubbe anivattho ahosi.
Or, in the sense of dressing after arranging it for entering the village, for he was not undressed before that.
Hoặc là mặc y đã chỉnh tề để vào làng, vì trước đó Tôn giả không phải là người không mặc y.
Pattacīvaramādāyāti pattaṃ hatthena cīvaraṃ kāyena ādiyitvā.
Taking my bowl and robe means: taking the bowl with the hand and the robe on the body.
Pattacīvaramādāya có nghĩa là cầm bát bằng tay và y trên người.
Piṇḍāyāti piṇḍapātatthāya.
For alms means: for the sake of alms-food.
Piṇḍāya có nghĩa là để khất thực.
Samītīti tassa nāmaṃ.
Samīti is his name.
Samītī là tên của vị đó.
Yānakāraputtoti rathakāraputto.
The cartwright's son means: the chariot-maker's son.
Yānakāraputto là con trai của người thợ xe.
Paṇḍuputtoti paṇḍussa putto.
Paṇḍu's son means: the son of Paṇḍu.
Paṇḍuputto là con trai của Paṇḍu.
Ājīvakoti naggasamaṇako.
An Ājīvaka means: a naked ascetic.
Ājīvako là một nhà khổ hạnh khỏa thân.
Purāṇayānakāraputtoti porāṇayānakārakulassa putto.
A former cartwright's son means: the son of a family of former cartwrights.
Purāṇayānakāraputto là con trai của một gia đình thợ xe lâu đời.
Paccupaṭṭhitoti upagantvā ṭhito.
Was standing by means: having approached, he was standing.
Paccupaṭṭhito có nghĩa là đến gần và đứng đó.
Vaṅkaṃ nāma ekato kuṭilaṃ.
Vaṅka means crooked in one part.
Vaṅkaṃ có nghĩa là cong một bên.
Jimhaṃ nāma sappagatamaggasadisaṃ.
Jimha means crooked like the track of a snake.
Jimhaṃ có nghĩa là cong như đường đi của rắn.
Dosanti phegguvisamagaṇṭhikādi.
A flaw means: sapwood, unevenness, knots, etc.
Dosaṃ có nghĩa là những khuyết điểm như lõi gỗ, chỗ gồ ghề, v.v.
Yathā yathāti kālatthe nipāto, yadā yadā yasmiṃ tasmiṃ kāleti vuttaṃ hoti.
Just as is a particle in the sense of time; it means "whenever, at whatever time."
Yathā yathā là một giới từ chỉ thời gian, có nghĩa là: bất cứ khi nào, vào thời điểm đó.
Tathā tathāti ayampi kālatthoyeva, tasmiṃ tasmiṃ kāleti vuttaṃ hoti.
So is also in the sense of time; it means "at that very time."
Tathā tathā cũng là giới từ chỉ thời gian, có nghĩa là: vào thời điểm đó.
So attano suttānulomena cintesi, itaro tena cintitakkhaṇe cintitaṭṭhānameva tacchati.
He thought according to his line, and the other planed the very spot he thought of at the moment he thought it.
Vị ấy suy nghĩ theo sợi dây của mình, còn vị kia thì đẽo đúng vào chỗ mà vị ấy vừa suy nghĩ.
Attamanoti sakamano tuṭṭhamano pītisomanassehi gahitamano.
Glad means: with his own mind, with a delighted mind, with a mind seized by joy and gladness.
Attamano có nghĩa là tâm hoan hỷ, tâm vui sướng, tâm được bao trùm bởi hỷ và lạc.
Attamanavācaṃ nicchāresīti attamanatāya vācaṃ, attamanabhāvassa vā yuttaṃ vācaṃ nicchāresi udīrayi, pabyāharīti vuttaṃ hoti.
He uttered a glad utterance means: he uttered a speech out of gladness, or a speech suitable for a state of gladness; it means he uttered, he pronounced.
Attamanavācaṃ nicchāresī có nghĩa là nói lời hoan hỷ, hoặc nói lời phù hợp với trạng thái hoan hỷ, tức là phát ra, thốt ra lời nói.
Hadayā hadayaṃ maññe aññāyāti cittena cittaṃ jānitvā viya.
As if knowing heart with heart, I think means: as if knowing my mind with your mind.
Hadayā hadayaṃ maññe aññāyā có nghĩa là như thể biết tâm của người khác bằng tâm của mình.
Assaddhāti buddhadhammasaṅghesu saddhāvirahitā.
Without faith means: lacking faith in the Buddha, Dhamma, and Saṅgha.
Assaddhā có nghĩa là không có niềm tin vào Phật, Pháp, Tăng.
Jīvikatthāti iṇabhayādīhi pīḷitā bahi jīvituṃ asakkontā idha jīvikatthikā hutvā.
For the sake of a livelihood means: being afflicted by the fear of debt and so on, unable to make a living outside, they have become seekers of a livelihood here.
Jīvikatthā có nghĩa là bị áp bức bởi nỗi sợ hãi nợ nần, v.v., không thể sống bên ngoài, nên tìm kế sinh nhai ở đây.
Na saddhāti na saddhāya.
Not out of faith means: not because of faith.
Na saddhā có nghĩa là không có niềm tin.
Saṭhā māyāvinoti māyāsāṭheyyehi yuttā.
Deceitful and cunning means: possessed of cunning and deceit.
Saṭhā māyāvino có nghĩa là những người đầy xảo quyệt và lừa dối.
Ketabinoti sikkhitakerāṭikā, nipphannathāmagatasāṭheyyāti vuttaṃ hoti.
Treacherous means: trained in trickery; it means having attained the full strength of deceit.
Ketabino có nghĩa là những kẻ xảo trá đã được huấn luyện, tức là những kẻ lừa dối đạt đến mức độ hoàn hảo.
Sāṭheyyañhi abhūtaguṇadassanato abhūtabhaṇḍaguṇadassanasamaṃ katvā ‘‘kerāṭiya’’nti vuccati.
For deceit, because it shows non-existent qualities, is called kerāṭiya, making it equivalent to showing non-existent qualities in goods.
Sự xảo trá được gọi là "kerāṭiya" vì nó giống như việc trình bày những phẩm chất không có của hàng hóa, do việc trình bày những phẩm chất không có.
Unnaḷāti uggatanaḷā, uṭṭhitatucchamānāti vuttaṃ hoti.
Arrogant means: with pride arisen; it means with empty conceit arisen.
Unnaḷā có nghĩa là những người có ngọn giáo vươn cao, tức là những người có lòng kiêu căng rỗng tuếch nổi lên.
Capalāti pattacīvaramaṇḍanādinā cāpallena yuttā.
Fickle means: possessed of fickleness through adorning the bowl and robe, and so on.
Capalā có nghĩa là những người có sự hấp tấp trong việc trang trí bát và y, v.v.
Mukharāti mukhakharā, kharavacanāti vuttaṃ hoti, vikiṇṇavācāti asaṃyatavacanā, divasampi niratthakavacanappalāpino.
Harsh-mouthed means: with a harsh mouth; it means having harsh speech. Of scattered speech means having unrestrained speech, prattling meaningless words even for a whole day.
Mukharā có nghĩa là những người có lời nói thô lỗ, tức là những người có lời nói gay gắt; vikiṇṇavācā có nghĩa là những người có lời nói không kiểm soát, những người nói những lời vô ích suốt cả ngày.
Indriyesu aguttadvārāti chasu indriyesu asaṃvutakammadvārā.
With faculties unguarded means: with the doors of action unrestrained regarding the six faculties.
Indriyesu aguttadvārā có nghĩa là những người có cửa nghiệp không được phòng hộ ở sáu căn.
Bhojane amattaññunoti bhojane yā mattā jānitabbā pariyesanapaṭiggahaṇaparibhogesu yuttatā, tassā ajānanakā.
Not knowing the measure in food means: not knowing the measure that should be known in food, that is, the appropriateness in seeking, accepting, and consuming.
Bhojane amattaññuno có nghĩa là những người không biết về mức độ cần thiết trong việc ăn uống, tức là sự phù hợp trong việc tìm kiếm, tiếp nhận và tiêu thụ vật thực.
Jāgariyaṃ ananuyuttāti jāgare ananuyuttā.
Not devoted to wakefulness means: not devoted to vigilance.
Jāgariyaṃ ananuyuttā có nghĩa là những người không chuyên tâm vào sự tỉnh thức.
Sāmaññe anapekkhavantoti samaṇadhamme nirapekkhā, dhammānudhammappaṭipattirahitāti attho.
Not concerned with the ascetic life means: having no regard for the duties of a recluse; the meaning is, lacking the practice of what is in accordance with the Dhamma.
Sāmaññe anapekkhavanto có nghĩa là những người không quan tâm đến pháp của Sa-môn, tức là những người không thực hành Dhamma-anudhamma.
Sikkhāya na tibbagāravāti sikkhāpadesu bahulagāravā na honti, āpattivītikkamabahulā vā.
Not having deep respect for the training means: not having much respect for the training precepts, or being full of transgressions of offenses.
Sikkhāya na tibbagāravā có nghĩa là những người không có sự tôn kính sâu sắc đối với các giới luật, hoặc những người thường xuyên vi phạm giới luật.
Bāhulikātiādi dhammadāyāde vuttaṃ, kusītātiādi bhayabherave.
Indulgent and so on is stated in the Dhammadāyāda Sutta; lazy and so on is in the Bhayabherava Sutta.
Bāhulikā v.v. đã được nói trong Dhammadāyāda, kusītā v.v. đã được nói trong Bhayabherava.
Dhammapariyāyenāti dhammadesanāya.
By this discourse on the Dhamma means: by this sermon on the Dhamma.
Dhammapariyāyenā có nghĩa là bằng bài thuyết pháp.
Saddhā agārasmāti pakatiyāpi saddhā, pabbajitāpi saddhāya agārasmā anagāriyaṃ pabbajitā.
Go forth from the home life out of faith means: being faithful by nature, they also went forth from the home life into homelessness out of faith.
Saddhā agārasmā có nghĩa là những người có đức tin tự nhiên, và những người đã xuất gia cũng là những người đã xuất gia từ gia đình để sống không gia đình bằng đức tin.
Pivanti maññe ghasanti maññeti pivanti viya ghasanti viya.
Drink it, I think, and consume it, I think means: as if they drink, as if they consume.
Pivanti maññe ghasanti maññe có nghĩa là như thể uống, như thể ăn.
Attamanavācaṃ nicchārentā vacasā pivanti viya, abbhanumodantā manasā ghasanti viya.
Those uttering a glad utterance seem to drink with their words; those rejoicing seem to consume with their minds.
Những người nói lời hoan hỷ thì như thể uống bằng lời nói, những người hoan hỷ tột độ thì như thể ăn bằng tâm ý.
Sādhu vatāti sundaraṃ vata.
It is good, indeed means: it is excellent, indeed.
Sādhu vatā có nghĩa là thật tốt lành thay.
Sabrahmacārīti rassampi vaṭṭati dīghampi.
Fellow Dhamma-farer: both the short and long forms are correct.
Sabrahmacārī có thể là âm ngắn hoặc âm dài.
Rasse sati sāriputtassa upari hoti, dīghe sati sabrahmacārīnaṃ.
With the short form, it refers to Sāriputta; with the long form, it refers to the fellow Dhamma-farers.
Khi là âm ngắn, nó chỉ về Sāriputta; khi là âm dài, nó chỉ về các đồng phạm hạnh.
Yadā sāriputtassa upari hoti, tadā sabrahmacārī sāriputto amhe akusalā vuṭṭhāpetvāti attho.
When it refers to Sāriputta, the meaning is: the fellow Dhamma-farer Sāriputta raises us from what is unwholesome.
Khi nó chỉ về Sāriputta, thì ý nghĩa là: Tôn giả Sāriputta, người đồng phạm hạnh, đã đưa chúng tôi thoát khỏi những điều bất thiện.
Yadā sabrahmacārīnaṃ, tadā sabrahmacārayo akusalā vuṭṭhāpetvāti attho.
When it refers to the fellow Dhamma-farers, the meaning is: he raises the fellow Dhamma-farers from what is unwholesome.
Khi nó chỉ về các đồng phạm hạnh, thì ý nghĩa là: các đồng phạm hạnh đã đưa chúng tôi thoát khỏi những điều bất thiện.
Daharoti taruṇo.
Young means: a youth.
Daharo có nghĩa là trẻ tuổi.
Yuvāti yobbanabhāve ṭhito.
A young man means: one in a state of youthfulness.
Yuvā có nghĩa là người đang ở trong tuổi thanh xuân.
Maṇḍanakajātikoti alaṅkārakasabhāvo.
Given to adornment means: having a nature inclined to adornment.
Maṇḍanakajātiko có nghĩa là người có thói quen trang sức.
Tattha koci taruṇopi yuvā na hoti yathā atitaruṇo, koci yuvāpi maṇḍanakajātiko na hoti yathā upasantasabhāvo, ālasiyabyasanādīhi vā abhibhūto, idha pana daharo ceva yuvā ca maṇḍanakajātiko ca adhippeto, tasmā evamāha.
Therein, someone may be a youth but not a young man, such as a very young boy. Someone may be a young man but not given to adornment, such as one with a calm nature, or one overcome by laziness, misfortune, and so on. But here, one who is young, a young man, and given to adornment is intended. Therefore, he said thus.
Trong số đó, có người trẻ tuổi nhưng không phải là thanh niên, như người quá trẻ; có người thanh niên nhưng không có thói quen trang sức, như người có bản tính trầm tĩnh, hoặc bị lười biếng, thói hư tật xấu, v.v. Ở đây, ý muốn nói là người vừa trẻ tuổi, vừa thanh niên, vừa có thói quen trang sức. Vì vậy, Đức Phật đã nói như vậy.
Uppalādīni lokasammatattā vuttāni.
Blue water lilies and so on are mentioned because they are esteemed by the world.
Các loài Uppalā v.v. được nói đến vì chúng được thế gian chấp nhận.
Itiha teti evaṃ te.
Thus these means: in this way, these.
Itiha te có nghĩa là như vậy.
Ubho mahānāgāti dvepi mahānāgā, dvepi hi ete aggasāvakā ‘‘mahānāgā’’ti vuccanti.
Both great nāgas means: both of these two great nāgas. For both of these chief disciples are called "great nāgas."
Ubho mahānāgā có nghĩa là cả hai vị đại long tượng. Cả hai vị Đại đệ tử này đều được gọi là "mahānāgā".
Tatrāyaṃ vacanattho, chandādīhi na gacchantīti nāgā, tena tena maggena pahīne kilese na āgacchantīti nāgā, nānappakārakaṃ āguṃ na karontīti nāgā, ayamettha saṅkhepo.
Herein, this is the meaning of the word: because they do not go by way of desire and so on, they are nāgas; because they do not return to the defilements abandoned by this or that path, they are nāgas; because they do not commit any kind of transgression, they are nāgas. This is the summary here.
Ở đây, ý nghĩa của từ này là: những người không đi theo dục vọng, v.v., nên được gọi là nāgā; những người không quay lại với những phiền não đã được đoạn trừ bằng con đường đó, nên được gọi là nāgā; những người không gây ra những lỗi lầm đa dạng, nên được gọi là nāgā. Đây là tóm tắt ở đây.
Vitthāro pana mahāniddese (mahāni. 80) vuttanayeneva veditabbo.
But the detailed explanation should be understood in the way stated in the Mahāniddesa.
Phần giải thích chi tiết nên được hiểu theo cách đã nói trong Mahāniddesa.
Apica –
Furthermore–
Hơn nữa –
Evamettha attho veditabbo.
In this way, the meaning should be understood here.
Ý nghĩa ở đây nên được hiểu như vậy.
Mahantā nāgā mahānāgā, aññehi khīṇāsavanāgehi pujjatarā ca pāsaṃsatarā cāti attho.
Great nāgas are mahānāgas; the meaning is, they are more worthy of reverence and praise than other nāgas who are Stream-enterers.
Những Nāga vĩ đại là mahānāgā, tức là những vị đáng tôn kính và đáng khen ngợi hơn những Nāga A-la-hán khác.
Aññamaññassāti añño aññassa.
Of each other means: one of another.
Aññamaññassā có nghĩa là người này của người kia.
Samanumodiṃsūti samaṃ anumodiṃsu.
Rejoiced together means: they rejoiced in harmony.
Samanumodiṃsū có nghĩa là cùng hoan hỷ.
Tattha imāya upamāya mahāmoggallāno anumodi, paṭibhātu taṃ āvusoti dhammasenāpati.
Therein, Mahāmoggallāna rejoiced in this simile; the General of the Dhamma rejoiced, saying, "Let it occur to you, friend."
Trong đó, Đại Trưởng lão Moggallāna đã hoan hỷ với ví dụ này, còn Pháp tướng quân thì nói: "Mong rằng nó khởi lên trong Hiền giả."
Tena vuttaṃ ‘‘aññamaññassa subhāsitaṃ samanumodiṃsū’’ti.
Therefore it was said: "They rejoiced in one another's well-spoken words."
Do đó, đã nói rằng: “Họ đã hoan hỷ với lời nói hay của nhau.”
Idaṃ paripuṇṇasampannaṃ nāma.
This is called "complete accomplishment."
Đây gọi là đầy đủ viên mãn.
‘‘Iminā pātimokkhasaṃvarena upeto hoti samupeto upāgato samupāgato upapanno sampanno samannāgato’’ti (vibha. 511) idaṃ samaṅgisampannaṃ nāma.
"With this Pātimokkha restraint he is endowed, well endowed, attained, well attained, arisen, accomplished, possessed of"—this is called "endowment-accomplishment."
“Với sự giữ gìn giới bổn Pātimokkha này, vị ấy được trang bị, được trang bị đầy đủ, đạt được, đạt được đầy đủ, thành tựu, đầy đủ, được sở hữu.” Đây gọi là đầy đủ sung túc.
‘‘Imissā, bhante, mahāpathaviyā heṭṭhimatalaṃ sampannaṃ, seyyathāpi khuddamadhuṃ aneḷakaṃ, evamassāda’’nti (pārā. 17) idaṃ madhurasampannaṃ nāma.
"Bhante, the lower surface of this great earth is accomplished, just as fine honey without impurities; such is its taste"—this is called "sweet accomplishment."
“Bạch Thế Tôn, tầng đất thấp nhất của đại địa này đầy đủ, giống như mật ong nhỏ không có tạp chất, vị của nó cũng vậy.” Đây gọi là đầy đủ ngọt ngào.
Idha pana paripuṇṇasampannampi samaṅgisampannampi vaṭṭati.
Here, however, both "complete accomplishment" and "endowment-accomplishment" are applicable.
Ở đây, cả đầy đủ viên mãn và đầy đủ sung túc đều thích hợp.
Tasmā sampannasīlāti paripuṇṇasīlā hutvātipi sīlasamaṅgino hutvātipi evamettha attho vedibbo.
Therefore, in "accomplished in sīla," the meaning should be understood in this way: "having complete sīla," or "being endowed with sīla."
Do đó, ý nghĩa của từ "sampannasīlā" ở đây nên được hiểu là "đã trở thành người có giới hạnh viên mãn" hoặc "đã trở thành người có giới hạnh đầy đủ".
Sīlanti kenaṭṭhena sīlaṃ?
"Sīla"—in what sense is it sīla?
Giới (sīla) là giới theo nghĩa nào?
Sīlanaṭṭhena sīlaṃ.
In the sense of composing, it is sīla.
Là giới theo nghĩa là sự sắp đặt tốt đẹp.
Tassa vitthārakathā visuddhimagge vuttā.
Its detailed explanation is given in the Visuddhimagga.
Lời giải thích chi tiết về điều đó đã được nói trong Thanh Tịnh Đạo (Visuddhimagga).
Tattha bījakhaṇḍaṃ nāma yattha antarantarā bījāni khaṇḍāni vā pūtīni vā honti, tāni yattha vapanti, tattha sassaṃ na uṭṭheti, khettaṃ khaṇḍaṃ hoti.
Therein, "broken by seed" is when here and there the seeds are broken or rotten; where they are sown, the crop does not grow, and the field is broken.
Hạt giống bị hư hại là nơi mà hạt giống bị gãy hoặc thối rữa ở giữa, khi gieo vào đó, cây trồng không mọc lên, ruộng bị hư hại.
Vappakhaṇḍaṃ nāma yattha akusalo bījāni vapanto antarantarā nipāteti.
"Broken by sowing" is when an unskilled person, sowing seeds, drops them intermittently.
Gieo trồng không đều là nơi mà người nông dân không khéo léo gieo hạt giống một cách ngắt quãng.
Evañhi sabbattha sassaṃ na uṭṭheti, khettaṃ khaṇḍaṃ hoti.
In this way, the crop does not grow everywhere, and the field is broken.
Như vậy, cây trồng sẽ không mọc lên khắp nơi, ruộng bị hư hại.
Udakakhaṇḍaṃ nāma yattha katthaci udakaṃ atibahu vā na vā hoti, tatrāpi hi sassāni na uṭṭhenti, khettaṃ khaṇḍaṃ hoti.
"Broken by water" is when in some places there is either too much water or none at all; there too the crops do not grow, and the field is broken.
Nước không đủ hoặc quá nhiều là nơi mà nước quá nhiều hoặc không có ở một số chỗ, ở đó cây trồng cũng không mọc lên, ruộng bị hư hại.
Ūsakhaṇḍaṃ nāma yattha kassako kismiñci padese naṅgalena bhūmiṃ cattāro pañca vāre kasanto atigambhīraṃ karoti, tato ūsaṃ uppajjati, tatrāpi hi sassaṃ na uṭṭheti, khettaṃ khaṇḍaṃ hoti, tādisañca khettaṃ na mahapphalaṃ hoti na mahānisaṃsaṃ, tatrāpi hi bahumpi vapitvā appaṃ labhati.
"Broken by saline soil" is when a farmer, ploughing the ground four or five times in a certain area, makes it too deep, from which saline soil arises; there too the crop does not grow, and the field is broken. Such a field is not very fruitful, not of great benefit, for even if much is sown there, little is obtained.
Đất bị mặn là nơi mà người nông dân cày đất quá sâu bốn hoặc năm lần ở một chỗ nào đó bằng cái cày, từ đó đất mặn xuất hiện, ở đó cây trồng cũng không mọc lên, ruộng bị hư hại, và một thửa ruộng như vậy không mang lại nhiều quả, không mang lại nhiều lợi ích, ở đó dù gieo nhiều cũng chỉ thu được ít.
Imesaṃ pana catunnaṃ dosānaṃ vigamā khettaṃ paripuṇṇaṃ hoti.
But through the removal of these four faults, the field becomes complete.
Nhưng khi bốn khuyết điểm này được loại bỏ, thửa ruộng sẽ đầy đủ.
Tādisañca khettaṃ mahapphalaṃ hoti mahānisaṃsaṃ.
And such a field is very fruitful, of great benefit.
Và một thửa ruộng như vậy sẽ mang lại nhiều quả và nhiều lợi ích.
Evameva khaṇḍaṃ chiddaṃ sabalaṃ kammāsanti catudosasamannāgataṃ sīlaṃ aparipūraṃ hoti.
In the very same way, sīla that is possessed of the four faults—broken, perforated, spotted, and mottled—is incomplete.
Cũng như vậy, giới không đầy đủ khi có bốn khuyết điểm: bị đứt đoạn, bị thủng, bị lốm đốm, và bị pha tạp.
Tādisañca sīlaṃ na mahapphalaṃ hoti, na mahānisaṃsaṃ.
And such sīla is not very fruitful, not of great benefit.
Và một giới như vậy không mang lại nhiều quả, không mang lại nhiều lợi ích.
Imesaṃ pana catunnaṃ dosānaṃ vigamā sīlakhettaṃ paripuṇṇaṃ hoti, tādisañca sīlaṃ mahapphalaṃ hoti mahānisaṃsaṃ.
But through the removal of these four faults, the field of sīla becomes complete, and such sīla is very fruitful, of great benefit.
Nhưng khi bốn khuyết điểm này được loại bỏ, ruộng giới sẽ đầy đủ, và một giới như vậy sẽ mang lại nhiều quả và nhiều lợi ích.
Tattha ‘‘sampannasīlā’’ti ettāvatā kira bhagavā catupārisuddhisīlaṃ uddisitvā ‘‘pātimokkhasaṃvarasaṃvutā’’ti iminā tattha jeṭṭhakasīlaṃ vitthāretvā dassesīti dīpavihāravāsī sumanatthero āha.
Therein, the Elder Sumana, a resident of Dīpavihāra, said: "By 'accomplished in sīla,' the Blessed One indicated the fourfold purification sīla, and then, by 'restrained by the Pātimokkha restraint,' he explained in detail the chief sīla among them."
Trong đó, Trưởng lão Sumanā, người cư trú tại Dīpavihāra, đã nói rằng: “Với từ ‘sampannasīlā’ (giới đầy đủ) này, Đức Thế Tôn đã chỉ ra Tứ thanh tịnh giới, và với từ ‘pātimokkhasaṃvarasaṃvutā’ (được chế ngự bởi sự phòng hộ giới bổn Pātimokkha) này, Ngài đã giải thích và trình bày giới tối thượng trong số đó.”
Antevāsiko panassa tepiṭakacūḷanāgatthero āha – ubhayatthāpi pātimokkhasaṃvaro bhagavatā vutto, pātimokkhasaṃvaroyeva hi sīlaṃ.
But his resident pupil, the Elder Tepiṭaka Cūḷanāga, said: "In both places, the Pātimokkha restraint was spoken of by the Blessed One, for the Pātimokkha restraint itself is sīla."
Nhưng đệ tử của Ngài, Trưởng lão Tipiṭakacūḷanāga, đã nói: “Đức Thế Tôn đã nói về sự phòng hộ giới bổn Pātimokkha ở cả hai nơi, vì chỉ có sự phòng hộ giới bổn Pātimokkha mới là giới.
Itarāni pana tīṇi sīlanti vuttaṭṭhānaṃ nāma atthīti ananujānanto vatvā āha – ‘‘indriyasaṃvaro nāma chadvārarakkhāmattakameva, ājīvapārisuddhi dhammena samena paccayuppattimattakaṃ, paccayanissitaṃ paṭiladdhapaccaye idamatthanti paccavekkhitvā paribhuñjanamattakaṃ.
Not allowing that there is any passage where the other three are called 'sīla,' he spoke and said: "Restraint of the sense faculties is merely the guarding of the six doors; purity of livelihood is merely the production of requisites righteously and fairly; that which is dependent on requisites is merely using the received requisites after having reflected, 'This is for this purpose.'"
Còn ba loại giới khác thì không có chỗ nào được gọi là giới.” Vị ấy không đồng ý và nói: “Sự phòng hộ các căn chỉ là việc bảo vệ sáu cửa giác quan; sự thanh tịnh về phương tiện sinh sống chỉ là việc có được các vật dụng một cách hợp pháp và đúng đắn; sự nương tựa vào các vật dụng chỉ là việc quán xét khi thọ dụng các vật dụng đã nhận được, rằng ‘điều này có lợi ích’.
Nippariyāyena pātimokkhasaṃvarova sīlaṃ.
Unconditionally, the Pātimokkha restraint itself is sīla.
Nói một cách tuyệt đối, chỉ có sự phòng hộ giới bổn Pātimokkha mới là giới.
Yassa so bhinno, ayaṃ chinnasīso viya puriso hatthapāde sesāni rakkhissatīti na vattabbo.
For whomever that is broken, he cannot be said to guard the remaining things, just like a man whose head has been cut off cannot be said to guard his hands and feet.
Người nào đã vi phạm giới đó, thì không thể nói rằng người đó sẽ bảo vệ các phần còn lại như tay chân, giống như một người đã bị chặt đầu.
Yassa pana so arogo, ayaṃ acchinnasīso viya puriso jīvitaṃ sesāni puna pākatikāni katvā rakkhituṃ sakkoti.
But for whomever that is unimpaired, he is able to restore the remaining things to their natural state and guard them, just like a man whose head is not cut off is able to protect his life and restore his other limbs to their natural state.
Nhưng người nào giữ giới đó không bị hư hoại, thì người đó có thể bảo vệ sự sống và các phần còn lại, làm cho chúng trở lại bình thường, giống như một người chưa bị chặt đầu.
Tasmā ‘sampannasīlā’ti iminā pātimokkhasaṃvaraṃ uddisitvā ‘sampannapātimokkhā’ti tasseva vevacanaṃ vatvā taṃ vitthāretvā dassento ‘pātimokkhasaṃvarasaṃvutā’tiādimāhā’’ti.
Therefore, having indicated the Pātimokkha restraint by 'accomplished in sīla,' and having stated a synonym for it, 'accomplished in the Pātimokkha,' in order to explain it in detail, he said 'restrained by the Pātimokkha restraint,' and so on."
Do đó, khi Đức Phật muốn chỉ ra sự phòng hộ giới bổn Pātimokkha bằng từ ‘sampannasīlā’ (giới đầy đủ), và sau đó nói ‘sampannapātimokkhā’ (Pātimokkha đầy đủ) như một từ đồng nghĩa của nó, rồi giải thích chi tiết điều đó, Ngài đã nói ‘pātimokkhasaṃvarasaṃvutā’ (được chế ngự bởi sự phòng hộ giới bổn Pātimokkha) và những điều tương tự.”
Tattha pātimokkhasaṃvarasaṃvutāti pātimokkhasaṃvarena samannāgatā.
Therein, "restrained by the Pātimokkha restraint" means possessed of the Pātimokkha restraint.
Trong đó, pātimokkhasaṃvarasaṃvutā có nghĩa là được trang bị sự phòng hộ giới bổn Pātimokkha.
Ācāragocarasampannāti ācārena ca gocarena ca sampannā.
"Accomplished in conduct and resort" means accomplished in both conduct and resort.
Ācāragocarasampannā có nghĩa là đầy đủ về oai nghi và phạm vi hành trì.
Aṇumattesūti appamattakesu.
"In minute" means in small amounts.
Aṇumattesū có nghĩa là những điều rất nhỏ.
Vajjesūti akusaladhammesu.
"Faults" means in unwholesome states.
Vajjesū có nghĩa là những pháp bất thiện.
Bhayadassāvīti bhayadassino.
"Seeing danger" means seeing fear.
Bhayadassāvī có nghĩa là thấy được sự nguy hiểm.
Samādāyāti sammā ādiyitvā.
"Having undertaken" means having well taken up.
Samādāyā có nghĩa là đã thọ trì một cách đúng đắn.
Sikkhatha sikkhāpadesūti sikkhāpadesu taṃ taṃ sikkhāpadaṃ samādiyitvā sikkhatha.
"You should train in the training rules" means you should train by undertaking each and every training rule among the training rules.
Sikkhatha sikkhāpadesū có nghĩa là hãy học tập trong các giới luật, thọ trì từng giới luật đó mà học tập.
Apica samādāya sikkhatha sikkhāpadesūti yaṃkiñci sikkhākoṭṭhāsesu sikkhitabbaṃ kāyikaṃ vācasikañca, taṃ sabbaṃ samādāya sikkhathāti ayamettha saṅkhepo, vitthārato pana sabbānetāni pātimokkhasaṃvarādīni padāni visuddhimagge vuttāni.
Moreover, "having undertaken, you should train in the training rules" means whatever bodily or verbal conduct is to be trained in among the sections of the training, you should train by undertaking it all. This is the summary here; but in detail, all these terms, beginning with Pātimokkha restraint, are stated in the Visuddhimagga.
Hơn nữa, samādāya sikkhatha sikkhāpadesū có nghĩa là bất cứ điều gì cần học tập trong các phần của giới luật, dù là về thân hay lời nói, hãy thọ trì tất cả và học tập – đây là ý nghĩa tóm tắt ở đây; còn về chi tiết, tất cả các từ ngữ như sự phòng hộ giới bổn Pātimokkha và những điều tương tự đã được nói trong Thanh Tịnh Đạo.
65. Ākaṅkheyya ceti idaṃ kasmā āraddhaṃ?
65. "If he should wish"—why was this begun?
65. Ākaṅkheyya ce (Nếu muốn) – điều này được bắt đầu vì lý do gì?
Sīlānisaṃsadassanatthaṃ.
To show the benefits of sīla.
Để chỉ ra lợi ích của giới.
Sacepi acirapabbajitānaṃ vā duppaññānaṃ vā evamassa ‘‘bhagavā sīlaṃ pūrethāti vadati, ko nu kho sīlapūraṇe ānisaṃso, ko viseso, kā vaḍḍhī’’ti?
If it should occur to those who have not been long ordained or to those of little wisdom: "The Blessed One says, 'Fulfill sīla,' but what, indeed, is the benefit in fulfilling sīla? What is the distinction? What is the growth?"
Nếu có những người mới xuất gia hoặc những người kém trí tuệ nghĩ rằng: “Đức Thế Tôn nói hãy viên mãn giới hạnh, vậy lợi ích của việc viên mãn giới hạnh là gì, có gì đặc biệt, có gì tăng trưởng?”
Tesaṃ sattarasa ānisaṃse dassetuṃ evamāha.
He spoke thus to show them the seventeen benefits.
Để chỉ ra mười bảy lợi ích cho những người đó, Ngài đã nói như vậy.
Appeva nāma etaṃ sabrahmacārīnaṃ piyamanāpatādiāsavakkhayapariyosānaṃ ānisaṃsaṃ sutvāpi sīlaṃ paripūreyyunti.
Perhaps, after hearing this benefit that begins with being dear and agreeable to their fellow celibates and culminates in the destruction of the taints, they might indeed fulfill their sīla.
Có lẽ khi nghe những lợi ích này, từ việc được các bạn đồng phạm hạnh yêu mến, ưa thích cho đến sự đoạn tận các lậu hoặc, họ sẽ viên mãn giới hạnh.
Visakaṇṭakavāṇijo viya.
Like the trader of "poison-thorns."
Giống như người bán thuốc độc và gai.
Visakaṇṭakavāṇijo nāma guḷavāṇijo vuccati.
The "trader of poison-thorns" is said to be a trader of molasses.
Người bán thuốc độc và gai được gọi là người bán đường thốt nốt.
So kira guḷaphāṇitakhaṇḍasakkharādīni sakaṭenādāya paccantagāmaṃ gantvā ‘‘visakaṇṭakaṃ gaṇhatha, visakaṇṭakaṃ gaṇhathā’’ti ugghosesi.
It is said that he, having loaded his cart with lumps of molasses, treacle, sugar candy, and sugar, went to a remote village and proclaimed, "Get your poison-thorns! Get your poison-thorns!"
Người đó đã chở đường thốt nốt, mật đường, đường mía, v.v., bằng xe bò đến một ngôi làng biên giới và rao lớn: “Hãy mua thuốc độc và gai, hãy mua thuốc độc và gai!”
Taṃ sutvā gāmikā ‘‘visaṃ nāma kakkhaḷaṃ, yo naṃ khādati, so marati, kaṇṭakampi vijjhitvā māreti, ubhopete kakkhaḷā, ko ettha ānisaṃso’’ti gehadvārāni thakesuṃ, dārake ca palāpesuṃ.
Hearing this, the villagers thought, "Poison is harsh; whoever eats it dies. A thorn also pierces and kills. Both are harsh. What is the benefit in this?" They shut the doors of their houses and made the children run away.
Nghe vậy, dân làng đóng cửa nhà lại và đuổi con cái đi, nói: “Thuốc độc thì khắc nghiệt, ai ăn vào sẽ chết; gai cũng đâm vào mà giết chết. Cả hai thứ này đều khắc nghiệt, vậy có lợi ích gì?”
Taṃ disvā vāṇijo ‘‘avohārakusalā ime gāmikā, handa ne upāyena gaṇhāpemī’’ti ‘‘atimadhuraṃ gaṇhatha, atisāduṃ gaṇhatha, guḷaṃ phāṇitaṃ sakkharaṃ samagghaṃ labbhati, kūṭamāsakakūṭakahāpaṇādīhipi labbhatī’’ti ugghosesi.
Seeing that, the merchant thought, “These villagers are unskilled in commerce. Come now, I will get them by a stratagem.” He proclaimed, “Take what is very sweet, take what is very delicious, molasses, treacle, and sugar are available cheaply, and can be obtained even with counterfeit māsakas, counterfeit kahāpaṇas, and so on.”
Thấy vậy, người lái buôn nghĩ: "Những người dân làng này không khéo léo trong giao dịch, hãy để ta dùng mưu kế để lấy hàng của họ." Rồi ông ta rao lớn: "Hãy lấy thứ rất ngọt, hãy lấy thứ rất ngon, đường thốt nốt, mật đường, đường mía đều có thể lấy với giá phải chăng, cũng có thể lấy bằng tiền xu giả, tiền vàng giả, v.v."
Taṃ sutvā gāmikā haṭṭhatuṭṭhā āgantvā bahumpi mūlaṃ datvā gahesuṃ.
Hearing that, the villagers, delighted and joyful, came and bought it, giving a great price.
Nghe vậy, những người dân làng vui mừng hớn hở đến, trả nhiều tiền và lấy hàng.
Tattha vāṇijassa ‘‘visakaṇṭakaṃ gaṇhathā’’ti ugghosanaṃ viya bhagavato ‘‘sampannasīlā, bhikkhave, viharatha…pe… samādāya sikkhatha sikkhāpadesū’’ti vacanaṃ.
Herein, like the merchant’s proclamation, “Take the visakaṇṭaka,” should be understood the Blessed One’s words, “Dwell, O monks, accomplished in sīla… undertake and train in the training rules.”
Trong đó, lời rao của người lái buôn: "Hãy lấy visakaṇṭakaṃ (gai độc)" ví như lời của Đức Thế Tôn: "Này các Tỳ-khưu, hãy sống với giới hạnh đầy đủ... (v.v.)... hãy thọ trì và tu học trong các học giới."
‘‘Ubhopete kakkhaḷā, ko ettha ānisaṃso’’ti gāmikānaṃ cintanaṃ viya bhagavā ‘‘sampannasīlā viharathā’’ti āha, ‘‘sīlañca nāmetaṃ kakkhaḷaṃ pharusaṃ khiḍḍādipaccanīkaṃ, ko nu kho sampannasīlānaṃ ānisaṃso’’ti bhikkhūnaṃ cintanaṃ.
Like the villagers’ thinking, “Both of these are harsh, what benefit is there in this?” is the monks’ thinking: “The Blessed One said, ‘Dwell accomplished in sīla,’ but this thing called sīla is harsh, rough, and opposed to play and the like. What then is the benefit for those accomplished in sīla?”
Việc dân làng nghĩ: "Cả hai thứ này đều thô cứng, lợi ích gì ở đây?" ví như việc các Tỳ-khưu nghĩ khi Đức Thế Tôn nói: "Hãy sống với giới hạnh đầy đủ": "Giới hạnh này thật thô cứng, khắc nghiệt, đối nghịch với sự vui đùa, vậy lợi ích gì khi có giới hạnh đầy đủ?"
Atha tassa vāṇijassa ‘‘atimadhuraṃ gaṇhathā’’tiādivacanaṃ viya bhagavato piyamanāpatādiāsavakkhayapariyosānaṃ sattarasaānisaṃsappakāsanatthaṃ ‘‘ākaṅkheyya ce’’tiādivacanaṃ veditabbaṃ.
Then, like that merchant’s words, “Take what is very sweet,” and so on, should be understood the Blessed One’s words beginning with “If a monk should wish,” for the purpose of explaining the seventeen benefits, beginning with being dear and agreeable and ending with the destruction of the taints.
Và lời của người lái buôn: "Hãy lấy thứ rất ngọt," v.v., ví như lời của Đức Thế Tôn: "Nếu một người mong muốn," v.v., để tuyên bố mười bảy lợi ích, từ việc được yêu mến, dễ chịu cho đến tận diệt các lậu hoặc.
Tattha ākaṅkheyya ceti yadi ākaṅkheyya yadi iccheyya.
Therein, if he should wish means if he should desire, if he should want.
Ở đây, ākaṅkheyya ce nghĩa là nếu mong muốn, nếu ước muốn.
Piyo ca assanti piyacakkhūhi sampassitabbo, sinehuppattiyā padaṭṭhānabhūto bhaveyyanti vuttaṃ hoti.
And he would be dear means he would be one to be looked upon with affectionate eyes; it is said that he would be a basis for the arising of affection.
Piyo ca assa có nghĩa là đáng được nhìn bằng con mắt yêu mến, tức là đáng là nguyên nhân phát sinh tình cảm.
Manāpoti tesaṃ manavaḍḍhanako, tesaṃ vā manena pattabbo, mettacittena pharitabboti vuttaṃ hoti.
Agreeable means one who increases their pleasure of mind, or one who is to be attained by their mind; it is said that he is one to be pervaded with a mind of loving-kindness.
Manāpo là người làm tăng trưởng tâm của họ, hoặc là người được tâm của họ đạt đến, tức là đáng được trải tâm từ.
Garūti tesaṃ garuṭṭhāniyo pāsāṇacchattasadiso.
Respected means he is in a position of respect for them, like a stone parasol.
Garū là người đáng được tôn kính đối với họ, giống như một cây dù đá.
Bhāvanīyoti ‘‘addhā ayamāyasmā jānaṃ jānāti passaṃ passatī’’ti evaṃ sambhāvanīyo.
To be esteemed means one to be highly regarded in this way: “Indeed, this venerable one knows what should be known, sees what should be seen.”
Bhāvanīyo là người đáng được quý trọng như: "Chắc chắn vị Tôn giả này biết những gì đáng biết, thấy những gì đáng thấy."
Sīlesvevassa paripūrakārīti catupārisuddhisīlesuyeva paripūrakārī assa, anūnena paripūritākārena samannāgato bhaveyyāti vuttaṃ hoti.
He should be a fulfiller of the precepts means he should be a fulfiller of the four kinds of purity of sīla; it is said that he should be endowed with the characteristic of fulfilling them without deficiency.
Sīlesvevassa paripūrakārī có nghĩa là người ấy nên hoàn thiện trong Tứ thanh tịnh giới (catupārisuddhisīla), tức là nên có đầy đủ sự hoàn thiện không thiếu sót.
Ajjhattaṃ cetosamathamanuyuttoti attano cittasamathe yutto, ettha hi ajjhattanti vā attanoti vā etaṃ ekatthaṃ, byañjanameva nānaṃ.
Devoted to internal serenity of mind means devoted to the calming of his own mind. For here, “internal” or “one’s own” have the same meaning; only the expression is different.
Ajjhattaṃ cetosamathamanuyutto là người tinh tấn trong sự an tịnh tâm của mình. Ở đây, "ajjhattaṃ" hay "attano" có cùng nghĩa, chỉ khác về từ ngữ.
Bhummatthe panetaṃ samathanti upayogavacanaṃ.
But this word “serenity” is a statement in the accusative case used in the sense of the locative case.
Từ "samatha" ở đây là một từ chỉ sự ứng dụng trong nghĩa vị trí (bhummattha).
Anūti iminā upasaggena yoge siddhaṃ.
It is accomplished in connection with the prefix “anu.”
Nó được hoàn thành với tiền tố "anu" trong ngữ cảnh này.
Anirākatajjhānoti bahi anīhaṭajjhāno, avināsitajjhāno vā, nīharaṇavināsatthañhi idaṃ nirākaraṇaṃ nāma.
Not neglecting jhāna means not having brought the jhāna out, or not having destroyed the jhāna. For this term “neglecting” has the meaning of bringing out or destroying.
Anirākatajjhāno là người không loại bỏ Thiền (jhāna) ra bên ngoài, hoặc là người không làm mất Thiền. Vì "nirākaraṇaṃ" có nghĩa là loại bỏ hoặc làm mất.
Thambhaṃ niraṃkatvā nivātavuttītiādīsu cassa payogo daṭṭhabbo.
Its usage should be seen in such phrases as “having fixed a pillar, he lives in a sheltered place.”
Việc sử dụng từ này có thể thấy trong các trường hợp như "Thambhaṃ niraṃkatvā nivātavuttī" (loại bỏ cột trụ và sống trong nơi không gió), v.v.
Vipassanāya samannāgatoti sattavidhāya anupassanāya yutto, sattavidhā anupassanā nāma aniccānupassanā dukkhānupassanā anattānupassanā nibbidānupassanā virāgānupassanā nirodhānupassanā paṭinissaggānupassanāti.
Endowed with vipassanā means yoked to the seven kinds of insight-contemplation. The seven kinds of insight-contemplation are: contemplation of impermanence, contemplation of suffering, contemplation of non-self, contemplation of disenchantment, contemplation of dispassion, contemplation of cessation, and contemplation of relinquishment.
Vipassanāya samannāgato là người có đầy đủ bảy loại quán chiếu (anupassanā). Bảy loại anupassanā là: vô thường quán (aniccānupassanā), khổ quán (dukkhānupassanā), vô ngã quán (anattānupassanā), yếm ly quán (nibbidānupassanā), ly tham quán (virāgānupassanā), diệt quán (nirodhānupassanā), xả ly quán (paṭinissaggānupassanā).
Tā visuddhimagge vitthāritā.
They are explained in detail in the Visuddhimagga.
Những điều này đã được giải thích chi tiết trong Visuddhimagga.
Brūhetā suññāgārānanti vaḍḍhetā suññāgārānaṃ, ettha ca samathavipassanāvasena kammaṭṭhānaṃ gahetvā rattindivaṃ suññāgāraṃ pavisitvā nisīdamāno bhikkhu ‘‘brūhetā suññāgārāna’’nti veditabbo.
An augmenter of empty dwellings means a developer of empty dwellings. And here, a monk who, having taken up a meditation subject by way of samatha and vipassanā, enters an empty dwelling day and night and sits, should be known as “an augmenter of empty dwellings.”
Brūhetā suññāgārānaṃ là người làm tăng trưởng các trú xứ vắng vẻ. Ở đây, một Tỳ-khưu lấy đề mục thiền định (kammaṭṭhāna) theo cách Samatha và Vipassanā, rồi ngày đêm vào trú xứ vắng vẻ để ngồi thiền, được gọi là "người làm tăng trưởng các trú xứ vắng vẻ."
Ekabhūmakādipāsāde kurumānopi pana neva suññāgārānaṃ brūhetāti daṭṭhabboti.
But it should be understood that even one who builds a one-storied mansion and so on is not an augmenter of empty dwellings.
Tuy nhiên, cần hiểu rằng một người xây dựng các cung điện một tầng, v.v., thì không phải là người làm tăng trưởng các trú xứ vắng vẻ.
Ettha hi ‘‘sīlesvevassa paripūrakārī’’ti ettāvatā adhisīlasikkhā vuttā.
Here, by the words “He should be a fulfiller of the precepts,” the training in higher sīla is stated.
Ở đây, "sīlesvevassa paripūrakārī" đã nói về giới học (adhisīlasikkhā).
‘‘Ajjhattaṃ cetosamathamanuyutto anirākatajjhāno’’ti ettāvatā adhicittasikkhā, ‘‘vipassanāya samannāgato’’ti ettāvatā adhipaññāsikkhā, ‘‘brūhetā suññāgārāna’’nti iminā pana samathavasena suññāgāravaḍḍhane adhicittasikkhā, vipassanāvasena adhipaññāsikkhāti evaṃ dvepi sikkhā saṅgahetvā vuttā.
By the words “Devoted to internal serenity of mind, not neglecting jhāna,” the training in higher mind is stated. By “endowed with vipassanā,” the training in higher wisdom is stated. But by “an augmenter of empty dwellings,” both trainings are included and stated: when augmenting empty dwellings by way of samatha, it is the training in higher mind, and by way of vipassanā, it is the training in higher wisdom.
"Ajjhattaṃ cetosamathamanuyutto anirākatajjhāno" đã nói về tâm học (adhicittasikkhā). "Vipassanāya samannāgato" đã nói về tuệ học (adhipaññāsikkhā). Còn "brūhetā suññāgārānaṃ" thì bao gồm cả hai học: tâm học trong việc tăng trưởng các trú xứ vắng vẻ theo phương diện định (samatha), và tuệ học theo phương diện tuệ (vipassanā).
Ettha ca ‘‘ajjhattaṃ cetosamathamanuyutto anirākatajjhāno’’ti imehi padehi sīlānurakkhikā eva cittekaggatā kathitā.
And here, by the words “devoted to internal serenity of mind, not neglecting jhāna,” only the concentration of mind that protects sīla is spoken of.
Ở đây, với các từ "ajjhattaṃ cetosamathamanuyutto anirākatajjhāno," chỉ sự nhất tâm (cittekaggatā) bảo vệ giới đã được nói đến.
‘‘Vipassanāyā’’ti iminā padena sīlānurakkhiko saṅkhārapariggaho.
By the word “with vipassanā,” the comprehension of formations that protects sīla is spoken of.
Với từ "vipassanā," sự nhận thức về các hành (saṅkhārapariggaho) bảo vệ giới đã được nói đến.
Kathaṃ cittekaggatā sīlamanurakkhati?
How does concentration of mind protect sīla?
Sự nhất tâm bảo vệ giới như thế nào?
Yassa hi cittekaggatā natthi, so byādhimhi uppanne vihaññati, so byādhivihato vikkhittacitto sīlaṃ vināsetvāpi byādhivūpasamaṃ kattā hoti.
For one who has no concentration of mind, when a disease arises, he is distressed. Being distressed by the disease, with a distracted mind, he may even destroy his sīla to bring about the pacification of the disease.
Người nào không có nhất tâm, khi bệnh tật phát sinh, người ấy sẽ bị khổ sở. Bị bệnh tật hành hạ, tâm tán loạn, người ấy có thể phá giới để làm dịu bệnh tật.
Yassa pana cittekaggatā atthi, so taṃ byādhidukkhaṃ vikkhambhetvā samāpattiṃ samāpajjati, samāpannakkhaṇe dukkhaṃ dūrāpakataṃ hoti, balavatarasukhamuppajjati.
But for one who has concentration of mind, he suppresses that pain of disease and enters an attainment. At the moment of attainment, the pain is far removed, and a stronger happiness arises.
Nhưng người nào có nhất tâm, người ấy sẽ chế ngự được khổ đau do bệnh tật và nhập định. Ngay khi nhập định, khổ đau sẽ bị đẩy lùi xa, và một niềm an lạc mạnh mẽ hơn sẽ phát sinh.
Evaṃ cittekaggatā sīlaṃ anurakkhati.
Thus, concentration of mind protects sīla.
Như vậy, nhất tâm bảo vệ giới.
Kathaṃ saṅkhārapariggaho sīlamanurakkhati?
How does comprehension of formations protect sīla?
Sự nhận thức về các hành bảo vệ giới như thế nào?
Yassa hi saṅkhārapariggaho natthi, tassa ‘‘mama rūpaṃ mama viññāṇa’’nti attabhāve balavamamattaṃ hoti, so tathārūpesu dubbhikkhabyādhibhayādīsu sampattesu sīlaṃ vināsetvāpi attabhāvaṃ posetā hoti.
For one who has no comprehension of formations, there is a strong sense of “mine” regarding his personality, as in “my form, my consciousness.” When met with such things as famine, disease, and fear, he may destroy his sīla to nourish his personality.
Người nào không có sự nhận thức về các hành, người ấy sẽ có sự chấp thủ mạnh mẽ vào thân thể ("Đây là sắc của ta, đây là thức của ta"). Khi gặp phải nạn đói, bệnh tật, sợ hãi, v.v., người ấy có thể phá giới để nuôi dưỡng thân thể.
Yassa pana saṅkhārapariggaho atthi, tassa attabhāve balavamamattaṃ vā sineho vā na hoti, so tathārūpesu dubbhikkhabyādhibhayādīsu sampattesu sacepissa antāni bahi nikkhamanti, sacepi ussussati visussati, khaṇḍākhaṇḍiko vā hoti satadhāpi sahassadhāpi, neva sīlaṃ vināsetvā attabhāvaṃ posetā hoti.
But for one who has comprehension of formations, there is no strong sense of “mine” or attachment to his personality. When met with such things as famine, disease, and fear, even if his intestines come out, even if he becomes parched and dried up, or is cut into pieces a hundred or a thousand times, he will never destroy his sīla to nourish his personality.
Nhưng người nào có sự nhận thức về các hành, người ấy sẽ không có sự chấp thủ mạnh mẽ hay tình cảm đối với thân thể. Khi gặp phải nạn đói, bệnh tật, sợ hãi, v.v., dù ruột gan có bị lòi ra ngoài, dù thân thể có khô héo, tàn tạ, dù bị cắt thành trăm mảnh hay ngàn mảnh, người ấy cũng không phá giới để nuôi dưỡng thân thể.
Evaṃ saṅkhārapariggaho sīlamanurakkhati.
Thus, comprehension of formations protects sīla.
Như vậy, sự nhận thức về các hành bảo vệ giới.
‘‘Brūhetā suññāgārāna’’nti iminā pana tasseva ubhayassa brūhanā vaḍḍhanā sātaccakiriyā dassitā.
And by the phrase “an augmenter of empty dwellings,” the augmentation, development, and continuous practice of these very two is shown.
Còn với "brūhetā suññāgārānaṃ," thì sự tăng trưởng, phát triển và thực hành liên tục của cả hai điều đó (định và tuệ) đã được chỉ ra.
Tasmā ‘‘ākaṅkheyya ce, bhikkhave, bhikkhu sabrahmacārīnaṃ piyo cassaṃ manāpo ca garu ca bhāvanīyo cāti sīlesvevassa paripūrakārī…pe… suññāgārāna’’nti vatvā idāni yasmā paccayalābhādiṃ patthayantenāpi idameva karaṇīyaṃ, na aññaṃ kiñci, tasmā ‘‘ākaṅkheyya ce, bhikkhave, bhikkhu lābhī assa’’ntiādimāha.
Therefore, having said, “If, O monks, a monk should wish: ‘May I be dear to my companions in the holy life, agreeable, respected, and esteemed,’ he should be a fulfiller of the precepts… an augmenter of empty dwellings,” now, since this very thing and nothing else must be done even by one who desires to obtain requisites and so on, He said, “If, O monks, a monk should wish: ‘May I be a recipient…’” and so on.
Do đó, sau khi nói: "Này các Tỳ-khưu, nếu một Tỳ-khưu mong muốn ta sẽ được các đồng phạm hạnh yêu mến, dễ chịu, tôn kính và đáng được quý trọng, thì người ấy phải hoàn thiện trong giới hạnh... (v.v.)... các trú xứ vắng vẻ," bây giờ, vì một người mong muốn có được lợi lộc, v.v., cũng phải làm điều này chứ không phải điều gì khác, nên Ngài nói: "Này các Tỳ-khưu, nếu một Tỳ-khưu mong muốn ta sẽ có được lợi lộc," v.v.
Na cettha bhagavā lābhanimittaṃ sīlādiparipūraṇaṃ kathetīti veditabbo.
And here it should be understood that the Blessed One is not speaking of the fulfillment of sīla and so on as a pretext for gain.
Và ở đây, cần hiểu rằng Đức Thế Tôn không nói về việc hoàn thiện giới hạnh, v.v., chỉ vì mục đích lợi lộc.
Bhagavā hi ghāsesanaṃ chinnakatho na vācaṃ payuttaṃ bhaṇeti, evaṃ sāvake ovadati, so kathaṃ lābhanimittaṃ sīlādiparipūraṇaṃ kathessati, puggalajjhāsayavasena panetaṃ vuttaṃ.
For the Blessed One has cut off talk about the quest for food and does not utter speech connected to it; thus he advises his disciples. How then would he teach the fulfillment of virtue and so on as a means for gains? Rather, this was said according to the disposition of the person.
Đức Thế Tôn quả thực không nói lời nào có ý đồ liên quan đến việc tìm cầu thức ăn, với lời nói đã được cắt bỏ (sự tìm cầu vật chất), Ngài dạy các đệ tử như vậy. Vậy làm sao Ngài có thể nói về sự viên mãn của giới (sīla) v.v., như một phương tiện để đạt được lợi lộc? Tuy nhiên, điều này được nói tùy theo khuynh hướng của mỗi cá nhân.
Yesañhi evaṃ ajjhāsayo bhaveyya ‘‘sace mayaṃ catūhi paccayehi na kilameyyāma, sīlādiṃ pūretuṃ sakkuṇeyyāmā’’ti, tesaṃ ajjhāsayavasena bhagavā evamāha.
For there might be some whose disposition is this: "If we were not to weary ourselves for the four requisites, we would be able to fulfill virtue and so on." It is according to the disposition of such ones that the Blessed One spoke in this way.
Quả thực, nếu có khuynh hướng như vậy (trong tâm) của những người nào đó: "Nếu chúng ta không phải vất vả vì bốn vật dụng (yếu tố), chúng ta có thể làm viên mãn giới (sīla) v.v.", thì tùy theo khuynh hướng của những người ấy, Đức Thế Tôn đã nói như vậy.
Apica rasānisaṃso esa sīlassa, yadidaṃ cattāro paccayā nāma.
Moreover, what are called the four requisites are a benefit of the essence of virtue.
Hơn nữa, bốn vật dụng (yếu tố) này là lợi ích của giới (sīla).
Tathā hi paṇḍitamanussā koṭṭhādīsu ṭhapitaṃ nīharitvā puttādīnampi adatvā attanāpi aparibhuñjitvā sīlavantānaṃ dentīti sīlassa sarasānisaṃsadassanatthaṃ petaṃ vuttaṃ.
Thus, wise people, taking out what was stored in granaries and so on, not giving it even to their own children and not consuming it themselves, give it to the virtuous. Therefore, this was also said to show the benefit of the essence of virtue.
Quả vậy, những người trí tuệ lấy gạo v.v. đã cất giữ trong kho ra, không cho con cái v.v. mà cũng không tự mình thọ hưởng, lại đem dâng cúng cho những người giữ giới (sīla). Điều này được nói để chỉ ra lợi ích của giới (sīla) như vậy.
Tatiyavāre yesāhanti yesaṃ ahaṃ.
In the third section, yesāhaṃ means "of whom I".
Trong lần thứ ba, yesāhaṃ (những người mà ta) là "những người mà ta".
Tesaṃ te kārāti tesaṃ devānaṃ vā manussānaṃ vā te mayi katā paccayadānakārā.
Tesaṃ te kārā means: "those services of giving requisites done to me by them," whether by devas or by humans.
Tesaṃ te kārā (những việc làm đó của họ) là những việc làm cúng dường vật dụng mà các vị trời hoặc người ấy đã làm cho ta.
Devāpi hi sīlādiguṇayuttānaṃ paccaye denti, na kevalaṃ manussāyeva, sakko viya āyasmato mahākassapassa.
For devas too, not only humans, give requisites to those endowed with virtues such as sīla, like Sakka did for the Venerable Mahākassapa.
Không chỉ con người, mà cả các vị trời cũng cúng dường vật dụng cho những người có đầy đủ giới (sīla) v.v. và đức hạnh, như Sakka (Đế Thích) đã cúng dường cho Tôn giả Mahākassapa.
Mahapphalā mahānisaṃsāti ubhayametaṃ atthato ekaṃ, byañjanameva nānaṃ.
Mahapphalā mahānisaṃsā (of great fruit, of great benefit): these two are one in meaning; only the expression is different.
Mahapphalā mahānisaṃsā (quả báo lớn, lợi ích lớn) cả hai từ này có cùng ý nghĩa, chỉ khác nhau về cách diễn đạt.
Mahantaṃ vā lokiyasukhaṃ phalantīti mahapphalā.
Or, because they bear great worldly happiness as their fruit, they are mahapphalā.
Hoặc vì chúng mang lại hạnh phúc thế gian to lớn nên gọi là mahapphalā (quả báo lớn).
Mahato lokuttarasukhassa ca paccayā hontīti mahānisaṃsā.
Because they are conditions for the great supramundane happiness, they are mahānisaṃsā.
Và vì chúng là điều kiện cho hạnh phúc siêu thế to lớn nên gọi là mahānisaṃsā (lợi ích lớn).
Sīlādiguṇayuttassa hi kaṭacchubhikkhāpi pañcaratanamattāya bhūmiyā paṇṇasālāpi katvā dinnā anekāni kappasahassāni duggativinipātato rakkhati, pariyosāne ca amatāya parinibbānadhātuyāpaccayo hoti.
For even a spoonful of almsfood given to one endowed with virtues like sīla, or a leaf-hut built and given on a piece of land measuring five ratanas, protects one from falling into a woeful state for many thousands of aeons, and in the end becomes a condition for the deathless element of final Nibbāna.
Quả thực, dù chỉ là một muỗng cơm hay một túp lều lá được cúng dường cho một vị Tỳ-khưu có đầy đủ giới (sīla) v.v. và đức hạnh trên một mảnh đất rộng năm ngàn (ratana), cũng có thể bảo vệ người cúng dường khỏi các cõi khổ (duggati) và đọa xứ (vinipāta) trong hàng ngàn kiếp, và cuối cùng trở thành điều kiện cho Niết-bàn (parinibbāna) bất tử.
‘‘Khīrodanaṃ ahamadāsi’’ntiādīni (vi. va. 413) cettha vatthūni, sakalameva vā petavatthu vimānavatthu ca sādhakaṃ.
In this context, the stories beginning with "I gave milk-rice" are relevant, or the entire Petavatthu and Vimānavatthu serve as evidence.
Các câu chuyện như "Tôi đã cúng dường cơm sữa" v.v. là những ví dụ ở đây, hoặc toàn bộ Petavatthu và Vimānavatthu đều là bằng chứng.
Tasmā paccayadāyakehi attani katānaṃ kārānaṃ mahapphalataṃ icchantenāpi sīlādiguṇayutteneva bhavitabbanti dasseti.
Therefore, it shows that one who wishes for the great fruitfulness of the services done to oneself by the donors of requisites must also be endowed with virtues such as sīla.
Do đó, để mong muốn những việc cúng dường vật dụng mà các thí chủ đã làm cho mình có quả báo lớn, lợi ích lớn, thì (vị Tỳ-khưu) cũng phải có đầy đủ giới (sīla) v.v. và đức hạnh. Điều này được chỉ ra.
Catutthavāre ñātīti sassusasurapakkhikā.
In the fourth section, ñātī means those on the side of the mother-in-law and father-in-law.
Trong lần thứ tư, ñātī (thân quyến) là những người thuộc phe cha mẹ chồng/vợ.
Sālohitāti ekalohitasambaddhā pītipitāmahādayo.
Sālohitā means those connected by the same bloodline, such as father, grandfather, and so on.
Sālohitā (huyết thống) là những người có cùng huyết thống như cha, ông, cố v.v.
Petāti peccabhāvaṃ gatā.
Petā means those who have gone to the next world.
Petā (người đã chết) là những người đã đi vào cảnh giới của ngạ quỷ (peta).
Kālaṅkatāti matā.
Kālaṅkatā means the dead.
Kālaṅkatā (đã qua đời) là những người đã chết.
Tesaṃ tanti tesaṃ taṃ mayi pasannacittataṃ vā pasannena cittena anussaraṇaṃ vā.
Tesaṃ taṃ means "their faithful mind towards me" or "their recollection of me with a faithful mind".
Tesaṃ taṃ (điều đó của họ) là sự thanh tịnh của tâm họ đối với ta, hoặc sự nhớ nghĩ của họ với tâm thanh tịnh.
Yassa hi bhikkhuno kālaṅkato pitā vā mātā vā ‘‘amhākaṃ ñātako thero sīlavā kalyāṇadhammo’’ti pasannacitto hutvā taṃ bhikkhuṃ anussarati, tassa so cittappasādopi taṃ anussaraṇamattampi mahapphalaṃ mahānisaṃsameva hoti, anekāni kappasatasahassāni duggatito vāretuṃ ante ca amataṃ pāpetuṃ samatthameva hoti.
For when the deceased father or mother of a bhikkhu, with a faithful mind thinks, "Our relative, the elder, is virtuous and of good character," and recollects that bhikkhu, that very confidence of mind and that mere act of recollection becomes of great fruit and great benefit for them; it is indeed capable of protecting them from a woeful state for many hundreds of thousands of aeons and of leading them to the deathless in the end.
Quả thực, nếu cha hoặc mẹ của một vị Tỳ-khưu đã qua đời, với tâm thanh tịnh, nhớ nghĩ về vị Tỳ-khưu đó rằng: "Vị Trưởng lão thân quyến của chúng ta là người giữ giới (sīla), có pháp hạnh tốt đẹp", thì sự thanh tịnh của tâm đó hoặc chỉ riêng sự nhớ nghĩ đó cũng mang lại quả báo lớn và lợi ích lớn. Điều đó có khả năng ngăn chặn (người đã chết) khỏi cõi khổ (duggati) trong hàng trăm ngàn kiếp và cuối cùng đưa đến Niết-bàn (amata).
Vuttañhetaṃ bhagavatā ‘‘ye te, bhikkhave, bhikkhū sīlasampannā samādhisampannā paññā, vimutti, vimuttiñāṇadassanasampannā, dassanaṃpāhaṃ, bhikkhave, tesaṃ bhikkhūnaṃ bahukāraṃ vadāmi.
For this was said by the Blessed One: "Bhikkhus, for those bhikkhus who are accomplished in virtue, accomplished in concentration, in wisdom, in liberation, and in the knowledge and vision of liberation, even seeing them, I say, is of great help.
Điều này đã được Đức Thế Tôn dạy: "Này các Tỳ-khưu, những Tỳ-khưu nào có đầy đủ giới (sīla), đầy đủ định (samādhi), đầy đủ tuệ (paññā), giải thoát (vimutti), và kiến giải về giải thoát (vimuttiñāṇadassana), này các Tỳ-khưu, ta nói rằng sự thấy (dassana) các Tỳ-khưu đó có nhiều lợi ích.
Savanaṃ, anussatiṃ, anupabbajjaṃ, upasaṅkamanaṃ, payirupāsanaṃpāhaṃ, bhikkhave, tesaṃ bhikkhūnaṃ bahukāraṃ vadāmī’’ti (itivu. 104).
Hearing them, recollecting them, going forth after them, approaching them, and attending on them, Bhikkhus, I say, is of great help for those bhikkhus."
Này các Tỳ-khưu, ta nói rằng sự nghe (savana), sự nhớ nghĩ (anussati), sự xuất gia theo (anupabbajja), sự đến gần (upasaṅkamana), sự phụng sự (payirupāsana) các Tỳ-khưu đó có nhiều lợi ích."
Tasmā ñātisālohitānaṃ attani cittappasādassa anussatiyā ca mahapphalataṃ icchantenāpi sīlādiguṇayutteneva, bhavitabbanti dasseti.
Therefore, it shows that one who wishes for the great fruitfulness of their relatives' and kinsmen's confidence of mind and recollection of them must also be endowed with virtues such as sīla.
Do đó, để mong muốn sự thanh tịnh của tâm và sự nhớ nghĩ của thân quyến đối với mình có quả báo lớn, lợi ích lớn, thì (vị Tỳ-khưu) cũng phải có đầy đủ giới (sīla) v.v. và đức hạnh. Điều này được chỉ ra.
66. Pañcamavāre aratiratisaho assanti aratiyā ratiyā ca saho abhibhavitā ajjhottharitā bhaveyyaṃ.
66. In the fifth section, aratiratisaho assaṃ means: "may I be one who endures, overcomes, and overwhelms discontent and delight."
Trong lần thứ năm, aratiratisaho assaṃ (ta có thể vượt qua sự bất mãn và sự thỏa mãn) có nghĩa là ta có thể chế ngự và vượt qua sự bất mãn (arati) và sự thỏa mãn (rati).
Ettha ca aratīti adhikusalesu dhammesu pantasenāsanesu ca ukkaṇṭhā.
Herein, arati means discontent with higher wholesome states and with secluded lodgings.
Ở đây, aratī (bất mãn) là sự chán nản đối với các pháp thiện cao thượng (adhikusalesu dhammesu) và các trú xứ thanh vắng (pantasenāsanesu).
Ratīti pañcakāmaguṇarati.
Rati means delight in the five strands of sensual pleasure.
Ratī (thỏa mãn) là sự thỏa mãn trong năm dục lạc (pañcakāmaguṇarati).
Na ca maṃ arati saheyyāti mañca arati na abhibhaveyya na maddeyya na ajjhotthareyya.
Na ca maṃ arati saheyyā means: "and may that discontent not overcome, crush, or overwhelm me."
Na ca maṃ arati saheyyā (sự bất mãn không thể chế ngự ta) có nghĩa là sự bất mãn không thể chế ngự, đè nén, hoặc vượt qua ta.
Uppannanti jātaṃ nibbattaṃ.
Uppannaṃ means arisen, produced.
Uppannaṃ (đã sinh khởi) là đã phát sinh, đã hình thành.
Sīlādiguṇayutto hi aratiñca ratiñca sahati ajjhottharati madditvā tiṭṭhati.
For one who is endowed with virtues such as sīla endures, overwhelms, and stands firm, having crushed both discontent and delight.
Quả thực, người có đầy đủ giới (sīla) v.v. và đức hạnh có thể chế ngự, vượt qua và đứng vững sau khi đè nén cả sự bất mãn và sự thỏa mãn.
Tasmā īdisaṃ attānaṃ icchantenāpi sīlādiguṇayutteneva bhavitabbanti dasseti.
Therefore, it shows that one who wishes to be such a person must also be endowed with virtues such as sīla.
Do đó, để mong muốn bản thân mình trở thành người như vậy, thì (vị Tỳ-khưu) cũng phải có đầy đủ giới (sīla) v.v. và đức hạnh. Điều này được chỉ ra.
Thero kira maggaṃ paṭipanno aññataraṃ pāsādikaṃ araññaṃ disvā ‘‘idhevajja samaṇadhammaṃ katvā gamissāmī’’ti maggā okkamma aññatarasmiṃ rukkhamūle saṅghāṭiṃ paññapetvā pallaṅkaṃ ābhujitvā nisīdi.
It is said that the elder, while journeying on a path, saw a certain pleasant forest and thought, "Today I will practice the ascetic's duties right here before going on." He stepped off the path, spread his outer robe at the foot of a certain tree, and sat down cross-legged.
Nghe nói, khi vị Trưởng lão đang đi trên đường, thấy một khu rừng thanh tịnh, Ngài nghĩ: "Hôm nay ta sẽ tu tập pháp Sa-môn ở đây rồi sẽ đi tiếp." Ngài rời đường, trải y Tăng-già-lê (saṅghāṭi) dưới gốc một cây nọ, rồi ngồi kiết già.
Rukkhadevatāya dārakā therassa sīlatejena sakabhāvena saṇṭhātuṃ asakkontā vissaramakaṃsu.
The children of the tree-deity, unable to remain in their own forms due to the elder's majestic virtue, made a discordant noise.
Các con của vị thiên nữ cây, do uy lực giới (sīla) của vị Trưởng lão, không thể giữ được hình dạng của mình nên đã kêu la thảm thiết.
Devatāpi rukkhaṃ cālesi.
The deity also shook the tree.
Vị thiên nữ cũng lay cây.
Thero acalova nisīdi.
The elder sat unshaken.
Vị Trưởng lão vẫn ngồi bất động.
Sā devatā dhūmāyi, pajjali, neva sakkhi theraṃ cāletuṃ, tato upāsakavaṇṇenāgantvā vanditvā aṭṭhāsi.
That deity created smoke and flames, but could not make the elder move. Then, approaching in the guise of a female lay devotee, she paid homage and stood there.
Vị thiên nữ bốc khói, bùng cháy, nhưng vẫn không thể làm vị Trưởng lão lay chuyển. Sau đó, nàng hiện thân thành một nữ cư sĩ, đến đảnh lễ rồi đứng đó.
‘‘Ko eso’’ti vuttā ‘‘ahaṃ, bhante, etasmiṃ rukkhe adhivatthā devatā’’ti avoca.
When asked, "Who is that?" she said, "Venerable sir, I am the deity dwelling in this tree."
Khi được hỏi "Ai đó?", nàng thưa: "Bạch Đại đức, con là thiên nữ trú ngụ trong cây này."
Tvaṃ ete vikāre akāsīti.
"Did you create these disturbances?"
"Ngươi đã làm những điều kỳ lạ này sao?"
Āma bhanteti.
"Yes, venerable sir."
"Vâng, bạch Đại đức," nàng đáp.
Kasmāti ca vuttā āha – ‘‘tumhākaṃ, bhante, sīlatejena dārakā sakabhāvena saṇṭhātuṃ asakkontā vissaramakaṃsu, sāhaṃ tumhe palāpetuṃ evamakāsi’’nti.
And when asked why, she said: "Venerable sir, because of the majesty of your virtue, my children were unable to remain in their own forms and made a discordant noise. I did this to make you leave."
Khi được hỏi "Tại sao?", nàng thưa: "Bạch Đại đức, do uy lực giới (sīla) của Ngài, các con của con không thể giữ được hình dạng của mình nên đã kêu la thảm thiết. Vì vậy, con đã làm như vậy để xua đuổi Ngài."
Thero āha – ‘‘atha kasmā idha, bhante, mā vasatha, mayhaṃ aphāsūti paṭikacceva nāvacāsi.
The elder said: "Then why did you not say at the very beginning, 'Venerable sir, please do not stay here; it is inconvenient for me'?
Vị Trưởng lão nói: "Vậy tại sao, bạch Đại đức, trước đó ngươi không nói rằng: 'Xin Ngài đừng ở đây, con cảm thấy không thoải mái'?
Idāni pana mā kiñci avaca, ariyakoṭiyamahādatto amanussabhayena gatoti vacanato lajjāmi, tenāhaṃ idheva vasissaṃ, tvaṃ pana ajjekadivasaṃ yattha katthaci vasāhī’’ti.
But now, do not say anything. I would be ashamed if it were said, 'Mahādatta of Ariyakoṭi left due to fear of a non-human being.' For that reason, I will stay right here. You, however, may stay wherever you like for this one day."
Bây giờ thì đừng nói gì nữa, ta xấu hổ khi người ta nói rằng Trưởng lão Mahādatta ở Ariyakoṭiya đã bỏ đi vì sợ phi nhân. Vì vậy, ta sẽ ở lại đây, còn ngươi thì hôm nay hãy đi trú ngụ ở bất cứ đâu."
Evaṃ sīlādiguṇayutto bhayabheravasaho hoti.
Thus, one endowed with virtues such as sīla is an endurer of fear and terror.
Như vậy, người có đầy đủ giới (sīla) v.v. và đức hạnh có thể chế ngự sự sợ hãi và kinh hoàng.
Tasmā īdisamattānaṃ icchantenāpi sīlādiguṇayutteneva bhavitabbanti dasseti.
Therefore, it shows that one who wishes to be such a person must also be endowed with virtues such as sīla.
Do đó, để mong muốn bản thân mình trở thành người như vậy, thì (vị Tỳ-khưu) cũng phải có đầy đủ giới (sīla) v.v. và đức hạnh. Điều này được chỉ ra.
Sattamavāre ābhicetasikānanti abhicetoti abhikkantaṃ visuddhacittaṃ vuccati, adhicittaṃ vā, abhicetasi jātāni ābhicetasikāni, abhiceto sannissitānīti vā ābhicetasikāni.
In the seventh section, regarding ābhicetasikānaṃ: abhiceto is said to be the excellent, purified mind, or the higher mind. Born in the higher mind, they are ābhicetasikāni; or dependent on the higher mind, they are ābhicetasikāni.
Trong lần thứ bảy, ābhicetasikānaṃ (của những điều liên quan đến tâm cao thượng): abhiceto (tâm cao thượng) được gọi là tâm thanh tịnh vượt trội, hoặc tâm siêu việt. Những gì sinh khởi trong tâm cao thượng là ābhicetasikāni, hoặc những gì nương tựa vào tâm cao thượng là ābhicetasikāni.
Diṭṭhadhammasukhavihārānanti diṭṭhadhamme sukhavihārānaṃ.
Diṭṭhadhammasukhavihārānaṃ means "of the blissful abidings in the here-and-now."
Diṭṭhadhammasukhavihārānaṃ (của những trú xứ hạnh phúc trong hiện tại) là của những trú xứ hạnh phúc trong hiện tại.
Diṭṭhadhammoti paccakkho attabhāvo vuccati, tattha sukhavihārabhūtānanti attho, rūpāvacarajjhānānametaṃ adhivacanaṃ.
Diṭṭhadhammo is said to be the present state of existence; the meaning is "which are blissful abidings therein." This is a designation for the form-sphere jhānas.
Diṭṭhadhammo (hiện tại) được gọi là thân thể hiện tại, có nghĩa là những trú xứ hạnh phúc trong đó. Đây là tên gọi của các thiền sắc giới (rūpāvacarajjhāna).
Tāni hi appetvā nisinnā jhāyino imasmiṃyeva attabhāve asaṃkiliṭṭhaṃ nekkhammasukhaṃ vindanti, tasmā ‘‘diṭṭhadhammasukhavihārānī’’ti vuccanti.
For meditators sitting having attained them find the unblemished bliss of renunciation in this very state of existence. Therefore, they are called "blissful abidings in the here-and-now."
Quả thực, những thiền giả đã chứng đắc các thiền đó sẽ cảm nhận được hạnh phúc ly dục (nekkhammasukha) không bị ô nhiễm ngay trong thân thể hiện tại này. Vì vậy, chúng được gọi là "diṭṭhadhammasukhavihārāni" (trú xứ hạnh phúc trong hiện tại).
Nikāmalābhīti nikāmena lābhī attano icchāvasena lābhī, icchiticchitakkhaṇe samāpajjituṃ samatthoti vuttaṃ hoti.
Nikāmalābhī means a gainer at will, a gainer according to one's own wish. This means one is able to attain it at any moment one wishes.
Nikāmalābhī (người đạt được tùy ý) là người đạt được tùy theo ý muốn của mình. Có nghĩa là người có khả năng nhập thiền bất cứ lúc nào mình muốn.
Akicchalābhīti sukheneva paccanīkadhamme vikkhambhetvā samāpajjituṃ samatthoti vuttaṃ hoti.
Akicchalābhī means a gainer without difficulty. This means one is able to attain it with ease, having suppressed the opposing states.
Akicchalābhī (người đạt được dễ dàng) có nghĩa là người có khả năng nhập thiền dễ dàng bằng cách chế ngự các pháp đối nghịch.
Akasiralābhīti akasirānaṃ vipulānaṃ lābhī, yathāparicchedeyeva vuṭṭhātuṃ samatthoti vuttaṃ hoti.
Akasiralābhī means a gainer of what is not troublesome, but abundant. This means one is able to emerge from it precisely as determined.
Akasiralābhī (người đạt được không khó khăn) là người đạt được rộng lớn không khó khăn, có nghĩa là người có khả năng xuất thiền đúng theo giới hạn đã định.
Ekacco hi lābhīyeva hoti, na pana sakkoti icchiticchitakkhaṇe samāpajjituṃ.
For a certain person is indeed a gainer, but is not able to attain it at any moment he wishes.
Có người chỉ đạt được (thiền), nhưng không thể nhập thiền bất cứ lúc nào mình muốn.
Ekacco sakkoti tathā samāpajjituṃ, pāribandhike pana kicchena vikkhambheti.
One person is able to attain absorption in that way, but suppresses the hindrances with difficulty.
Một số người có thể nhập định như vậy, nhưng khó khăn lắm mới chế ngự được các chướng ngại.
Ekacco tathā samāpajjati, pāribandhike ca akiccheneva vikkhambheti, na sakkoti nāḷikāyantaṃ viya yathāparicchedeyeva ca vuṭṭhātuṃ.
One person attains absorption in that way and suppresses the hindrances without difficulty, but is not able to emerge at the precisely determined moment, like a water clock.
Một số người khác lại có thể nhập định như vậy, và dễ dàng chế ngự các chướng ngại, nhưng không thể xuất định theo ý muốn như một chiếc đồng hồ.
Yo pana imaṃ tividhampi sampadaṃ icchati, sopi sīlesvevassa paripūrakārīti.
But whoever desires this threefold accomplishment, they too should be one who fulfills the moral precepts.
Còn ai mong muốn thành tựu cả ba sự viên mãn này, người ấy cũng phải là người hoàn thiện trong giới (sīla).
Tattha santāti aṅgasantatāya ceva ārammaṇasantatāya ca.
Therein, peaceful means because of the peacefulness of their factors and the peacefulness of their object.
Trong đó, “an tịnh” (santā) là do các chi an tịnh và đối tượng an tịnh.
Vimokkhāti paccanīkadhammehi vimuttattā ārammaṇe ca adhimuttattā.
Liberations means because of being liberated from opposing states and because of being resolved upon the object.
“Giải thoát” (vimokkhā) là do giải thoát khỏi các pháp đối nghịch và do giải thoát trong đối tượng.
Atikkamma rūpeti rūpāvacarajjhāne atikkamitvā, ye te vimokkhā atikkamma rūpe santāti padasambandho, itarathā hi atikkamma rūpe kiṃ karotīti na paññāyeyyuṃ.
Having transcended forms means having transcended the form-sphere jhānas. The connection of the words is: “those liberations that are peaceful, having transcended forms.” Otherwise, it would not be clear what one does after having transcended forms.
“Vượt qua sắc” (atikkamma rūpe) là vượt qua các thiền sắc giới (rūpāvacarajjhāna). Sự liên kết từ ngữ là: “những giải thoát an tịnh đó vượt qua sắc”. Nếu không, sẽ không rõ “vượt qua sắc thì làm gì?”
Āruppāti ārammaṇato ca vipākato ca rūpavirahitā.
Formless means they are devoid of form with respect to their object and their result.
“Vô sắc” (āruppā) là không có sắc, cả về đối tượng lẫn quả.
Kāyena phusitvāti nāmakāyena phusitvā pāpuṇitvā, adhigantvāti vuttaṃ hoti.
Having touched with the body means having touched with the mental body, having attained, having realized; this is what is said.
“Chạm đến bằng thân” (kāyena phusitvā) có nghĩa là chạm đến bằng danh thân (nāmakāya), đạt được.
Sesaṃ vuttānameva.
The rest is as already explained.
Phần còn lại là những gì đã được nói.
Idaṃ vuttaṃ hoti ‘‘yopi bhikkhu ime vimokkhe phusitvā viharitukāmo, sopi sīlesvevassa paripūrakārī’’ti.
This is what is said: “Whatever monk wishes to dwell having touched these liberations, they too should be one who fulfills the moral precepts.”
Điều này có nghĩa là: “Vị tỳ khưu nào muốn an trú sau khi chạm đến những giải thoát này, vị ấy cũng phải là người hoàn thiện trong giới (sīla).”
67. Navamavāre tiṇṇaṃ saṃyojanānanti sakkāyadiṭṭhivicikicchāsīlabbataparāmāsasaṅkhātānaṃ tiṇṇaṃ bandhanānaṃ.
67. In the ninth section, of the three fetters means of the three bonds designated as identity view, doubt, and adherence to rules and observances.
Trong đoạn thứ chín, “ba kiết sử” (tiṇṇaṃ saṃyojanānaṃ) là ba sự ràng buộc được gọi là thân kiến (sakkāyadiṭṭhi), hoài nghi (vicikicchā) và giới cấm thủ (sīlabbataparāmāsa).
Tāni hi saṃyojenti khandhagatibhavādīhi khandhagatibhavādayo, kammaṃ vā phalena, tasmā saṃyojanānīti vuccanti, bandhanānīti attho.
For they fetter existences associated with the aggregates, and so on, to those existences associated with the aggregates, and so on, or they fetter kamma to its result. Therefore, they are called fetters; the meaning is bonds.
Chúng ràng buộc các uẩn, các cảnh giới tái sinh (bhava) với các uẩn, các cảnh giới tái sinh, hoặc nghiệp với quả. Do đó, chúng được gọi là “kiết sử” (saṃyojanāni), tức là những sự ràng buộc.
Parikkhayāti parikkhayena.
Through the complete destruction means through their complete destruction.
“Do đoạn trừ” (parikkhayā) có nghĩa là do sự đoạn trừ.
Sotāpannoti sotaṃ āpanno.
Stream-enterer means one who has entered the stream.
“Bậc Dự Lưu” (Sotāpanno) là người đã nhập dòng (sota).
Sototi ca maggassetaṃ adhivacanaṃ.
And ‘stream’ is a designation for the path.
Và “dòng” (sota) là tên gọi của đạo lộ.
Sotāpannoti taṃsamaṅgipuggalassa.
Stream-enterer is a designation for the person possessing that path.
“Bậc Dự Lưu” (Sotāpanno) là của người có đạo lộ đó.
Yathāha ‘‘soto sototi hidaṃ, sāriputta, vuccati.
As it is said: “This is called ‘stream, stream,’ Sāriputta.
Như đã nói:
Katamo nu kho, sāriputta, sototi?
Now what, Sāriputta, is the stream?
“Này Sāriputta, người ta gọi là ‘dòng, dòng’.
Ayameva hi, bhante, ariyo aṭṭhaṅgiko maggo.
It is this very Noble Eightfold Path, venerable sir.
Này Sāriputta, dòng là gì?
Seyyathidaṃ, sammādiṭṭhi…pe… sammāsamādhīti.
That is, right view… and so on… right concentration.
Thưa Tôn giả, chính là Bát Chánh Đạo này: tức là chánh kiến… (v.v.)… chánh định.”
Sotāpanno sotāpannoti hidaṃ, sāriputta, vuccati.
This is called ‘stream-enterer, stream-enterer,’ Sāriputta.
“Này Sāriputta, người ta gọi là ‘bậc Dự Lưu, bậc Dự Lưu’.
Katamo nu kho, sāriputta, sotāpannoti?
Now who, Sāriputta, is a stream-enterer?
Này Sāriputta, bậc Dự Lưu là gì?
Yo hi, bhante, iminā aṭṭhaṅgikena maggena samannāgato, ayaṃ vuccati sotāpanno, yoyaṃ āyasmā evaṃnāmo evaṃgotto’’ti.
Whoever, venerable sir, is endowed with this Eightfold Path, they are called a stream-enterer, that venerable one of such a name and such a clan.”
Thưa Tôn giả, người nào đầy đủ Bát Chánh Đạo này, người ấy được gọi là bậc Dự Lưu, tức là vị tôn giả mang tên như vậy, thuộc dòng họ như vậy.”
Idha pana maggena phalassa nāmaṃ dinnaṃ, tasmā phalaṭṭho ‘‘sotāpanno’’ti veditabbo.
Here, however, the name of the fruit is given by way of the path; therefore, ‘stream-enterer’ should be understood as one established in the fruit.
Tuy nhiên, ở đây, tên của đạo lộ được dùng để chỉ quả, do đó, người an trú trong quả được hiểu là “bậc Dự Lưu” (sotāpanno).
Avinipātadhammoti vinipātetīti vinipāto, nāssa vinipāto dhammoti avinipātadhammo, na attānaṃ apāye vinipātasabhāvoti vuttaṃ hoti.
Not subject to falling away means that which causes falling away is a fall; for them, there is no nature of falling away, so they are not subject to falling away. What is said is that they do not have the nature of causing themselves to fall into a lower realm.
“Không còn rơi rớt” (avinipātadhammo): “rơi rớt” (vinipāto) là điều làm cho rơi rớt; “không còn rơi rớt” (avinipātadhammo) là không có pháp làm cho rơi rớt, tức là không có bản chất tự mình rơi vào các cảnh khổ (apāya).
Ye dhammā apāyagamaniyā, tesaṃ pahīnattā.
Because the states that lead to the lower realms have been abandoned.
Vì những pháp dẫn đến cảnh khổ đã được đoạn trừ.
Sambodhi paraṃ ayanaṃ gati assāti sambodhiparāyaṇo, uparimaggattayaṃ avassaṃ sampāpakoti attho.
One whose destination is supreme enlightenment is bound for enlightenment; the meaning is that they will certainly attain the three higher paths.
“Hướng đến giác ngộ” (sambodhiparāyaṇo) có nghĩa là giác ngộ là nơi nương tựa, là đích đến tối thượng của người ấy, tức là chắc chắn sẽ đạt được ba đạo lộ phía trên.
Paṭiladdhapaṭhamamaggattā.
Because they have attained the first path.
Vì đã đạt được đạo lộ đầu tiên.
Sīlesvevāti īdiso hotukāmopi sīlesvevassa paripūraṇārīti.
In the moral precepts means that one who wishes to become like this should be one who fulfills the moral precepts.
“Chỉ trong giới” (sīlesvevā): người muốn trở thành như vậy cũng phải hoàn thiện trong giới (sīla).
Dasamavāre paṭhamamaggena parikkhīṇānipi tīṇi saṃyojanāni sakadāgāmimaggassa vaṇṇabhaṇanatthaṃ vuttāni.
In the tenth section, the three fetters, though already destroyed by the first path, are mentioned to praise the path of the once-returner.
Trong đoạn thứ mười, ba kiết sử đã được đoạn trừ bằng đạo lộ đầu tiên cũng được đề cập để ca ngợi đạo lộ Nhất Lai (sakadāgāmimagga).
Rāgadosamohānaṃ tanuttāti etesaṃ tanubhāvena, tanuttakaraṇenāti vuttaṃ hoti.
Through the attenuation of greed, hatred, and delusion means through the attenuation of these states; what is said is through the act of making them attenuated.
“Do tham, sân, si giảm thiểu” (rāgadosamohānaṃ tanuttā) có nghĩa là do sự thưa thớt, làm cho mỏng manh của chúng.
Tattha dvīhi kāraṇehi tanuttaṃ veditabbaṃ adhiccuppattiyā ca pariyuṭṭhānamandatāya ca.
Therein, the attenuation should be understood in two ways: through infrequent arising and through the weakness of their manifestation.
Trong đó, cần hiểu sự giảm thiểu do hai nguyên nhân: sự phát sinh không thường xuyên và sự yếu ớt của các phiền não (kilesa) khi chúng phát sinh.
Sakadāgāmissa hi vaṭṭānusārimahājanasseva kilesā abhiṇhaṃ na uppajjanti, kadāci karahaci uppajjanti viraḷākārā hutvā, viraḷavāpite khette aṅkurā viya.
For a once-returner, defilements do not arise frequently as they do for the great mass of people who follow the round of existence; they arise only occasionally, being of a sparse nature, like seedlings in a sparsely sown field.
Đối với bậc Nhất Lai (Sakadāgāmī), các phiền não không phát sinh thường xuyên như đối với đại chúng luân hồi, mà chỉ thỉnh thoảng phát sinh một cách thưa thớt, như những mầm cây trong một cánh đồng được gieo thưa thớt.
Uppajjamānāpi ca vaṭṭānusārimahājanasseva maddantā pharantā chādentā andhakāraṃ karontā na uppajjanti, mandamandā uppajjanti tanukākārā hutvā, abbhapaṭalamiva makkhikāpattamiva ca.
And even when they do arise, they do not arise with crushing, pervasive, and overwhelming force that creates darkness, as they do for the great mass of people who follow the round of existence; they arise very weakly, being of a thin nature, like a film of cloud or the wing of a fly.
Ngay cả khi chúng phát sinh, chúng cũng không phát sinh một cách áp đảo, lan tràn, che khuất và tạo ra bóng tối như đối với đại chúng luân hồi, mà phát sinh một cách yếu ớt, thưa thớt, như một lớp mây mỏng hay một cánh ruồi.
Sakadāgāmīti sakiṃ āgamanadhammo.
Once-returner means one who has the nature of returning once.
“Bậc Nhất Lai” (Sakadāgāmī) là người có bản chất chỉ trở lại một lần.
Sakideva imaṃ lokaṃ āgantvāti ekavāraṃyeva imaṃ manussalokaṃ paṭisandhivasena āgantvā.
Having come to this world just once means having come to this human world by way of rebirth just one time.
“Chỉ trở lại thế giới này một lần” (sakideva imaṃ lokaṃ āgantvā) có nghĩa là chỉ một lần tái sinh vào thế giới loài người này.
Yopi hi idha sakadāgāmimaggaṃ bhāvetvā idheva parinibbāti, sopi idha na gahito.
One who develops the once-returner path here and attains final extinguishment here is not included here.
Người nào tu tập đạo Nhất Lai (sakadāgāmimagga) ở đây và chứng Niết Bàn (parinibbāna) ngay tại đây, người ấy không được bao gồm ở đây.
Yopi idha maggaṃ bhāvetvā devesu upapajjitvā tattheva parinibbāti.
Nor is one who develops the path here, is reborn among the devas, and attains final extinguishment right there.
Người nào tu tập đạo lộ ở đây, tái sinh vào cõi trời và chứng Niết Bàn ngay tại đó.
Yopi devaloke maggaṃ bhāvetvā tattheva parinibbāti.
Nor is one who develops the path in the deva world and attains final extinguishment right there.
Người nào tu tập đạo lộ ở cõi trời và chứng Niết Bàn ngay tại đó.
Yopi devaloke maggaṃ bhāvetvā idheva manussaloke nibbattitvā parinibbāti.
Nor is one who develops the path in the deva world, is reborn here in the human world, and attains final extinguishment.
Người nào tu tập đạo lộ ở cõi trời, tái sinh vào thế giới loài người này và chứng Niết Bàn.
Yo pana idha maggaṃ bhāvetvā devaloke nibbatto, tattha yāvatāyukaṃ ṭhatvā puna idheva upapajjitvā parinibbāti, ayamidha gahitoti veditabbo.
But one who develops the path here, is reborn in the deva world, remains there for the full lifespan, and is then reborn here again and attains final extinguishment—this one should be understood as included here.
Nhưng người nào tu tập đạo lộ ở đây, tái sinh vào cõi trời, an trú ở đó cho đến hết tuổi thọ, rồi lại tái sinh vào thế giới loài người này và chứng Niết Bàn, người ấy được hiểu là được bao gồm ở đây.
Dukkhassantaṃ kareyyanti vaṭṭadukkhassa paricchedaṃ kareyyaṃ.
Would make an end of suffering means I would make a complete cessation of the suffering of the round of existence.
“Chấm dứt khổ” (dukkhassantaṃ kareyya) có nghĩa là chấm dứt khổ luân hồi (vaṭṭadukkha).
Sīlesvevāti īdiso hotukāmopi sīlesvevassa paripūrakārīti.
In the moral precepts means that one who wishes to become like this should be one who fulfills the moral precepts.
“Chỉ trong giới” (sīlesvevā): người muốn trở thành như vậy cũng phải hoàn thiện trong giới (sīla).
Ekādasamavāre pañcannanti gaṇanaparicchedo.
In the eleventh section, of the five is a numerical determination.
Trong đoạn thứ mười một, “năm” (pañcannaṃ) là số lượng được xác định.
Orambhāgiyānanti oraṃ vuccati heṭṭhā, heṭṭhābhāgiyānanti attho, kāmāvacaraloke uppattipaccayānanti adhippāyo.
Lower fetters means fetters of the lower part; the intention is that they are the cause for rebirth in the sensual sphere.
“Hạ phần kiết sử” (orambhāgiyānaṃ): “oraṃ” có nghĩa là “phía dưới”, tức là những kiết sử thuộc phần dưới, ý nói những kiết sử là nhân duyên cho sự tái sinh trong cõi dục (kāmāvacaraloka).
Saṃyojanānanti bandhanānaṃ, tāni kāmarāgabyāpādasaṃyojanehi saddhiṃ pubbe vuttasaṃyojanāneva veditabbāni.
Fetters means bonds. They should be understood as the previously mentioned fetters along with the fetters of sensual craving and ill will.
“Kiết sử” (saṃyojanānaṃ) là những sự ràng buộc. Chúng được hiểu là những kiết sử đã được nói trước đó, cùng với kiết sử tham dục (kāmarāga) và sân hận (byāpāda).
Yassa hi etāni appahīnāni, so kiñcāpi bhavagge uppanno hoti, atha kho āyuparikkhayā kāmāvacare nibbattatiyeva, gilitabalisamacchūpamo svāyaṃ puggalo dīghasuttakena pāde baddhavihaṅgūpamo cāti veditabbo.
For one whose fetters are not abandoned, even if they are reborn at the peak of existence, they are certainly reborn in the sensual sphere upon the exhaustion of their lifespan. Such a person should be understood as being like a fish that has swallowed a baited hook, or like a bird with its feet tied by a long string.
Người nào chưa đoạn trừ những kiết sử này, dù có tái sinh vào cảnh giới cao nhất (bhavagge), nhưng khi tuổi thọ kết thúc, người ấy vẫn tái sinh vào cõi dục. Người này được ví như con cá nuốt mồi và con chim bị buộc chân bằng sợi dây dài.
Pubbe vuttānampi cettha vacanaṃ vaṇṇabhaṇanatthamevāti veditabbaṃ.
And the mention here of those previously stated should be understood as being for the purpose of praise.
Cũng cần hiểu rằng việc đề cập đến những kiết sử đã nói trước đó ở đây là để ca ngợi.
Opapātikoti sesayonipaṭikkhepavacanametaṃ.
Of spontaneous birth is a statement that rejects the other modes of birth.
“Hóa sinh” (Opapātiko) là từ chối các loại tái sinh khác.
Tatthaparinibbāyīti tattheva brahmaloke parinibbāyī.
Attaining final extinguishment there means attaining final extinguishment right there in the Brahma world.
“Chứng Niết Bàn tại đó” (Tatthaparinibbāyī) có nghĩa là chứng Niết Bàn ngay tại cõi Phạm thiên (brahmaloka) đó.
Anāvattidhammo tasmā lokāti tato brahmalokā paṭisandhivasena puna anāvattisabhāvo.
Not returning from that world means having the nature of not returning from that Brahma world by way of rebirth.
“Không còn trở lại thế giới đó” (Anāvattidhammo tasmā lokā) có nghĩa là không còn tái sinh trở lại cõi Phạm thiên đó nữa.
Sīlesvevāti īdiso hotukāmopi sīlesvevassa paripūrakārīti.
In the moral precepts means that one who wishes to become like this should be one who fulfills the moral precepts.
“Chỉ trong giới” (sīlesvevā): người muốn trở thành như vậy cũng phải hoàn thiện trong giới (sīla).
68. Evaṃ anāgāmimagge vutte kiñcāpi catutthamaggassa vāro āgato, atha kho naṃ bhagavā aggahetvāva yasmā na kevalā āsavakkhayābhiññā eva sīlānaṃ ānisaṃso, apica kho lokiyapañcābhiññāyopi, tasmā tāpi dassetuṃ, yasmā ca āsavakkhaye kathite desanā niṭṭhitā hoti, evañca sati imesaṃ guṇānaṃ akathitattā ayaṃ kathā muṇḍābhiññākathā nāma bhaveyya, tasmā ca abhiññāpāripūriṃ katvā dassetumpi, yasmā ca anāgāmimagge ṭhitassa sukhena iddhivikuppanā ijjhati, samādhiparibandhānaṃ kāmarāgabyāpādānaṃ samūhatattā, anāgāmī hi sīlesu ca samādhimhi ca paripūrakārī, tasmā yuttaṭṭhāneyeva lokiyābhiññāyo dassetumpi ‘‘ākaṅkheyya ce…pe… anekavihita’’nti evamādimāhāti ayamanusandhi.
68. Thus, when the path of the non-returner has been spoken of, although the turn for the fourth path has come, the Blessed One, not taking it up, showed those as well, because not only the direct knowledge of the destruction of the taints is the benefit of moral virtues, but also the five mundane direct knowledges. And because when the destruction of the taints is spoken of, the discourse is concluded, and if so, due to these qualities not being spoken of, this talk would be called a talk on bald direct knowledge. And for this reason, to show it after making the direct knowledges complete. And because for one established in the path of the non-returner, the accomplishment of supernormal power with its variations is easily achieved, due to the uprooting of sensual lust and ill will, which are hindrances to concentration. Indeed, a non-returner is one who fulfills moral virtues and concentration. Therefore, to also show the mundane direct knowledges in their proper place, he said, “Should he wish… and so on… of many kinds,” and so forth. This is the connection.
68. Khi con đường Bất Lai đã được nói đến như vậy, mặc dù đến lượt nói về con đường thứ tư (A-la-hán), nhưng Thế Tôn đã không đề cập đến nó. Vì ân đức của giới không chỉ riêng biệt là thắng trí diệt trừ các lậu hoặc (āsavakkhayābhiññā), mà còn là năm thắng trí thế gian (lokiyapañcābhiññā). Do đó, để trình bày cả những điều đó. Và vì khi sự diệt trừ lậu hoặc đã được nói đến thì bài pháp đã hoàn tất, và nếu như vậy mà các đức tính này (năm thắng trí thế gian) không được nói đến, thì bài pháp này sẽ trở thành một bài pháp về thắng trí "trọc lóc" (muṇḍābhiññākathā). Do đó, để trình bày sự viên mãn của thắng trí. Và vì đối với người đã an trú trên con đường Bất Lai, việc biến hóa thần thông (iddhivikuppanā) được thành tựu dễ dàng, bởi vì tham ái dục (kāmarāga) và sân hận (byāpāda) – những chướng ngại của định – đã bị nhổ tận gốc. Quả thật, vị Bất Lai là người hoàn thành viên mãn về giới và định. Do đó, để trình bày các thắng trí thế gian (lokiyābhiññāyo) tại chỗ thích hợp, Ngài đã nói những lời như ‘‘ākaṅkheyya ce…pe… anekavihita’’ (Nếu một Tỳ-khưu mong muốn…pe… nhiều loại khác nhau). Đó là mối liên hệ này.
69. Chaṭṭhābhiññāya āsavānaṃ khayāti arahattamaggena sabbakilesānaṃ khayā.
69. In the sixth direct knowledge, by the destruction of the taints means by the destruction of all defilements through the path of Arahantship.
69. Đối với thắng trí thứ sáu, āsavānaṃ khayā (do sự diệt tận các lậu hoặc) có nghĩa là do sự diệt tận tất cả các phiền não bằng con đường A-la-hán.
Anāsavanti āsavavirahitaṃ.
Taintless means devoid of taints.
Anāsavaṃ (không lậu hoặc) có nghĩa là không có lậu hoặc.
Cetovimuttiṃ paññāvimuttinti ettha cetovacanena arahattaphalasampayuttova samādhi, paññāvacanena taṃsampayuttā paññāva vuttā.
In liberation of mind, liberation by wisdom, herein, by the word ‘mind’, only the concentration associated with the fruit of Arahantship is meant; by the word ‘wisdom’, only the wisdom associated with it is meant.
Trong cụm từ cetovimuttiṃ paññāvimutti (tâm giải thoát và tuệ giải thoát) này, từ "tâm" (ceto) chỉ định chỉ định (samādhi) đi kèm với quả A-la-hán, và từ "tuệ" (paññā) chỉ định tuệ (paññā) đi kèm với nó.
Tattha ca samādhi rāgato vimuttattā cetovimutti, paññā avijjāya vimuttattā paññāvimuttīti veditabbā.
And therein, it should be understood that concentration is liberation of mind because it is liberated from lust, and wisdom is liberation by wisdom because it is liberated from ignorance.
Trong đó, định được biết là cetovimutti (tâm giải thoát) vì đã giải thoát khỏi tham ái (rāga), và tuệ được biết là paññāvimutti (tuệ giải thoát) vì đã giải thoát khỏi vô minh (avijjā).
Vuttañcetaṃ bhagavatā ‘‘yo hissa, bhikkhave, samādhi, tadassa samādhindriyaṃ.
And this was said by the Blessed One: “Whatever, bhikkhus, is his concentration, that is his faculty of concentration.
Điều này đã được Thế Tôn nói: ‘‘Này các Tỳ-khưu, định nào của vị ấy, đó là định căn của vị ấy.
Yā hissa, bhikkhave, paññā, tadassa paññindriyaṃ.
Whatever, bhikkhus, is his wisdom, that is his faculty of wisdom.
Này các Tỳ-khưu, tuệ nào của vị ấy, đó là tuệ căn của vị ấy.
Iti kho, bhikkhave, rāgavirāgā cetovimutti, avijjāvirāgā paññāvimuttī’’ti, apicettha samathaphalaṃ cetovimutti, vipassanāphalaṃ paññāvimuttīti veditabbā.
Thus, bhikkhus, through dispassion for lust there is liberation of mind; through dispassion for ignorance there is liberation by wisdom.” Moreover, herein, the fruit of serenity should be understood as liberation of mind, and the fruit of insight as liberation by wisdom.
Như vậy, này các Tỳ-khưu, tâm giải thoát là do ly tham (rāgavirāgā), tuệ giải thoát là do ly vô minh (avijjāvirāgā)’’. Hơn nữa, ở đây, quả của thiền chỉ (samatha) được biết là cetovimutti, và quả của thiền quán (vipassanā) được biết là paññāvimutti.
Evaṃ bhagavā sīlānisaṃsakathaṃ yāva arahattā kathetvā idāni sabbampi taṃ sīlānisaṃsaṃ sampiṇḍetvā dassento nigamanaṃ āha ‘‘sampannasīlā, bhikkhave…pe… idametaṃ paṭicca vutta’’nti.
Thus the Blessed One, having taught the discourse on the benefits of moral virtue up to Arahantship, now, summarizing all those benefits of moral virtue, delivered the conclusion, saying: “Endowed with moral virtue, bhikkhus… and so on… This was said in reference to that.”
Như vậy, Thế Tôn đã nói về lợi ích của giới cho đến bậc A-la-hán. Giờ đây, để tóm tắt tất cả các lợi ích của giới đó, Ngài đã kết luận: ‘‘Này các Tỳ-khưu, hãy sống với giới hạnh viên mãn…pe… điều này đã được nói đến dựa trên điều đó’’.
Tassāyaṃ saṅkhepattho, ‘‘sampannasīlā, bhikkhave, viharatha…pe… samādāya sikkhatha sikkhāpadesū’’ti iti yaṃ taṃ mayā pubbe evaṃ vuttaṃ, idaṃ sabbampi sampannasīlo bhikkhu sabrahmacārīnaṃ piyo hoti manāpo, garu bhāvanīyo paccayānaṃ lābhī, paccayadāyakānaṃ mahapphalakaro, pubbañātīnaṃ anussaraṇacetanāya phalamahattakaro, aratiratisaho, bhayabheravasaho, rūpāvacarajjhānānaṃ arūpāvacarajjhānānañca lābhī, heṭṭhimāni tīṇi sāmaññaphalāni pañca lokiyābhiññā āsavakkhayañāṇanti ca ime ca guṇe sayaṃ abhiññā sacchikattā hoti, etaṃ paṭicca idaṃ sandhāya vuttanti.
This is its summary meaning: That which was previously stated by me thus, “Endowed with moral virtue, bhikkhus, dwell… and so on… undertake and train in the training rules,” — all of this was said in reference to this, with this in mind: a bhikkhu endowed with moral virtue is dear and agreeable to his companions in the holy life, respected and revered; he is a recipient of the requisites; he brings great fruit to the donors of the requisites; he brings great fruit to the commemorative thoughts of his deceased relatives; he is an endurer of discontent and delight; he is an endurer of fear and terror; he is a recipient of the form-sphere and formless-sphere absorptions; he is one who has realized for himself with direct knowledge these qualities, namely, the lower three fruits of the contemplative life, the five mundane direct knowledges, and the knowledge of the destruction of the taints.
Ý nghĩa tóm tắt của điều này là: ‘‘Này các Tỳ-khưu, hãy sống với giới hạnh viên mãn…pe… hãy thọ trì và học tập các học giới’’. Điều mà ta đã nói trước đây như vậy, tất cả những điều này có nghĩa là một Tỳ-khưu giới hạnh viên mãn sẽ được các vị đồng Phạm hạnh yêu mến, hài lòng, đáng tôn kính, đáng được tu tập lòng từ, được lợi dưỡng vật thực, là người mang lại quả báo lớn cho những người cúng dường vật thực, là người mang lại quả báo lớn cho ý muốn hồi hướng đến những bà con đã qua đời, là người chịu đựng được sự bất mãn và sự mãn nguyện, chịu đựng được sự sợ hãi và kinh hoàng, là người đạt được các thiền sắc giới và thiền vô sắc giới, và cũng là người tự mình chứng ngộ ba quả Sa-môn thấp hơn, năm thắng trí thế gian và trí tuệ diệt trừ lậu hoặc. Điều này đã được nói đến dựa trên điều đó.
Idamavoca bhagavā, attamanā te bhikkhu bhagavato bhāsitaṃ abhinandunti.
This the Blessed One said. Those bhikkhus, delighted, rejoiced in the Blessed One’s words.
Thế Tôn đã nói điều này, và các Tỳ-khưu hoan hỷ, vui mừng với lời dạy của Thế Tôn.
70. Evaṃ me sutanti vatthasuttaṃ.
70. The sutta beginning with Thus have I heard is the Vatthasutta.
70. Evaṃ me sutaṃ (Tôi đã nghe như vầy) là Kinh Vattha.
Tattha seyyathāpi, bhikkhave, vatthanti upamāvacanamevetaṃ.
Therein, Just as, bhikkhus, a cloth is simply a statement of simile.
Trong đó, seyyathāpi, bhikkhave, vattha (ví như, này các Tỳ-khưu, một tấm vải) là một câu ví dụ.
Upamaṃ karonto ca bhagavā katthaci paṭhamaṃyeva upamaṃ dassetvā pacchā atthaṃ dasseti, katthaci paṭhamamatthaṃ dassetvā pacchā upamaṃ, katthaci upamāya atthaṃ parivāretvā dasseti, katthaci atthena upamaṃ.
And the Blessed One, when making a simile, sometimes first shows the simile and afterwards shows the meaning; sometimes first shows the meaning and afterwards the simile; sometimes he shows the meaning surrounded by the simile; sometimes the simile by the meaning.
Khi đưa ra ví dụ, Thế Tôn đôi khi trình bày ví dụ trước rồi sau đó trình bày ý nghĩa; đôi khi trình bày ý nghĩa trước rồi sau đó trình bày ví dụ; đôi khi trình bày ý nghĩa được bao quanh bởi ví dụ; đôi khi ví dụ được bao quanh bởi ý nghĩa.
Tathā hesa – ‘‘seyyathāpissu, bhikkhave, dve agārā sadvārā, tattha cakkhumā puriso majjhe ṭhito passeyyā’’ti (ma. ni. 3.261) sakalampi devadūtasuttaṃ upamaṃ paṭhamaṃ dassetvā pacchā atthaṃ dassento āha.
Indeed, thus, he spoke, showing the simile first and afterwards showing the meaning, for the entire Devadūtasutta: “Just as if, bhikkhus, there were two houses with facing doors, and a man with good sight standing in the middle were to see.”
Chẳng hạn, trong toàn bộ Kinh Devadūta, Ngài đã trình bày ví dụ trước rồi sau đó trình bày ý nghĩa: ‘‘Này các Tỳ-khưu, ví như có hai ngôi nhà có cửa, một người có mắt đứng giữa có thể nhìn thấy’’ (Ma. Ni. 3.261).
‘‘Tirokuṭṭaṃ tiropākāraṃ tiropabbataṃ asajjamāno gacchati, seyyathāpi ākāse’’tiādinā (dī. ni. 1.238; paṭi. ma. 1.102) pana nayena sakalampi iddhividhamatthaṃ paṭhamaṃ dassetvā pacchā upamaṃ dassento āha.
But by the method beginning, “He goes unhindered through a wall, through a rampart, through a mountain, as if through open space,” he spoke, showing the meaning of the whole section on supernormal power first and afterwards showing the simile.
Còn theo cách ‘‘Đi xuyên tường, xuyên hàng rào, xuyên núi mà không bị vướng mắc, ví như trên hư không’’ (Dī. Ni. 1.238; Paṭi. Ma. 1.102) và các cách tương tự, Ngài đã trình bày toàn bộ thần thông trước rồi sau đó trình bày ví dụ.
‘‘Seyyathāpi brāhmaṇapuriso sāratthiko sāragavesī’’tiādināva (ma. ni. 1.318) nayena sakalampi cūḷasāropamasuttaṃ upamāya atthaṃ parivāretvā dassento āha.
By the method beginning, “Just as a man in need of heartwood, searching for heartwood,” he spoke, showing the meaning surrounded by the simile, for the entire Cūḷasāropamasutta.
Theo cách ‘‘Ví như một người Bà-la-môn tìm kiếm cốt lõi, đi tìm cốt lõi’’ (Ma. Ni. 1.318) và các cách tương tự, Ngài đã trình bày toàn bộ Kinh Cūḷasāropama (Ví Dụ Về Cốt Lõi Nhỏ) với ý nghĩa được bao quanh bởi ví dụ.
‘‘Idha pana, bhikkhave, ekacce kulaputtā dhammaṃ pariyāpuṇanti suttaṃ…pe… seyyathāpi, bhikkhave, puriso alagaddatthiko’’tiādinā (ma. ni. 1.238) nayena sakalampi alagaddasuttaṃ mahāsāropamasuttanti evamādīni suttāni atthena upamaṃ parivāretvā dassento āha.
And by the method beginning, “Herein, bhikkhus, some clansmen master the Dhamma—Sutta… and so on… Just as, bhikkhus, a man in need of a water snake,” he spoke, showing the simile surrounded by the meaning, for suttas such as the entire Alagaddasutta and the Mahāsāropamasutta.
Còn ở đây, ‘‘Này các Tỳ-khưu, một số thiện gia tử học Pháp, kinh…pe… ví như, này các Tỳ-khưu, một người tìm rắn độc’’ (Ma. Ni. 1.238) và các cách tương tự, Ngài đã trình bày toàn bộ Kinh Alagadda (Kinh Rắn Độc), Kinh Mahāsāropama (Kinh Ví Dụ Về Cốt Lõi Lớn) và các kinh tương tự, với ví dụ được bao quanh bởi ý nghĩa.
Svāyaṃ idha paṭhamaṃ upamaṃ dassetvā pacchā atthaṃ dasseti.
Here, this one first shows the simile and afterwards shows the meaning.
Ở đây, Ngài trình bày ví dụ trước rồi sau đó trình bày ý nghĩa.
Kasmā panevaṃ bhagavā dassetīti?
But why does the Blessed One show it in this way?
Vì sao Thế Tôn lại trình bày như vậy?
Puggalajjhāsayena vā desanāvilāsena vā.
Either because of the disposition of the person or because of the grace of the teaching.
Là do khuynh hướng của chúng sinh hoặc do sự khéo léo trong bài pháp.
Ye hi puggalā paṭhamaṃ upamaṃ dassetvā vuccamānamatthaṃ sukhena paṭivijjhanti, tesaṃ paṭhamaṃ upamaṃ dasseti.
For those persons who easily penetrate the meaning when it is spoken after the simile has first been shown, he shows the simile first.
Vì những người mà khi ví dụ được trình bày trước, họ dễ dàng thấu hiểu ý nghĩa được nói đến, thì Ngài trình bày ví dụ trước cho họ.
Esa nayo sabbattha.
This is the method in all cases.
Nguyên tắc này áp dụng cho tất cả mọi trường hợp.
Yassā ca dhammadhātuyā suppaṭividdhattā desanāvilāsaṃ patto hoti, tassā suppaṭividdhā.
And due to the thorough penetration of that Dhamma-element, he attains the grace of the teaching, and for him, it is thoroughly penetrated.
Và vì sự thấu hiểu sâu sắc Pháp tính (dhammadhātu) mà Ngài đạt được sự khéo léo trong bài pháp.
Tasmā esa desanāvilāsampatto dhammissaro dhammarājā, so yathā yathā icchati, tathā tathā dhammaṃ desetīti evaṃ iminā puggalajjhāsayena vā desanāvilāsena vā evaṃ dassetīti veditabbo.
Therefore, this Lord of the Dhamma, this King of the Dhamma, having attained the grace of the teaching, teaches the Dhamma in whatever way he wishes. Thus it should be understood that he shows it in this way either because of the disposition of the person or because of the grace of the teaching.
Do đó, vị Dhammissara (Chúa tể của Pháp), Dhammarājā (Vua của Pháp) này, người đã đạt được sự khéo léo trong bài pháp, Ngài thuyết Pháp theo bất cứ cách nào Ngài muốn. Vì vậy, cần phải hiểu rằng Ngài trình bày như vậy là do khuynh hướng của chúng sinh hoặc do sự khéo léo trong bài pháp.
Tattha vatthanti pakatiparisuddhaṃ vatthaṃ.
Therein, a cloth means a cloth that is naturally pure.
Trong đó, vattha (vải) là tấm vải vốn dĩ tinh khiết.
Saṃkiliṭṭhaṃ malaggahitanti āgantukena paṃsurajādinā saṃkilesena saṃkiliṭṭhaṃ, sedajallikādinā malena gahitattā malaggahitaṃ.
Stained and grime-laden means stained by the adventitious defilement of dust and dirt, and grime-laden because of being covered with the grime of sweat and so on.
Saṃkiliṭṭhaṃ malaggahitaṃ (bị dơ bẩn, dính bẩn) có nghĩa là bị dơ bẩn do các tạp chất bên ngoài như bụi bặm, và bị dính bẩn do các vết bẩn như mồ hôi.
Raṅgajāteti ettha raṅgameva raṅgajātaṃ.
In in a dye, the dye itself is the dye-stuff.
Raṅgajāte (trong thuốc nhuộm) ở đây, raṅgajātaṃ chính là raṅgaṃ (thuốc nhuộm).
Upasaṃhareyyāti upanāmeyya.
Were to dip means were to bring it near.
Upasaṃhareyyā (mang đến) có nghĩa là mang đến.
Yadi nīlakāyāti nīlakāya vā, nīlakatthāya vāti vuttaṃ hoti.
If for blue means either for the blue color or for the purpose of blue; this is what is meant.
Yadi nīlakāyā (nếu muốn màu xanh) có nghĩa là nếu muốn màu xanh hoặc để nhuộm màu xanh.
Evaṃ sabbattha.
So it is in all cases.
Tương tự cho tất cả các trường hợp.
Rajako hi nīlakatthāya upasaṃharanto kaṃsanīlapalāsanīlādike nīlaraṅge upasaṃharati.
For a dyer, when dipping for the purpose of blue, dips it into blue dyes like indigo blue or palāsa-leaf blue.
Thật vậy, người thợ nhuộm khi mang đến để nhuộm màu xanh thì nhuộm bằng các loại thuốc nhuộm xanh như xanh đồng, xanh lá cây.
Pītakatthāya upasaṃharanto kaṇikārapupphasadise pītakaraṅge.
When dipping for the purpose of yellow, into yellow dyes like the color of the kaṇikāra flower.
Khi mang đến để nhuộm màu vàng thì nhuộm bằng các loại thuốc nhuộm vàng giống như hoa kaṇikāra.
Lohitakatthāya upasaṃharanto bandhujīvakapupphasadise lohitakaraṅge.
When dipping for the purpose of red, into red dyes like the color of the bandhujīvaka flower.
Khi mang đến để nhuộm màu đỏ thì nhuộm bằng các loại thuốc nhuộm đỏ giống như hoa bandhujīvaka.
Mañjiṭṭhakatthāya upasaṃharanto kaṇavīrapupphasadise mandarattaraṅge.
When dipping for the purpose of madder, into pale red dyes like the color of the kaṇavīra flower.
Khi mang đến để nhuộm màu cánh kiến thì nhuộm bằng các loại thuốc nhuộm đỏ thẫm giống như hoa kaṇavīra.
Tena vuttaṃ ‘‘yadi nīlakāya…pe… yadi mañjiṭṭhakāyā’’ti.
Therefore, it was said, “if for blue… and so on… if for madder.”
Vì thế, đã nói ‘‘yadi nīlakāyā…pe… yadi mañjiṭṭhakāyā’’ (nếu muốn màu xanh…pe… nếu muốn màu cánh kiến).
Durattavaṇṇamevassāti duṭṭhu rañjitavaṇṇameva assa.
It would have a badly dyed color means it would have a color that is poorly dyed.
Màu sắc của nó sẽ bị nhuộm xấu (Durattavaṇṇamevassā) nghĩa là màu sắc của nó sẽ bị nhuộm một cách xấu xí.
Aparisuddhavaṇṇamevassāti nīlavaṇṇopissa parisuddho na bhaveyya, sesavaṇṇopi.
It would have an impure color means its blue color would not be pure, nor would its other colors.
Màu sắc của nó sẽ không tinh khiết (Aparisuddhavaṇṇamevassā) nghĩa là ngay cả màu xanh của nó cũng không thể tinh khiết, và các màu khác cũng vậy.
Tādisañhi vatthaṃ nīlakumbhiyā pakkhittampi sunīlaṃ na hoti, sesakumbhīsu pakkhittampi pītakādivaṇṇaṃ na hoti, milātanīla kuraṇḍa-kaṇikāra-bandhujīvaka-kaṇavīrapupphavaṇṇameva hoti.
Indeed, such a cloth, even when put into a vat of blue dye, does not become truly blue; even when put into other vats, it does not take on a yellow color or other colors; it only becomes the color of a faded blue kuraṇḍa flower, a kaṇikāra flower, a bandhujīvaka flower, or a kaṇavīra flower.
Thật vậy, một tấm vải như thế, dù được nhúng vào thùng thuốc nhuộm màu xanh cũng không thể trở nên xanh thẫm, dù được nhúng vào các thùng thuốc nhuộm khác cũng không thể có màu vàng hay các màu khác, mà chỉ có màu như hoa milātanīla, kuraṇḍa, kaṇikāra, bandhujīvaka, kaṇavīra đã úa tàn.
Taṃ kissa hetūti taṃ vatthaṃ kissa hetu kiṃ kāraṇā īdisaṃ hoti, tasmiṃ vā vatthe raṅgajātaṃ kissa hetu īdisaṃ durattavaṇṇaṃ aparisuddhavaṇṇaṃ hotīti?
For what reason? means for what reason, for what cause does that cloth become like this? Or, for what reason does the dye on that cloth become so badly dyed and impure in color?
Vì lý do gì? (Taṃ kissa hetū) nghĩa là vì lý do gì, vì nguyên nhân nào mà tấm vải đó lại trở nên như vậy, hoặc vì lý do gì mà thuốc nhuộm trên tấm vải đó lại có màu sắc xấu xí, không tinh khiết như thế?
Yasmā panassa vatthassa saṃkiliṭṭhabhāvoyevettha kāraṇaṃ, na aññaṃ kiñci, tasmā ‘‘aparisuddhattā, bhikkhave, vatthassā’’ti āha.
And since the reason for this is simply the stained state of the cloth and nothing else, He said, “Because of the impurity of the cloth, monks.”
Vì sự ô nhiễm của tấm vải là nguyên nhân ở đây, không có gì khác, do đó Ngài đã nói: “Này các Tỳ-khưu, vì sự không tinh khiết của tấm vải.”
Evameva khoti upamāsampaṭipādanaṃ.
Just so is the presentation of the simile.
Cũng vậy (Evameva kho) là lời dẫn nhập cho ví dụ.
Citte saṃkiliṭṭheti cittamhi saṃkiliṭṭhamhi.
When the mind is stained means when the mind is stained.
Khi tâm bị ô nhiễm (Citte saṃkiliṭṭhe) nghĩa là khi tâm bị ô nhiễm.
Kasmā pana bhagavā saṃkiliṭṭhavatthena opammaṃ akāsīti ce, vāyāmamahapphaladassanatthaṃ.
But if it is asked, why did the Blessed One make a comparison with a stained cloth? It was to show that effort bears great fruit.
Nếu hỏi: “Vì sao Đức Thế Tôn lại dùng ví dụ về tấm vải bị ô nhiễm?”, thì câu trả lời là để chỉ ra sự lợi ích to lớn của nỗ lực.
Yathā hi āgantukehi malehi saṃkiliṭṭhaṃ vatthaṃ pakatiyā paṇḍarattā puna dhovīyamānaṃ paṇḍaraṃ hoti, na tattha jātikāḷake viya eḷakalome vāyāmo nipphalo hoti, evaṃ cittampi āgantukehi kilesehi saṃkiliṭṭhaṃ.
For just as a cloth stained by adventitious defilements, being naturally white, becomes white again when washed, and the effort is not fruitless as it would be with the naturally black wool of a ram, so too the mind is stained by adventitious defilements.
Thật vậy, giống như một tấm vải bị ô nhiễm bởi những vết bẩn ngoại lai, vốn dĩ trắng tinh, khi được giặt lại sẽ trở nên trắng sạch, nỗ lực không vô ích như đối với lông cừu vốn dĩ đen tự nhiên; cũng vậy, tâm bị ô nhiễm bởi các phiền não ngoại lai.
Pakatiyā pana taṃ sakalepi paṭisandhibhavaṅgavāre paṇḍarameva.
But by nature, it is white throughout the entire course of rebirth-linking and bhavaṅga.
Tuy nhiên, bản chất của tâm trong tất cả các khoảnh khắc tái tục và hữu phần đều là trong sáng.
Yathāha – ‘‘pabhassaramidaṃ, bhikkhave, cittaṃ, tañca kho āgantukehi upakkilesehi upakkiliṭṭha’’nti (a. ni. 1.51).
As it is said: “This mind, monks, is luminous, but it is stained by adventitious corruptions.”
Như đã nói: “Này các Tỳ-khưu, tâm này vốn trong sáng, nhưng nó bị ô nhiễm bởi các uế nhiễm ngoại lai.”
Taṃ visodhīyamānaṃ sakkā pabhassarataraṃ kātuṃ, na tattha vāyāmo nipphaloti evaṃ vāyāmamahapphaladassanatthaṃ saṃkiliṭṭhavatthena opammaṃ akāsīti veditabbo.
When it is purified, it can be made more luminous; the effort therein is not fruitless. Thus, it should be understood that He made the comparison with a stained cloth to show that effort bears great fruit.
Khi tâm được thanh lọc, có thể làm cho nó trở nên trong sáng hơn, nỗ lực không vô ích ở đó, vì vậy cần phải hiểu rằng Ngài đã dùng ví dụ về tấm vải bị ô nhiễm để chỉ ra sự lợi ích to lớn của nỗ lực.
Anagāriyopi imasmiṃ sāsane pabbajito saṃkiliṭṭhacitto dūteyyapahiṇagamanaṃ gacchati, vejjakammaṃ karoti, saṅghabhedāya cetiyabhedāya parakkamati, veḷudānādīhi jīvikaṃ kappeti, sakalampi anācāraṃ agocarañca paripūreti, ayamassa anagāriyapaṭipattiduggati.So tattha ṭhito kāyassa bhedā nirayampi gacchati, tiracchānayonimpi, pettivisayampi gacchati samaṇayakkho nāma hoti samaṇapeto, ādittehi saṅghāṭiādīhi sampajjalitakāyo aṭṭassaraṃ karonto vicarati, ayamassa gatiduggati.
One gone forth in this Dispensation, having become a monk with a stained mind, undertakes the going on messages and errands, practices medicine, strives to create a schism in the Saṅgha and to destroy a cetiya, and makes a living by such means as giving bamboo; he fulfills all manner of misconduct and wrong resort. This is his woeful destination of practice for one gone forth. Established therein, at the breakup of the body, he goes to hell, the animal realm, or the sphere of ghosts; he becomes what is called a monk-yakkha or a monk-peta, and with his body ablaze from flaming robes and so on, he wanders about making painful cries. This is his woeful destination of rebirth.
Người xuất gia trong giáo pháp này, với tâm ô nhiễm, đi làm sứ giả, làm nghề y, nỗ lực gây chia rẽ Tăng đoàn, phá hoại tháp thờ, kiếm sống bằng cách cho mượn tre và các hành vi không chính đáng khác, hoàn thành tất cả các hành vi bất tịnh và không hợp pháp; đây là ác thú về hành vi của người xuất gia của người ấy. Người ấy, sau khi chết, sẽ rơi vào địa ngục, hoặc cảnh giới súc sinh, hoặc cảnh giới ngạ quỷ, trở thành một dạ-xoa sa-môn, một ngạ quỷ sa-môn, thân thể bốc cháy với y phục cháy rực, lang thang kêu la thảm thiết; đây là ác thú về cảnh giới của người ấy.
Seyyathāpīti sukkapakkhaṃ dassetumāraddho, tassattho kaṇhapakkhe vuttapaccanīkeneva veditabbo.
Just as begins the section showing the bright side, the meaning of which should be understood by way of the opposite of what was said in the dark-side section.
Ví như (Seyyathāpi) là bắt đầu trình bày về khía cạnh thiện, ý nghĩa của nó cần được hiểu ngược lại với những gì đã nói về khía cạnh bất thiện.
Etthāpi ca sugati nāma paṭipattisugati gatisugatīti duvidhā hoti.
Here too, a happy destination is twofold: the happy destination of practice and the happy destination of rebirth.
Ở đây, thiện thú cũng có hai loại: thiện thú về hành vi (paṭipattisugati) và thiện thú về cảnh giới (gatisugati).
Paṭipattisugatipi agāriyapaṭipattisugati anagāriyapaṭipattisugatīti duvidhā hoti.
The happy destination of practice is also twofold: the happy destination of practice for a householder and the happy destination of practice for one gone forth.
Thiện thú về hành vi cũng có hai loại: thiện thú về hành vi của người tại gia (agāriyapaṭipattisugati) và thiện thú về hành vi của người xuất gia (anagāriyapaṭipattisugati).
Agāriyo hi parisuddhacitto pāṇātipātāpi viramati, adinnādānāpi, sakalepi dasa kusalakammapathe paripūreti, ayamassa agāriyapaṭipattisugati.
A householder with a pure mind refrains from killing living beings, from taking what is not given, and fulfills all ten wholesome courses of action. This is his happy destination of practice for a householder.
Người tại gia với tâm thanh tịnh từ bỏ sát sinh, từ bỏ lấy của không cho, hoàn thành tất cả mười thiện nghiệp đạo; đây là thiện thú về hành vi của người tại gia của người ấy.
So tattha ṭhito kāyassa bhedā manussamahantatampi devamahantatampi upapajjati, ayamassa gatisugati.
Established therein, at the breakup of the body, he is reborn to greatness among humans or greatness among devas. This is his happy destination of rebirth.
Người ấy, sau khi chết, sẽ tái sinh làm người cao quý hoặc chư thiên cao quý; đây là thiện thú về cảnh giới của người ấy.
Anagāriyopi imasmiṃ sāsane pabbajitvā parisuddhacitto catupārisuddhisīlaṃ sodheti, terasa dhutaṅgāni samādiyati, aṭṭhatiṃsārammaṇesu attano anukūlakammaṭṭhānaṃ gahetvā pantasenāsane paṭisevamāno kasiṇaparikammaṃ katvā jhānasamāpattiyo nibbatteti, sotāpattimaggaṃ bhāveti…pe… anāgāmimaggaṃ bhāveti, ayamassa anagāriyapaṭipattisugati.
One gone forth, having become a monk in this Dispensation with a pure mind, purifies the fourfold purity of virtue, undertakes the thirteen ascetic practices, and having taken up a meditation subject suitable for himself from among the thirty-eight objects, and resorting to a secluded dwelling, he does the preliminary work on a kasiṇa, produces the jhāna attainments, develops the path of stream-entry... and so on... develops the path of non-returning. This is his happy destination of practice for one gone forth.
Người xuất gia trong giáo pháp này, sau khi xuất gia, với tâm thanh tịnh, giữ gìn Tứ Thanh Tịnh Giới, thọ trì mười ba pháp đầu đà, chọn một đề mục thiền phù hợp trong ba mươi tám đề mục, sống ở nơi thanh vắng, thực hành kasiṇa, đạt được các thiền định, tu tập Sơ quả Tu-đà-hoàn… cho đến tu tập quả Bất hoàn; đây là thiện thú về hành vi của người xuất gia của người ấy.
So tattha ṭhito kāyassa bhedā manussaloke vā tīsu mahākulesu, chasu vā kāmāvacaradevesu, dasasu vā brahmabhavanesu, pañcasu vā suddhāvāsesu, catūsu vā āruppesu upapajjati, ayamassa gatisugatīti.
Established therein, at the breakup of the body, he is reborn either in the human world into one of the three great families, or in one of the six sense-sphere heavenly worlds, or in one of the ten Brahma-planes, or in one of the five Pure Abodes, or in one of the four formless realms. This is his happy destination of rebirth.
Người ấy, sau khi chết, sẽ tái sinh vào một trong ba dòng dõi cao quý trong cõi người, hoặc sáu cõi trời Dục giới, hoặc mười cõi Phạm thiên, hoặc năm cõi Tịnh cư thiên, hoặc bốn cõi Vô sắc giới; đây là thiện thú về cảnh giới của người ấy.
Tattha sakabhaṇḍe chandarāgo abhijjhā, parabhaṇḍe visamalobho.
Therein, sensual desire for one's own property is covetousness (abhijjhā); for another's property it is unrighteous greed (visamalobho).
Ở đây, tham ái đối với tài sản của mình là tham lam (abhijjhā), tham ái đối với tài sản của người khác là tham lam bất chính (visamalobho).
Atha vā sakabhaṇḍe vā parabhaṇḍe vā hotu, yuttapattaṭṭhāne chandarāgo abhijjhā, ayuttāpattaṭṭhāne visamalobho.
Or, whether it be for one's own property or another's, sensual desire in a proper context is covetousness; in an improper context it is unrighteous greed.
Hoặc, dù là tài sản của mình hay của người khác, tham ái ở nơi hợp lý là tham lam (abhijjhā), tham ái ở nơi không hợp lý là tham lam bất chính (visamalobho).
Thero panāha ‘‘kissa vinibbhogaṃ karotha, yutte vā ayutte vā hotu, ‘rāgo visamaṃ doso visamaṃ moho visama’nti (vibha. 924) vacanato na koci lobho avisamo nāma, tasmā lobhoyeva abhijjhāyanaṭṭhena abhijjhā, visamaṭṭhena visamaṃ, ekatthametaṃ byañjanameva nāna’’nti.
The Elder, however, said, “Why do you make a distinction? Whether it be in a proper or improper context, according to the text ‘Greed is unrighteous, hatred is unrighteous, delusion is unrighteous,’ there is no greed that is not unrighteous. Therefore, greed itself is called ‘covetousness’ (abhijjhā) in the sense of coveting, and ‘unrighteous’ (visama) in the sense of being unrighteous. They have one meaning; only the expressions differ.”
Tuy nhiên, Trưởng lão nói: “Tại sao các vị lại phân biệt? Dù là hợp lý hay không hợp lý, không có tham lam nào là không bất chính, theo lời dạy ‘tham lam là bất chính, sân hận là bất chính, si mê là bất chính’, do đó, tham lam chính là tham lam (abhijjhā) theo nghĩa mong muốn, và bất chính (visamaṃ) theo nghĩa bất chính; đây là một ý nghĩa, chỉ có từ ngữ là khác nhau.”
So panesa abhijjhāvisamalobho uppajjitvā cittaṃ dūseti, obhāsituṃ na deti.
And this covetousness and unrighteous greed, having arisen, corrupts the mind and does not allow it to shine.
Tham lam bất chính này, khi phát sinh, làm ô nhiễm tâm, không cho phép tâm tỏa sáng.
Tasmā ‘‘cittassa upakkileso’’ti vuccati.
Therefore, it is called a “corruption of the mind.”
Do đó, nó được gọi là “uế nhiễm của tâm”.
Yathā cesa, evaṃ navavidhaāghātavatthusambhavo byāpādo.
Just as this is, so also is ill will (byāpāda), which arises from the nine grounds for resentment.
Cũng như vậy, sân hận (byāpādo) phát sinh từ chín căn bản của sự thù hằn.
Dasavidhaāghātavatthusambhavo kodho.
Anger (kodho), which arises from the ten grounds for resentment.
Giận dữ (kodho) phát sinh từ mười căn bản của sự thù hằn.
Punappunaṃ cittapariyonandhano upanāho.
Hostility (upanāho), which repeatedly envelops the mind.
Hiềm hận (upanāho) là sự bao trùm tâm hết lần này đến lần khác.
Agāriyassa vā anagāriyassa vā sukatakaraṇavināsano makkho.
Denigration (makkho), which effaces the good deeds done, whether of a householder or one gone forth.
Khinh miệt (makkho) là sự hủy hoại công đức của người tại gia hoặc người xuất gia.
Agāriyopi hi kenaci anukampakena daliddo samāno ucce ṭhāne ṭhapito, aparena samayena ‘‘kiṃ tayā mayhaṃ kata’’nti tassa sukatakaraṇaṃ vināseti.
For a householder, though poor, may be placed in a high position by some compassionate person, but at a later time he effaces that good deed, saying, “What have you done for me?”
Người tại gia, vốn nghèo khó, được một người có lòng từ bi đặt vào vị trí cao, nhưng sau một thời gian lại nói: “Ngươi đã làm gì cho ta?” và hủy hoại công đức của người đó.
Anagāriyopi sāmaṇerakālato pabhuti ācariyena vā upajjhāyena vā catūhi paccayehi uddesaparipucchāhi ca anuggahetvā dhammakathānayapakaraṇakosallādīni sikkhāpito, aparena samayena rājarājamahāmattādīhi sakkato garukato ācariyupajjhāyesu acittīkato caramāno ‘‘ayaṃ amhehi daharakāle evaṃ anuggahito saṃvaḍḍhito ca, atha panidāni nissineho jāto’’ti vuccamāno ‘‘kiṃ mayhaṃ tumhehi kata’’nti tesaṃ sukatakaraṇaṃ vināseti, tassa so sukatakaraṇavināsano makkho uppajjitvā cittaṃ dūseti, obhāsituṃ na deti.
The renunciate, too, from the time of being a sāmaṇera, having been supported by a teacher or preceptor with the four requisites and with recitation and questioning, and having been taught skill in the method of Dhamma talks, in the treatises, etc., at a later time, when honored and respected by kings, great ministers of kings, and others, acts without respect towards his teachers and preceptors. When he is told, “This person was supported and raised by us in this way when he was young, yet now he has become ungrateful,” he obliterates their good deeds, saying, “What have you done for me?” For him, that makkha, which is the destruction of good deeds done, arises and corrupts the mind; it does not allow it to shine.
Và một người xuất gia, từ khi còn là Sa-di, được thầy Tế độ hay thầy Y chỉ giúp đỡ bằng bốn vật dụng cúng dường, bằng việc giảng dạy và vấn đáp, được dạy dỗ về sự khéo léo trong các phương pháp thuyết pháp và các bộ luận, sau này được vua chúa, đại thần v.v. tôn kính, trọng vọng, nhưng lại không có lòng kính trọng đối với các vị thầy Tế độ và thầy Y chỉ của mình, đi đây đó và bị người khác nói rằng: “Người này đã được chúng ta giúp đỡ và nuôi dưỡng như vậy khi còn trẻ, nhưng bây giờ lại trở nên vô ơn.” Khi nghe vậy, người ấy nói: “Các ông đã làm gì cho tôi?” và hủy hoại những việc tốt mà các vị thầy đã làm cho mình. Sự chối bỏ công ơn (makkha) này khởi lên trong tâm người ấy, làm ô nhiễm tâm, không cho tâm tỏa sáng.
Tasmā ‘‘cittassa upakkileso’’ti vuccati.
Therefore, it is called “a defilement of the mind.”
Vì vậy, nó được gọi là “ô nhiễm của tâm”.
Yathā cāyaṃ, evaṃ bahussutepi puggale ajjhottharitvā ‘‘īdisassa ceva bahussutassa aniyatā gati, tava vā mama vā ko viseso’’tiādinā nayena uppajjamāno yugaggāhagāhī paḷāso.
Just as this is so, in the same way, paḷāsa is competitiveness that arises by disparaging even a very learned person, with reasoning such as, “The destination of such a very learned person is uncertain; what is the difference between you and me?”
Cũng như vậy, khi một người đa văn bị kiêu mạn lấn át và khởi lên ý nghĩ rằng: “Ngay cả một người đa văn như vậy cũng có một vận mệnh không chắc chắn, vậy thì giữa ta và ngươi có gì khác biệt?”, sự chấp thủ ngang ngược này là paḷāsa (kiêu căng ganh tị).
Paresaṃ sakkārādīni khīyanā issā.
Issā is jealousy towards the honor and so forth of others.
Sự đố kỵ đối với sự cung kính v.v. của người khác là issā (đố kỵ).
Attano sampattiyā parehi sādhāraṇabhāvaṃ asahamānaṃ macchariyaṃ.
Macchariyaṃ is avarice, being unable to tolerate one’s own possessions being shared with others.
Không chịu đựng được việc chia sẻ tài sản của mình với người khác là macchariyaṃ (keo kiệt).
Vañcanikacariyabhūtā māyā.
Māyā is deceit, which is fraudulent conduct.
Hành vi lừa dối là māyā (giả dối).
Kerāṭikabhāvena uppajjamānaṃ sāṭheyyaṃ.
Sāṭheyyaṃ is fraud, which arises out of craftiness.
Sự khởi lên với bản chất xảo trá là sāṭheyyaṃ (xảo quyệt).
Kerāṭiko hi āyatanamaccho viya hoti.
Indeed, a crafty person is like the āyatanamaccha.
Quả thật, một người xảo trá giống như cá āyatana.
Āyatanamaccho nāma kira macchānaṃ naṅguṭṭhaṃ dasseti sappānaṃ sīsaṃ, ‘‘tumhehi sadiso aha’’nti jānāpetuṃ.
The āyatanamaccha, it is said, shows its tail to fish and its head to snakes, in order to make them know, “I am like you.”
Người ta nói rằng cá āyatana là loài cá cho thấy đuôi của cá và đầu của rắn, để làm cho người khác biết rằng “ta giống như các ngươi”.
Evameva kerāṭiko puggalo yaṃ yaṃ suttantikaṃ vā ābhidhammikaṃ vā upasaṅkamati, taṃ taṃ evaṃ vadati ‘‘ahaṃ tumhākaṃ baddhacaro, tumhe mayhaṃ anukampakā, nāhaṃ tumhe muñcāmī’’ti ‘‘evamete ‘sagāravo ayaṃ amhesu sappatisso’ti maññissantī’’ti.
In the very same way, a crafty person, whenever he approaches a master of the Suttanta or a master of the Abhidhamma, says to them, “I am your devoted follower; you are my benefactors; I will not leave you,” thinking, “In this way, they will think, ‘This person is respectful and deferential towards us.’”
Cũng như vậy, một người xảo trá, khi đến gặp một vị Tỳ-khưu thông thạo kinh điển hay thông thạo Abhidhamma, sẽ nói: “Tôi là người hầu cận của quý vị, quý vị là những người từ bi với tôi, tôi không thể rời bỏ quý vị.” Người ấy nghĩ: “Như vậy, những vị Tỳ-khưu này sẽ nghĩ rằng ‘người này có lòng kính trọng và biết vâng lời chúng ta’.”
Tassetaṃ kerāṭikabhāvena uppajjamānaṃ sāṭheyyaṃ uppajjitvā cittaṃ dūseti, obhāsituṃ na deti.
For him, this sāṭheyyaṃ, arising out of craftiness, arises and corrupts the mind; it does not allow it to shine.
Sự xảo quyệt này, khởi lên với bản chất xảo trá của người ấy, làm ô nhiễm tâm, không cho tâm tỏa sáng.
Tasmā ‘‘cittassa upakkileso’’ti vuccati.
Therefore, it is called “a defilement of the mind.”
Vì vậy, nó được gọi là “ô nhiễm của tâm”.
Yathā cetaṃ, evaṃ vātabharitabhastasadisathaddhabhāvapaggahitasiraanivātavuttikārakaraṇo thambho.
Just as this is so, in the same way, thambho is obstinacy, which creates a stiff state like a leather bag filled with air, with an uplifted head and an unyielding demeanor.
Cũng như vậy, sự cứng nhắc (thaddha-bhāva) giống như một túi da căng đầy gió, khiến cho người ta có thái độ không khiêm tốn với cái đầu ngẩng cao, đó là thambho (cứng đầu).
Taduttarikaraṇo sārambho.
Sārambho is rivalry, which is the act of going beyond that.
Vượt trội hơn thế nữa là sārambho (kiêu ngạo cạnh tranh).
So duvidhena labbhati akusalavasena ceva kusalavasena ca.
It is found in two ways: through the unwholesome and through the wholesome.
Nó được nhận biết theo hai cách: theo khía cạnh bất thiện và theo khía cạnh thiện.
Tattha agāriyassa parena kataṃ alaṅkārādiṃ disvā taddiguṇakaraṇena uppajjamāno, anagāriyassa ca yattakaṃ yattakaṃ paro pariyāpuṇāti vā katheti vā, mānavasena taddiguṇataddiguṇakaraṇena uppajjamāno akusalo.
Therein, for a householder, it arises by doing twice as much upon seeing the adornments and so on made by another; for a renunciate, it arises out of conceit by doing twice as much as another learns or teaches. This is unwholesome.
Trong đó, đối với người tại gia, khi thấy sự trang hoàng v.v. do người khác làm, sự kiêu ngạo khởi lên do muốn làm gấp đôi điều đó; đối với người xuất gia, khi thấy người khác học hay thuyết giảng nhiều đến mức nào, sự kiêu ngạo khởi lên do muốn làm gấp đôi, gấp ba điều đó, đó là bất thiện.
Agāriyassa pana paraṃ ekaṃ salākabhattaṃ dentaṃ disvā attanā dve vā tīṇi vā dātukāmatāya uppajjamāno, anagāriyassa ca parena ekanikāye gahite mānaṃ anissāya kevalaṃ taṃ disvā attanā ālasiyaṃ abhibhuyya dve nikāye gahetukāmatāya uppajjamāno kusalo.
However, for a householder, it arises from the wish to give two or three ticket-meals upon seeing another give one; and for a renunciate, upon seeing another master one Nikāya, it arises not out of conceit but simply from the wish to master two Nikāyas by overcoming laziness. This is wholesome.
Còn đối với người tại gia, khi thấy người khác cúng dường một phần cơm bằng thẻ, sự kiêu ngạo khởi lên do muốn cúng dường hai hay ba phần; đối với người xuất gia, khi thấy người khác học một bộ kinh, không dựa vào kiêu mạn mà chỉ vì thấy điều đó, sự kiêu ngạo khởi lên do muốn vượt qua sự lười biếng và học hai bộ kinh, đó là thiện.
Idha pana akusalo adhippeto.
Here, however, the unwholesome is intended.
Ở đây, ý muốn nói đến sự kiêu ngạo bất thiện.
Ayañhi uppajjitvā cittaṃ dūseti, obhāsituṃ na deti.
For this, when it arises, corrupts the mind; it does not allow it to shine.
Vì điều này khởi lên làm ô nhiễm tâm, không cho tâm tỏa sáng.
Tasmā ‘‘cittassa upakkileso’’ti vuccati.
Therefore, it is called “a defilement of the mind.”
Vì vậy, nó được gọi là “ô nhiễm của tâm”.
72. Ettāvatā saṃkilesaṃ dassetvā idāni vodānaṃ dassento sa kho so, bhikkhavetiādimāha.
72. Having thus shown the defiling aspect, now, to show the purifying aspect, he said, “So, bhikkhus,” and so on.
72. Sau khi trình bày sự ô nhiễm cho đến đây, bây giờ để trình bày sự thanh tịnh, Ngài nói: "Này các Tỳ-khưu, vị ấy..." v.v..
Tattha iti viditvāti evaṃ jānitvā.
Therein, “having known thus” means having known in this way.
Trong đó, "iti viditvā" có nghĩa là "sau khi biết như vậy".
Pajahatīti samucchedappahānavasena ariyamaggena pajahati.
“He abandons” means he abandons with the noble path, by way of abandonment by cutting off.
"Pajahati" có nghĩa là "từ bỏ bằng Thánh đạo theo cách đoạn diệt hoàn toàn".
Tattha kilesapaṭipāṭiyā maggapaṭipāṭiyāti dvidhā pahānaṃ veditabbaṃ.
Therein, abandonment should be understood in two ways: by the sequence of defilements and by the sequence of the paths.
Ở đây, sự từ bỏ cần được hiểu theo hai cách: theo thứ tự phiền não và theo thứ tự đạo.
Kilesapaṭipāṭiyā tāva abhijjhāvisamalobho thambho sārambho māno atimāno madoti ime cha kilesā arahattamaggena pahīyanti.
Firstly, by the sequence of defilements, these six defilements—covetousness and unrighteous greed, obstinacy, rivalry, conceit, arrogance, and intoxication—are abandoned by the path of Arahantship.
Theo thứ tự phiền não, sáu phiền não này là: tham lam bất chính (abhijjhāvisamalobho), cứng đầu (thambho), kiêu ngạo cạnh tranh (sārambho), kiêu mạn (māno), kiêu mạn thái quá (atimāno), say mê (mado) được từ bỏ bằng A-la-hán đạo.
Byāpādo kodho upanāho pamādoti ime cattāro kilesā anāgāmimaggena pahīyanti.
These four defilements—ill will, anger, resentment, and heedlessness—are abandoned by the path of non-returning.
Bốn phiền não này là: sân hận (byāpādo), giận dữ (kodho), oán hận (upanāho), phóng dật (pamādo) được từ bỏ bằng Bất Hoàn đạo.
Makkho paḷāso issā macchariyaṃ māyā sāṭheyyanti ime cha sotāpattimaggena pahīyantīti.
These six—contempt, competitiveness, jealousy, avarice, deceit, and fraud—are abandoned by the path of stream-entry.
Sáu phiền não này là: chối bỏ công ơn (makkho), kiêu căng ganh tị (paḷāso), đố kỵ (issā), keo kiệt (macchariyaṃ), giả dối (māyā), xảo quyệt (sāṭheyyaṃ) được từ bỏ bằng Nhập Lưu đạo.
Maggapaṭipāṭiyā pana, sotāpattimaggena makkho paḷāso issā macchariyaṃ māyā sāṭheyyanti ime cha pahīyanti.
By the sequence of the paths, with the path of stream-entry, these six—contempt, competitiveness, jealousy, avarice, deceit, and fraud—are abandoned.
Còn theo thứ tự đạo, bằng Nhập Lưu đạo, sáu phiền não này là: chối bỏ công ơn (makkho), kiêu căng ganh tị (paḷāso), đố kỵ (issā), keo kiệt (macchariyaṃ), giả dối (māyā), xảo quyệt (sāṭheyyaṃ) được từ bỏ.
Anāgāmimaggena byāpādo kodho upanāho pamādoti ime cattāro.
With the path of non-returning, these four—ill will, anger, resentment, and heedlessness.
Bằng Bất Hoàn đạo, bốn phiền não này là: sân hận (byāpādo), giận dữ (kodho), oán hận (upanāho), phóng dật (pamādo).
Arahattamaggena abhijjhāvisamalobho thambho sārambho māno atimāno madoti ime cha pahīyantīti.
With the path of Arahantship, these six—covetousness and unrighteous greed, obstinacy, rivalry, conceit, arrogance, and intoxication—are abandoned.
Bằng A-la-hán đạo, sáu phiền não này là: tham lam bất chính (abhijjhāvisamalobho), cứng đầu (thambho), kiêu ngạo cạnh tranh (sārambho), kiêu mạn (māno), kiêu mạn thái quá (atimāno), say mê (mado) được từ bỏ.
Imasmiṃ pana ṭhāne ime kilesā sotāpattimaggavajjhā vā hontu, sesamaggavajjhā vā, atha kho anāgāmimaggeneva pahānaṃ sandhāya ‘‘abhijjhāvisamalobhaṃ cittassa upakkilesaṃ pajahatī’’tiādimāhāti veditabbā.
In this passage, however, it should be understood that whether these defilements are to be abandoned by the path of stream-entry or by the other paths, he spoke, “He abandons covetousness and unrighteous greed, a defilement of the mind,” and so on, with reference to abandonment by the path of non-returning alone.
Tuy nhiên, trong đoạn này, những phiền não này có thể được từ bỏ bằng Nhập Lưu đạo, hoặc bằng các đạo khác, nhưng cần phải hiểu rằng Đức Phật đã nói: “Từ bỏ tham lam bất chính, ô nhiễm của tâm” v.v. là để chỉ sự từ bỏ bằng Bất Hoàn đạo.
Ayamettha paveṇimaggāgato sambhavo, so ca upari catutthamaggasseva niddiṭṭhattā yujjati, tatiyamaggena pahīnāvasesānañhi visamalobhādīnaṃ tena pahānaṃ hoti, sesānaṃ imināva.
This here is the traditional sequence handed down through the lineage of teachers. And that is fitting, because what is explained above pertains only to the fourth path. For unrighteous greed and so on, which remain after having been abandoned by the third path, are abandoned by that (fourth path), while the others are abandoned by this (third path).
Đây là cách hiểu truyền thống ở đây, và nó phù hợp vì ở trên đã chỉ rõ là Tứ đạo; bởi vì những phiền não còn lại sau khi được từ bỏ bằng Tam đạo, như tham lam bất chính v.v. thì được từ bỏ bằng đạo đó, còn những phiền não khác thì bằng cách này.
Yepi hi sotāpattimaggena pahīyanti, tepi taṃsamuṭṭhāpakacittānaṃ appahīnattā anāgāmimaggeneva suppahīnā hontīti.
For even those defilements that are abandoned by the path of stream-entry are only well abandoned by the path of non-returning, because the minds that give rise to them have not yet been abandoned.
Ngay cả những phiền não được từ bỏ bằng Nhập Lưu đạo, chúng cũng được từ bỏ hoàn toàn bằng Bất Hoàn đạo vì những tâm tạo ra chúng chưa được từ bỏ hoàn toàn.
Keci pana paṭhamamaggena cettha pahānaṃ vaṇṇayanti, taṃ pubbāparena na sandhiyati.
Some, however, explain the abandonment here by the first path, but that does not connect with what precedes and follows.
Một số người lại cho rằng sự từ bỏ ở đây là bằng Đệ nhất đạo, nhưng điều đó không phù hợp với trước sau.
Keci vikkhambhanappahānampi, taṃ tesaṃ icchāmattameva.
Some explain it as abandonment by suppression, but that is merely their own wish.
Một số khác lại cho rằng đó là sự từ bỏ bằng cách trấn áp (vikkhambhana-pahāna), nhưng điều đó chỉ là ý muốn của họ.
74. So buddhe aveccappasādenāti etaṃ ‘‘yato kho, bhikkhave, abhijjhāvisamalobho pahīno hoti, so buddhe aveccappasādena samannāgato hotī’’ti evaṃ ekamekena padena yojetabbaṃ.
74. This phrase, “He is endowed with unwavering confidence in the Buddha,” should be connected with each term, as in: “When, bhikkhus, covetousness and unrighteous greed is abandoned, he is endowed with unwavering confidence in the Buddha.”
74. "So buddhe aveccappasādenā" cần được kết hợp với từng từ như sau: "Này các Tỳ-khưu, khi tham lam bất chính đã được từ bỏ, vị ấy có niềm tin bất động vào Đức Phật."
Imassa hi bhikkhuno anāgāmimaggena lokuttarappasādo āgato, athassa aparena samayena buddhaguṇe dhammaguṇe saṅghaguṇe ca anussarato lokiyo uppajjati, tamassa sabbampi lokiyalokuttaramissakaṃ pasādaṃ dassento bhagavā ‘‘buddhe aveccappasādenā’’tiādimāha.
For this bhikkhu, supramundane confidence has come through the path of non-returning. Then, at a later time, as he recollects the qualities of the Buddha, the Dhamma, and the Saṅgha, mundane confidence arises. The Blessed One, showing all his confidence, both mundane and supramundane mixed together, said, “with unwavering confidence in the Buddha,” and so on.
Thật vậy, đối với Tỳ-khưu này, niềm tin siêu thế đã đến bằng Bất Hoàn đạo, sau đó, vào một thời điểm khác, khi quán tưởng về các phẩm chất của Đức Phật, Pháp và Tăng, niềm tin thế gian khởi lên. Để trình bày tất cả niềm tin đó, bao gồm cả thế gian và siêu thế, Đức Thế Tôn đã nói: "có niềm tin bất động vào Đức Phật" v.v..
Tattha aveccappasādenāti buddhadhammasaṅghaguṇānaṃ yāthāvato ñātattā acalena accutena pasādena.
Therein, “with unwavering confidence” means with unshakable, immovable confidence, because the qualities of the Buddha, Dhamma, and Saṅgha are known as they really are.
Trong đó, "aveccappasādenā" có nghĩa là "niềm tin bất động, không lay chuyển, do đã biết rõ các phẩm chất của Đức Phật, Pháp và Tăng một cách chân thật".
Idāni yathā tassa bhikkhuno anussarato so aveccappasādo uppanno, taṃ vidhiṃ dassento ‘‘itipi so bhagavā’’tiādinā nayena tīṇi anussatiṭṭhānāni vitthāresi.
Now, showing the method by which that unshakable confidence arose in that bhikkhu as he recollected, He expounded upon the three bases of recollection by the method beginning with “Itipi so bhagavā.”
Hiện nay, để chỉ ra phương cách mà vị Tỳ-khưu ấy đã phát sinh niềm tịnh tín bất động (aveccappasāda) khi quán niệm, Đức Thế Tôn đã giải thích ba đề mục tùy niệm (anussatiṭṭhāna) theo cách thức "Iti pi so Bhagavā" (Đức Thế Tôn là bậc như vậy) và những đoạn tương tự.
Tesaṃ atthavaṇṇanā sabbākārena visuddhimagge anussatikathāyaṃ vuttā.
The commentary on their meaning is stated in all aspects in the chapter on recollection in the Visuddhimagga.
Sự giải thích ý nghĩa của những điều ấy đã được nói đến trong phần Anussatikathā của Visuddhimagga một cách đầy đủ.
75. Evamassa lokiyalokuttaramissakaṃ pasādaṃ dassetvā idāni kilesappahānaṃ aveccappasādasamannāgatañca paccavekkhato uppajjamānaṃ somanassādiānisaṃsaṃ dassento yathodhi kho panassātiādimāha.
75. Having thus shown his confidence, which is a mixture of the mundane and supramundane, now, to show the benefit of mental joy and so on that arises from reviewing the abandonment of defilements and the possession of unshakable confidence, He said, “Yathodhi kho panassā” and so on.
75. Sau khi chỉ ra niềm tịnh tín pha tạp giữa thế gian và xuất thế gian của vị ấy như vậy, bây giờ, để chỉ ra lợi ích như sự hoan hỷ phát sinh khi quán xét sự đoạn trừ phiền não và sự thành tựu niềm tịnh tín bất động (aveccappasāda), Đức Thế Tôn đã nói: Yathodhi kho panassā (Và những gì của vị ấy đã được từ bỏ theo giới hạn) v.v.
Anāgāmissa hi paccante vuṭṭhitaṃ corupaddavaṃ vūpasametvā taṃ paccavekkhato mahānagare vasantassa rañño viya ime cime ca mama kilesā pahīnāti attano kilesappahānaṃ paccavekkhato balavasomanassaṃ uppajjati.
For a non-returner, just as for a king dwelling in a great city who reviews the pacification of a disturbance by thieves that arose in a border region, when he reviews the abandonment of his own defilements, thinking, “These and those defilements of mine have been abandoned,” powerful mental joy arises.
Quả thật, đối với một vị Anāgāmī, khi quán xét sự đoạn trừ phiền não của mình, niềm đại hoan hỷ phát sinh, giống như một vị vua sống trong kinh thành lớn, sau khi dẹp yên nạn trộm cướp nổi lên ở vùng biên giới, quán xét sự yên ổn đó và nghĩ: “Những phiền não này của ta đã được đoạn trừ.”
Taṃ dassento bhagavā ‘‘yathodhi kho panassā’’tiādimāha.
To show this, the Blessed One said, “Yathodhi kho panassā” and so on.
Để chỉ ra niềm đại hoan hỷ ấy, Đức Thế Tôn đã nói: “Yathodhi kho panassā” v.v.
Tassattho – yvāyaṃ anāgāmī bhikkhu evaṃ ‘‘buddhe aveccappasādena samannāgato hoti…pe… dhamme…pe… saṅghe…pe… anuttaraṃ puññakkhettaṃ lokassā’’ti, tassa yathodhi kho cattaṃ hoti paṭinissaṭṭhaṃ, sakasakaodhivasena cattameva hoti, taṃ taṃ kilesajātaṃ vantaṃ muttaṃ pahīnaṃ paṭinissaṭṭhaṃ.
The meaning of this is: That non-returner bhikkhu is thus “endowed with unshakable confidence in the Buddha... and so on... in the Dhamma... and so on... in the Saṅgha... and so on... the unsurpassed field of merit for the world.” For him, what has been given up, relinquished, is according to the limit. By the power of each respective limit, it is given up indeed; that particular group of defilements is vomited, released, abandoned, relinquished.
Ý nghĩa của câu ấy là: Vị Tỳ-khưu Anāgāmī này, người đã “thành tựu niềm tịnh tín bất động đối với Đức Phật... v.v... đối với Pháp... v.v... đối với Tăng... v.v... là phước điền vô thượng của thế gian,” thì những gì của vị ấy đã được từ bỏ theo giới hạn (odhi), đã được xả bỏ. Những loại phiền não ấy đã được từ bỏ, đã được xả bỏ theo giới hạn riêng của từng loại, đã được nhổ bỏ, đã được giải thoát, đã được đoạn trừ, đã được xả bỏ.
Sakasakaodhivasenāti dve odhī kilesodhi ca maggodhi ca.
By the power of each respective limit means there are two limits: the limit of defilements and the limit of the path.
Sakasakaodhivasenā (Theo giới hạn riêng của từng loại) có hai giới hạn (odhi): giới hạn của phiền não (kilesodhi) và giới hạn của đạo (maggodhi).
Tattha kilesodhivasenāpi ye kilesā yaṃ maggavajjhā, te aññamaggavajjhehi amissā hutvā sakeneva odhinā pahīnā.
Therein, by the power of the limit of defilements: whichever defilements are to be destroyed by a certain path are abandoned by their own respective limit, unmixed with those to be destroyed by another path.
Trong đó, theo giới hạn của phiền não, những phiền não nào bị diệt bởi đạo nào, thì những phiền não ấy đã được đoạn trừ bằng giới hạn riêng của chúng, không lẫn lộn với những phiền não bị diệt bởi đạo khác.
Maggodhivasenāpi ye kilesā yena maggena pahātabbā, tena teyeva pahīnā honti.
And by the power of the limit of the path: whichever defilements are to be abandoned by a certain path, only those are abandoned by it.
Và theo giới hạn của đạo, những phiền não nào cần được đoạn trừ bằng đạo nào, thì chính những phiền não ấy đã được đoạn trừ bằng đạo đó.
Evaṃ sakasakaodhivasena taṃ taṃ kilesajātaṃ cattameva hoti paṭinissaṭṭhaṃ, taṃ paccavekkhitvā ca laddhasomanasso tatuttaripi so ‘‘buddhe aveccappasādena samannāgatomhī’’ti labhati atthavedanti sambandho.
Thus, by the power of each respective limit, that particular group of defilements is indeed given up, relinquished. The connection is: having reviewed that and gained mental joy, he, even beyond that, thinking, “I am endowed with unshakable confidence in the Buddha,” gains the experience of the meaning.
Như vậy, theo giới hạn riêng của từng loại, những loại phiền não ấy đã được từ bỏ, đã được xả bỏ. Sau khi quán xét điều đó và đạt được niềm hoan hỷ, vị ấy còn đạt được sự thấu hiểu ý nghĩa (atthaveda) rằng: “Ta đã thành tựu niềm tịnh tín bất động đối với Đức Phật” v.v. Đây là mối liên hệ.
Yatodhi khotipi pāṭho.
There is also the reading yatodhi kho.
Cũng có bản đọc là Yatodhi kho.
Tassa vasena ayamattho, assa bhikkhuno yatodhi kho pana cattaṃ hoti paṭinissaṭṭhaṃ.
According to that, this is the meaning: for this bhikkhu, it is because of the limit that it has been given up, relinquished.
Theo bản đọc đó, ý nghĩa là: Những gì của vị Tỳ-khưu ấy đã được từ bỏ, đã được xả bỏ từ giới hạn nào.
Tattha yatoti kāraṇavacanaṃ, yasmāti vuttaṃ hoti.
Therein, yato is a word indicating cause; it means “because.”
Trong đó, yato là từ chỉ nguyên nhân, có nghĩa là “vì lý do nào.”
Odhīti heṭṭhā tayo maggā vuccanti.
By odhi, the lower three paths are meant.
Odhī (giới hạn) ở đây chỉ ba đạo thấp hơn.
Te hi odhiṃ katvā koṭṭhāsaṃ katvā uparimaggena pahātabbakilese ṭhapetvā pajahanti, tasmā odhīti vuccanti.
Because they abandon defilements by making a limit, making a division, setting aside the defilements to be abandoned by the higher path, they are called odhī.
Vì chúng đoạn trừ các phiền não bằng cách đặt ra giới hạn (odhi), đặt ra phần (koṭṭhāsa), ngoại trừ những phiền não sẽ được đoạn trừ bằng đạo cao hơn. Do đó, chúng được gọi là odhi.
Arahattamaggo pana kiñci kilesaṃ anavasesetvā pajahati, tasmā anodhīti vuccati.
But the path of arahantship abandons defilements without leaving any remainder, therefore it is called anodhī.
Còn A-la-hán đạo thì đoạn trừ phiền não mà không để lại chút gì, do đó nó được gọi là anodhī (vô giới hạn).
Imassa ca bhikkhuno heṭṭhāmaggattayena cattaṃ.
And for this bhikkhu, the giving up is by means of the three lower paths.
Và đối với vị Tỳ-khưu này, các phiền não đã được từ bỏ bằng ba đạo thấp hơn.
Tena vuttaṃ ‘‘yatodhi kho panassa cattaṃ hotī’’ti.
Therefore it is said, “yatodhi kho panassa cattaṃ hoti.”
Vì vậy, đã nói: “Yatodhi kho panassa cattaṃ hoti” (Những gì của vị ấy đã được từ bỏ từ giới hạn nào).
Tattha kho panāti nipātamattaṃ.
Therein, kho pana are mere particles.
Trong đó, kho panā chỉ là một tiểu từ.
Ayaṃ pana piṇḍattho.
This, however, is the summary meaning.
Đây là ý nghĩa tổng quát:
Yasmā assa odhi cattaṃ hoti paṭinissaṭṭhaṃ, tasmā taṃ paccavekkhitvā ca laddhasomanasso tatuttaripi so ‘‘buddhe aveccappasādena samannāgatomhī’’ti labhati atthavedanti yathāpāḷi netabbaṃ.
Because for him the giving up is by limit, it is relinquished; therefore, having reviewed that and gained mental joy, he, even beyond that, thinking, “I am endowed with unshakable confidence in the Buddha,” gains the experience of the meaning. This should be understood according to the Pāli.
Vì những gì của vị ấy đã được từ bỏ, đã được xả bỏ từ giới hạn nào, nên sau khi quán xét điều đó và đạt được niềm hoan hỷ, vị ấy còn đạt được sự thấu hiểu ý nghĩa (atthaveda) rằng: “Ta đã thành tựu niềm tịnh tín bất động đối với Đức Phật.” Phải hiểu theo nguyên văn như vậy.
Tattha cattanti idaṃ sakabhāvapariccajanavasena vuttaṃ.
Therein, cattaṃ (given up) is stated in the sense of renouncing its own nature.
Trong đó, từ cattaṃ (từ bỏ) được nói theo nghĩa từ bỏ bản chất của chính nó.
Vantanti idaṃ pana anādiyanabhāvadassanavasena.
Vantaṃ (vomited), however, is in the sense of showing the state of non-acquisition.
Còn từ vantaṃ (nhổ bỏ) được nói theo nghĩa không chấp thủ trở lại.
Muttanti idaṃ santatito vinimocanavasena.
Muttaṃ (released) is in the sense of liberation from the continuity.
Từ muttaṃ (giải thoát) được nói theo nghĩa thoát khỏi dòng tương tục.
Pahīnanti idaṃ muttassapi kvaci anavaṭṭhānadassanavasena.
Pahīnaṃ (abandoned) is in the sense of showing the non-existence of what has been released anywhere.
Từ pahīnaṃ (đoạn trừ) được nói theo nghĩa ngay cả khi đã giải thoát, nó cũng không còn tồn tại ở bất cứ đâu.
Paṭinissaṭṭhanti idaṃ pubbe ādinnapubbassa paṭinissaggadassanavasena paṭimukhaṃ vā nissaṭṭhabhāvadassanavasena bhāvanābalena abhibhuyya nissaṭṭhabhāvadassanavasenāti vuttaṃ hoti.
Paṭinissaṭṭhaṃ (relinquished) is stated in the sense of showing the relinquishment of what was formerly acquired, or in the sense of showing the state of being relinquished face-to-face, or in the sense of showing the state of being relinquished by overpowering through the strength of development.
Từ paṭinissaṭṭhaṃ (xả bỏ) được nói theo nghĩa xả bỏ những gì đã từng chấp thủ trước đây, hoặc theo nghĩa xả bỏ đối diện, hoặc theo nghĩa xả bỏ bằng sức mạnh của sự tu tập. Đó là ý nghĩa.
Labhati atthavedaṃ labhati dhammavedanti ettha buddhādīsu aveccappasādoyeva araṇīyato attho, upagantabbatoti vuttaṃ hoti.
Here, in “gains the experience of the meaning, gains the experience of the Dhamma,” it is unshakable confidence in the Buddha and so on that is the meaning (attha), because it should be reached; this is what is meant.
Trong câu labhati atthavedaṃ labhati dhammavedaṃ (đạt được sự thấu hiểu ý nghĩa, đạt được sự thấu hiểu Pháp), niềm tịnh tín bất động (aveccappasāda) đối với Đức Phật v.v. chính là ý nghĩa (attha) vì nó đáng được đạt đến, đáng được tiếp cận. Đó là ý nghĩa.
Dhāraṇato dhammo, vinipatituṃ appadānatoti vuttaṃ hoti.
It is the Dhamma because it supports, meaning it does not allow one to fall into a woeful state.
Pháp (dhamma) là vì nó gìn giữ, vì nó không để rơi vào cảnh suy đồi. Đó là ý nghĩa.
Vedoti ganthopi ñāṇampi somanassampi.
Veda means scripture, knowledge, or mental joy.
Veda (thấu hiểu) có thể là kinh điển, trí tuệ, hoặc sự hoan hỷ.
‘‘Tiṇṇaṃ vedānaṃ pāragū’’tiādīsu (dī. ni. 1.256) hi gantho ‘‘vedo’’ti vuccati.
In such phrases as “a master of the three Vedas,” scripture is called “veda.”
Trong các câu như “Tiṇṇaṃ vedānaṃ pāragū” (Bậc đã vượt qua ba Veda) v.v., veda được gọi là kinh điển.
‘‘Yaṃ brāhmaṇaṃ vedagumābhijaññā, akiñcanaṃ kāmabhāve asatta’’ntiādīsu (su. ni. 1065) ñāṇaṃ.
In such phrases as “That Brahmin one should know as a master of knowledge, having nothing, unattached to sensual existence,” it is knowledge.
Trong các câu như “Yaṃ brāhmaṇaṃ vedagumābhijaññā, akiñcanaṃ kāmabhāve asattaṃ” (Vị Bà-la-môn nào đã thông suốt Veda, không có gì, không dính mắc vào cõi dục) v.v., là trí tuệ.
‘‘Ye vedajātā vicaranti loke’’tiādīsu somanassaṃ.
In such phrases as “Those who, born of joy, wander in the world,” it is mental joy.
Trong các câu như “Ye vedajātā vicaranti loke” (Những ai sống trong thế gian với sự hoan hỷ đã phát sinh) v.v., là sự hoan hỷ.
Idha pana somanassañca somanassasampayuttañāṇañca adhippetaṃ, tasmā ‘‘labhati atthavedaṃ labhati dhammavedanti aveccappasādārammaṇasomanassañca somanassamayañāṇañca labhatī’’ti evamettha attho veditabbo.
Here, however, both mental joy and the knowledge associated with mental joy are intended. Therefore, in “gains the experience of the meaning, gains the experience of the Dhamma,” the meaning should be understood as: “he gains the mental joy that has unshakable confidence as its object, and he gains the knowledge made of mental joy.”
Ở đây, ý nghĩa được nhắm đến là sự hoan hỷ và trí tuệ tương ưng với sự hoan hỷ. Do đó, ở đây, ý nghĩa phải được hiểu là: “đạt được sự thấu hiểu ý nghĩa, đạt được sự thấu hiểu Pháp” có nghĩa là đạt được sự hoan hỷ có đối tượng là niềm tịnh tín bất động (aveccappasāda) và trí tuệ phát sinh từ sự hoan hỷ.
Atha vā atthavedanti aveccappasādaṃ paccavekkhato uppannaṃ vuttappakārameva vedaṃ.
Alternatively, “experience of the meaning” refers to the experience of the kind described that arises from reviewing unshakable confidence.
Hoặc, atthavedaṃ là sự thấu hiểu (veda) đã nói ở trên, phát sinh khi quán xét niềm tịnh tín bất động (aveccappasāda).
Dhammavedanti aveccappasādassa hetuṃ odhiso kilesappahānaṃ paccavekkhato uppannaṃ vuttappakārameva vedanti evampi ettha attho veditabbo.
“Experience of the Dhamma” refers to the experience of the kind described that arises from reviewing the limited abandonment of defilements, which is the cause of that unshakable confidence. The meaning here should be understood in this way as well.
Dhammavedaṃ là sự thấu hiểu (veda) đã nói ở trên, phát sinh khi quán xét sự đoạn trừ phiền não theo giới hạn (odhi) – nguyên nhân của niềm tịnh tín bất động (aveccappasāda). Ý nghĩa ở đây cũng phải được hiểu như vậy.
Vuttañhetaṃ ‘‘hetumhi ñāṇaṃ dhammapaṭisambhidā, hetuphale ñāṇaṃ atthapaṭisambhidā’’ti (vibha. 718-719).
For it has been said: “Knowledge of the cause is the analytical knowledge of the Dhamma; knowledge of the fruit of the cause is the analytical knowledge of the meaning.”
Quả thật, điều này đã được nói: “Trí tuệ về nguyên nhân là Dhamma-paṭisambhidā (Vô ngại giải về Pháp), trí tuệ về quả của nguyên nhân là Attha-paṭisambhidā (Vô ngại giải về nghĩa).”
Dhammūpasaṃhitaṃ pāmojjanti tameva atthañca dhammañca atthadhammānisaṃsabhūtaṃ vedañca paccavekkhato uppannaṃ pāmojjaṃ.
“Joy connected with the Dhamma” refers to the joy that arises from reviewing that very meaning, the Dhamma, and the experience which is the benefit of the meaning and the Dhamma.
Dhammūpasaṃhitaṃ pāmojjaṃ (niềm hỷ lạc liên hệ đến Pháp) là niềm hỷ lạc phát sinh khi quán xét ý nghĩa (attha) đó, Pháp (dhamma) đó, và sự thấu hiểu (veda) là lợi ích của ý nghĩa và Pháp.
Tañhi anavajjalakkhaṇena paccavekkhaṇākārappavattena dhammena upasañhitanti vuccati.
For it is said to be connected (upasañhita) with the Dhamma that proceeds in the manner of reviewing, characterized by being blameless.
Niềm hỷ lạc ấy được gọi là upasañhitaṃ (liên hệ) với Pháp (dhamma) thông qua đặc tính không có lỗi và cách thức quán xét.
Pamuditassa pīti jāyatīti iminā pāmojjena pamuditassa nirāmisā pīti jāyati.
“For one who is joyful, rapture is born” means for one who is gladdened by this joy, non-carnal rapture is born.
Pamuditassa pīti jāyatī (Khi hoan hỷ, hỷ phát sinh): Với niềm hỷ lạc này, hỷ vô nhiễm phát sinh cho người đã hoan hỷ.
Pītimanassāti tāya pītiyā pīṇitamanassa.
Pītimanassa means one whose mind is suffused with that rapture.
Pītimanassā (Người có tâm hoan hỷ): Người có tâm được làm cho sung mãn bởi hỷ đó.
Kāyo passambhatīti kāyopi passaddho hoti vūpasantadaratho.
“The body becomes tranquil” means the mental body also becomes tranquil, its distress calmed.
Kāyo passambhatī (Thân được an tịnh): Thân cũng trở nên an tịnh, sự mệt mỏi đã lắng xuống.
Passaddhakāyo sukhanti evaṃ vūpasantakāyadaratho cetasikaṃ sukhaṃ paṭisaṃvedeti.
“With a tranquil body, he feels pleasure” means one whose bodily distress is thus calmed experiences mental pleasure.
Passaddhakāyo sukhaṃ (Thân an tịnh, lạc): Người có thân đã lắng xuống sự mệt mỏi như vậy cảm nhận được sự lạc về tâm (cetasika sukha).
Cittaṃ samādhiyatīti cittaṃ sammā ādhiyati appitaṃ viya acalaṃ tiṭṭhati.
“The mind becomes concentrated” means the mind is well placed, it stands unshaken as if in absorption.
Cittaṃ samādhiyatī (Tâm được định): Tâm được định tĩnh đúng đắn, đứng yên bất động như thể đã được an trú.
Tattha evaṃsīloti tassa anāgāmimaggasampayuttaṃ sīlakkhandhaṃ dasseti.
Therein, “of such virtue” shows the aggregate of virtue associated with the path of the non-returner.
Trong đó, evaṃsīlo (người có giới hạnh như vậy) chỉ ra giới uẩn (sīlakkhandha) tương ưng với đạo Anāgāmī của vị ấy.
Evaṃdhammo evaṃpaññoti taṃsampayuttameva samādhikkhandhaṃ paññākkhandhañca dasseti.
“Of such a nature, of such wisdom” shows the aggregate of concentration and the aggregate of wisdom associated with it.
Evaṃdhammo evaṃpañño (người có Pháp như vậy, có tuệ như vậy) chỉ ra định uẩn (samādhikkhandha) và tuệ uẩn (paññākkhandha) tương ưng với điều đó.
Sālīnanti lohitasāligandhasāliādīnaṃ anekarūpānaṃ.
Of sālī rice means of the many varieties, such as red sālī, fragrant sālī, and so on.
Sālīnaṃ (của các loại gạo) như gạo lúa đỏ, gạo thơm, v.v., nhiều loại khác nhau.
Piṇḍapātanti odanaṃ.
Almsfood means boiled rice.
Piṇḍapātaṃ (vật thực khất thực) là cơm.
Vicitakāḷakanti apanītakāḷakaṃ.
With dark grains removed means with the black grains removed.
Vicitakāḷakaṃ (đã nhặt bỏ những hạt đen) có nghĩa là đã loại bỏ những hạt đen.
Nevassa taṃ hoti antarāyāyāti tassa evaṃvidhassa bhikkhuno taṃ vuttappakārapiṇḍapātabhojanaṃ maggassa vā phalassa vā neva antarāyāya hoti, paṭiladdhaguṇassa hi taṃ kimantarāyaṃ karissati?
That is no obstacle for him means for such a bhikkhu, eating that kind of almsfood is no obstacle for either the path or the fruit. For one who has already attained a quality, what obstacle could it create?
Nevassa taṃ hoti antarāyāyā (Điều đó không trở thành chướng ngại cho vị ấy): Việc thọ dụng vật thực khất thực đã nói trên không trở thành chướng ngại cho đạo hay quả của vị Tỳ-khưu như vậy. Làm sao điều đó có thể gây chướng ngại cho người đã đạt được công đức?
Yopissa appaṭiladdho catutthamaggo ca phalaṃ ca tappaṭilābhāya vipassanaṃ ārabhatopi nevassa taṃ hoti antarāyāya, antarāyaṃ kātuṃ asamatthameva hoti.
Even for him who has not attained the fourth path and its fruit, and who is undertaking insight practice to attain them, that is no obstacle for him; it is simply incapable of creating an obstacle.
Ngay cả đối với người chưa đạt được đạo thứ tư và quả, khi bắt đầu thực hành thiền quán để đạt được chúng, điều đó cũng không trở thành chướng ngại cho vị ấy; nó hoàn toàn không có khả năng gây chướng ngại.
Vuttappakārasīladhammapaññāsaṅgahena maggena visuddhacittattā.
because his mind is purified by the path which is a collection of the aforementioned virtue, concentration, and wisdom.
Vì tâm thanh tịnh nhờ Đạo (magga) bao gồm Giới (sīla), Pháp (dhamma) và Tuệ (paññā) đã được nói đến.
Tattha acchanti vippasannaṃ.
Therein, clear means exceptionally limpid.
Ở đây, accha có nghĩa là trong suốt, rất trong.
Parisuddhaṃ malavigamena.
Purified means through the removal of impurities.
Parisuddhaṃ (thanh tịnh) là không có ô nhiễm.
Pariyodātaṃ pabhassaratāya.
Bright means due to its radiance.
Pariyodātaṃ (trong sạch) là do sự rực rỡ.
Ukkāmukhanti suvaṇṇakārānaṃ mūsāmukhaṃ.
Furnace-mouth means the opening of a goldsmith’s crucible.
Ukkāmukhaṃ là miệng lò của thợ kim hoàn.
Suvaṇṇakārānaṃ mūsā hi idha ukkā, aññattha pana dīpikādayopi vuccanti.
Indeed, here a goldsmith’s crucible is an ukkā, but elsewhere a torch and so on are also called thus.
Thật vậy, miệng lò của thợ kim hoàn ở đây được gọi là ukkā, nhưng ở nơi khác, nó cũng được gọi là ngọn đuốc, v.v.
‘‘Ukkāsu dhārīyamānāsū’’ti (dī. ni. 1.159) hi āgataṭṭhāne dīpikā ‘‘ukkā’’ti vuccati.
For in the passage where it comes, “while the torches were being held,” a torch is called an “ukkā.”
Trong đoạn “khi các ngọn đuốc được giữ” (Dī. Ni. 1.159), ngọn đuốc được gọi là “ukkā”.
‘‘Ukkaṃ bandheyya, ukkaṃ bandhitvā ukkāmukhaṃ ālimpeyyā’’ti (ma. ni. 3.360) āgataṭṭhāne aṅgārakapallaṃ.
In the passage where it comes, “One should prepare the charcoal pan; having prepared the charcoal pan, one should smear the mouth of the charcoal pan,” a charcoal pan is meant.
Trong đoạn “nên buộc lò, sau khi buộc lò, nên trát miệng lò” (Ma. Ni. 3.360), lò than được gọi là “ukkā”.
‘‘Kammārānaṃ yathā ukkā, anto jhāyati no bahī’’ti (jā. 2.22.649) āgataṭṭhāne kammāruddhanaṃ.
In the passage where it comes, “Just as a blacksmith’s bellows burns within but not without,” a blacksmith’s forge is meant.
Trong đoạn “như lò của thợ rèn, cháy bên trong chứ không bên ngoài” (Jā. 2.22.649), lò rèn được gọi là “ukkā”.
‘‘Evaṃvipāko ukkāpāto bhavissatī’’ti (dī. ni. 1.24) āgataṭṭhāne vātavego ‘‘ukkā’’ti vuccati.
In the passage where it comes, “Such will be the result of a meteor shower,” a blast of wind is called an “ukkā.”
Trong đoạn “sự rơi xuống như lửa sẽ có quả báo như vậy” (Dī. Ni. 1.24), luồng gió mạnh được gọi là “ukkā”.
Imasmiṃ pana ṭhāne aññesu ca evarūpesu ‘‘saṇḍāsena jātarūpaṃ gahetvā ukkāmukhe pakkhipatī’’ti āgataṭṭhānesu suvaṇṇakārānaṃ mūsā ‘‘ukkā’’ti veditabbā.
However, in this place and in other similar passages where it comes, “taking the gold with tongs, he places it in the furnace-mouth,” it should be understood that a goldsmith's crucible is an “ukkā.”
Tuy nhiên, ở đây và ở những nơi tương tự như đoạn “dùng kẹp lấy vàng bỏ vào miệng lò”, miệng lò của thợ kim hoàn được biết là “ukkā”.
Tatrāyaṃ upamāsaṃsandanā – saṃkiliṭṭhavatthaṃ viya hi saṃkiliṭṭhajātarūpaṃ viya ca imassa bhikkhuno puthujjanakāle kāmarāgādimalānugataṃ cittaṃ daṭṭhabbaṃ.
Here, this is the application of the simile: Just as there is a soiled cloth, and just as there is impure gold, so should this bhikkhu’s mind, followed by the stains of sensual lust and so on during his time as a worldling, be regarded.
Sự so sánh ví dụ ở đây là: Tâm của Tỳ-kheo này vào thời còn là phàm phu, bị ô nhiễm bởi các phiền não như dục ái, nên được xem như y phục bị dơ bẩn hoặc vàng bị ô uế.
Acchodakaṃ viya ukkāmukhaṃ viya ca anāgāmimaggo.
Just as there is clear water, and just as there is a furnace-mouth, so is the path of a non-returner.
Đạo Anāgāmī (Bất Lai) được xem như nước trong suốt hoặc miệng lò.
Taṃ udakaṃ ukkāmukhañca āgamma vatthasuvaṇṇānaṃ parisuddhatā viya tassa bhikkhuno vuttappakārasīladhammapaññāsaṅgahaṃ anāgāmimaggaṃ āgamma visuddhacittatāti.
Just as the cloth and gold become purified by depending on that water and furnace-mouth, so the purity of that bhikkhu’s mind should be regarded as depending on the path of a non-returner, which is a collection of the aforementioned types of virtue, concentration, and wisdom.
Và giống như y phục và vàng trở nên thanh tịnh nhờ nước và miệng lò đó, tâm của Tỳ-kheo đó trở nên thanh tịnh nhờ Đạo Anāgāmī bao gồm Giới, Pháp và Tuệ đã được nói đến.
77. So mettāsahagatena cetasāti yathānusandhivasena desanā āgatā.
77. He, with a mind accompanied by loving-kindness: The teaching is given by way of contextual connection.
77. Tâm với lòng từ (mettāsahagatena cetasā) – lời dạy này được đưa ra theo cách yathānusandhi (liên hệ tương ứng).
Tayo hi anusandhī pucchānusandhi ajjhāsayānusandhi yathānusandhīti.
Indeed, there are three connections: the connection of a question, the connection of disposition, and the contextual connection.
Thật vậy, có ba cách liên hệ: pucchānusandhi (liên hệ câu hỏi), ajjhāsayānusandhi (liên hệ ý định) và yathānusandhi (liên hệ tương ứng).
Tattha ‘‘evaṃ vutte aññataro bhikkhu bhagavantaṃ etadavoca ‘siyā nu kho, bhante, bahiddhā asati paritassanā’ti?
Among these, “When this was said, a certain bhikkhu said this to the Blessed One: ‘Venerable sir, could there be non-agitation in the absence of an external object?’”
Trong đó, “Khi nói vậy, một Tỳ-kheo khác bạch Đức Thế Tôn rằng: ‘Bạch Thế Tôn, có thể nào không có sự lo sợ ở bên ngoài không?’
‘Siyā bhikkhū’ti bhagavā avocā’’ti (ma. ni. 1.242).
“‘There could, bhikkhu,’ the Blessed One said.”
Đức Thế Tôn đáp: ‘Có, này các Tỳ-kheo’” (Ma. Ni. 1.242).
Evaṃ pucchantānaṃ vissajjitasuttavasena pucchānusandhi veditabbo.
In this way, the connection of a question should be understood through suttas that are answers to those who ask.
Cách pucchānusandhi (liên hệ câu hỏi) này nên được hiểu theo các bài kinh được giải đáp cho những người hỏi như vậy.
‘‘Siyā kho pana te brāhmaṇa evamassa, ajjāpi nūna samaṇo gotamo avītarāgo’’ti (ma. ni. 1.55) evaṃ paresaṃ ajjhāsayaṃ viditvā vuttassa suttassa vasena ajjhāsayānusandhi veditabbo.
“‘It might occur to you, brahmin, that even today the ascetic Gotama is not free from lust.’” In this way, by knowing the disposition of others, the connection of disposition should be understood through a sutta spoken in that manner.
Cách ajjhāsayānusandhi (liên hệ ý định) nên được hiểu theo bài kinh được nói ra sau khi biết ý định của người khác, như “Này Bà-la-môn, có thể ông nghĩ rằng Sa-môn Gotama vẫn chưa thoát khỏi dục ái” (Ma. Ni. 1.55).
Yena pana dhammena ādimhi desanā uṭṭhitā, tassa dhammassa anurūpadhammavasena vā paṭipakkhavasena vā yesu suttesu upari desanā āgacchati, tesaṃ vasena yathānusandhi veditabbo.
But in whichever suttas the teaching arises later, either through a Dhamma that is suitable to the Dhamma with which the teaching began, or through its opposite, through those suttas the contextual connection should be understood.
Còn cách yathānusandhi (liên hệ tương ứng) nên được hiểu theo những bài kinh mà lời dạy được đưa ra ở phần trên, hoặc là theo pháp tương ứng với pháp đã được đề cập ở phần đầu của lời dạy, hoặc là theo pháp đối lập.
Seyyathidaṃ, ākaṅkheyyasutte heṭṭhā sīlena desanā uṭṭhitā, upari cha abhiññā āgatā.
As, for instance, in the Ākaṅkheyyasutta, the teaching began below with virtue, and the six higher knowledges came later.
Ví dụ, trong kinh Ākaṅkheyya, lời dạy bắt đầu từ giới (sīla) ở phần dưới, và sáu thắng trí (abhiññā) được đề cập ở phần trên.
Kakacūpame heṭṭhā akkhantiyā uṭṭhitā, upari kakacūpamovādo āgato.
In the Kakacūpama Sutta, it began below with intolerance, and the exhortation of the simile of the saw came later.
Trong kinh Kakacūpama, lời dạy bắt đầu từ sự không nhẫn nại ở phần dưới, và lời khuyên ví như cưa được đề cập ở phần trên.
Alagadde heṭṭhā diṭṭhiparidīpanena uṭṭhitā, upari tiparivaṭṭasuññatāpakāsanā āgatā, cūḷaassapure heṭṭhā kilesaparidīpanena uṭṭhitā, upari brahmavihārā āgatā.
In the Alagaddūpama Sutta, it began below with an exposition of views, and the explanation of emptiness in three rounds came later; in the Cūḷa-assapura Sutta, it began below with an exposition of defilements, and the divine abidings came later.
Trong kinh Alagaddūpama, lời dạy bắt đầu bằng sự trình bày về tà kiến ở phần dưới, và sự tuyên bố về tánh không ba vòng được đề cập ở phần trên; trong kinh Cūḷaassapura, lời dạy bắt đầu bằng sự trình bày về phiền não ở phần dưới, và các Phạm trú (brahmavihāra) được đề cập ở phần trên.
Kosambiyasutte heṭṭhā bhaṇḍanena uṭṭhitā, upari sāraṇīyadhammā āgatā.
In the Kosambiyasutta, it began below with quarreling, and the principles of cordiality came later.
Trong kinh Kosambiya, lời dạy bắt đầu bằng sự tranh cãi ở phần dưới, và các pháp hòa hợp (sāraṇīyadhamma) được đề cập ở phần trên.
Imasmimpi vatthasutte heṭṭhā kilesaparidīpanena uṭṭhitā, upari brahmavihārā āgatā.
In this very Vatthasutta as well, it began below with an exposition of defilements, and the divine abidings came later.
Trong kinh Vatthasutta này, lời dạy bắt đầu bằng sự trình bày về phiền não ở phần dưới, và các Phạm trú được đề cập ở phần trên.
Tena vuttaṃ ‘‘yathānusandhivasena desanā āgatā’’ti.
Therefore it was said, “The teaching is given by way of contextual connection.”
Vì vậy, đã nói rằng “lời dạy được đưa ra theo cách liên hệ tương ứng”.
Brahmavihāresu pana anupadavaṇṇanā ca bhāvanānayo ca sabbo sabbākārena visuddhimagge vutto.
Regarding the divine abidings, however, the word-by-word commentary and the method of development have been entirely stated in all aspects in the Visuddhimagga.
Tuy nhiên, trong các Phạm trú, toàn bộ phần giải thích từng từ và phương pháp tu tập đều được trình bày trong Thanh Tịnh Đạo (Visuddhimagga).
Tassattho – so anāgāmī evaṃ bhāvitabrahmavihāro etesaṃ brahmavihārānaṃ yato kutoci vuṭṭhāya te eva brahmavihāradhamme nāmavasena tesaṃ nissayaṃ hadayavatthuṃ vatthunissayāni bhūtānīti iminā nayena bhūtupādāyadhamme rūpavasena ca vavatthapetvā atthi idanti pajānāti, ettāvatānena dukkhasaccavavatthānaṃ kataṃ hoti.
The meaning is this: That non-returner, having thus developed the divine abidings, rising from any one of those divine abidings, having defined those very states of the divine abidings in terms of mind, and having defined their physical basis, the heart-base, and the primary elements that are the basis for the heart-base—in this way defining the primary and derived matter in terms of matter—he understands, “There is this.” By this much, he has made a definition of the truth of suffering.
Ý nghĩa của đoạn này là: Vị Anāgāmī, sau khi đã tu tập Phạm trú như vậy, từ bất kỳ Phạm trú nào mà vị ấy đã xuất ra, vị ấy phân biệt các pháp Phạm trú đó theo phương diện danh (nāma), và phân biệt vật y cứ của chúng là tâm sở (hadayavatthu), và các đại chủng (bhūtāni) là vật y cứ của vật y cứ, theo phương diện sắc (rūpa), rồi vị ấy biết rằng có điều này (atthi idaṃ). Đến đây, vị ấy đã phân biệt Khổ đế.
Tato tassa dukkhassa samudayaṃ paṭivijjhanto atthi hīnanti pajānāti, ettāvatānena samudayasaccavavatthānaṃ kataṃ hoti.
Then, penetrating the origin of that suffering, he understands, “There is the inferior.” By this much, he has made a definition of the truth of the origin.
Từ đó, khi quán triệt nguyên nhân của khổ đó, vị ấy biết rằng có điều thấp kém (atthi hīnaṃ). Đến đây, vị ấy đã phân biệt Tập đế.
Tato tassa pahānupāyaṃ vicinanto atthi paṇītanti pajānāti, ettāvatānena maggasaccavavatthānaṃ kataṃ hoti.
Then, investigating the means for its abandonment, he understands, “There is the superior.” By this much, he has made a definition of the truth of the path.
Từ đó, khi tìm kiếm phương tiện đoạn trừ khổ đó, vị ấy biết rằng có điều cao thượng (atthi paṇītaṃ). Đến đây, vị ấy đã phân biệt Đạo đế.
Tato tena maggena adhigantabbaṭṭhānaṃ vicinanto atthi uttari imassa saññāgatassa nissaraṇanti pajānāti, imassa mayā adhigatassa brahmavihārasaññāgatassa uttari nissaraṇaṃ nibbānaṃ atthīti evaṃ pajānātīti adhippāyo, ettāvatānena nirodhasaccavavatthānaṃ kataṃ hoti.
Then, investigating the state to be realized by that path, he understands, “There is a further escape from this field of perception.” The intention is that he understands thus: ‘There is a further escape from this field of perception of the divine abidings attained by me, which is Nibbāna.’ By this much, he has made a definition of the truth of cessation.
Từ đó, khi tìm kiếm nơi có thể đạt được bằng con đường đó, vị ấy biết rằng có sự thoát ly cao hơn khỏi trạng thái nhận thức này (atthi uttari imassa saññāgatassa nissaraṇaṃ). Ý nghĩa là vị ấy biết rằng có Niết Bàn, sự thoát ly cao hơn khỏi trạng thái nhận thức Phạm trú mà tôi đã đạt được. Đến đây, vị ấy đã phân biệt Diệt đế.
Tassa evaṃ jānato evaṃ passatoti tassa vipassanāpaññāya evaṃ catūhi ākārehi cattāri saccāni jānato, maggapaññāya evaṃ passato, bhayabherave vuttanayeneva kāmāsavāpi cittaṃ vimuccati…pe… itthattāyāti pajānātīti.
For one who knows thus and sees thus: for one who knows the four truths in four aspects thus with the wisdom of insight, and sees thus with the wisdom of the path, his mind is liberated also from the taint of sensuality… and so on… he understands: “…for this state of being,” just as was stated in the Bhayabherava Sutta.
Khi vị ấy biết như vậy, khi vị ấy thấy như vậy – có nghĩa là khi vị ấy biết Tứ Thánh Đế bằng Tuệ quán (vipassanāpaññā) theo bốn phương diện như vậy, và khi vị ấy thấy bằng Đạo tuệ (maggapaññā) như vậy, thì tâm của vị ấy giải thoát khỏi các lậu hoặc dục (kāmāsava), v.v. giống như cách đã nói trong kinh Bhayabherava, và vị ấy biết rằng “đây là sự chấm dứt của đời sống này”.
79. Sundarikabhāradvājoti bhāradvājo nāma so brāhmaṇo attano gottavasena, sundarikāya pana nadiyā sinātassa pāpappahānaṃ hotīti ayamassa diṭṭhi, tasmā ‘‘sundarikabhāradvājo’’ti vuccati.
79. Sundarikabhāradvāja: That brahmin was named Bhāradvāja according to his clan, but his view was that by bathing in the Sundarikā river, the abandonment of evil occurs; therefore, he is called “Sundarikabhāradvāja.”
79. Sundarikabhāradvāja – Bà-la-môn đó tên là Bhāradvāja theo dòng họ của mình, nhưng vì ông có quan điểm rằng tội lỗi được gột rửa khi tắm ở sông Sundarikā, nên ông được gọi là “Sundarikabhāradvāja”.
So taṃ bhagavato vacanaṃ sutvā cintesi ‘‘mayaṃ sinānasuddhiṃ vaṇṇema, samaṇopi gotamo tatheva vaṇṇeti, samānacchando dāni esa amhehī’’ti.
Hearing the Blessed One’s words, he thought, “We praise purification by bathing, and the ascetic Gotama praises it in the same way. Now he is of the same mind as us.”
Nghe lời Đức Thế Tôn nói vậy, ông nghĩ: “Chúng ta ca ngợi sự thanh tịnh do tắm rửa, Sa-môn Gotama cũng ca ngợi như vậy, vậy là ông ấy có cùng chí hướng với chúng ta.”
Atha bhagavantaṃ bāhukaṃ nadiṃ gantvā taṃ tattha pāpaṃ pavāhetvā āgataṃ viya maññamāno āha ‘‘gacchati pana bhavaṃ gotamo bāhukaṃ nadiṃ sināyitu’’nti?
Then, thinking the Blessed One had gone to the Bāhukā river, washed away his evil there, and returned, he said, “Does the honorable Gotama go to the Bāhukā river to bathe?”
Rồi, tưởng rằng Đức Thế Tôn đã đến sông Bāhukā, gột rửa tội lỗi ở đó rồi trở về, ông hỏi: “Tôn giả Gotama có đến sông Bāhukā để tắm không?”
Bhagavā tassa gacchāmīti vā na gacchāmīti vā avatvāyeva brāhmaṇassa diṭṭhisamugghātaṃ kattukāmo ‘‘kiṃ brāhmaṇa bāhukāya nadiyā, kiṃ bāhukā nadī karissatī’’ti āha.
Without saying either “I go” or “I do not go,” the Blessed One, wishing to uproot the brahmin’s view, said, “What, brahmin, of the Bāhukā river? What will the Bāhukā river do?”
Đức Thế Tôn, không đáp “có đi” hay “không đi”, mà muốn đoạn trừ tà kiến của Bà-la-môn, nên nói: “Này Bà-la-môn, sông Bāhukā có ích gì? Sông Bāhukā sẽ làm gì?”
Tassattho kiṃ payojanaṃ bāhukāya, kiṃ sā karissati?
The meaning of this is: What is the use of the Bāhukā? What can it do?
Ý nghĩa của lời đó là: Sông Bāhukā có mục đích gì? Nó sẽ làm gì?
Asamatthā sā kassaci atthāya, kiṃ tattha gamissāmīti?
It is incapable of benefiting anyone; why should I go there?
Nó (con sông) không có khả năng mang lại lợi ích cho bất cứ ai, tôi sẽ đi đến đó làm gì?
Atha brāhmaṇo taṃ pasaṃsanto lokkhasammatātiādimāha.
Then the brahmin, praising it, said ‘esteemed by the coarse,’ and so on.
Rồi, vị Bà-la-môn ấy, khen ngợi con sông đó, nói lời mở đầu rằng: lokkhasammatā (được thế gian công nhận).
Tattha lokkhasammatāti lūkhabhāvasammatā, lūkhabhāvanti cokkhabhāvaṃ, visuddhibhāvaṃ detīti evaṃ sammatāti vuttaṃ hoti.
Therein, ‘esteemed by the coarse’ means esteemed for its quality of coarseness. ‘Quality of coarseness’ means it is esteemed as giving a state of purity, a state of purification; this is what is meant.
Ở đó, lokkhasammatā có nghĩa là được công nhận là mang lại sự thanh tịnh, được công nhận là mang lại sự trong sạch, sự thanh tịnh khỏi điều bất thiện.
Lokyasammatātipi pāṭho.
There is also the reading ‘esteemed by the worldly.’
Cũng có bản đọc là lokyasammatā.
Tassattho, seṭṭhaṃ lokaṃ gamayatīti evaṃ sammatāti.
Its meaning is: it is esteemed as leading to an excellent world.
Ý nghĩa của nó là: được công nhận là dẫn đến thế giới cao thượng.
Puññasammatāti puññanti sammatā.
‘Esteemed as merit’ means esteemed as merit.
Puññasammatā có nghĩa là được công nhận là phước báu.
Pavāhetīti gamayati visodheti.
‘Washes away’ means carries away, purifies.
Pavāhetī có nghĩa là rửa sạch, làm cho thanh tịnh.
Gāthāhi ajjhabhāsīti gāthāhi abhāsi.
‘Addressed him with verses’ means he spoke with verses.
Gāthāhi ajjhabhāsī có nghĩa là nói bằng kệ.
Gāthā ca vuccamānā tadatthadīpanatthameva vā gāthārucikānaṃ vuccati, visesatthadīpanatthaṃ vā.
And when verses are spoken, they are spoken either to explain the meaning of what was just said, for those who delight in verses, or to explain a special meaning.
Những bài kệ được nói ra là để làm sáng tỏ ý nghĩa của chúng, hoặc được nói cho những người yêu thích kệ, hoặc để làm sáng tỏ một ý nghĩa đặc biệt.
Idha panetā ubhayatthadīpanatthaṃ vuttāti veditabbā.
But here, it should be understood that they are spoken to explain both meanings.
Ở đây, nên biết rằng những bài kệ này được nói ra để làm sáng tỏ cả hai ý nghĩa.
Bāhukanti idameva hi ettha vacanaṃ tadatthadīpakaṃ, sesāni visesatthadīpakāni.
Indeed, here it is this very word ‘Bāhukā’ that explains that meaning; the remaining words explain a special meaning.
Bāhukaṃ: Ở đây, chỉ có lời này làm sáng tỏ ý nghĩa đó; những lời còn lại làm sáng tỏ ý nghĩa đặc biệt.
Yatheva hi bāhukaṃ, evaṃ adhikakkādīnipi loko gacchati nhānena pāpaṃ pavāhetuṃ.
Just as people go to the Bāhukā, so too do they go to Adhikakka and other places to wash away evil by bathing.
Cũng như sông Bāhuka, người ta đến các nơi như Adhikakka để gột rửa tội lỗi bằng cách tắm rửa.
Tattha ye tesaṃ ṭhānānaṃ āsannā honti, te divasassa tikkhattuṃ nhāyanti.
Therein, those who are near those places bathe three times a day.
Trong số đó, những người sống gần các địa điểm ấy thì tắm ba lần một ngày.
Ye dūrā, te yathākkamaṃ dvikkhattuṃ sakiṃ ekadivasantaraṃ, evaṃ yāva saṃvaccharantaraṃ nhāyanti.
Those who are far away bathe, in succession, twice, once, every other day, and so on, up to once a year.
Những người sống xa thì lần lượt tắm hai lần, một lần, cách một ngày, cứ thế cho đến cách một năm.
Ye pana sabbathāpi gantuṃ na sakkonti, te ghaṭehipi tato udakaṃ āharāpetvā nhāyanti.
But those who are completely unable to go have water brought from there in pots and bathe.
Còn những người hoàn toàn không thể đến được thì cho người mang nước từ đó về để tắm.
Sabbañcetaṃ niratthakaṃ, tasmā imaṃ visesatthaṃ dīpetuṃ adhikakkādīnipīti āha.
And all of this is futile; therefore, to explain this special meaning, he said ‘to Adhikakka and other places.’
Tất cả những điều này đều vô ích, do đó để làm sáng tỏ ý nghĩa đặc biệt này, (Đức Phật) nói: adhikakkādīnipi (cũng như Adhikakka và các nơi khác).
Tattha adhikakkanti nhānasambhāravasena laddhavohāraṃ ekaṃ titthaṃ vuccati.
Therein, ‘Adhikakka’ refers to a certain bathing place that got its name from the bathing preparations.
Ở đó, adhikakka được gọi là một bến sông được đặt tên theo các vật dụng tắm rửa.
Gayātipi maṇḍalavāpisaṇṭhānaṃ titthameva vuccati.
‘Gayā’ also refers to a bathing place shaped like a circular pond.
Gayā cũng được gọi là một bến sông có hình dạng ao tròn.
Payāgāti etampi gaṅgāya ekaṃ titthameva mahāpanādassa rañño gaṅgāyaṃ nimuggapāsādassa sopānasammukhaṭṭhānaṃ, bāhukā sundarikā sarassatī bāhumatīti imā pana catasso nadiyo.
‘Payāga’ is also a certain bathing place on the Ganges, a place opposite the stairs of the palace of King Mahāpanāda, which had sunk into the Ganges. Bāhukā, Sundarikā, Sarassatī, and Bāhumatī are these four rivers.
Payāgā cũng là một bến sông của sông Gaṅgā, là nơi đối diện với cầu thang của cung điện chìm dưới sông Gaṅgā của vua Mahāpanāda. Còn Bāhukā, Sundarikā, Sarasvatī, Bāhumatī là bốn con sông này.
Bāloti duppañño.
‘A fool’ means one of little wisdom.
Bālo có nghĩa là người ngu si.
Pakkhandoti pavisanto.
‘Immersing’ means entering.
Pakkhando có nghĩa là khi đi vào.
Na sujjhatīti kilesasuddhiṃ na pāpuṇāti, kevalaṃ rajojallameva pavāheti.
‘Is not purified’ means does not attain purification from defilements; he only washes away dust and dirt.
Na sujjhatī có nghĩa là không đạt được sự thanh tịnh của phiền não; chỉ gột rửa bụi bẩn mà thôi.
Kiṃ sundarikā karissatīti sundarikā kilesavisodhane kiṃ karissati?
‘What can the Sundarikā do?’ means what can the Sundarikā do in purifying defilements?
Kiṃ sundarikā karissatī có nghĩa là sông Sundarikā sẽ làm gì trong việc thanh tịnh phiền não?
Na kiñci kātuṃ samatthāti adhippāyo.
The intention is that it is not capable of doing anything.
Ý nghĩa là: nó không có khả năng làm bất cứ điều gì.
Esa nayo payāgabāhukāsu.
This is the method for ‘Payāga and Bāhukā.’
Nguyên tắc này cũng áp dụng cho Payāgā và Bāhukā.
Imehi ca tīhi padehi vuttehi itarānipi cattāri lakkhaṇāhāranayena vuttāneva honti, tasmā yatheva sundarikā payāgā bāhukā na kiñci karonti, tathā adhikakkādayopīti veditabbā.
And with these three terms having been stated, the other four are also as good as stated by the method of applying the characteristic. Therefore, it should be understood that just as the Sundarikā, Payāga, and Bāhukā do nothing, so too do Adhikakka and the others.
Và khi ba từ này được nói ra, bốn từ còn lại cũng được nói ra theo cách suy luận đặc điểm, do đó, nên biết rằng cũng như Sundarikā, Payāgā, Bāhukā không làm được gì, thì Adhikakka và các nơi khác cũng vậy.
Verinti pāṇātipātādipañcaverasamannāgataṃ.
‘A hostile person’ means one endowed with the five kinds of hostility, such as the destruction of life.
Veriṃ có nghĩa là người bị năm mối thù như sát sinh chi phối.
Katakibbisanti kataluddakammaṃ.
‘Who has done wrong’ means one who has done cruel deeds.
Katakibbisaṃ có nghĩa là người đã thực hiện hành vi ác độc.
Na hi naṃ sodhayeti sundarikā vā payāgā vā bāhukā vā na sodhaye, na sodhetīti vuttaṃ hoti.
‘Cannot purify him’ means the Sundarikā, or Payāga, or Bāhukā cannot purify him; ‘does not purify’ is what is meant.
Na hi naṃ sodhaye có nghĩa là Sundarikā, Payāgā, hay Bāhukā sẽ không thanh tịnh được người đó, tức là không làm cho thanh tịnh.
Pāpakamminanti pāpakehi verakibbisakammehi yuttaṃ, lāmakakamme yuttaṃ vā verakibbisabhāvaṃ appattehi khuddakehipi pāpehi yuttanti vuttaṃ hoti.
‘An evil-doer’ means one endowed with evil deeds of hostility and wrong, or endowed with base deeds; it is said to mean one endowed even with minor evils that have not reached the state of hostility and wrong.
Pāpakamminaṃ có nghĩa là người bị chi phối bởi các hành vi thù địch và ác độc, hoặc người bị chi phối bởi những điều ác nhỏ nhặt chưa đạt đến mức độ thù địch và ác độc.
Suddhassāti nikkilesassa.
‘For one who is pure’ means for one without defilements.
Suddhassā có nghĩa là người không có phiền não.
Sadā phaggūti niccampi phaggunīnakkhattameva.
‘Always the Phaggu’ means it is always the Phaggunī constellation.
Sadā phaggū có nghĩa là luôn luôn là ngày sao Phaggunī.
Phaggunamāse kira ‘‘uttaraphaggunadivase yo nhāyati, so saṃvaccharaṃ katapāpaṃ sodhetī’’ti evaṃ diṭṭhiko so brāhmaṇo, tenassa bhagavā taṃ diṭṭhiṃ paṭihananto āha ‘‘suddhassa ve sadā phaggū’’ti.
In the month of Phagguna, that brahmin held the view, "Whoever bathes on the day of Uttaraphaggunī purifies the evil done for a year." Because of this, the Blessed One, refuting his view, said, "For one who is pure, it is always the Phaggu."
Vào tháng Phagguna, vị Bà-la-môn ấy có quan điểm rằng "ai tắm vào ngày Uttaraphaggunī thì sẽ gột rửa được tội lỗi đã gây ra trong một năm", do đó, Đức Thế Tôn đã bác bỏ quan điểm đó của ông và nói: "Suddhassa ve sadā phaggū" (Đối với người thanh tịnh, luôn luôn là ngày Phaggunī).
Nikkilesassa niccaṃ phaggunīnakkhattaṃ, itaro kiṃ sujjhatīti?
For one without defilements, it is always the Phaggunī constellation. How can the other be purified?
Đối với người không có phiền não, luôn luôn là ngày sao Phaggunī. Người khác làm sao có thể thanh tịnh được?
Uposatho sadāti suddhassa ca cātuddasapannarasādīsu uposathaṅgāni asamādiyatopi niccameva uposatho.
‘Always the Uposatha’ means for one who is pure, it is always the Uposatha, even without undertaking the Uposatha factors on the fourteenth, fifteenth, and so on.
Uposatho sadā có nghĩa là đối với người thanh tịnh, ngay cả khi không giữ các giới Uposatha vào các ngày mười bốn, mười lăm, v.v., thì luôn luôn là Uposatha.
Suddhassa sucikammassāti nikkilesatāya suddhassa sucīhi ca kāyakammādīhi samannāgatassa.
‘For one who is pure, of pure deeds’ means for one who is pure due to being without defilements and endowed with pure bodily actions and so on.
Suddhassa sucikammassā có nghĩa là người thanh tịnh do không có phiền não, và người có các hành vi thân, khẩu, ý trong sạch.
Sadā sampajjate vatanti īdisassa ca kusalūpasañhitaṃ vatasamādānampi niccaṃ sampannameva hotīti.
‘The vow is always accomplished’ means for such a person, the undertaking of a vow connected with the wholesome is always accomplished.
Sadā sampajjate vataṃ có nghĩa là đối với người như vậy, việc giữ giới hạnh liên quan đến thiện pháp cũng luôn luôn được viên mãn.
Idheva sināhīti imasmiṃyeva mama sāsane sināhi.
‘Bathe right here’ means bathe right here in my Dispensation.
Idheva sināhī có nghĩa là hãy tắm rửa ngay trong Giáo pháp của ta.
Kiṃ vuttaṃ hoti?
What is meant?
Ý nghĩa là gì?
‘‘Sace ajjhattikakilesamalappavāhanaṃ icchasi, idheva mama sāsane aṭṭhaṅgikamaggasalilena sināhi, aññatra hi idaṃ natthī’’ti.
"If you wish to wash away the stain of internal defilements, bathe right here in my Dispensation with the water of the Eightfold Path, for this does not exist elsewhere."
"Nếu ngươi mong muốn gột rửa những cấu uế phiền não nội tâm, thì hãy tắm rửa bằng dòng nước của Bát Chánh Đạo ngay trong Giáo pháp của ta, vì điều này không có ở nơi nào khác."
Sace musā na bhaṇasīti etenassa vacīdvārasuddhi.
‘If you do not speak falsely,’ by this, the purity of his speech-door.
Sace musā na bhaṇasī (Nếu ngươi không nói dối) – bằng lời này, sự thanh tịnh của ngữ môn (lời nói).
Sace pāṇaṃ na hiṃsasi sace adinnaṃ nādiyasīti etehi kāyadvārasuddhi.
‘If you do not harm a living being, if you do not take what is not given,’ by these, the purity of the body-door.
Sace pāṇaṃ na hiṃsasi sace adinnaṃ nādiyasī (Nếu ngươi không hại sinh mạng, nếu ngươi không lấy của không cho) – bằng những lời này, sự thanh tịnh của thân môn.
Saddahāno amaccharīti etehi pana naṃ evaṃ parisuddhadvāraṃ saddhāsampadāya cāgasampadāya ca niyojesi.
But by ‘Faithful and not miserly,’ he enjoined him, whose doors were thus purified, to the accomplishment of faith and the accomplishment of generosity.
Saddahāno amaccharī (Có đức tin, không keo kiệt) – bằng những lời này, (Đức Phật) đã khuyến khích ông, người có các môn thanh tịnh như vậy, vào sự thành tựu của đức tin và sự thành tựu của sự bố thí.
Kiṃ kāhasi gayaṃ gantvā, udapānopi te gayāti ayaṃ pana upaḍḍhagāthā, sace sabbabhūtesu khemataṃ karissasi, musā na bhaṇissasi, pāṇaṃ na hanissasi, adinnaṃ nādiyissasi, saddhahāno amaccharī bhavissasi, kiṃ kāhasi gayaṃ gantvā udapānopi te gayā, gayāyapi hi te nhāyantassa udapānepi imāya eva paṭipattiyā kilesasuddhi, sarīramalasuddhi pana ubhayattha samāti evaṃ yojetabbaṃ.
This half-verse, ‘What will you do by going to Gayā? Even a well is Gayā for you,’ should be connected in this way: if you establish security for all beings, do not speak falsely, do not kill a living being, do not take what is not given, and are faithful and not miserly, what will you do by going to Gayā? Even a well is Gayā for you. For indeed, for you who bathe, the purification of defilements is by this very practice, whether at Gayā or in a well, but the purification of bodily dirt is the same in both places.
Kiṃ kāhasi gayaṃ gantvā, udapānopi te gayā (Ngươi sẽ làm gì khi đến Gayā? Giếng nước cũng là Gayā đối với ngươi) – đây là một nửa bài kệ. Nếu ngươi tạo sự an toàn cho tất cả chúng sinh, không nói dối, không sát sinh, không lấy của không cho, có đức tin và không keo kiệt, thì ngươi sẽ làm gì khi đến Gayā? Giếng nước cũng là Gayā đối với ngươi. Bởi vì ngay cả khi ngươi tắm ở Gayā hay ở giếng nước, sự thanh tịnh phiền não của ngươi cũng đến từ chính hành vi này; còn sự thanh tịnh của bụi bẩn cơ thể thì như nhau ở cả hai nơi. Nên giải thích như vậy.
Yasmā ca loke gayā sammatatarā, tasmā tassa bhagavā ‘‘gacchati pana bhavaṃ gotamo bāhuka’’nti puṭṭhopi ‘‘kiṃ kāhasi bāhukaṃ gantvā’’ti avatvā ‘‘kiṃ kāhasi gayaṃ gantvā’’ti āhāti veditabbo.
And because Gayā is more esteemed in the world, therefore, although asked, "Venerable Gotama, are you going to the Bāhukā?" the Blessed One did not say, "What will you do by going to the Bāhukā?" but said, "What will you do by going to Gayā?" This should be understood.
Và bởi vì Gayā được xem là nổi tiếng hơn trên thế gian, nên Đức Thế Tôn, mặc dù được hỏi "Ngài Gotama có đi đến Bāhuka không?", đã không nói "Ngài sẽ làm gì khi đến Bāhuka?" mà lại nói "Ngài sẽ làm gì khi đến Gayā?". Nên hiểu như vậy.
80. Evaṃ vutteti evamādi bhayabherave vuttattā pākaṭameva.
80. ‘When this was said,’ and so on, is clear since it was stated in the Bhayabherava Sutta.
80. Evaṃ vutte (Khi được nói như vậy) và các câu tương tự đã được giải thích rõ ràng trong Bhayabherava Sutta.
Eko vūpakaṭṭhotiādīsu pana eko kāyavivekena.
But in ‘alone and secluded,’ and so on, ‘alone’ is by seclusion of the body.
Trong Eko vūpakaṭṭho (một mình, ẩn dật), v.v.: eko (một mình) là về sự độc cư thân.
Vūpakaṭṭho cittavivekena.
‘Secluded’ is by seclusion of the mind.
Vūpakaṭṭho (ẩn dật) là về sự độc cư tâm.
Appamatto kammaṭṭhāne sati avijahanena.
‘Diligent’ is by not abandoning mindfulness on the meditation subject.
Appamatto (không phóng dật) là về sự không từ bỏ chánh niệm trong đề mục thiền định.
Ātāpī kāyikacetasikavīriyasaṅkhātena ātāpena.
‘Ardent’ is by the ardor described as physical and mental energy.
Ātāpī (tinh cần) là về sự tinh tấn thân và tâm.
Pahitatto kāye ca jīvite ca anapekkhatāya.
‘With self resolute’ is by indifference to body and life.
Pahitatto (kiên quyết) là về sự không bám víu vào thân và mạng sống.
Viharanto aññatarairiyāpathavihārena.
‘Dwelling’ is with one or another posture.
Viharanto (an trú) là về việc an trú trong một trong các oai nghi.
Nacirassevāti pabbajjaṃ upādāya vuccati.
‘Before long’ is said with reference to his going forth.
Nacirassevā (không lâu sau) được nói đến từ khi xuất gia.
Kulaputtāti duvidhā kulaputtā jātikulaputtā ca ācārakulaputtā ca, ayaṃ pana ubhayathāpi kulaputto.
‘Sons of good family’—sons of good family are twofold: sons of good family by birth and sons of good family by conduct. This one, however, was a son of good family in both ways.
Kulaputtā (thiện nam tử) có hai loại: thiện nam tử về dòng dõi và thiện nam tử về hành vi. Ở đây, (vị Bà-la-môn) là thiện nam tử theo cả hai cách.
Agārasmāti gharā.
‘From the household’ means from the home.
Agārasmā (từ gia đình) có nghĩa là từ nhà.
Agārassa hitaṃ agāriyaṃ, kasigorakkhādikuṭumbaposanakammaṃ vuccati, natthi ettha agāriyanti anagāriyaṃ, pabbajjāyetaṃ adhivacanaṃ.
Beneficial to the household is ‘household life’; this refers to the work of supporting a family, such as farming and cattle-herding. Where there is no household life is ‘the homeless life’; this is a term for the going forth.
Agāriyaṃ (việc gia đình) là công việc nuôi sống gia đình như nông nghiệp, chăn nuôi gia súc. Anagāriyaṃ (không gia đình) có nghĩa là không có việc gia đình, đây là tên gọi khác của sự xuất gia.
Pabbajantīti upagacchanti upasaṅkamanti.
‘Go forth’ means they approach, they draw near.
Pabbajantī (xuất gia) có nghĩa là đi đến, đến gần.
Tadanuttaranti taṃ anuttaraṃ.
‘That supreme’ means that unsurpassed.
Tadanuttaraṃ (vô thượng đó) có nghĩa là điều vô thượng đó.
Brahmacariyapariyosānanti maggabrahmacariyassa pariyosānaṃ, arahattaphalanti vuttaṃ hoti.
‘Goal of the holy life’ means the culmination of the holy life of the path; the fruit of Arahantship is what is meant.
Brahmacariyapariyosānaṃ (sự hoàn thành của Phạm hạnh) có nghĩa là sự hoàn thành của Phạm hạnh Đạo, tức là quả vị A-la-hán.
Tassa hi atthāya kulaputtā pabbajanti.
For the sake of this, indeed, sons of good family go forth.
Chính vì mục đích đó mà các thiện nam tử xuất gia.
Diṭṭheva dhammeti tasmiṃyeva attabhāve.
‘In this very life’ means in that very existence.
Diṭṭheva dhamme (ngay trong đời này) có nghĩa là ngay trong kiếp sống này.
Sayaṃ abhiññā sacchikatvāti attanāyeva paññāya paccakkhaṃ katvā, aparappaccayaṃ katvāti attho.
‘Having realized it for himself through direct knowledge’ means having made it directly experienced through his own wisdom, having made it not reliant on another; this is the meaning.
Sayaṃ abhiññā sacchikatvā (tự mình chứng ngộ bằng thắng trí) có nghĩa là tự mình thực chứng bằng trí tuệ, tức là không phụ thuộc vào người khác.
Upasampajja vihāsīti pāpuṇitvā sampādetvā vihāsīti, evaṃ viharanto ca khīṇā jāti…pe… abbhaññāsi.
Having entered upon and dwelled means having attained, having accomplished, he dwelled. And while dwelling thus, ‘birth is destroyed...’ and so on... he directly knew.
Upasampajja vihāsī có nghĩa là đã đạt được, đã thành tựu và an trú. Khi an trú như vậy, vị ấy đã chứng ngộ rằng: "Sự tái sinh đã tận diệt... (v.v.)... đã biết rõ."
Etenassa paccavekkhaṇabhūmiṃ dasseti.
By this, the ground for his reviewing is shown.
Với điều này, (Đức Phật) trình bày về cảnh giới quán xét của vị ấy.
Katamā panassa jāti khīṇā?
But which birth of his is destroyed?
Nhưng sự tái sinh nào đã tận diệt của vị ấy?
Kathañca naṃ abbhaññāsīti?
And how did he directly know it?
Và làm sao vị ấy đã biết được điều đó?
Vuccate, kāmañcetaṃ bhayabheravepi vuttaṃ, tathāpi naṃ idha paṭhamapurisavasena yojanānayassa dassanatthaṃ puna saṅkhepato bhaṇāma.
It is said: Although this was stated in the Bhayabherava Sutta, nevertheless we shall state it again here briefly to show the method of application in the first person.
Được nói rằng, mặc dù điều này đã được đề cập trong kinh Bhayabherava, nhưng ở đây, để trình bày phương pháp kết nối theo ngôi thứ nhất, chúng tôi xin tóm tắt lại.
Na tāvassa atītā jāti khīṇā, pubbeva khīṇattā.
Now, his past birth is not destroyed, because it was already destroyed before.
Sự tái sinh trong quá khứ của vị ấy chưa tận diệt, vì nó đã tận diệt từ trước.
Na anāgatā, tattha vāyāmābhāvato.
Not the future one, because there is no effort made there.
Sự tái sinh trong tương lai chưa tận diệt, vì không có sự tinh tấn nào ở đó.
Na paccuppannā, vijjamānattā.
Not the present one, because it is existing.
Sự tái sinh trong hiện tại chưa tận diệt, vì nó đang hiện hữu.
Maggassa pana abhāvitattā yā uppajjeyya ekacatupañcavokārabhavesu ekacatupañcakkhandhappabhedā jāti, sā maggassa bhāvitattā anuppādadhammataṃ āpajjanena khīṇā, taṃ so maggabhāvanāya pahīnakilese paccavekkhitvā kilesābhāve vijjamānampi kammaṃ āyatiṃ appaṭisandhikaṃ hotīti jānanto jānāti.
But because the path has not been developed, that birth which would arise, differentiated into one, four, or five aggregates in the one, four, or five-constituent existences, that birth is destroyed by reaching a state of non-arising, because the path has been developed. He, having reviewed the defilements abandoned through the development of the path, knows, knowing that in the absence of defilements, even existing kamma becomes incapable of producing rebirth in the future.
Tuy nhiên, do con đường (Đạo) chưa được tu tập, sự tái sinh thuộc một, bốn hoặc năm uẩn trong các cõi một, bốn hoặc năm uẩn, đáng lẽ sẽ phát sinh, đã tận diệt do việc tu tập con đường (Đạo) khiến nó không còn khả năng phát sinh nữa. Vị ấy đã biết điều này, sau khi quán xét các phiền não đã được đoạn trừ nhờ tu tập Đạo, và biết rằng ngay cả nghiệp hiện hữu cũng sẽ không đưa đến tái sinh trong tương lai khi không còn phiền não.
Vusitanti vutthaṃ parivutthaṃ, kataṃ caritaṃ niṭṭhāpitanti attho.
Lived means has been lived, has been completely lived; the meaning is: has been done, has been practiced, has been finished.
Vusita có nghĩa là đã sống, đã hoàn thành, đã làm, đã thực hành, đã kết thúc.
Brahmacariyanti maggabrahmacariyaṃ.
The holy life means the holy life of the path.
Brahmacariya có nghĩa là Phạm hạnh Đạo (maggabrahmacariya).
Kataṃ karaṇīyanti catūsu saccesu catūhi maggehi pariññāpahānasacchikiriyabhāvanāvasena soḷasavidhampi kiccaṃ niṭṭhāpitanti attho.
Done what was to be done means that the sixteen-fold task—by way of full understanding, abandonment, realization, and development with the four paths in the Four Truths—has been finished.
Kataṃ karaṇīya có nghĩa là tất cả mười sáu việc cần làm đã được hoàn tất trong bốn Chân lý, thông qua bốn Đạo, dưới hình thức liễu tri (pariññā), đoạn trừ (pahāna), chứng ngộ (sacchikiriyā) và tu tập (bhāvanā).
Nāparaṃ itthattāyāti idāni punaitthabhāvāya evaṃsoḷasakiccabhāvāya, kilesakkhayāya vā maggabhāvanā natthīti.
There is nothing further for this state of being means: now again for this state of being, for such a sixteen-fold task, or for the destruction of defilements, there is no development of the path.
Nāparaṃ itthattāyā có nghĩa là không còn sự tu tập Đạo nào nữa để đạt đến trạng thái này (mười sáu việc) hoặc để diệt trừ phiền não.
Atha vā, itthattāyāti itthabhāvato imasmā evaṃpakārā idāni vattamānakkhandhasantānā aparaṃ khandhasantānaṃ natthi.
Or else, for this state of being means: from this state of being, from this kind of presently occurring continuum of aggregates, there is no other continuum of aggregates.
Hoặc itthattāyā có nghĩa là không còn một dòng tương tục uẩn nào khác ngoài dòng tương tục uẩn hiện tại như vậy.
Ime pana pañcakkhandhā pariññātā tiṭṭhanti, chinnamūlako rukkho viyāti abbhaññāsi.
But these five aggregates stand fully understood, like a tree with its root cut off—thus he directly knew.
Và vị ấy đã biết rằng năm uẩn này, sau khi đã được liễu tri, vẫn tồn tại như một cái cây bị đốn gốc.
Aññataroti eko.
One of means a certain one.
Aññataro có nghĩa là một.
Arahatanti arahantānaṃ, bhagavato sāvakānaṃ arahataṃ abbhantaro ahosīti.
The Arahants means of the Arahants; he became included among the Arahants who are disciples of the Blessed One.
Arahata có nghĩa là vị ấy đã trở thành một trong các A-la-hán, một A-la-hán trong hàng đệ tử của Đức Thế Tôn.
81. Evaṃ me sutanti sallekhasuttaṃ.
81. Thus have I heard is the Sallekha Sutta.
81. Evaṃ me suta là kinh Sallekhasutta.
Tattha mahācundoti tassa therassa nāmaṃ.
Therein, Mahācunda is the name of that elder.
Trong đó, Mahācundo là tên của vị Trưởng lão ấy.
Sāyanhasamayanti sāyanhakāle.
In the evening means at the time of evening.
Sāyanhasamaya có nghĩa là vào buổi chiều.
Paṭisallānā vuṭṭhitoti ettha paṭisallānanti tehi tehi sattasaṅkhārehi paṭinivattitvā sallānaṃ nilīyanaṃ, ekībhāvo pavivekoti vuttaṃ hoti.
Having risen from seclusion: Herein, seclusion means turning back from those various conditioned things of beings and secluding oneself, hiding oneself; being alone, solitude is what is meant.
Paṭisallānā vuṭṭhito: ở đây, paṭisallāna có nghĩa là sự rút lui, sự ẩn mình khỏi các hành (saṅkhāra) này, sự hợp nhất, tức là sự độc cư (paviveka).
Yo tato vuṭṭhito, so paṭisallānā vuṭṭhito nāma hoti.
One who has risen from that is called 'having risen from seclusion'.
Người nào xuất khỏi trạng thái đó thì được gọi là xuất khỏi độc cư (paṭisallānā vuṭṭhito).
Ayaṃ pana yasmā paṭisallānānaṃ uttamato phalasamāpattito vuṭṭhāsi, tasmā ‘‘paṭisallānā vuṭṭhito’’ti vutto.
But since this one rose from the supreme of seclusions, the attainment of fruition, therefore he is called 'having risen from seclusion'.
Vị này được gọi là "xuất khỏi độc cư" vì ngài đã xuất khỏi sự nhập quả (phalasamāpatti), là trạng thái độc cư tối thượng.
Bhagavantaṃ abhivādetvāti samadasanakhujjalavibhūsitena sirasā bhagavantaṃ sakkaccaṃ vanditvā, abhivādāpetvā vā ‘‘sukhī bhava, cundā’’ti evaṃ vacībhedaṃ kārāpetvā, bhagavā pana kira vandito samāno suvaṇṇadundubhisadisaṃ gīvaṃ paggayha kaṇṇasukhaṃ pemaniyaṃ amatābhisekasadisaṃ brahmaghosaṃ nicchārento ‘‘sukhī hohī’’ti tassa tassa nāmaṃ gahetvā vadati, etaṃ āciṇṇaṃ tathāgatānaṃ.
Having paid homage to the Blessed One means having respectfully venerated the Blessed One with his head, adorned with hands whose nails were even and comely; or having caused homage to be paid, having caused the utterance, "May you be well, Cunda." For when the Blessed One is venerated, it is said he raises his neck, which is like a golden drum, and emitting a voice like Brahmā's, pleasant to the ear, lovely, like an ambrosial consecration, he speaks, taking the name of each person, saying, "May you be well." This is the custom of the Tathāgatas.
Bhagavantaṃ abhivādetvā có nghĩa là cung kính đảnh lễ Đức Thế Tôn bằng đầu, được tô điểm bởi mười móng tay đều đặn và sáng chói; hoặc được Đức Thế Tôn cho phép đảnh lễ, tức là được Ngài nói lời chúc phúc như "Cundā, con hãy được an lạc." Bởi vì, khi được đảnh lễ, Đức Thế Tôn thường vươn cổ Ngài giống như trống vàng, phát ra tiếng Phạm âm êm tai, đáng yêu, như dòng cam lồ, và nói "Con hãy được an lạc" bằng cách gọi tên từng người. Đây là thói quen của các Đức Như Lai.
Tatridaṃ sādhakasuttaṃ, ‘‘sakko, bhante, devānamindo sāmacco saparijano bhagavato pāde sirasā vandatīti, sukhī hotu pañcasikha sakko devānamindo sāmacco saparijano, sukhakāmā hi devā manussā asurā nāgā gandhabbā, ye caññe santi puthukāyā’’ti.
In this regard, there is a supporting sutta: "Venerable sir, Sakka, the lord of the devas, with his ministers and retinue, bows with his head at the feet of the Blessed One." "May Sakka, the lord of the devas, with his ministers and retinue, be well, Pañcasikha. For devas, humans, asuras, nāgas, gandhabbas, and whatever other various kinds of beings there are, are desirers of well-being."
Trong trường hợp này, kinh chứng minh là: "(Thưa Thế Tôn), Sakka, vua của chư thiên, cùng với các vị đại thần và tùy tùng, đảnh lễ dưới chân Đức Thế Tôn bằng đầu." (Đức Phật đáp): "Này Pañcasikha, Sakka, vua của chư thiên, cùng với các vị đại thần và tùy tùng, hãy được an lạc. Vì chư thiên, loài người, A-tu-la, Nāga, Gandhabba, và các loài hữu tình khác, đều mong cầu an lạc."
Evañca pana tathāgatā evarūpe mahesakkhe yakkhe abhivadantīti.
And in this way, the Tathāgatas address such powerful yakkhas.
Và các Đức Như Lai đã nói lời chúc phúc như vậy đến các vị Dạ-xoa có đại oai lực này.
Yā imāti idāni vattabbābhimukhaṃ karonto viya āha.
Whatever these—he spoke as if making the topic about to be discussed face-to-face.
Yā imā: (Đức Thế Tôn) nói điều này như thể đang hướng đến những gì sẽ được nói.
Anekavihitāti nānappakārā.
Of many kinds means of various types.
Anekavihitā có nghĩa là nhiều loại, đủ loại.
Diṭṭhiyoti micchādiṭṭhiyo.
Views means wrong views.
Diṭṭhiyo có nghĩa là các tà kiến.
Loke uppajjantīti sattesu pātubhavanti.
Arise in the world means they appear among beings.
Loke uppajjantī có nghĩa là phát sinh trong chúng sinh.
Attavādappaṭisaṃyuttāti ‘‘rūpaṃ attato samanupassatī’’tiādinayappavattena attavādena paṭisaṃyuttā, tā vīsati bhavanti.
Connected with doctrines of self means connected with the doctrine of self that proceeds in the manner of "one regards form as self," and so on; they are twenty in number.
Attavādappaṭisaṃyuttā có nghĩa là liên quan đến tà kiến về tự ngã (attavāda) phát sinh theo cách như "thấy sắc là tự ngã" (rūpaṃ attato samanupassatī) v.v. Có hai mươi loại tà kiến này.
Lokavādappaṭisaṃyuttāti ‘‘sassato attā ca loko cā’’tiādinayappavattena lokavādena paṭisaṃyuttā, tā aṭṭha honti sassato, asassato, sassato ca asassato ca, neva sassato nāsassato, antavā, anantavā, antavā ca anantavā ca, nevantavā nānantavā attā ca loko cāti evaṃ pavattattā.
Connected with doctrines of the world means connected with the doctrine of the world that proceeds in the manner of "the self and the world are eternal," and so on; they are eight in number, as they proceed thus: the self and the world are eternal, not eternal, both eternal and not eternal, neither eternal nor not eternal; finite, infinite, both finite and infinite, neither finite nor infinite.
Lokavādappaṭisaṃyuttā có nghĩa là liên quan đến tà kiến về thế giới (lokavāda) phát sinh theo cách như "tự ngã và thế giới là thường hằng" (sassato attā ca loko cā) v.v. Có tám loại tà kiến này: thường hằng, vô thường, vừa thường hằng vừa vô thường, không thường hằng cũng không vô thường; có giới hạn, vô giới hạn, vừa có giới hạn vừa vô giới hạn, không có giới hạn cũng không vô giới hạn – tự ngã và thế giới – vì chúng phát sinh như vậy.
Ādimevātiādīsu ayamattho kiṃ nu kho bhante ādimeva manasikarontassa appatvāpi sotāpattimaggaṃ vipassanāmissakapaṭhamamanasikārameva manasikarontassa bhikkhuno evametāsaṃ ettakeneva upāyena etāsaṃ diṭṭhīnaṃ pahānañca paṭinissaggo ca hotīti.
At the very beginning—in this and following phrases, this is the meaning: Venerable sir, for a bhikkhu who is attending at the very beginning, even without having attained the path of stream-entry, attending only to the initial attention mixed with insight, does the abandonment and relinquishment of these views occur just by this much of a method?
Trong các từ như ādimevā v.v., ý nghĩa là: "Bạch Thế Tôn, có phải chăng đối với một Tỷ-kheo chỉ quán niệm từ ban đầu (ādimeva manasikarontassa), ngay cả khi chưa đạt đến Sơ quả Tu-đà-hoàn, chỉ cần quán niệm sự chú ý ban đầu (manasikāra) kết hợp với tuệ quán (vipassanā), thì sự đoạn trừ và từ bỏ những tà kiến này sẽ xảy ra ngay lập tức bằng phương pháp này?"
Idañca thero attanā anadhimānikopi samāno adhimānikānaṃ adhimānappahānatthaṃ adhimāniko viya hutvā pucchatīti veditabbo.
And it should be understood that the elder, though not conceited himself, asks this as if he were conceited, for the purpose of abandoning the conceit of the conceited.
Và điều này nên được hiểu rằng vị Trưởng lão, mặc dù không kiêu mạn, đã hỏi như một người kiêu mạn để đoạn trừ sự kiêu mạn của những người kiêu mạn.
Apare panāhu ‘‘therassa antevāsikā ādimanasikāreneva diṭṭhīnaṃ samucchedappahānaṃ hotīti evaṃsaññinopi, samāpattivihārā sallekhavihārāti evaṃsaññinopi atthi.
But others say: "There are disciples of the elder who have the perception that the eradication and abandonment of views occurs by initial attention alone, and also those who have the perception that dwelling in attainments is dwelling in effacement.
Những người khác lại nói: "Có những đệ tử của vị Trưởng lão tin rằng sự đoạn trừ hoàn toàn các tà kiến xảy ra chỉ bằng sự chú ý ban đầu; và cũng có những người tin rằng các trú xứ nhập định là các trú xứ thanh lọc (sallekhavihāra)."
So tesaṃ atthāya bhagavantaṃ pucchatī’’ti.
For their sake, he asks the Blessed One."
Vì vậy, vị ấy đã hỏi Đức Thế Tôn vì lợi ích của họ.
82. Athassa bhagavā tāsaṃ diṭṭhīnaṃ pahānūpāyaṃ dassento yā imātiādimāha.
82. Then the Blessed One, showing him the method for abandoning those views, said, Whatever these, and so on.
82. Sau đó, Đức Thế Tôn đã nói yā imā v.v. để trình bày phương pháp đoạn trừ các tà kiến đó.
Tattha yattha cetā diṭṭhiyo uppajjantītiādi pañcakkhandhe sandhāya vuttaṃ.
Therein, "where these views arise," and so on, was said with reference to the five aggregates.
Trong đó, các câu như "Nơi nào các tà kiến này phát sinh" v.v. được nói liên quan đến năm uẩn.
Etesu hi etā diṭṭhiyo uppajjanti.
For it is in these that these views arise.
Quả thật, các tà kiến này phát sinh trong những uẩn đó.
Yathāha ‘‘rūpe kho, bhikkhave, sati rūpaṃ abhinivissa evaṃ diṭṭhi uppajjati, so attā so loko so pecca bhavissāmi nicco dhuvo sassato avipariṇāmadhammo’’ti (saṃ. ni. 3.152) vitthāro.
As it is said: "Monks, when form exists, by being intent on form, such a view arises: 'That is self, that is the world; after death I will be permanent, stable, eternal, not subject to change'," the detailed explanation.
Như đã nói: "Này các Tỷ-kheo, khi có sắc, bám chấp vào sắc, tà kiến phát sinh rằng: 'Đó là tự ngã, đó là thế giới, sau khi chết ta sẽ là thường hằng, kiên cố, vĩnh cửu, không biến đổi.'" (Tương Ưng Bộ 3.152) – đây là phần giải thích chi tiết.
Ārammaṇavasena pana ekavacanaṃ katvā yattha cāti āha, yasmiṃ ārammaṇe uppajjantīti vuttaṃ hoti.
But he spoke in the singular, and where, with reference to the object, meaning, "in which object they arise."
Tuy nhiên, bằng cách sử dụng số ít theo đối tượng (ārammaṇa), (Đức Phật) đã nói yattha cā, có nghĩa là "trên đối tượng nào chúng phát sinh".
Ettha ca uppajjanti anusenti samudācarantīti imesaṃ evaṃ nānākaraṇaṃ veditabbaṃ.
And here, the different functions of arise, lie latent, and are enacted should be understood in this way.
Ở đây, sự khác biệt của các từ uppajjanti, anusenti, samudācaranti cần được hiểu rõ.
Jātivasena hi ajātā jāyamānā uppajjantīti vuccanti.
By way of arising, those that have not arisen, while arising, are said to arise.
Theo nghĩa phát sinh, các (tà kiến) chưa phát sinh nhưng đang trong quá trình phát sinh được gọi là uppajjanti (phát sinh).
Punappunaṃ āsevitā thāmagatā appaṭivinītā anusentīti.
Those that have been repeatedly practiced, have gained strength, and are not disciplined are said to lie latent.
Các (phiền não) đã được thực hành nhiều lần, đã trở nên mạnh mẽ, chưa được đoạn trừ được gọi là anusenti (tiềm tàng).
Kāyavacīdvāraṃ sampattā samudācarantīti, idametesaṃ nānākaraṇaṃ.
Those that have reached the doors of body and speech are said to be enacted; this is the difference between them.
Các (tà kiến) đã đạt đến cửa thân và cửa lời được gọi là samudācaranti (biểu hiện). Đây là sự khác biệt giữa chúng.
Taṃ netaṃ mamātiādīsu taṃ pañcakkhandhappabhedaṃ ārammaṇametaṃ mayhaṃ na hoti, ahampi eso na asmi, eso me attāpi na hotīti evametaṃ yathābhūtaṃ sammappaññāya passatoti evaṃ tāva padattho veditabbo.
In That is not mine, and so on, the meaning of the words should first be understood in this way: that object, which is differentiated into the five aggregates, is not mine; I am not that; that is not my self—thus he sees this as it really is with right wisdom.
Trong các câu như taṃ netaṃ mamā v.v., ý nghĩa của từ (padattha) trước hết cần được hiểu là: "Đối tượng thuộc năm uẩn này không phải của tôi, tôi cũng không phải là nó, nó cũng không phải là tự ngã của tôi" – như vậy, vị ấy thấy điều này đúng như thực bằng trí tuệ chân chánh.
Yasmā pana ettha etaṃ mamāti taṇhāgāho, tañca gaṇhanto aṭṭhasatataṇhāvicaritappabhedaṃ taṇhāpapañcaṃ gaṇhāti.
But since herein, "this is mine" is the grasping of craving, and in grasping it, one grasps the proliferation of craving, which has one hundred and eight varieties;
Vì ở đây, "điều này là của tôi" (etaṃ mama) là sự chấp thủ của tham ái (taṇhāgāha), và người chấp thủ điều đó đang chấp thủ sự lan man của tham ái (taṇhāpapañca) gồm một trăm lẻ tám loại.
Esohamasmīti mānagāho, tañca gaṇhanto navappabhedaṃ mānapapañcaṃ gaṇhāti.
"this I am" is the grasping of conceit, and in grasping it, one grasps the nine-fold proliferation of conceit;
"Tôi là cái đó" (esohamasmi) là sự chấp thủ của mạn (mānagāha), và người chấp thủ điều đó đang chấp thủ sự lan man của mạn (mānapapañca) gồm chín loại.
Eso me attāti diṭṭhigāho, tañca gaṇhanto dvāsaṭṭhidiṭṭhigatappabhedaṃ diṭṭhipapañcaṃ gaṇhāti.
"this is my self" is the grasping of views, and in grasping it, one grasps the proliferation of views, which has sixty-two types of wrong views;
"Cái đó là tự ngã của tôi" (eso me attā) là sự chấp thủ của tà kiến (diṭṭhigāha), và người chấp thủ điều đó đang chấp thủ sự lan man của tà kiến (diṭṭhipapañca) gồm sáu mươi hai loại.
Tasmā netaṃ mamāti vadanto bhagavā yathāvuttappabhedaṃ taṇhāpapañcaṃ paṭikkhipati.
therefore, in saying That is not mine, the Blessed One rejects the proliferation of craving, differentiated as described above.
Do đó, khi nói netaṃ mamā, Đức Thế Tôn bác bỏ sự lan man của tham ái đã được đề cập ở trên.
Nesohamasmīti mānapapañcaṃ.
“This is not I am” refers to the proliferation of conceit.
Tôi không phải là cái đó (Nesohamasmī) là sự phóng dật của ngã mạn.
Na meso attāti diṭṭhipapañcaṃ.
“This is not my self” refers to the proliferation of views.
Cái đó không phải là tự ngã của tôi (Na meso attā) là sự phóng dật của tà kiến.
Diṭṭhekaṭṭhāyeva cettha taṇhāmānā veditabbā.
And here, craving and conceit should be understood as having the same basis as view.
Ở đây, tham ái và ngã mạn nên được hiểu là cùng một đối tượng với tà kiến.
Evametanti evaṃ ‘‘netaṃ mamā’’tiādinā ākārena etaṃ khandhapañcakaṃ.
Thus this is: in this way, by the mode of “this is not mine,” and so on, is this pentad of aggregates.
Evametaṃ (như vậy) nghĩa là theo cách thức "đây không phải của tôi" v.v., đây là năm uẩn.
Yathābhūtanti yathā sabhāvaṃ, yathā atthīti vuttaṃ hoti.
As it really is: as its nature is; it means as it exists.
Yathābhūtaṃ (như thật) nghĩa là như bản chất, như những gì đang tồn tại, tức là vô thường, khổ, vô ngã, bất tịnh.
Khandhapañcakañhi eteneva ākārena atthi.
For the pentad of aggregates exists only in this mode.
Thật vậy, năm uẩn chỉ tồn tại theo cách thức đó.
Mamantiādinā pana gayhamānampi tenākārena nevatthīti adhippāyo.
The meaning is that although it is grasped as “mine,” etc., it does not exist in that mode.
Nhưng nếu bị nắm giữ theo cách "của tôi" v.v., thì nó không tồn tại theo cách đó. Đó là ý nghĩa.
Sammappaññāya passatoti sotāpattimaggapaññāpariyosānāya vipassanāpaññāya suṭṭhu passantassa.
Of one who sees with right wisdom: of one who sees rightly with insight-wisdom that culminates in the wisdom of the path of stream-entry.
Sammappaññāya passato (nhìn thấy bằng chánh tuệ) nghĩa là nhìn thấy rõ ràng bằng tuệ quán, kết thúc bằng tuệ của đạo Tu-đà-hoàn (Sotāpattimagga).
Evametāsanti etena upāyena etāsaṃ.
Thus of these: by this method, of these.
Evametāsaṃ (như vậy đối với những điều này) nghĩa là bằng phương pháp này đối với những điều này.
Pahānaṃ paṭinissaggoti ubhayampetaṃ samucchedappahānassevādhivacanaṃ.
Abandonment, relinquishment: both of these are terms for abandonment by cutting off.
Pahānaṃ paṭinissaggo (sự đoạn diệt, sự từ bỏ) cả hai đều là từ đồng nghĩa của sự đoạn diệt hoàn toàn (samucchedappahāna).
Evaṃ bhagavā ādimanasikāreneva diṭṭhīnaṃ pahānaṃ hoti nu kho noti āyasmatā mahācundena adhimānikānaṃ vasena pañhaṃ puṭṭho sotāpattimaggena diṭṭhippahānaṃ dassetvā idāni sayameva adhimānikānaṃ jhānaṃ vibhajanto ṭhānaṃ kho panetantiādimāha.
Thus, when the Blessed One was asked a question by the venerable Mahācunda on behalf of those with overestimation—"Is there an abandonment of views by initial attention or not?"—having shown the abandonment of views through the path of stream-entry, he now, on his own, expounds on the jhāna of those with overestimation, saying “Now, this is a possible case,” etc.
Khi Tôn giả Mahācunda hỏi Đức Thế Tôn rằng liệu các tà kiến có được đoạn trừ ngay từ sự tác ý ban đầu hay không, Đức Thế Tôn đã chỉ ra sự đoạn trừ tà kiến bằng đạo Tu-đà-hoàn. Bây giờ, Ngài tự mình phân tích thiền của những người có tâm kiêu mạn (adhimānika) và nói: ṭhānaṃ kho panetaṃ (điều này có thể xảy ra) v.v.
Tattha adhimānikā nāma yesaṃ appatte pattasaññāya adhimāno uppajjati, svāyaṃ uppajjamāno neva lokavaṭṭānusārīnaṃ bālaputhujjanānaṃ uppajjati, na ariyasāvakānaṃ.
Therein, those with overestimation are those in whom overestimation arises with the perception of having attained what has not been attained. When this arises, it arises neither in foolish ordinary people who follow the round of the world, nor in noble disciples.
Trong đó, adhimānika là những người phát sinh tâm kiêu mạn (adhimāna) với nhận thức rằng mình đã đạt được điều chưa đạt. Tâm kiêu mạn này không phát sinh ở những phàm phu ngu si đang trôi lăn trong vòng luân hồi, cũng không phát sinh ở các bậc Thánh đệ tử.
Na hi sotāpannassa ‘‘sakadāgāmī aha’’nti adhimāno uppajjati, na sakadāgāmissa ‘‘anāgāmī aha’’nti, na anāgāmino ‘‘arahā aha’’nti, kārakasseva pana samathavasena vā vipassanāvasena vā vikkhambhitakilesassa niccaṃ yuttapayuttassa āraddhavipassakassa uppajjati.
For in a stream-enterer, the overestimation “I am a once-returner” does not arise; nor in a once-returner, “I am a non-returner”; nor in a non-returner, “I am an arahant.” Rather, it arises only in one who is a practitioner, whose defilements have been suppressed either by way of serenity or by way of insight, who is constantly diligent and devoted, and who has begun insight meditation.
Thật vậy, một vị Tu-đà-hoàn không phát sinh tâm kiêu mạn "ta là Sakadāgāmī", một vị Sakadāgāmī không phát sinh tâm kiêu mạn "ta là Anāgāmī", một vị Anāgāmī không phát sinh tâm kiêu mạn "ta là Arahant". Tâm kiêu mạn này chỉ phát sinh ở những người đang thực hành, những người đã tạm thời chế ngự phiền não bằng thiền định (samatha) hoặc tuệ quán (vipassanā), những người luôn tinh tấn và đã bắt đầu tuệ quán.
Tassa hi samathavikkhambhitānaṃ vā vipassanāvikkhambhitānaṃ vā kilesānaṃ samudācāraṃ apassato ‘‘sotāpanno ahanti vā, sakadāgāmī, anāgāmī, arahā aha’’nti vā adhimāno uppajjati, talaṅgaratissapabbatavāsidhammadinnattherena ovādiyamānattherānaṃ viya.
Indeed, for such a person who does not see the manifestation of defilements suppressed either by serenity or by insight, the overestimation arises, “I am a stream-enterer,” or “a once-returner, a non-returner, I am an arahant,” as in the case of the elders being advised by the elder Dhammadinna, a resident of Talaṅgaratissa mountain.
Thật vậy, một người không thấy sự phát sinh trở lại của các phiền não đã được chế ngự bằng thiền định hoặc tuệ quán sẽ phát sinh tâm kiêu mạn "ta là Tu-đà-hoàn, hoặc Sakadāgāmī, Anāgāmī, Arahant", giống như các Tỳ-kheo được trưởng lão Dhammadinna trú tại núi Talaṅgaratissa giáo hóa.
Therassa kira acirūpasampannasseva ovāde ṭhatvā bahū bhikkhū visesaṃ adhigacchiṃsu.
It is said that many monks attained a special distinction by following the elder's advice, even though he had been ordained only for a short time.
Nghe nói, nhiều Tỳ-kheo đã đạt được thành tựu đặc biệt khi y theo lời giáo huấn của vị Trưởng lão Dhammadinna, người mới thọ giới không lâu.
Taṃ pavattiṃ sutvā tissamahāvihāravāsī bhikkhusaṅgho ‘‘na aṭṭhānaniyojako theroti theraṃ ānethā’’ti sambahule bhikkhū pāhesi.
Hearing this news, the community of monks residing at Tissamahāvihāra said, “The elder is not one who appoints without cause. Bring the elder,” and sent many monks.
Nghe tin đó, Tăng đoàn Tỳ-kheo trú tại Đại Tự viện Tissa đã gửi nhiều Tỳ-kheo đi với lời nhắn: "Vị Trưởng lão không phải là người sai bảo vô cớ, hãy thỉnh Trưởng lão đến đây".
Te gantvā, ‘‘āvuso, dhammadinna bhikkhusaṅgho taṃ pakkosāpetī’’ti āhaṃsu.
They went and said, “Friend Dhammadinna, the community of monks summons you.”
Họ đến và nói: "Thưa Tôn giả Dhammadinna, Tăng đoàn Tỳ-kheo thỉnh Tôn giả đến".
So āha ‘‘kiṃ pana tumhe, bhante, attānaṃ gavesatha para’’nti?
He said, “Venerable sirs, are you searching for yourselves or for another?”
Vị ấy hỏi: "Thưa các Tôn giả, quý vị tự tìm mình hay tìm người khác?"
Attānaṃ sappurisāti, so tesaṃ kammaṭṭhānamadāsi, sabbeva arahattaṃ pāpuṇiṃsu.
“For ourselves, good sir.” So he gave them a meditation subject, and they all attained arahantship.
Họ nói: "Chúng tôi là thiện nam tử". Vị ấy đã ban đề mục thiền cho họ, và tất cả đều đạt được quả A-la-hán.
Bhikkhusaṅgho puna aññe bhikkhū pāhesi, evaṃ yāvatatiyaṃ pahitā sabbepi tattheva arahattaṃ patvā vihariṃsu.
The community of monks sent other monks again. In this way, all those who were sent, up to the third time, attained arahantship right there and dwelled so.
Tăng đoàn Tỳ-kheo lại gửi thêm các Tỳ-kheo khác, cứ như vậy, ba lần được gửi đi, tất cả đều đạt được quả A-la-hán tại đó và an trú.
Tato saṅgho gatagatā nāgacchantīti aññataraṃ vuḍḍhapabbajitaṃ pāhesi.
Then, thinking, “Those who have gone do not return,” the Saṅgha sent a certain elder who had gone forth in old age.
Sau đó, Tăng đoàn nghĩ: "Những người đã đi không trở lại", nên đã gửi một vị Tỳ-kheo lớn tuổi khác.
So gantvā ca, ‘‘bhante, dhammadinna tikkhattuṃ tissamahāvihāravāsī bhikkhusaṅgho tuyhaṃ santike pesesi, tvaṃ nāma saṅghassa āṇaṃ garuṃ na karosi, nāgacchasī’’ti āha.
Having gone, he said, “Venerable Dhammadinna, the community of monks from Tissamahāvihāra has sent for you three times. Do you not respect the command of the Saṅgha, that you do not come?”
Vị ấy đến và nói: "Thưa Trưởng lão Dhammadinna, Tăng đoàn Tỳ-kheo trú tại Đại Tự viện Tissa đã ba lần gửi người đến chỗ Tôn giả, sao Tôn giả lại không xem trọng mệnh lệnh của Tăng đoàn và không đến?"
Thero kimetanti paṇṇasālaṃ appavisitvāva pattacīvaraṃ gāhāpetvā tāvadeva nikkhami, so antarāmagge haṅkanavihāraṃ pāvisi.
The elder said, “What is this?” and without even entering his leaf-hut, he had his bowl and robes taken and left immediately. On the way, he entered the Haṅkana monastery.
Vị Trưởng lão hỏi: "Điều này là gì?" và không vào tịnh xá lá, mà sai người mang y bát rồi lập tức ra đi. Trên đường đi, vị ấy vào một ngôi tịnh xá tên là Haṅkana.
Tattha ceko mahāthero saṭṭhivassātīto adhimānena arahattaṃ paṭijānāti.
There, a great elder, over sixty years of age, was claiming arahantship through overestimation.
Ở đó có một Đại Trưởng lão đã quá sáu mươi tuổi, tự nhận mình là A-la-hán do tâm kiêu mạn.
Thero taṃ upasaṅkamitvā vanditvā paṭisanthāraṃ katvā adhigamaṃ pucchi.
The elder approached him, paid homage, exchanged courteous greetings, and asked about his attainment.
Trưởng lão Dhammadinna đến gần, đảnh lễ, chào hỏi rồi hỏi về sự chứng đắc của vị ấy.
Thero āha ‘‘āma dhammadinna, yaṃ pabbajitena kātabbaṃ, cirakataṃ taṃ mayā, atītasaṭṭhivassomhi etarahī’’ti.
The elder said, “Yes, Dhammadinna, what is to be done by one who has gone forth has long been done by me. I am now past sixty years of age.”
Vị Trưởng lão kia nói: "Vâng, Dhammadinna, những gì một người xuất gia phải làm, ta đã làm từ lâu rồi. Bây giờ ta đã quá sáu mươi tuổi hạ".
Kiṃ, bhante, iddhimpi vaḷañjethāti.
“Venerable sir, do you also practice psychic powers?”
"Thưa Tôn giả, Tôn giả có sử dụng thần thông không?"
Āma dhammadinnāti.
“Yes, Dhammadinna.”
"Vâng, Dhammadinna," vị ấy đáp.
Sādhu vata, bhante, hatthiṃ tumhākaṃ paṭimukhaṃ āgacchantaṃ māpethāti.
“It would be good, venerable sir, if you could create an elephant coming towards you.”
"Thưa Tôn giả, xin hãy hóa hiện một con voi đang đến đối diện Tôn giả!"
Sādhāvusoti thero sabbasetaṃ sattappatiṭṭhaṃ tidhāpabhinnaṃ naṅguṭṭhaṃ bījayamānaṃ soṇḍaṃ mukhe pakkhipitvā dvīhi dantehi vijjhitukāmaṃ viya paṭimukhaṃ āgacchantaṃ mahāhatthiṃ māpesi.
“Very well, friend,” said the elder, and created a great elephant, all white, with seven points of firmness, its must flowing in three streams, flicking its tail, placing its trunk in its mouth, coming towards him as if about to gore him with its two tusks.
"Được thôi, Tôn giả!" Vị Trưởng lão liền hóa hiện một con voi lớn toàn thân màu trắng, có bảy chỗ đứng vững, ba lần phân chia, vẫy đuôi, vòi cho vào miệng, và như muốn dùng hai ngà đâm tới, đang tiến đến đối diện.
So taṃ attanāyeva māpitaṃ hatthiṃ disvā bhīto palāyituṃ ārabhi.
Seeing the elephant he himself had created, he became frightened and started to flee.
Vị ấy nhìn thấy con voi do chính mình hóa hiện thì sợ hãi bắt đầu bỏ chạy.
Tadāva attānaṃ ‘‘nāhaṃ arahā’’ti ñatvā dhammadinnassa pādamūle ukkuṭikaṃ nisīditvā ‘‘patiṭṭhā me hohi, āvuso’’ti āha.
At that very moment, knowing himself to be “not an arahant,” he sat squatting at Dhammadinna’s feet and said, “Be my refuge, friend.”
Ngay lúc đó, tự biết "ta chưa phải là A-la-hán", vị ấy quỳ xuống dưới chân Trưởng lão Dhammadinna và nói: "Thưa Tôn giả, xin hãy là nơi nương tựa cho con!"
Dhammadinno ‘‘mā, bhante, soci, mā anattamano ahosi, kārakānaṃyeva adhimāno uppajjatī’’ti theraṃ samassāsetvā kammaṭṭhānamadāsi.
Dhammadinna comforted the elder, saying, “Do not grieve, venerable sir, do not be disheartened. Overestimation arises only in practitioners,” and gave him a meditation subject.
Trưởng lão Dhammadinna an ủi vị Trưởng lão: "Thưa Tôn giả, đừng lo lắng, đừng buồn bã. Tâm kiêu mạn chỉ phát sinh ở những người đang thực hành thôi", rồi ban đề mục thiền cho vị ấy.
Thero tassovāde ṭhatvā arahattaṃ pāpuṇi.
Following his advice, the elder attained arahantship.
Vị Trưởng lão y theo lời giáo huấn của Ngài, đã đạt được quả A-la-hán.
Cittalapabbatepi tādisova thero vasati.
On Cittalapabbata, too, lived a similar elder.
Ở núi Cittala cũng có một vị Trưởng lão tương tự đang trú ngụ.
Dhammadinno tampi upasaṅkamitvā tatheva pucchi.
Dhammadinna approached him also and asked in the same way.
Trưởng lão Dhammadinna cũng đến gặp vị ấy và hỏi tương tự.
Sopi tatheva byākāsi.
He, too, replied in the same way.
Vị ấy cũng trả lời tương tự.
Tato naṃ dhammadinno kiṃ, bhante, iddhimpi vaḷañjethāti āha.
Then Dhammadinna asked him, “Venerable sir, do you also practice psychic powers?”
Sau đó, Trưởng lão Dhammadinna hỏi vị ấy: "Thưa Tôn giả, Tôn giả có sử dụng thần thông không?"
Āmāvusoti.
“Yes, friend.”
"Vâng, Tôn giả," vị ấy đáp.
Sādhu vata, bhante, ekaṃ pokkharaṇiṃ māpethāti.
“It would be good, venerable sir, if you could create a pond.”
"Thưa Tôn giả, xin hãy hóa hiện một cái ao!"
Thero māpesi.
The elder created it.
Vị Trưởng lão hóa hiện.
Ettha, bhante, padumagumbaṃ māpethāti.
“In it, venerable sir, create a lotus thicket.”
"Thưa Tôn giả, xin hãy hóa hiện một bụi sen trong ao này!"
Tampi māpesi.
He created that, too.
Vị ấy cũng hóa hiện.
Padumagumbe mahāpadumaṃ māpethāti.
“In the lotus thicket, create a great lotus flower.”
"Xin hãy hóa hiện một bông sen lớn trong bụi sen!"
Tampi māpesi.
He created that, too.
Vị ấy cũng hóa hiện.
Etasmiṃ padumagumbe ṭhatvā madhurassarena gāyantaṃ naccantañca ekaṃ itthiviggahaṃ māpethāti.
“In this lotus thicket, create the form of a woman, standing, singing with a sweet voice, and dancing.”
"Xin hãy hóa hiện một hình dáng phụ nữ đang đứng trong bông sen đó, hát và nhảy múa với giọng ngọt ngào!"
Tampi māpesi.
He created that, too.
Vị ấy cũng hóa hiện.
So etaṃ, bhante, punappunaṃ upanijjhāyathāti vatvā sayaṃ pāsādaṃ pāvisi.
“Venerable sir, gaze at this again and again,” he said, and went into his quarters himself.
Trưởng lão Dhammadinna nói: "Thưa Tôn giả, hãy nhìn kỹ hình dáng này nhiều lần", rồi chính mình đi vào cung điện.
Therassa taṃ upanijjhāyato saṭṭhivassāni vikkhambhitakilesā caliṃsu, so tadā attānaṃ ñatvā purimatthero viya dhammadinnattherassa santike kammaṭṭhānaṃ gahetvā arahattaṃ pāpuṇi.
As the elder gazed at it, the defilements that had been suppressed for sixty years were stirred. Then, knowing his own state, like the previous elder, he took a meditation subject from the elder Dhammadinna and attained arahantship.
Khi vị Trưởng lão kia nhìn kỹ hình dáng đó, các phiền não đã bị chế ngự trong sáu mươi năm của vị ấy đã lay động. Ngay lúc đó, tự biết mình (chưa phải là A-la-hán), vị ấy đã nhận đề mục thiền từ Trưởng lão Dhammadinna, giống như vị Trưởng lão trước, và đạt được quả A-la-hán.
Dhammadinnopi anupubbena tissamahāvihāraṃ agamāsi.
Dhammadinna, too, in due course, went to Tissamahāvihāra.
Trưởng lão Dhammadinna cũng tuần tự đến Đại Tự viện Tissa.
Tasmiñca samaye therā cetiyaṅgaṇaṃ sammajjitvā buddhārammaṇaṃ pītiṃ uppādetvā nisinnā honti, etaṃ kira tesaṃ vattaṃ.
At that time, the elders, having swept the cetiya terrace and aroused joy with the Buddha as its object, were seated. This, it seems, was their custom.
Vào lúc đó, các vị Trưởng lão đã quét dọn sân tháp, phát khởi niềm hoan hỷ hướng về Đức Phật và đang ngồi. Đây là bổn phận của họ.
Tena nesaṃ ekopi ‘‘idha pattacīvaraṃ ṭhapehī’’ti dhammadinnaṃ vattā pucchitāpi nāhosi.
Because of this, not one of them was there to ask or to tell Dhammadinna, “Place your bowl and robes here.”
Vì vậy, không một ai trong số họ hỏi Trưởng lão Dhammadinna rằng: "Hãy đặt y bát ở đây!"
Dhammadinno eso bhaveyyāti ñatvā pana pañhaṃ pucchiṃsu.
But knowing that this might be Dhammadinna, they asked him questions.
Trưởng lão Dhammadinna biết rằng đây là bổn phận của họ, nên đã hỏi một câu hỏi.
So pucchitapañhe tiṇhena asinā kumudanāḷakalāpaṃ viya chinditvā pādaṅguliyā mahāpathaviṃ pahari.
He, having cut through the questions as if cutting a bunch of water lily stalks with a sharp sword, struck the great earth with his big toe.
Ngài đã giải quyết các câu hỏi được hỏi như dùng thanh kiếm sắc bén cắt bó ngó sen, rồi dùng ngón chân đập xuống đất lớn.
Bhante ayaṃ acetanā mahāpathavīpi dhammadinnassa guṇaṃ jānāti.
“Venerable sirs, this great earth, though insentient, knows the qualities of Dhammadinna.
"Thưa các Tôn giả, ngay cả mặt đất vô tri này cũng biết được công đức của Dhammadinna.
Tumhe pana na jānitthāti ca vatvā imaṃ gāthamāha –
But you do not know,” he said, and uttered this verse:
Còn quý vị thì không biết", và nói lên bài kệ này –
Tassattho, atthetaṃ kāraṇaṃ, no natthi.
The meaning of this is: this is a reason, it is not that there is no reason.
Ý nghĩa của nó là: điều đó có lý do, không phải là không có.
Yena idhekacco bhikkhu bāhiraparibbājakehi sādhāraṇaṃ vivicceva kāmehi…pe… paṭhamaṃ jhānaṃ upasampajja vihareyya, yaṃ pana tassa evamassa sallekhena viharāmīti, yaṃ paṭipattividhānaṃ kilese saṃlikhati, tenāhaṃ viharāmīti, taṃ na yujjati, na hi adhimānikassa bhikkhuno jhānaṃ sallekho vā sallekhapaṭipadā vā hoti.
By which a certain bhikkhu here, in common with outside wanderers, secluded from sensual pleasures... might enter and abide in the first jhāna; but if it were to occur to him, "I am abiding through effacement," that is, "I am abiding by that method of practice which scrapes off the defilements," this is not suitable, for the jhāna of a bhikkhu with conceit is neither effacement nor the practice of effacement.
Ở đây, một tỳ khưu nào đó, sau khi đã ly dục một cách hoàn toàn, giống như các du sĩ ngoại đạo…pe… có thể an trú, chứng đạt sơ thiền. Nếu người ấy nghĩ rằng: ‘Tôi đang an trú với sự thanh lọc (sallekha)’ — tức là, ‘Tôi đang an trú với sự thực hành nào đó làm tiêu trừ các phiền não’ — thì điều đó không hợp lý. Quả thật, đối với một tỳ khưu có sự tự mãn (adhimāna), thiền định không phải là sự thanh lọc (sallekha) hay con đường thanh lọc (sallekhapaṭipadā).
Kasmā?
Why is that?
Vì sao?
Avipassanāpādakattā.
Because it is not a basis for insight.
Vì nó không phải là nền tảng cho tuệ quán (vipassanā).
Na hi so jhānaṃ samāpajjitvā tato vuṭṭhāya saṅkhāre sammasati, jhānaṃ panassa cittekaggamattaṃ karoti, diṭṭhadhammasukhavihāro hoti.
For that bhikkhu does not, after attaining jhāna and emerging from it, contemplate the formations. Rather, his jhāna only produces one-pointedness of mind and is a pleasant abiding in the here and now.
Thật vậy, sau khi nhập thiền, vị ấy không xuất thiền để quán xét các hành (saṅkhāra). Thiền định của vị ấy chỉ tạo ra sự định tâm nhất thời, và là một sự an trú hạnh phúc trong hiện tại (diṭṭhadhammasukhavihāra).
Tasmā tamatthaṃ dassento bhagavā ‘‘na kho panete, cunda, ariyassa vinaye sallekhā vuccanti, diṭṭhadhammasukhavihārā ete ariyassa vinaye vuccantī’’ti āha.
Therefore, to show this meaning, the Blessed One said: “But these, Cunda, are not called ‘effacements’ in the Noble One’s discipline; in the Noble One’s discipline these are called ‘pleasant abidings in the here and now.’”
Vì vậy, để chỉ ra ý nghĩa đó, Đức Thế Tôn đã nói: “Này Cunda, những điều này không được gọi là sự thanh lọc (sallekha) trong Giáo pháp của bậc Thánh; những điều này được gọi là sự an trú hạnh phúc trong hiện tại (diṭṭhadhammasukhavihāra) trong Giáo pháp của bậc Thánh.”
Tattha eteti jhānadhammavasena bahuvacanaṃ veditabbaṃ, ete paṭhamajjhānadhammāti vuttaṃ hoti.
Therein, these should be understood as a plural form on account of the jhānic factors; it means "these first-jhāna factors."
Ở đây, từ “những điều này” (ete) cần được hiểu là số nhiều theo nghĩa các pháp thiền định; tức là, những pháp sơ thiền này.
Samāpattivasena vā, ekampi hi paṭhamajjhānaṃ punappunaṃ samāpattivasena pavattattā bahuttaṃ gacchati.
Or it is on account of attainments, for even the single first jhāna becomes plural through being attained again and again.
Hoặc theo nghĩa sự nhập định: ngay cả sơ thiền duy nhất cũng trở thành số nhiều do sự nhập định lặp đi lặp lại.
Ārammaṇavasena vā, ekampi hi paṭhamajjhānaṃ pathavīkasiṇādīsu pavattivasena bahuttaṃ gacchatīti.
Or it is on account of the objects, for even the single first jhāna becomes plural by occurring in relation to the earth-kasiṇa and so on.
Hoặc theo nghĩa đối tượng: ngay cả sơ thiền duy nhất cũng trở thành số nhiều do sự thực hành trên các đề mục như địa biến xứ (pathavīkasiṇa), v.v.
Esa nayo dutiyatatiyacatutthajjhānesu.
This is the method for the second, third, and fourth jhānas.
Nguyên tắc này cũng áp dụng cho nhị thiền, tam thiền và tứ thiền.
Āruppajhānesu pana ārammaṇabhedābhāvato purimakāraṇadvayavaseneva bahuvacanaṃ veditabbaṃ.
But in the formless jhānas, since there is no variety of objects, the plural form should be understood only on account of the two aforementioned reasons.
Tuy nhiên, đối với các thiền vô sắc (āruppajhāna), vì không có sự khác biệt về đối tượng, nên số nhiều cần được hiểu theo hai lý do trước.
Yasmā cetesaṃ aṅgānipi santāni ārammaṇānipi, nibbutāni ceva sukhumāni cāti vuttaṃ hoti, tasmā tāni santā ete vihārāti evaṃ vuttānīti veditabbāni.
Because their factors are peaceful and their objects are both extinguished and subtle, it is said that they are therefore called peaceful abidings, and should be understood as such.
Vì các chi phần của chúng đều an tịnh và các đối tượng của chúng đều tịch tịnh và vi tế, nên chúng được gọi là “những sự an trú an tịnh này” (santā ete vihārā), cần được hiểu như vậy.
Ayaṃ tāva tesaṃ catunnampi sādhāraṇā vaṇṇanā.
This, for now, is the general explanation for all four of them.
Đây là lời giải thích chung cho cả bốn thiền định.
Visesavaṇṇanā pana ‘‘sabbaso rūpasaññāna’’ntiādipadānusārato vattabbā siyā.
But the specific explanation should be given following the wording beginning with "by the complete surmounting of perceptions of form."
Tuy nhiên, lời giải thích đặc biệt sẽ được trình bày theo các từ như “hoàn toàn vượt qua các tưởng về sắc” (sabbaso rūpasaññānaṃ), v.v.
Sā visuddhimagge sabbākārena vuttāyeva.
It is fully stated in the Visuddhimagga.
Lời giải thích đó đã được trình bày đầy đủ trong Thanh Tịnh Đạo (Visuddhimagga).
Kasmā pana ‘‘aṭṭhahi samāpattīhi avihiṃsādayo sallekhā’’ti vuttā?
But why are non-harming and the others called “effacements” over and above the eight attainments?
Vì sao lại nói rằng “từ vô hại (avihiṃsā) trở đi là các pháp thanh lọc (sallekha) so với tám thiền chứng (samāpatti)”?
Lokuttarapādakattā.
Because they are a basis for the supramundane.
Vì chúng là nền tảng cho siêu thế (lokuttara).
Bāhirakānañhi aṭṭha samāpattiyo vaṭṭapādakāyeva.
For outsiders, the eight attainments are only a basis for the round of rebirth.
Tám thiền chứng của ngoại đạo chỉ là nền tảng cho luân hồi (vaṭṭa).
Sāsane saraṇagamanampi lokuttarapādakaṃ, pageva avihiṃsādayo.
In the Sāsana, even going for refuge is a basis for the supramundane, let alone non-harming and the others.
Trong giáo pháp, ngay cả việc quy y Tam Bảo cũng là nền tảng cho siêu thế, huống chi là các pháp từ vô hại (avihiṃsā) trở đi.
Imināyeva ca suttena veditabbaṃ ‘‘yathā bāhirakassa aṭṭhasamāpattilābhino pañcābhiññassāpi dinnadānato sāsane tisaraṇagatassa dinnadānaṃ mahapphalataraṃ hotī’’ti.
And it should be understood from this very sutta that "a gift given to one who has gone for the three refuges in the Sāsana is of greater fruit than a gift given to an outsider who has obtained the eight attainments and the five supernormal powers."
Chính nhờ bài kinh này mà chúng ta có thể biết rằng: “Việc bố thí cho người quy y Tam Bảo trong giáo pháp có quả báo lớn hơn nhiều so với việc bố thí cho một người ngoại đạo đã đạt được tám thiền chứng và năm thắng trí.”
Idañhi sandhāya dakkhiṇāvisuddhisutte ‘‘bāhirake kāmesu vītarāge dānaṃ datvā koṭisatasahassaguṇā pāṭikaṅkhitabbā.
Indeed, with reference to this, it was said in the Dakkhiṇāvisuddhi Sutta: “Having given a gift to an outsider who is free from sensual passion, a return of a hundred thousand koṭis can be expected.
Vì vậy, để đề cập đến điều này, trong kinh Dakkhināvisuddhi (Sự Thanh Tịnh của Sự Bố Thí), có nói:
Sotāpattiphalasacchikiriyāya paṭipanne dānaṃ datvā asaṅkheyyā appameyyā dakkhiṇā pāṭikaṅkhitabbā, ko pana vādo sotāpanne’’ti vuttaṃ (ma. ni. 3.379).
Having given a gift to one who is practicing for the realization of the fruit of stream-entry, an offering that is incalculable and immeasurable can be expected; what then to say of one who is a stream-enterer?”
“Bố thí cho người ngoại đạo đã ly tham dục (kāma) thì có thể mong đợi quả báo gấp trăm ngàn vạn lần. Bố thí cho người đang thực hành để chứng đạt quả Dự Lưu thì có thể mong đợi quả báo vô số, vô lượng. Huống chi là bố thí cho bậc Dự Lưu!”
Saraṇagamanato paṭṭhāya hi tattha sotāpattiphalasacchikiriyāya paṭipanno adhippetoti, ayaṃ tāvettha pāḷiyojanā.
For it should be understood that, starting from taking refuge, one who is practicing for the realization of the fruit of stream-entry is intended there. This, for now, is the connection of the Pali text here.
Ở đây, từ việc quy y Tam Bảo trở đi, người đang thực hành để chứng đạt quả Dự Lưu được đề cập đến. Đây là cách giải thích Pali ở đây.
Anupadavaṇṇanāyaṃ pana idhāti vihiṃsādivatthudīpanametaṃ.
But in the word-by-word commentary, herein is an indication of the basis, such as harming and so on.
Trong phần giải thích từng từ, “idha” (ở đây) là để chỉ ra đối tượng của sự vô hại (avihiṃsā), v.v.
Kho panāti nipātamattaṃ.
But then is a mere particle.
“Kho pana” chỉ là một tiểu từ.
Voti karaṇatthe sāmivacanaṃ, ayaṃ pana saṅkhepattho, yadetaṃ ‘‘pare vihiṃsakā bhavissantī’’tiādinā nayena vihiṃsādivatthuṃ vadāma.
For you is the genitive case in the sense of the instrumental. And this is the brief meaning: concerning this basis of harming and so on, which we speak of with the method beginning "others will be harmful."
“Vo” là một từ ở cách sở hữu, nhưng ở đây có nghĩa là cách công cụ. Đây là ý nghĩa tóm tắt: “Điều mà chúng ta nói về đối tượng của sự vô hại (avihiṃsā), v.v., theo cách ‘người khác sẽ là kẻ gây hại’ và tương tự.
Idha, cunda, tumhehi sallekho kātabboti.
Herein, Cunda, effacement is to be done by you.
Này Cunda, ở đây, các con phải thực hành sự thanh lọc (sallekha).”
Tattha pareti ye keci imaṃ sallekhamananuyuttā.
Therein, others means whosoever are not devoted to this effacement.
Ở đây, “người khác” (pare) là bất kỳ ai không thực hành sự thanh lọc này.
Vihiṃsakā bhavissantīti pāṇinā vā leḍḍunā vātiādīhi sattānaṃ vihesakā bhavissanti.
Will be harmful means they will be tormentors of beings with their hands, with clods, and so on.
“Sẽ là kẻ gây hại” (vihiṃsakā bhavissanti) có nghĩa là họ sẽ làm hại chúng sinh bằng tay, bằng gạch, v.v.
Mayamettha avihiṃsakā bhavissāmāti mayaṃ pana yattheva vatthusmiṃ pare evaṃ vihiṃsakā bhavissanti, ettheva avihiṃsakā bhavissāma, avihiṃsaṃ uppādetvā viharissāma.
We here shall be harmless means: in that very matter where others will be harmful, right there we shall be harmless; having generated non-harming, we will abide.
“Chúng ta ở đây sẽ là người không gây hại” (mayamettha avihiṃsakā bhavissāmā) có nghĩa là: “Chúng ta, ngay trong đối tượng mà người khác sẽ là kẻ gây hại như vậy, sẽ là người không gây hại, sẽ an trú bằng cách phát sinh sự vô hại.”
Iti sallekho karaṇīyoti evaṃ tumhehi sallekho kātabbo.
Thus effacement should be practiced means: in this way, effacement is to be done by you.
“Đó là sự thanh lọc cần được thực hành” (iti sallekho karaṇīyo) có nghĩa là: “Các con phải thực hành sự thanh lọc như vậy.”
Sallekhoti ca idha avihiṃsāva veditabbā.
And here, effacement should be understood as non-harming itself.
Và “thanh lọc” (sallekho) ở đây cần được hiểu là sự vô hại (avihiṃsā).
Avihiṃsā hi vihiṃsaṃ sallekhati, taṃ chindati, tasmā sallekhoti vuccati.
For non-harming scrapes off harming, it cuts it off; therefore it is called effacement.
Thật vậy, sự vô hại (avihiṃsā) làm tiêu trừ sự gây hại (vihiṃsā), nó cắt đứt sự gây hại, do đó được gọi là “thanh lọc” (sallekho).
Esa nayo sabbattha.
This is the method everywhere.
Nguyên tắc này áp dụng cho tất cả.
Ayaṃ pana viseso.
But this is the distinction:
Tuy nhiên, có một điểm khác biệt.
Pare micchādiṭṭhīti ettha kammapathānaṃ antamicchādiṭṭhiñca micchattānaṃ ādimicchādiṭṭhiñca missetvā diṭṭhi vuttāti veditabbā.
In "others will have wrong view," it should be understood that "view" is spoken of by combining the wrong view that is the culmination of the paths of action and the wrong view that is the beginning of the wrongnesses.
Trong cụm từ “người khác có tà kiến” (pare micchādiṭṭhī), cần hiểu rằng tà kiến được đề cập đến là sự kết hợp giữa tà kiến cuối cùng của các nghiệp đạo (kammapatha) và tà kiến khởi đầu của các tà pháp (micchatta).
Tathā mayamettha sammādiṭṭhīti vuttaṭṭhāne sammādiṭṭhi.
Similarly, where it is said "we here shall have right view," right view should be understood.
Tương tự, trong trường hợp nói “chúng ta ở đây có chánh kiến” (mayamettha sammādiṭṭhī), đó là chánh kiến.
Ettha ca kammapathakathā vitthārato sammādiṭṭhisutte āvi bhavissati.
And here, the discussion of the paths of action will become clear in detail in the Sammādiṭṭhi Sutta.
Ở đây, câu chuyện về các nghiệp đạo sẽ được trình bày chi tiết trong kinh Sammādiṭṭhi (Chánh Kiến).
Micchattesu micchādiṭṭhiādayo dvedhāvitakke.
Among the wrongnesses, wrong view and so on are in the Dvedhāvitakka Sutta.
Trong các tà pháp (micchatta), tà kiến (micchādiṭṭhi) và các pháp tương tự sẽ được trình bày trong kinh Dvayavitakka (Hai Loại Tư Duy).
Ayaṃ panettha saṅkhepo, pāṇaṃ atipātentīti pāṇātipātī pāṇaghātakāti attho.
This is the summary here: they destroy living beings, thus they are destroyers of life; the meaning is killers of living beings.
Đây là phần tóm tắt ở đây: “Những người sát hại sinh mạng” (pāṇaṃ atipātenti) có nghĩa là “những kẻ sát sinh” (pāṇātipātī), tức là những kẻ giết hại sinh mạng.
Adinnaṃ ādiyantīti adinnādāyī, parassa hārinoti attho.
They take what is not given, thus they are takers of what is not given; the meaning is stealers of others' property.
“Những người lấy của không cho” (adinnaṃ ādiyanti) có nghĩa là “những kẻ trộm cắp” (adinnādāyī), tức là những kẻ cướp của người khác.
Abrahmaṃ hīnaṃ lāmakadhammaṃ carantīti abrahmacārī, methunadhammappaṭisevakāti attho.
They practice the unholy, the base, the low, thus they are unchaste; the meaning is practitioners of sexual intercourse.
“Những người sống phi phạm hạnh, hành vi thấp kém, xấu xa” (abrahmaṃ hīnaṃ lāmakadhammaṃ carantīti) có nghĩa là “những kẻ phi phạm hạnh” (abrahmacārī), tức là những kẻ giao cấu.
Brahmaṃ seṭṭhaṃ paṭipadaṃ carantīti brahmacārī, methunā paṭiviratāti attho.
They practice the holy, the excellent conduct, thus they are chaste; the meaning is they have refrained from sexual intercourse.
“Những người sống phạm hạnh cao thượng” (brahmaṃ seṭṭhaṃ paṭipadaṃ carantīti) có nghĩa là “những người phạm hạnh” (brahmacārī), tức là những người từ bỏ giao cấu.
Ettha ca brahmacariyaṃ sallekhoti veditabbaṃ.
And here, chastity should be understood as effacement.
Ở đây, phạm hạnh (brahmacariya) cần được hiểu là sự thanh lọc (sallekha).
Brahmacariyañhi abrahmacariyaṃ sallekhati.
For chastity scrapes off unchastity.
Thật vậy, phạm hạnh (brahmacariya) làm tiêu trừ phi phạm hạnh (abrahmacariya).
Musā vadantīti musāvādī, paresaṃ atthabhañjanakaṃ tucchaṃ alikaṃ vācaṃ bhāsitāroti attho.
They speak falsehood, thus they are speakers of falsehood; the meaning is they are speakers of empty, untrue words that destroy the welfare of others.
“Những người nói dối” (musā vadantīti) có nghĩa là “những kẻ nói dối” (musāvādī), tức là những kẻ nói lời hư không, sai trái làm hại lợi ích của người khác.
Pisuṇā vācā etesanti pisuṇavācā.
They have divisive speech, thus they are of divisive speech.
“Những người có lời nói chia rẽ” (pisuṇā vācā etesanti) có nghĩa là “những kẻ nói lời chia rẽ” (pisuṇavācā).
Paresaṃ mammacchedikā pharusā vācā etesanti pharusavācā.
They have harsh speech that cuts others to the quick, thus they are of harsh speech.
“Những người có lời nói thô tục, làm tổn thương lòng người khác” (paresaṃ mammacchedikā pharusā vācā etesanti) có nghĩa là “những kẻ nói lời thô tục” (pharusavācā).
Samphaṃ niratthakavacanaṃ palapantīti samphappalāpī.
They chatter pointless, useless talk, thus they are idle chatterers.
“Những người nói lời vô ích, vô nghĩa” (samphaṃ niratthakavacanaṃ palapantīti) có nghĩa là “những kẻ nói lời vô ích” (samphappalāpī).
Abhijjhāyantīti abhijjhālū, parabhaṇḍalubbhanasīlāti attho.
They covet, thus they are covetous; the meaning is they are inclined to lust after others' property.
“Những người có lòng tham lam” (abhijjhāyantīti) có nghĩa là “những kẻ tham lam” (abhijjhālū), tức là những kẻ có thói quen ham muốn tài sản của người khác.
Byāpannaṃ pūtibhūtaṃ cittametesanti byāpannacittā.
Their mind is malevolent, putrid, thus they are of malevolent mind.
“Những người có tâm sân hận, thối nát” (byāpannaṃ pūtibhūtaṃ cittametesanti) có nghĩa là “những người có tâm sân hận” (byāpannacittā).
Micchā pāpikā viññugarahitā etesaṃ diṭṭhīti micchādiṭṭhī, kammapathapariyāpannāya natthi dinnantiādivatthukāya, micchattapariyāpannāya aniyyānikadiṭṭhiyā ca samannāgatāti attho.
Their view is wrong, evil, censured by the wise, thus they are of wrong view; the meaning is they possess the view included in the path of action, which has as its basis "there is nothing given," etc., and the non-leading-out view included in the wrongnesses.
“Những người có tà kiến, xấu xa, bị người trí chỉ trích” (micchā pāpikā viññugarahitā etesaṃ diṭṭhīti) có nghĩa là “những người có tà kiến” (micchādiṭṭhī), tức là những người có tà kiến thuộc về các nghiệp đạo (kammapatha) với nội dung “không có sự bố thí”, v.v., và tà kiến không dẫn đến giải thoát (aniyyānika) thuộc về các tà pháp (micchatta).
Sammā sobhanā viññuppasatthā etesaṃ diṭṭhīti sammādiṭṭhī, kammapathapariyāpannāya atthi dinnantiādikāya kammassakatādiṭṭhiyā, sammattapariyāpannāya maggadiṭṭhiyā ca samannāgatāti attho.
Their view is right, good, praised by the wise, thus they are of right view; the meaning is they possess the view of kamma-ownership included in the path of action, which begins with "there is what is given," etc., and the view of the path included in the rightnesses.
“Những người có chánh kiến, tốt đẹp, được người trí tán thán” (sammā sobhanā viññuppasatthā etesaṃ diṭṭhīti) có nghĩa là “những người có chánh kiến” (sammādiṭṭhī), tức là những người có chánh kiến thuộc về các nghiệp đạo (kammapatha) với nội dung “có sự bố thí”, v.v., tức là nghiệp báo (kammassakata), và chánh kiến con đường (maggadiṭṭhi) thuộc về các chánh pháp (sammattapariyāpanna).
Micchāsaṅkappāti ayāthāvaaniyyānikaakusalasaṅkappā.
Of wrong thought means of incorrect, non-leading-out, unwholesome thoughts.
“Tà tư duy” (micchāsaṅkappā) là những tư duy bất thiện, không đúng đắn, không dẫn đến giải thoát.
Esa nayo micchāvācātiādīsu.
This is the method in of wrong speech, and so on.
Nguyên tắc này cũng áp dụng cho “tà ngữ” (micchāvācā), v.v.
Ayaṃ pana viseso, micchāsaṅkappādayo viya hi micchāsati nāma pāṭiekko koci dhammo natthi, atītaṃ pana cintayato pavattānaṃ catunnampi akusalakkhandhānametaṃ adhivacanaṃ.
But this is the special point: like wrong intention, etc., there is no separate dhamma called micchāsati. Rather, this is a designation for the four unwholesome aggregates that arise for one who is thinking of the past.
Tuy nhiên, đây là một điểm đặc biệt, vì không có pháp nào riêng biệt được gọi là tà niệm (micchāsati), như tà tư duy (micchāsaṅkappa) và các pháp khác. Tuy nhiên, đây là tên gọi chung cho bốn uẩn bất thiện (akusalakkhandhā) phát sinh khi một người suy nghĩ về quá khứ.
Yampi vuttaṃ bhagavatā – ‘‘atthesā, bhikkhave, anussati, nesā natthīti vadāmi, puttalābhaṃ vā, bhikkhave, anussarato, dhanalābhaṃ vā, bhikkhave, anussarato, yasalābhaṃ vā, bhikkhave, anussarato’’ti, tampi taṃ taṃ cintentassa satipatirūpakena uppattiṃ sandhāya vuttanti veditabbaṃ.
And what was said by the Blessed One—"Monks, there is this recollection; I do not say it does not exist. It is when one recollects the gain of a child, monks, or recollects the gain of wealth, monks, or recollects the gain of fame, monks"—should be understood as said in reference to its arising as a counterfeit of mindfulness for one thinking of those things.
Lời Thế Tôn đã dạy: ‘‘Này các Tỳ-khưu, có niệm này, Ta không nói là không có. Này các Tỳ-khưu, khi một người nhớ đến việc có con, nhớ đến việc có tài sản, nhớ đến việc có danh tiếng’’, thì cũng nên hiểu rằng lời này được nói đến sự phát sinh của các uẩn bất thiện tương tự như niệm (sati-paṭirūpaka) khi người ấy suy nghĩ về những điều đó.
Micchāñāṇīti ettha ca micchāñāṇanti pāpakiriyāsu upāyacintāvasena pāpaṃ katvā ‘‘sukataṃ mayā’’ti paccavekkhaṇākārena ca uppanno moho veditabbo, tena samannāgatā puggalā micchāñāṇī.
And here, regarding one with wrong knowledge, micchāñāṇa should be understood as the delusion that arises by way of thinking of a means for evil actions, and, after doing an evil act, by way of reviewing, "It was well done by me." Individuals endowed with that are those with wrong knowledge.
Trong cụm từ tà tri kiến (micchāñāṇī), tà tri kiến (micchāñāṇa) nên được hiểu là sự si mê (moha) phát sinh do suy nghĩ cách thức thực hiện các hành động ác, hoặc do xem xét sau khi đã làm điều ác và nghĩ rằng ‘‘ta đã làm điều thiện’’. Những người có đầy đủ sự si mê đó được gọi là tà tri kiến (micchāñāṇī).
Sammāñāṇī ti ettha pana ekūnavīsatibhedaṃ paccavekkhaṇāñāṇaṃ ‘‘sammāñāṇa’’nti vuccati, tena samannāgatā puggalā sammāñāṇī.
But here, regarding one with right knowledge, the reviewing knowledge of nineteen kinds is called "sammāñāṇa." Individuals endowed with that are those with right knowledge.
Trong cụm từ chánh tri kiến (sammāñāṇī), trí tuệ quán chiếu (paccavekkhaṇāñāṇa) có mười chín loại được gọi là chánh tri kiến (sammāñāṇa). Những người có đầy đủ trí tuệ đó được gọi là chánh tri kiến (sammāñāṇī).
Micchāvimuttīti avimuttāyeva samānā ‘‘vimuttā maya’’nti evaṃsaññino, avimuttiyaṃ vā vimuttisaññino.
Wrong deliverance means those who, while being undelivered, perceive, "We are delivered," or who have the perception of deliverance in what is not deliverance.
Tà giải thoát (micchāvimuttī) là những người chưa được giải thoát nhưng lại cho rằng ‘‘chúng ta đã được giải thoát’’, hoặc những người nhận thức sự giải thoát trong sự chưa giải thoát.
Tatrāyaṃ vacanattho, micchā pāpikā viparītā vimutti etesaṃ atthīti micchāvimuttī.
Herein, this is the meaning of the word: for them there is wrong, evil, perverted deliverance; thus they are those of wrong deliverance.
Trong đó, ý nghĩa của từ này là: sự giải thoát của họ là sai lầm, xấu xa, trái ngược (micchā pāpikā viparītā vimutti), do đó họ được gọi là tà giải thoát (micchāvimuttī).
Micchāvimuttīti ca yathāvuttenākārena pavattānaṃ akusalakkhandhānametaṃ adhivacanaṃ.
And micchāvimutti is a designation for the unwholesome aggregates that proceed in the manner already stated.
Và tà giải thoát (micchāvimuttī) là tên gọi chung cho các uẩn bất thiện (akusalakkhandhā) phát sinh theo cách đã nói.
Phalasampayuttāni pana sammādiṭṭhiādīni aṭṭhaṅgāni ṭhapetvā sesadhammā sammāvimuttīti veditabbā.
But, having set aside the eight factors such as right view associated with the fruit, the remaining dhammas should be understood as sammāvimutti.
Trừ tám chi phần như chánh kiến (sammādiṭṭhi) v.v... liên quan đến quả (phala-sampayutta), các pháp còn lại nên được hiểu là chánh giải thoát (sammāvimuttī).
Sā ca micchāvimuttiṃ sallikhitvā ṭhitattā sallekhoti veditabbā.
And because it stands having effaced wrong deliverance, it should be known as sallekha.
Và sự giải thoát đó, vì đã gột rửa tà giải thoát (micchāvimutti) mà đứng vững, nên cần hiểu là sự gột rửa (sallekha).
Tattha niyojento āha ‘‘mayamettha sammāvimuttī bhavissāmāti sallekho karaṇīyo’’ti.
Enjoining one in that, he said: "The practice of effacement should be done: 'Herein we will be of right deliverance.'"
Để khuyên nhủ về điều đó, Ngài nói: ‘‘Chúng ta nên thực hành sự gột rửa (sallekha) để trở thành những người có chánh giải thoát (sammāvimuttī) ở đây.’’
Ito parāni tīṇi nīvaraṇavasena vuttāni.
The three that follow are stated by way of the hindrances.
Ba điều tiếp theo được nói đến theo cách của các triền cái (nīvaraṇa).
Abhijjhālū byāpannacittāti evaṃ kammapathesu vuttattā panettha paṭhamāni dve nīvaraṇāni na vuttānīti veditabbāni.
Because "covetous and of malevolent mind" are stated in this way in the paths of kamma, it should be understood that the first two hindrances are not stated here.
Nên hiểu rằng hai triền cái đầu tiên không được đề cập ở đây, vì chúng đã được nói đến trong các đạo lộ nghiệp (kammapatha) dưới dạng tham lam (abhijjhālū) và tâm ác ý (byāpannacittā).
Tattha thinamiddhena pariyuṭṭhitā abhibhūtāti thinamiddhapariyuṭṭhitā.
Therein, those who are beset and overcome by sloth and torpor are those beset by sloth and torpor.
Trong đó, những người bị hôn trầm và thụy miên (thīnamiddha) bao phủ, chế ngự được gọi là bị hôn trầm và thụy miên bao phủ (thīnamiddhapariyuṭṭhitā).
Uddhaccena samannāgatāti uddhatā.
Those who are endowed with restlessness are restless.
Những người có đầy đủ sự phóng dật (uddhacca) được gọi là phóng dật (uddhatā).
Vicinantā kicchanti na sakkonti sanniṭṭhānaṃ kātunti vicikicchī.
While investigating, they struggle; they are unable to make a conclusion, thus they are doubtful.
Những người khi xem xét thì gặp khó khăn, không thể đưa ra kết luận được gọi là hoài nghi (vicikicchī).
Kodhanātiādīni dasa cittassa upakkilesavasena vuttāni.
The ten beginning with angry are stated by way of the defilements of the mind.
Mười điều như sân hận (kodhanā) v.v... được nói đến theo cách của các cấu uế (upakkilesa) của tâm.
Tattha kodhādīsu yaṃ vattabbaṃ siyā, taṃ sabbaṃ dhammadāyādavatthasuttesu vuttaṃ.
Therein, what should be said regarding anger and so on has all been said in the Dhammadāyāda Sutta and the Vattha Sutta.
Trong đó, tất cả những gì cần nói về sân hận (kodha) v.v... đã được nói trong các kinh Dhammadāyāda và Vatthasutta.
Ayaṃ panettha vacanattho – kodhanāti kujjhanasīlā.
Herein, this is the word-meaning: angry are those of an angry nature.
Trong đó, ý nghĩa của từ này là: sân hận (kodhanā) là những người có thói quen nổi giận.
Upanāhīti upanāhanasīlā, upanāho vā etesaṃ atthīti upanāhī.
Hostile are those of a hostile nature, or they have hostility, thus they are hostile.
Oán kết (upanāhī) là những người có thói quen ôm giữ oán hận, hoặc những người có oán hận (upanāha). Do đó họ được gọi là oán kết (upanāhī).
Tathā makkhī palāsī ca.
Likewise for denigrating and contemptuous.
Tương tự, giả dối (makkhī) và xảo trá (palāsī).
Issantīti issukī.
They are envious, thus they are envious.
Những người đố kỵ được gọi là đố kỵ (issukī).
Maccharāyantīti maccharī, maccheraṃ vā etesaṃ atthīti maccharī.
They are stingy, thus they are stingy; or they have stinginess, thus they are stingy.
Những người keo kiệt được gọi là keo kiệt (maccharī), hoặc những người có sự keo kiệt (macchera) được gọi là keo kiệt (maccharī).
Saṭhayantīti saṭhā, na sammā bhāsantīti vuttaṃ hoti, kerāṭikayuttānametaṃ adhivacanaṃ.
They are deceitful, thus they are deceitful; this means they do not speak correctly. This is a designation for those endowed with craftiness.
Những người lừa dối được gọi là gian xảo (saṭhā), có nghĩa là họ không nói đúng sự thật. Đây là tên gọi chung cho những người có thói quen lừa dối (kerāṭika).
Māyā etesaṃ atthīti māyāvī.
They have māyā, thus they are treacherous.
Những người có sự lừa dối (māyā) được gọi là xảo quyệt (māyāvī).
Thambhasamaṅgitāya thaddhā.
Through being endowed with stubbornness, they are stubborn.
Do sự cứng nhắc (thambhasamaṅgitāya) nên là cứng đầu (thaddhā).
Atimānayogena atimānī.
Through connection with excessive pride, they are excessively proud.
Do sự kiêu mạn quá mức (atimānayogena) nên là quá kiêu mạn (atimānī).
Vuttapaccanīkanayena sukkapakkho veditabbo.
The bright side should be understood by way of the opposite of what has been stated.
Phía thiện (sukkapakkha) nên được hiểu theo cách ngược lại với những gì đã nói.
Dubbacāti vattuṃ dukkhā kiñci vuccamānā na sahanti.
Those difficult to admonish are difficult to speak to; when anything is said, they do not endure it.
Khó dạy (dubbacā) là những người khó nói chuyện, khi được nói điều gì thì không chịu đựng được.
Tabbiparītā suvacā.
The opposite of that are those easy to admonish.
Ngược lại với điều đó là dễ dạy (suvacā).
Devadattādisadisā pāpakā mittā etesanti pāpamittā.
They have evil friends similar to Devadatta and so on, thus they are those with evil friends.
Những người có bạn bè xấu xa như Devadatta v.v... được gọi là bạn bè xấu (pāpamittā).
Buddhā vā sāriputtādisadisā vā kalyāṇā mittā etesanti kalyāṇamittā.
They have good friends who are either Buddhas or similar to Sāriputta and so on, thus they are those with good friends.
Những người có bạn bè tốt như Đức Phật hay Sāriputta v.v... được gọi là bạn bè tốt (kalyāṇamittā).
Kāyaduccaritādīsu cittavossaggavasena pamattā.
Through letting the mind go loose in bodily misconduct and so on, they are heedless.
Những người phóng dật (pamattā) là do tâm buông thả trong các ác hạnh thân (kāyaduccarita) v.v...
Viparītā appamattāti veditabbā.
The opposite should be understood as heedful.
Ngược lại là không phóng dật (appamattā) nên được hiểu.
Imāni tīṇi pakiṇṇakavasena vuttāni.
These three are stated by way of miscellaneous topics.
Ba điều này được nói đến theo cách hỗn tạp (pakiṇṇaka).
Assaddhātiādīni satta asaddhammavasena.
The seven beginning with unfaithful are stated by way of bad qualities.
Bảy điều như không có đức tin (assaddhā) v.v... được nói đến theo cách của các pháp bất thiện (asaddhamma).
Tattha tīsu vatthūsu saddhā etesaṃ natthīti assaddhā.
Therein, for them there is no faith in the three objects, thus they are unfaithful.
Trong đó, những người không có đức tin (saddhā) vào ba đối tượng (vatthū) được gọi là không có đức tin (assaddhā).
Sukkapakkhe saddahantīti saddhā, saddhā vā etesaṃ atthītipi saddhā.
On the bright side, they have faith, thus they are faithful; or they possess faith, thus they are also faithful.
Những người có đức tin vào phía thiện (sukkapakkha) được gọi là có đức tin (saddhā), hoặc những người có đức tin (saddhā) cũng được gọi là có đức tin (saddhā).
Natthi etesaṃ hirīti ahirikā, akusalasamāpattiyā ajigucchamānānametaṃ adhivacanaṃ.
For them there is no hirī, thus they are shameless; this is a designation for those not disgusted by the attainment of the unwholesome.
Những người không có hổ thẹn (hirī) được gọi là không hổ thẹn (ahirikā). Đây là tên gọi chung cho những người không ghê tởm khi rơi vào tình trạng bất thiện (akusalasamāpatti).
Hirī etesaṃ mane, hiriyā vā yuttamanāti hirimanā.
They have hirī in their mind, or their mind is endowed with hirī, thus they are conscientious.
Những người có hổ thẹn (hirī) trong tâm, hoặc những người có tâm liên hệ với hổ thẹn (hiriyā yutta-manā) được gọi là có tâm hổ thẹn (hirimanā).
Na ottappantīti anottappī, akusalasamāpattiyā na bhāyantīti vuttaṃ hoti.
They do not have moral dread, thus they are unscrupulous; this means they are not afraid of the attainment of the unwholesome.
Những người không sợ hãi (na ottappanti) được gọi là không sợ hãi (anottappī), có nghĩa là họ không sợ khi rơi vào tình trạng bất thiện (akusalasamāpatti).
Tabbiparītā ottappī.
The opposite of that are those who are scrupulous.
Ngược lại là sợ hãi (ottappī).
Appaṃ sutametesanti appassutā, appanti ca thokanti na gahetabbaṃ, natthīti gahetabbaṃ.
They have little learning, thus they are of little learning; and "little" should not be taken as "a small amount," it should be taken as "non-existent."
Những người có ít học vấn được gọi là ít học (appassutā). Từ ‘‘ít’’ (appa) không nên hiểu là ‘‘một chút’’ (thoka), mà nên hiểu là ‘‘không có’’ (natthi).
‘‘Appassutā’’ti hi nissutā sutavirahitā vuccanti.
For by "of little learning" is meant those without learning, those devoid of learning.
Thật vậy, ‘‘ít học’’ (appassutā) được dùng để chỉ những người không có học vấn, thiếu học vấn (sutavirahitā).
Bahu sutametesanti bahussutā, tathāgatabhāsitaṃ ekampi gāthaṃ yāthāvato ñatvā anurūpapaṭipannānametaṃ adhivacanaṃ.
They have much learning, thus they are of much learning; this is a designation for those who, having correctly understood even a single verse spoken by the Tathāgata, have practiced accordingly.
Những người có nhiều học vấn được gọi là đa văn (bahussutā). Đây là tên gọi chung cho những người đã hiểu đúng một bài kệ do Đức Như Lai (Tathāgata) thuyết giảng và đã thực hành phù hợp.
Kucchitā sīdantīti kusītā, hīnavīriyānametaṃ adhivacanaṃ.
They are censurable and they sink down, thus they are lazy; this is a designation for those of inferior energy.
Những người xấu xa, chìm đắm (sīdanti) được gọi là biếng nhác (kusītā). Đây là tên gọi chung cho những người có tinh tấn yếu kém (hīnavīriya).
Āraddhaṃ vīriyametesanti āraddhavīriyā, sammappadhānayuttānametaṃ adhivacanaṃ, muṭṭhā sati etesanti muṭṭhassatī, naṭṭhassatīti vuttaṃ hoti.
They have aroused energy, thus they are of aroused energy; this is a designation for those endowed with right exertion. They have lapsed mindfulness, thus they are of lapsed mindfulness; this means they have lost mindfulness.
Những người có tinh tấn đã được khởi lên (āraddhaṃ vīriyaṃ) được gọi là tinh tấn đã được khởi lên (āraddhavīriyā). Đây là tên gọi chung cho những người thực hành chánh cần (sammappadhāna). Những người có niệm thất lạc (muṭṭhā sati) được gọi là thất niệm (muṭṭhassatī), có nghĩa là niệm đã bị mất.
Upaṭṭhitā sati etesanti upaṭṭhitassatī, niccaṃ ārammaṇābhimukhappavattasatīnametaṃ adhivacanaṃ.
They have established mindfulness, thus they are of established mindfulness; this is a designation for those whose mindfulness constantly proceeds towards the object.
Những người có niệm hiện tiền (upaṭṭhitā sati) được gọi là niệm hiện tiền (upaṭṭhitassatī). Đây là tên gọi chung cho những người có niệm luôn hướng về đối tượng (ārammaṇābhimukhappavatta-satī).
Duṭṭhā paññā etesanti duppaññā, naṭṭhapaññāti vuttaṃ hoti.
They have corrupt wisdom, thus they are unwise; this means they have lost wisdom.
Những người có tuệ xấu (duṭṭhā paññā) được gọi là ác tuệ (duppaññā), có nghĩa là tuệ đã bị mất.
Paññāya sampannāti paññāsampannā, paññāti ca idha vipassanāpaññā veditabbā.
Endowed with wisdom, they are endowed with wisdom; and here, wisdom should be understood as insight-wisdom.
Những người có đầy đủ trí tuệ (paññāya sampannā) được gọi là tuệ đầy đủ (paññāsampannā). Và trí tuệ (paññā) ở đây nên được hiểu là trí tuệ quán chiếu (vipassanāpaññā).
Vipassanāsambhāro hi paripūro imasmiṃ ṭhāne āgato, tasmā vipassanāpaññāva ayanti porāṇānaṃ āṇā.
For the complete provision for insight has come at this point; therefore, "this is indeed insight-wisdom" is the decree of the ancients.
Vì trong trường hợp này, sự chuẩn bị cho tuệ quán (vipassanāsambhāra) đã hoàn thành, do đó, đây chính là tuệ quán. Đây là lời dạy của các bậc cổ đức (porāṇa).
Idāni ekameva lokuttaraguṇānaṃ antarāyakaraṃ aniyyānikadiṭṭhiṃ tīhākārehi dassento sandiṭṭhiparāmāsītiādimāha.
Now, showing the one view that is not a means of release, which is an obstacle to supramundane qualities, in three ways, he said, "One who misapprehends their own views," and so on.
Bây giờ, để trình bày một tà kiến (aniyyānikadiṭṭhi) duy nhất gây trở ngại cho các pháp siêu thế (lokuttaraguṇa) theo ba cách, Ngài nói: bám chấp vào tự kiến (sandiṭṭhiparāmāsī) v.v...
Tattha sandiṭṭhiṃ parāmasantīti sandiṭṭhiparāmāsī.
Therein, they misapprehend their own views, thus they are those who misapprehend their own views.
Trong đó, những người bám chấp vào tự kiến (sandiṭṭhi) được gọi là bám chấp vào tự kiến (sandiṭṭhiparāmāsī).
Ādhānaṃ gaṇhantīti ādhānaggāhī, ādhānanti daḷhaṃ vuccati, daḷhaggāhīti attho.
They take up a grip, thus they are those who grasp tenaciously; ādhāna is said to mean "firmly." The meaning is "those who grasp firmly."
Những người nắm giữ sự chấp thủ (ādhāna) được gọi là chấp thủ (ādhānaggāhī). Chấp thủ (ādhāna) có nghĩa là kiên cố, tức là những người nắm giữ một cách kiên cố.
Yuttakāraṇaṃ disvāva laddhiṃ paṭinissajjantīti paṭinissaggī, dukkhena kicchena kasirena bahumpi kāraṇaṃ dassetvā na sakkā paṭinissaggaṃ kātunti duppaṭinissaggī, ye attano uppannaṃ diṭṭhiṃ idameva saccanti daḷhaṃ gaṇhitvā api buddhādīhi kāraṇaṃ dassetvā vuccamānā na paṭinissajjanti, tesametaṃ adhivacanaṃ.
Those who, upon seeing a valid reason, renounce their view are renouncers. Those for whom it is not possible to bring about a renunciation even after showing much reason with difficulty, with trouble, with hardship, are those who do not renounce easily. This is a designation for those who, having firmly grasped their arisen view as "this alone is the truth," do not renounce it even when spoken to and shown a reason by the Buddhas and others.
Những người từ bỏ tà kiến (laddhi) chỉ khi thấy một lý do hợp lý được gọi là dễ từ bỏ (paṭinissaggī). Những người không thể từ bỏ tà kiến dù đã được chỉ ra nhiều lý do một cách khó khăn, vất vả, gian nan được gọi là khó từ bỏ (duppaṭinissaggī). Đây là tên gọi chung cho những người kiên cố bám chấp vào tà kiến của mình, cho rằng ‘‘chỉ có điều này là sự thật’’, và không từ bỏ dù được các bậc Phật (Buddha) và những người khác chỉ ra lý do.
Tādisā hi puggalā yaṃ yadeva dhammaṃ vā adhammaṃ vā gaṇhanti, taṃ sabbaṃ ‘‘evaṃ amhākaṃ ācariyehi kathitaṃ, evaṃ amhehi suta’’nti kummova aṅgāni sake kapāle antoyeva samodahanti, kumbhīlaggāhaṃ gaṇhanti na vissajjanti.
For such individuals, whatever Dhamma or non-Dhamma they grasp, they draw it all into themselves like a turtle drawing its limbs into its own shell, thinking, "Thus it was spoken by our teacher, thus have we heard," and they grasp it with a crocodile's grip and do not release it.
Thật vậy, những người như vậy, bất cứ pháp thiện (dhamma) hay pháp bất thiện (adhamma) nào mà họ chấp giữ, tất cả đều được họ coi là ‘‘điều này đã được các vị thầy của chúng ta nói như vậy, điều này chúng ta đã được nghe như vậy’’. Họ thu mình vào vỏ bọc của mình như con rùa thu các chi vào mai, nắm giữ như cá sấu nắm giữ con mồi, không chịu buông bỏ.
Vuttavipariyāyena sukkapakkho veditabbo.
The bright side should be understood by way of the opposite of what has been said.
Phía thiện (sukkapakkha) nên được hiểu theo cách ngược lại với những gì đã nói.
Tassattho, ahaṃ, cunda, kusalesu dhammesu cittuppādampi bahūpakāraṃ vadāmi, yā panetā kāyena ca vācāya ca anuvidhiyanā, yathā paṭhamaṃ cittaṃ uppannaṃ, tatheva tesaṃ dhammānaṃ kāyena karaṇaṃ, vācāya ca ‘‘karothā’’ti āṇāpanaṃ vā, uggahaparipucchādīni vā, tattha vādoyeva ko, ekantabahūpakārāyeva hi tā anuvidhiyanāti dasseti.
Its meaning: Cunda, I say that even the arising of a thought regarding wholesome states is of great help. What then to say of the enacting of them by body and by speech? Just as the thought first arose, so too is the performance of those states with the body, and with the speech either the commanding, "Do it," or the learning, questioning, and so on. What is there to say in that regard? Indeed, those enactments are certainly of very great help; thus he shows.
Ý nghĩa của đoạn này là: Này Cunda, Ta nói rằng ngay cả sự phát khởi tâm trong các pháp thiện cũng có nhiều lợi ích. Còn những sự thực hành bằng thân và khẩu, như tâm ban đầu đã khởi lên, cũng vậy, việc thực hành các pháp đó bằng thân, và việc thực hành bằng khẩu, hoặc việc ra lệnh "hãy làm đi" cho người khác, hoặc việc học hỏi, tra vấn, v.v., thì có gì đáng nói nữa đâu? Quả thật, những sự thực hành đó chắc chắn là có vô vàn lợi ích.
Kasmā panettha cittuppādopi bahūpakāroti?
But why is even the arising of a thought here of great help?
Vì sao ngay cả sự phát khởi tâm cũng có nhiều lợi ích trong các pháp này?
Ekantahitasukhāvahattā anuvidhiyanānaṃ hetuttā ca.
Because it unfailingly brings welfare and happiness, and because it is the cause for enactments.
Vì chúng hoàn toàn mang lại lợi ích và hạnh phúc, và vì chúng là nhân duyên cho các sự thực hành.
‘‘Dānaṃ dassāmī’’ti hi cittuppādo sayampi ekantahitasukhāvaho anuvidhiyanānampi hetu, evañhi uppannacittattāyeva dutiyadivase mahāvīthiṃ pidahitvā mahāmaṇḍapaṃ katvā bhikkhusatassa vā bhikkhusahassassa vā dānaṃ deti, ‘‘bhikkhusaṅghaṃ nimantetha pūjetha parivisathā’’ti parijane āṇāpeti.
For the arising of the thought, "I will give a gift," is itself an unfailing bringer of welfare and happiness and is a cause for enactments. Indeed, it is only because such a thought has arisen that on the next day, one blocks the main street, builds a great pavilion, and gives a gift to a hundred bhikkhus or a thousand bhikkhus, and commands one's attendants, "Invite the Sangha of bhikkhus, honor them, serve them."
Quả thật, sự phát khởi tâm "Ta sẽ bố thí" tự nó đã hoàn toàn mang lại lợi ích và hạnh phúc, và là nhân duyên cho các sự thực hành. Chính vì tâm đã khởi lên như vậy, nên vào ngày thứ hai, người đó chặn đường lớn, dựng đại giảng đường, và bố thí cho hàng trăm hoặc hàng ngàn Tỳ-kheo, ra lệnh cho người nhà rằng: "Hãy thỉnh Tăng đoàn, cúng dường, và dâng thức ăn."
Evaṃ ‘‘saṅghassa cīvaraṃ senāsanaṃ bhesajjaṃ dassāmī’’ti cittuppādo sayampi ekantahitasukhāvaho anuvidhiyanānampi hetu, evaṃ uppannacittattāyeva hi cīvarādīni abhisaṅkharoti deti dāpeti ca.
Similarly, the arising of the thought, "I will give robes, lodgings, and medicine to the Sangha," is itself an unfailing bringer of welfare and happiness and is a cause for enactments. Indeed, it is only because such a thought has arisen that one prepares, gives, and causes to be given robes and other requisites.
Cũng vậy, sự phát khởi tâm "Ta sẽ cúng dường y phục, chỗ ở, thuốc men cho Tăng đoàn" tự nó đã hoàn toàn mang lại lợi ích và hạnh phúc, và là nhân duyên cho các sự thực hành. Chính vì tâm đã khởi lên như vậy, nên người đó chuẩn bị, cúng dường, và khiến người khác cúng dường y phục, v.v.
Esa nayo saraṇagamanādīsu.
This is the method in cases such as going for refuge.
Nguyên tắc này cũng áp dụng cho việc quy y, v.v.
‘‘Saraṇaṃ gacchāmī’’ti hi cittaṃ uppādetvāva pacchā kāyena vā vācāya vā saraṇaṃ gaṇhāti.
For it is only after having generated the thought, "I will go for refuge," that one later takes refuge with the body or with speech.
Quả thật, sau khi phát khởi tâm "Ta sẽ quy y", người ta mới quy y bằng thân hoặc khẩu.
Tathā ‘‘pañcaṅgaṃ aṭṭhaṅgaṃ dasaṅgaṃ vā sīlaṃ samādiyissāmī’’ti cittaṃ uppādetvā kāyena vā vācāya vā samādiyati, ‘‘pabbajitvā catūsu sīlesu patiṭṭhahissāmī’’ti ca cittaṃ uppādetvā kāyena vācāya ca pūretabbaṃ sīlaṃ pūreti.
Likewise, having generated the thought, "I will undertake the five-factored, eight-factored, or ten-factored morality," one undertakes it with the body or with speech. And having generated the thought, "Having gone forth, I will become established in the fourfold morality," one fulfills the morality that is to be fulfilled with body and speech.
Cũng vậy, sau khi phát khởi tâm "Ta sẽ thọ trì ngũ giới, bát giới, hoặc thập giới", người ta mới thọ trì bằng thân hoặc khẩu. Và sau khi phát khởi tâm "Ta sẽ xuất gia và an trú trong tứ thanh tịnh giới", người ta mới viên mãn giới cần được viên mãn bằng thân và khẩu.
‘‘Buddhavacanaṃ uggahessāmī’’ti cittaṃ uppādetvāva ekaṃ vā nikāyaṃ dve vā tayo vā cattāro vā pañca vā nikāye vācāya uggaṇhāti.
It is only after having generated the thought, "I will learn the word of the Buddha," that one learns by voice one nikāya, or two, three, four, or five nikāyas.
Sau khi phát khởi tâm "Ta sẽ học lời Phật dạy", người ta mới học một, hai, ba, bốn, hoặc năm bộ Nikāya bằng khẩu.
Evaṃ dhutaṅgasamādāna-kammaṭṭhānuggaha-kasiṇaparikamma-jhānasamāpattivipassanāmaggaphala- paccekabodhi-sammāsambodhivasena netabbaṃ.
Thus it should be understood by way of undertaking the ascetic practices, learning a meditation subject, the preliminary work for a kasiṇa, the attainment of jhāna, insight, path and fruit, the enlightenment of a paccekabuddha, and perfect self-enlightenment.
Cũng vậy, điều này cần được mở rộng theo cách thọ trì hạnh đầu đà (dhutaṅga), học nghiệp xứ (kammaṭṭhāna), thực hành sơ khởi biến xứ (kasiṇaparikamma), nhập thiền (jhānasamāpatti), quán tuệ (vipassanā), đạo quả (maggaphala), Bồ-đề Duyên Giác (Paccekabodhi), và Chánh Đẳng Chánh Giác (Sammāsambodhi).
‘‘Buddho bhavissāmī’’ti hi cittuppādo sayampi ekantahitasukhāvaho anuvidhiyanānampi hetu, evañhi uppannacittattāyeva aparena samayena kappasatasahassādhikāni cattāri asaṅkheyyāni kāyena vācāya ca pāramiyo pūretvā sadevakaṃ lokaṃ tārento vicarati.
For the arising of the thought, "I will become a Buddha," is itself an unfailing bringer of welfare and happiness and is a cause for enactments. Indeed, it is only because such a thought has arisen that, at a later time, for four incalculables and a hundred thousand aeons, one fulfills the perfections with body and speech and journeys on, liberating the world with its devas.
Quả thật, sự phát khởi tâm "Ta sẽ thành Phật" tự nó đã hoàn toàn mang lại lợi ích và hạnh phúc, và là nhân duyên cho các sự thực hành. Chính vì tâm đã khởi lên như vậy, nên sau này, trong bốn A-tăng-kỳ và một trăm ngàn đại kiếp, vị ấy đã viên mãn các Ba-la-mật bằng thân và khẩu, rồi du hành cứu độ chúng sinh trong thế gian cùng với chư thiên.
Evaṃ sabbattha cittuppādopi bahūpakāro.
Thus, in every case, even the arising of a thought is of great help.
Cũng vậy, ở khắp mọi nơi, ngay cả sự phát khởi tâm cũng có nhiều lợi ích.
Kāyavācāhi pana anuvidhiyanā atibahūpakārāyevāti veditabbā.
But the enacting by means of body and speech should be known to be of exceedingly great help.
Tuy nhiên, cần biết rằng sự thực hành bằng thân và khẩu chắc chắn có vô cùng nhiều lợi ích.
Tassattho, yathā nāma, cunda, khāṇukaṇṭakapāsāṇādīhi visamo maggo bhaveyya, tassa parikkamanāya parivajjanatthāya añño suparikammakato viya bhūmibhāgo samo maggo bhaveyya, yathā ca rukkhamūlapāsāṇapapātakumbhīlamakarādi paribyākulaṃ visamaṃ titthamassa, tassa parikkamanāya parivajjanatthāya aññaṃ avisamaṃ anupubbagambhīraṃ sopānaphalakasadisaṃ titthaṃ bhaveyya, yaṃ paṭipanno sukheneva taṃ nadiṃ vā taḷākaṃ vā ajjhogāhetvā nhāyeyya vā uttareyya vā, evameva kho, cunda, visamamaggavisamatitthasadisāya vihiṃsāya samannāgatassa vihiṃsakapuggalassa samamaggasamatitthasadisā avihiṃsā hoti parikkamanāya.
Its meaning is: Cunda, just as there might be an uneven path with stumps, thorns, stones, and so on, and for getting around it, for avoiding it, there might be another, even path, a stretch of ground as if well-prepared; and just as there might be an uneven ford turbulent with tree roots, stones, cliffs, crocodiles, sea-monsters, and so on, and for getting around it, for avoiding it, there might be another, even ford, gradually deepening, like a set of stairs, which one who has entered could easily descend into that river or lake and either bathe or cross over; just so, Cunda, for a harmful person endowed with harmfulness, which is like an uneven path and an uneven ford, non-harming, which is like an even path and an even ford, is for getting around it.
Ý nghĩa của đoạn này là: Này Cunda, ví như có một con đường gồ ghề đầy gốc cây, gai góc, đá tảng, v.v., để tránh né và vượt qua nó, có một con đường khác bằng phẳng như một vùng đất đã được sửa sang kỹ lưỡng. Và ví như có một bến lội gồ ghề, đầy rễ cây, đá tảng, vực sâu, cá sấu, cá mập, v.v., để tránh né và vượt qua nó, có một bến khác bằng phẳng, dần dần sâu xuống như bậc thang hay tấm ván, mà người đi vào đó có thể dễ dàng xuống sông hay ao để tắm hoặc vượt qua. Cũng vậy, này Cunda, đối với một người có hành vi bạo động, giống như con đường gồ ghề và bến lội gồ ghề, thì sự không bạo động (avihiṃsā) giống như con đường bằng phẳng và bến lội bằng phẳng để tránh né.
Yatheva hi visamamaggatitthaparivajjanatthāya samo maggo ca titthañca paṭiyattaṃ, evaṃ vihiṃsāparivajjanatthāya avihiṃsā paṭiyattā, yaṃ paṭipanno sukheneva manussagatiṃ vā devagatiṃ vā ajjhogāhetvā sampattiṃ vā anubhaveyya uttareyya vā lokā.
For just as an even path and ford are prepared for avoiding an uneven path and ford, so non-harming is prepared for avoiding harming. One who has entered upon it can easily descend into the human state or the deva state and either experience success or cross over from the world.
Quả thật, như con đường bằng phẳng và bến lội bằng phẳng được chuẩn bị để tránh con đường và bến lội gồ ghề, thì sự không bạo động được chuẩn bị để tránh bạo động. Người đi theo con đường này có thể dễ dàng đi vào cõi người hoặc cõi trời để hưởng thụ tài sản hoặc vượt thoát khỏi thế gian.
Eteneva upāyena sabbapadāni yojetabbāni.
All the terms should be construed in this way.
Theo phương pháp này, tất cả các từ ngữ còn lại cũng cần được kết nối.
Tassattho, yathā nāma, cunda, ye keci akusalā dhammā paṭisandhiyā janakā vā ajanakā vā, dinnāyapi paṭisandhiyā vipākajanakā vā ajanakā vā, sabbe te jātivasena adhobhāgaṅgamanīyāti evaṃnāmāva honti, vipākakāle aniṭṭhākantavipākattā.
Its meaning: Cunda, just as whatever unwholesome states there are, whether they generate rebirth-linking or not, and even when rebirth-linking has been given, whether they have produced their result or not, all of them, by their very nature, are simply named "leading downwards," because at the time of their result, their result is undesirable and unpleasant.
Ý nghĩa của đoạn này là: Này Cunda, ví như bất kỳ pháp bất thiện nào, dù có khả năng tái sinh hay không, dù đã cho quả tái sinh hay chưa, tất cả chúng đều được gọi là "dẫn đến cõi thấp" theo bản chất của chúng, vì khi cho quả, chúng mang lại những kết quả không mong muốn và không dễ chịu.
Yathā ca ye keci kusalā dhammā paṭisandhiyā janakā vā ajanakā vā dinnāyapi paṭisandhiyā vipākajanakā vā ajanakā vā, sabbe te jātivasena uparibhāgaṅgamanīyāti evaṃnāmāva honti, vipākakāle iṭṭhakantavipākattā, evameva kho, cunda, vihiṃsakassa…pe… uparibhāgāyāti.
And just as whatever wholesome states there are, whether they generate rebirth-linking or not, and even when rebirth-linking has been given, whether they have produced their result or not, all of them, by their very nature, are simply named "leading upwards," because at the time of their result, their result is desirable and pleasant; just so, Cunda, for a harmful person... for a higher state.
Và ví như bất kỳ pháp thiện nào, dù có khả năng tái sinh hay không, dù đã cho quả tái sinh hay chưa, tất cả chúng đều được gọi là "dẫn đến cõi cao" theo bản chất của chúng, vì khi cho quả, chúng mang lại những kết quả mong muốn và dễ chịu. Cũng vậy, này Cunda, đối với người có hành vi bạo động... v.v. ... dẫn đến cõi cao.
Tatrāyaṃ opammasaṃsandanā – yathā sabbe akusalā adhobhāgaṅgamanīyā, evaṃ vihiṃsakassa ekā vihiṃsāpi.
Herein, this is the connection with the simile: just as all unwholesome states lead downwards, so too does the single instance of harmfulness for a harmful person.
Ở đây, sự so sánh ví dụ như sau: Như tất cả các pháp bất thiện đều dẫn đến cõi thấp, thì một hành vi bạo động duy nhất của người có hành vi bạo động cũng vậy.
Yathā ca sabbe kusalā uparibhāgaṅgamanīyā, evaṃ avihiṃsakassa ekā avihiṃsāpi.
And just as all wholesome states lead upwards, so too does the single instance of non-harming for a non-harming person.
Và như tất cả các pháp thiện đều dẫn đến cõi cao, thì một hành vi không bạo động duy nhất của người không bạo động cũng vậy.
Eteneva upāyena akusalaṃ akusalena kusalañca kusalena upametabbaṃ, ayaṃ kirettha adhippāyoti.
By this method, the unwholesome should be compared with the unwholesome, and the wholesome with the wholesome. This, it seems, is the intention here.
Theo phương pháp này, bất thiện cần được so sánh với bất thiện, và thiện cần được so sánh với thiện. Đây là ý nghĩa ở đây.
87. Evaṃ tasseva sallekhassa uparibhāgaṅgamanīyataṃ dassetvā idāni parinibbāpane samatthabhāvaṃ dassetuṃ so vata cundātiādimāha.
87. Thus, having shown that this very effacement leads to a higher state, he now spoke the words beginning, "Indeed, Cunda, that one," to show that it is capable of bringing about final Nibbāna.
87. Sau khi chỉ ra khả năng đi lên các cõi cao hơn của sự thanh lọc đó, bây giờ để chỉ ra khả năng đưa đến Niết-bàn, Đức Phật nói: "Này Cunda, người đó," v.v.
Tattha soti vuttappakārapuggalaniddeso.
Therein, "that one" is a designation for the kind of person mentioned.
Trong đó, từ "người đó" (so) là chỉ định một người đã được đề cập.
Tassa yoti imaṃ uddesavacanaṃ āharitvā yo attanā palipapalipanno, so vata, cunda, paraṃ palipapalipannaṃ uddharissatīti evaṃ sabbapadesu sambandho veditabbo.
Bringing in the indicative phrase "one who," the connection should be understood in all clauses thus: "Indeed, Cunda, that one who is himself stuck in the mud should pull out another who is stuck in the mud—this is impossible."
Cần hiểu rằng bằng cách lấy từ chỉ định "yo" của từ "tassa" đó, sự kết nối trong tất cả các đoạn là: "Này Cunda, người nào tự mình bị sa lầy, người đó liệu có thể kéo người khác đang bị sa lầy lên được không?"
Palipapalipannoti gambhīrakaddame nimuggo vuccati, no ca kho ariyassa vinaye.
"Stuck in the mud" refers to one sunk in deep mire, but not so in the Noble One's discipline.
"Palipapalipanno" có nghĩa là bị lún sâu trong bùn lầy sâu, nhưng không phải trong giới luật của bậc Thánh.
Ariyassa pana vinaye palipanti pañca kāmaguṇā vuccanti.
Rather, in the Noble One's discipline, "mud" refers to the five cords of sensual pleasure.
Tuy nhiên, trong giới luật của bậc Thánh, "palipa" được gọi là năm dục lạc.
Palipannoti tattha nimuggo bālaputhujjano, tasmā evamettha atthayojanā veditabbā.
"Stuck" refers to an ignorant worldling sunk therein. Therefore, the application of the meaning should be understood in this way:
"Palipanno" có nghĩa là một phàm phu ngu si bị lún sâu vào đó. Do đó, cần hiểu ý nghĩa ở đây như sau:
Yathā, cunda, koci puriso yāva nāsikaggā gambhīre kaddame nimuggo aparaṃ tattheva nimuggaṃ hatthe vā sīse vā gahetvā uddharissatīti netaṃ ṭhānaṃ vijjati, na hi taṃ kāraṇamatthi, yena so taṃ uddharitvā thale patiṭṭhapeyya, evameva yo attanā pañcakāmaguṇapalipe palipanno, so vata paraṃ tatheva palipapalipannaṃ uddharissatīti netaṃ ṭhānaṃ vijjati.
Cunda, just as a person sunk up to the tip of their nose in deep mire might grab another sunk in that same mire by the hand or head and pull them out—this is impossible. There is no means by which they could pull them out and establish them on dry land. In the very same way, that one who is himself stuck in the mud of the five cords of sensual pleasure should pull out another who is likewise stuck in the mud—this is impossible.
Này Cunda, ví như một người bị lún sâu trong bùn lầy đến tận mũi, liệu có thể kéo một người khác cũng bị lún sâu như vậy bằng cách nắm tay hoặc đầu lên được không? Điều đó không thể xảy ra. Không có lý do nào để người đó có thể kéo người kia lên và đặt trên đất khô. Cũng vậy, người nào tự mình bị lún sâu trong bùn lầy của năm dục lạc, liệu người đó có thể kéo người khác cũng bị lún sâu như vậy lên được không? Điều đó không thể xảy ra.
Tattha siyā ayuttametaṃ, puthujjanānampi bhikkhubhikkhunīupāsakaupāsikānaṃ dhammadesanaṃ sutvā hontiyeva dhammaṃ abhisametāro, tasmā palipapalipanno uddharatīti, taṃ na tathā daṭṭhabbaṃ.
In this regard, it might be said: this is incorrect, for there are those who realize the Dhamma after hearing a Dhamma discourse from worldling bhikkhus, bhikkhunīs, male lay followers, and female lay followers; therefore, one who is stuck in the mud does pull others out. But this should not be seen in that way.
Ở đây có thể có ý kiến rằng điều này không hợp lý, vì ngay cả những phàm phu Tỳ-kheo, Tỳ-kheo-ni, Ưu-bà-tắc, Ưu-bà-di cũng có thể chứng ngộ Pháp sau khi nghe Pháp, do đó người bị sa lầy vẫn có thể kéo người khác lên. Điều đó không nên được nhìn nhận như vậy.
Bhagavāyeva hi tattha uddharati, pasaṃsāmattameva pana dhammakathikā labhanti raññā pahitalekhavācako viya.
For indeed, it is the Blessed One himself who uplifts them. The Dhamma-preachers, however, receive only praise, like one who reads a letter sent by a king.
Chính Đức Thế Tôn là Đấng cứu vớt ở đó. Còn các vị thuyết pháp chỉ nhận được sự tán dương, giống như người đọc thư do vua phái đến.
Yathā hi rañño paccantajanapade pahitaṃ lekhaṃ tattha manussā lekhaṃ vācetuṃ ajānantā yo vācetuṃ jānāti, tena vācāpetvā tamatthaṃ sutvā ‘‘rañño āṇā’’ti ādarena sampādenti, na ca nesaṃ hoti ‘‘lekhavācakassa ayaṃ āṇā’’ti.
For just as when a letter sent by a king to a border province is read by someone who knows how to read it, since the people there do not know how to read the letter, and having heard its contents they respectfully carry it out, thinking, "This is the king's command," it does not occur to them, "This is the command of the letter-reader."
Ví như, khi một bức thư do vua phái đến vùng biên giới, những người ở đó không biết đọc thư, bèn nhờ người biết đọc đọc cho nghe, rồi nghe ý nghĩa đó, họ cung kính thực hiện (mệnh lệnh) rằng: “Đây là chiếu chỉ của vua”, chứ không nghĩ rằng: “Đây là chiếu chỉ của người đọc thư”.
Lekhavācako pana ‘‘vissaṭṭhāya vācāya vācesi anelagaḷāyā’’ti pasaṃsāmattameva labhati, evameva kiñcāpi sāriputtapabhutayo dhammakathikā dhammaṃ desenti, atha kho likhitapaṇṇavācako viya te honti.
The letter-reader, however, receives only praise, such as, "He read with a clear and distinct voice." In the same way, although Dhamma-preachers like Sāriputta and others teach the Dhamma, they are like the one who reads the written leaf.
Còn người đọc thư chỉ nhận được sự tán dương rằng: “Người ấy đã đọc bằng giọng nói rõ ràng, không vấp váp”, cũng vậy, mặc dù các vị thuyết pháp như Tôn giả Sāriputta thuyết giảng Dhamma, nhưng các vị ấy giống như người đọc một văn bản đã được viết sẵn.
Bhagavatoyeva pana sā dhammadesanā rañño āṇā viya.
That Dhamma-teaching, however, is the Blessed One's alone, like the king's command.
Tuy nhiên, lời thuyết giảng Dhamma đó là của Đức Thế Tôn, giống như chiếu chỉ của vua.
Ye ca taṃ sutvā dhammaṃ abhisamenti, te bhagavāyeva uddharatīti veditabbā.
And those who, having heard it, awaken to the Dhamma, should be understood as being uplifted by the Blessed One himself.
Và những ai nghe lời ấy mà chứng ngộ Dhamma, thì nên biết rằng chính Đức Thế Tôn đã cứu vớt họ.
Dhammakathikā pana ‘‘vissaṭṭhāya vācāya dhammaṃ desenti anelagaḷāyā’’ti pasaṃsāmattameva labhantīti.
The Dhamma-preachers, however, receive only praise, such as, "They teach the Dhamma with a clear and distinct voice."
Còn các vị thuyết pháp chỉ nhận được sự tán dương rằng: “Các vị ấy đã thuyết giảng Dhamma bằng giọng nói rõ ràng, không vấp váp”.
Tasmā yuttamevetanti.
Therefore, this is indeed appropriate.
Do đó, điều này là hoàn toàn hợp lý.
Vuttavipariyāyena sukkapakkho veditabbo.
The bright side should be understood by way of the opposite of what has been said.
Mặt trắng (sukkapakkha) nên được hiểu theo nghĩa ngược lại với những gì đã nói.
Adanto avinīto aparinibbutoti ettha pana anibbisatāya adanto.
In the phrase untamed, undisciplined, unextinguished, he is untamed due to not having discharged the venom of defilements.
Ở đây, adanto avinīto aparinibbuto (không được điều phục, không được huấn luyện, không được tịch tịnh) nên được hiểu là: adanto (không được điều phục) vì chưa nhổ bỏ (kilesa).
Asikkhitavinayatāya avinīto.
He is undisciplined due to not having trained in the discipline.
Avinīto (không được huấn luyện) vì chưa học hỏi giới luật.
Anibbutakilesatāya aparinibbutoti veditabbo.
He is unextinguished due to his defilements being unextinguished.
Aparinibbuto (không được tịch tịnh) vì phiền não chưa được tịch tịnh.
So tādiso paraṃ damessati, nibbisaṃ karissati, vinessati vā tisso sikkhā sikkhāpessati, parinibbāpessati vā tassa kilese nibbāpessatīti netaṃ ṭhānaṃ vijjati.
That such a person will tame another, render him venom-free, discipline him or train him in the three trainings, or cause him to attain Parinibbāna by extinguishing his defilements—this is not a possible case.
Một người như vậy mà có thể điều phục người khác, làm cho người khác nhổ bỏ (phiền não), huấn luyện người khác, khiến người khác học ba loại học, hay làm cho phiền não của người khác được tịch tịnh – điều đó không thể xảy ra.
Vuttavipariyāyena sukkapakkho veditabbo.
The bright side should be understood by way of the opposite of what has been said.
Mặt trắng (sukkapakkha) nên được hiểu theo nghĩa ngược lại với những gì đã nói.
Evameva kho, cunda, vihiṃsakassa…pe… parinibbānāyāti ettha pana evamattho veditabbo – yathā hi attanā apalipapalipanno paraṃ palipapalipannaṃ uddharissati, danto damessati, vinīto vinessati, parinibbuto parinibbāpessatīti ṭhānametaṃ vijjatīti.
In the phrase "Just so, Cunda, for one who is harmful... for the sake of final extinguishment," the meaning should be understood thus: just as one who is not stuck in the mud can pull out another who is stuck in the mud, one who is tamed can tame, one who is disciplined can discipline, one who is extinguished can cause extinguishment—this is a possible case.
Ở đây, trong câu Evameva kho, Cunda, vihiṃsakassa…pe… parinibbānāyā (Cunda, cũng vậy, đối với người làm hại…pe… để đạt đến Nibbāna), ý nghĩa nên được hiểu như sau: Ví như, một người tự mình không bị lún sâu (vào bùn lầy), đã được điều phục, đã được huấn luyện, đã được tịch tịnh, thì có thể cứu vớt người khác đang bị lún sâu, điều phục người khác, huấn luyện người khác, làm cho người khác được tịch tịnh – điều đó có thể xảy ra.
Kiṃ pana tanti?
But what is that basis?
Vậy điều gì là có thể?
Apalipapalipannattaṃ, dantattaṃ vinītattaṃ parinibbutattañca, evameva kho, cunda, vihiṃsakassa purisapuggalassa avihiṃsā hoti parinibbānāya.
The state of not being stuck in the mud, the state of being tamed, the state of being disciplined, and the state of being extinguished. Just so, Cunda, for a harmful person, non-harming leads to final extinguishment.
Đó là việc tự mình không bị lún sâu, đã được điều phục, đã được huấn luyện và đã được tịch tịnh. Cũng vậy, này Cunda, đối với người làm hại, sự không làm hại sẽ đưa đến Nibbāna.
Kiṃ vuttaṃ hoti?
What is meant by this?
Ý nghĩa là gì?
Yo attanā avihiṃsako, tassa yā avihiṃsā, ayaṃ yā esā vihiṃsakassa parassa vihiṃsā, tassā parinibbānāya hoti, attanā hi avihiṃsako parassa vihiṃsācetanaṃ nibbāpessatīti ṭhānametaṃ vijjati.
For one who is personally non-harmful, that non-harming of his leads to the final extinguishment of the harming in another person who is harmful. Indeed, one who is personally non-harmful can extinguish the harmful intention of another—this is a possible case.
Người nào tự mình không làm hại, thì sự không làm hại của người ấy sẽ đưa đến sự tịch tịnh của hành vi làm hại của người khác. Thật vậy, một người tự mình không làm hại có thể làm cho ý muốn làm hại của người khác được tịch tịnh – điều đó có thể xảy ra.
Kiṃ pana tanti?
But what is that basis?
Vậy điều gì là có thể?
Avihiṃsakattameva.
The very state of being non-harmful.
Chính là việc tự mình không làm hại.
Yañhi yena attanā adhigataṃ hoti, so paraṃ tadatthāya samādapetuṃ sakkotīti.
For whatever has been personally attained by someone, that person is able to establish another in it for that purpose.
Thật vậy, người nào đã tự mình đạt được điều gì, thì người ấy có thể khuyến khích người khác đạt được điều đó.
Atha vā yathā attanā apalipanno danto vinīto parinibbuto paraṃ palipapalipannaṃ adantaṃ avinītaṃ aparinibbutañca uddharissati damessati vinessati parinibbāpessatīti ṭhānametaṃ vijjati, evameva vihiṃsakassa purisapuggalassa vihiṃsāpahānāya maggaṃ bhāvayato uppannā avihiṃsā hoti parinibbānāya.
Alternatively, just as one who is personally not stuck, tamed, disciplined, and extinguished can pull out, tame, discipline, and cause the final extinguishment of another who is stuck, untamed, undisciplined, and unextinguished—this is a possible case. In the same way, for a harmful person who is developing the path for the abandoning of harming, the non-harming that has arisen leads to final extinguishment.
Hoặc là, ví như một người tự mình không bị lún sâu, đã được điều phục, đã được huấn luyện, đã được tịch tịnh, thì có thể cứu vớt người khác đang bị lún sâu, chưa được điều phục, chưa được huấn luyện, chưa được tịch tịnh; có thể điều phục, huấn luyện và làm cho người khác được tịch tịnh – điều đó có thể xảy ra. Cũng vậy, đối với người làm hại, sự không làm hại phát sinh khi người ấy tu tập con đường từ bỏ sự làm hại sẽ đưa đến Nibbāna.
Parinibbuto viya hi aparinibbutaṃ avihiṃsācetanāva vihiṃsācetanaṃ parinibbāpetuṃ samatthā.
Indeed, just as one who is extinguished is capable of extinguishing one who is unextinguished, the intention of non-harming is capable of extinguishing the intention of harming.
Thật vậy, ý muốn không làm hại có khả năng làm cho ý muốn làm hại được tịch tịnh, giống như một người đã tịch tịnh có thể làm cho người chưa tịch tịnh được tịch tịnh.
Etamatthaṃ dassento ‘‘evameva kho, cundā’’tiādimāhāti evamettha attho daṭṭhabbo.
In order to show this meaning, he said, "Just so, Cunda," and so on. This is how the meaning should be seen here.
Ý nghĩa ở đây nên được hiểu là Đức Phật đã nói: “Cũng vậy, này Cunda” và các câu tiếp theo để chỉ rõ ý nghĩa này.
Yathā cettha, evaṃ sabbapadesu.
As it is here, so it is in all instances.
Và như ở đây, thì cũng vậy ở tất cả các đoạn khác.
Ativitthārabhayena pana anupadayojanā na katāti.
However, for fear of excessive length, a word-by-word analysis has not been made.
Tuy nhiên, vì sợ quá dài dòng, nên không giải thích từng từ một.
88. Evaṃ tassa parinibbāpane samatthabhāvaṃ dassetvā idāni taṃ desanaṃ nigametvā dhammapaṭipattiyaṃ niyojetuṃ iti kho, cundātiādimāha.
88. Having thus shown its capability for causing final extinguishment, now, to conclude that teaching and to enjoin the practice of the Dhamma, he said, "Therefore, Cunda," and so on.
88. Sau khi chỉ rõ khả năng làm cho (phiền não) tịch tịnh của vị ấy, bây giờ để kết thúc lời thuyết giảng đó và khuyến khích thực hành Dhamma, Đức Phật đã nói: iti kho, Cundā (Vậy thì, này Cunda) và các câu tiếp theo.
Tattha sallekhapariyāyoti sallekhakāraṇaṃ.
Therein, the discourse on effacement means the reason for effacement.
Ở đây, sallekhapariyāyo có nghĩa là nhân của sự thanh lọc (sallekha).
Esa nayo sabbattha ettha avihiṃsādayo eva vihiṃsādīnaṃ sallekhanato sallekhakāraṇaṃ.
This is the method everywhere. Here, non-harming and so on are the reason for effacement because they efface harming and so on.
Nguyên tắc này áp dụng cho tất cả các trường hợp. Ở đây, các yếu tố như avihiṃsā (không làm hại) là nhân của sự thanh lọc vì chúng thanh lọc các yếu tố như vihiṃsā (làm hại).
Tesaṃ vasena cittassa uppādetabbato cittupādakāraṇaṃ, vihiṃsādi, parikkamanassa hetuto parikkamanakāraṇaṃ, uparibhāganipphādanato uparibhāgakāraṇaṃ, vihiṃsādīnaṃ parinibbāpanato parinibbānakāraṇanti veditabbā.
It is the reason for the arising of thought because the thought is to be generated by means of them; it is the reason for transcending because it is the cause for transcending harming and so on; it is the reason for the higher part because it brings about the higher part; and it is the reason for final extinguishment because it causes the final extinguishment of harming and so on. This should be understood.
Chúng nên được hiểu là nhân của sự phát khởi tâm (cittuppādakāraṇa) vì tâm được phát khởi dựa trên chúng; nhân của sự từ bỏ (parikkamanakāraṇa) vì chúng là nguyên nhân của việc từ bỏ vihiṃsā và các điều tương tự; nhân của sự vượt lên (uparibhāgakāraṇa) vì chúng tạo ra trạng thái cao hơn; và nhân của sự tịch tịnh (parinibbānakāraṇa) vì chúng làm cho vihiṃsā và các điều tương tự được tịch tịnh.
Hitesināti hitaṃ esantena.
By one who seeks their welfare: by one who seeks what is beneficial.
Hitesinā có nghĩa là bởi người tìm kiếm lợi ích.
Anukampakenāti anukampamānena.
By a compassionate one: by one who is compassionate.
Anukampakenā có nghĩa là bởi người có lòng từ bi.
Anukampaṃ upādāyāti anukampaṃ cittena pariggahetvā, pariccātipi vuttaṃ hoti.
Out of compassion: having embraced compassion with the mind; it is also said to mean "on account of".
Anukampaṃ upādāyā có nghĩa là nắm giữ lòng từ bi trong tâm, hay nói cách khác là dựa vào lòng từ bi.
Kataṃ vo taṃ mayāti taṃ mayā ime pañca pariyāye dassentena tumhākaṃ kataṃ.
That has been done for you by me: that has been done for you by me in showing these five discourses.
Kataṃ vo taṃ mayā có nghĩa là Ta đã làm điều đó cho các con bằng cách chỉ ra năm phương pháp này.
Ettakameva hi anukampakassa satthu kiccaṃ, yadidaṃ aviparītadhammadesanā.
For this much is the duty of a compassionate Teacher, that is, the teaching of the unerring Dhamma.
Thật vậy, đây là nhiệm vụ của một Bậc Đạo Sư có lòng từ bi, đó là thuyết giảng Dhamma một cách không sai lệch.
Ito paraṃ pana paṭipatti nāma sāvakānaṃ kiccaṃ.
Beyond this, however, the practice is the duty of the disciples.
Từ đây trở đi, sự thực hành là nhiệm vụ của các đệ tử.
Tenāha etāni, cunda, rukkhamūlāni…pe… amhākaṃ anusāsanīti.
Therefore he said, "Here, Cunda, are the roots of trees... This is our instruction."
Vì vậy, Đức Phật đã nói: etāni, Cunda, rukkhamūlāni…pe… amhākaṃ anusāsanī (Này Cunda, đây là các gốc cây…pe… là lời giáo huấn của chúng Ta).
Tattha ca rukkhamūlānīti iminā rukkhamūlasenāsanaṃ dasseti.
And therein, by the roots of trees, he indicates the dwelling at the root of a tree.
Ở đây, với rukkhamūlāni, Ngài chỉ ra chỗ ở dưới gốc cây.
Suññāgārānīti iminā janavivittaṭṭhānaṃ.
By empty dwellings, he indicates a place secluded from people.
Với suññāgārāni, Ngài chỉ ra nơi vắng vẻ không người.
Ubhayenāpi ca yogānurūpasenāsanamācikkhati, dāyajjaṃ niyyāteti.
And by both, he points out a dwelling suitable for meditation; he hands over the inheritance.
Và bằng cả hai, Ngài chỉ rõ chỗ ở phù hợp cho việc tu tập, ban tặng di sản.
Jhāyathāti ārammaṇūpanijjhānena aṭṭhatiṃsārammaṇāni, lakkhaṇūpanijjhānena ca aniccādito khandhāyatanādīni upanijjhāyatha, samathañca vipassanañca vaḍḍhethāti vuttaṃ hoti.
Meditate: You should closely contemplate the thirty-eight objects by means of absorption into the object, and you should closely contemplate the aggregates, sense bases, and so on as impermanent, etc., by means of absorption into the characteristics. It means, "develop both serenity and insight."
Jhāyathā có nghĩa là hãy quán sát 38 đối tượng thiền định bằng cách quán sát đối tượng (ārammaṇūpanijjhāna), và quán sát các uẩn, xứ, v.v., từ vô thường, v.v., bằng cách quán sát đặc tính (lakkhaṇūpanijjhāna); nói cách khác, hãy phát triển samatha (tịnh chỉ) và vipassanā (quán chiếu).
Mā pamādatthāti mā pamajjittha.
Do not be heedless: Do not be negligent.
Mā pamādatthā có nghĩa là chớ lơ là.
Mā pacchā vippaṭisārino ahuvatthāti ye hi pubbe daharakāle, ārogyakāle, sattasappāyādisampattikāle, satthu sammukhībhāvakāle ca yonisomanasikāravirahitā rattindivaṃ maṅgulabhattā hutvā seyyasukhaṃ middhasukhamanubhontā pamajjanti, te pacchā jarākāle, rogakāle, maraṇakāle, vipattikāle, satthu parinibbutakāle ca taṃ pubbe pamādavihāraṃ anussarantā, sappaṭisandhikālakiriyañca bhāriyaṃ sampassamānā vippaṭisārino honti, tumhe pana tādisā mā ahuvatthāti etamatthaṃ dassento āha ‘‘mā pacchā vippaṭisārino ahuvatthā’’ti.
Do not be regretful later: For those who, in their youth, in times of health, in times of favorable conditions like the seven kinds of suitability, and when the Teacher was present, being devoid of wise attention, become heedless, spending day and night like well-fed bulls enjoying the pleasures of sleep and drowsiness, they later, in old age, in times of sickness, at the time of death, in times of adversity, and after the Teacher's Parinibbāna, remembering that former heedless living and seeing the weighty matter of dying with rebirth to follow, become regretful. Showing the meaning, "But you should not be like that," he said, "Do not be regretful later."
Mā pacchā vippaṭisārino ahuvatthā có nghĩa là những ai trước đây, khi còn trẻ, khỏe mạnh, có đầy đủ các điều kiện thuận lợi như bảy điều thích hợp, và khi còn được diện kiến Bậc Đạo Sư, mà sống lơ là, thiếu tác ý đúng đắn, trải qua ngày đêm như những người ăn tiệc, hưởng thụ sự an lạc của giấc ngủ và sự an lạc của sự lười biếng, thì sau này, khi già yếu, bệnh tật, sắp chết, gặp phải tai họa, và khi Bậc Đạo Sư đã nhập Niết Bàn, họ sẽ hối tiếc khi nhớ lại lối sống lơ là trước đây, và thấy rằng việc tái sinh là một gánh nặng lớn. Để chỉ rõ ý nghĩa này, Đức Phật đã nói: “Chớ để sau này phải hối tiếc”.
Ayaṃ vo amhākaṃ anusāsanīti ayaṃ amhākaṃ santikā ‘‘jhāyatha mā pamādatthā’’ti tumhākaṃ anusāsanī, ovādoti vuttaṃ hoti.
This is our instruction for you: This is our instruction for you from us, "Meditate, do not be heedless." It means, this is the exhortation.
Ayaṃ vo amhākaṃ anusāsanī có nghĩa là “Đây là lời giáo huấn, lời khuyên của chúng Ta dành cho các con: ‘Hãy thiền định, chớ lơ là’”.
Tattha yasmā jānantāpi sammādiṭṭhīti vadanti ajānantāpi bāhirakāpi sāsanikāpi anussavādivasenāpi attapaccakkhenāpi, tasmā taṃ bahūnaṃ vacanaṃ upādāya dvikkhattuṃ āmasanto ‘‘sammādiṭṭhi sammādiṭṭhīti, āvuso, vuccatī’’ti āha.
Therein, because those who know say "right view" and those who do not know also say it, those outside and those within the Sāsana, whether by hearsay or by personal experience, he therefore, taking into account this saying of many, addressed it twice, saying: "Friend, it is said, 'right view, right view'."
Ở đây, vì có những người biết mà nói là chánh kiến, có những người không biết mà nói là chánh kiến; có những người ngoại đạo mà nói, có những người trong giáo pháp mà nói; có những người nói dựa trên truyền thống, có những người nói dựa trên sự chứng nghiệm của bản thân. Vì vậy, dựa trên những lời nói đa dạng đó, Trưởng lão đã lặp lại hai lần: “Này chư Hiền, chánh kiến, chánh kiến được nói đến”.
Ayañhi ettha adhippāyo, aparehipi sammādiṭṭhīti vuccati, athāparehipi sammādiṭṭhīti vuccati, svāyaṃ evaṃ vuccamāno atthañca lakkhaṇañca upādāya kittāvatā nu kho, āvuso, ariyasāvako sammādiṭṭhi hotīti.
For this is the intention here: By some it is called ‘right view,’ and by others it is also called ‘right view.’ With regard to what meaning and characteristic is that person, being spoken of in this way—to what extent, friends, is a noble disciple one of right view?
Ý nghĩa ở đây là thế này: Các người khác cũng nói là chánh kiến (sammādiṭṭhi), rồi những người khác nữa cũng nói là chánh kiến. Vậy khi được nói như thế, này các hiền giả, một đệ tử của bậc Thánh (ariyasāvako) đạt được chánh kiến (sammādiṭṭhi) đến mức độ nào, dựa trên ý nghĩa và đặc tính?
Tattha sammādiṭṭhīti sobhanāya pasatthāya ca diṭṭhiyā samannāgato.
Therein, one of right view means one endowed with a beautiful and praiseworthy view.
Ở đây, chánh kiến (sammādiṭṭhi) là người thành tựu với cái thấy tốt đẹp và đáng ca ngợi.
Yadā pana dhammeyeva ayaṃ sammādiṭṭhisaddo vattati, tadāssa sobhanā pasatthā ca diṭṭhi sammādiṭṭhīti evamattho veditabbo.
But when this term ‘right view’ is applied to the Dhamma itself, then its meaning should be understood thus: a beautiful and praiseworthy view is right view.
Tuy nhiên, khi từ chánh kiến này (sammādiṭṭhisaddo) chỉ đề cập đến Pháp (dhamma), thì phải hiểu nghĩa là cái thấy tốt đẹp và đáng ca ngợi đó chính là chánh kiến.
Sā cāyaṃ sammādiṭṭhi duvidhā hoti lokiyā lokuttarāti.
And that right view is of two kinds: worldly and supramundane.
Chánh kiến này có hai loại: thế gian (lokiyā) và siêu thế (lokuttarā).
Tattha kammassakatāñāṇaṃ saccānulomikañāṇañca lokiyā sammādiṭṭhi, saṅkhepato vā sabbāpi sāsavā paññā.
Therein, the knowledge of ownership of kamma and the knowledge that conforms to the truths is worldly right view; or, in brief, all wisdom that is subject to the taints.
Trong đó, trí tuệ về nghiệp sở hữu (kammassakatāñāṇa) và trí tuệ thuận theo Chân đế (saccānulomikañāṇa) là chánh kiến thế gian (lokiyā sammādiṭṭhi), hay nói tóm lại, tất cả mọi trí tuệ còn hữu lậu (sāsavā paññā).
Ariyamaggaphalasampayuttā paññā lokuttarā sammādiṭṭhi.
The wisdom associated with the noble path and fruition is supramundane right view.
Trí tuệ hợp với Thánh đạo và Thánh quả (ariyamaggaphalasampayuttā paññā) là chánh kiến siêu thế (lokuttarā sammādiṭṭhi).
Puggalo pana tividho hoti puthujjano sekkho asekkho ca.
A person, however, is of three kinds: an ordinary person, a learner, and one beyond learning.
Tuy nhiên, có ba loại người: phàm phu (puthujjano), hữu học (sekkho) và vô học (asekkho).
Tattha puthujjano duvidho hoti bāhirako sāsaniko ca.
Therein, an ordinary person is of two kinds: an outsider and one within the Sāsana.
Trong đó, phàm phu có hai loại: ngoại đạo (bāhirako) và nội giáo (sāsaniko).
Tattha bāhirako kammavādī kammassakatādiṭṭhiyā sammādiṭṭhi hoti, no saccānulomikāya attadiṭṭhiparāmāsakattā.
Therein, the outsider who holds the doctrine of kamma is one of right view through the view of ownership of kamma, but not through the view that conforms to the truths, because of grasping the view of self.
Trong đó, người ngoại đạo (bāhirako) là người tin nghiệp (kammavādī) có chánh kiến (sammādiṭṭhi) nhờ cái thấy về nghiệp sở hữu (kammassakatādiṭṭhiyā), nhưng không phải nhờ trí tuệ thuận theo Chân đế (saccānulomikāya) vì còn chấp thủ ngã kiến (attadiṭṭhiparāmāsakattā).
Sāsaniko dvīhipi.
One within the Sāsana is so through both.
Người nội giáo (sāsaniko) có cả hai.
Sekkho niyatāya sammādiṭṭhiyā sammādiṭṭhi.
A learner is one of right view through the fixed right view.
Người hữu học (sekkho) có chánh kiến (sammādiṭṭhi) nhờ chánh kiến chắc chắn (niyatāya sammādiṭṭhiyā).
Asekkho asekkhāya.
One beyond learning is so through the right view of one beyond learning.
Người vô học (asekkho) có chánh kiến vô học (asekkhāya).
Idha pana niyatāya niyyānikāya lokuttarakusalasammādiṭṭhiyā samannāgato ‘‘sammādiṭṭhī’’ti adhippeto.
Here, however, one endowed with the fixed, emancipating, supramundane wholesome right view is intended as "one of right view."
Ở đây, "người có chánh kiến" (sammādiṭṭhīti) được hiểu là người thành tựu với chánh kiến siêu thế (lokuttarakusalasammādiṭṭhiyā) hướng đến giải thoát (niyyānikāya) và chắc chắn (niyatāya).
Tenevāha ‘‘ujugatāssa diṭṭhi dhamme aveccappasādena samannāgato āgato imaṃ saddhamma’’nti, lokuttarakusalasammādiṭṭhiyeva hi antadvayamanupagamma ujubhāvena gatattā, kāyavaṅkādīni ca sabbavaṅkāni samucchinditvā gatattā ujugatā hoti, tāyeva ca diṭṭhiyā samannāgato navappakārepi lokuttaradhamme aveccappasādena acalappasādena samannāgato hoti, sabbadiṭṭhigahanāni ca vinibbeṭhento sabbakilese pajahanto jātisaṃsārā nikkhamanto paṭipattiṃ pariniṭṭhapento ariyena maggena āgato imaṃ sambuddhappaveditaṃ amatogadhaṃ nibbānasaṅkhātaṃ saddhammanti vuccati.
Therefore, it was said: "his view is straightened, he is endowed with unwavering confidence in the Dhamma, he has come to this true Dhamma." For it is precisely the supramundane wholesome right view that is straightened, because it proceeds with straightness without approaching the two extremes, and because it proceeds having cut off all crookedness, such as crookedness of body, etc. And one endowed with that very view is endowed with unwavering, unshakable confidence in the nine kinds of supramundane Dhamma. And while disentangling all thickets of views, abandoning all defilements, emerging from the saṃsāra of birth, and bringing the practice to perfection, he is said to have come by the noble path to this true Dhamma, declared by the Perfectly Enlightened One, which has the deathless as its destination, and is called Nibbāna.
Chính vì thế mà có lời dạy: "Cái thấy của vị ấy ngay thẳng, thành tựu với sự tín tâm bất động vào Pháp, đã đến với Chánh Pháp này." Quả thật, chỉ có chánh kiến siêu thế thiện lành (lokuttarakusalasammādiṭṭhiyeva) mới trở nên ngay thẳng (ujugatā) vì đã đi thẳng không rơi vào hai cực đoan, và vì đã nhổ tận gốc rễ tất cả những quanh co như quanh co thân (kāyavaṅkādīni) và tất cả những quanh co khác. Người thành tựu với chánh kiến ấy sẽ có tín tâm bất động (aveccappasādena acalappasādena) vào chín loại pháp siêu thế (navappakārepi lokuttaradhamme). Vị ấy được gọi là "đã đến với Chánh Pháp (saddhamma) này", tức là Niết Bàn (nibbānasaṅkhātaṃ) – nơi không còn chết chóc (amatogadhaṃ) – được Đức Phật Toàn Giác (sambuddhappaveditaṃ) tuyên thuyết, bằng cách gỡ bỏ tất cả những mê lầm của tà kiến (sabbadiṭṭhigahanāni ca vinibbeṭṭhento), từ bỏ tất cả phiền não (sabbakilese pajahanto), thoát khỏi luân hồi sinh tử (jātisaṃsārā nikkhamanto), và hoàn tất sự thực hành (paṭipattiṃ pariniṭṭhapento) bằng Thánh đạo (ariyena maggena).
Yato khoti kālaparicchedavacanametaṃ, yasmiṃ kāleti vuttaṃ hoti.
From when, friends is a statement defining a period of time; it means ‘at which time’.
Yato kho là lời xác định thời gian, có nghĩa là "vào lúc nào".
Akusalañca pajānātīti dasākusalakammapathasaṅkhātaṃ akusalañca pajānāti, nirodhārammaṇāya pajānanāya kiccavasena ‘‘idaṃ dukkha’’nti paṭivijjhanto akusalaṃ pajānāti.
And he knows the unwholesome: He knows the unwholesome, designated as the ten unwholesome courses of kamma. By knowing with the knowledge that has cessation as its object, in terms of function, while penetrating ‘this is suffering,’ he knows the unwholesome.
Akusalañca pajānāti (biết rõ bất thiện) là biết rõ bất thiện được gọi là mười con đường nghiệp bất thiện (dasākusalakammapathasaṅkhātaṃ akusalañca), tức là biết rõ bất thiện bằng cách thấu hiểu "đây là khổ" (idaṃ dukkha) theo chức năng của trí tuệ hiểu biết có Niết Bàn làm đối tượng (nirodhārammaṇāya pajānanāya kiccavasena).
Akusalamūlañca pajānātīti tassa mūlapaccayabhūtaṃ akusalamūlañca pajānāti, teneva pakārena ‘‘ayaṃ dukkhasamudayo’’ti paṭivijjhanto.
And he knows the root of the unwholesome: He knows the root of the unwholesome, which is the root-condition for that unwholesome, in the very same way, while penetrating ‘this is the origin of suffering.’
Akusalamūlañca pajānāti (biết rõ cội rễ bất thiện) là biết rõ cội rễ bất thiện (akusalamūlañca) là nguyên nhân căn bản của bất thiện ấy, cũng theo cách đó, bằng cách thấu hiểu "đây là Khổ tập" (ayaṃ dukkhasamudayo).
Esa nayo kusalañca kusalamūlañcāti etthāpi.
This same method applies to and the wholesome, and the root of the wholesome.
Nguyên tắc này cũng áp dụng cho kusalañca kusalamūlañcā (thiện và cội rễ thiện).
Yathā cettha, evaṃ ito paresu sabbavāresu kiccavaseneva vatthupajānanā veditabbā.
And just as here, so in all the following sections, the knowing of the matter should be understood in terms of function.
Cũng như ở đây, trong tất cả các trường hợp sau, sự hiểu biết về đối tượng (vatthupajānanā) phải được hiểu theo chức năng (kiccavaseneva).
Ettāvatāpīti ettakena iminā akusalādippajānanenāpi.
To this extent: By this much, by this knowing of the unwholesome and so forth.
Ettāvatāpī (đến mức độ này) là ngay cả với sự hiểu biết về bất thiện, v.v., đến mức độ này.
Sammādiṭṭhi hotīti vuttappakārāya lokuttarasammādiṭṭhiyā samannāgato hoti.
Is one of right view: He is endowed with the supramundane right view of the kind described.
Sammādiṭṭhi hoti (có chánh kiến) là thành tựu với chánh kiến siêu thế (lokuttarasammādiṭṭhiyā) đã được nói đến.
Ujugatāssa…pe… imaṃ saddhammanti ettāvatā saṃkhittadesanā niṭṭhitā hoti.
His view is straightened... he has come to this true Dhamma: With this much, the concise teaching is concluded.
Với lời dạy ujugatāssa…pe… imaṃ saddhamma (cái thấy của vị ấy ngay thẳng... đã đến với Chánh Pháp này), sự thuyết giảng tóm tắt đã kết thúc.
Desanāyeva cesā saṃkhittā, tesaṃ pana bhikkhūnaṃ vitthāravaseneva sammāmanasikārappaṭivedho veditabbo.
And this teaching is concise, but for those bhikkhus, the right attention and penetration should be understood as being in detail.
Chỉ là sự thuyết giảng được tóm tắt, nhưng sự thâm nhập bằng tác ý đúng đắn (sammāmanasikārappaṭivedho) của các Tỳ-khưu ấy phải được hiểu là đã được giải thích chi tiết.
Dutiyavāre pana desanāpi vitthārena manasikārappaṭivedhopi vitthāreneva vuttoti veditabbo.
In the second section, however, it should be understood that both the teaching and the attention and penetration are stated in detail.
Tuy nhiên, trong trường hợp thứ hai, cả sự thuyết giảng (desanāpi) và sự thâm nhập bằng tác ý (manasikārappaṭivedhopi) đều được nói đến một cách chi tiết.
Tattha ‘‘saṃkhittadesanāya dve heṭṭhimamaggā, vitthāradesanāya dve uparimamaggā kathitā’’ti bhikkhū āhaṃsu vitthāradesanāvasāne ‘‘sabbaso rāgānusayaṃ pahāyā’’tiādivacanaṃ sampassamānā.
Therein, the bhikkhus said, "In the concise teaching, the two lower paths are taught; in the detailed teaching, the two higher paths are taught," seeing the words at the end of the detailed teaching, such as "having completely abandoned the underlying tendency to lust."
Ở đó, các Tỳ-khưu nói rằng: "Trong sự thuyết giảng tóm tắt, hai Thánh đạo thấp hơn đã được nói đến; trong sự thuyết giảng chi tiết, hai Thánh đạo cao hơn đã được nói đến," khi họ xem xét lời dạy "đã từ bỏ hoàn toàn tùy miên tham ái" (sabbaso rāgānusayaṃ pahāyā) và những lời tương tự ở cuối phần thuyết giảng chi tiết.
Thero panāha ‘‘saṃkhittadesanāyapi cattāro maggā rāsito kathitā, vitthāradesanāyapī’’ti.
But the Elder said, "In the concise teaching also, the four paths are taught collectively, and in the detailed teaching as well."
Nhưng vị Trưởng lão nói: "Trong sự thuyết giảng tóm tắt, bốn Thánh đạo đã được nói đến một cách tổng quát; và trong sự thuyết giảng chi tiết cũng vậy."
Yā cāyaṃ idha saṃkhittavitthāradesanāsu vicāraṇā āvikatā, sā sabbavāresu idha vuttanayeneva veditabbā.
And this investigation into the concise and detailed teachings that has been revealed here should be understood in all sections in the way stated here.
Và sự phân tích (vicāraṇā) về sự thuyết giảng tóm tắt và chi tiết được trình bày ở đây, phải được hiểu theo cách đã nói ở đây trong tất cả các trường hợp.
Apubbānuttānapadavaṇṇanāmattameva hi ito paraṃ karissāma.
For from now on, we shall only provide a commentary on terms that have not previously appeared or been explained.
Từ đây trở đi, chúng ta sẽ chỉ giải thích những từ ngữ mới và chưa rõ ràng.
Tattha paṭhamavārassa tāva vitthāradesanāya ‘‘pāṇātipāto kho, āvuso, akusala’’ntiādīsu akosallappavattiyā akusalaṃ veditabbaṃ, parato vattabbakusalappaṭipakkhato vā.
Therein, in the detailed teaching of the first section, in passages such as "The destruction of life, friends, is unwholesome," the unwholesome should be understood as arising from unskillfulness, or as the opposite of the wholesome, which will be discussed later.
Trong đó, đối với phần thuyết giảng chi tiết của trường hợp thứ nhất, trong các câu như "Này các hiền giả, sát sinh (pāṇātipāto) là bất thiện (akusala)", bất thiện (akusala) phải được hiểu là sự không khéo léo (akosallappavattiyā), hoặc là đối nghịch với thiện (kusalappaṭipakkhato) sẽ được nói đến sau.
Taṃ lakkhaṇato sāvajjadukkhavipākaṃ saṃkiliṭṭhaṃ vā.
By characteristic, it is blameworthy, has painful results, or is defiled.
Đặc tính của nó là có tội lỗi, quả khổ, hoặc là ô nhiễm.
Ayaṃ tāvettha sādhāraṇapadavaṇṇanā.
This, first, is the commentary on the general terms here.
Đây là phần giải thích chung cho các từ ngữ.
Asādhāraṇesu pana pāṇassa atipāto pāṇātipāto, pāṇavadho pāṇaghātoti vuttaṃ hoti.
Among the specific terms, however, the destruction of a living being is destruction of life; it means the killing of a living being, the slaying of a living being.
Đối với những từ ngữ không chung, sát sinh (pāṇātipāto) là sự giết hại sinh vật (pāṇassa atipāto), có nghĩa là giết chết sinh vật (pāṇavadho) hay làm hại sinh vật (pāṇaghāto).
Pāṇoti cettha vohārato satto, paramatthato jīvitindriyaṃ.
Herein, a living being is, in conventional terms, a creature; in ultimate terms, it is the life faculty.
Ở đây, sinh vật (pāṇo) theo cách nói thông thường là chúng sinh (satto), theo nghĩa tối hậu là sinh mạng quyền (jīvitindriyaṃ).
Tasmiṃ pana pāṇe pāṇasaññino jīvitindriyupacchedakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā vadhakacetanā pāṇātipāto.
Now, with regard to that living being, the volition to kill, occurring through one of the two doors of body or speech, which originates the effort that severs the life faculty of one who perceives it as a living being, is destruction of life.
Khi có nhận thức về sinh vật (pāṇasaññino) đối với sinh vật đó, thì sự sát sinh (pāṇātipāto) là ý muốn giết hại (vadhakacetanā) phát sinh từ một trong hai cửa thân (kāya) hoặc khẩu (vacī), gây ra hành động cắt đứt sinh mạng quyền (jīvitindriyupacchedakaupakkamasamuṭṭhāpikā).
So guṇavirahitesu tiracchānagatādīsu pāṇesu khuddake pāṇe appasāvajjo, mahāsarīre mahāsāvajjo.
That act, when directed towards living beings devoid of virtue, such as animals, is of little blame if the being is small, and of great blame if it has a large body.
Sự sát sinh đó đối với các sinh vật thiếu phẩm hạnh như loài súc sinh, sinh vật nhỏ thì tội lỗi ít (appasāvajjo), sinh vật có thân lớn thì tội lỗi nhiều (mahāsāvajjo).
Payogamahantatāya.
Because of the greatness of the effort.
Vì sự lớn lao của hành động (payogamahantatāya).
Payogasamattepi vatthumahantatāya.
Even when the effort is the same, because of the greatness of the object.
Ngay cả khi hành động tương đương, thì vì sự lớn lao của đối tượng (vatthumahantatāya).
Guṇavantesu manussādīsu appaguṇe pāṇe appasāvajjo, mahāguṇe mahāsāvajjo.
When directed towards virtuous beings, such as humans, it is of little blame if the being has little virtue, and of great blame if it has great virtue.
Đối với các sinh vật có phẩm hạnh như con người, sinh vật có ít phẩm hạnh thì tội lỗi ít, sinh vật có nhiều phẩm hạnh thì tội lỗi nhiều.
Sarīraguṇānaṃ pana samabhāve sati kilesānaṃ upakkamānañca mudutāya appasāvajjo, tibbatāya mahāsāvajjoti veditabbo.
But when the body and virtue are equal, it should be understood that it is of little blame if the defilements and the effort are weak, and of great blame if they are strong.
Khi phẩm hạnh của thân tương đương, thì do phiền não và hành động nhẹ nhàng, tội lỗi ít; do phiền não và hành động mãnh liệt, tội lỗi nhiều. Phải hiểu như vậy.
Tassa pañca sambhārā honti pāṇo, pāṇasaññitā, vadhakacittaṃ, upakkamo, tena maraṇanti.
It has five components: a living being, the perception of a living being, the intention to kill, the effort, and the resulting death.
Có năm yếu tố cấu thành (sambhārā) của nó: sinh vật (pāṇo), nhận thức về sinh vật (pāṇasaññitā), ý muốn giết hại (vadhakacittaṃ), hành động (upakkamo), và cái chết do hành động đó (tena maraṇaṃ).
Cha payogā sāhatthiko, āṇattiko, nissaggiyo, thāvaro, vijjāmayo, iddhimayoti.
There are six kinds of effort: by one's own hand, by command, by missile, by fixed trap, by magical incantation, and by psychic power.
Có sáu phương pháp (payogā): tự tay làm (sāhatthiko), ra lệnh (āṇattiko), vứt bỏ (nissaggiyo), cố định (thāvaro), bằng thần chú (vijjāmayo), bằng thần thông (iddhimayoti).
Imasmiṃ panettha vitthārīyamāne atipapañco hoti, tasmā naṃ na vitthārayāma, aññañca evarūpaṃ.
If this were to be elaborated on here, it would become too diffuse; therefore, we will not elaborate on it, nor on anything else of this kind.
Nếu giải thích chi tiết điều này ở đây sẽ trở nên quá dài dòng, vì vậy chúng tôi sẽ không giải thích chi tiết nó, cũng như những điều tương tự khác.
Atthikehi pana samantapāsādikaṃ vinayaṭṭhakathaṃ (pārā. aṭṭha. 2.172) oloketvā gahetabbo.
But those who are interested should look it up in the Samantapāsādikā, the commentary on the Vinaya.
Những ai quan tâm có thể tham khảo trong Samantapāsādikā Vinayaṭṭhakathā.
Adinnassa ādānaṃ adinnādānaṃ, parassa haraṇaṃ theyyaṃ, corikāti vuttaṃ hoti.
The taking of what is not given is taking what is not given; it means the carrying away of another's property, theft, robbery.
Lấy của không cho (adinnassa ādānaṃ) là trộm cắp (adinnādānaṃ), có nghĩa là lấy đi của người khác, hành vi trộm cắp.
Tattha adinnanti parapariggahitaṃ, yattha paro yathākāmakāritaṃ āpajjanto adaṇḍāraho anupavajjo ca hoti.
Therein, what is not given means what is possessed by another, regarding which another person, having the freedom to do as they wish, would be free from punishment and blame.
Ở đây, của không cho (adinnaṃ) là tài sản của người khác (parapariggahitaṃ), mà người khác có quyền tự do sử dụng mà không bị trừng phạt hay khiển trách.
Tasmiṃ pana parapariggahite parapariggahitasaññino tadādāyakaupakkamasamuṭṭhāpikā theyyacetanā adinnādānaṃ.
Now, with regard to that which is possessed by another, the volition to steal, which originates the effort to take it by one who perceives it as possessed by another, is taking what is not given.
Khi có nhận thức rằng đó là tài sản của người khác (parapariggahitasaññino) đối với tài sản của người khác đó, thì trộm cắp (adinnādānaṃ) là ý muốn trộm cắp (theyyacetanā) phát sinh từ hành động lấy đi tài sản đó (tadādāyakaupakkamasamuṭṭhāpikā).
Taṃ hīne parasantake appasāvajjaṃ, paṇīte mahāsāvajjaṃ.
That act is of little blame if the property of another is of low value, and of great blame if it is of high value.
Hành vi đó đối với tài sản thấp kém của người khác thì tội lỗi ít (appasāvajjaṃ), đối với tài sản quý giá thì tội lỗi nhiều (mahāsāvajjaṃ).
Vatthupaṇītatāya.
Because of the high value of the object.
Vì sự quý giá của tài sản (vatthupaṇītatāya).
Vatthusamatte sati guṇādhikānaṃ santake vatthusmiṃ mahāsāvajjaṃ.
When the object is of equal value, it is of great blame if the object belongs to those of superior virtue.
Ngay cả khi tài sản tương đương, thì đối với tài sản của những người có phẩm hạnh cao hơn, tội lỗi nhiều.
Taṃ taṃ guṇādhikaṃ upādāya tato tato hīnaguṇassa santake vatthusmiṃ appasāvajjaṃ.
In relation to that person of superior virtue, it is of little blame if the object belongs to one of lesser virtue than that.
Tùy thuộc vào phẩm hạnh cao hơn đó, đối với tài sản của những người có phẩm hạnh thấp hơn, tội lỗi ít.
Tassa pañca sambhārā honti parapariggahitaṃ, parapariggahitasaññitā, theyyacittaṃ, upakkamo, tena haraṇanti.
It has five components: the property of another, the perception that it is the property of another, the intention to steal, the effort, and the taking away by that means.
Có năm yếu tố cấu thành (sambhārā) của nó: tài sản của người khác (parapariggahitaṃ), nhận thức về tài sản của người khác (parapariggahitasaññitā), ý muốn trộm cắp (theyyacittaṃ), hành động (upakkamo), và việc lấy đi tài sản đó (tena haraṇanti).
Cha payogā sāhatthikādayova.
There are six kinds of effort, namely, by one's own hand and so on.
Có sáu phương pháp (payogā) như tự tay làm, v.v.
Te ca kho yathānurūpaṃ theyyāvahāro, pasayhāvahāro, paṭicchannāvahāro, parikappāvahāro, kusāvahāroti imesaṃ avahārānaṃ vasena pavattāti ayamettha saṅkhepo.
And these proceed, according to the circumstances, by means of these ways of carrying away: carrying away by theft, carrying away by force, carrying away by concealment, carrying away by false measure, and carrying away by fraudulent lot—this is the summary here.
Tóm lại, những hành vi này xảy ra tùy theo các loại trộm cắp như trộm cắp tài sản (theyyāvahāro), cướp giật (pasayhāvahāro), trộm cắp lén lút (paṭicchannāvahāro), trộm cắp bằng mưu kế (parikappāvahāro), trộm cắp bằng cách lừa gạt (kusāvahāroti).
Vitthāro pana samantapāsādikāyaṃ (pārā. aṭṭha. 1.92) vutto.
The detailed explanation, however, is given in the Samantapāsādikā.
Tuy nhiên, phần giải thích chi tiết đã được trình bày trong bộ Samantapāsādikā.
Tattha agamanīyaṭṭhānaṃ nāma purisānaṃ tāva māturakkhitā, piturakkhitā, mātāpiturakkhitā, bhāturakkhitā, bhaginirakkhitā, ñātirakkhitā, gottarakkhitā, dhammarakkhitā, sārakkhā, saparidaṇḍāti māturakkhitādayo dasa; dhanakkītā, chandavāsinī, bhogavāsinī, paṭavāsinī, odapattakinī, obhaṭacumbaṭā, dāsī ca bhariyā ca, kammakārī ca bhariyā ca, dhajāhatā, muhuttikāti etā ca dhanakkītādayo dasāti vīsati itthiyo.
Therein, an illicit partner for men, firstly, are ten types of women: one protected by her mother, one protected by her father, one protected by her mother and father, one protected by her brother, one protected by her sister, one protected by her relatives, one protected by her clan, one protected by the Dhamma, one with a guardian, and one who is betrothed; and ten other types: one bought with wealth, one living willingly, one living for wealth, one living for clothing, one ritually accepted, one taken from a water pot, one who is both a slave and a wife, one who is both a worker and a wife, one captured in war, and a temporary wife—thus there are twenty types of women.
Trong đó, những nơi không nên đến (agamanīyaṭṭhāna) đối với nam giới là mười loại phụ nữ được bảo vệ bởi mẹ, bởi cha, bởi cha mẹ, bởi anh em, bởi chị em, bởi bà con, bởi gia tộc, bởi pháp, những người có phòng hộ, và những người bị trừng phạt; và mười loại phụ nữ khác như người được mua bằng tiền, người sống theo ý muốn, người sống nhờ tài sản, người sống nhờ y phục, người đã nhúng tay vào bát nước, người đã đội khăn lên đầu, người nô tì và là vợ, người làm công và là vợ, người bị bắt làm tù binh, và người vợ tạm thời – tổng cộng là hai mươi loại phụ nữ.
Itthīsu pana dvinnaṃ sārakkhāsaparidaṇḍānaṃ, dasannañca dhanakkītādīnanti dvādasannaṃ itthīnaṃ aññe purisā, idaṃ agamanīyaṭṭhānaṃ nāma.
For women, however, other men are an illicit partner with respect to the twelve types of women: the two with a guardian and who are betrothed, and the ten who are bought with wealth and so on.
Đối với phụ nữ, những người đàn ông khác ngoài chồng của họ là những nơi không nên đến đối với mười hai loại phụ nữ: hai loại có phòng hộ và bị trừng phạt, và mười loại bắt đầu từ người được mua bằng tiền.
So panesa micchācāro sīlādiguṇarahite agamanīyaṭṭhāne appasāvajjo, sīlādiguṇasampanne mahāsāvajjo.
This wrong conduct is slightly blameworthy in the case of an illicit partner who is devoid of qualities such as virtue, and greatly blameworthy in one endowed with qualities such as virtue.
Tà hạnh này ít tội lỗi nếu diễn ra ở nơi không nên đến mà thiếu các phẩm chất như giới, và rất tội lỗi nếu diễn ra ở nơi không nên đến mà có đầy đủ các phẩm chất như giới.
Tassa cattāro sambhārā agamanīyavatthu, tasmiṃ sevanacittaṃ, sevanapayogo, maggenamaggappaṭipattiadhivāsananti.
Its four components are: an illicit object, the thought of engaging with it, the effort of engaging, and the consenting to the union of the paths.
Nó có bốn yếu tố cấu thành: đối tượng không nên đến (phụ nữ), ý muốn giao cấu với đối tượng đó, sự thực hành giao cấu, và sự chấp nhận việc vượt qua giới hạn qua đường đạo.
Eko payogo sāhatthiko eva.
There is only one kind of effort: that done by oneself.
Chỉ có một loại thực hành là tự mình thực hiện.
Musāti visaṃvādanapurekkhārassa atthabhañjako vacīpayogo kāyapayogo vā.
Falsehood is a verbal or bodily effort that destroys another's welfare, with the intention to deceive.
Musā (nói dối) là hành vi lời nói hoặc hành vi thân thể làm tổn hại lợi ích của người khác với ý đồ lừa dối.
Visaṃvādanādhippāyena panassa paravisaṃvādanakakāyavacīpayogasamuṭṭhāpikā cetanā musāvādo.
With the intention to deceive, the volition that gives rise to the bodily or verbal effort to deceive another is false speech.
Ý muốn lừa dối người khác, phát sinh từ hành vi thân thể hoặc lời nói nhằm lừa dối, đó chính là musāvādo (nói dối).
Aparo nayo musāti abhūtaṃ atacchaṃ vatthu.
Another way: ‘falsehood’ is an unreal, untrue matter.
Một cách giải thích khác: Musā là sự việc không có thật, không đúng sự thật.
Vādoti tassa bhūtato tacchato viññāpanaṃ.
‘Speech’ is the communicating of it as real and true.
Vādo (lời nói) là việc làm cho người khác biết sự việc đó là có thật, là đúng sự thật.
Lakkhaṇato pana atathaṃ vatthuṃ tathato paraṃ viññāpetukāmassa tathāviññattisamuṭṭhāpikā cetanā musāvādo.
By characteristic, however, false speech is the volition that gives rise to the communication for one who wishes to make another know an untrue matter as true.
Theo đặc tính, musāvādo là ý muốn làm cho người khác biết một sự việc không đúng sự thật là đúng sự thật, phát sinh từ sự biểu hiện như vậy.
So yamatthaṃ bhañjati, tassa appatāya appasāvajjo, mahantatāya mahāsāvajjo.
According to the welfare it destroys, it is slightly blameworthy if it is small, and greatly blameworthy if it is great.
Lời nói dối này ít tội lỗi nếu làm tổn hại một lợi ích nhỏ, và rất tội lỗi nếu làm tổn hại một lợi ích lớn.
Apica gahaṭṭhānaṃ attano santakaṃ adātukāmatāya natthītiādinayappavatto appasāvajjo, sakkhinā hutvā atthabhañjanatthaṃ vutto mahāsāvajjo.
Furthermore, for householders, it is slightly blameworthy when, out of unwillingness to give their own property, they say, "There is none," and so forth; it is greatly blameworthy when spoken as a witness to destroy another's welfare.
Hơn nữa, đối với gia chủ, lời nói dối như "không có" khi không muốn cho tài sản của mình, thì ít tội lỗi; nhưng lời nói dối được nói ra với tư cách là nhân chứng để làm tổn hại lợi ích thì rất tội lỗi.
Pabbajitānaṃ appakampi telaṃ vā sappiṃ vā labhitvā hasādhippāyena ‘‘ajja gāme telaṃ nadīmaññe sandatī’’ti purāṇakathānayena pavatto appasāvajjo, adiṭṭhaṃyeva pana diṭṭhantiādinā nayena vadantānaṃ mahāsāvajjo.
For the ordained, after receiving even a little oil or ghee, it is slightly blameworthy if spoken in jest, in the manner of an old tale, such as, "Today, oil is flowing like a river in the village"; but it is greatly blameworthy for those who speak in a way such as declaring what was not seen as seen.
Đối với người xuất gia, việc nhận được một ít dầu hoặc bơ rồi nói đùa theo cách nói chuyện cũ rằng "hôm nay trong làng, dầu chảy như sông", thì ít tội lỗi; nhưng việc nói những điều chưa thấy là đã thấy, v.v., thì rất tội lỗi.
Tassa cattāro sambhārā honti atathaṃ vatthu, visaṃvādanacittaṃ, tajjo vāyāmo, parassa tadatthavijānananti.
It has four components: an untrue matter, the intention to deceive, the effort arising from it, and the other person's understanding of that meaning.
Nó có bốn yếu tố cấu thành: sự việc không đúng sự thật, ý muốn lừa dối, nỗ lực tương ứng, và việc người khác hiểu được ý nghĩa đó.
Eko payogo sāhatthikova.
There is only one kind of effort: that done by oneself.
Chỉ có một loại thực hành là tự mình thực hiện.
So kāyena vā kāyappaṭibaddhena vā vācāya vā visaṃvādakakiriyākaraṇe daṭṭhabbo.
This should be understood as occurring through the body, through something connected to the body, or through speech, by performing a deceptive action.
Điều này cần được hiểu là hành vi lừa dối được thực hiện bằng thân, bằng vật liên quan đến thân, hoặc bằng lời nói.
Tāya ce kiriyāya paro tamatthaṃ jānāti, ayaṃ kiriyāsamuṭṭhāpikacetanākkhaṇeyeva musāvādakammunā bajjhati.
If by that action the other person understands that meaning, one is bound by the kamma of false speech at the very moment of the volition that gave rise to the action.
Nếu người khác hiểu được ý nghĩa đó qua hành vi ấy, thì người đó bị ràng buộc bởi nghiệp nói dối ngay tại khoảnh khắc ý muốn phát sinh hành vi đó.
Pisuṇā vācātiādīsu yāya vācāya yassa taṃ vācaṃ bhāsati, tassa hadaye attano piyabhāvaṃ parassa ca suññabhāvaṃ karoti, sā pisuṇā vācā.
In ‘slanderous speech,’ etc., the speech by which, when spoken to someone, one creates a feeling of affection for oneself and a feeling of emptiness toward another in that person's heart, is slanderous speech.
Trong các loại như pisuṇā vācā (lời nói chia rẽ), lời nói nào khi nói với ai đó, làm cho người đó cảm thấy mình được yêu mến và người kia bị xa lánh, đó là pisuṇā vācā.
Yāya pana attānampi parampi pharusampi karoti, sā vācā sayampi pharusā neva kaṇṇasukhā na hadayasukhā vā, ayaṃ pharusā vācā.
But the speech that makes both oneself and another harsh, and that speech which is itself harsh, being pleasant neither to the ear nor to the heart—this is harsh speech.
Còn lời nói nào làm cho cả mình và người khác trở nên thô bạo, lời nói đó tự nó đã thô bạo, không êm tai, cũng không an lòng, đó là pharusā vācā (lời nói thô ác).
Yena samphaṃ palapati niratthakaṃ, so samphappalāpo.
That by which one prattles frivolously and uselessly is idle chatter.
Lời nói vô ích, vô nghĩa mà người ta nói, đó là samphappalāpo (lời nói vô ích).
Tesaṃ mūlabhūtā cetanāpi pisuṇāvācādināmameva labhati, sā eva ca idha adhippetāti.
The underlying volition for these also receives the name ‘slanderous speech,’ etc., and that is what is intended here.
Ý muốn căn bản của những lời nói này cũng được gọi là pisuṇāvācā, v.v., và chính ý muốn đó được đề cập ở đây.
Tattha saṃkiliṭṭhacittassa paresaṃ vā bhedāya attano piyakamyatāya vā kāyavacīpayogasamuṭṭhāpikā cetanā pisuṇā vācā.
In that context, the volition of a person with a defiled mind that gives rise to bodily or verbal effort, either to divide others or out of a desire for their own affection, is slanderous speech.
Trong đó, pisuṇā vācā là ý muốn phát sinh từ hành vi thân thể hoặc lời nói, của một tâm ô nhiễm, nhằm chia rẽ người khác hoặc nhằm làm cho mình được yêu mến.
Sā yassa bhedaṃ karoti, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
It is slightly blameworthy if the person being divided has few good qualities, and greatly blameworthy if they have great qualities.
Lời nói chia rẽ này ít tội lỗi nếu người bị chia rẽ có ít phẩm chất, và rất tội lỗi nếu người bị chia rẽ có nhiều phẩm chất.
Tassā cattāro sambhārā bhinditabbo paro, ‘‘iti ime nānā bhavissanti vinā bhavissantī’’ti bhedapurekkhāratā vā, ‘‘ahaṃ piyo bhavissāmi vissāsiko’’ti piyakamyatā vā, tajjo vāyāmo, tassa tadatthavijānananti.
Its four components are: another person who can be divided; the intention to divide, such as, "Thus they will be separated, they will be apart," or the desire for affection, such as, "I will be dear, I will be trusted"; the effort arising from it; and that person's understanding of its meaning.
Nó có bốn yếu tố cấu thành: người bị chia rẽ, ý đồ chia rẽ ("họ sẽ trở nên xa cách nhau, họ sẽ chia lìa nhau") hoặc ý muốn được yêu mến ("tôi sẽ được yêu mến, được tin cậy"), nỗ lực tương ứng, và việc người kia hiểu được ý nghĩa đó.
Parassa mammacchedakakāyavacīpayogasamuṭṭhāpikā ekantapharusā cetanā pharusā vācā.
Harsh speech is the utterly harsh volition that gives rise to bodily or verbal effort that pierces another's heart.
Pharusā vācā là ý muốn hoàn toàn thô bạo, phát sinh từ hành vi thân thể hoặc lời nói làm tổn thương sâu sắc người khác.
Tassa āvibhāvatthamidaṃ vatthu – eko kira dārako mātuvacanaṃ anādiyitvā araññaṃ gacchati, taṃ mātā nivattetuṃ asakkontī ‘‘caṇḍā taṃ mahiṃsī anubandhatū’’ti akkosi.
To illustrate this, there is a story: A certain boy, not heeding his mother's words, goes to the forest. His mother, unable to make him return, cursed him, saying, "May a fierce buffalo chase you."
Để làm rõ điều này, có một câu chuyện như sau: Có một cậu bé không nghe lời mẹ mà đi vào rừng. Người mẹ không thể ngăn cản được, bèn nguyền rủa: "Mong con trâu cái hung dữ đuổi theo con!"
Athassa tattheva araññe mahiṃsī uṭṭhāsi.
Then, right there in the forest, a buffalo rose up before him.
Thế rồi, một con trâu cái xuất hiện ngay trong rừng.
Dārako ‘‘yaṃ mama mātā mukhena kathesi taṃ mā hotu, yaṃ cittena cintesi taṃ hotū’’ti saccakiriyamakāsi.
The boy made an act of truth, saying, "May what my mother spoke with her mouth not come to be, but may what she thought in her mind come to be."
Cậu bé lập lời chân thật rằng: "Điều mẹ con nói bằng miệng, xin đừng xảy ra. Điều mẹ con nghĩ trong tâm, xin hãy xảy ra."
Mahiṃsī tattheva baddhā viya aṭṭhāsi.
The buffalo stood right there as if bound.
Con trâu cái liền đứng yên như bị trói tại chỗ.
Evaṃ mammacchedakopi payogo cittasaṇhatāya pharusā vācā na hoti.
Thus, even an effort that pierces the heart is not harsh speech if the mind is gentle.
Như vậy, ngay cả một hành vi làm tổn thương sâu sắc cũng không phải là lời nói thô ác nếu tâm ý dịu dàng.
Mātāpitaro hi kadāci puttake evampi vadanti ‘‘corā vo khaṇḍākhaṇḍikaṃ karontū’’ti, uppalapattampi ca nesaṃ upari patantaṃ na icchanti.
Indeed, parents sometimes say such things to their children as, "May thieves cut you to pieces," yet they would not wish even a lotus petal to fall upon them.
Cha mẹ đôi khi cũng nói với con cái rằng: "Mong lũ cướp chặt các con thành từng mảnh!", nhưng họ không hề muốn ngay cả một cánh sen rơi trên người con.
Ācariyupajjhāyā ca kadāci nissitake evaṃ vadanti ‘‘kiṃ ime ahirikā anottappino caranti niddhamatha ne’’ti.
And teachers and preceptors sometimes say this of their pupils: "Why do these shameless and reckless ones wander about? Expel them."
Các vị thầy và thầy tế độ đôi khi cũng nói với các đệ tử rằng: "Tại sao những kẻ vô liêm sỉ, không biết hổ thẹn này lại đi lang thang? Hãy đuổi chúng đi!"
Atha kho nesaṃ āgamādhigamasampattiṃ icchanti.
Yet they wish for their attainment in learning and realization.
Thế nhưng, họ lại mong muốn các đệ tử đạt được thành tựu trong học vấn và chứng đắc.
Yathā ca cittasaṇhatāya pharusā vācā na hoti, evaṃ vacanasaṇhatāya apharusā vācāpi na hoti.
And just as it is not harsh speech when the mind is gentle, so too it is not non-harsh speech when the words are gentle.
Cũng như lời nói thô ác không phải là thô ác nếu tâm ý dịu dàng, thì lời nói dịu dàng cũng không phải là không thô ác nếu tâm ý thô bạo.
Na hi mārāpetukāmassa ‘‘imaṃ sukhaṃ sayāpethā’’ti vacanaṃ apharusā vācā hoti.
For one who wishes to have another killed, the words "Let this one sleep peacefully" are not non-harsh speech.
Lời nói "Hãy cho người này ngủ yên bình" không phải là lời nói không thô ác đối với người muốn giết hại.
Cittapharusatāya panesā pharusā vācāva.
Due to the harshness of the mind, it is indeed harsh speech.
Mà lời nói này chính là lời nói thô ác do tâm ý thô bạo.
Sā yaṃ sandhāya pavattitā, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
It is slightly blameworthy if the person to whom it is directed has few good qualities, and greatly blameworthy if they have great qualities.
Lời nói này ít tội lỗi nếu người bị nhắm đến có ít phẩm chất, và rất tội lỗi nếu người bị nhắm đến có nhiều phẩm chất.
Tassā tayo sambhārā akkositabbo paro, kupitacittaṃ, akkosanāti.
Its three components are: another person to be reviled, an angered mind, and the act of reviling.
Nó có ba yếu tố cấu thành: người bị mắng chửi, tâm sân hận, và hành vi mắng chửi.
Abhijjhāyatīti abhijjhā, parabhaṇḍābhimukhī hutvā tanninnatāya pavattatīti attho.
It covets, thus it is covetousness; the meaning is that it arises directed towards another's property, with an inclination for it.
Abhijjhāyati có nghĩa là abhijjhā (tham lam), tức là hướng về tài sản của người khác và phát sinh với ý muốn chiếm hữu.
Sā ‘‘aho vata idaṃ mamassā’’ti evaṃ parabhaṇḍābhijjhāyanalakkhaṇā.
Its characteristic is coveting another's property in this way: "Oh, that this were mine!"
Nó có đặc tính là tham lam tài sản của người khác, với ý nghĩ "Ôi, ước gì cái này là của mình!"
Adinnādānaṃ viya appasāvajjā ca mahāsāvajjā ca.
Like taking what is not given, it can be slightly blameworthy or greatly blameworthy.
Nó cũng ít tội lỗi và rất tội lỗi như việc lấy của không cho.
Tassā dve sambhārā parabhaṇḍaṃ, attano pariṇāmanañca.
Its two components are: another's property, and appropriating it to oneself.
Nó có hai yếu tố cấu thành: tài sản của người khác, và việc biến nó thành của mình.
Parabhaṇḍavatthuke hi lobhe uppannepi na tāva kammapathabhedo hoti, yāva ‘‘aho vatīdaṃ mamassā’’ti attano na pariṇāmeti.
For even when greed arises concerning another's property, the course of kamma is not broken until one appropriates it to oneself, thinking, "Oh, that this were mine!"
Thật vậy, ngay cả khi lòng tham phát sinh đối với tài sản của người khác, con đường nghiệp vẫn chưa bị phá vỡ cho đến khi người ta nghĩ "Ôi, ước gì cái này là của mình!" và biến nó thành của mình.
Hitasukhaṃ byāpādayatīti byāpādo.
It destroys well-being and happiness, thus it is ill will.
Hành vi làm tổn hại hạnh phúc của người khác được gọi là byāpādo (ác ý).
So paravināsāya manopadosalakkhaṇo, pharusā vācā viya appasāvajjo mahāsāvajjo ca.
Its characteristic is mental corruption for the destruction of another; like harsh speech, it can be slightly or greatly blameworthy.
Nó có đặc tính là tâm ý xấu xa nhằm hủy hoại người khác, và cũng ít tội lỗi hay rất tội lỗi như lời nói thô ác.
Tassa dve sambhārā parasatto ca, tassa ca vināsacintā.
Its two components are: another being, and the thought of their destruction.
Nó có hai yếu tố cấu thành: người khác, và ý nghĩ hủy hoại người đó.
Parasattavatthuke hi kodhe uppannepi na tāva kammapathabhedo hoti, yāva ‘‘aho vatāyaṃ ucchijjeyya vinasseyyā’’ti tassa vināsaṃ na cinteti.
Indeed, even when anger with another being as its object has arisen, a breach of the course of kamma does not yet occur so long as one does not contemplate that being’s destruction, thinking: “Oh, may this one be cut off, may this one perish!”
Thật vậy, khi cơn giận nổi lên đối với một chúng sanh khác, thì nghiệp đạo chưa thành tựu cho đến khi người ấy chưa nghĩ đến sự hủy diệt của chúng sanh đó, rằng: “Ôi! Ước gì người này bị tiêu diệt, bị hủy hoại!”
Yathābhuccagahaṇābhāvena micchā passatīti micchādiṭṭhi.
It sees wrongly through the absence of grasping things as they truly are; thus, it is wrong view.
Vì thấy sai lầm do không nắm bắt được sự thật, nên gọi là tà kiến (micchādiṭṭhi).
Sā ‘‘natthi dinna’’ntiādinā nayena viparītadassanalakkhaṇā.
It has the characteristic of perverse seeing, in the manner of “There is nothing given,” and so on.
Tà kiến đó có đặc tính là thấy sai lệch theo cách như: “Không có bố thí,” v.v.
Samphappalāpo viya appasāvajjā mahāsāvajjā ca.
Like frivolous speech, it can be of minor fault and of major fault.
Cũng như lời nói phù phiếm (samphappalāpa), có thể là tội nhẹ hoặc tội nặng.
Apica aniyatā appasāvajjā, niyatā mahāsāvajjā.
Moreover, the non-fixed wrong view is of minor fault; the fixed wrong view is of major fault.
Hơn nữa, tà kiến bất định (aniyatā) là tội nhẹ, tà kiến cố định (niyatā) là tội nặng.
Tassā dve sambhārā vatthuno ca gahitākāraviparītatā, yathā ca taṃ gaṇhāti, tathābhāvena tassupaṭṭhānanti.
Its two components are the perversity of the object and the mode in which it is grasped, and its appearance in accordance with how it is grasped.
Tà kiến có hai yếu tố: sự sai lệch trong cách nắm bắt đối tượng, và sự hiện hữu của đối tượng theo cách mà người ấy nắm bắt.
Koṭṭhāsatoti paṭipāṭiyā satta, micchādiṭṭhi cāti ime aṭṭha kammapathā eva honti, no mūlāni.
In terms of category: the first seven in sequence and wrong view—these eight are only courses of kamma, not roots.
Về phần, bảy nghiệp đầu tiên theo thứ tự và tà kiến (micchādiṭṭhi) – tám nghiệp này chỉ là nghiệp đạo (kammapatha), không phải là căn bản (mūla).
Abhijjhābyāpādā kammapathā ceva mūlāni ca.
Covetousness and ill will are both courses of kamma and roots.
Tham lam và sân hận (abhijjhābyāpādā) vừa là nghiệp đạo vừa là căn bản.
Abhijjhā hi mūlaṃ patvā lobho akusalamūlaṃ hoti.
Indeed, covetousness, when it reaches the level of a root, becomes greed, an unwholesome root.
Thật vậy, tham lam khi đạt đến cấp độ căn bản thì trở thành tham ái (lobha), là căn bản bất thiện.
Byāpādo doso akusalamūlaṃ.
Ill will becomes hatred, an unwholesome root.
Sân hận (byāpāda) là sân (dosa), là căn bản bất thiện.
Ārammaṇatoti pāṇātipāto jīvitindriyārammaṇato saṅkhārārammaṇo hoti.
In terms of object: destroying life has formations as its object, due to its object being the life faculty.
Về đối tượng, sát sanh (pāṇātipāta) có đối tượng là sinh mạng (jīvitindriya), là đối tượng của các hành (saṅkhārārammaṇa).
Adinnādānaṃ sattārammaṇaṃ vā saṅkhārārammaṇaṃ vā.
Taking what is not given has either a being or formations as its object.
Trộm cắp (adinnādāna) có đối tượng là chúng sanh (sattārammaṇa) hoặc đối tượng của các hành (saṅkhārārammaṇa).
Micchācāro phoṭṭhabbavasena saṅkhārārammaṇo.
Sexual misconduct has formations as its object, by way of the tangible object.
Tà dâm (micchācāra) có đối tượng là các hành (saṅkhārārammaṇa) theo phương diện xúc chạm.
Sattārammaṇotipi eke.
Some say it has a being as its object.
Một số vị nói rằng nó cũng có đối tượng là chúng sanh (sattārammaṇa).
Musāvādo sattārammaṇo vā saṅkhārārammaṇo vā.
False speech has either a being or formations as its object.
Nói dối (musāvāda) có đối tượng là chúng sanh (sattārammaṇa) hoặc đối tượng của các hành (saṅkhārārammaṇa).
Tathā pisuṇā vācā.
Likewise for slanderous speech.
Tương tự, nói lời đâm thọc (pisuṇā vācā).
Pharusā vācā sattārammaṇāva.
Harsh speech has only a being as its object.
Nói lời thô ác (pharusā vācā) chỉ có đối tượng là chúng sanh (sattārammaṇa).
Samphappalāpo diṭṭhasutamutaviññātavasena sattārammaṇo vā saṅkhārārammaṇo vā, tathā abhijjhā.
Frivolous speech has either a being or formations as its object, by way of what is seen, heard, sensed, or cognized; likewise for covetousness.
Nói lời phù phiếm (samphappalāpa) có đối tượng là chúng sanh (sattārammaṇa) hoặc đối tượng của các hành (saṅkhārārammaṇa) tùy theo điều đã thấy, đã nghe, đã cảm nhận, đã biết; tham lam (abhijjhā) cũng vậy.
Byāpādo sattārammaṇova.
Ill will has only a being as its object.
Sân hận (byāpāda) chỉ có đối tượng là chúng sanh (sattārammaṇa).
Micchādiṭṭhi tebhūmakadhammavasena saṅkhārārammaṇā.
Wrong view has formations as its object, by way of the dhammas of the three planes of existence.
Tà kiến (micchādiṭṭhi) có đối tượng là các hành (saṅkhārārammaṇā) theo phương diện các pháp thuộc ba cõi (tebhūmakadhamma).
Vedanātoti pāṇātipāto dukkhavedano hoti.
In terms of feeling: destroying life is accompanied by painful feeling.
Về cảm thọ, sát sanh (pāṇātipāta) là cảm thọ khổ (dukkhavedana).
Kiñcāpi hi rājāno coraṃ disvā hasamānāpi ‘‘gacchatha naṃ ghātethā’’ti vadanti, sanniṭṭhāpakacetanā pana nesaṃ dukkhasampayuttāva hoti.
For although kings, upon seeing a thief, may say with a laugh, “Go and execute him,” their decisive cetanā is indeed associated with pain.
Mặc dù các vị vua khi thấy kẻ trộm có thể cười mà nói: “Hãy đi giết hắn!”, nhưng tư tâm sở quyết định của họ vẫn là đồng sanh với khổ thọ.
Adinnādānaṃ tivedanaṃ.
Taking what is not given is accompanied by any of the three feelings.
Trộm cắp (adinnādāna) có ba loại cảm thọ (tivedana).
Micchācāro sukhamajjhattavasena dvivedano, sanniṭṭhāpakacitte pana majjhattavedano na hoti.
Sexual misconduct is accompanied by two feelings, by way of pleasure and neutrality, but in the decisive consciousness, it is not accompanied by neutral feeling.
Tà dâm (micchācāra) có hai loại cảm thọ (dvivedana) theo phương diện lạc thọ và xả thọ, nhưng trong tâm quyết định thì không phải là xả thọ.
Musāvādo tivedano, tathā pisuṇā vācā.
False speech is accompanied by any of the three feelings; likewise for slanderous speech.
Nói dối (musāvāda) có ba loại cảm thọ (tivedana), nói lời đâm thọc (pisuṇā vācā) cũng vậy.
Pharusā vācā dukkhavedanāva.
Harsh speech is only accompanied by painful feeling.
Nói lời thô ác (pharusā vācā) chỉ có cảm thọ khổ (dukkhavedanā).
Samphappalāpo tivedano.
Frivolous speech is accompanied by any of the three feelings.
Nói lời phù phiếm (samphappalāpa) có ba loại cảm thọ (tivedana).
Abhijjhā sukhamajjhattavasena dvivedanā, tathā micchādiṭṭhi.
Covetousness is accompanied by two feelings, by way of pleasure and neutrality; likewise for wrong view.
Tham lam (abhijjhā) có hai loại cảm thọ (dvivedanā) theo phương diện lạc thọ và xả thọ, tà kiến (micchādiṭṭhi) cũng vậy.
Byāpādo dukkhavedano.
Ill will is accompanied by painful feeling.
Sân hận (byāpāda) là cảm thọ khổ (dukkhavedano).
Mūlatoti pāṇātipāto dosamohavasena dvimūlako hoti.
In terms of root: destroying life is two-rooted, by way of hatred and delusion.
Về căn bản, sát sanh (pāṇātipāta) có hai căn bản (dvimūlako) là sân và si (dosamoha).
Adinnādānaṃ dosamohavasena vā lobhamohavasena vā.
Taking what is not given is either by way of hatred and delusion, or by way of greed and delusion.
Trộm cắp (adinnādāna) có hai căn bản là sân và si (dosamoha) hoặc tham và si (lobhamoha).
Micchācāro lobhamohavasena.
Sexual misconduct is by way of greed and delusion.
Tà dâm (micchācāra) có hai căn bản là tham và si (lobhamoha).
Musāvādo dosamohavasena vā lobhamohavasena vā, tathā pisuṇā vācā samphappalāpo ca.
False speech is either by way of hatred and delusion, or by way of greed and delusion; likewise for slanderous speech and frivolous speech.
Nói dối (musāvāda) có hai căn bản là sân và si (dosamoha) hoặc tham và si (lobhamoha), nói lời đâm thọc (pisuṇā vācā) và nói lời phù phiếm (samphappalāpo) cũng vậy.
Pharusā vācā dosamohavasena.
Harsh speech is by way of hatred and delusion.
Nói lời thô ác (pharusā vācā) có hai căn bản là sân và si (dosamoha).
Abhijjhā mohavasena ekamūlā, tathā byāpādo.
Covetousness is one-rooted, by way of delusion; likewise for ill will.
Tham lam (abhijjhā) có một căn bản (ekamūlā) là si (moha), sân hận (byāpādo) cũng vậy.
Micchādiṭṭhi lobhamohavasena dvimūlāti.
Wrong view is two-rooted, by way of greed and delusion.
Tà kiến (micchādiṭṭhi) có hai căn bản (dvimūlā) là tham và si (lobhamoha).
Lobho akusalamūlantiādīsu lubbhatīti lobho.
In the phrase greed is an unwholesome root, etc., it clings, thus it is greed.
Trong các câu như " Tham ái là căn bản bất thiện" (Lobho akusalamūlaṃ), tham ái (lobho) là sự dính mắc.
Dussatīti doso.
It is corrupt, thus it is hatred.
Sân (doso) là sự phẫn nộ.
Muyhatīti moho.
It is deluded, thus it is delusion.
Si (moho) là sự mê mờ.
Tesu lobho sayañca akusalo sāvajjadukkhavipākaṭṭhena, imesañca pāṇātipātādīnaṃ akusalānaṃ kesañci sampayuttappabhāvakaṭṭhena kesañci upanissayapaccayaṭṭhena mūlanti akusalamūlaṃ.
Among these, greed is itself unwholesome in the sense of being faulty and having a painful result, and it is a root of these unwholesome states beginning with destroying life—for some in the sense of being a conjoined cause, and for others in the sense of being a decisive support condition. Thus, it is an unwholesome root.
Trong số đó, tham ái tự nó là bất thiện vì có lỗi lầm và quả khổ, đồng thời là căn bản bất thiện vì là đồng sanh và là duyên y chỉ (upanissayapaccaya) cho một số nghiệp bất thiện như sát sanh, v.v.
Vuttampi cetaṃ ‘‘ratto kho āvuso rāgena abhibhūto pariyādinnacitto pāṇampi hanatī’’tiādi.
And this has been said: “Friend, a person who is impassioned, overcome, and mentally obsessed by passion, even destroys life,” and so on.
Cũng đã được nói rằng: “Này chư hiền, người bị tham ái chi phối, tâm bị bao phủ bởi tham ái, còn có thể giết hại chúng sanh.”
Dosamohānaṃ akusalamūlabhāvepi eseva nayo.
This same method applies to hatred and delusion being unwholesome roots.
Đối với sân và si là căn bản bất thiện cũng theo cùng một cách này.
Pāṇātipātā veramaṇī kusalantiādīsu pāṇātipātādayo vuttatthā eva.
In the phrase abstinence from destroying life is wholesome, etc., the terms destroying life, and so on, have the meanings already stated.
Trong các câu như " Từ bỏ sát sanh là thiện" (Pāṇātipātā veramaṇī kusalaṃ), các từ sát sanh (pāṇātipātā), v.v., đã được giải thích ý nghĩa.
Veraṃ maṇatīti veramaṇī, veraṃ pajahatīti attho.
It abandons enmity, thus it is abstinence; the meaning is that it forsakes enmity.
Từ bỏ (veramaṇī) là sự từ bỏ các ác nghiệp (veraṃ maṇati), nghĩa là sự đoạn trừ ác nghiệp (veraṃ pajahati).
Viramati vā etāya karaṇabhūtāya, vikārassa vekāraṃ katvāpi veramaṇī.
Or, one abstains by means of it as an instrument; by changing the vi to ve, it is also veramaṇī.
Hoặc là nhờ điều này mà từ bỏ (viramati), cũng có thể gọi là veramaṇī bằng cách biến đổi âm "vi" thành "ve".
Ayaṃ tāvettha byañjanato vaṇṇanā.
This, for now, is the etymological explanation.
Đây là giải thích về ngữ pháp của từ này.
Atthato pana veramaṇīti kusalacittasampayuttā virati.
In terms of meaning, however, abstinence is the virati associated with a wholesome consciousness.
Tuy nhiên, về ý nghĩa thực sự, veramaṇī là sự từ bỏ (virati) đồng sanh với tâm thiện.
Yā ‘‘pāṇātipātā viramantassa, yā tasmiṃ samaye pāṇātipātā ārati viratī’’ti evaṃ vuttā kusalacittasampayuttā virati, sā bhedato tividho hoti sampattavirati samādānavirati samucchedaviratīti.
That which is described as, “For one who abstains from destroying life, the refraining, the abstaining from destroying life at that time”—that virati associated with a wholesome consciousness is of three kinds by way of classification: abstinence by chance encounter, abstinence by undertaking, and abstinence by cutting off.
Sự từ bỏ đồng sanh với tâm thiện, được nói đến như: “Sự từ bỏ, sự tránh xa, sự kiêng cữ khỏi sát sanh vào thời điểm người ấy từ bỏ sát sanh,” sự từ bỏ ấy có ba loại theo sự phân biệt: từ bỏ do tình huống (sampattavirati), từ bỏ do thọ trì (samādānavirati), và từ bỏ do đoạn diệt (samucchedavirati).
Tattha asamādinnasikkhāpadānaṃ attano jātivayabāhusaccādīni paccavekkhitvā ‘‘ayuttaṃ amhākaṃ evarūpaṃ kātu’’nti sampattavatthuṃ avītikkamantānaṃ uppajjamānā virati sampattaviratīti veditabbā sīhaḷadīpe cakkanaupāsakassa viya.
Therein, the abstinence that arises in those who have not undertaken the training rules, who, after reflecting on their own birth, age, learning, etc., do not transgress when faced with an occasion for it, thinking, “It is not proper for us to do such a thing,” should be known as abstinence by chance encounter, as in the case of the lay follower Cakkana in the island of Sīhaḷa.
Trong đó, sự từ bỏ phát sinh ở những người chưa thọ trì giới luật, nhưng sau khi quán xét về dòng dõi, tuổi tác, sự hiểu biết rộng rãi của mình, họ nghĩ: “Việc làm như vậy là không đúng với chúng ta,” và không vi phạm đối tượng hiện tại, sự từ bỏ đó được gọi là từ bỏ do tình huống (sampattaviratī), giống như trường hợp của cư sĩ Cakkana ở đảo Sīhaḷa.
Tassa kira daharakāleyeva mātuyā rogo uppajji.
It is said that when he was just a boy, his mother fell ill.
Nghe nói rằng, khi ông còn nhỏ, mẹ ông bị bệnh.
Vejjena ca ‘‘allasasamaṃsaṃ laddhuṃ vaṭṭatī’’ti vuttaṃ.
And the physician said, “It is proper to get fresh hare’s meat.”
Thầy thuốc nói: “Cần phải có thịt thỏ tươi.”
Tato cakkanassa bhātā ‘‘gaccha tāta khettaṃ āhiṇḍāhī’’ti cakkanaṃ pesesi.
Then Cakkana’s brother sent Cakkana, saying, “Go, my dear, and wander through the field.”
Thế là anh trai của Cakkana sai ông: “Con trai, hãy đi tìm trong cánh đồng.”
So tattha gato.
He went there.
Ông đã đi đến đó.
Tasmiñca samaye eko saso taruṇasassaṃ khādituṃ āgato hoti, so taṃ disvā vegena dhāvento valliyā baddho ‘‘kiri kirī’’ti saddamakāsi.
And at that moment, a hare had come to eat the young crops; seeing him, it ran with speed, got caught in a vine, and made a ‘kiri kiri’ sound.
Vào lúc đó, một con thỏ đến ăn lúa non, nó thấy ông liền chạy nhanh và bị mắc vào dây leo, kêu “kiri kiri”.
Cakkano tena saddena gantvā taṃ gahetvā cintesi ‘‘mātu bhesajjaṃ karomī’’ti.
Cakkana, hearing that sound, went and caught it, thinking, “I will make medicine for my mother.”
Cakkana nghe tiếng kêu, đến bắt con thỏ và nghĩ: “Mình sẽ làm thuốc cho mẹ.”
Puna cintesi ‘‘na metaṃ patirūpaṃ, yvāhaṃ mātu jīvitakāraṇā paraṃ jīvitā voropeyya’’nti.
Again, he thought, “It is not proper for me to deprive another of life for the sake of my mother’s life.”
Ông lại nghĩ: “Việc này không phù hợp với mình, làm sao mình có thể tước đoạt mạng sống của người khác vì mạng sống của mẹ?”
Atha naṃ ‘‘gaccha araññe sasehi saddhiṃ tiṇodakaṃ paribhuñjā’’ti muñci.
Then he released it, saying, “Go, enjoy grass and water with the hares in the forest.”
Rồi ông thả con thỏ đi, nói: “Hãy đi vào rừng và ăn cỏ uống nước với những con thỏ khác.”
Bhātarā ca ‘‘kiṃ tāta saso laddho’’ti pucchito taṃ pavattiṃ ācikkhi.
When his brother asked, “Dear, did you get a hare?” he related what had happened.
Khi anh trai hỏi: “Con trai, có bắt được thỏ không?”, ông kể lại toàn bộ sự việc.
Tato naṃ bhātā paribhāsi.
Then his brother scolded him.
Thế là anh trai mắng ông.
So mātusantikaṃ gantvā ‘‘yatohaṃ jāto, nābhijānāmi sañcicca pāṇaṃ jīvitā voropetā’’ti saccaṃ vatvā adhiṭṭhāsi.
He went to his mother and made a declaration of truth, saying, “From the day I was born, I am not aware of intentionally depriving a living being of life.”
Ông đến chỗ mẹ và nói lời chân thật: “Từ khi con sinh ra, con chưa từng cố ý tước đoạt mạng sống của bất kỳ chúng sanh nào.”
Tāvadevassa mātā arogā ahosi.
At that very moment, his mother became well.
Ngay lập tức, mẹ ông khỏi bệnh.
So kira ambariyavihāravāsīpiṅgalabuddharakkhitattherassa santike sikkhāpadāni gahetvā khettaṃ kassati.
It is said that he, having taken the training rules from the Elder Piṅgala-Buddharakkhita, who lived in the Ambariya monastery, was ploughing his field.
Nghe nói rằng, ông ấy đã thọ trì giới luật từ Trưởng lão Piṅgalabuddharakkhita, vị trú tại Ambariyavihāra, rồi đi cày ruộng.
Athassa goṇo naṭṭho, so taṃ gavesanto uttaravaḍḍhamānapabbataṃ āruhi, tatra naṃ mahāsappo aggahesi.
Then his ox got lost. Searching for it, he climbed Uttaravaḍḍhamāna mountain, where a great serpent seized him.
Thế rồi con bò của ông bị mất, ông đi tìm nó và leo lên núi Uttaravaḍḍhamāna, ở đó một con rắn lớn đã bắt ông.
So cintesi ‘‘imāyassa tikhiṇavāsiyā sīsaṃ chindāmī’’ti.
He thought, “I will cut off its head with this sharp axe.”
Ông nghĩ: “Mình sẽ dùng cái rìu sắc bén này chặt đầu nó.”
Puna cintesi ‘‘na metaṃ patirūpaṃ, yvāhaṃ bhāvanīyassa garuno santike sikkhāpadaṃ gahetvā bhindeyya’’nti.
Again, he thought, “It is not proper for me, who have taken the training rule from a venerable teacher, to break it.”
Ông lại nghĩ: “Việc này không phù hợp với mình, làm sao mình có thể phá giới đã thọ trì từ vị thầy đáng kính?”
Evaṃ yāvatatiyaṃ cintetvā ‘‘jīvitaṃ pariccajāmi, na sikkhāpada’’nti aṃse ṭhapitaṃ tikhiṇadaṇḍavāsiṃ araññe chaḍḍesi.
Having thought thus up to a third time, he resolved, “I will give up my life, but not the training rule,” and threw the sharp-bladed axe he carried on his shoulder into the forest.
Cứ thế, ông suy nghĩ đến ba lần, rồi nói: “Mình thà hy sinh mạng sống chứ không phá giới,” và vứt cái rìu sắc bén có cán dài đang vác trên vai xuống rừng.
Tāvadeva naṃ mahāvāḷo muñcitvā agamāsīti.
At that very moment, the great venomous snake released him and went away.
Ngay lập tức, con rắn lớn buông ông ra và bỏ đi.
Ariyamaggasampayuttā pana virati samucchedaviratīti veditabbā.
The virati associated with the noble path, however, should be known as abstinence by cutting off.
Còn sự từ bỏ đồng sanh với Đạo Thánh (ariyamagga) được gọi là từ bỏ do đoạn diệt (samucchedaviratī).
Yassā uppattito pabhuti ‘‘pāṇaṃ ghātessāmī’’ti ariyapuggalānaṃ cittampi na uppajjatīti.
From the moment of its arising, not even the thought, “I will kill a living being,” arises in noble persons.
Kể từ khi sự từ bỏ này phát sinh, tâm của các bậc Thánh (ariyapuggala) không còn khởi lên ý nghĩ “mình sẽ giết hại chúng sanh” nữa.
Sā panāyaṃ virati kosallappavattiyā kusalanti vuttā.
And that very abstinence is called wholesome because it occurs through skillfulness.
Sự kiêng cữ đó được gọi là kusala (thiện) vì nó phát sinh từ sự khéo léo.
Kucchitasayanato vā kusanti laddhavohāraṃ dussīlyaṃ lunātītipi kusalaṃ.
Or, because it cuts off immorality, which has received the designation kusa from its despicable nature, it is also wholesome.
Hoặc, kusala (thiện) cũng được gọi như vậy vì nó cắt đứt sự bất thiện, vốn được gọi là "kusa" do nó phá hủy những pháp bất thiện đáng ghê tởm.
Katamañcāvuso kusalanti imassa pana pañhassa ananurūpattā kusalāti na vuttā.
However, because it is not in conformity with the question, "And what, friend, is wholesome?", it is not stated as kusalā.
Nhưng vì không phù hợp với câu hỏi "Này chư hiền, thế nào là thiện (kusala)?", nên không được nói là "kusalā".
Koṭṭhāsatoti paṭipāṭiyā satta kammapathā eva, no mūlāni.
By way of classification: according to sequence, the seven are only courses of action, not roots.
Về phần: theo thứ tự, chỉ có bảy nghiệp đạo (kammapatha), không phải là căn nguyên (mūla).
Ante tayo kammapathā ceva mūlāni ca.
The final three are both courses of action and roots.
Ba pháp cuối cùng là nghiệp đạo và cũng là căn nguyên.
Anabhijjhā hi mūlaṃ patvā alobho kusalamūlaṃ hoti.
Indeed, when non-covetousness reaches the status of a course of action, it becomes the wholesome root of non-greed.
Khi không tham đắm (anabhijjhā) đạt đến căn nguyên, nó trở thành vô tham (alobha) là căn nguyên thiện (kusalamūla).
Abyāpādo adoso kusalamūlaṃ.
Non-ill will becomes the wholesome root of non-hatred.
Vô sân (abyāpāda) là vô sân (adosa) là căn nguyên thiện.
Sammādiṭṭhi amoho kusalamūlaṃ.
Right view becomes the wholesome root of non-delusion.
Chánh kiến (sammādiṭṭhi) là vô si (amoha) là căn nguyên thiện.
Mūlatoti paṭipāṭiyā satta kammapathā ñāṇasampayuttacittena viramantassa alobhaadosaamohavasena timūlā honti.
By way of root: according to sequence, the seven courses of action, for one who abstains with a mind associated with knowledge, have three roots, by way of non-greed, non-hatred, and non-delusion.
Về căn nguyên: theo thứ tự, bảy nghiệp đạo của người kiêng cữ với tâm tương ưng với trí tuệ (ñāṇasampayuttacitta) thì có ba căn nguyên (timūlā) là vô tham (alobha), vô sân (adosa) và vô si (amoha).
Ñāṇavippayuttacittena viramantassa dvimūlā.
For one who abstains with a mind dissociated from knowledge, they have two roots.
Đối với người kiêng cữ với tâm không tương ưng với trí tuệ (ñāṇavippayuttacitta) thì có hai căn nguyên (dvimūlā).
Anabhijjhā ñāṇasampayuttacittena viramantassa dvimūlā.
Non-covetousness, for one who abstains with a mind associated with knowledge, has two roots.
Không tham đắm (anabhijjhā) của người kiêng cữ với tâm tương ưng với trí tuệ thì có hai căn nguyên (dvimūlā).
Ñāṇavippayuttacittena ekamūlā.
For one who abstains with a mind dissociated from knowledge, it has one root.
Với tâm không tương ưng với trí tuệ thì có một căn nguyên (ekamūlā).
Alobho pana attanāva attano mūlaṃ na hoti, abyāpādepi eseva nayo.
But non-greed is not itself its own root; this is the method also for non-ill will.
Còn vô tham (alobha) tự nó không phải là căn nguyên của chính nó, tương tự đối với vô sân (abyāpāda).
Sammādiṭṭhi alobhādosavasena dvimūlāvāti.
Right view has only two roots, by way of non-greed and non-hatred.
Chánh kiến (sammādiṭṭhi) thì có hai căn nguyên (dvimūlā) là vô tham và vô sân.
Alobho kusalamūlantiādīsu na lobhoti alobho, lobhapaṭipakkhassa dhammassetaṃ adhivacanaṃ.
In passages such as "Non-greed is a wholesome root," it is non-greed because it is not greed; this is a designation for the state that is the opposite of greed.
Trong các cụm từ như " Vô tham là căn nguyên thiện" (Alobho kusalamūlaṃ), "alobho" (vô tham) là không có tham (lobha), đây là tên gọi của pháp đối nghịch với tham.
Adosāmohesupi eseva nayo.
This is the same method for non-hatred and non-delusion as well.
Tương tự đối với vô sân (adosa) và vô si (amoha).
Tesu alobho sayañca kusalaṃ, imesañca pāṇātipātā veramaṇīādīnaṃ kusalānaṃ kesañci sampayuttappabhāvakaṭṭhena kesañci upanissayapaccayaṭṭhena mūlanti kusalamūlaṃ.
Among them, non-greed is itself wholesome, and for some of these wholesome states like abstinence from killing living beings, it is a root because it is a conascent cause, and for others, it is a root because it is a condition of strong dependence; thus it is a wholesome root.
Trong số đó, vô tham (alobha) tự nó là thiện, và đối với một số pháp thiện như kiêng cữ sát sinh (pāṇātipātā veramaṇī) và các pháp khác, nó là căn nguyên (mūla) theo nghĩa là yếu tố tương ưng và khởi phát (sampayuttappabhāvakaṭṭhena), và đối với một số khác, nó là căn nguyên theo nghĩa là duyên y chỉ mạnh (upanissayapaccayaṭṭhena), do đó được gọi là căn nguyên thiện (kusalamūla).
Adosāmohānampi kusalamūlabhāve eseva nayo.
This is the same method for the state of non-hatred and non-delusion as wholesome roots.
Tương tự đối với vô sân (adosa) và vô si (amoha) về việc chúng là căn nguyên thiện.
Idāni sabbampi taṃ saṅkhepena ca vitthārena ca desitamatthaṃ nigamento yato kho āvusotiādiappanāvāramāha.
Now, concluding the meaning that has been taught in brief and in detail, he spoke the section on absorption, beginning with "When, friends,..."
Bây giờ, để kết thúc ý nghĩa đã được giảng giải cả tóm tắt và chi tiết, Ngài đã nói đến phần mở đầu " Yato kho āvuso" (Này chư hiền, khi nào…).
Tattha evaṃ akusalaṃ pajānātīti evaṃ yathāniddiṭṭhadasākusalakammapathavasena akusalaṃ pajānāti.
Therein, "thus he understands the unwholesome" means he understands the unwholesome by way of the ten unwholesome courses of action as specified.
Trong đó, " Evaṃ akusalaṃ pajānātīti" (biết rõ pháp bất thiện như vậy) có nghĩa là biết rõ pháp bất thiện theo mười nghiệp đạo bất thiện đã được chỉ rõ như vậy.
Evaṃ akusalamūlantiādīsupi eseva nayo.
This is the same method for "thus the unwholesome root" and so on.
Tương tự đối với " Evaṃ akusalamūlaṃ" (căn nguyên bất thiện như vậy) và các cụm từ khác.
Ettāvatā ekena nayena catusaccakammaṭṭhānikassa yāva arahattā niyyānaṃ kathitaṃ hoti.
By this much, the path of release up to Arahantship for one practicing the meditation subject of the Four Truths has been explained by one method.
Đến đây, bằng một phương pháp, con đường dẫn đến A-la-hán quả của hành giả tu Tứ Thánh Đế đã được giảng giải.
Ettha hi ṭhapetvā abhijjhaṃ dasa akusalakammapathā ca kusalakammapathā ca dukkhasaccaṃ.
Herein, leaving aside covetousness, the ten unwholesome courses of action and the wholesome courses of action are the truth of suffering.
Ở đây, trừ bỏ sự tham lam (abhijjhā), mười nghiệp đạo bất thiện và mười nghiệp đạo thiện là Khổ đế (Dukkhasacca).
Abhijjhā ca lobho akusalamūlañcāti ime dve dhammā nippariyāyena samudayasaccaṃ.
These two states, covetousness and the unwholesome root of greed, are directly the truth of the origin.
Tham lam (abhijjhā) và tham ái (lobha) là căn nguyên bất thiện (akusalamūla) – hai pháp này là Tập đế (Samudayasacca) theo nghĩa trực tiếp.
Pariyāyena pana sabbepi kammapathā dukkhasaccaṃ.
But indirectly, all the courses of action are the truth of suffering.
Còn theo nghĩa gián tiếp, tất cả các nghiệp đạo đều là Khổ đế.
Sabbāni kusalākusalamūlāni samudayasaccaṃ.
All the wholesome and unwholesome roots are the truth of the origin.
Tất cả các căn nguyên thiện và bất thiện đều là Tập đế.
Ubhinnaṃ appavatti nirodhasaccaṃ.
The non-occurrence of both is the truth of cessation.
Sự không phát sinh của cả hai (Khổ và Tập) là Diệt đế (Nirodhasacca).
Dukkhaṃ parijānanto samudayaṃ pajahamāno nirodhaṃ pajānanto ariyamaggo maggasaccanti iti dve saccāni sarūpena vuttāni, dve āvattahāravasena veditabbāni.
The noble path—which fully understands suffering, abandons the origin, and realizes cessation—is the truth of the path. Thus two truths are stated in their own nature, and two are to be understood by the method of deduction.
Thánh đạo (ariyamagga) là Đạo đế (Maggasacca) khi nó hiểu rõ khổ, đoạn trừ tập, và biết rõ diệt. Như vậy, hai Thánh đế được nói theo bản chất, và hai Thánh đế còn lại phải được hiểu theo cách chuyển hóa.
So sabbaso rāgānusayaṃ pahāyāti so evaṃ akusalādīni pajānanto sabbākārena rāgānusayaṃ pajahitvā.
Having completely abandoned the latent tendency of lust: he, thus understanding the unwholesome and so on, having abandoned the latent tendency of lust in all its forms.
So sabbaso rāgānusayaṃ pahāyāti (Vị ấy đoạn trừ hoàn toàn tùy miên tham ái) có nghĩa là vị ấy, khi đã biết rõ các pháp bất thiện và các pháp khác như vậy, đã đoạn trừ tùy miên tham ái (rāgānusaya) bằng mọi phương cách.
Paṭighānusayaṃ paṭivinodetvāti paṭighānusayañca sabbākāreneva nīharitvāti vuttaṃ hoti.
Having dispelled the latent tendency of aversion: it means having removed the latent tendency of aversion in all its forms.
Paṭighānusayaṃ paṭivinodetvāti (và loại bỏ tùy miên sân hận) có nghĩa là vị ấy đã loại bỏ hoàn toàn tùy miên sân hận (paṭighānusaya) bằng mọi phương cách.
Ettāvatā anāgāmimaggo kathito.
By this much, the path of the non-returner is explained.
Đến đây, con đường của bậc Bất Hoàn (Anāgāmimagga) đã được giảng giải.
Asmīti diṭṭhimānānusayaṃ samūhanitvāti pañcasu khandhesu kañci dhammaṃ anavakārīkaritvā ‘‘asmī’’ti iminā samūhaggahaṇākārena pavattaṃ diṭṭhimānānusayaṃ samugghāṭetvā.
Having uprooted the latent tendency of the view and conceit 'I am': without making any distinction among the five aggregates, having eradicated the latent tendency of the view and conceit that occurs in the form of a collective grasp expressed as 'I am'.
Asmīti diṭṭhimānānusayaṃ samūhanitvāti (nhổ tận gốc tùy miên tà kiến và kiêu mạn "ta là") có nghĩa là vị ấy đã nhổ tận gốc tùy miên tà kiến và kiêu mạn (diṭṭhimānānusaya) phát sinh dưới hình thức chấp thủ tổng thể "ta là" mà không phân biệt bất kỳ pháp nào trong năm uẩn.
Avijjaṃ pahāyāti vaṭṭamūlaṃ avijjaṃ pajahitvā.
Having abandoned ignorance: having abandoned the ignorance that is the root of the cycle of existence.
Avijjaṃ pahāyāti (Đoạn trừ vô minh) có nghĩa là đoạn trừ vô minh (avijjā) là căn nguyên của vòng luân hồi (vaṭṭamūla).
Vijjaṃ uppādetvāti tassā avijjāya samugghāṭikaṃ arahattamaggavijjaṃ uppādetvā.
Having aroused knowledge: having aroused the knowledge of the Arahant path that eradicates that ignorance.
Vijjaṃ uppādetvāti (Phát sinh minh) có nghĩa là phát sinh minh (vijjā) của A-la-hán đạo (arahattamaggavijja) để nhổ tận gốc vô minh đó.
Ettāvatā arahattamaggo kathito.
By this much, the path of Arahantship is explained.
Đến đây, con đường của bậc A-la-hán (arahattamagga) đã được giảng giải.
Diṭṭheva dhamme dukkhassantakaro hotīti asmiṃyeva attabhāve vaṭṭadukkhassa paricchedakaro hoti.
He is one who makes an end of suffering in this very life: in this very existence, he becomes one who puts an end to the suffering of the cycle of existence.
Diṭṭheva dhamme dukkhassantakaro hotīti (Trong ngay đời này, vị ấy chấm dứt khổ đau) có nghĩa là vị ấy chấm dứt khổ đau của vòng luân hồi (vaṭṭadukkha) ngay trong kiếp sống này.
Ettāvatāpi kho, āvusoti desanaṃ niyyāteti, imāya kammapathadesanāya vuttamanasikārappaṭivedhavasenapīti vuttaṃ hoti.
To this extent also, friends: he presents the teaching; it means also through the reflective attention and penetration mentioned in this teaching on the courses of action.
Ettāvatāpi kho, āvusoti (Này chư hiền, chừng ấy thôi) là để kết thúc bài giảng, có nghĩa là "ngay cả bằng sự thâm nhập (paṭivedha) và tác ý (manasikāra) đã được nói đến trong bài giảng về nghiệp đạo này".
Sesaṃ vuttanayameva.
The rest is just as has been explained.
Phần còn lại cũng theo cách đã nói.
Evaṃ anāgāmimaggaarahattamaggehi desanaṃ niṭṭhapesīti.
Thus, he concluded the teaching with the paths of the non-returner and Arahantship.
Như vậy, Ngài đã kết thúc bài giảng bằng con đường của bậc Bất Hoàn và con đường của bậc A-la-hán.
90. Sādhāvusoti kho…pe… āgato imaṃ saddhammanti evaṃ āyasmato sāriputtassa kusalākusalamukhena catusaccadesanaṃ sutvā taṃ āyasmato sāriputtassa bhāsitaṃ ‘‘sādhāvuso’’ti iminā vacanena te bhikkhū abhinanditvā imasseva vacanassa samuṭṭhāpakena cittena anumoditvā vacasā sampaṭicchitvā cetasā sampiyāyitvāti vuttaṃ hoti.
"Excellent, friend!"... entered into this good Dhamma: thus, having heard the venerable Sāriputta's teaching on the Four Truths by way of the wholesome and the unwholesome, those bhikkhus, with the words "Excellent, friend!" acclaimed the venerable Sāriputta's speech. It is meant that with the mind that gave rise to this very speech, they rejoiced, with their words they accepted it, and with their minds they cherished it.
90. Sādhāvuso ti kho…pe… āgato imaṃ saddhammaṃ (Lành thay, thưa chư hiền… này… đã đến Pháp chân diệu này): Như vậy, sau khi nghe bài giảng về Tứ Thánh Đế của Tôn giả Sāriputta thông qua thiện và bất thiện, các Tỳ-kheo ấy đã hoan hỷ với lời nói "Sādhāvuso" (Lành thay, thưa chư hiền) của Tôn giả Sāriputta, tùy hỷ với tâm phát sinh lời nói ấy, chấp nhận bằng lời nói, và yêu mến bằng tâm ý.
Idāni yasmā thero nānappakārena catusaccadesanaṃ desetuṃ paṭibalo, yathāha ‘‘sāriputto, bhikkhave, pahoti cattāri ariyasaccāni vitthārena ācikkhituṃ desetu’’nti yasmā vā uttarimpi desetukāmova hutvā ‘‘ettāvatāpi kho’’ti avaca, tasmā aparenapi nayena saccadesanaṃ sotukāmā te bhikkhū āyasmantaṃ sāriputtaṃ uttariṃ pañhaṃ apucchiṃsu.
Now, because the Elder was capable of teaching the Four Truths in various ways, as it is said: "Sāriputta, bhikkhus, is able to explain and teach the Four Noble Truths in detail," or because he, being desirous of teaching even further, said, "To this extent also...", those bhikkhus, wishing to hear the teaching on the truths by yet another method, asked the venerable Sāriputta a further question.
Bây giờ, vì Trưởng lão có khả năng giảng giải Tứ Thánh Đế bằng nhiều cách khác nhau, như đã nói: "Này chư Tỳ-kheo, Sāriputta có khả năng giảng giải và thuyết minh Tứ Thánh Đế một cách chi tiết"; và vì Ngài muốn giảng giải thêm, nên đã nói "ettāvatāpi kho" (chừng ấy thôi). Do đó, các Tỳ-kheo ấy, muốn nghe bài giảng về Thánh Đế bằng một phương pháp khác, đã hỏi Tôn giả Sāriputta một câu hỏi tiếp theo.
Tena sayameva pucchitvā vissajjitapañhato uttariṃ siyā kho panāvuso, aññopi pariyāyo bhaveyya aññampi kāraṇanti iminā nayena aññaṃ atirekaṃ pañhaṃ pucchiṃsu, purimapañhassa vā uparibhāge pucchiṃsūti vuttaṃ hoti.
Therefore, beyond the question that was asked and answered by himself, they asked another, additional question by the method of "Might there be, friend, another way, another reason?" or it is meant that they asked a question on top of the previous question.
Do đó, họ đã hỏi một câu hỏi bổ sung, một câu hỏi vượt ra ngoài những gì Ngài tự hỏi và trả lời, theo cách "Siyā kho panāvuso, aññopi pariyāyo bhaveyya aññampi kāraṇaṃ" (Này chư hiền, có thể có một phương pháp khác, một lý do khác), hoặc họ đã hỏi ở phần trên của câu hỏi trước.
Atha nesaṃ byākaramāno thero siyā, āvusotiādimāha.
Then, answering them, the Elder said, "There might be, friends," and so on.
Sau đó, khi trả lời họ, Trưởng lão đã nói " Siyā, āvuso" (Có thể, thưa chư hiền) và các lời khác.
Tatthāyaṃ anuttānapadavaṇṇanā, āhāranti paccayaṃ.
Therein, this is the explanation of unclear words: nutriment means a condition.
Trong đó, đây là phần giải thích các từ không rõ ràng: āhāraṃ (dưỡng) là nhân duyên (paccaya).
Paccayo hi āharati attano phalaṃ, tasmā ‘‘āhāro’’ti vuccati.
Because a condition brings its own fruit, it is called "nutriment."
Thật vậy, nhân duyên mang lại quả của chính nó, do đó được gọi là "āhāra" (dưỡng).
Bhūtānaṃ vā sattānantiādīsu bhūtāti sañjātā, nibbattā.
In "for beings... or for those seeking birth," and so on, beings means those who have been born, who have come into existence.
Trong các cụm từ như Bhūtānaṃ vā sattānaṃ (hoặc cho các chúng sinh đã sinh), bhūtā là đã sinh, đã phát sinh.
Sambhavesīnanti ye sambhavaṃ jātiṃ nibbattiṃ esanti gavesanti.
Those seeking birth means those who seek, who search for becoming, birth, and coming into existence.
Sambhavesīnaṃ (cho những chúng sinh đang tìm kiếm sự tái sinh) là những chúng sinh đang tìm kiếm, đang truy cầu sự tái sinh, sự sinh khởi.
Tattha catūsu yonīsu aṇḍajajalābujā sattā yāva aṇḍakosaṃ vatthikosañca na bhindanti, tāva sambhavesino nāma.
Therein, among the four kinds of birth, egg-born and womb-born beings, as long as they do not break the eggshell or the womb-sac, are called "those seeking birth."
Trong đó, các chúng sinh sinh từ trứng (aṇḍaja) và sinh từ thai (jalābujā) trong bốn loại sinh, chừng nào chưa phá vỡ vỏ trứng hoặc bọc thai, thì được gọi là sambhavesino (đang tìm kiếm sự tái sinh).
Aṇḍakosaṃ vatthikosañca bhinditvā bahi nikkhantā bhūtā nāma.
Having broken the eggshell or the womb-sac and come out, they are called "beings."
Sau khi phá vỡ vỏ trứng hoặc bọc thai và xuất hiện ra ngoài, thì được gọi là bhūtā (đã sinh).
Saṃsedajā opapātikā ca paṭhamacittakkhaṇe sambhavesino nāma.
Moisture-born and spontaneously arisen beings, at the first moment of consciousness, are called sambhavesino.
Các loài sinh ra từ ẩm thấp (saṃsedaja) và hóa sinh (opapātika) được gọi là 'sambhavesī' (chúng sinh đang tìm kiếm sự tái sinh) ngay trong sát-na tâm đầu tiên.
Dutiyacittakkhaṇato pabhuti bhūtā nāma.
From the second moment of consciousness onwards, they are called bhūtā.
Từ sát-na tâm thứ hai trở đi, chúng được gọi là 'bhūtā' (chúng sinh đã hiện hữu).
Yena yena vā iriyāpathena jāyanti, yāva te tato aññaṃ na pāpuṇanti, tāva sambhavesino nāma.
Or, by whatever posture they are born, as long as they have not yet attained another from that, they are called sambhavesino.
Hoặc, chúng sinh được gọi là 'sambhavesī' chừng nào chúng sinh ra trong bất kỳ oai nghi nào và chưa đạt đến một oai nghi khác.
Tato paraṃ bhūtā nāma.
Thereafter, they are called bhūtā.
Sau đó, chúng được gọi là 'bhūtā'.
Atha vā bhūtāti jātā abhinibbattā, ye bhūtāyeva na puna bhavissantīti saṅkhyaṃ gacchanti, tesaṃ khīṇāsavānametaṃ adhivacanaṃ.
Alternatively, bhūtā means born, fully arisen; this is a designation for those who have just become and will not become again, who are counted as such, that is, for the khīṇāsavas.
Hoặc, bhūtā (đã hiện hữu) có nghĩa là đã sinh ra, đã thành tựu, những vị đã hiện hữu và sẽ không còn tái sinh nữa, đây là tên gọi dành cho các bậc lậu tận (khīṇāsava).
Sambhavamesantīti sambhavesino.
Those who seek arising are sambhavesino.
Những vị đang tìm kiếm sự tái sinh được gọi là sambhavesī.
Appahīnabhavasaṃyojanattā āyatimpi sambhavaṃ esantānaṃ sekkhaputhujjanānametaṃ adhivacanaṃ.
This is a designation for learners (sekhas) and ordinary persons (puthujjanas) who, because the fetter of existence is not abandoned, seek arising in the future as well.
Do chưa đoạn trừ kiết sử hữu (bhavasaṃyojana), những vị này vẫn còn tìm kiếm sự tái sinh trong tương lai, đây là tên gọi dành cho các bậc hữu học (sekha) và phàm phu (puthujjana).
Evaṃ sabbathāpi imehi dvīhi padehi sabbasatte pariyādiyati.
Thus, in every way, all beings are encompassed by these two terms.
Như vậy, bằng hai từ này, tất cả chúng sinh đều được bao hàm.
Vāsaddo cettha sampiṇḍanattho, tasmā bhūtānañca sambhavesīnañcāti ayamattho veditabbo.
Here, the particle vā has the meaning of grouping together; therefore, the meaning should be understood as "of bhūtā and of sambhavesino."
Từ ngữ vā ở đây có nghĩa là tổng hợp, do đó phải hiểu là “của những vị bhūtā và sambhavesī”.
Ṭhitiyāti ṭhitatthaṃ.
Ṭhitiyā means for the sake of endurance.
Ṭhitiyā có nghĩa là để tồn tại.
Anuggahāyāti anuggahatthaṃ upakāratthaṃ.
Anuggahāya means for the sake of support, for the sake of benefit.
Anuggahāyā có nghĩa là để hỗ trợ, để giúp đỡ.
Vacanabhedo cesa, attho pana dvinnampi padānaṃ ekoyeva.
This is a difference in wording, but the meaning of both terms is one and the same.
Đây là sự khác biệt về từ ngữ, nhưng ý nghĩa của cả hai từ đều giống nhau.
Atha vā ṭhitiyāti tassa tassa sattassa uppannadhammānaṃ anuppabandhavasena avicchedāya.
Alternatively, ṭhitiyā means for the non-interruption, by way of continuous succession, of the dhammas that have arisen in each and every being.
Hoặc, ṭhitiyā có nghĩa là để duy trì sự liên tục, không gián đoạn của các pháp đã sinh khởi trong mỗi chúng sinh.
Anuggahāyāti anuppannānaṃ uppādāya.
Anuggahāya means for the arising of those that have not yet arisen.
Anuggahāyā có nghĩa là để làm phát sinh những pháp chưa sinh khởi.
Ubhopi cetāni bhūtānaṃ ṭhitiyā ceva anuggahāya ca.
Both these are for the endurance and support of the bhūtā.
Cả hai điều này đều là để duy trì và hỗ trợ cho các chúng sinh đã hiện hữu (bhūtā).
Sambhavesīnaṃ vā ṭhitiyā ceva anuggahāya cāti evaṃ ubhayattha daṭṭhabbāni.
Or, they should be seen in both cases thus: for the endurance and support of the sambhavesino.
Hoặc, để duy trì và hỗ trợ cho các chúng sinh đang tìm kiếm sự tái sinh (sambhavesī), phải hiểu theo cả hai cách.
Kabaḷīkāro āhāroti kabaḷaṃ katvā ajjhoharitabbato kabaḷīkāro āhāro, odanakummāsādivatthukāya ojāyetaṃ adhivacanaṃ.
Kabaḷīkāro āhāro (edible food) is so called because it must be swallowed after being made into a morsel; this is a designation for the nutritive essence (ojā) that has rice, gruel, etc., as its physical basis.
Kabaḷīkāro āhāro (thức ăn vật chất) là thức ăn được nuốt vào từng miếng (kabaḷa), đây là tên gọi của chất dinh dưỡng (ojā) có trong cơm, cháo, bánh mì, v.v.
Oḷāriko vā sukhumo vāti vatthuoḷārikatāya oḷāriko, vatthusukhumatāya sukhumo.
Oḷāriko vā sukhumo vā (gross or subtle): it is gross due to the grossness of its physical basis, and subtle due to the subtlety of its physical basis.
Oḷāriko vā sukhumo vā (thô hay vi tế) có nghĩa là thô do vật chất thô, vi tế do vật chất vi tế.
Sabhāvena pana sukhumarūpapariyāpannattā kabaḷīkāro āhāro sukhumova hoti.
By its intrinsic nature, however, edible food is only subtle, as it is included in subtle matter (sukhumarūpa).
Tuy nhiên, về bản chất, thức ăn vật chất (kabaḷīkāro āhāro) là vi tế vì nó thuộc vào sắc vi tế.
Sāpi cassa vatthuto oḷārikatā sukhumatā ca upādāyupādāya veditabbā.
And its grossness and subtlety, due to its physical basis, should be understood in relative terms.
Sự thô và vi tế của nó về mặt vật chất cũng phải được hiểu tùy theo từng trường hợp.
Kumbhīlānañhi āhāraṃ upādāya morānaṃ āhāro sukhumo.
Compared to the food of crocodiles, the food of peacocks is subtle.
So với thức ăn của cá sấu, thức ăn của chim công là vi tế.
Kumbhīlā kira pāsāṇe gilanti.
It is said that crocodiles swallow stones.
Người ta nói rằng cá sấu nuốt đá.
Te ca nesaṃ kucchippattāva vilīyanti.
And these dissolve as soon as they reach their stomachs.
Và những viên đá đó tan rã ngay khi vào bụng chúng.
Morā sappavicchikādipāṇe khādanti.
Peacocks eat creatures such as snakes and scorpions.
Chim công ăn rắn, bọ cạp, v.v.
Morānaṃ pana āhāraṃ upādāya taracchānaṃ āhāro sukhumo.
But compared to the food of peacocks, the food of hyenas is subtle.
So với thức ăn của chim công, thức ăn của linh cẩu là vi tế.
Te kira tivassachaḍḍitāni visāṇāni ceva aṭṭhīni ca khādanti.
It is said they eat horns and bones that have been discarded for three years.
Người ta nói rằng chúng ăn sừng và xương đã bị vứt bỏ ba năm.
Tāni ca nesaṃ kheḷena temitamatteneva kandamūlaṃ viya mudukāni honti.
And these, merely by being moistened with their saliva, become as soft as bulbs and roots.
Và những thứ đó trở nên mềm như rễ cây chỉ với một chút nước bọt của chúng.
Taracchānampi āhāraṃ upādāya hatthīnaṃ āhāro sukhumo.
Compared to the food of hyenas, the food of elephants is subtle.
So với thức ăn của linh cẩu, thức ăn của voi là vi tế.
Tepi nānārukkhasākhāyo khādanti.
They too eat the branches of various trees.
Chúng ăn nhiều loại cành cây khác nhau.
Hatthīnaṃ āhārato gavayagokaṇṇamigādīnaṃ āhāro sukhumo.
Compared to the food of elephants, the food of wild oxen, deer, and other animals is subtle.
So với thức ăn của voi, thức ăn của các loài như bò rừng, nai sừng tấm là vi tế.
Te kira nissārāni nānārukkhapaṇṇādīni khādanti.
It is said they eat the pithless leaves of various trees and so on.
Người ta nói rằng chúng ăn nhiều loại lá cây không có chất dinh dưỡng, v.v.
Tesampi āhārato gunnaṃ āhāro sukhumo.
Compared to their food, the food of cattle is subtle.
So với thức ăn của chúng, thức ăn của bò là vi tế.
Te allasukkhatiṇāni khādanti.
They eat wet and dry grass.
Chúng ăn cỏ tươi và cỏ khô.
Tesaṃ āhārato sasānaṃ āhāro sukhumo.
Compared to their food, the food of rabbits is subtle.
So với thức ăn của bò, thức ăn của thỏ là vi tế.
Sasānaṃ āhārato sakuṇānaṃ āhāro sukhumo.
Compared to the food of rabbits, the food of birds is subtle.
So với thức ăn của thỏ, thức ăn của chim là vi tế.
Sakuṇānaṃ āhārato paccantavāsīnaṃ āhāro sukhumo.
Compared to the food of birds, the food of border-region dwellers is subtle.
So với thức ăn của chim, thức ăn của những người sống ở vùng biên giới là vi tế.
Paccantavāsīnaṃ āhārato gāmabhojakānaṃ āhāro sukhumo.
Compared to the food of border-region dwellers, the food of village headmen is subtle.
So với thức ăn của những người sống ở vùng biên giới, thức ăn của các vị trưởng làng là vi tế.
Gāmabhojakānaṃ āhārato rājarājamahāmattānaṃ āhāro sukhumo.
Compared to the food of village headmen, the food of kings and royal ministers is subtle.
So với thức ăn của các vị trưởng làng, thức ăn của vua và các đại thần là vi tế.
Tesampi āhārato cakkavattino āhāro sukhumo.
Compared to their food, the food of a wheel-turning monarch is subtle.
So với thức ăn của họ, thức ăn của một vị Chuyển Luân Vương là vi tế.
Cakkavattino āhārato bhummadevānaṃ āhāro sukhumo.
Compared to the food of a wheel-turning monarch, the food of earth-bound devas is subtle.
So với thức ăn của một vị Chuyển Luân Vương, thức ăn của các vị thiên nhân địa cư là vi tế.
Bhummadevānaṃ āhārato cātumahārājikānaṃ āhāro sukhumo.
Compared to the food of earth-bound devas, the food of the devas of the Cātumahārājika realm is subtle.
So với thức ăn của các vị thiên nhân địa cư, thức ăn của các vị Tứ Đại Thiên Vương là vi tế.
Evaṃ yāva paranimmitavasavattīnaṃ āhāro vitthāretabbo, tesaṃ āhāro sukhumotveva niṭṭhaṃ patto.
Thus it should be elaborated up to the food of the Paranimmitavasavattī devas; their food is concluded to be the most subtle.
Cứ như thế, thức ăn của các vị thiên nhân cho đến cõi Tha Hóa Tự Tại Thiên (Paranimmitavasavattī) cũng phải được diễn giải rộng ra, và kết luận rằng thức ăn của họ là vi tế.
Ettha ca oḷārike vatthusmiṃ ojā parittā hoti dubbalā, sukhume balavatī.
Herein, in a gross physical basis, the nutritive essence is little and weak; in a subtle one, it is powerful.
Ở đây, trong vật chất thô, chất dinh dưỡng (ojā) ít và yếu, trong vật chất vi tế thì mạnh mẽ.
Tathā hi ekapattapūrampi yāguṃ pīvato muhutteneva jighacchito hoti, yaṃkañcideva khāditukāmo.
Indeed, one who drinks even a full bowl of gruel feels hungry in a moment and wants to eat something or other.
Do đó, người uống một bát cháo đầy chỉ trong chốc lát đã đói trở lại, muốn ăn bất cứ thứ gì.
Sappiṃ pana pasaṭamattaṃ pivitvā divasaṃ abhottukāmo hoti.
But having drunk just a spoonful of ghee, one does not want to eat for a whole day.
Nhưng người uống một thìa bơ sữa (sappiṃ) thì không muốn ăn gì cả ngày.
Tattha vatthu parissamaṃ vinodeti, na pana sakkoti pāletuṃ.
Therein, the physical basis alleviates fatigue, but cannot sustain.
Trong trường hợp đó, vật chất chỉ làm dịu đi sự mệt mỏi, nhưng không thể duy trì.
Ojā pāleti, na sakkoti parissamaṃ vinodetuṃ.
The nutritive essence sustains, but cannot alleviate fatigue.
Chất dinh dưỡng (ojā) duy trì, nhưng không thể làm dịu đi sự mệt mỏi.
Dve pana ekato hutvā parissamañceva vinodenti pālenti cāti.
But the two together both alleviate fatigue and sustain.
Tuy nhiên, khi cả hai kết hợp lại, chúng vừa làm dịu đi sự mệt mỏi vừa duy trì.
Phasso dutiyoti cakkhusamphassādi chabbidhopi phasso.
Phasso dutiyo (contact is the second): this refers to all six kinds of contact, beginning with eye-contact.
Phasso dutiyo (Xúc là thứ hai) là sáu loại xúc, như nhãn xúc, v.v.
Etesu catūsu āhāresu dutiyo āhāroti veditabbo.
It should be understood as the second nutriment among these four nutriments.
Trong bốn loại thức ăn này, nó phải được hiểu là thức ăn thứ hai.
Desanānayo eva cesa.
And this is just the method of exposition.
Đây chỉ là một phương pháp giảng dạy.
Tasmā iminā nāma kāraṇena dutiyo vā tatiyo vāti idamettha na gavesitabbaṃ.
Therefore, one should not investigate here why it is called the second or third for this or that reason.
Do đó, không cần phải tìm hiểu lý do tại sao nó là thứ hai hay thứ ba.
Manosañcetanāti cetanā eva vuccati.
Manosañcetanā (mental volition): only volition (cetanā) is meant.
Manosañcetanā (Tư tâm sở) chỉ là ý tư (cetanā).
Viññāṇanti yaṃkiñci cittaṃ.
Viññāṇa (consciousness): any kind of consciousness (citta).
Viññāṇaṃ (Thức) là bất kỳ loại tâm nào.
Etthāha, yadi paccayaṭṭho āhāraṭṭho, atha kasmā aññesupi sattānaṃ paccayesu vijjamānesu imeyeva cattāro vuttāti?
Here it is asked: if the meaning of nutriment is that of a condition, then why, when there are other conditions for beings, are only these four mentioned?
Ở đây có người hỏi: Nếu ý nghĩa của 'āhāra' là 'duyên' (paccaya), vậy tại sao chỉ có bốn loại này được đề cập trong khi có nhiều duyên khác cho chúng sinh?
Vuccate, ajjhattikasantatiyā visesapaccayattā.
It is said: because they are specific conditions for the internal continuity.
Trả lời: Vì chúng là những duyên đặc biệt cho dòng tương tục nội tại.
Visesapaccayo hi kabaḷīkārāhārabhakkhānaṃ sattānaṃ rūpakāyassa kabaḷīkāro āhāro.
Indeed, for beings who consume edible food, edible food is the specific condition for the physical body (rūpakāya).
Thật vậy, đối với chúng sinh ăn thức ăn vật chất, thức ăn vật chất là duyên đặc biệt cho thân sắc.
Nāmakāye vedanāya phasso, viññāṇassa manosañcetanā, nāmarūpassa viññāṇaṃ.
In the mental body (nāmakāya), contact is for feeling; mental volition is for consciousness; and consciousness is for name-and-form (nāmarūpa).
Trong thân danh, xúc là duyên cho thọ, ý tư là duyên cho thức, thức là duyên cho danh sắc.
Yathāha –
As it is said:
Như đã nói:
Kathaṃ?
How?
Bằng cách nào?
Kabaḷīkārāhāro hi upatthambhentoyeva kāyaṭṭhapanena sattānaṃ ṭhitiyā hoti.
The nutriment of edible food, by supporting and thereby establishing the body, contributes to the endurance of beings.
Thức ăn vật chất, bằng cách hỗ trợ, duy trì thân thể, là sự tồn tại cho chúng sinh.
Kammajanitopi hi ayaṃ kāyo kabaḷīkārāhārena upatthambhito dasapi vassāni vassasatampi yāva āyuparimāṇaṃ tiṭṭhati.
Indeed, this body, though born of kamma, when supported by the nutriment of physical food, endures for ten years, a hundred years, for as long as the lifespan extends.
Thật vậy, thân này, dù do nghiệp sinh ra, được duy trì bởi thực phẩm thô (kabaḷīkārāhāra) thì vẫn tồn tại mười năm, một trăm năm, hoặc cho đến hết tuổi thọ.
Yathā kiṃ?
Like what?
Ví như điều gì?
Yathā mātuyā janitopi dārako dhātiyā thaññādīni pāyetvā posiyamānova ciraṃ tiṭṭhati, yathā cupatthambhena upatthambhitagehaṃ.
Just as a child, though born of its mother, endures for a long time only when nourished by a wet nurse who gives it milk and so on to drink, and just as a house propped up by a support stands for a long time.
Ví như đứa trẻ dù do mẹ sinh ra, được vú nuôi cho bú sữa và nuôi dưỡng thì tồn tại lâu dài; ví như ngôi nhà được chống đỡ bằng cột chống.
Vuttampi cetaṃ –
And this has been said:
Và điều này cũng đã được nói:
Evaṃ upatthambhanādivasena āhārakiccaṃ sādhayamānesu panetesu cattāri bhayāni daṭṭhabbāni.
Thus, in these four nutriments which accomplish the function of nutriment through supporting and so on, four dangers should be seen.
Khi các loại thức ăn này hoàn thành chức năng nuôi dưỡng, v.v., thì bốn nỗi sợ hãi cần được nhận thấy.
Seyyathidaṃ, kabaḷīkārāhāre nikantiyeva bhayaṃ, phasse upagamanameva, manosañcetanāya āyūhanameva, viññāṇe abhinipātoyeva bhayanti.
That is to say: in the nutriment of physical food, desire itself is the danger; in contact, the mere approach; in mental volition, the mere accumulation; in consciousness, the mere descent is the danger.
Đó là: trong thực phẩm thô (kabaḷīkārāhāra) thì sự ham muốn (nikanti) là nỗi sợ hãi; trong xúc (phassa) thì sự tiếp cận (upagamana) là nỗi sợ hãi; trong ý tư (manosañcetanā) thì sự nỗ lực (āyūhana) là nỗi sợ hãi; và trong thức (viññāṇa) thì sự tái sinh (abhinipāta) là nỗi sợ hãi.
Kiṃ kāraṇā?
For what reason?
Vì lý do gì?
Kabaḷīkārāhāre hi nikantiṃ katvā sītādīnaṃ purekkhatā sattā āhāratthāya muddāgaṇanādikammāni karontā anappakaṃ dukkhaṃ nigacchanti.
Because, having generated desire for the nutriment of physical food, beings, motivated by cold and so on, perform actions like calculating with seals for the sake of food, and they undergo immense suffering.
Thật vậy, do ham muốn (nikanti) thực phẩm thô (kabaḷīkārāhāra), chúng sinh bị lạnh, v.v. chi phối, phải làm các công việc như đếm ngón tay để kiếm thức ăn, và phải chịu không ít khổ đau.
Ekacce ca imasmiṃ sāsane pabbajitvāpi vejjakammādikāya anesanāya āhāraṃ pariyesantā diṭṭhepi dhamme gārayhā honti.
And some, even after going forth in this Dispensation, are reprehensible in this very life while seeking food through wrong livelihood such as medical practice.
Một số người, dù đã xuất gia trong giáo pháp này, nhưng lại tìm kiếm thức ăn bằng những cách sống không chân chính như nghề y, v.v., thì bị chỉ trích ngay trong đời này.
Samparāyepi tassa saṅghāṭipi ādittā sampajjalitātiādinā lakkhaṇasaṃyutte vuttanayena samaṇapetā honti.
In the next life, they become ascetic petas, in the way described in the Lakkhaṇa Saṃyutta, with such statements as, “His outer robe is blazing and burning.”
Và trong đời sau, họ trở thành ngạ quỷ Sa-môn (samaṇapeta), như đã nói trong Lakkhaṇasaṃyutta rằng: “Y phục của vị ấy bốc cháy, rực lửa,” v.v.
Imināva tāva kāraṇena kabaḷīkārāhāre nikantiyeva bhayanti veditabbā.
For this very reason, it should be understood that in the nutriment of physical food, desire itself is the danger.
Chính vì lý do này mà cần phải hiểu rằng trong thực phẩm thô (kabaḷīkārāhāra) thì sự ham muốn (nikanti) là nỗi sợ hãi.
Phassaṃ upagacchantāpi phassassādino paresaṃ rakkhitagopitesu dārādīsu bhaṇḍesu aparajjhanti.
Those who approach contact, delighting in contact, transgress with regard to the wives and other possessions of others that are guarded and protected.
Những người tiếp cận xúc (phassa) và say đắm trong xúc (phassassādin) cũng phạm lỗi đối với vợ con, v.v., và tài sản được người khác bảo vệ, giữ gìn.
Te saha bhaṇḍena bhaṇḍasāmikā gahetvā khaṇḍākhaṇḍikaṃ vā chinditvā saṅkārakūṭesu chaḍḍenti.
The owners of the possessions seize them along with the goods, either cut them to pieces and throw them on a rubbish heap,
Những người chủ tài sản bắt họ cùng với tài sản, hoặc chặt họ thành từng mảnh rồi vứt vào đống rác.
Rañño vā niyyātenti.
or hand them over to the king.
Hoặc giao nộp họ cho vua.
Tato ne rājā vividhā kammakāraṇā kārāpeti.
Then the king has various punishments inflicted on them.
Từ đó, nhà vua bắt họ chịu các hình phạt khác nhau.
Kāyassa ca bhedā duggati nesaṃ pāṭikaṅkhā hoti.
And at the breakup of the body, a woeful destination is to be expected for them.
Và sau khi thân hoại, họ phải chịu ác thú (duggati).
Iti phassassādamūlakaṃ diṭṭhadhammikampi samparāyikampi bhayaṃ sabbamāgatameva hoti.
Thus, all danger, both in this life and in the next, which is rooted in the delight in contact, has indeed arrived.
Như vậy, tất cả nỗi sợ hãi trong đời này và đời sau, có cội rễ từ sự say đắm trong xúc (phassassāda), đều đến.
Iminā kāraṇena phassāhāre upagamanameva bhayanti veditabbaṃ.
For this reason, it should be understood that in the nutriment of contact, the mere approach is the danger.
Chính vì lý do này mà cần phải hiểu rằng trong thức ăn xúc (phassāhāra) thì sự tiếp cận (upagamana) là nỗi sợ hãi.
Evaṃ sabhayesu pana imesu āhāresu sammāsambuddho kabaḷīkārāhāre nikantipariyādānatthaṃ ‘‘seyyathāpi, bhikkhave, dve jāyampatikā’’tiādinā (saṃ. ni. 2.63) nayena puttamaṃsūpamaṃ desesi.
Thus, regarding these nutriments fraught with danger, the Perfectly Enlightened One, in order to overcome desire for the nutriment of physical food, taught the simile of the son’s flesh with the passage beginning, “Suppose, monks, a couple...”
Trong các loại thức ăn đầy hiểm nguy này, Đức Chánh Đẳng Giác đã thuyết giảng ví dụ về thịt con trai (puttamaṃsūpama) với cách nói “Này các Tỳ-kheo, ví như hai vợ chồng,” v.v. (Saṃ. Ni. 2.63), để đoạn trừ sự ham muốn (nikanti) trong thực phẩm thô (kabaḷīkārāhāra).
Phassāhāre nikantipariyādānatthaṃ ‘‘seyyathāpi, bhikkhave, gāvī niccammā’’tiādinā nayena niccammagāvūpamaṃ desesi.
To overcome desire for the nutriment of contact, he taught the simile of the flayed cow with the passage beginning, “Suppose, monks, a flayed cow...”
Để đoạn trừ sự ham muốn (nikanti) trong thức ăn xúc (phassāhāra), Ngài đã thuyết giảng ví dụ về con bò không da (niccammagāvūpama) với cách nói “Này các Tỳ-kheo, ví như một con bò không da,” v.v.
Manosañcetanāhāre nikantipariyādānatthaṃ ‘‘seyyathāpi, bhikkhave, aṅgārakāsū’’tiādinā nayena aṅgārakāsūpamaṃ desesi.
To overcome desire for the nutriment of mental volition, he taught the simile of the charcoal pit with the passage beginning, “Suppose, monks, a charcoal pit...”
Để đoạn trừ sự ham muốn (nikanti) trong thức ăn ý tư (manosañcetanāhāra), Ngài đã thuyết giảng ví dụ về hố than hồng (aṅgārakāsūpama) với cách nói “Này các Tỳ-kheo, ví như một hố than hồng,” v.v.
Viññāṇāhāre nikantipariyādānatthaṃ ‘‘seyyathāpi, bhikkhave, coraṃ āgucāri’’ntiādinā nayena sattisatāhatūpamaṃ desesi.
To overcome desire for the nutriment of consciousness, he taught the simile of the man struck by a hundred spears with the passage beginning, “Suppose, monks, a criminal, a wrongdoer...”
Để đoạn trừ sự ham muốn (nikanti) trong thức ăn thức (viññāṇāhāra), Ngài đã thuyết giảng ví dụ về người bị trăm mũi giáo đâm (sattisatāhatūpama) với cách nói “Này các Tỳ-kheo, ví như một tên trộm phạm tội,” v.v.
Tatrāyaṃ bhūtamatthaṃ katvā saṅkhepato atthayojanā, dve kira jāyampatikā puttaṃ gahetvā parittena pātheyyena yojanasatikaṃ kantāramaggaṃ paṭipajjiṃsu.
Herein, establishing the actual events, is a brief explanation of the meaning. It is said that a couple, taking their son and a small amount of provisions, set out on a journey through a hundred-yojana wilderness.
Trong số đó, đây là sự giải thích ý nghĩa tóm tắt, dựa trên sự việc có thật: Có hai vợ chồng nọ, mang theo con trai, lên đường đi qua một sa mạc dài một trăm do-tuần với ít lương thực.
Tesaṃ paññāsa yojanāni gantvā pātheyyaṃ niṭṭhāsi.
After they had gone fifty yojanas, their provisions were exhausted.
Khi đi được năm mươi do-tuần, lương thực của họ đã hết.
Te khuppipāsāturā viraḷacchāyāyaṃ nisīdiṃsu.
Afflicted by hunger and thirst, they sat down in a place with sparse shade.
Họ đói khát, ngồi dưới bóng cây thưa thớt.
Tato puriso bhariyaṃ āha ‘‘bhadde ito samantā paññāsa yojanāni gāmo vā nigamo vā natthi, tasmā yaṃ taṃ purisena kātabbaṃ bahumpi kasigorakkhādikammaṃ, na dāni sakkā taṃ mayā kātuṃ, ehi maṃ māretvā upaḍḍhamaṃsaṃ khāditvā upaḍḍhaṃ pātheyyaṃ katvā puttena saddhiṃ kantāraṃ nittharāhī’’ti.
Then the husband said to his wife, “My dear, for fifty yojanas all around from here, there is no village or town. Therefore, whatever work a man should do, such as much farming and cattle-herding, I can no longer do it. Come, kill me, eat half the flesh, make the other half into provisions, and cross the wilderness with our son.”
Sau đó, người chồng nói với vợ: “Này em, từ đây trong vòng năm mươi do-tuần không có làng mạc hay thị trấn nào. Vì vậy, những công việc lớn lao mà một người đàn ông phải làm, như cày cấy, chăn nuôi, v.v., bây giờ anh không thể làm được nữa. Em hãy đến, giết anh đi, ăn một nửa thịt, làm một nửa thành lương thực, rồi cùng con vượt qua sa mạc này.”
Sāpi āha ‘‘sāmi mayā dāni yaṃ taṃ itthiyā kātabbaṃ bahumpi suttakantanādikammaṃ, taṃ kātuṃ na sakkā, ehi maṃ māretvā upaḍḍhamaṃsaṃ khāditvā upaḍḍhaṃ pātheyyaṃ katvā puttena saddhiṃ kantāraṃ nittharāhī’’ti.
She too said, “My lord, whatever work a woman should do, such as much spinning of thread, I can no longer do it. Come, kill me, eat half the flesh, make the other half into provisions, and cross the wilderness with our son.”
Người vợ cũng nói: “Thưa chồng, những công việc lớn lao mà một người phụ nữ phải làm, như kéo sợi, v.v., bây giờ em không thể làm được nữa. Anh hãy đến, giết em đi, ăn một nửa thịt, làm một nửa thành lương thực, rồi cùng con vượt qua sa mạc này.”
Tato so taṃ āha ‘‘bhadde mātugāmamaraṇena dvinnaṃ maraṇaṃ paññāyati.
Then he said to her, “My dear, with the death of a woman, the death of two is apparent.
Sau đó, người chồng nói với vợ: “Này em, cái chết của người phụ nữ sẽ dẫn đến cái chết của cả hai.
Na hi mando kumāro mātaraṃ vinā jīvituṃ sakkoti.
For a young boy cannot live without his mother.
Vì đứa bé yếu ớt không thể sống thiếu mẹ.
Yadi pana mayaṃ jīvāma, puna dārakaṃ labheyyāma, handa dāni puttakaṃ māretvā maṃsaṃ gahetvā kantāraṃ nittharāmā’’ti.
But if we live, we might have another child. Come now, let us kill our son, take the flesh, and cross the wilderness.”
Nhưng nếu chúng ta sống sót, chúng ta có thể có con lần nữa. Thôi, bây giờ chúng ta hãy giết đứa con, lấy thịt của nó, rồi cùng nhau vượt qua sa mạc này.”
Tato mātā puttamāha ‘‘tāta pitu santikaṃ gacchāhī’’ti.
Then the mother said to the son, “My dear, go to your father.”
Sau đó, người mẹ nói với con: “Con trai, con hãy đến chỗ cha.”
So agamāsi.
He went.
Đứa bé đi đến.
Athassa pitā ‘‘mayā puttakaṃ posessāmīti kasigorakkhādīhi anappakaṃ dukkhamanubhūtaṃ, na sakkomi puttaṃ māretuṃ, tvaṃyeva tava puttakaṃ mārehī’’ti vatvā ‘‘tāta mātusantikameva gacchāhī’’ti āha.
Then his father, thinking, “I have endured immense suffering from farming, cattle-herding, and so on, intending to raise my son. I cannot kill my son. You yourself kill your son,” said, “My dear, just go to your mother.”
Lúc đó, người cha nói: “Ta đã chịu không ít khổ đau vì cày cấy, chăn nuôi, v.v., với ý định nuôi con. Ta không thể giết con. Con hãy tự giết con của mình đi,” rồi nói: “Con trai, con hãy đến chỗ mẹ.”
So agamāsi.
He went.
Đứa bé đi đến.
Athassa mātāpi ‘‘mayā puttaṃ patthentiyā govatakukkuravatadevatāyācanādīhipi tāva anappakaṃ dukkhaṃ anubhūtaṃ, ko pana vādo kucchinā pariharantiyā?
Then his mother too, thinking, “While wishing for a son, I endured immense suffering from observances like the cow-vow and the dog-vow, making pleas to deities, and so on. What can be said of the suffering while carrying him in my womb?
Lúc đó, người mẹ cũng nói: “Ta đã chịu không ít khổ đau khi mong có con, thậm chí phải cầu nguyện các vị thần linh, tuân giữ các giới hạnh như bò, chó, v.v. Huống hồ là khi mang thai con trong bụng?
Na sakkāhaṃ puttaṃ māretu’’nti vatvā ‘‘tāta pitusantikaṃyeva gacchāhī’’ti āha.
I cannot kill my son,” said, “My dear, just go to your father.”
Ta không thể giết con,” rồi nói: “Con trai, con hãy đến chỗ cha.”
Evaṃ so dvinnaṃ antarā gacchantoyeva mato.
Thus, while going back and forth between the two, he died.
Cứ như vậy, đứa bé chết ngay khi đang đi lại giữa hai người.
Te taṃ disvā paridevitvā pubbe vuttanayeneva maṃsāni gahetvā khādantā pakkamiṃsu.
Seeing him, they lamented, and in the manner previously described, they took the flesh, and eating it, they departed.
Hai người thấy vậy, than khóc, rồi lấy thịt theo cách đã nói trước đó, ăn và tiếp tục đi.
Tesaṃ so puttamaṃsāhāro navahi kāraṇehi paṭikulattā neva davāya hoti, na madāya na maṇḍanāya na vibhūsanāya, kevalaṃ kantāranittharaṇatthāyeva hoti.
For them, that meal of their son’s flesh, being repulsive for nine reasons, was not for amusement, not for intoxication, not for adornment, not for beautification; it was solely for the purpose of crossing the wilderness.
Đối với hai vợ chồng đó, thức ăn là thịt con trai (puttamaṃsāhāra) này, vì ghê tởm bởi chín lý do, nên không phải để vui chơi, không phải để say sưa, không phải để trang điểm, không phải để làm đẹp, mà chỉ thuần túy là để vượt qua sa mạc.
Katamehi navahi kāraṇehi paṭikūloti ce?
If it is asked, “For which nine reasons is it repulsive?”
Nếu hỏi: “Vì chín lý do nào mà ghê tởm?”
Sajātimaṃsatāya ñātimaṃsatāya puttamaṃsatāya piyaputtamaṃsatāya taruṇamaṃsatāya āmakamaṃsatāya agorasamaṃsatāya aloṇatāya adhūpitatāyāti.
Because it is the flesh of one’s own species, the flesh of a relative, the flesh of a son, the flesh of a beloved son, tender flesh, raw flesh, unsavory flesh, unsalted, and unsmoked.
Đó là: vì là thịt đồng loại, vì là thịt thân quyến, vì là thịt con, vì là thịt con yêu quý, vì là thịt non, vì là thịt sống, vì là thịt không mua ở chợ, vì không có muối, vì không được hun khói.
Tasmā yo bhikkhu kabaḷīkārāhāraṃ evaṃ puttamaṃsasadisaṃ passati, so tattha nikantiṃ pariyādiyati.
Therefore, whichever bhikkhu sees physical nutriment as being like the flesh of a son, he exhausts craving for it.
Do đó, Tỳ-khưu nào thấy thực phẩm nuôi dưỡng thân thể (kabaḷīkārāhāra) giống như thịt con mình như vậy, vị ấy sẽ diệt trừ sự ham muốn (nikanti) đối với nó.
Ayaṃ tāva puttamaṃsūpamāyaṃ atthayojanā.
This, for now, is the application of the meaning in the simile of the son's flesh.
Trước hết, đây là sự giải thích ý nghĩa trong ví dụ thịt con trai.
Niccammagāvūpamāyaṃ pana yathā sā gāvī gīvato yāva khurā, tāva cammaṃ uddāletvā muttā yaṃ yadeva nissāya tiṭṭhati, tattha pāṇakehi khajjamānā dukkhassevādhikaraṇaṃ hoti, evaṃ phassopi yaṃ yadeva vatthuṃ ārammaṇaṃ vā nissāya tiṭṭhati, taṃtaṃvatthārammaṇasambhavassa vedayitadukkhassa adhikaraṇameva hoti.
But in the simile of the flayed cow, just as that cow, having been flayed from the neck to the hooves and then released, becomes a basis for suffering wherever it stands, being devoured by creatures that prey on it, so too contact, whatever physical basis or object it depends on, becomes a basis for the felt suffering that arises from that particular physical basis and object.
Trong ví dụ con bò không da, giống như con bò cái bị lột da từ cổ đến móng, khi được thả ra, nó dựa vào bất cứ thứ gì, và ở đó, nó bị các loài côn trùng gặm nhấm, chỉ trở thành nơi chứa đựng khổ đau. Tương tự như vậy, xúc (phassa) cũng vậy, bất cứ vật hay đối tượng nào mà nó nương tựa, thì chính vật và đối tượng đó trở thành nơi chứa đựng khổ đau được cảm nhận, phát sinh từ đó.
Tasmā yo bhikkhu phassāhāraṃ evaṃ niccammagāvisadisaṃ passati, so tattha nikantiṃ pariyādiyati, ayaṃ niccammagāvūpamāyaṃ atthayojanā.
Therefore, whichever bhikkhu sees the nutriment of contact as being like a flayed cow, he exhausts craving for it. This is the application of the meaning in the simile of the flayed cow.
Do đó, Tỳ-khưu nào thấy xúc thực (phassāhāra) giống như con bò không da như vậy, vị ấy sẽ diệt trừ sự ham muốn (nikanti) đối với nó. Đây là sự giải thích ý nghĩa trong ví dụ con bò không da.
Aṅgārakāsūpamāyaṃ pana yathā sā aṅgārakāsu, evaṃ mahāpariḷāhaṭṭhena tayo bhavā.
But in the simile of the charcoal pit, just as that charcoal pit, so the three kinds of existence are of great torment.
Trong ví dụ hố than hồng, ba cõi (bhava) giống như hố than hồng, với ý nghĩa là sự thiêu đốt mãnh liệt.
Yathā nānābāhāsu gahetvā tattha upakaḍḍhakā dve purisā, evaṃ bhavesu upakaḍḍhanaṭṭhena manosañcetanā.
Just as the two men who, seizing a man by his various arms, drag him towards it, so is mental volition in its function of dragging one into the kinds of existence.
Giống như hai người đàn ông nắm cánh tay kéo vào đó, thì ý tư (manosañcetanā) có ý nghĩa là sự kéo vào các cõi.
Tasmā yo bhikkhu manosañcetanāhāraṃ evaṃ aṅgārakāsūpakaḍḍhakapurisasadisaṃ passati, so tattha nikantiṃ pariyādiyati, ayaṃ aṅgārakāsūpamāyaṃ atthayojanā.
Therefore, whichever bhikkhu sees the nutriment of mental volition as being like the men dragging one toward a charcoal pit, he exhausts craving for it. This is the application of the meaning in the simile of the charcoal pit.
Do đó, Tỳ-khưu nào thấy ý tư thực (manosañcetanāhāra) giống như hai người đàn ông kéo vào hố than hồng như vậy, vị ấy sẽ diệt trừ sự ham muốn (nikanti) đối với nó. Đây là sự giải thích ý nghĩa trong ví dụ hố than hồng.
Sattisatāhatūpamāyaṃ pana yena so puriso pubbaṇhasamaye sattisatena haññati, tamassa sarīre vaṇamukhasataṃ katvā antarā aṭṭhatvā vinivijjhitvā aparabhāgeyeva patati, evaṃ itarāni dve sattisatāni, evamassa patitokāse apatitvā apatitvā gatāhi sattīhi sabbasarīraṃ chiddāvachiddameva hoti, tassa ekavaṇamukhepi uppannassa dukkhassa pamāṇaṃ natthi, ko pana vādo tīsu vaṇamukhasatesu?
But in the simile of the man struck by a hundred spears, with the hundred spears that the man is struck in the morning, a hundred wound-openings are made in his body, which pass through without remaining inside and fall on the other side. Similarly, the other two sets of a hundred spears. In this way, his whole body is riddled with holes by spears that did not fall in the places where previous spears had struck. The suffering that arises even in a single wound-opening is immeasurable, so what is to be said of three hundred wound-openings?
Trong ví dụ người bị đâm trăm mũi giáo, giống như người đàn ông bị đâm bởi một trăm mũi giáo vào buổi sáng, tạo ra một trăm vết thương trên cơ thể, những mũi giáo đó không mắc kẹt mà xuyên qua và rơi ra ở phía bên kia. Tương tự như vậy, hai trăm mũi giáo còn lại cũng xuyên qua. Cứ như vậy, với những mũi giáo không ngừng rơi vào những chỗ chưa bị đâm, toàn bộ cơ thể của người ấy trở nên đầy rẫy những vết thương. Khổ đau phát sinh từ một vết thương cũng không thể đo lường được, huống chi là từ ba trăm vết thương?
Tattha sattinipātakālo viya paṭisandhiviññāṇanibbattakālo.
Therein, the time of the occurrence of relinking-consciousness is like the time the spears strike.
Ở đây, thời điểm mũi giáo đâm vào giống như thời điểm tái sinh thức (paṭisandhiviññāṇa) phát sinh.
Vaṇamukhajananaṃ viya khandhajananaṃ.
The generation of the aggregates is like the creation of the wound-openings.
Việc tạo ra vết thương giống như việc tạo ra các uẩn (khandha).
Vaṇamukhesu dukkhavedanuppādo viya jātesu khandhesu vaṭṭamūlakanānāvidhadukkhuppādo.
The arising of various kinds of suffering rooted in the round of rebirth in the generated aggregates is like the arising of painful feeling in the wound-openings.
Sự phát sinh khổ thọ tại các vết thương giống như sự phát sinh các loại khổ đau khác nhau có gốc rễ từ vòng luân hồi (vaṭṭa) trên các uẩn đã sinh.
Aparo nayo, āgucārī puriso viya paṭisandhiviññāṇaṃ.
Another method: relinking-consciousness is like a criminal.
Một phương pháp khác là, tái sinh thức (paṭisandhiviññāṇa) giống như một người phạm tội.
Tassa sattighātehi uppannavaṇamukhāni viya viññāṇapaccayā nāmarūpaṃ.
Mind-and-matter conditioned by consciousness is like the wound-openings that arose from the spear strikes on that man.
Danh sắc (nāmarūpa) do duyên thức (viññāṇa) phát sinh giống như những vết thương do bị đâm giáo.
Vaṇamukhapaccayā tassa purisassa kakkhaḷadukkhuppādo viya nāmarūpapaccayā viññāṇassa dvattiṃsakammakāraṇaaṭṭhanavutirogādivasena nānappakārakadukkhuppādo daṭṭhabbo.
The arising of various kinds of suffering for consciousness—such as the thirty-two tortures and ninety-eight diseases—conditioned by mind-and-matter, should be seen as being like the arising of harsh suffering for that man, conditioned by the wound-openings.
Khổ đau dữ dội phát sinh cho người đó do duyên các vết thương giống như sự phát sinh các loại khổ đau khác nhau cho thức (viññāṇa) do duyên danh sắc (nāmarūpa), chẳng hạn như ba mươi hai loại hình phạt hành hạ (kammakāraṇa) và chín mươi tám loại bệnh tật, v.v., cần phải hiểu như vậy.
Tasmā yo bhikkhu viññāṇāhāraṃ evaṃ sattisatāhatasadisaṃ passati.
Therefore, whichever bhikkhu sees the nutriment of consciousness as being like the man struck by a hundred spears,
Do đó, Tỳ-khưu nào thấy thức thực (viññāṇāhāra) giống như người bị đâm trăm mũi giáo như vậy.
So tattha nikantiṃ pariyādiyati, ayaṃ sattisatāhatūpamāyaṃ atthayojanā.
he exhausts craving for it. This is the application of the meaning in the simile of the man struck by a hundred spears.
Vị ấy diệt trừ sự ham muốn (nikanti) đối với nó. Đây là sự giải thích ý nghĩa trong ví dụ người bị đâm trăm mũi giáo.
‘‘Kabaḷīkāre, bhikkhave, āhāre pariññāte pañcakāmaguṇiko rāgo pariññāto hoti.
"Bhikkhus, when the nutriment of physical food is fully understood, lust for the five cords of sensual pleasure is fully understood.
“Này các Tỳ-khưu, khi thực phẩm nuôi dưỡng thân thể (kabaḷīkārāhāra) được thấu hiểu, thì tham ái năm dục (pañcakāmaguṇiko rāgo) cũng được thấu hiểu.
Pañcakāmaguṇike rāge pariññāte natthi taṃ saṃyojanaṃ, yena saṃyojanena saṃyutto ariyasāvako puna imaṃ lokaṃ āgaccheyya.
When lust for the five cords of sensual pleasure is fully understood, there is no fetter bound by which a noble disciple might come again to this world.
Khi tham ái năm dục được thấu hiểu, không còn có kiết sử nào mà một đệ tử thánh (ariyasāvako) bị trói buộc bởi kiết sử đó mà phải trở lại thế giới này nữa.
Phasse, bhikkhave, āhāre pariññāte tisso vedanā pariññātā honti.
Bhikkhus, when the nutriment of contact is fully understood, the three kinds of feeling are fully understood.
Này các Tỳ-khưu, khi xúc thực (phassāhāra) được thấu hiểu, thì ba loại cảm thọ (tisso vedanā) cũng được thấu hiểu.
Tīsu vedanāsu pariññātāsu ariyasāvakassa natthi kiñci uttarikaraṇīyanti vadāmi.
When the three kinds of feeling are fully understood, I say there is nothing further for a noble disciple to do.
Khi ba loại cảm thọ được thấu hiểu, Ta nói rằng đệ tử thánh không còn việc gì phải làm thêm nữa.
Manosañcetanāya, bhikkhave, āhāre pariññāte tisso taṇhā pariññātā honti.
Bhikkhus, when the nutriment of mental volition is fully understood, the three kinds of craving are fully understood.
Này các Tỳ-khưu, khi ý tư thực (manosañcetanāhāra) được thấu hiểu, thì ba loại tham ái (tisso taṇhā) cũng được thấu hiểu.
Tīsu taṇhāsu pariññātāsu ariyasāvakassa natthi kiñci uttarikaraṇīyanti vadāmi.
When the three kinds of craving are fully understood, I say there is nothing further for a noble disciple to do.
Khi ba loại tham ái được thấu hiểu, Ta nói rằng đệ tử thánh không còn việc gì phải làm thêm nữa.
Viññāṇe, bhikkhave, āhāre pariññāte nāmarūpaṃ pariññātaṃ hoti.
Bhikkhus, when the nutriment of consciousness is fully understood, mind-and-matter is fully understood.
Này các Tỳ-khưu, khi thức thực (viññāṇāhāra) được thấu hiểu, thì danh sắc (nāmarūpa) cũng được thấu hiểu.
Nāmarūpe pariññāte ariyasāvakassa natthi kiñci uttarikaraṇīyanti vadāmī’’ti (saṃ. ni. 2.63).
When mind-and-matter is fully understood, I say there is nothing further for a noble disciple to do."
Khi danh sắc được thấu hiểu, Ta nói rằng đệ tử thánh không còn việc gì phải làm thêm nữa.”
Taṇhāsamudayā āhārasamudayoti purimataṇhāsamudayā paṭisandhikānaṃ āhārānaṃ samudayo nibbatto hotīti attho.
From the arising of craving, there is the arising of nutriment means: from the arising of craving in a previous existence, the arising of nutriments at relinking comes to be.
Do tham ái tập khởi, các thực phẩm tập khởi – có nghĩa là do tham ái ở kiếp trước tập khởi, các thực phẩm tái sinh (paṭisandhika) phát sinh.
Kathaṃ?
How so?
Như thế nào?
Paṭisandhikkhaṇe hi tisantativasena uppannasamatiṃsarūpabbhantare jātā ojā atthi.
At the moment of relinking, there is nutritive essence present within the thirty material phenomena that arise through the three continuities of decads.
Vào khoảnh khắc tái sinh (paṭisandhikkhaṇa), có chất dinh dưỡng (ojā) phát sinh bên trong ba mươi loại sắc (rūpa) đã sinh theo ba chuỗi (tisantati).
Ayaṃ taṇhāpaccayā nibbatto upādinnakakabaḷīkārāhāro.
This is the physical nutriment that is clung to, which has arisen conditioned by craving.
Đây là thực phẩm nuôi dưỡng thân thể (kabaḷīkārāhāra) bị nắm giữ (upādinna) phát sinh do duyên tham ái.
Paṭisandhicittasampayuttā pana phassacetanā sayañca cittaṃ viññāṇanti ime taṇhāpaccayā nibbattā upādinnakaphassamanosañcetanā viññāṇāhārāti.
Furthermore, the contact and volition associated with the relinking-consciousness, and that consciousness itself as viññāṇa—these are the nutriments of contact, mental volition, and consciousness that are clung to, which have arisen conditioned by craving.
Còn xúc (phassa) và tư (cetanā) đi kèm với tâm tái sinh (paṭisandhicitta), và chính tâm (citta) là thức (viññāṇa), thì những điều này là xúc thực (phassa), ý tư thực (manosañcetanā) và thức thực (viññāṇa) bị nắm giữ (upādinna) phát sinh do duyên tham ái.
Evaṃ tāva purimataṇhāsamudayā paṭisandhikānaṃ āhārānaṃ samudayo veditabbo.
In this way, first, the arising of nutriments at relinking should be understood as being from the arising of craving in a previous existence.
Như vậy, trước hết, sự tập khởi của các thực phẩm tái sinh do duyên tham ái ở kiếp trước cần được hiểu.
Yasmā panidha upādinnakāpi anupādinnakāpi āhārā missetvā kathitā, tasmā anupādinnakānampi evaṃ taṇhāsamudayā āhārasamudayo veditabbo.
But since both clung-to and non-clung-to nutriments are discussed here together, the arising of nutriment from the arising of craving should also be understood in this way for the non-clung-to nutriments.
Hơn nữa, vì ở đây các thực phẩm bị nắm giữ (upādinna) và không bị nắm giữ (anupādinna) được đề cập lẫn lộn, do đó, sự tập khởi của các thực phẩm không bị nắm giữ cũng cần được hiểu là do duyên tham ái tập khởi như vậy.
Aṭṭhalobhasahagatacittasamuṭṭhitesu hi rūpesu ojā atthi, ayaṃ sahajātataṇhāpaccayā nibbatto anupādinnakakabaḷīkārāhāro.
There is nutritive essence in the material phenomena originated by the eight types of consciousness accompanied by greed; this is the non-clung-to physical nutriment that has arisen conditioned by co-nascent craving.
Trong các sắc (rūpa) phát sinh do tám tâm tham (lobhasahagatacitta), có chất dinh dưỡng (ojā). Đây là thực phẩm nuôi dưỡng thân thể (kabaḷīkārāhāra) không bị nắm giữ (anupādinna) phát sinh do duyên tham ái đồng sinh (sahajāta taṇhā).
Lobhasahagatacittasampayuttā pana phassacetanā sayañca cittaṃ viññāṇanti ime taṇhāpaccayā nibbattā anupādinnakaphassamanosañcetanā viññāṇāhārāti.
Furthermore, the contact and volition associated with consciousness accompanied by greed, and that consciousness itself as viññāṇa—these are the non-clung-to nutriments of contact, mental volition, and consciousness that have arisen conditioned by craving.
Còn xúc (phassa) và tư (cetanā) đi kèm với tâm tham (lobhasahagatacitta), và chính tâm (citta) là thức (viññāṇa), thì những điều này là xúc thực (phassa), ý tư thực (manosañcetanā) và thức thực (viññāṇa) không bị nắm giữ (anupādinna) phát sinh do duyên tham ái.
Taṇhānirodhā āhāranirodhoti imissā upādinnakānañca anupādinnakānañca āhārānaṃ paccayabhūtāya taṇhāya nirodhena āhāranirodho paññāyati.
From the cessation of craving, there is the cessation of nutriment means: through the cessation of this craving, which is the condition for both clung-to and non-clung-to nutriments, the cessation of nutriment is discerned.
Do tham ái diệt, các thực phẩm diệt – có nghĩa là do sự diệt trừ tham ái, là nhân duyên của các thực phẩm bị nắm giữ và không bị nắm giữ, thì sự diệt trừ các thực phẩm được biết đến.
Sesaṃ vuttanayameva.
The rest is just as has been stated.
Phần còn lại cũng theo cách đã nói.
Ayaṃ pana viseso, idha cattāripi saccāni sarūpeneva vuttāni.
This, however, is the distinction: here, all four truths are stated in terms of their intrinsic nature.
Tuy nhiên, có sự khác biệt này: ở đây, cả bốn Chân lý (saccāni) đều được nói đến một cách trực tiếp.
Yathā ca idha, evaṃ ito uttarimpi sabbavāresūti.
And just as here, so too in all the sections that follow.
Như ở đây, tương tự như vậy, trong tất cả các phần tiếp theo.
Tasmā sabbattha asammuyhantena saccāni uddharitabbāni.
Therefore, the truths should be drawn out in every case without confusion.
Do đó, ở mọi nơi, người không bị lầm lẫn phải trích dẫn các Chân lý.
Sabbavāresu ca ‘‘ettāvatāpi kho āvuso’’ti idaṃ desanāniyyātanaṃ tattha tattha desitadhammavasena yojetabbaṃ.
And in all the sections, this concluding statement of the teaching, "To this extent, friend," should be applied according to the Dhamma taught in each respective place.
Và trong tất cả các phần, câu “Này Hiền giả, chỉ với chừng ấy thôi” (ettāvatāpi kho āvuso) này, là phần kết luận của bài pháp, cần được kết nối theo giáo pháp đã được thuyết giảng ở từng nơi.
Tassa idha tāva ayaṃ yojanā ettāvatāpīti imāya āhāradesanāya vuttamanasikārappaṭivedhavasenāpīti vuttaṃ hoti.
Here, its application is this: To this extent means "even through the contemplation and penetration spoken of in this teaching on nutriment."
Ở đây, ý nghĩa của câu đó là: chỉ với chừng ấy thôi có nghĩa là chỉ với sự thấu hiểu do tác ý đã được nói đến trong bài pháp về các thực phẩm này.
Esa nayo sabbatthāpi.
This is the method everywhere.
Cách này cũng áp dụng cho tất cả các trường hợp.
91. Idāni ‘‘sādhāvuso’’ti purimanayeneva therassa bhāsitaṃ abhinanditvā anumoditvā te bhikkhū uttarimpi pañhaṃ pucchiṃsu.
91. Now, having acclaimed and rejoiced in the Elder's speech with "Excellent, friend," in the same way as before, those bhikkhus asked a further question.
91. Bây giờ, các Tỳ-khưu đó, sau khi hoan hỷ và tán thán lời thuyết giảng của Trưởng lão theo cách đã nói trước đó, đã hỏi thêm một câu hỏi.
Thero ca nesaṃ aññenapi pariyāyena byākāsi.
And the Elder explained it to them by another method.
Và Trưởng lão đã giải thích cho họ bằng một phương pháp khác.
Esa nayo ito paresupi sabbavāresu.
This is the method in all the sections that follow this one.
Cách này cũng áp dụng cho tất cả các phần tiếp theo.
Tasmā ito paraṃ evarūpāni vacanāni anāmasitvā yena yena pariyāyena byākaroti, tassa tasseva atthaṃ vaṇṇayissāma.
Therefore, from now on, without examining such transitional words, we will explain the meaning of each method by which he explains.
Do đó, từ đây trở đi, chúng tôi sẽ không đề cập đến những lời như vậy mà chỉ giải thích ý nghĩa của từng phương pháp mà Trưởng lão đã giải thích.
Imassa pana vārassa saṅkhepadesanāyaṃ dukkhañca pajānātīti ettha dukkhanti dukkhasaccaṃ.
In the summary teaching of this section, in the phrase and he understands suffering, suffering means the truth of suffering.
Trong phần tóm tắt của chương này, ở chỗ hiểu biết về khổ (dukkhañca pajānāti), khổ (dukkha) là Khổ đế (Dukkhasacca).
Vitthāradesanāyaṃ pana yaṃ vattabbaṃ siyā, taṃ sabbaṃ visuddhimagge saccaniddese vuttamevāti.
As for what might be said in the detailed teaching, all of that has already been stated in the Visuddhimagga, in the exposition of the truths.
Còn những gì cần nói trong phần giải thích chi tiết, tất cả đều đã được nói trong phần giải thích về các Chân lý trong Thanh Tịnh Đạo (Visuddhimagga).
92. Ito paraṃ paṭiccasamuppādavasena desanā hoti.
92. Hereafter, the teaching is given in terms of dependent origination.
92. Từ đây trở đi, bài pháp được thuyết giảng theo duyên khởi (paṭiccasamuppāda).
Tattha jarāmaraṇavāre tāva tesaṃ tesanti ayaṃ saṅkhepato anekesaṃ sattānaṃ sādhāraṇaniddesoti ñātabbo.
Therein, in the section on aging and death, of these various should be understood as a general reference to many beings in summary.
Ở đây, trong phần về già và chết (jarāmaraṇa), câu của những cái đó, của những cái đó (tesaṃ tesaṃ) cần được hiểu là sự chỉ định chung cho nhiều chúng sinh một cách tóm tắt.
Yā devadattassa jarā, yā somadattassa jarāti evañhi divasampi kathentassa neva sattā pariyādānaṃ gacchanti.
For if one were to speak thus, "the aging of Devadatta, the aging of Somadatta," even for a whole day, the beings would never be exhausted.
"Sự già của Devadatta là gì, sự già của Somadatta là gì?" – Dù có giảng giải như vậy suốt cả ngày, các chúng sinh cũng không thể cạn kiệt.
Imehi pana dvīhi padehi na koci satto apariyādinno hoti.
But by these two words, no being is left unincluded.
Nhưng với hai từ này, không một chúng sinh nào không được bao gồm.
Tasmā vuttaṃ ‘‘ayaṃ saṅkhepato anekesaṃ sattānaṃ sādhāraṇaniddeso’’ti.
Therefore it was said, "This is a general designation for many beings in brief."
Do đó đã nói rằng: "Đây là một sự diễn tả chung tóm tắt về nhiều chúng sinh."
Tamhi tamhīti ayaṃ gatijātivasena anekesaṃ nikāyānaṃ sādhāraṇaniddeso.
"In this or that": this is a general designation for the many groups of beings according to their destinies and births.
"Ở đó, ở đó" (Tamhi tamhīti) là sự diễn tả chung cho nhiều nhóm chúng sinh theo các cảnh giới và loài.
Sattanikāyeti sādhāraṇaniddesena niddiṭṭhassa sarūpanidassanaṃ.
"Group of beings": this is an illustration of the nature of what was indicated by the general designation.
"Trong nhóm chúng sinh" (Sattanikāye) là sự trình bày bản chất của điều đã được diễn tả bằng cách diễn tả chung.
Jarā jīraṇatātiādīsu pana jarāti sabhāvaniddeso.
In "aging, decrepitude," and so on, "aging" is a designation of its intrinsic nature.
Trong "Già là sự lão hóa" (Jarā jīraṇatā) và các từ tương tự, "già" (jarā) là sự diễn tả bản chất.
Jīraṇatāti ākāraniddeso.
"Decrepitude" is a designation of its mode.
"Lão hóa" (Jīraṇatā) là sự diễn tả trạng thái.
Khaṇḍiccantiādayo kālātikkame kiccaniddesā.
"Brokenness of teeth," and so on, are designations of its function when time has passed.
"Sự sứt mẻ" (Khaṇḍicca) và các từ tương tự là sự diễn tả chức năng theo thời gian trôi qua.
Pacchimā dve pakatiniddesā.
The last two are designations of its natural state.
Hai từ cuối cùng là sự diễn tả bản chất.
Ayañhi jarāti iminā padena sabhāvato dīpitā, tenassāyaṃ sabhāvaniddeso.
For by this word "aging" it is shown in its intrinsic nature; therefore, this is its designation of intrinsic nature.
Thật vậy, sự già này được diễn tả về bản chất bằng từ "già" (jarā), do đó đây là sự diễn tả bản chất của nó.
Jīraṇatāti iminā ākārato.
By "decrepitude," it is shown in its mode.
Bằng từ "lão hóa" (Jīraṇatā) là về trạng thái.
Tenassāyaṃ ākāraniddeso.
Therefore, this is its designation of mode.
Do đó đây là sự diễn tả trạng thái của nó.
Khaṇḍiccanti iminā kālātikkame dantanakhānaṃ khaṇḍitabhāvakaraṇakiccato.
By "brokenness of teeth," it is shown by the function of making teeth and nails broken when time has passed.
Bằng từ "sự sứt mẻ" (Khaṇḍicca) là do chức năng làm cho răng và móng bị sứt mẻ khi thời gian trôi qua.
Pāliccanti iminā kesalomānaṃ palitabhāvakaraṇakiccato.
By "greyness of hair," it is shown by the function of making head hair and body hair grey.
Bằng từ "sự bạc trắng" (Pālicca) là do chức năng làm cho tóc và lông bạc trắng.
Valittacatāti iminā maṃsaṃ milāpetvā tace valittabhāvakaraṇakiccato dīpitā.
By "wrinkled skin," it is shown by the function of withering the flesh and making the skin wrinkled.
Bằng từ "da nhăn nheo" (Valittacatā) là do chức năng làm cho da nhăn nheo sau khi thịt héo mòn.
Tenassā ime khaṇḍiccantiādayo tayo kālātikkame kiccaniddesā.
Therefore, these three—"brokenness of teeth," and so on—are designations of its function when time has passed.
Do đó, ba từ này, "sự sứt mẻ" (Khaṇḍicca) và các từ tương tự, là sự diễn tả chức năng theo thời gian trôi qua của nó.
Tehi imesaṃ vikārānaṃ dassanavasena pākaṭībhūtā pākaṭajarā dassitā.
Through them, manifest aging, which has become apparent through the seeing of these alterations, is shown.
Qua đó, sự già rõ ràng (pākaṭajarā) được trình bày bằng cách chỉ ra những biến đổi này.
Yatheva hi udakassa vā aggino vā vātassa vā tiṇarukkhādīnaṃ sambhaggapalibhaggatāya vā jhāmatāya vā gatamaggo pākaṭo hoti, na ca so gatamaggo tāneva udakādīni, evameva jarāya dantādīsu khaṇḍiccādivasena gatamaggo pākaṭo, cakkhuṃ ummīletvāpi gayhati.
Just as the path taken by water, fire, or wind is made manifest by the breaking and shattering of grass, trees, and so on, or by their being burnt, yet that path taken is not the water itself, and so on; so too, the path taken by aging is manifest in the teeth and so on through brokenness and the like, and it can be grasped even by opening the eyes.
Thật vậy, giống như con đường mà nước, lửa hay gió đã đi qua được thể hiện rõ ràng qua việc cỏ cây bị đổ nát, tan hoang hoặc bị cháy rụi, nhưng con đường đó không phải là chính nước, lửa, v.v., thì cũng vậy, con đường mà sự già đã đi qua trên răng, v.v., dưới dạng sứt mẻ, v.v., là rõ ràng, có thể nhận biết ngay cả khi mở mắt.
Na ca khaṇḍiccādīneva jarā, na hi jarā cakkhuviññeyyā hoti.
Yet brokenness and so on are not aging itself, for aging is not cognizable by the eye-consciousness.
Và sự sứt mẻ, v.v., không phải là chính sự già, vì sự già không phải là đối tượng của nhãn thức.
Tattha yasmā jaraṃ pattassa āyu hāyati, tasmā jarā ‘‘āyuno saṃhānī’’ti phalūpacārena vuttā.
Therein, because the life-span of one who has reached old age declines, aging is called "decline of life" by a metaphorical application based on its result.
Ở đây, vì tuổi thọ suy giảm khi đạt đến sự già, nên sự già được gọi là "sự suy giảm tuổi thọ" (āyuno saṃhāni) theo phép ẩn dụ về quả.
Yasmā ca daharakāle suppasannāni sukhumampi attano visayaṃ sukheneva gaṇhanasamatthāni cakkhādīni indriyāni jaraṃ pattassa paripakkāni āluḷitāni avisadāni oḷārikampi attano visayaṃ gahetuṃ asamatthāni honti, tasmā ‘‘indriyānaṃ paripāko’’tipi phalūpacāreneva vuttā.
And because in youth the faculties such as the eye are very clear and capable of easily grasping even their subtle objects, but for one who has reached old age they become overripe, agitated, and unclear, incapable of grasping even their coarse objects, it is therefore also called "ripening of the faculties" by a metaphorical application based on its result.
Và vì các căn như mắt, v.v., vốn rất trong sáng và có khả năng nhận biết đối tượng vi tế của mình một cách dễ dàng khi còn trẻ, trở nên suy yếu, hỗn loạn và không rõ ràng khi đạt đến sự già, không có khả năng nhận biết ngay cả đối tượng thô của mình, nên nó cũng được gọi là "sự suy yếu của các căn" (indriyānaṃ paripāko) theo phép ẩn dụ về quả.
Sā panāyaṃ evaṃ niddiṭṭhā sabbāpi jarā pākaṭā paṭicchannāti duvidhā hoti.
But this aging, thus described, is of two kinds: manifest and concealed.
Tất cả sự già được diễn tả như vậy đều có hai loại: rõ ràng (pākaṭā) và ẩn kín (paṭicchannā).
Tattha dantādīsu khaṇḍabhāvādidassanato rūpadhammesu jarā pākaṭajarā nāma.
Therein, aging in physical phenomena is called manifest aging, due to the visibility of the broken state of teeth and so on.
Trong đó, sự già trên các pháp sắc, được nhìn thấy qua sự sứt mẻ, v.v., trên răng, v.v., được gọi là sự già rõ ràng (pākaṭajarā).
Arūpadhammesu pana tādisassa vikārassa adassanato paṭicchannajarā nāma.
But in non-physical phenomena, it is called concealed aging, due to the invisibility of such an alteration.
Còn trên các pháp vô sắc, do không nhìn thấy sự biến đổi như vậy, nên được gọi là sự già ẩn kín (paṭicchannajarā).
Tattha yvāyaṃ khaṇḍādibhāvo dissati, so tādisānaṃ dantādīnaṃ suviññeyyattā vaṇṇoyeva, taṃ cakkhunā disvā manodvārena cintetvā ‘‘ime dantā jarāya pahaṭā’’ti jaraṃ jānāti udakaṭṭhāne baddhāni gosīsādīni oloketvā heṭṭhā udakassa atthibhāvaṃ jānanaṃ viya.
Therein, this state of brokenness and so on that is seen is merely the color, which is easily discernible in such things as teeth. Seeing that color with the eye and reflecting on it through the mind-door, one knows aging, thinking "these teeth are struck by aging," just as one knows of the presence of water below by observing the cow's horns and so on tied at the water's edge.
Ở đây, sự sứt mẻ, v.v., được nhìn thấy, chỉ là màu sắc do các răng, v.v., như vậy dễ nhận biết. Nhìn thấy màu sắc đó bằng mắt, suy nghĩ qua ý môn, người ta biết rằng "những chiếc răng này đã bị sự già tác động", giống như nhìn thấy đầu bò, v.v., được buộc ở nơi có nước mà biết rằng có nước ở dưới.
Puna avīci savīcīti evampi duvidhā hoti.
Again, it is also of two kinds: with intervals and without intervals.
Hơn nữa, nó cũng có hai loại: không có khoảng cách (avīci) và có khoảng cách (savīci).
Tattha maṇikanakarajatapavāḷasūriyādīnaṃ mandadasakādīsu pāṇīnaṃ viya pupphaphalapallavādīsu ca apāṇīnaṃ viya antarantarā vaṇṇavisesādīnaṃ duviññeyyattā jarā avīcijarā nāma, nirantarajarāti attho.
Therein, aging in gems, gold, silver, coral, the sun, and so on, and as in animate beings in the manda decade and so on, and as in inanimate things such as flowers, fruits, and sprouts, is called aging without intervals (avīcijarā), meaning aging that is uninterrupted, because the distinctions in color and so on between intervals are hard to discern.
Trong đó, sự già trên ngọc, vàng, bạc, san hô, mặt trời, v.v., và trên các vật vô sinh như hoa, quả, chồi, v.v., giống như trên các chúng sinh trong các nhóm mười pháp yếu ớt, v.v., do sự khác biệt về màu sắc, v.v., khó nhận biết ở giữa, nên được gọi là sự già không có khoảng cách (avīcijarā), nghĩa là sự già liên tục.
Tato aññesu pana yathāvuttesu antarantarā vaṇṇavisesādīnaṃ suviññeyyattā jarā savīcijarā nāmāti veditabbā.
But in other things as mentioned above, because the distinctions in color and so on between intervals are easy to discern, aging should be known as aging with intervals (savīcijarā).
Còn trên các vật khác đã nói ở trên, do sự khác biệt về màu sắc, v.v., dễ nhận biết ở giữa, nên sự già được gọi là sự già có khoảng cách (savīcijarā).
Ito paraṃ, tesaṃ tesantiādi vuttanayeneva veditabbaṃ.
From here on, "of those beings," and so on, should be understood in the way already explained.
Từ đây trở đi, "của những cái đó, của những cái đó" (tesaṃ tesaṃ) và các từ tương tự phải được hiểu theo cách đã nói.
Cuti cavanatātiādīsu pana cutīti cavanakavasena vuccati, ekacatupañcakkhandhānaṃ sāmaññavacanametaṃ.
In "passing away, falling away," and so on, "passing away" (cuti) is spoken of in the sense of falling away; this is a general term for the one, four, or five aggregates.
Trong "Sự chết, sự diệt vong" (Cuti cavanatā) và các từ tương tự, "sự chết" (cuti) được nói theo nghĩa diệt vong; đây là một từ chung cho một, bốn hoặc năm uẩn.
Cavanatāti bhāvavacanena lakkhaṇanidassanaṃ.
"Falling away" (cavanatā) is an indication of the characteristic by means of an abstract noun.
"Sự diệt vong" (Cavanatā) là sự trình bày đặc tính bằng từ trạng thái.
Bhedoti cutikkhandhānaṃ bhaṅguppattiparidīpanaṃ.
"Break-up" (bhedo) is an exposition of the aggregates at death reaching a state of dissolution.
"Sự tan rã" (Bhedo) là sự trình bày sự phát sinh của sự hoại diệt của các uẩn đã chết.
Antaradhānanti ghaṭasseva bhinnassa bhinnānaṃ cutikkhandhānaṃ yena kenaci pariyāyena ṭhānābhāvaparidīpanaṃ.
"Disappearance" (antaradhānaṃ) is an exposition of the non-existence of a place for the broken aggregates at death to stand, in any way whatsoever, just like a shattered pot that has been broken.
"Sự biến mất" (Antaradhānaṃ) là sự trình bày sự không tồn tại của các uẩn đã chết đã tan rã bằng cách nào đó, giống như một cái bình đã vỡ.
Maccu maraṇanti maccusaṅkhātaṃ maraṇaṃ.
"Death, dying" (maccu maraṇaṃ) is the dying known as death (maccu).
"Tử vong, cái chết" (Maccu maraṇaṃ) là cái chết được gọi là tử vong.
Tena samucchedamaraṇādīni nisedheti.
By this, he rejects annihilationist death and so on.
Bằng cách đó, nó phủ nhận các loại chết như tử vong đoạn diệt (samucchedamaraṇā) và các loại khác.
Kālo nāma antako, tassa kiriyāti kālakiriyā.
Time (kālo) is the end-maker; its doing is "the doing of time" (kālakiriyā).
Thời gian (kālo) là kẻ hủy diệt, hành động của nó là sự kết thúc thời gian (kālakiriyā).
Etena lokasammutiyā maraṇaṃ dīpeti.
By this, he shows death in terms of worldly convention.
Bằng cách này, nó trình bày cái chết theo quy ước thế gian.
Ettha ca catuvokāravasena khandhānaṃ bhedo, ekavokāravasena kaḷevarassa nikkhepo.
And here, the break-up of the aggregates is in terms of the four-aggregate existence, and the laying down of the corpse is in terms of the one-aggregate existence.
Ở đây, sự tan rã của các uẩn là theo nghĩa của cõi Tứ uẩn (catuvokāra), sự bỏ lại thân xác là theo nghĩa của cõi Nhất uẩn (ekavokāra).
Catuvokāravasena vā khandhānaṃ bhedo, sesadvayavasena kaḷevarassa nikkhepo veditabbo.
Or, the break-up of the aggregates should be understood in terms of the four-aggregate existence, and the laying down of the corpse in terms of the other two.
Hoặc sự tan rã của các uẩn là theo nghĩa của cõi Tứ uẩn, và sự bỏ lại thân xác là theo nghĩa của hai loại còn lại.
Bhavadvayepi rūpakāyasaṅkhātassa kaḷevarassa sambhavato.
Because of the possibility of a corpse, known as a physical body, in both of those existences.
Vì thân xác, tức là thân sắc, tồn tại trong cả hai cõi.
Atha vā yasmā ca cātumahārājikādīsu khandhā bhijjanteva, na kiñci nikkhipanti, tasmā tesaṃ vasena khandhānaṃ bhedo, manussādīsu kaḷevarassa nikkhepo.
Or, because in the realms of the Cātumahārājika devas and so on the aggregates just break up and they do not lay down anything, therefore, "the break-up of the aggregates" is in terms of them, and "the laying down of the corpse" is in the case of humans and so on.
Hoặc, vì trong các cõi Tứ Đại Thiên Vương, v.v., các uẩn chỉ tan rã mà không bỏ lại bất cứ thứ gì, nên sự tan rã của các uẩn là theo nghĩa của chúng, còn ở loài người, v.v., là sự bỏ lại thân xác.
Ettha ca kaḷevarassa nikkhepakāraṇato maraṇaṃ kaḷevarassa nikkhepoti vuttanti evamattho daṭṭhabbo.
And here, the meaning should be seen thus: because the laying down of the corpse is a cause of death, death is said to be "the laying down of the corpse."
Ở đây, ý nghĩa phải được hiểu là cái chết được gọi là sự bỏ lại thân xác vì đó là nguyên nhân của việc bỏ lại thân xác.
93. Jātivāre jāti sañjātītiādīsu jāyanaṭṭhena jāti, sā aparipuṇṇāyatanavasena yuttā.
93. In the section on birth, in "birth, production," and so on, it is "birth" (jāti) in the sense of being born; it is associated with having incomplete sense bases.
Trong phần Sanh (Jātivāra), trong "sanh, sự sanh" (jāti sañjāti) và các từ tương tự, sanh (jāti) là theo nghĩa phát sinh, nó phù hợp với các xứ chưa hoàn chỉnh.
Sañjāyanaṭṭhena sañjāti, sā paripuṇṇāyatanavasena yuttā.
It is "production" (sañjāti) in the sense of being well and fully born; it is associated with having complete sense bases.
Sự sanh hoàn toàn (sañjāti) là theo nghĩa phát sinh hoàn toàn, nó phù hợp với các xứ hoàn chỉnh.
Okkamanaṭṭhena okkanti, sā aṇḍajajalābujavasena yuttā.
It is "descent" (okkanti) in the sense of descending into; it is associated with the egg-born and womb-born.
Sự nhập vào (okkanti) là theo nghĩa đi vào, nó phù hợp với các loài noãn sinh (aṇḍaja) và thai sinh (jalābuja).
Te hi aṇḍakosañca vatthikosañca okkamantā pavisantā viya paṭisandhiṃ gaṇhanti.
For they take conception as if descending and entering into the eggshell and the uterine sac.
Thật vậy, chúng nhận sự tái sinh như thể chúng đi vào và nhập vào vỏ trứng và túi thai.
Abhinibbattanaṭṭhena abhinibbatti, sā saṃsedajaopapātikavasena yuttā, te hi pākaṭāyeva hutvā nibbattanti.
It is "coming to be" (abhinibbatti) in the sense of manifesting; it is associated with the moisture-born and the spontaneously arisen, for they come to be having already become manifest.
Sự tái sinh hiển lộ (abhinibbatti) là theo nghĩa hiển lộ, nó phù hợp với các loài thấp sinh (saṃsedaja) và hóa sinh (opapātika), vì chúng tái sinh một cách rõ ràng.
Ayaṃ tāva vohāradesanā.
This, for now, is the conventional teaching.
Đây là lời dạy theo quy ước.
Idāni paramatthadesanā hoti.
Now comes the ultimate teaching.
Bây giờ là lời dạy theo ý nghĩa tối hậu.
Khandhāyeva hi paramatthato pātubhavanti, na satto.
Indeed, only the aggregates manifest in the ultimate sense, not a being.
Thật vậy, theo ý nghĩa tối hậu, chỉ có các uẩn phát sinh, chứ không phải chúng sinh.
Tattha ca khandhānanti ekavokārabhave ekassa catuvokārabhave catunnaṃ pañcavokārabhave pañcannampi gahaṇaṃ veditabbaṃ.
And there, by ‘of the aggregates,’ it should be understood as the taking of one in the one-constituent existence, of four in the four-constituent existence, and of all five in the five-constituent existence.
Ở đây, các uẩn (khandhānaṃ) phải được hiểu là sự bao gồm một uẩn trong cõi Nhất uẩn, bốn uẩn trong cõi Tứ uẩn và cả năm uẩn trong cõi Ngũ uẩn.
Pātubhāvoti uppatti.
Manifestation means arising.
Sự phát sinh (pātubhāvo) là sự xuất hiện.
Āyatanānanti ettha tatra tatra uppajjamānāyatanavaseneva saṅgaho veditabbo.
Here, by ‘of the bases,’ the inclusion should be understood only by way of the bases that arise in this or that existence.
Các xứ (āyatanānaṃ) ở đây phải được hiểu là sự bao gồm theo các xứ phát sinh ở từng nơi.
Paṭilābhoti santatiyaṃ pātubhāvoyeva.
Acquisition is just the manifestation in the continuity.
Sự thọ đắc (paṭilābho) chính là sự phát sinh trong dòng tương tục.
Pātubhavantāneva hi tāni paṭiladdhāni nāma honti.
Indeed, it is only as they are manifesting that they are called ‘acquired’.
Thật vậy, khi chúng phát sinh, chúng được gọi là đã thọ đắc.
Ayaṃ vuccatāvuso jātīti iminā padena vohārato paramatthato ca desitāya jātiyā nigamanaṃ karotīti.
‘This, friend, is called birth’: by this phrase, he makes a conclusion about the birth that was taught conventionally and in the ultimate sense.
Với cụm từ ‘Này chư hiền, đây được gọi là sự sanh’ (Ayaṃ vuccatāvuso jātī), sự kết luận về jāti (sự sanh) đã được trình bày cả theo nghĩa thông thường (vohāra) và nghĩa tối hậu (paramattha).
Bhavasamudayāti ettha pana jātiyā paccayabhūto kammabhavo veditabbo.
But here, in ‘from the origination of existence,’ kammabhava which is the condition for birth should be understood.
Trong cụm từ ‘do sự tập khởi của hữu’ (Bhavasamudayā) này, cần phải hiểu rằng nghiệp hữu (kammabhava) là nhân duyên của sự sanh (jāti).
Sesaṃ vuttanayamevāti.
The rest is just as has been explained.
Phần còn lại cũng theo cách đã nói.
94. Bhavavāre kāmabhavoti kammabhavo ca upapattibhavo ca.
94. In the section on existence, sense-sphere existence is both kammabhava and upapattibhava.
94. Trong Bhavavāra (phần hữu), kāmabhava (dục hữu) là nghiệp hữu (kammabhava) và tái sanh hữu (upapattibhava).
Tattha kammabhavo nāma kāmabhavūpagaṃ kammameva.
Therein, what is called kammabhava is just the kamma that leads to the sense-sphere existence.
Trong đó, nghiệp hữu (kammabhava) chính là nghiệp dẫn đến tái sanh trong cõi dục.
Tañhi upapattibhavassa kāraṇattā ‘‘sukho buddhānamuppādo (dha. pa. 194) dukkho pāpassa uccayo’’tiādīni (dha. pa. 117) viya phalavohārena bhavoti vuttaṃ.
Indeed, because it is the cause of upapattibhava, it is called ‘existence’ by a conventional designation of the effect, like in such passages as “the arising of Buddhas is happiness” and “the accumulation of evil is suffering”.
Nghiệp đó được gọi là hữu (bhava) bằng cách dùng tên quả để gọi nhân, vì nó là nguyên nhân của tái sanh hữu, giống như trong các câu ‘Sự xuất hiện của chư Phật là an lạc’ (sukho buddhānamuppādo) và ‘Sự tích lũy ác nghiệp là khổ đau’ (dukkho pāpassa uccayo).
Upapattibhavo nāma tena kammena nibbattaṃ upādinnakhandhapañcakaṃ.
What is called upapattibhava is the pentad of clung-to aggregates produced by that kamma.
Tái sanh hữu (upapattibhava) là năm uẩn bị chấp thủ (upādinnakhandhapañcaka) được tạo ra bởi nghiệp đó.
Tañhi tattha bhavatīti katvā bhavoti vuttaṃ.
Indeed, because it comes to be (bhavati) there, it is called bhava (existence).
Nó được gọi là hữu (bhava) vì nó hiện hữu ở đó.
Evaṃ sabbathāpi idaṃ kammañca upapatti ca ubhayampetamidha ‘‘kāmabhavo’’ti vuttaṃ.
Thus, in every way, both this kamma and this rebirth-existence are here called “sense-sphere existence.”
Như vậy, cả nghiệp này và tái sanh này, cả hai đều được gọi là “dục hữu” (kāmabhava) ở đây.
Esa nayo rūpārūpabhavesu.
This is the method for fine-material and immaterial existences.
Nguyên tắc này cũng áp dụng cho sắc hữu và vô sắc hữu (rūpārūpabhavesu).
Upādānasamudayāti ettha pana upādānaṃ kusalakammabhavassa upanissayavaseneva paccayo hoti.
But here, in ‘from the origination of clinging,’ clinging is a condition for wholesome kammabhava only by way of decisive support.
Trong cụm từ ‘do sự tập khởi của chấp thủ’ (Upādānasamudayā) này, chấp thủ (upādāna) chỉ là nhân duyên cho nghiệp hữu thiện (kusalakammabhava) theo cách hỗ trợ mạnh mẽ (upanissaya).
Akusalakammabhavassa upanissayavasenapi sahajātādivasenapi.
For unwholesome kammabhava, it is a condition by way of decisive support and also by way of conascence and so on.
Đối với nghiệp hữu bất thiện (akusalakammabhava) thì theo cách hỗ trợ mạnh mẽ và cả theo cách đồng sanh (sahajāta) v.v..
Upapattibhavassa pana sabbassāpi upanissayavaseneva.
But for all upapattibhava, it is a condition only by way of decisive support.
Còn đối với tất cả tái sanh hữu (upapattibhava) thì chỉ theo cách hỗ trợ mạnh mẽ.
Sesaṃ vuttanayamevāti.
The rest is just as has been explained.
Phần còn lại cũng theo cách đã nói.
95. Upādānavāre kāmupādānantiādīsu vatthukāmaṃ upādiyati etena, sayaṃ vā taṃ upādiyatīti kāmupādānaṃ.
95. In the section on clinging, in such phrases as ‘clinging to sensual pleasures,’ one clings to sensual objects by means of this, or it itself clings to them; thus it is kāmupādāna (clinging to sensual pleasures).
95. Trong Upādānavāra (phần chấp thủ), trong các cụm từ như kāmupādāna (chấp thủ dục), các đối tượng dục (vatthukāma) được chấp thủ bởi điều này, hoặc chính nó chấp thủ điều đó, nên gọi là kāmupādāna.
Kāmo ca so upādānañcāti vā kāmupādānaṃ.
Or, it is sensual pleasure and it is clinging; thus it is kāmupādāna.
Hoặc là dục (kāma) và chấp thủ (upādāna) nên gọi là kāmupādāna.
Upādānanti daḷhaggahaṇaṃ vuccati.
Clinging is said to be a firm grasp.
Upādāna (chấp thủ) được gọi là sự nắm giữ chắc chắn.
Daḷhattho hi ettha upasaddo, ‘‘upāyāsa upakaṭṭhā’’tiādīsu viya pañcakāmaguṇikarāgassetaṃ adhivacanaṃ.
For here the prefix upa has the sense of firmness, as in upāyāsa (distress) and upakaṭṭha (very near); this is a designation for the greed connected with the five strands of sensual pleasure.
Ở đây, tiền tố ‘upa’ có nghĩa là kiên cố, giống như trong ‘upāyāsa’ (khổ não), ‘upakaṭṭhā’ (gần gũi) v.v., đây là tên gọi của tham ái đối với năm dục trần.
Ayamettha saṅkhepo.
This is the summary here.
Đây là tóm tắt về điều này.
Vitthārato panetaṃ ‘‘tattha katamaṃ kāmupādānaṃ, yo kāmesu kāmacchando’’ti (dha. sa. 1220; vibha. 938) vuttanayena veditabbaṃ.
But in detail, this should be understood according to the method stated: “Therein, what is clinging to sensual pleasures? Whatever sensual desire in regard to sensual pleasures…”
Về chi tiết, điều này cần được hiểu theo cách đã nói trong câu ‘Trong đó, thế nào là chấp thủ dục? Đó là dục tham trong các dục’ (tattha katamaṃ kāmupādānaṃ, yo kāmesu kāmacchando).
Tathā diṭṭhi ca sā upādānañcāti diṭṭhupādānaṃ.
Similarly, it is a view and it is clinging; thus it is diṭṭhupādāna (clinging to views).
Tương tự, tà kiến (diṭṭhi) và chấp thủ (upādāna) nên gọi là diṭṭhupādāna (chấp thủ tà kiến).
Atha vā diṭṭhiṃ upādiyati, upādiyanti vā etena diṭṭhinti diṭṭhupādānaṃ.
Or, one clings to a view, or one clings to a view by means of it; thus it is diṭṭhupādāna.
Hoặc, tà kiến được chấp thủ, hoặc tà kiến được chấp thủ bởi điều này, nên gọi là diṭṭhupādāna.
Upādiyati hi purimadiṭṭhiṃ uttaradiṭṭhi.
Indeed, a later view clings to a former view.
Thật vậy, tà kiến sau chấp thủ tà kiến trước.
Upādiyanti ca tāya diṭṭhiṃ.
And they cling to a view by means of it.
Và họ chấp thủ tà kiến bởi điều đó.
Yathāha ‘‘sassato attā ca loko ca, idameva saccaṃ moghamañña’’ntiādi (ma. ni. 3.27), sīlabbatupādānaattavādupādānavajjassa sabbadiṭṭhigatassetaṃ adhivacanaṃ.
As it is said: “The self and the world are eternal; this alone is true, anything else is false,” and so on. This is a designation for any wrong view, except for clinging to rites and observances and clinging to a doctrine of self.
Như đã nói: ‘Tự ngã và thế giới là thường còn, đây là sự thật, điều khác là vô nghĩa’ v.v. Đây là tên gọi của tất cả các tà kiến, ngoại trừ chấp thủ giới cấm (sīlabbatupādāna) và chấp thủ ngã kiến (attavādupādāna).
Ayamettha saṅkhepo.
This is the summary here.
Đây là tóm tắt về điều này.
Vitthārato panetaṃ ‘‘tattha katamaṃ diṭṭhupādānaṃ natthi dinna’’nti (dha. sa. 1220; vibha. 938) vuttanayena veditabbaṃ.
But in detail, this should be understood according to the method stated: “Therein, what is clinging to views? ‘There is nothing given…’”
Về chi tiết, điều này cần được hiểu theo cách đã nói trong câu ‘Trong đó, thế nào là chấp thủ tà kiến? Không có sự bố thí’ (tattha katamaṃ diṭṭhupādānaṃ natthi dinna).
Tathā sīlabbataṃ upādiyanti etena, sayaṃ vā taṃ upādiyati, sīlabbatañca taṃ upādānañcāti vā sīlabbatupādānaṃ.
Similarly, one clings to rites and observances by means of this, or it itself clings to them, or it is rites and observances and it is clinging; thus it is sīlabbatupādāna (clinging to rites and observances).
Tương tự, giới cấm (sīlabbata) được chấp thủ bởi điều này, hoặc chính nó chấp thủ điều đó, hoặc đó là giới cấm và đó là chấp thủ, nên gọi là sīlabbatupādāna (chấp thủ giới cấm).
Gosīlagovatādīni hi evaṃ suddhīti abhinivesato sayameva upādānāni ayamettha saṅkhepo.
Indeed, from the deep conviction that “purification comes through these things, such as bovine morality and bovine vows,” they themselves become clingings. This is the summary here.
Thật vậy, các giới như giới bò (gosīla) và giới chó (govata) v.v. tự chúng là chấp thủ do sự cố chấp rằng ‘sự thanh tịnh là như thế này’. Đây là tóm tắt về điều này.
Vitthārato panetaṃ ‘‘tattha katamaṃ sīlabbatupādānaṃ, ito bahiddhā samaṇabrāhmaṇānaṃ sīlena suddhī’’ti vuttanayena veditabbaṃ.
But in detail, this should be understood according to the method stated: “Therein, what is clinging to rites and observances? ‘Purification comes through the rites and observances of ascetics and brahmins outside of this dispensation…’”
Về chi tiết, điều này cần được hiểu theo cách đã nói trong câu ‘Trong đó, thế nào là chấp thủ giới cấm? Sự thanh tịnh của các Sa-môn và Bà-la-môn bên ngoài đây là do giới’ (tattha katamaṃ sīlabbatupādānaṃ, ito bahiddhā samaṇabrāhmaṇānaṃ sīlena suddhī).
Idāni vadanti etenāti vādo.
Now, they declare by means of this; thus it is a vādo (doctrine).
Bây giờ, họ nói bởi điều này nên gọi là vādo (quan điểm).
Upādiyanti etenāti upādānaṃ.
They cling by means of this; thus it is upādāna (clinging).
Họ chấp thủ bởi điều này nên gọi là upādānaṃ (chấp thủ).
Kiṃ vadanti, upādiyanti vā?
What do they declare or cling to?
Họ nói gì, hoặc chấp thủ gì?
Attānaṃ.
The self.
Ngã (attā).
Attano vādupādānaṃ attavādupādānaṃ.
The doctrine and clinging of the self is attavādupādāna (clinging to a doctrine of self).
Quan điểm và sự chấp thủ về ngã nên gọi là attavādupādānaṃ (chấp thủ ngã kiến).
Attavādamattameva vā attāti upādiyati etenāti attavādupādānaṃ, vīsativatthukāya sakkāyadiṭṭhiyā etaṃ adhivacanaṃ.
Or, by means of this one clings to just the doctrine of self as ‘self’; thus it is attavādupādāna. This is a designation for the personality-view based on twenty grounds.
Hoặc, chính quan điểm về ngã được chấp thủ như là ngã bởi điều này, nên gọi là attavādupādānaṃ. Đây là tên gọi của thân kiến (sakkāyadiṭṭhi) với hai mươi căn cứ.
Ayamettha saṅkhepo.
This is the summary here.
Đây là tóm tắt về điều này.
Vitthārato panetaṃ ‘‘tattha katamaṃ attavādupādānaṃ, idha assutavā puthujjano ariyānaṃ adassāvī’’ti (dha. sa. 1223) vuttanayena veditabbaṃ.
But in detail, this should be understood according to the method stated: “Therein, what is clinging to a doctrine of self? Here, an uninstructed ordinary person, who has not seen the noble ones…”
Về chi tiết, điều này cần được hiểu theo cách đã nói trong câu ‘Trong đó, thế nào là chấp thủ ngã kiến? Ở đây, phàm phu không được nghe giáo pháp, không thấy các bậc Thánh’ (tattha katamaṃ attavādupādānaṃ, idha assutavā puthujjano ariyānaṃ adassāvī).
96. Taṇhāvāre rūpataṇhā…pe… dhammataṇhāti evaṃ cakkhudvārādīsu javanavīthiyaṃ pavattāya taṇhāya ‘‘seṭṭhiputto brāhmaṇaputto’’ti evamādīsu pitito nāmaṃ viya pitisadisārammaṇato nāmaṃ.
96. In the section on craving, in phrases such as ‘craving for forms… craving for mind-objects,’ the name for the craving that proceeds in the javana-process at the eye-door and so on, comes from its object, which is like a father, similar to how names like ‘son of a wealthy merchant’ or ‘son of a brahmin’ come from the father.
96. Trong Taṇhāvāra (phần tham ái), rūpataṇhā…pe… dhammataṇhā (tham ái sắc… v.v… tham ái pháp) là tên gọi của tham ái phát sinh trong lộ trình tâm tốc hành (javanavīthi) tại các cửa mắt v.v., giống như tên gọi từ cha trong các trường hợp như ‘con trai của nhà tài phiệt’, ‘con trai của Bà-la-môn’, hoặc tên gọi từ đối tượng tương tự như cha.
Ettha ca rūpārammaṇā taṇhā, rūpe taṇhāti rūpataṇhā.
And here, craving that has form as its object, or craving for form, is rūpataṇhā (craving for forms).
Ở đây, tham ái có đối tượng là sắc, tham ái đối với sắc, nên gọi là rūpataṇhā (tham ái sắc).
Sā kāmarāgabhāvena rūpaṃ assādentī pavattamānā kāmataṇhā.
That, proceeding as sensual passion and delighting in form, is kāmataṇhā (craving for sensual pleasure).
Tham ái đó, khi nó vị nếm sắc với trạng thái dục tham (kāmarāga), đang vận hành, nên gọi là kāmataṇhā (tham ái dục).
Sassatadiṭṭhisahagatarāgabhāvena rūpaṃ niccaṃ dhuvaṃ sassatanti evaṃ assādentī pavattamānā bhavataṇhā.
Proceeding as passion accompanied by the eternalist view and delighting in form as permanent, stable, and eternal, it is bhavataṇhā (craving for existence).
Tham ái đó, khi nó vị nếm sắc với trạng thái tham ái đi kèm với thường kiến (sassatadiṭṭhi) rằng sắc là thường, kiên cố, vĩnh cửu, đang vận hành, nên gọi là bhavataṇhā (tham ái hữu).
Ucchedadiṭṭhisahagatarāgabhāvena rūpaṃ ucchijjati vinassati pecca na bhavissatīti evaṃ assādentī pavattamānā vibhavataṇhāti evaṃ tividhā hoti.
Proceeding as passion accompanied by the annihilationist view and delighting in the idea that form is annihilated, perishes, and will not exist after death, it is vibhavataṇhā (craving for non-existence). Thus, it is threefold.
Tham ái đó, khi nó vị nếm sắc với trạng thái tham ái đi kèm với đoạn kiến (ucchedadiṭṭhi) rằng sắc sẽ bị đoạn diệt, tiêu hoại, sẽ không còn trong đời sau, đang vận hành, nên gọi là vibhavataṇhā (tham ái phi hữu). Như vậy, nó có ba loại.
Yathā ca rūpataṇhā, tathā saddataṇhādayopīti etāni aṭṭhārasa taṇhāvicaritāni honti.
And just as craving for forms, so too craving for sounds and so on. Thus, these are eighteen courses of craving.
Giống như rūpataṇhā, saddataṇhā (tham ái âm thanh) v.v. cũng vậy, nên có mười tám loại tham ái vận hành (taṇhāvicarita).
Tāni ajjhattarūpādīsu aṭṭhārasa, bahiddhārūpādīsu aṭṭhārasāti chattiṃsa.
Those are eighteen regarding internal forms and so on, and eighteen regarding external forms and so on, making thirty-six.
Mười tám loại đó đối với sắc nội xứ v.v., và mười tám loại đối với sắc ngoại xứ v.v., tổng cộng là ba mươi sáu.
Iti atītāni chattiṃsa, anāgatāni chattiṃsa, paccuppannāni chattiṃsāti aṭṭhasataṃ.
Thus, thirty-six in the past, thirty-six in the future, and thirty-six in the present, make one hundred and eight.
Như vậy, ba mươi sáu loại trong quá khứ, ba mươi sáu loại trong vị lai, và ba mươi sáu loại trong hiện tại, tổng cộng là một trăm lẻ tám.
‘‘Ajjhattikassupādāya ‘asmī’ti hoti, ‘itthasmī’ti hotī’’ti (vibha. 973-974) vā evamādīnā ajjhattikarūpādinissitāni aṭṭhārasa, ‘‘bāhirassupādāya ‘iminā asmī’ti hoti, ‘iminā itthasmī’ti hotī’’ti vā (vibha. 975) evamādinā bāhirarūpādinissitāni aṭṭhārasāti chattiṃsa.
Or, based on the internal, there arises ‘I am,’ ‘I am like this,’ and so on: eighteen based on internal forms, etc. Based on the external, there arises ‘by this I am,’ ‘by this I am like this,’ and so on: eighteen based on external forms, etc., making thirty-six.
Hoặc, mười tám loại dựa trên sắc nội xứ v.v. như đã nói ‘Do chấp thủ nội xứ mà có ‘ta là’, có ‘ta là thế này’’ (ajjhattikassupādāya ‘asmī’ti hoti, ‘itthasmī’ti hoti), và mười tám loại dựa trên sắc ngoại xứ v.v. như đã nói ‘Do chấp thủ ngoại xứ mà có ‘ta là bởi điều này’, có ‘ta là thế này bởi điều này’’ (bāhirassupādāya ‘iminā asmī’ti hoti, ‘iminā itthasmī’ti hoti), tổng cộng là ba mươi sáu.
Iti atītāni chattiṃsa, anāgatāni chattiṃsa, paccuppannāni chattiṃsāti evampi aṭṭhasatataṇhāvicaritāni honti.
Thus, thirty-six in the past, thirty-six in the future, and thirty-six in the present; in this way too there are one hundred and eight courses of craving.
Như vậy, ba mươi sáu loại trong quá khứ, ba mươi sáu loại trong vị lai, và ba mươi sáu loại trong hiện tại, tổng cộng cũng là một trăm lẻ tám loại tham ái vận hành (aṭṭhasatataṇhāvicaritāni).
Puna saṅgahe karīyamāne rūpādīsu ārammaṇesu chaḷeva taṇhākāyā tissoyeva kāmataṇhādayo hontīti evaṃ –
When summarized again, there are only six bodies of craving in regard to the objects of forms and so on, and only three kinds, beginning with craving for sensual pleasure. Thus—
Khi được tổng hợp lại, có sáu loại thân tham ái (taṇhākāya) đối với các đối tượng như sắc v.v., và chỉ có ba loại như kāmataṇhā v.v. Như vậy –
Vedanāsamudayāti ettha pana vedanāti vipākavedanā adhippetā.
‘From the origination of feeling’: here, by feeling, resultant feeling is intended.
Trong cụm từ ‘do sự tập khởi của thọ’ (Vedanāsamudayā) này, thọ (vedanā) được đề cập là thọ quả báo (vipākavedanā).
Sā kathaṃ chasu dvāresu taṇhāya paccayo hotīti ce?
If it is asked how that is a condition for craving at the six doors, it is:
Nếu hỏi: ‘Thọ đó làm sao trở thành nhân duyên cho tham ái ở sáu cửa?’
Assādanīyato.
Through delighting.
Là do tính chất đáng vị nếm (assādanīyato).
Sukhāya hi vedanāya assādanena sattā vedanaṃ mamāyantā vedanāya taṇhaṃ uppādetvā vedanārāgarattā hutvā cakkhudvāre iṭṭhameva rūpaṃ patthenti, laddhā ca naṃ assādenti, ārammaṇadāyakānañca cittakārādīnaṃ sakkāraṃ karonti.
For, by delighting in pleasant feeling, beings, identifying with the feeling, generate craving for feeling, and being infatuated with passion for feeling, they desire only a desirable form at the eye-door, and having obtained it, they delight in it, and they make offerings to those who provide the object, such as painters and so on.
Thật vậy, do vị nếm thọ lạc, chúng sanh yêu thích thọ, sanh tham ái đối với thọ, và trở nên say đắm trong tham ái thọ, họ mong muốn sắc ý thích ở cửa mắt, và khi có được thì họ vị nếm nó, và họ tôn kính những người cung cấp đối tượng như họa sĩ v.v..
Tathā sotadvārādīsu iṭṭhe ca saddādayo patthenti, laddhā ca ne assādenti, ārammaṇadāyakānañca vīṇāvādaka-gandhikasūda-tantavāya-nānāvidhasippasandassakādīnaṃ sakkāraṃ karonti.
Likewise, in the ear-door and so on, they long for desirable sounds and other sense-objects; and having obtained them, they savor them and pay respect to the givers of those sense-objects, such as lute players, perfumers, cooks, weavers, and demonstrators of various other arts.
Tương tự, ở cửa tai v.v., họ mong muốn âm thanh ý thích v.v., và khi có được thì họ vị nếm chúng, và họ tôn kính những người cung cấp đối tượng như người chơi đàn, người bán hương, đầu bếp, thợ dệt, người biểu diễn các loại nghề nghiệp khác nhau v.v..
Yathā kiṃ?
Like what?
Giống như gì?
Yathā puttasinehena puttaṃ mamāyantā dhātiyā sakkāraṃ karonti, sappāyasappikhīrādīniyeva naṃ pāyenti ceva bhojenti ca.
Just as those who cherish a son with parental affection pay respect to his wet nurse, feeding and giving him only suitable things like ghee and milk.
Giống như cha mẹ yêu thương con cái, tôn kính bảo mẫu, và cho con bú sữa, ăn bơ sữa thích hợp v.v..
Sesaṃ vuttanayameva.
The rest is just as has been explained.
Phần còn lại cũng theo cách đã nói.
97. Vedanāvāre vedanākāyāti vedanāsamūhā.
97. In the section on feeling, bodies of feeling means aggregates of feeling.
97. Trong phần về Thọ (Vedanā), vedanākāya (thọ uẩn) có nghĩa là tập hợp các thọ.
Cakkhusamphassajā vedanā…pe… manosamphassajā vedanāti etaṃ ‘‘cakkhusamphassajā vedanā atthi kusalā, atthi akusalā, atthi abyākatā’’ti (vibha. 34) evaṃ vibhaṅge āgatattā cakkhudvārādīsu pavattānaṃ kusalākusalābyākatavedanānaṃ ‘‘sāriputto, mantāṇiputto’’ti evamādīsu mātito nāmaṃ viya mātisadisavatthuto nāmaṃ.
Feeling born of eye-contact... and so on... feeling born of mind-contact: Since it is stated in the Vibhaṅga, "There is feeling born of eye-contact that is wholesome, there is that which is unwholesome, there is that which is indeterminate," this is a name for the wholesome, unwholesome, and indeterminate feelings that arise at the eye-door and so on, derived from a basis similar to a mother, just as in "Sāriputta, son of Mantāṇī," the name comes from the mother.
Thọ do xúc nhãn sinh…pe… thọ do xúc ý sinh – điều này, vì được trình bày trong Vibhaṅga (Vibha. 34) rằng: “Có thọ do xúc nhãn sinh là thiện, có là bất thiện, có là vô ký”, nên đây là tên gọi của các thọ thiện, bất thiện, vô ký phát sinh ở nhãn môn và các môn khác, giống như tên gọi của một người con từ mẹ, ví dụ như “Sāriputta, Mantāṇiputta”, là tên gọi từ đối tượng tương tự như mẹ.
Vacanattho panettha cakkhusamphassahetu jātā vedanā cakkhusamphassajā vedanāti.
Herein, the meaning of the expression is: feeling born due to eye-contact is feeling born of eye-contact.
Ở đây, nghĩa của từ là: thọ sinh ra do duyên xúc nhãn gọi là thọ do xúc nhãn sinh.
Esa nayo sabbattha.
This is the method everywhere.
Tương tự cho tất cả các trường hợp.
Ayaṃ tāvettha sabbasaṅgāhikakathā.
This, for a start, is the all-inclusive explanation here.
Đây là lời giải thích bao quát tất cả ở đây.
Vipākavasena pana cakkhudvāre dve cakkhuviññāṇāni, dve manodhātuyo, tisso manoviññāṇadhātuyoti etāhi sampayuttavasena vedanā veditabbā.
However, by way of resultants, feelings should be understood in association with these: at the eye-door, the two eye-consciousnesses, the two mind-elements, and the three mind-consciousness-elements.
Tuy nhiên, theo khía cạnh quả (vipāka), các thọ cần được hiểu là những thọ tương ưng với hai nhãn thức, hai ý giới, và ba ý thức giới ở nhãn môn.
Esa nayo sotadvārādīsu.
This is the method at the ear-door and so on.
Tương tự cho nhĩ môn và các môn khác.
Manodvāre manoviññāṇadhātusampayuttāva.
At the mind-door, it is associated only with the mind-consciousness-element.
Ở ý môn, chỉ là các thọ tương ưng với ý thức giới.
Phassasamudayāti ettha pana pañcadvāre pañcavatthukavedanānaṃ sahajātacakkhusamphassādisamudayā samudayo hoti.
Here, in from the arising of contact, the arising of feelings based on the five physical bases in the five doors occurs from the arising of co-nascent eye-contact and so on.
Tuy nhiên, ở đây, trong cụm từ do xúc tập khởi (phassasamudayā), đối với các thọ thuộc năm cảnh ở năm môn, sự tập khởi là do sự tập khởi của xúc nhãn sinh đồng sinh và các xúc khác.
Avasesānaṃ cakkhusamphassādayo upanissayādivasena paccayā.
For the remaining feelings, eye-contact and so on are conditions by way of decisive support, etc.
Đối với các thọ còn lại, xúc nhãn và các xúc khác là duyên theo cách y chỉ mạnh (upanissaya) và các cách khác.
Manodvāre tadārammaṇavedanānaṃ advārikānañca paṭisandhibhavaṅgacutivedanānaṃ sahajātamanosamphassasamudayā samudayo hotīti veditabbo.
It should be understood that at the mind-door, for feelings of registration, and for doorless feelings of rebirth-linking, life-continuum, and decease, the arising occurs from the arising of co-nascent mind-contact.
Ở ý môn, đối với các thọ thuộc tâm tái tục (paṭisandhi), tâm hộ kiếp (bhavaṅga), tâm tử (cuti) không có môn, và các thọ thuộc tâm tùy quán (tadārammaṇa), sự tập khởi cần được hiểu là do sự tập khởi của xúc ý đồng sinh.
Sesaṃ vuttanayameva.
The rest is as has been explained.
Phần còn lại tương tự như đã nói.
98. Phassavāre cakkhusamphassoti cakkhumhi samphasso.
98. In the section on contact, eye-contact is contact in the eye.
98. Trong phần về Xúc (Phassa), cakkhusamphassa (nhãn xúc) là xúc ở nhãn.
Esa nayo sabbattha.
This is the method everywhere.
Tương tự cho tất cả các trường hợp.
Cakkhusamphasso…pe… kāyasamphassoti ettāvatā ca kusalākusalavipākā pañcavatthukā dasa samphassā vuttā honti.
And by this much, eye-contact... and so on... body-contact, ten wholesome and unwholesome resultant contacts based on the five physical bases are stated.
Với cụm từ nhãn xúc…pe… thân xúc (kāyasamphassa), mười xúc thuộc năm căn, là quả của thiện và bất thiện, đã được nói đến.
Manosamphassoti iminā sesā bāvīsati lokiyavipākamanasampayuttaphassā.
By mind-contact, the remaining twenty-two contacts associated with mundane resultant minds are meant.
Với cụm từ ý xúc (manosamphassa), hai mươi hai xúc còn lại là các xúc tương ưng với ý thức quả thuộc cõi dục (lokiya vipāka manasampayutta phassa).
Saḷāyatanasamudayāti channaṃ cakkhādīnaṃ āyatanānaṃ samudayena imassa chabbidhassāpi samphassassa samudayo hotīti veditabbo.
From the arising of the six sense bases: it should be understood that with the arising of the six sense bases, the eye and so on, there is the arising of this sixfold contact.
Trong cụm từ do sáu xứ tập khởi (saḷāyatanasamudayā), cần hiểu rằng sự tập khởi của sáu loại xúc này là do sự tập khởi của sáu xứ như nhãn và các xứ khác.
Sesaṃ vuttanayamevāti.
The rest is as has been explained.
Phần còn lại tương tự như đã nói.
99. Saḷāyatanavāre cakkhāyatanantiādīsu yaṃ vattabbaṃ, taṃ sabbaṃ visuddhimagge khandhaniddese ceva āyatananiddese ca vuttanayameva.
99. In the section on the six sense bases, whatever should be said concerning eye-base and so on, all of that is in accordance with the method stated in the Visuddhimagga, in the Exposition of the Aggregates and the Exposition of the Sense Bases.
99. Trong phần về Sáu Xứ (Saḷāyatana), tất cả những gì cần nói về nhãn xứ (cakkhāyatana) và các xứ khác đã được nói trong Thanh Tịnh Đạo (Visuddhimagga) ở phần giải thích về các uẩn (khandhaniddesa) và phần giải thích về các xứ (āyatananiddesa).
Nāmarūpasamudayāti ettha pana yaṃ nāmaṃ yañca rūpaṃ, yañca nāmarūpaṃ yassa āyatanassa paccayo hoti, tassa vasena visuddhimagge paṭiccasamuppādaniddese vuttanayena nāmarūpasamudayā saḷāyatanasamudayo veditabbo.
From the arising of name-and-form: here, the arising of the six sense bases from the arising of name-and-form should be understood according to the method stated in the Visuddhimagga, in the Exposition of Dependent Origination, based on whichever name, whichever form, and whichever name-and-form is a condition for a particular sense base.
Tuy nhiên, ở đây, trong cụm từ do danh sắc tập khởi (nāmarūpasamudayā), sự tập khởi của sáu xứ cần được hiểu là do sự tập khởi của danh sắc, theo cách đã nói trong phần giải thích về Duyên Khởi (paṭiccasamuppādaniddesa) của Thanh Tịnh Đạo, tùy theo danh, sắc, hoặc danh sắc nào là duyên cho xứ nào.
Sesaṃ vuttappakāramevāti.
The rest is in the manner already explained.
Phần còn lại tương tự như đã nói.
100. Nāmarūpavāre namanalakkhaṇaṃ nāmaṃ.
100. In the section on name-and-form, name has the characteristic of bending.
100. Trong phần về Danh Sắc (Nāmarūpa), danh (nāma) có đặc tính hướng về.
Ruppanalakkhaṇaṃ rūpaṃ.
Form has the characteristic of being afflicted.
Sắc (rūpa) có đặc tính bị biến hoại.
Vitthāravāre panassa vedanāti vedanākkhandho.
However, in the detailed section, by feeling the feeling-aggregate is to be understood.
Tuy nhiên, trong phần mở rộng, thọ (vedanā) là thọ uẩn.
Saññāti saññākkhandho.
By perception, the perception-aggregate.
Tưởng (saññā) là tưởng uẩn.
Cetanā phasso manasikāroti saṅkhārakkhandho veditabbo.
By volition, contact, attention, the formations-aggregate is to be understood.
Tư, xúc, tác ý (cetanā phasso manasikāro) cần được hiểu là hành uẩn.
Kāmañca aññepi saṅkhārakkhandhasaṅgahitā dhammā santi, ime pana tayo sabbadubbalesupi cittesu santi.
Although it is true that there are other states included in the formations-aggregate, these three are present even in the very weakest minds.
Mặc dù có những pháp khác cũng thuộc hành uẩn, nhưng ba pháp này có mặt ngay cả trong những tâm yếu kém nhất.
Tasmā etesaṃyeva vasenettha saṅkhārakkhandhopi dassito.
Therefore, the formations-aggregate is shown here by means of these alone.
Vì vậy, hành uẩn ở đây được trình bày chỉ dựa trên ba pháp này.
Cattāri ca mahābhūtānīti ettha cattārīti gaṇanaparicchedo.
In and the four great elements, four is a numerical determination.
Trong cụm từ và bốn đại hiển (cattāri ca mahābhūtāni), cattāri (bốn) là giới hạn số lượng.
Mahābhūtānīti pathavīāpatejavāyānametaṃ adhivacanaṃ.
Great elements is a designation for earth, water, fire, and air.
Mahābhūtāni (đại hiển) là tên gọi của đất, nước, lửa, gió.
Yena pana kāraṇena tāni mahābhūtānīti vuccanti, yo cettha añño vinicchayanayo, so sabbo visuddhimagge rūpakkhandhaniddese vutto.
The reason why they are called great elements, and any other method of analysis herein, all that is stated in the Visuddhimagga, in the Exposition of the Form-Aggregate.
Lý do tại sao chúng được gọi là đại hiển, và tất cả các phương pháp phân tích khác ở đây, đều đã được nói trong phần giải thích về sắc uẩn (rūpakkhandhaniddesa) trong Thanh Tịnh Đạo.
Catunnañca mahābhūtānaṃ upādāyāti ettha pana catunnanti upayogatthe sāmivacanaṃ, cattāri ca mahābhūtānīti vuttaṃ hoti.
Here, in and derived from the four great elements, of the four is a genitive in the sense of 'with respect to'; it means 'the four great elements'.
Tuy nhiên, ở đây, trong cụm từ do nương tựa bốn đại hiển (catunnañca mahābhūtānaṃ upādāyā), catunnaṃ là cách nói sở hữu cách (sāmivacana) mang nghĩa công dụng, tức là “bốn đại hiển”.
Upādāyāti upādiyitvā, gahetvāti attho.
Derived from means 'having derived from', 'having grasped'; this is the meaning.
Upādāyā có nghĩa là “do nương tựa”, “do nắm giữ”.
Nissāyātipi eke.
Some say it means 'depending on'.
Một số người nói là “do y chỉ”.
Vattamānanti ayañcettha pāṭhaseso.
And here, 'which is present' is the rest of the text to be supplied.
Và đây là phần còn thiếu của câu: “đang hiện hữu” (vattamānaṃ).
Samūhatthe vā etaṃ sāmivacanaṃ.
Or, this genitive is in the sense of a collection.
Hoặc đây là sở hữu cách mang nghĩa tập hợp.
Tena catunnañca mahābhūtānaṃ samūhaṃ upādāya pavattamānaṃ rūpanti ayamattho veditabbo.
Therefore, this meaning should be understood: form that is present derived from the collection of the four great elements.
Theo đó, cần hiểu nghĩa là: sắc hiện hữu do nương tựa vào tập hợp của bốn đại hiển.
Evaṃ sabbatthāpi yāni cattāri pathavīādīni mahābhūtāni, yañca catunnaṃ mahābhūtānaṃ upādāya vattamānaṃ cakkhāyatanādibhedena abhidhammapāḷiyameva vuttaṃ tevīsatividhaṃ rūpaṃ, taṃ sabbampi ‘‘rūpa’’nti veditabbaṃ.
Thus, in every case, whatever are the four great elements—earth, etc.—and whatever is the twenty-threefold form stated in the Abhidhamma Canon itself as differentiated into the eye-base, etc., which is present derived from the four great elements, all of that should be understood as 'form'.
Như vậy, ở khắp mọi nơi, bốn đại hiển như đất và các đại hiển khác, và hai mươi ba loại sắc đã được nói đến trong chính kinh tạng Abhidhamma, với các phân loại như nhãn xứ, v.v., đều cần được hiểu là “sắc”.
Viññāṇasamudayāti ettha pana yaṃ viññāṇaṃ yassa nāmassa yassa ca rūpassa yassa ca nāmarūpassa paccayo hoti, tassa vasena visuddhimagge paṭiccasamuppādaniddese vuttanayeneva viññāṇasamudayā nāmarūpasamudayo veditabbo.
Here, in from the arising of consciousness, the arising of name-and-form from the arising of consciousness should be understood in the very way stated in the Visuddhimagga, in the Exposition of Dependent Origination, based on whichever consciousness is a condition for a particular name, a particular form, and a particular name-and-form.
Tuy nhiên, ở đây, trong cụm từ do thức tập khởi (viññāṇasamudayā), sự tập khởi của danh sắc cần được hiểu là do sự tập khởi của thức, theo cách đã nói trong phần giải thích về Duyên Khởi (paṭiccasamuppādaniddesa) của Thanh Tịnh Đạo, tùy theo thức nào là duyên cho danh, cho sắc, hoặc cho danh sắc nào.
Sesaṃ vuttanayamevāti.
The rest is as has been explained.
Phần còn lại tương tự như đã nói.
101. Viññāṇavāre cakkhuviññāṇanti cakkhumhi viññāṇaṃ, cakkhuto vā jātaṃ viññāṇanti cakkhuviññāṇaṃ.
101. In the section on consciousness, eye-consciousness is consciousness in the eye, or consciousness born from the eye is eye-consciousness.
101. Trong phần về Thức (Viññāṇa), nhãn thức (cakkhuviññāṇa) là thức ở nhãn, hoặc thức sinh ra từ nhãn.
Evaṃ sotaghānajivhākāyaviññāṇāni.
Likewise for ear-, nose-, tongue-, and body-consciousness.
Tương tự cho nhĩ thức, tỷ thức, thiệt thức, thân thức.
Itaraṃ pana manoyeva viññāṇanti manoviññāṇaṃ.
The other, however, is mind itself as consciousness, thus mind-consciousness.
Còn ý thức (manoviññāṇa) là thức chính là ý.
Dvipañcaviññāṇavajjassa tebhūmakavipākacittassetaṃ adhivacanaṃ.
This is a designation for resultant consciousness of the three planes, excluding the two sets of five sense-consciousnesses.
Đây là tên gọi của các tâm quả thuộc ba cõi (tebhūmaka vipākacitta), trừ mười thức song ngũ (dvipañcaviññāṇa).
Saṅkhārasamudayāti ettha pana yo saṅkhāro yassa viññāṇassa paccayo hoti, tassa vasena saṅkhārasamudayā viññāṇasamudayo veditabbo.
Here, in from the arising of formations, the arising of consciousness from the arising of formations should be understood according to whichever formation is a condition for a particular consciousness.
Tuy nhiên, ở đây, trong cụm từ do hành tập khởi (saṅkhārasamudayā), sự tập khởi của thức cần được hiểu là do sự tập khởi của hành, tùy theo hành nào là duyên cho thức nào.
Sesaṃ vuttanayamevāti.
The rest is as has been explained.
Phần còn lại tương tự như đã nói.
102. Saṅkhāravāre abhisaṅkharaṇalakkhaṇo saṅkhāro.
102. In the section on formations, a formation has the characteristic of forming.
102. Trong phần về Hành (Saṅkhāra), hành (saṅkhāra) có đặc tính tạo tác.
Vitthāravāre panassa kāyasaṅkhāroti kāyato pavattasaṅkhāro, kāyadvāre copanavasena pavattānaṃ kāmāvacarakusalato aṭṭhannaṃ, akusalato dvādasannanti vīsatiyā kāyasañcetanānametaṃ adhivacanaṃ.
However, in the detailed section, bodily formation is a formation that proceeds from the body; this is a designation for the twenty bodily volitions that arise by way of bodily intimation at the body-door, namely, eight from wholesome sense-sphere consciousness and twelve from unwholesome consciousness.
Tuy nhiên, trong phần mở rộng, thân hành (kāyasaṅkhāro) là hành phát sinh từ thân, là tên gọi của hai mươi thân tư (kāyasañcetanā) – tám thiện nghiệp thuộc Dục giới và mười hai bất thiện nghiệp – phát sinh ở thân môn theo cách tác ý.
Vacīsaṅkhāroti vacito pavattasaṅkhāro, vacīdvāre vacanabhedavasena pavattānaṃ vīsatiyā eva vacīsañcetanānametaṃ adhivacanaṃ.
Verbal formation is a formation that proceeds from speech; this is a designation for those same twenty verbal volitions that arise by way of verbal intimation at the speech-door.
Khẩu hành (vacīsaṅkhāro) là hành phát sinh từ lời nói, là tên gọi của hai mươi khẩu tư (vacīsañcetanā) phát sinh ở khẩu môn theo cách nói ra.
Cittasaṅkhāroti cittato pavattasaṅkhāro, kāyavacīdvāre copanaṃ akatvā raho nisīditvā cintayantassa pavattānaṃ lokiyakusalākusalavasena ekūnatiṃsamanosañcetanānametaṃ adhivacanaṃ.
Mental formation is a formation that proceeds from the mind; this is a designation for the twenty-nine mental volitions, in terms of mundane wholesome and unwholesome states, that arise for one who is thinking while seated in seclusion, without making intimations at the body- or speech-door.
Ý hành (cittasaṅkhāro) là hành phát sinh từ tâm, là tên gọi của hai mươi chín ý tư (manosañcetanā) thiện và bất thiện thuộc thế gian (lokiya), phát sinh khi một người ngồi một mình suy tư mà không tác ý qua thân môn hay khẩu môn.
Avijjāsamudayāti ettha pana kusalānaṃ upanissayavasena akusalānaṃ sahajātādivasenāpi avijjāpaccayo hotīti veditabbā.
Here, in from the arising of ignorance, it should be understood that ignorance is a condition for wholesome formations by way of decisive support, and for unwholesome ones by way of co-nascence, etc.
Tuy nhiên, ở đây, trong cụm từ do vô minh tập khởi (avijjāsamudayā), cần hiểu rằng vô minh là duyên cho các hành thiện theo cách y chỉ mạnh (upanissaya), và cho các hành bất thiện theo cách đồng sinh và các cách khác.
Sesaṃ vuttanayamevāti.
The rest is as has been explained.
Phần còn lại tương tự như đã nói.
103. Avijjāvāre dukkhe aññāṇanti dukkhasacce aññāṇaṃ, mohassetaṃ adhivacanaṃ.
103. In the section on ignorance, ignorance concerning suffering means ignorance regarding the truth of suffering; this is a designation for delusion.
103. Trong phần về Vô Minh (Avijjā), không biết về khổ (dukkhe aññāṇaṃ) là không biết về chân lý Khổ, đây là tên gọi của si (moha).
Esa nayo samudaye aññāṇantiādīsu.
This is the method in ignorance concerning the origin and so on.
Tương tự cho không biết về tập khởi (samudaye aññāṇaṃ) và các điều khác.
Tattha catūhi kāraṇehi dukkhe aññāṇaṃ veditabbaṃ antogadhato vatthuto ārammaṇato paṭicchādanato ca.
Therein, ignorance concerning suffering should be understood through four reasons: through inclusion, through its object, through its subject, and through its concealment.
Ở đó, sự không biết về Khổ cần được hiểu qua bốn phương diện: do bao hàm (antogadhato), do đối tượng (vatthuto), do cảnh (ārammaṇato), và do che lấp (paṭicchādanato).
Tathā hi taṃ dukkhasaccapariyāpannattā dukkhe antogadhaṃ, dukkhasaccañcassa nissayapaccayabhāvena vatthu, ārammaṇapaccayabhāvena ārammaṇaṃ, dukkhasaccañca etaṃ paṭicchādeti, tassa yāthāvalakkhaṇappaṭivedhanivāraṇena, ñāṇappavattiyā cettha appadānena.
Indeed, since it is included in the truth of suffering, it is comprised within suffering. The truth of suffering is its base, by way of being a support condition, and its object, by way of being an object condition. And it conceals the truth of suffering by preventing the penetration of its true characteristic and by not allowing the proceeding of knowledge therein.
Thật vậy, do thuộc về khổ đế, nên nó nằm trong khổ. Khổ đế là đối tượng của nó theo nghĩa duyên nương tựa, là đối tượng theo nghĩa duyên cảnh. Và nó che giấu khổ đế bằng cách ngăn cản sự thấu hiểu các đặc tính chân thật của nó, và không cho phép trí tuệ phát sinh ở đây.
Samudaye aññāṇaṃ tīhi kāraṇehi veditabbaṃ vatthuto ārammaṇato paṭicchādanato ca.
Ignorance concerning the origin should be understood by three reasons: from the standpoint of its base, its object, and its concealing.
Vô minh đối với Khổ tập đế cần được hiểu theo ba phương diện: về đối tượng (vatthu), về cảnh (ārammaṇa) và về sự che giấu.
Nirodhe paṭipadāyañca aññāṇaṃ ekeneva kāraṇena veditabbaṃ paṭicchādanato.
Ignorance concerning the cessation and the path should be understood by one reason only: from the standpoint of its concealing.
Vô minh đối với Khổ diệt đế và Đạo diệt khổ cần được hiểu theo một phương diện duy nhất: về sự che giấu.
Nirodhapaṭipadāya hi paṭicchādakameva aññāṇaṃ tesaṃ yāthāvalakkhaṇappaṭivedhanivāraṇena, tesu ca ñāṇappavattiyā appadānena.
For, ignorance only conceals the cessation and the path by preventing the penetration of their true characteristics and by not allowing the proceeding of knowledge regarding them.
Thật vậy, vô minh đối với Khổ diệt đế và Đạo diệt khổ chỉ là sự che giấu, bằng cách ngăn cản sự thấu hiểu các đặc tính chân thật của chúng, và không cho phép trí tuệ phát sinh nơi chúng.
Na pana tattha antogadhaṃ, tasmiṃ saccadvaye apariyāpannattā.
But it is not comprised therein, because it is not included in that pair of truths.
Nhưng nó không nằm trong hai Thánh đế đó, vì không thuộc về chúng.
Na tassa taṃ saccadvayaṃ vatthu, asahajātattā.
That pair of truths is not its base, because they are not conascent with it.
Hai Thánh đế đó không phải là đối tượng (vatthu) của nó, vì không đồng sinh.
Nārammaṇaṃ, tadārabbha appavattanato.
Nor is it their object, because ignorance does not arise taking them as its object.
Cũng không phải là cảnh (ārammaṇa), vì nó không phát sinh dựa vào chúng.
Pacchimañhi saccadvayaṃ gambhīrattā duddasaṃ, na cettha andhabhūtaṃ aññāṇaṃ pavattati.
Indeed, the latter pair of truths is difficult to see because of its profundity, and blind ignorance does not proceed in this regard.
Thật vậy, hai Thánh đế sau (Diệt và Đạo) do sâu xa nên khó thấy, và vô minh mù quáng không phát sinh dựa vào chúng.
Purimaṃ pana vañcaniyaṭṭhena sabhāvalakkhaṇassa duddasattā gambhīraṃ, tattha vipallāsaggāhavasena pavattati.
The former pair, however, is profound because its intrinsic characteristic is difficult to see due to its deceptive nature, and ignorance proceeds there by way of distorted grasping.
Còn hai Thánh đế trước (Khổ và Tập) thì sâu xa do bản chất đặc tính của chúng khó thấy vì tính chất lừa dối, và vô minh phát sinh ở đó theo cách chấp thủ sai lầm.
Apica dukkheti ettāvatā saṅgahato vatthuto ārammaṇato kiccato ca avijjā dīpitā.
Furthermore, by the expression in suffering, ignorance is shown by way of inclusion, base, object, and function.
Hơn nữa, với từ “đối với Khổ” (dukkhe), vô minh được trình bày theo phương diện bao hàm, đối tượng (vatthu), cảnh (ārammaṇa) và chức năng (kicca).
Dukkhasamudayeti ettāvatā vatthuto ārammaṇato kiccato ca.
By the expression in the origin of suffering, it is shown by way of base, object, and function.
Với từ “đối với Khổ tập” (dukkhasamudaye), theo phương diện đối tượng (vatthu), cảnh (ārammaṇa) và chức năng (kicca).
Dukkhanirodhe dukkhanirodhagāminiyā paṭipadāyāti ettāvatā kiccato.
By the expressions in the cessation of suffering and in the path leading to the cessation of suffering, it is shown by way of function.
Với từ “đối với Khổ diệt và con đường đưa đến Khổ diệt” (dukkhanirodhe dukkhanirodhagāminiyā paṭipadāya), theo phương diện chức năng (kicca).
Avisesato pana aññāṇanti etena sabhāvato niddiṭṭhāti ñātabbā.
But it should be known that by the general term ignorance, it is pointed out by way of its intrinsic nature.
Tuy nhiên, nói chung, cần hiểu rằng vô minh được chỉ rõ theo bản chất của nó bằng từ “vô minh” (aññāṇaṃ).
Āsavasamudayāti ettha pana kāmāsavabhavāsavā sahajātādivasena avijjāya paccayā honti.
Here, in the phrase from the origin of the taints, the taint of sensuality and the taint of existence are conditions for ignorance by way of conascence and so on.
Trong từ “do lậu hoặc tập khởi” (āsavasamudayā), các lậu hoặc dục (kāmāsava) và hữu (bhavāsava) là duyên cho vô minh theo cách đồng sinh, v.v.
Avijjāsavo upanissayavaseneva.
The taint of ignorance is a condition only by way of decisive support.
Còn lậu hoặc vô minh (avijjāsava) thì chỉ theo cách tăng thượng duyên (upanissaya).
Pubbuppannā cettha avijjā avijjāsavoti veditabbā.
And here, previously arisen ignorance should be understood as the taint of ignorance.
Ở đây, vô minh đã phát sinh trước đó được gọi là lậu hoặc vô minh.
Sā aparāparuppannāya avijjāya upanissayapaccayo hoti.
It becomes a decisive support condition for ignorance that arises subsequently.
Nó là tăng thượng duyên cho vô minh phát sinh sau này.
Sesaṃ vuttanayamevāti.
The rest is just as has been explained.
Phần còn lại cũng theo cách đã nói.
104. Āsavavāre avijjāsamudayāti ettha avijjā kāmāsavabhavāsavānaṃ sahajātādivasena paccayo hoti.
104. In the section on the taints, in the phrase from the origin of ignorance, ignorance is a condition for the taint of sensuality and the taint of existence by way of conascence and so on.
104. Trong phần Lậu hoặc, ở đây, với từ “do vô minh tập khởi” (avijjāsamudayā), vô minh là duyên cho các lậu hoặc dục (kāmāsava) và hữu (bhavāsava) theo cách đồng sinh, v.v.
Avijjāsavassa upanissayavaseneva.
It is a condition for the taint of ignorance only by way of decisive support.
Còn đối với lậu hoặc vô minh (avijjāsava) thì chỉ theo cách tăng thượng duyên (upanissaya).
Aparāparuppannā cettha avijjā avijjāsavoti veditabbā.
And here, subsequently arising ignorance should be understood as the taint of ignorance.
Ở đây, vô minh phát sinh liên tiếp được gọi là lậu hoặc vô minh.
Pubbuppannā avijjāyevassa aparāparuppannassa avijjāsavassa upanissayapaccayo hoti.
The previously arisen ignorance itself becomes a decisive support condition for the subsequently arising taint of ignorance.
Chính vô minh đã phát sinh trước đó là tăng thượng duyên cho lậu hoặc vô minh phát sinh liên tiếp sau này.
Sesaṃ vuttanayamevāti.
The rest is just as has been explained.
Phần còn lại cũng theo cách đã nói.
Ayaṃ vāro yā esā paṭiccasamuppādapadesu jeṭṭhikā avijjā, tassāpi paccayadassanavasena vutto.
This section is also stated in order to show the condition for that ignorance which is the chief among the sections of dependent origination.
Phần này được nói lên để chỉ ra duyên cho chính vô minh tối thượng, vô minh mà là cái đầu tiên trong các chi phần của Duyên khởi.
Evaṃ vuttena vārena saṃsārassa anamataggatā sādhitā hoti.
By the section thus stated, the beginningless nature of saṃsāra is established.
Như vậy, với phần đã nói, tính vô thủy của luân hồi đã được chứng minh.
Kathaṃ?
How?
Bằng cách nào?
Āsavasamudayena hi avijjāsamudayo.
The origin of ignorance is from the origin of the taints.
Thật vậy, do lậu hoặc tập khởi nên vô minh tập khởi.
Avijjāsamudayenāpi āsavasamudayo.
The origin of the taints is also from the origin of ignorance.
Và do vô minh tập khởi nên lậu hoặc tập khởi.
Evaṃ āsavā avijjāya avijjāpi āsavānaṃ paccayoti katvā pubbakoṭi na paññāyati avijjāya, tassā apaññāyanato saṃsārassa anamataggatā siddhā hotīti.
Thus, because the taints are a condition for ignorance, and ignorance is also a condition for the taints, a prior point of ignorance is not discerned. Because it is not discerned, the beginningless nature of saṃsāra is established.
Như vậy, các lậu hoặc là duyên cho vô minh, và vô minh cũng là duyên cho các lậu hoặc. Do đó, không thể biết được điểm khởi đầu của vô minh, và vì không thể biết được điểm khởi đầu của nó, nên tính vô thủy của luân hồi được xác lập.
Evaṃ sabbepime imasmiṃ sutte kammapathavāro āhāravāro dukkhavāro jarā-maraṇa-jāti-bhava-upādāna-taṇhā-vedanā-phassa-saḷāyatana-nāmarūpa- viññāṇa-saṅkhāra-avijjā-āsavavāroti soḷasavārā vuttā.
Thus, in this sutta, the section on the paths of action, the section on nutriments, the section on suffering, and the sections on aging-and-death, birth, existence, clinging, craving, feeling, contact, the six sense bases, name-and-form, consciousness, formations, ignorance, and the taints—in all, these sixteen sections have been stated.
Như vậy, tất cả các phần trong kinh này – phần Nghiệp đạo, phần Thực, phần Khổ, phần Già-chết, Sinh, Hữu, Thủ, Ái, Thọ, Xúc, Lục nhập, Danh sắc, Thức, Hành, Vô minh, Lậu hoặc – tổng cộng là mười sáu phần đã được trình bày.
Tesu ekekassa vārassa saṅkhepavitthāravasena dvidhā vibhattā dvattiṃsaṭṭhānāni honti.
Among them, when each section is divided in two by way of a summary and a detailed explanation, there are thirty-two topics.
Trong số đó, mỗi phần được chia thành hai cách (tóm tắt và chi tiết), tạo thành ba mươi hai trường hợp.
Iti imasmiṃ sutte imesu dvattiṃsaṭṭhānesu cattāri saccāni kathitāni.
Thus, in this sutta, in these thirty-two topics, the four truths have been taught.
Như vậy, trong kinh này, ở ba mươi hai trường hợp này, bốn Thánh đế đã được giảng.
Etesaṃyeva vitthāravasena vuttesu soḷasasu ṭhānesu arahattaṃ kathitaṃ.
In the sixteen topics stated by way of detailed explanation of these very truths, arahantship has been taught.
Ở mười sáu trường hợp được trình bày chi tiết hơn, quả A-la-hán đã được giảng.
Therassa pana matena dvattiṃsāyapi ṭhānesu cattāri saccāni cattāro ca maggā kathitāti.
But according to the Elder's view, in all thirty-two topics, the four truths and the four paths have been taught.
Nhưng theo quan điểm của Trưởng lão, ở cả ba mươi hai trường hợp, bốn Thánh đế và bốn Đạo đã được giảng.
Iti sakalepi pañcamahānikāyasaṅgahite buddhavacane natthi taṃ suttaṃ, yattha dvattiṃsakkhattuṃ cattāri saccāni dvattiṃsakkhattuñca arahattaṃ pakāsitaṃ aññatra imamhā sammādiṭṭhisuttāti.
Thus, in the entire Word of the Buddha, compiled in the five great Nikāyas, there is no other sutta where the four truths are expounded thirty-two times and arahantship is expounded thirty-two times, apart from this Sammādiṭṭhi Sutta.
Như vậy, trong toàn bộ giáo pháp của Đức Phật được tổng hợp trong năm bộ Nikāya lớn, không có kinh nào mà bốn Thánh đế được công bố ba mươi hai lần và quả A-la-hán cũng ba mươi hai lần, ngoại trừ kinh Chánh Kiến này.
105. Evaṃ me sutanti satipaṭṭhānasuttaṃ.
105. Thus have I heard begins the Satipaṭṭhāna Sutta.
105. “ Như vầy tôi nghe” – đây là kinh Tứ niệm xứ (Satipaṭṭhāna Sutta).
Tattha kurūsu viharatīti kurunāmakā jānapadino rājakumārā, tesaṃ nivāso ekopi janapado ruḷhīsaddena kurūti vuccati, tasmiṃ kurūsu janapade.
Therein, while dwelling among the Kurus: The country-dwelling princes named the Kurus; their residence, even a single country, is called the Kurus by a conventional term. In that country of the Kurus.
Trong đó, “ trú tại xứ Kuru” (kurūsu viharati) có nghĩa là các hoàng tử thuộc xứ Kuru. Một vùng đất duy nhất là nơi cư trú của họ, theo nghĩa thông thường, được gọi là Kuru (số nhiều), tức là tại vùng đất Kuru đó.
Aṭṭhakathācariyā panāhu – mandhātukāle tīsu dīpesu manussā jambudīpo nāma buddhapaccekabuddhamahāsāvakacakkavattipabhutīnaṃ uttamapurisānaṃ uppattibhūmi uttamadīpo atiramaṇīyoti sutvā raññā mandhātucakkavattinā cakkaratanaṃ purakkhatvā cattāro dīpe anusaṃyāyantena saddhiṃ āgamaṃsu.
The commentary teachers, however, said: In the time of Mandhātu, people on three continents, having heard, "Jambudīpa is the birthplace of supreme persons such as Buddhas, Paccekabuddhas, great disciples, and wheel-turning monarchs; it is a supreme and most delightful continent," came along with the wheel-turning monarch Mandhātu as he traveled through the four continents with his wheel-treasure placed before him.
Tuy nhiên, các vị Luận sư nói rằng: Vào thời vua Mandhātā, con người ở ba châu lục đã nghe rằng Jambudīpa (Nam Thiệm Bộ Châu) là một hòn đảo tối thượng, là nơi phát sinh của các bậc vĩ nhân như chư Phật, chư Phật Độc Giác, các Đại đệ tử và các Chuyển Luân Vương, và là một nơi vô cùng đẹp đẽ. Do đó, họ đã đến cùng với vua Chuyển Luân Mandhātā, người dẫn đầu với bánh xe báu, đi khắp bốn châu lục.
Tato rājā pariṇāyakaratanaṃ pucchi –
Then the king asked the treasurer-jewel:
Sau đó, nhà vua hỏi vị cố vấn báu (pariṇāyakaratana) rằng:
Rājā cakkaratanaṃ purakkhatvā tattha agamāsi.
The king, placing the wheel-treasure before him, went there.
Nhà vua dẫn đầu với bánh xe báu và đi đến đó.
Cattāro mahārājāno ‘‘mandhātumahārājā āgato’’ti sutvāva ‘‘mahiddhiko mahānubhāvo rājā na sakkā yuddhena paṭibāhitu’’nti sakarajjaṃ niyyātesuṃ.
The four great kings, upon hearing "The great king Mandhātu has arrived," thinking, "The king is of great psychic power and great might; he cannot be repelled by battle," handed over their own kingdoms.
Bốn vị Đại Thiên vương, vừa nghe “Đại vương Mandhātā đã đến”, liền nghĩ “Vị vua có đại thần lực, đại oai đức này không thể bị đẩy lùi bằng chiến tranh”, và bèn dâng vương quốc của mình.
So taṃ gahetvā puna pucchi – ‘‘atthi nu kho ito ramaṇīyataraṃ ṭhāna’’nti.
Having taken it, he asked again, "Is there, indeed, a place more delightful than this?"
Sau khi nhận lấy, nhà vua lại hỏi: “Có nơi nào đẹp đẽ hơn nơi này không?”
Athassa tāvatiṃsabhavanaṃ kathayiṃsu – ‘‘tāvatiṃsabhavanaṃ, deva, ramaṇīyataraṃ, tattha sakkassa devarañño ime cattāro mahārājāno paricārakā dovārikabhūmiyaṃ tiṭṭhanti.
Then they told him of the Tāvatiṃsa realm: "The Tāvatiṃsa realm, sire, is more delightful. There, these four great kings are attendants of Sakka, king of the devas, standing in the position of doorkeepers.
Khi đó, họ kể cho vua nghe về cõi trời Đao Lợi (Tāvatiṃsa): “Tâu Đại vương, cõi trời Đao Lợi đẹp đẽ hơn. Ở đó, bốn vị Đại Thiên vương này là những người phục vụ, đứng ở vị trí gác cổng của Thiên vương Sakka.
Sakko devarājā mahiddhiko mahānubhāvo.
Sakka, king of the devas, is of great psychic power and great might.
Thiên vương Sakka có đại thần lực, đại oai đức.
Tassimāni pana upabhogaṭṭhānāni, yojanasahassubbedho vejayantapāsādo, pañcayojanasatubbedhā sudhammā devasabhā, diyaḍḍhayojanasatiko vejayantaratho, tathā erāvaṇo hatthī, dibbarukkhasahassapaṭimaṇḍitaṃ nandanavanaṃ cittalatāvanaṃ phārusakavanaṃ missakavanaṃ.
And these are his places of enjoyment: the Vejayanta palace, a thousand yojanas high; the Sudhammā assembly hall of the devas, five hundred yojanas high; the Vejayanta chariot, one hundred and fifty yojanas; likewise, the elephant Erāvaṇa; the Nandanavana park, Cittalatāvana park, Phārusakavana park, and Missakavana park, all adorned with a thousand celestial trees.
Và đây là những nơi hưởng thụ của ngài: cung điện Vejayanta cao một ngàn dojana, hội trường chư thiên Sudhammā cao năm trăm dojana, cỗ xe Vejayanta dài một trăm rưỡi dojana, cũng như voi Eravāṇa, vườn Nandanā, vườn Cittalatā, vườn Phārusaka, vườn Missaka được trang hoàng với hàng ngàn cây trời.
Yojanasatubbedho pāricchattako koviḷāro, tassa heṭṭhā saṭṭhiyojanāyāmā paṇṇāsayojanavitthatā pañcadasayojanubbedhā jayasumanapupphavaṇṇā paṇḍukambalasilā, yassā mudutāya sakkassa nisīdato upaḍḍhakāyo anupavisatī’’ti.
The Pāricchattaka coral tree is a hundred yojanas high. Beneath it is the Paṇḍukambala stone slab, the color of a jayasumana flower, sixty yojanas long, fifty yojanas wide, and fifteen yojanas thick. Due to its softness, when Sakka sits, half his body sinks into it."
Cây Pāricchattaka koviḷāra cao một trăm dojana. Phía dưới nó là tảng đá Paṇḍukambala, dài sáu mươi dojana, rộng năm mươi dojana, dày mười lăm dojana, có màu sắc như hoa Jayasumana, và mềm đến nỗi khi Sakka ngồi xuống, một nửa thân ngài lún vào.”
Taṃ sutvā rājā tattha gantukāmo cakkaratanaṃ abbhukkiri.
Hearing this, the king, wishing to go there, tossed up the wheel-treasure.
Nghe vậy, nhà vua muốn đi đến đó, bèn phóng bánh xe báu lên.
Taṃ ākāse patiṭṭhāsi saddhiṃ caturaṅginiyā senāya.
It stood in the sky, along with his fourfold army.
Bánh xe đó đứng vững trên không cùng với quân đội bốn binh chủng.
Atha dvinnaṃ devalokānaṃ vemajjhato cakkaratanaṃ otaritvā pathaviyaṃ patiṭṭhāsi saddhiṃ pariṇāyakaratanappamukhāya caturaṅginiyā senāya.
Then, from the middle of the two deva worlds, the wheel-treasure descended and established itself on the earth, together with the fourfold army headed by the advisor-treasure.
Sau đó, từ giữa hai cõi trời, Luân Bảo (Cakkaratana) giáng xuống và an vị trên mặt đất, cùng với quân đội bốn binh chủng do Thắng Lợi Bảo (Pariṇāyaka-ratana) dẫn đầu.
Rājā ekakova tāvatiṃsabhavanaṃ agamāsi.
The king went to the Tāvatiṃsa realm all by himself.
Vua một mình đi đến cõi trời Tāvatiṃsa.
Sakko ‘‘mandhātā āgato’’ti sutvāva tassa paccuggamanaṃ katvā – ‘‘svāgataṃ te, mahārāja, sakaṃ te, mahārāja.
Sakka, upon hearing "Mandhātā has come," went out to meet him and said, "Welcome to you, great king; this is your own, great king.
Sakko, vừa nghe tin “Mandhātā đã đến”, liền đi ra đón ngài và nói: “Chào mừng Đại vương, Đại vương đã đến cõi của mình.
Anusāsa, mahārājā’’ti vatvā saddhiṃ nāṭakehi rajjaṃ dvebhāge katvā ekaṃ bhāgamadāsi.
Rule, great king!" and, dividing the kingdom into two parts, he gave one part to him, together with the celestial dancers.
Xin Đại vương hãy cai trị!” Rồi cùng với các tiên nữ, chia vương quốc làm hai phần và trao một phần cho ngài.
Rañño tāvatiṃsabhavane patiṭṭhitamattasseva manussabhāvo vigacchi, devabhāvo pāturahosi.
As soon as the king was established in the Tāvatiṃsa realm, his human state vanished and a deva state appeared.
Ngay khi vua vừa an vị tại cõi trời Tāvatiṃsa, thân phận con người của ngài liền biến mất, thân phận chư thiên xuất hiện.
Tassa kira sakkena saddhiṃ paṇḍukambalasilāyaṃ nisinnassa akkhinimisamattena nānattaṃ paññāyati.
It is said that for him, sitting with Sakka on the Paṇḍukambala stone slab, the difference was discernible only by the blinking of an eye.
Khi ngài ngồi trên phiến đá Pandukambala cùng với Sakko, sự khác biệt giữa hai người chỉ có thể nhận ra trong khoảnh khắc nháy mắt.
Taṃ asallakkhentā devā sakkassa ca tassa ca nānatte muyhanti.
Not perceiving this, the devas were bewildered by the difference between Sakka and him.
Các vị chư thiên không nhận ra điều đó, nên bối rối về sự khác biệt giữa Sakko và ngài.
So tattha dibbasampattiṃ anubhavamāno yāva chattiṃsa sakkā uppajjitvā cutā, tāva rajjaṃ kāretvā atittoyeva kāmehi tato cavitvā attano uyyāne patiṭṭhito vātātapena phuṭṭhagatto kālamakāsi.
Enjoying divine bliss there, he reigned for as long as it took for thirty-six Sakkas to arise and pass away, and still insatiate with sensual pleasures, he fell from there, landed in his own park, and, his body afflicted by wind and sun, he passed away.
Ở đó, ngài hưởng thọ thiên lạc và cai trị vương quốc cho đến khi ba mươi sáu vị Sakka đã xuất hiện và mệnh chung, ngài vẫn chưa thỏa mãn các dục lạc, rồi từ đó mệnh chung và giáng sinh trong khu vườn của mình, thân thể bị gió và nắng tác động, và qua đời.
Cakkaratane pana pathaviyaṃ patiṭṭhite pariṇāyakaratanaṃ suvaṇṇapaṭṭe mandhātuupāhanaṃ likhāpetvā idaṃ mandhāturajjanti rajjamanusāsi.
When the wheel-treasure was established on the earth, the advisor-treasure had Mandhātā's sandal inscribed on a golden plate and ruled the kingdom, declaring, "This is Mandhātā's kingdom."
Khi Luân Bảo (Cakkaratana) an vị trên mặt đất, Thắng Lợi Bảo (Pariṇāyaka-ratana) đã cho khắc hình đôi dép của Mandhātā lên một tấm vàng và cai trị vương quốc, nói rằng: “Đây là vương quốc của Mandhātā.”
Tepi tīhi dīpehi āgatamanussā puna gantuṃ asakkontā pariṇāyakaratanaṃ upasaṅkamitvā ‘‘deva mayaṃ rañño ānubhāvena āgatā, idāni gantuṃ na sakkoma, vasanaṭṭhānaṃ no dehī’’ti yāciṃsu.
Those people who had come from the three continents, unable to return, approached the advisor-treasure and requested, "Sire, we came by the king's power, but now we cannot go back. Give us a place to live."
Những người từ ba châu lục đến đó, vì không thể trở về, đã đến gặp Thắng Lợi Bảo và cầu xin: “Thưa Đại vương, chúng tôi đã đến đây nhờ oai lực của đức vua, bây giờ chúng tôi không thể trở về được, xin ngài hãy ban cho chúng tôi một nơi để ở.”
So tesaṃ ekekaṃ janapadamadāsi.
He gave each of them a country.
Ngài đã ban cho mỗi người một vùng đất.
Tattha pubbavidehato āgatamanussehi āvasitapadeso tāyeva purimasaññāya videharaṭṭhanti nāmaṃ labhi.
Among these, the region inhabited by the people who came from Pubbavideha received the name Videharaṭṭha by that same previous designation.
Vùng đất mà những người từ Pubbavideha đến ở đã được gọi là Videharaṭṭha (Xứ Videha) theo tên cũ.
Aparagoyānato āgatamanussehi āvasitapadeso aparantajanapadoti nāmaṃ labhi.
The region inhabited by the people who came from Aparagoyāna received the name Aparantajanapada.
Vùng đất mà những người từ Aparagoyāna đến ở đã được gọi là Aparantajanapada (Xứ Aparanta).
Uttarakuruto āgatamanussehi āvasitapadeso kururaṭṭhanti nāmaṃ labhīti.
The region inhabited by the people who came from Uttarakuru received the name Kururaṭṭha.
Vùng đất mà những người từ Uttarukuru đến ở đã được gọi là Kururaṭṭha (Xứ Kuru).
Bahuke pana gāmanigamādayo upādāya bahuvacanena voharīyati.
However, it is referred to in the plural form on account of the many villages, towns, and so on.
Tuy nhiên, nhiều làng mạc và thị trấn khác được gọi bằng số nhiều.
Tena vuttaṃ ‘‘kurūsu viharatī’’ti.
Therefore it was said: "dwells among the Kurus."
Do đó, có câu nói: “Viharati Kurūsu” (Trú tại xứ Kuru).
Kammāsadhammaṃ nāma kurūnaṃ nigamoti.
Kammāsadhamma is a market town of the Kurus.
Kammāsadhammaṃ nāma Kurūnaṃ nigamo (Kammāsadhamma là một thị trấn của người Kuru).
Kammāsadhammanti ettha keci dha-kārassa da-kārena atthaṃ vaṇṇayanti.
Here, in Kammāsadhamma, some explain the meaning by replacing the letter 'dha' with the letter 'da'.
Ở đây, trong từ Kammāsadhamma, một số người giải thích ý nghĩa bằng cách thay chữ ‘dha’ bằng chữ ‘da’.
Kammāso ettha damitoti kammāsadammo.
Kammāsa was tamed here, thus Kammāsadamma.
Kammāsa (con hổ vằn) đã được thuần hóa ở đây, nên gọi là Kammāsadamma.
Kammāsoti kammāsapādo porisādo vuccati.
Kammāsa refers to the man-eater Kammāsapāda.
Kammāsa dùng để chỉ con hổ ăn thịt người (porisāda).
Tassa kira pāde khāṇukena viddhaṭṭhāne vaṇo ruhanto cittadārusadiso hutvā ruhi, tasmā kammāsapādoti paññāyittha.
It is said that at the spot on his foot pierced by a stump, the healing wound became like patterned wood as it healed; therefore, he became known as Kammāsapāda (Spotty-Foot).
Tương truyền, khi chân nó bị gai đâm, vết thương lành lại trông giống như một bức tượng gỗ được chạm khắc tinh xảo, nên nó được gọi là Kammāsapāda (hổ chân vằn).
So ca tasmiṃ okāse damito porisādabhāvato paṭisedhito.
And he was tamed in that place, restrained from his man-eating nature.
Nó đã được thuần hóa tại nơi đó, được ngăn chặn không còn ăn thịt người nữa.
Mahāsattena.
By the Great Being.
Bởi Đại Bồ Tát.
Katarasmiṃ jātaketi?
In which Jātaka?
Trong câu chuyện Jātaka nào?
Mahāsutasomajātaketi eke.
Some say in the Mahāsutasoma Jātaka.
Một số người nói là trong Mahāsutasoma Jātaka.
Ime pana therā jayaddisajātaketi vadanti.
These elders, however, say it was in the Jayaddisa Jātaka.
Tuy nhiên, các vị trưởng lão này lại nói là trong Jayaddisa Jātaka.
Tadā hi mahāsattena kammāsapādo damito.
For at that time, Kammāsapāda was tamed by the Great Being.
Khi đó, Bồ Tát đã thuần hóa Kammāsapāda.
Yathāha –
As it is said:
Như đã nói:
Keci pana dha-kāreneva atthaṃ vaṇṇayanti.
Some, however, explain the meaning using the letter 'dha'.
Tuy nhiên, một số người khác lại giải thích ý nghĩa bằng chính chữ ‘dha’.
Kururaṭṭhavāsīnaṃ kira kuruvattadhammo tasmiṃ kammāso jāto, tasmā taṃ ṭhānaṃ kammāso ettha dhammo jātoti kammāsadhammanti vuccati.
It is said that the Kurus' principle of conduct (kuruvattadhamma) became variegated (kammāso) in that place; therefore, that place is called Kammāsadhamma because the Dhamma became variegated (kammāso) there.
Tương truyền, pháp Kuru (kuruvattadhamma) của cư dân xứ Kuru đã trở nên tạp loạn (kammāsa) tại nơi đó, nên nơi đó được gọi là Kammāsadhamma, nghĩa là pháp đã trở nên tạp loạn ở đây.
Tattha niviṭṭhanigamassāpi etadeva nāmaṃ.
The market town established there also has this name.
Và thị trấn được thành lập ở đó cũng mang tên này.
Bhummavacanena kasmā na vuttanti?
Why was it not expressed with the locative case?
Tại sao không dùng cách nói ở thể sở hữu (bhummavacana)?
Avasanokāsato.
Because there was no dwelling place.
Vì không có chỗ ở.
Bhagavato kira tasmiṃ nigame vasanokāso koci vihāro nāhosi.
It is said that the Blessed One had no monastery as a dwelling place in that town.
Tương truyền, Đức Thế Tôn không có bất kỳ tu viện nào để ở trong thị trấn đó.
Nigamato pana apakkamma aññatarasmiṃ udakasampanne ramaṇīye bhūmibhāge mahāvanasaṇḍo ahosi.
But moving away from the town, in a certain delightful region with plenty of water, there was a large forest grove.
Tuy nhiên, cách xa thị trấn, có một khu rừng lớn trên một vùng đất đẹp đẽ, đầy nước.
Tattha bhagavā vihāsi.
The Blessed One dwelled there.
Đức Thế Tôn đã trú ngụ ở đó.
Taṃ nigamaṃ gocaragāmaṃ katvā, tasmā evamettha attho veditabbo ‘‘kurūsu viharati kammāsadhammaṃ nāma kurūnaṃ nigamo, taṃ gocaragāmaṃ katvā’’ti.
He made that town his alms-resort village; therefore, the meaning here should be understood as: "He dwells among the Kurus, at a market town of the Kurus named Kammāsadhamma, which he had made his alms-resort village."
Ngài đã biến thị trấn đó thành nơi khất thực (gocaragāma). Do đó, ý nghĩa ở đây nên được hiểu là: “Ngài trú tại xứ Kuru, thị trấn tên là Kammāsadhamma, đã biến thị trấn đó thành nơi khất thực.”
106. Ekāyano ayaṃ, bhikkhave, maggoti.
106. This is the one-and-only path, Bhikkhus.
106. Này các Tỳ-khưu, đây là con đường độc nhất (ekāyano ayaṃ, bhikkhave, maggo).
Kasmā bhagavā idaṃ suttamabhāsi?
Why did the Blessed One deliver this discourse?
Vì sao Đức Thế Tôn đã thuyết bài kinh này?
Kururaṭṭhavāsīnaṃ gambhīradesanāpaṭiggahaṇasamatthatāya.
Because of the capacity of the inhabitants of the Kuru country to grasp profound teachings.
Vì cư dân xứ Kuru có khả năng tiếp nhận giáo lý sâu sắc.
Kururaṭṭhavāsino kira bhikkhū bhikkhuniyo upāsakā upāsikāyo utupaccayādisampannattā tassa raṭṭhassa sappāyautupaccayasevanena niccaṃ kallasarīrā kallacittā ca honti.
It is said that the monks, nuns, laymen, and laywomen of the Kuru country, due to the excellence of the climate and other conditions of that country, and by making use of those favorable conditions, always have healthy bodies and healthy minds.
Tương truyền, các Tỳ-khưu, Tỳ-khưu-ni, cư sĩ nam và cư sĩ nữ ở xứ Kuru, nhờ có đầy đủ các yếu tố thuận lợi về khí hậu và điều kiện sống, luôn có thân thể khỏe mạnh và tâm trí minh mẫn.
Te cittasarīrakallatāya anuggahitapaññābalā gambhīrakathaṃ pariggahetuṃ samatthā honti.
Because of their mental and physical health, their power of wisdom is enhanced, and they are capable of grasping profound teachings.
Với thân thể và tâm trí khỏe mạnh, họ có năng lực trí tuệ được hỗ trợ, nên có khả năng nắm bắt những lời giáo huấn sâu sắc.
Tena tesaṃ bhagavā imaṃ gambhīradesanāpaṭiggahaṇasamatthataṃ sampassanto ekavīsatiyā ṭhānesu kammaṭṭhānaṃ arahatte pakkhipitvā idaṃ gambhīratthaṃ satipaṭṭhānasuttaṃ abhāsi.
Therefore, seeing this capacity of theirs to grasp profound teachings, the Blessed One delivered this Satipaṭṭhāna Sutta of profound meaning, placing the meditation subject in twenty-one instances leading up to Arahantship.
Vì thế, Đức Thế Tôn, nhận thấy khả năng tiếp nhận giáo lý sâu sắc này của họ, đã giảng bài kinh Tứ Niệm Xứ (Satipaṭṭhāna Sutta) có ý nghĩa sâu xa này, đặt pháp hành (kammaṭṭhāna) vào hai mươi mốt phương diện trong A-la-hán quả.
Yathā hi puriso suvaṇṇacaṅkoṭakaṃ labhitvā tattha nānāpupphāni pakkhipeyya, suvaṇṇamañjūsaṃ vā pana labhitvā sattaratanāni pakkhipeyya, evaṃ bhagavā kururaṭṭhavāsiparisaṃ labhitvā gambhīradesanaṃ desesi.
Just as a man, having obtained a golden flower-basket, would place various kinds of flowers in it, or having obtained a golden casket, would place the seven kinds of gems in it, so the Blessed One, having obtained the assembly of the Kuru country's inhabitants, taught a profound teaching.
Cũng như một người đàn ông tìm được một chiếc hộp vàng và đặt vào đó đủ loại hoa, hoặc tìm được một chiếc rương vàng và đặt vào đó bảy loại châu báu, tương tự như vậy, Đức Thế Tôn đã tìm được hội chúng cư dân xứ Kuru và thuyết giảng giáo lý sâu sắc.
Tenevettha aññānipi gambhīratthāni dīghanikāye mahānidānaṃ mahāsatipaṭṭhānaṃ imasmiṃ majjhimanikāye sāropamaṃ rukkhūpamaṃ raṭṭhapālaṃ māgaṇḍiyaṃ āneñjasappāyanti aññānipi suttāni desesi.
For this very reason, he also taught other discourses of profound meaning there, such as the Mahānidāna and Mahāsatipaṭṭhāna in the Dīgha Nikāya, and in this Majjhima Nikāya, the Sāropama, Rukkhūpama, Raṭṭhapāla, Māgaṇḍiya, and Āneñjasappāya, as well as other suttas.
Chính vì vậy, ở đây, Ngài cũng đã thuyết giảng những bài kinh có ý nghĩa sâu sắc khác trong Trường Bộ Kinh (Dīghanikāya) như Mahānidānaṃ (Đại Duyên Hệ), Mahāsatipaṭṭhānaṃ (Đại Niệm Xứ), và trong Trung Bộ Kinh (Majjhimanikāya) như Sāropamaṃ (Ví Dụ Về Lõi Cây), Rukkhūpamaṃ (Ví Dụ Về Cây), Raṭṭhapālaṃ (Raṭṭhapāla), Māgaṇḍiyaṃ (Māgaṇḍiya), Āneñjasappāya (Thích Ứng Với Vô Động), và nhiều bài kinh khác.
Apica tasmiṃ janapade catasso parisā pakatiyāva satipaṭṭhānabhāvanānuyogamanuyuttā viharanti, antamaso dāsakammakaraparijanāpi satipaṭṭhānappaṭisaṃyuttameva kathaṃ kathenti.
Moreover, in that country, the four assemblies naturally dwell dedicated to the practice of developing the establishments of mindfulness; even down to the slaves, workers, and servants, they engage in talk connected with the establishments of mindfulness.
Hơn nữa, tại xứ đó, bốn chúng tự nhiên đã chuyên tâm thực hành thiền Tứ Niệm Xứ, ngay cả những người hầu, người làm công cũng nói chuyện liên quan đến Tứ Niệm Xứ.
Udakatitthasuttakantanaṭṭhānādīsupi niratthakakathā nāma na pavattati.
Even at watering places, spinning places, and the like, there is no meaningless talk.
Ngay cả ở những nơi như bến nước, chỗ kéo sợi, cũng không có những câu chuyện vô ích.
Sace kāci itthī ‘‘amma tvaṃ kataraṃ satipaṭṭhānabhāvanaṃ manasikarosī’’ti pucchitā ‘‘na kiñcī’’ti vadati.
If some woman, when asked, "Mother, which establishment of mindfulness are you contemplating?" replies, "None at all,"
Nếu có một người phụ nữ nào đó được hỏi: “Mẹ ơi, mẹ đang thực hành thiền Tứ Niệm Xứ nào?”, và trả lời: “Không có gì cả.”
Taṃ garahanti ‘‘dhiratthu tava jīvitaṃ, jīvamānāpi tvaṃ matasadisā’’ti.
they rebuke her, saying, "Fie on your life! Though living, you are like one dead."
Thì người ta sẽ quở trách cô ấy: “Đáng ghê tởm thay cuộc sống của cô, dù sống mà cô cũng như đã chết.”
Atha naṃ ‘‘mā dāni puna evamakāsī’’ti ovaditvā aññataraṃ satipaṭṭhānaṃ uggaṇhāpenti.
Then, advising her, "Do not do so again," they make her learn one of the establishments of mindfulness.
Sau đó, họ khuyên cô ấy: “Đừng làm như vậy nữa,” và dạy cô ấy một pháp Tứ Niệm Xứ nào đó.
Yā pana ‘‘ahaṃ asukaṃ satipaṭṭhānaṃ manasikaromī’’ti vadati.
But as for the one who says, "I am contemplating such-and-such an establishment of mindfulness,"
Còn người nào nói: “Tôi đang thực hành pháp Tứ Niệm Xứ này,”
Tassā ‘‘sādhu sādhū’’ti sādhukāraṃ datvā ‘‘tava jīvitaṃ sujīvitaṃ, tvaṃ nāma manussattaṃ pattā, tavatthāya sammāsambuddho uppanno’’tiādīhi pasaṃsanti.
they give their approval, saying, "Excellent, excellent!" and praise her with words like, "Your life is well-lived; you have truly attained a human existence; it is for your sake that the Perfectly Enlightened One arose."
Thì họ sẽ tán thán: “Lành thay, lành thay! Cuộc sống của cô thật tốt đẹp, cô đã đạt được thân phận con người, Đức Chánh Đẳng Giác đã xuất hiện vì lợi ích của cô,” và những lời tương tự.
Na kevalañcettha manussajātiyāyeva satipaṭṭhānamanasikārayuttā, te nissāya viharantā tiracchānagatāpi.
And not only are those of human birth devoted to the contemplation of the establishments of mindfulness there, but also the animals that live depending on them.
Không chỉ có loài người ở đây chuyên tâm thực hành Tứ Niệm Xứ, mà ngay cả những loài vật sống nương tựa vào họ cũng vậy.
Tatridaṃ vatthu – eko kira naṭako suvapotakaṃ gahetvā sikkhāpento vicarati.
On this, there is the following story: A certain entertainer was traveling around, having caught and trained a young parrot.
Có một câu chuyện như sau: Tương truyền, có một người diễn viên xiếc mang theo một con vẹt con và đi khắp nơi để huấn luyện nó.
So bhikkhunupassayaṃ upanissāya vasitvā gamanakāle suvapotakaṃ pamussitvā gato.
He stayed near a nunnery, and when it was time to leave, he forgot the young parrot and went away.
Anh ta đã sống nương tựa vào một tu viện của các Tỳ-khưu-ni, và khi rời đi, anh ta đã quên con vẹt con.
Taṃ sāmaṇeriyo gahetvā paṭijaggiṃsu.
The female novices took it and looked after it.
Các Sāmaṇerī đã nhận nuôi và chăm sóc nó.
Buddharakkhitotissa nāmaṃ akaṃsu.
They gave it the name Buddharakkhita.
Họ đặt tên cho nó là Buddharakkhita.
Taṃ ekadivasaṃ purato nisinnaṃ disvā mahātherī āha – ‘‘buddharakkhitā’’ti?
One day, seeing it sitting in front of her, the senior nun said, "Buddharakkhita?"
Một ngày nọ, Đại Trưởng Lão Ni nhìn thấy nó đang ngồi trước mặt và hỏi: “Buddharakkhita à?”
Taṃ ekadivasaṃ pātova toraṇagge nisīditvā bālātapaṃ tapamānaṃ eko sakuṇo nakhapañjarena aggahesi.
One day, early in the morning, while he was sitting on top of an archway basking in the early sun, a bird seized him with its talons.
Một hôm, vào sáng sớm, khi vị ấy đang ngồi trên cổng vòm sưởi nắng sớm, một con chim đã dùng móng vuốt của nó tóm lấy vị ấy.
So ‘‘kiri kirī’’ti saddamakāsi.
He made the sound "kiri kiri."
Vị ấy kêu lên “kiri kiri”.
Sāmaṇeriyo sutvā ‘‘ayye buddharakkhito sakuṇena gahito, mocema na’’nti leḍḍuādīni gahetvā anubandhitvā mocesuṃ.
The novice nuns, hearing it, said, "Venerable lady, Buddharakkhita has been seized by a bird! Let us free him!" and taking pebbles and the like, they pursued it and freed him.
Các Sa-di-ni nghe thấy, nói: “Sư cô ơi, Buddharakkhita bị chim bắt rồi, chúng ta có nên giải cứu không?” – rồi cầm gạch đá đuổi theo và giải cứu vị ấy.
Taṃ ānetvā purato ṭhapitaṃ therī āha –
Having brought him and placed him before her, the elder nun said:
Sau khi đưa vị ấy về và đặt trước mặt, Sư cô hỏi:
Bahūni nāmāni.
there are many names.
Có nhiều tên gọi.
Svāyaṃ idha ayananāmena vutto.
Here, it is spoken of by the name ayanaṃ.
Ở đây, nó được gọi bằng tên ayana.
Tasmā ekāyano ayaṃ, bhikkhave, maggoti ettha ekamaggo ayaṃ, bhikkhave, maggo, na dvedhāpathabhūtoti evamattho daṭṭhabbo.
Therefore, in the phrase ekāyano ayaṃ, bhikkhave, maggo, the meaning should be understood thus: “This path, monks, is a one-path; it is not a forked path.”
Do đó, trong câu ekāyano ayaṃ, bhikkhave, maggo (Này các Tỳ-khưu, đây là con đường độc nhất), ý nghĩa cần được hiểu là: Này các Tỳ-khưu, đây là một con đường duy nhất, không phải là con đường hai ngả.
Atha vā ekena ayitabboti ekāyano.
Or, it is ekāyano because it is to be gone by one.
Hoặc, ekāyano là con đường mà một người phải đi.
Ekenāti gaṇasaṅgaṇikaṃ pahāya vūpakaṭṭhena pavivittacittena.
By one means: having abandoned association with a group, with a secluded and withdrawn mind.
Ekenā có nghĩa là bởi một người đã từ bỏ sự tụ tập, đã ẩn dật, với tâm thanh tịnh.
Ayitabboti paṭipajjitabbo.
To be gone means to be practiced.
Ayitabbo có nghĩa là phải thực hành.
Ayanti vā etenāti ayano, saṃsārato nibbānaṃ gacchantīti attho.
Or, they go by this, thus it is ayano; the meaning is that they go from saṃsāra to Nibbāna.
Hoặc, ayano là con đường mà người ta đi qua, nghĩa là đi từ luân hồi đến Niết-bàn.
Ekassa ayano ekāyano, ekassāti seṭṭhassa.
The path of the One is ekāyano; of the One means of the foremost.
Con đường của một người (ekassa ayano) là ekāyano, của một người ekassā tức là của vị tối thượng.
Sabbasattānaṃ seṭṭho ca bhagavā, tasmā bhagavatoti vuttaṃ hoti.
And the Blessed One is the foremost of all beings; therefore, it is said to be of the Blessed One.
Vị Thế Tôn là tối thượng trong tất cả chúng sinh, do đó có nghĩa là của Thế Tôn.
Kiñcāpi hi tena aññepi ayanti, evaṃ santepi bhagavatova so ayano tena uppāditattā.
Although others also go by it, even so, that path belongs to the Blessed One alone, because it was produced by him.
Mặc dù những người khác cũng đi trên con đường đó, nhưng con đường đó vẫn là của Thế Tôn vì Ngài đã tạo ra nó.
Yathāha ‘‘so hi, brāhmaṇa, bhagavā anuppannassa maggassa uppādetā’’tiādi (ma. ni. 3.79).
As it is said: “For that Blessed One, Brahmin, is the producer of the unarisen path,” and so on.
Như đã nói: “Này Bà-la-môn, Thế Tôn là người đã tạo ra con đường chưa từng có” và vân vân.
Ayatīti vā ayano, gacchati pavattatīti attho.
Or, it goes, thus it is ayano; the meaning is it proceeds, it occurs.
Hoặc, ayano là con đường đi, nghĩa là nó diễn tiến.
Ekasmiṃ ayanoti ekāyano, imasmiṃyeva dhammavinaye pavattati, na aññatrāti vuttaṃ hoti.
It is an ayana in one, thus ekāyano; what is meant is that it occurs only in this Dhamma-Vinaya, not elsewhere.
Con đường diễn tiến trong một (ekasmiṃ ayano) là ekāyano, có nghĩa là nó chỉ diễn tiến trong Pháp và Luật này, không ở nơi nào khác.
Yathāha ‘‘imasmiṃ kho, subhadda, dhammavinaye ariyo aṭṭhaṅgiko maggo upalabbhatī’’ti (dī. ni. 2.214).
As it is said: "In this Dhamma-Vinaya, Subhadda, the Noble Eightfold Path is found."
Như đã nói: “Này Subhadda, trong Pháp và Luật này, Bát Chánh Đạo cao quý được tìm thấy.”
Desanābhedoyeva heso, attho paneko.
This is just a difference in teaching; the meaning, however, is one.
Đây chỉ là sự khác biệt trong cách giảng dạy, nhưng ý nghĩa thì là một.
Apica ekaṃ ayatīti ekāyano.
Moreover, it goes to one, thus ekāyano.
Hơn nữa, ekāyano là con đường dẫn đến một (ekaṃ ayati).
Pubbabhāge nānāmukhabhāvanānayappavattopi aparabhāge ekaṃ nibbānameva gacchatīti vuttaṃ hoti.
What is meant is that although in the preliminary stage it proceeds by way of various methods of development, in the later stage it goes only to the one Nibbāna.
Có nghĩa là, mặc dù trong giai đoạn đầu nó có thể diễn tiến theo nhiều phương pháp tu tập khác nhau, nhưng trong giai đoạn sau, nó chỉ dẫn đến một mục tiêu duy nhất là Niết-bàn.
Yathāha brahmā sahampati –
As Brahmā Sahampati said:
Như Phạm thiên Sahampati đã nói:
Keci pana ‘‘na pāraṃ diguṇaṃ yantī’’ti gāthānayena yasmā ekavāraṃ nibbānaṃ gacchati.
Some, however, by the method of the verse "they do not go to the further shore a second time," say that because one goes to Nibbāna one time,
Tuy nhiên, một số người nói rằng ekāyano là vì người ta chỉ đi đến Niết-bàn một lần, theo câu kệ “không đi hai lần đến bờ bên kia”. Nhưng điều đó không hợp lý.
Tasmā ‘‘ekāyano’’ti vadanti, taṃ na yujjati.
therefore it is called ekāyano, but that is not correct.
Thật vậy, đối với ý nghĩa này, cách diễn đạt phải là “sakiṃ ayano” (đi một lần).
Imassa hi atthassa sakiṃ ayanoti iminā byañjanena bhavitabbaṃ.
For this meaning, the expression should be sakiṃ ayano.
Nếu người ta giải thích ý nghĩa này bằng cách kết hợp rằng “con đường này có một sự đi, một sự diễn tiến duy nhất”, thì cách diễn đạt có thể hợp lý, nhưng ý nghĩa thì không hợp lý theo cả hai cách.
Yadi pana ekaṃ ayanamassa ekā gati pavattīti evamatthaṃ yojetvā vucceyya, byañjanaṃ yujjeyya, attho pana ubhayathāpi na yujjati.
If it were said by constructing the meaning as, "it has a one-time going, a one-time proceeding," the expression would be correct, but the meaning would not be correct in either case.
Vì sao?
Kasmā?
Why?
Vì ở đây, ý muốn nói đến con đường niệm xứ sơ khởi.
Idha pubbabhāgamaggassa adhippetattā.
Because here the path of the preliminary stage is intended.
Thật vậy, con đường niệm xứ sơ khởi diễn tiến trên bốn đối tượng như thân v.v. được đề cập ở đây, chứ không phải con đường siêu thế.
Kāyādicatuārammaṇappavatto hi pubbabhāgasatipaṭṭhānamaggo idha adhippeto, na lokuttaro.
Here, the path of preliminary satipaṭṭhāna, which occurs with the four objects beginning with the body, is intended, not the supramundane path.
Và con đường đó có thể diễn tiến nhiều lần, và có nhiều sự diễn tiến của nó.
So ca anekavārampi ayati, anekañcassa ayanaṃ hoti.
And that path goes many times, and its going is manifold.
Và ngay cả trước đây, đã có cuộc thảo luận của các vị Đại Trưởng lão về thuật ngữ này.
Pubbepi ca imasmiṃ pade mahātherānaṃ sākacchā ahosiyeva.
In the past, too, there was a discussion among the great elders on this term.
Trưởng lão Tipiṭakacūḷanāga nói rằng đó là “con đường niệm xứ sơ khởi” (pubbabhāgasatipaṭṭhānamaggo).
Tipiṭakacūḷanāgatthero ‘‘pubbabhāgasatipaṭṭhānamaggo’’ti āha.
The elder Tipiṭaka Cūḷanāga said, “It is the path of preliminary satipaṭṭhāna.”
Nhưng vị thầy của ngài, Trưởng lão Tipiṭakacūḷasuma, nói rằng đó là “con đường hỗn hợp” (missakamaggo).
Ācariyo panassa tipiṭakacūḷasumatthero ‘‘missakamaggo’’ti āha.
His teacher, however, the elder Tipiṭaka Cūḷasuma, said, “It is the mixed path.”
“Bạch sư, đó là giai đoạn sơ khởi.”
Pubbabhāgo bhanteti.
“Venerable sir, it is the preliminary stage.”
“Này hiền giả, đó là hỗn hợp.”
Missako āvusoti.
“Friend, it is the mixed path.”
Khi vị thầy lặp đi lặp lại, ngài không phản bác mà giữ im lặng.
Ācariye punappunaṃ bhaṇante appaṭibāhitvā tuṇhī ahosi.
When his teacher spoke again and again, he did not object and remained silent.
Họ đã đứng dậy mà không giải quyết được vấn đề.
Pañhaṃ avinicchinitvāva uṭṭhahiṃsu.
They rose without having settled the question.
Sau đó, khi vị Trưởng lão thầy đang đi đến phòng tắm, ngài nghĩ: “Ta đã nói là con đường hỗn hợp, nhưng Cūḷanāga lại nói là giai đoạn sơ khởi. Vậy đâu là quyết định đúng ở đây?” Ngài đã lật lại kinh từ đầu và nhận ra ở chỗ này: “Này các Tỳ-khưu, nếu ai đó tu tập bốn niệm xứ này như vậy trong bảy năm…” Ngài nhận thấy rằng không có con đường siêu thế nào tồn tại trong bảy năm sau khi phát sinh. Ngài biết rằng con đường hỗn hợp mà mình đã nói là không đúng, mà con đường niệm xứ sơ khởi mà Cūḷanāga đã thấy mới là đúng. Sau khi nhận ra điều đó, ngài đã đi đến nơi nghe Pháp khi tiếng chuông báo hiệu ngày thứ tám vang lên.
Athācariyatthero nhānakoṭṭhakaṃ gacchanto ‘‘mayā missakamaggo kathito, cūḷanāgo pubbabhāgoti ādāya voharati, ko nu kho ettha nicchayo’’ti suttantaṃ ādito paṭṭhāya parivattento ‘‘yo hi koci, bhikkhave, ime cattāro satipaṭṭhāne evaṃ bhāveyya satta vassānī’’ti imasmiṃ ṭhāne sallakkhesi, lokuttaramaggo uppajjitvā satta vassāni tiṭṭhamāno nāma natthi, mayā vutto missakamaggo na labbhati, cūḷanāgena diṭṭho pubbabhāgamaggova labbhatīti ñatvā aṭṭhamiyaṃ dhammassavane saṅghuṭṭhe agamāsi.
Then, as the teacher-elder was going to the bath-house, he reviewed the Suttanta from the beginning, thinking, “I said it was the mixed path, but Cūḷanāga holds it to be the preliminary stage. What is the decision here?” He noted the passage, “Whoever, monks, should develop these four establishments of mindfulness in this way for seven years…” He knew, “There is no such thing as a supramundane path arising and lasting for seven years. The mixed path I spoke of is not found; only the path of the preliminary stage seen by Cūḷanāga is found.” Then, on the eighth day, when the Dhamma-hearing was announced, he went.
Người ta nói rằng các vị Trưởng lão thời xưa rất thích nghe Pháp.
Porāṇakattherā kira piyadhammassavanā honti.
It is said that the ancient elders were fond of listening to the Dhamma.
Nghe tiếng chuông là họ liền đổ xô đến, nói: “Tôi trước, tôi trước!”
Saddaṃ sutvāva ‘‘ahaṃ paṭhamaṃ, ahaṃ paṭhama’’nti ekappahāreneva osaranti.
As soon as they heard the sound, they would assemble all at once, thinking, “I first, I first.”
Và vào ngày đó, đến lượt Trưởng lão Cūḷanāga thuyết Pháp.
Tasmiñca divase cūḷanāgattherassa vāro.
And on that day, it was the elder Cūḷanāga’s turn.
Ngài ngồi trên pháp tòa, cầm quạt, và sau khi đã nói những câu kệ mở đầu, ngài nghĩ trong lòng khi vị Trưởng lão (thầy) đang đứng sau lưng ghế: “Ta sẽ không nói riêng.”
Tena dhammāsane nisīditvā vījaniṃ gahetvā pubbagāthāsu vuttāsu therassa āsanapiṭṭhiyaṃ ṭhitassa etadahosi ‘‘raho nisīditvā na vakkhāmī’’ti.
When he was seated on the Dhamma-seat, had taken the fan, and the preliminary verses had been spoken, it occurred to the elder, who was standing behind the seat, “I will not speak while sitting in private.”
Thật vậy, các vị Trưởng lão thời xưa không có tâm ganh tị, họ không đi khắp nơi nâng cao quan điểm của mình như gánh mía, mà họ chỉ chấp nhận lý lẽ và loại bỏ những điều phi lý.
Porāṇakattherā hi anusūyakā honti, na attano rucimeva ucchubhāraṃ viya evaṃ ukkhipitvā vicaranti, kāraṇameva gaṇhanti, akāraṇaṃ vissajjenti.
For the ancient elders were not envious; they did not go about holding up their own preferences like a load of sugarcane. They accepted what was reasonable and rejected what was not.
Vì vậy, vị Trưởng lão (thầy) nói: “Này hiền giả Cūḷanāga.”
Tasmā thero ‘‘āvuso cūḷanāgā’’ti āha.
Therefore, the elder said, “Friend Cūḷanāga.”
Vị ấy, nghe giọng nói giống như của thầy mình, liền dừng Pháp lại và nói: “Bạch sư, có việc gì ạ?”
So ācariyassa viya saddoti dhammaṃ ṭhapetvā ‘‘kiṃ bhante’’ti āha.
He, thinking, “It is like my teacher’s voice,” set aside the Dhamma and said, “What is it, venerable sir?”
“Này hiền giả Cūḷanāga, con đường hỗn hợp mà ta đã nói là không đúng, con đường niệm xứ sơ khởi mà con đã nói mới là đúng.”
Āvuso cūḷanāga mayā vutto missakamaggo na labbhati, tayā vutto pubbabhāgasatipaṭṭhānamaggova labbhatīti.
“Friend Cūḷanāga, the mixed path that I spoke of is not found; only the path of preliminary satipaṭṭhāna that you spoke of is found.”
Vị Trưởng lão (Cūḷanāga) nghĩ: “Thầy của chúng ta là bậc thông suốt tất cả các kinh điển, bậc Tam Tạng, bậc Phật nghe nhiều, mà một vấn đề như vậy vẫn còn làm ngài bối rối. Trong tương lai, các huynh đệ của ta cũng sẽ bối rối về vấn đề này.” Ngài liền lấy kinh từ Paṭisambhidāmagga để làm cho vấn đề này vững chắc: “Con đường độc nhất (ekāyanamaggo) được gọi là con đường niệm xứ sơ khởi –
Maggoti kenaṭṭhena maggo?
Maggo: In what sense is it a path?
Theo ý nghĩa là con đường dẫn đến Niết-bàn, và theo ý nghĩa là được những người mong cầu Niết-bàn tìm kiếm.
Nibbānagamanaṭṭhena nibbānatthikehi magganiyaṭṭhena ca.
In the sense of going to Nibbāna, and in the sense of being sought by those who seek Nibbāna.
Để thanh tịnh chúng sinh (sattānaṃ visuddhiyā): Để thanh tịnh tâm của chúng sinh bị ô nhiễm bởi các cấu uế như tham ái v.v., và bởi các phiền não như tham lam bất chính v.v.
Sattānaṃ visuddhiyāti rāgādīhi malehi abhijjhāvisamalobhādīhi ca upakkilesehi kiliṭṭhacittānaṃ sattānaṃ visuddhatthāya.
Sattānaṃ visuddhiyā: For the purification of beings whose minds are stained by defilements such as passion and the corruptions such as covetousness and unrighteous greed.
Sattānaṃ visuddhiyā (để thanh tịnh chúng sinh) nghĩa là để thanh tịnh những chúng sinh có tâm bị ô nhiễm bởi các cấu uế như tham ái v.v., và các phiền não phụ như tham lam bất chính v.v.
Tathā hi imināva maggena ito satasahassakappādhikānaṃ catunnaṃ asaṅkhyeyyānaṃ upari ekasmiññeva kappe nibbatte taṇhaṅkaramedhaṅkarasaraṇaṅkaradīpaṅkaranāmake buddhe ādiṃ katvā sakyamunipariyosānā aneke sammāsambuddhā anekasatā paccekabuddhā gaṇanapathaṃ vītivattā ariyasāvakā cāti ime sattā sabbe cittamalaṃ pavāhetvā paramavisuddhiṃ pattā.
Indeed, it is so. By this very path, from four incalculable aeons and one hundred thousand aeons ago, beginning with the Buddhas named Taṇhaṅkara, Medhaṅkara, Saraṇaṅkara, and Dīpaṅkara, who arose in a single aeon, up to the Sage of the Sakyans, many Perfectly Enlightened Buddhas, many hundreds of Paccekabuddhas, and noble disciples who are beyond count—all these beings washed away the defilements of the mind and attained supreme purity.
Thật vậy, chính bằng con đường này, kể từ Taṇhaṅkara, Medhaṅkara, Saraṇaṅkara và Dīpaṅkara Buddhas, những vị đã xuất hiện trong một kappa duy nhất sau bốn a-tăng-kỳ và một trăm ngàn kappa từ đây, cho đến Đức Sakyamuni, vô số Chánh Đẳng Giác, hàng trăm vị Độc Giác Phật vượt ngoài sự tính đếm, và các vị Thánh Đệ tử – tất cả những chúng sanh này đều đã gột sạch cấu uế của tâm và đạt được sự thanh tịnh tối thượng.
Rūpamalavasena pana saṃkilesavodānapaññattiyeva natthi.
However, in terms of defilement by way of matter, there is no designation of defilement and purification at all.
Tuy nhiên, về phương diện cấu uế của sắc, thì không có sự chế định nào về sự cấu nhiễm hay thanh tịnh cả.
Tathā hi –
Indeed, it is so:
Chẳng hạn như:
Sokaparidevānaṃ samatikkamāyāti sokassa ca paridevassa ca samatikkamāya, pahānāyāti attho.
For the overcoming of sorrow and lamentation means for the overcoming, for the abandoning, of both sorrow and lamentation.
Để vượt qua sầu bi (sokaparidevānaṃ samatikkamāya) có nghĩa là để vượt qua, để đoạn trừ sầu và bi.
Ayañhi maggo bhāvito santatimahāmattādīnaṃ viya sokasamatikkamāya, paṭācārādīnaṃ viya ca paridevasamatikkamāya ca saṃvattati.
For when this path is developed, it leads to the overcoming of sorrow, as in the case of the Great Minister Santati and others, and to the overcoming of lamentation, as in the case of Paṭācārā and others.
Con đường này, khi được tu tập, dẫn đến sự vượt qua sầu, như trường hợp của Đại Thần Santati và những vị khác, và vượt qua bi, như trường hợp của Paṭācārā và những vị khác.
Tenāha ‘‘sokaparidevānaṃ samatikkamāyā’’ti.
Therefore, He said, “for the overcoming of sorrow and lamentation.”
Vì vậy, Đức Phật đã nói: “để vượt qua sầu bi.”
Kiñcāpi hi santatimahāmatto –
For although the Great Minister Santati,
Mặc dù Đại Thần Santati –
Tatrāyaṃ atthadīpanā – sāvatthiyaṃ kira tisso nāma kuṭumbikaputto cattālīsa hiraññakoṭiyo pahāya pabbajitvā agāmake araññe viharati.
Herein is the explanation of the meaning: In Sāvatthī, it is said, a householder's son named Tissa, having given up forty crores of gold, went forth and lived in a forest where there was no village.
Đây là sự giải thích ý nghĩa về điều đó: Có một người con trai của gia chủ tên là Tissa ở Sāvatthī, đã từ bỏ bốn mươi triệu đồng tiền vàng để xuất gia và sống trong một khu rừng không có làng mạc.
Tassa kaniṭṭhabhātubhariyā ‘‘gacchatha naṃ jīvitā voropethā’’ti pañcasate core pesesi.
The wife of his younger brother sent five hundred robbers, saying, “Go and deprive him of his life.”
Vợ của người em trai ông đã sai năm trăm tên cướp đi: “Hãy đi và giết ông ta!”
Te gantvā theraṃ parivāretvā nisīdiṃsu.
They went, surrounded the elder, and sat down.
Chúng đi đến, bao vây vị Trưởng lão và ngồi xuống.
Thero āha ‘‘kasmā āgatattha upāsakā’’ti?
The elder said, “Why have you come, lay devotees?”
Vị Trưởng lão hỏi: “Này các cận sự nam, các ông đến đây làm gì?”
Taṃ jīvitā voropessāmāti.
“We will deprive you of your life.”
“Chúng tôi sẽ giết ngài.”
Pāṭibhogaṃ me upāsakā gahetvā ajjekarattiṃ jīvitaṃ dethāti.
“Lay devotees, take a surety from me and give me my life for just one night.”
“Này các cận sự nam, hãy nhận tôi làm vật bảo đảm và cho tôi sống thêm một đêm nay.”
Ko te, samaṇa, imasmiṃ ṭhāne pāṭibhogo bhavissatīti?
“Monk, who in this place will be your surety?”
“Này Sa-môn, ai sẽ là vật bảo đảm cho ngài ở nơi này?”
Thero mahantaṃ pāsāṇaṃ gahetvā dve ūruṭṭhīni bhinditvā ‘‘vaṭṭati upāsakā pāṭibhogo’’ti āha.
The elder took a large stone, broke his two thigh bones, and said, “Is the surety sufficient, lay devotees?”
Vị Trưởng lão nhặt một tảng đá lớn, đập vỡ hai xương đùi và nói: “Này các cận sự nam, vật bảo đảm này có được không?”
Te apakkamitvā caṅkamanasīse aggiṃ katvā nipajjiṃsu.
They moved away, made a fire at the head of the walking path, and lay down.
Chúng bỏ đi, đốt lửa ở đầu đường kinh hành và nằm xuống.
Therassa vedanaṃ vikkhambhetvā sīlaṃ paccavekkhato parisuddhaṃ sīlaṃ nissāya pītipāmojjaṃ uppajji.
As the elder suppressed the pain and reflected on his virtue, joy and gladness arose in him on account of his pure virtue.
Vị Trưởng lão, sau khi chế ngự cảm thọ và quán xét giới hạnh của mình, đã phát sinh hỷ và hoan hỷ nhờ giới hạnh thanh tịnh.
Tato anukkamena vipassanaṃ vaḍḍhento tiyāmarattiṃ samaṇadhammaṃ katvā aruṇuggamane arahattaṃ patto imaṃ udānaṃ udānesi –
Then, gradually developing insight, he practiced the ascetic's duties through the three watches of the night and, at the break of dawn, attained Arahantship and uttered this inspired utterance:
Từ đó, tuần tự phát triển tuệ quán, tu tập pháp Sa-môn suốt ba canh đêm, và khi bình minh ló dạng, đã chứng A-la-hán quả và thốt lên bài kệ cảm hứng này:
Aparepi tiṃsa bhikkhū bhagavato santike kammaṭṭhānaṃ gahetvā araññavihāre vassaṃ upagantvā ‘‘āvuso, tiyāmarattiṃ samaṇadhammova kātabbo, na aññamaññassa santikaṃ āgantabba’’nti vatvā vihariṃsu.
On another occasion, thirty monks, having received a meditation subject from the Blessed One, entered the rains retreat in a forest monastery and lived there, having made a pact: “Friends, we must practice the ascetic’s duties through the three watches of the night and not visit one another.”
Ba mươi vị Tỳ-kheo khác cũng đã nhận đề mục thiền từ Đức Phật, sau đó an cư mùa mưa trong một trú xứ rừng, và sống với lời thề: “Này chư Hiền, chúng ta chỉ nên tu tập pháp Sa-môn suốt ba canh đêm, không nên đến gần nhau.”
Tesaṃ samaṇadhammaṃ katvā paccūsasamaye pacalāyantānaṃ eko byaggho āgantvā ekekaṃ bhikkhuṃ gahetvā gacchati.
While they were dozing at dawn after practicing the ascetic's duties, a tiger came and carried off one monk after another.
Sau khi tu tập pháp Sa-môn, vào lúc rạng đông, khi các vị đang ngủ gật, một con hổ đến và bắt từng vị Tỳ-kheo mang đi.
Na koci ‘‘maṃ byaggho gaṇhī’’ti vācampi nicchāresi.
Not one of them even uttered a word, saying, “A tiger has seized me.”
Không một ai thốt ra lời nào như: “Hổ bắt tôi rồi!”
Evaṃ pañcasu dasasu bhikkhūsu khāditesu uposathadivase ‘‘itare, āvuso, kuhi’’nti pucchitvā ñatvā ca ‘‘idāni gahitena, gahitomhīti vattabba’’nti vatvā vihariṃsu.
Thus, after five or ten monks had been eaten, on the Uposatha day, they asked, “Friends, where are the others?” Upon learning what had happened, they agreed, saying, “From now on, whoever is seized must say, ‘I have been seized,’” and continued their practice.
Cứ như vậy, sau khi mười lăm vị Tỳ-kheo bị ăn thịt, vào ngày trai giới, các vị còn lại hỏi: “Này chư Hiền, các vị kia ở đâu?” Sau khi biết chuyện, các vị nói: “Bây giờ, ai bị bắt thì phải nói: ‘Tôi bị hổ bắt!’” và tiếp tục sống như vậy.
Atha aññataraṃ daharabhikkhuṃ purimanayeneva byaggho gaṇhi.
Then a tiger seized a certain young monk in the same way as before.
Sau đó, một vị Tỳ-kheo trẻ khác cũng bị hổ bắt theo cách tương tự.
So ‘‘byaggho, bhante’’ti āha.
He cried out, “Venerable sirs, a tiger!”
Vị ấy nói: “Thưa chư Tôn giả, hổ!”
Bhikkhū kattaradaṇḍe ca ukkāyo ca gahetvā mocessāmāti anubandhiṃsu.
The monks, taking sticks and torches, pursued it, intending to rescue him.
Các Tỳ-kheo cầm gậy và đuốc, đuổi theo với ý định giải cứu.
Byaggho bhikkhūnaṃ agatiṃ chinnataṭaṭṭhānaṃ āruyha taṃ bhikkhuṃ pādaṅguṭṭhakato paṭṭhāya khādituṃ ārabhi.
The tiger climbed to a place with a sheer cliff, inaccessible to the monks, and began to devour that monk, starting from his big toe.
Con hổ leo lên một vách đá dựng đứng mà các Tỳ-kheo không thể đến được, và bắt đầu ăn thịt vị Tỳ-kheo ấy từ ngón chân cái.
Itarepi ‘‘idāni, sappurisa, amhehi kattabbaṃ natthi, bhikkhūnaṃ viseso nāma evarūpe ṭhāne paññāyatī’’ti āhaṃsu.
The other monks said, “Good sir, there is nothing we can do now. It is in such a situation that the distinction of a true monk becomes apparent.”
Các vị Tỳ-kheo khác nói: “Này Thiện nam tử, bây giờ chúng ta không thể làm gì được nữa. Sự khác biệt giữa các Tỳ-kheo được thể hiện rõ ràng trong hoàn cảnh như thế này.”
So byagghamukhe nipannova taṃ vedanaṃ vikkhambhetvā vipassanaṃ vaḍḍhento yāva gopphakā khāditasamaye sotāpanno hutvā, yāva jaṇṇukā khāditasamaye sakadāgāmī, yāva nābhiyā khāditasamaye anāgāmī hutvā, hadayarūpe akhāditeyeva saha paṭisambhidāhi arahattaṃ patvā imaṃ udānaṃ udānesi –
Lying in the tiger's mouth, he suppressed the pain and developed insight. By the time he was eaten up to the ankles, he had become a stream-enterer; by the time he was eaten up to the knees, a once-returner; by the time he was eaten up to the navel, a non-returner; and before his heart-base was eaten, he attained Arahantship together with the analytical knowledges and uttered this inspired utterance:
Vị ấy, nằm trong miệng hổ, đã chế ngự cảm thọ đó, phát triển tuệ quán, và khi bị ăn đến mắt cá chân thì chứng quả Dự Lưu, khi bị ăn đến đầu gối thì chứng quả Nhất Lai, khi bị ăn đến rốn thì chứng quả Bất Hoàn, và trước khi tim bị ăn thịt, đã chứng A-la-hán quả cùng với Tứ Vô Ngại Giải, rồi thốt lên bài kệ cảm hứng này:
Aparopi pītamallatthero nāma gihikāle tīsu rajjesu paṭākaṃ gahetvā tambapaṇṇidīpaṃ āgamma rājānaṃ disvā raññā katānuggaho ekadivasaṃ kilañjakāpaṇasāladvārena gacchanto ‘‘rūpaṃ, bhikkhave, na tumhākaṃ, taṃ pajahatha, taṃ vo pahīnaṃ dīgharattaṃ hitāya sukhāya bhavissatī’’ti (saṃ. ni. 3.33-34) natumhākavaggaṃ sutvā cintesi ‘‘neva kira rūpaṃ attano, na vedanā’’ti.
Another, Elder Pītamalla, in his lay life, having carried the standard in three kingdoms, came to the island of Tambapaṇṇi, saw the king, and received favor from the king. One day, while passing by the door of a shop selling wickerwork, he heard the Natumhāka-vagga being recited: “Monks, form is not yours. Abandon it. When it is abandoned by you, it will lead to your welfare and happiness for a long time.” He thought, “So form is not mine, nor are feelings.”
Một vị khác là Trưởng lão Pītamalla, khi còn là cư sĩ, đã cầm cờ hiệu chiến thắng ở ba vương quốc, sau đó đến đảo Tambapaṇṇi (Tích Lan). Gặp vua, được vua ban ân huệ. Một ngày nọ, khi đi ngang qua cổng một hội trường chợ chiếu, nghe phẩm Natumhākavagga (Không Phải Của Các Ngươi) nói: “Này các Tỳ-kheo, sắc không phải của các ngươi, hãy từ bỏ nó; khi nó được từ bỏ, nó sẽ mang lại lợi ích và hạnh phúc lâu dài cho các ngươi.” Vị ấy suy nghĩ: “Thật vậy, sắc không phải của ta, thọ cũng không.”
So taṃyeva aṅkusaṃ katvā nikkhamitvā mahāvihāraṃ gantvā pabbajjaṃ yācitvā pabbajito upasampanno dvemātikā paguṇaṃ katvā tiṃsa bhikkhū gahetvā gabalavāliyaaṅgaṇaṃ gantvā samaṇadhammamakāsi.
Making that very teaching his goad, he left, went to the Mahāvihāra, asked for the going forth, was ordained, received the higher ordination, mastered the two Mātikās, took thirty monks, went to the Gabalavāliya terrace, and practiced the ascetic's duties.
Vị ấy lấy đó làm động lực, xuất gia, đến Mahāvihāra xin xuất gia, được thọ giới, học thuộc lòng hai bộ luật (dvemātikā), sau đó dẫn ba mươi vị Tỳ-kheo đến Gabalavāliyaṅgaṇa và tu tập pháp Sa-môn.
Pādesu avahantesu jaṇṇukehi caṅkamati.
When his feet were worn out, he practiced walking meditation on his knees.
Khi chân không còn đi được, vị ấy kinh hành bằng đầu gối.
Tamenaṃ rattiṃ eko migaluddako migoti maññamāno sattiyā pahari.
One night, a deer hunter, mistaking him for a deer, struck him with a spear.
Một đêm nọ, một thợ săn thú, lầm tưởng vị ấy là một con nai, đã phóng lao vào vị ấy.
Satti vinivijjhitvā gatā.
The spear went right through him.
Mũi lao xuyên qua và đi mất.
So taṃ sattiṃ harāpetvā pahāramukhāni tiṇavaṭṭiyā pūrāpetvā pāsāṇapiṭṭhiyaṃ attānaṃ nisīdāpetvā okāsaṃ kāretvā vipassanaṃ vaḍḍhetvā saha paṭisambhidāhi arahattaṃ patvā ukkāsitasaddena āgatānaṃ bhikkhūnaṃ byākaritvā imaṃ udānaṃ udānesi –
He, having had that spear removed, having had the wounds filled with plugs of grass, having seated himself on a flat rock, having created an opportunity, developed insight, and having attained arahatship together with the analytical knowledges, he declared it to the monks who had come on hearing the sound of his clearing his throat and uttered this inspired utterance:
Vị ấy đã rút mũi giáo ra, lấp đầy các vết thương bằng cỏ bện, ngồi trên phiến đá, tạo cơ hội (cho mình), phát triển thiền quán (vipassanā), đạt A-la-hán quả cùng với các tuệ phân tích (paṭisambhidā), rồi nói với các Tỳ-kheo đến gần bằng tiếng ho, và thốt lên lời cảm hứng này:
Subrahmāpi devaputto accharāsahassaparivāro saggasampattiṃ anubhoti, tattha pañcasatā accharāyo rukkhato pupphāni ocinantiyo cavitvā niraye upapannā.
Also, the devaputta Subrahmā, surrounded by a thousand celestial nymphs, was enjoying the splendors of heaven. There, five hundred nymphs, while picking flowers from a tree, passed away and were reborn in hell.
Thiên tử Subrahmā cũng hưởng thụ sự giàu sang của cõi trời với đoàn tùy tùng gồm một ngàn tiên nữ, trong đó, năm trăm tiên nữ đang hái hoa từ cây đã mạng chung và tái sinh vào địa ngục.
So ‘‘kiṃ imā cirāyantī’’ti upadhārento tāsaṃ niraye nibbattabhāvaṃ disvā ‘‘kittakaṃ nu kho mama āyū’’ti upaparikkhanto attanopi āyuparikkhayaṃ viditvā tattheva niraye nibbattanabhāvaṃ disvā bhīto ativiya domanassajāto hutvā ‘‘imaṃ me domanassaṃ satthā vinayissati na añño’’ti avasesā pañcasatā accharāyo gahetvā bhagavantaṃ upasaṅkamitvā pañhaṃ pucchi –
He, wondering, “Why are they taking so long?” and investigating, saw that they had been reborn in hell. Then, examining, “How long is my lifespan?” he learned of the exhaustion of his own lifespan and saw that he would be reborn in that very same hell. Frightened and extremely distressed, he thought, “The Teacher will dispel this distress of mine, no one else.” Taking the remaining five hundred nymphs, he approached the Blessed One and asked a question:
Vị ấy tự hỏi: “Sao các tiên nữ này lại lâu như vậy?” Khi quán xét, thấy các tiên nữ ấy đã tái sinh vào địa ngục. Rồi khi xem xét: “Tuổi thọ của ta còn bao lâu?” Vị ấy biết tuổi thọ của mình cũng sắp hết và sẽ tái sinh vào chính địa ngục đó. Vị ấy rất sợ hãi và tràn đầy ưu phiền, nghĩ rằng: “Chỉ có Đức Đạo Sư mới có thể loại bỏ nỗi ưu phiền này của ta, không ai khác,” rồi dẫn năm trăm tiên nữ còn lại đến gần Đức Thế Tôn và hỏi một câu hỏi:
Ñāyassa adhigamāyāti ñāyo vuccati ariyo aṭṭhaṅgiko maggo, tassa adhigamāya, pattiyāti vuttaṃ hoti.
For the attainment of the ñāya: The ñāya is said to be the Noble Eightfold Path. “For its attainment” means for reaching it.
Để đạt được Chánh Đạo (ñāyassa adhigamāya) có nghĩa là Chánh Đạo (ñāya) được gọi là Bát Chánh Đạo (ariyo aṭṭhaṅgiko maggo), để đạt được nó, để thành tựu nó, đó là điều được nói đến.
Ayañhi pubbabhāge lokiyo satipaṭṭhānamaggo bhāvito lokuttarassa maggassa adhigamāya saṃvattati.
Indeed, this mundane path of the establishments of mindfulness, when developed in the preliminary stage, leads to the attainment of the supramundane path.
Thật vậy, con đường Tứ Niệm Xứ (satipaṭṭhānamaggo) thế gian này, khi được tu tập ở giai đoạn đầu, dẫn đến sự thành tựu của con đường siêu thế (lokuttara magga).
Tenāha ‘‘ñāyassa adhigamāyā’’ti.
Therefore, he said, “for the attainment of the ñāya.”
Vì thế, Đức Phật nói: “để đạt được Chánh Đạo.”
Nibbānassa sacchikiriyāyāti taṇhāvānavirahitattā nibbānanti laddhanāmassa amatassa sacchikiriyāya, attapaccakkhatāyāti vuttaṃ hoti.
For the realization of Nibbāna: Because it is devoid of the “stitching” of craving, it has received the name Nibbāna. “For the realization of the deathless” means for experiencing it for oneself.
Để chứng ngộ Nibbāna (Nibbānassa sacchikiriyāyā) có nghĩa là để chứng ngộ, để tự mình thấy được trạng thái bất tử (amata) được gọi là Nibbāna, vì nó không còn sự trói buộc của ái dục (taṇhāvāna), đó là điều được nói đến.
Ayañhi maggo bhāvito anupubbena nibbānasacchikiriyaṃ sādheti.
Indeed, this path, when developed, gradually accomplishes the realization of Nibbāna.
Thật vậy, con đường này, khi được tu tập, dần dần dẫn đến sự chứng ngộ Nibbāna.
Tenāha ‘‘nibbānassa sacchikiriyāyā’’ti.
Therefore, he said, “for the realization of Nibbāna.”
Vì thế, Đức Phật nói: “để chứng ngộ Nibbāna.”
Tattha kiñcāpi ‘‘sattānaṃ visuddhiyā’’ti vutte sokasamatikkamādīni atthato siddhāneva honti, ṭhapetvā pana sāsanayuttikovide aññesaṃ na pākaṭāni, na ca bhagavā paṭhamaṃ sāsanayuttikovidaṃ janaṃ katvā pacchā dhammaṃ deseti.
Therein, although when “for the purification of beings” is said, the overcoming of sorrow and so on are in fact accomplished in terms of meaning, they are not clear to others apart from those skilled in the methods of the teaching. And the Blessed One does not first make people skilled in the methods of the teaching and then teach the Dhamma afterwards.
Mặc dù khi nói “để thanh tịnh chúng sinh” thì sự vượt qua sầu bi và các điều khác đã được ngụ ý về mặt ý nghĩa, nhưng đối với những người không thông thạo giáo lý (sāsanayuttikovide), những điều này không rõ ràng. Và Đức Thế Tôn không phải là người đầu tiên làm cho chúng sinh thông thạo giáo lý rồi sau đó mới thuyết pháp.
Tena teneva pana suttena taṃ taṃ atthaṃ ñāpeti.
Rather, he makes each particular meaning known through each particular sutta.
Ngài làm cho chúng sinh hiểu từng ý nghĩa đó bằng từng bài kinh.
Tasmā idha yaṃ yaṃ atthaṃ ekāyanamaggo sādheti, taṃ taṃ pākaṭaṃ katvā dassento ‘‘sokaparidevānaṃ samatikkamāyā’’tiādimāha.
Therefore, here, to clarify and show each and every meaning that the one-way path accomplishes, he said, “for the overcoming of sorrow and lamentation,” and so on.
Do đó, ở đây, để làm rõ từng ý nghĩa mà con đường độc nhất này (ekāyanamaggo) thành tựu, Đức Phật đã nói: “để vượt qua sầu bi,” v.v.
Yasmā vā yā sattānaṃ visuddhi ekāyanamaggena saṃvattati, sā sokaparidevānaṃ samatikkamena hoti, sokaparidevānaṃ samatikkamo dukkhadomanassānaṃ atthaṅgamena, dukkhadomanassānaṃ atthaṅgamo ñāyassādhigamena, ñāyassādhigamo nibbānassa sacchikiriyāya.
Or, because the purification of beings that occurs through the one-way path happens through the overcoming of sorrow and lamentation; the overcoming of sorrow and lamentation happens through the cessation of pain and distress; the cessation of pain and distress happens through the attainment of the ñāya; and the attainment of the ñāya happens through the realization of Nibbāna.
Hoặc vì sự thanh tịnh của chúng sinh mà con đường độc nhất này dẫn đến, là nhờ vượt qua sầu bi; sự vượt qua sầu bi là nhờ chấm dứt khổ ưu; sự chấm dứt khổ ưu là nhờ đạt được Chánh Đạo; sự đạt được Chánh Đạo là nhờ chứng ngộ Nibbāna.
Tasmā imampi kamaṃ dassento ‘‘sattānaṃ visuddhiyā’’ti vatvā ‘‘sokaparidevānaṃ samatikkamāyā’’tiādimāha.
Therefore, to show this sequence as well, after saying “for the purification of beings,” he said, “for the overcoming of sorrow and lamentation,” and so on.
Vì vậy, để chỉ ra trình tự này, Đức Phật đã nói “để thanh tịnh chúng sinh” rồi tiếp theo là “để vượt qua sầu bi,” v.v.
Apica vaṇṇabhaṇanametaṃ ekāyanamaggassa.
Moreover, this is a statement of praise for the one-way path.
Hơn nữa, đây là lời tán thán con đường độc nhất (ekāyanamagga).
Yatheva hi bhagavā ‘‘dhammaṃ vo, bhikkhave, desessāmi ādikalyāṇaṃ majjhekalyāṇaṃ pariyosānakalyāṇaṃ sātthaṃ sabyañjanaṃ kevalaparipuṇṇaṃ parisuddhaṃ brahmacariyaṃ pakāsessāmi, yadidaṃ chachakkānī’’ti (ma. ni. 3.420) chachakkadesanāya aṭṭhahi padehi vaṇṇaṃ abhāsi, yathā ca ariyavaṃsadesanāya ‘‘cattārome, bhikkhave, ariyavaṃsā aggaññā rattaññā vaṃsaññā porāṇā asaṃkiṇṇā asaṃkiṇṇapubbā na saṃkīyanti, na saṃkīyissanti, appaṭikuṭṭhā samaṇehi brāhmaṇehi viññūhī’’ti (a. ni. 4.28) navahi padehi vaṇṇaṃ abhāsi, evaṃ imassapi ekāyanamaggassa sattānaṃ visuddhiyātiādīhi sattahi padehi vaṇṇaṃ abhāsi.
Just as the Blessed One, in the discourse on the six sixes, uttered praise with eight terms, saying, “Bhikkhus, I will teach you the Dhamma that is good in the beginning, good in the middle, and good in the end, with its meaning and phrasing. I will make known the holy life that is entirely complete and pure, that is, the six sixes.” And just as in the discourse on the noble lineages, he uttered praise with nine terms, saying, “Bhikkhus, these four are the noble lineages—primal, of long standing, traditional, ancient, unadulterated and never before adulterated, which are not being adulterated and will not be adulterated, not despised by wise ascetics and brahmins.” So too, for this one-way path, he uttered praise with seven terms beginning with “for the purification of beings.”
Giống như Đức Thế Tôn đã tán thán bài pháp về sáu nhóm pháp (chachakkadesanā) bằng tám từ: “Này các Tỳ-kheo, Ta sẽ thuyết cho các ông một pháp, tốt đẹp ở đoạn đầu, tốt đẹp ở đoạn giữa, tốt đẹp ở đoạn cuối, có ý nghĩa, có văn tự, hoàn toàn đầy đủ, thanh tịnh, phạm hạnh, đó là sáu nhóm pháp,” và giống như Ngài đã tán thán bài pháp về các truyền thống cao quý (ariyavaṃsadesanā) bằng chín từ: “Này các Tỳ-kheo, có bốn truyền thống cao quý này, là tối thượng, được biết đến từ lâu, là truyền thống cổ xưa, không bị pha tạp, chưa từng bị pha tạp, không bị các Sa-môn, Bà-la-môn, và những người trí thức chỉ trích,” thì tương tự, Ngài đã tán thán con đường độc nhất này bằng bảy từ, bắt đầu từ “để thanh tịnh chúng sinh,” v.v.
Kasmā iti ce?
If asked why?
Tại sao lại như vậy?
Tesaṃ bhikkhūnaṃ ussāhajananatthaṃ.
It was to generate enthusiasm in those monks.
Để khơi dậy sự nhiệt tâm cho các Tỳ-kheo đó.
Vaṇṇabhāsanañhi sutvā te bhikkhū ‘‘ayaṃ kira maggo hadayasantāpabhūtaṃ sokaṃ, vācāvippalāpabhūtaṃ paridevaṃ, kāyikaasātabhūtaṃ dukkhaṃ, cetasikaasātabhūtaṃ domanassanti cattāro upaddave hanati, visuddhiṃ ñāyaṃ nibbānanti tayo visese āvahatī’’ti ussāhajātā imaṃ dhammadesanaṃ uggahetabbaṃ pariyāpuṇitabbaṃ dhāretabbaṃ vācetabbaṃ, imañca maggaṃ bhāvetabbaṃ maññissanti.
For upon hearing the statement of praise, those monks would think, “This path, it seems, destroys the four calamities: sorrow, which is affliction of the heart; lamentation, which is verbal wailing; pain, which is physical displeasure; and distress, which is mental displeasure. It brings about the three excellences: purification, the ñāya, and Nibbāna.” Thus, filled with enthusiasm, they would consider this Dhamma teaching worthy of being learned, studied, retained, and recited, and this path worthy of being developed.
Khi nghe lời tán thán, các Tỳ-kheo đó sẽ nghĩ: “Con đường này tiêu diệt bốn tai họa là sầu (soka) phát sinh từ sự đau khổ trong tâm, bi (parideva) phát sinh từ lời than vãn, khổ (dukkha) phát sinh từ sự khó chịu về thân, và ưu (domanassa) phát sinh từ sự khó chịu về tâm; và nó mang lại ba lợi ích đặc biệt là sự thanh tịnh (visuddhi), Chánh Đạo (ñāya), và Nibbāna,” và sẽ nhiệt tâm cho rằng bài pháp này cần được học, được nghiên cứu, được ghi nhớ, được giảng dạy, và con đường này cần được tu tập.
Iti tesaṃ bhikkhūnaṃ ussāhajananatthaṃ vaṇṇaṃ abhāsi, kambalavāṇijādayo kambalādīnaṃ vaṇṇaṃ viya.
Thus, he uttered praise to generate enthusiasm in those monks, just as a wool-blanket merchant and others praise their blankets and so on.
Như vậy, để khơi dậy sự nhiệt tâm cho các Tỳ-kheo đó, Đức Phật đã tán thán, giống như những người bán chăn tán thán chăn của họ.
Yathā hi satasahassagghanikapaṇḍukambalavāṇijena kambalaṃ gaṇhathāti ugghositepi asukakambaloti na tāva manussā jānanti.
For example, when a merchant with a golden blanket worth a hundred thousand proclaims, “Buy a blanket!” people do not yet know what kind of blanket it is.
Thật vậy, khi người bán chăn quý giá một trăm ngàn đồng la lớn: “Hãy mua chăn đi!” thì mọi người vẫn chưa biết đó là loại chăn nào.
Kesakambalavālakambalādayopi hi duggandhā kharasamphassā kambalātveva vuccanti.
For blankets made of hair, blankets made of fur, and so on, which are bad-smelling and rough to the touch, are also just called “blankets.”
Vì các loại chăn bằng lông tóc, chăn bằng lông thú, v.v., cũng được gọi là chăn, mặc dù chúng có mùi hôi và thô ráp khi chạm vào.
Yadā pana tena gandhārako rattakambalo sukhumo ujjalo sukhasamphassoti ugghositaṃ hoti, tadā ye pahonti, te gaṇhanti.
But when he proclaims that it is a red blanket from Gandhāra, fine, bright, and pleasant to the touch, then those who can afford it, buy it.
Nhưng khi người đó rao lên: “Đây là chăn Gandhara màu đỏ, mềm mại, sáng bóng, dễ chịu khi chạm vào,” thì những ai có khả năng sẽ mua. Những ai không có khả năng cũng muốn xem.
Ye na pahonti, tepi dassanakāmā honti, evamevaṃ ‘‘ekāyano ayaṃ, bhikkhave, maggo’’ti vuttepi asukamaggoti na tāva pākaṭo hoti.
Those who cannot afford it still wish to see it. In the same way, when it is said, “Bhikkhus, this is the one-way path,” it is not yet clear what kind of path it is.
Cũng vậy, khi nói: “Này các Tỳ-kheo, đây là con đường độc nhất,” thì vẫn chưa rõ đó là con đường nào.
Nānappakārakā hi aniyyānamaggāpi maggātveva vuccanti.
For various kinds of paths that are not for deliverance are also just called “paths.”
Vì nhiều loại con đường không dẫn đến giải thoát cũng được gọi là con đường.
‘‘Sattānaṃ visuddhiyā’’tiādimhi pana vutte ‘‘ayaṃ kira maggo cattāro upaddave hanati, tayo visese āvahatī’’ti ussāhajātā imaṃ dhammadesanaṃ uggahetabbaṃ pariyāpuṇitabbaṃ dhāretabbaṃ vācetabbaṃ, imañca maggaṃ bhāvetabbaṃ maññissantīti vaṇṇaṃ bhāsanto ‘‘sattānaṃ visuddhiyā’’tiādimāha.
But when “For the purification of beings” and so on is said, thinking, “Indeed, this path destroys four dangers and brings three special qualities,” with enthusiasm arisen, they will consider that this Dhamma teaching should be learned, should be mastered, should be remembered, should be recited, and that this path should be developed. Thus, speaking its praise, he said, “For the purification of beings,” and so on.
Khi nói đến ‘‘Để thanh lọc chúng sinh’’ v.v., Đức Phật đã nói về công đức của con đường này, rằng: ‘‘Con đường này diệt trừ bốn tai họa, mang lại ba điều đặc biệt’’, để những người đã phát khởi tinh tấn sẽ nghĩ rằng: ‘‘Phải học, phải tu tập, phải ghi nhớ, phải thuyết giảng giáo pháp này, và phải tu tập con đường này’’. Do đó, Ngài đã nói ‘‘Để thanh lọc chúng sinh’’ v.v.
Yathā ca satasahassagghanikapaṇḍukambalavāṇijopamā, evaṃ rattajambunadasuvaṇṇaudakappasādakamaṇiratanasuvisuddhamuttāratanadhotapavāḷādivāṇijūpamādayopettha āharitabbā.
And just as the simile of the merchant with the blanket worth a hundred thousand is to be brought in, so too, other similes of merchants dealing in red Jambu-river gold, water-clarifying jewels, exceedingly pure pearl-gems, washed coral, and so on, should also be brought in here.
Và cũng như ví dụ về người buôn chăn màu vàng trị giá một trăm ngàn, ở đây cũng nên đưa ra các ví dụ về người buôn vàng sông Jambū, nước trong sạch như ngọc, ngọc quý, ngọc trai tinh khiết, san hô đã được rửa sạch, v.v.
Yadidanti nipāto, ye imeti ayamassa attho.
Yadidaṃ is a particle; its meaning is “which are these.”
Yadidaṃ là một tiểu từ, nghĩa của nó là ‘những điều này’.
Cattāroti gaṇanaparicchedo, tena na tato heṭṭhā na uddhanti satipaṭṭhānaparicchedaṃ dīpeti.
Cattāro is a numerical determination; by it, he shows the delimitation of the satipaṭṭhānas as “not fewer than that, not more.”
Cattāro là một từ chỉ số lượng, nó cho thấy sự giới hạn của các Satipaṭṭhāna, không ít hơn cũng không nhiều hơn con số đó.
Satipaṭṭhānāti tayo satipaṭṭhānā satigocaropi, tidhā paṭipannesu sāvakesu satthuno paṭighānunayavītivattatāpi, satipi.
Satipaṭṭhānā: there are three kinds of satipaṭṭhāna: the objective field of mindfulness (satigocara); the Teacher’s transcending of aversion and approval towards disciples practicing in three ways; and mindfulness (sati) itself.
Satipaṭṭhānā (các niệm xứ) có ba nghĩa: đối tượng của niệm (sati-gocara), sự vượt qua được thiện cảm và ác cảm của Đức Đạo Sư đối với các đệ tử thực hành theo ba cách, và chính niệm (sati).
‘‘Catunnaṃ, bhikkhave, satipaṭṭhānānaṃ samudayañca atthaṅgamañca desessāmi, taṃ suṇātha…pe….
“Bhikkhus, I will teach the origin and the passing away of the four satipaṭṭhānas. Listen to that… and so on….
Trong các đoạn như: ‘‘Này các Tỳ-khưu, Ta sẽ thuyết giảng về sự sinh khởi và sự diệt tận của bốn niệm xứ. Hãy lắng nghe… này các Tỳ-khưu, sự sinh khởi của thân là gì?’’
Ko ca, bhikkhave, kāyassa samudayo?
And what, Bhikkhus, is the origin of the body?
Sự sinh khởi của thân là sự sinh khởi của vật thực’’, v.v.
Āhārasamudayā kāyasamudayo’’tiādīsu (saṃ. ni. 3.408) hi satigocaro satipaṭṭhānanti vuccati.
With the origin of nutriment, there is the origin of the body.” In such passages, the objective field of mindfulness is called satipaṭṭhāna.
Ở đây, đối tượng của niệm được gọi là Satipaṭṭhāna.
Tathā ‘‘kāyo paṭṭhānaṃ, no sati.
Likewise, also in passages like, “The body is a foundation (paṭṭhāna), not mindfulness (sati).
Cũng vậy, trong các đoạn như: ‘‘Thân là nền tảng (paṭṭhāna), không phải niệm.
Sati paṭṭhānañceva sati cā’’tiādīsupi (paṭi. ma. 3.35).
Mindfulness is both a foundation and mindfulness.”
Niệm vừa là nền tảng vừa là niệm’’, v.v.
Tassattho – patiṭṭhāti asminti paṭṭhānaṃ.
Its meaning is: it is established (patiṭṭhāti) in this, thus it is a foundation (paṭṭhāna).
Nghĩa của nó là: ‘Paṭṭhāna’ là nơi mà niệm an trú.
Kā patiṭṭhāti?
What is established?
Cái gì an trú?
Satiyā paṭṭhānaṃ satipaṭṭhānaṃ.
The foundation of mindfulness is satipaṭṭhāna.
Nơi an trú của niệm là Satipaṭṭhāna.
Padhānaṭṭhānanti vā paṭṭhānaṃ.
Or, a principal place is a foundation (paṭṭhāna).
Hoặc ‘Paṭṭhāna’ là nền tảng chính yếu.
Satiyā paṭṭhānaṃ satipaṭṭhānaṃ, hatthiṭṭhānaassaṭṭhānādīni viya.
The foundation of mindfulness is satipaṭṭhāna, like an elephant stable, a horse stable, and so on.
Nền tảng chính yếu của niệm là Satipaṭṭhāna, giống như nơi ở của voi, nơi ở của ngựa, v.v.
‘‘Tayo satipaṭṭhānā, yadariyo sevati, yadariyo sevamāno satthā gaṇamanusāsitumarahatī’’ti (ma. ni. 3.311) etthāpi tidhā paṭipannesu sāvakesu satthuno paṭighānunayavītivattatā ‘‘satipaṭṭhāna’’nti vuttā.
In the passage, “There are three satipaṭṭhānas which the Noble One cultivates, cultivating which the Teacher is able to instruct the group,” the Teacher’s transcending of aversion and approval towards disciples practicing in three ways is called “satipaṭṭhāna.”
Trong đoạn: ‘‘Có ba niệm xứ mà bậc Thánh thực hành, khi thực hành chúng, Đức Đạo Sư xứng đáng để giáo huấn chúng hội’’, ở đây, sự vượt qua thiện cảm và ác cảm của Đức Đạo Sư đối với các đệ tử thực hành theo ba cách được gọi là ‘‘Satipaṭṭhāna’’.
Tassattho – paṭṭhapetabbato paṭṭhānaṃ, pavattayitabbatoti attho.
Its meaning is: because it is to be established, it is a foundation (paṭṭhāna); the meaning is, because it is to be made to occur.
Nghĩa của nó là: Paṭṭhāna là cái cần được thiết lập, tức là cái cần được vận hành.
Kena paṭṭhapetabbatoti?
By what is it to be established?
Cần được thiết lập bởi cái gì?
Satiyā.
By mindfulness.
Bởi niệm.
Satiyā paṭṭhānaṃ satipaṭṭhānanti.
The establishing by mindfulness is satipaṭṭhāna.
Cái được niệm thiết lập là Satipaṭṭhāna.
‘‘Cattāro satipaṭṭhānā bhāvitā bahulīkatā satta bojjhaṅge paripūrentī’’tiādīsu (saṃ. ni. 5.989) pana satiyeva ‘‘satipaṭṭhāna’’nti vuccati.
But in passages such as, “The four satipaṭṭhānas, when developed and cultivated, fulfill the seven factors of awakening,” mindfulness itself is called “satipaṭṭhāna.”
Tuy nhiên, trong các đoạn như: ‘‘Bốn niệm xứ được tu tập, được làm cho sung mãn, sẽ làm viên mãn bảy chi phần giác ngộ’’, v.v., thì chính niệm được gọi là ‘‘Satipaṭṭhāna’’.
Tassattho – patiṭṭhātīti paṭṭhānaṃ, upaṭṭhāti okkantitvā pakkhanditvā pavattatīti attho.
Its meaning is: it establishes (patiṭṭhāti), thus it is a foundation (paṭṭhāna); the meaning is, it is present (upaṭṭhāti), having entered and penetrated, it proceeds.
Nghĩa của nó là: ‘Paṭṭhāna’ là cái an trú một cách vững chắc, tức là cái hiện khởi, đi vào, thâm nhập và vận hành.
Satiyeva paṭṭhānaṃ satipaṭṭhānaṃ.
Mindfulness itself is the foundation, satipaṭṭhāna.
Chính niệm là Paṭṭhāna, tức là Satipaṭṭhāna.
Atha vā saraṇaṭṭhena sati, upaṭṭhānaṭṭhena paṭṭhānaṃ.
Or, mindfulness (sati) in the sense of remembering, and foundation (paṭṭhāna) in the sense of being present (upaṭṭhāna).
Hoặc, ‘Sati’ theo nghĩa ghi nhớ, ‘Paṭṭhāna’ theo nghĩa hiện tiền.
Iti sati ca sā paṭṭhānañcātipi satipaṭṭhānaṃ.
Thus, it is both mindfulness and a foundation, so it is also satipaṭṭhāna.
Như vậy, niệm và sự hiện tiền của nó cũng là Satipaṭṭhāna.
Idamidha adhippetaṃ.
This is what is intended here.
Đây là ý nghĩa được đề cập ở đây.
Yadi evaṃ, kasmā ‘‘satipaṭṭhānā’’ti bahuvacanaṃ?
If so, why is the plural “satipaṭṭhānā” used?
Nếu vậy, tại sao lại dùng số nhiều ‘‘Satipaṭṭhānā’’?
Satibahuttā.
Because of the multiplicity of mindfulness.
Vì có nhiều niệm.
Ārammaṇabhedena hi bahukā etā satiyo.
For these mindfulnesses are multiple due to the difference in their objects.
Thật vậy, những niệm này rất nhiều do sự khác biệt về đối tượng.
Atha maggoti kasmā ekavacanaṃ?
Then why is the singular “maggo” (path) used?
Vậy tại sao lại dùng số ít ‘‘maggo’’ (đạo lộ)?
Maggaṭṭhena ekattā.
Because of its oneness in the sense of a path.
Vì có sự đồng nhất theo nghĩa là một con đường.
Catassopi hi etā satiyo maggaṭṭhena ekattaṃ gacchanti.
For all four of these mindfulnesses become one in the sense of a path.
Thật vậy, cả bốn niệm này đều trở thành một theo nghĩa là một con đường.
Vuttañhetaṃ ‘‘maggoti kenaṭṭhena maggo?
For this has been said: “In what sense is it a path (maggo)?
Điều này đã được nói: ‘‘Con đường được gọi là con đường theo nghĩa nào?
Nibbānagamanaṭṭhena, nibbānatthikehi magganīyaṭṭhena cā’’ti.
In the sense of going to Nibbāna, and in the sense of being that which is to be sought by those who seek Nibbāna.”
Theo nghĩa dẫn đến Nibbāna, và theo nghĩa được những người tìm cầu Nibbāna tìm kiếm.’’
Catassopi cetā aparabhāge kāyādīsu ārammaṇesu kiccaṃ sādhayamānā nibbānaṃ gacchanti.
For all four of these, while accomplishing their function with regard to objects like the body in the later stage, go to Nibbāna.
Cả bốn niệm này, về sau, khi thực hiện công việc trên các đối tượng như thân, v.v., đều dẫn đến Nibbāna.
Ādito paṭṭhāya ca nibbānatthikehi maggīyanti, tasmā catassopi eko maggoti vuccanti.
And from the beginning, they are sought by those who seek Nibbāna; therefore, all four are called one path.
Và từ ban đầu, chúng được những người tìm cầu Nibbāna tìm kiếm, do đó, cả bốn đều được gọi là một con đường.
Evañca sati vacanānusandhinā sānusandhikāva desanā hoti, ‘‘mārasenappamaddanaṃ vo, bhikkhave, maggaṃ desessāmi, taṃ suṇātha…pe… katamo ca, bhikkhave, mārasenappamaddano maggo?
This being so, the teaching has a proper connection through the connection of the wording. For just as in passages like, “Bhikkhus, I will teach you the path for crushing Māra’s army. Listen to that… and so on… And what, Bhikkhus, is the path for crushing Māra’s army?
Như vậy, với sự liên kết của các từ, lời dạy trở nên có sự liên kết, giống như trong các đoạn: ‘‘Này các Tỳ-khưu, Ta sẽ thuyết giảng cho các ông con đường nghiền nát quân Ma-ra. Hãy lắng nghe… này các Tỳ-khưu, con đường nghiền nát quân Ma-ra là gì?
Yadidaṃ sattabojjhaṅgā’’tiādīsu (saṃ. ni. 5.224) viya hi yathā mārasenappamaddanoti ca sattabojjhaṅgāti ca atthato ekaṃ, byañjanamevettha nānaṃ.
It is the seven factors of awakening,” where “crushing Māra’s army” and “the seven factors of awakening” are one in meaning, and only the phrasing here is different.
Đó là bảy chi phần giác ngộ’’, ở đây, ‘‘con đường nghiền nát quân Ma-ra’’ và ‘‘bảy chi phần giác ngộ’’ là một về ý nghĩa, chỉ khác nhau về từ ngữ.
Evaṃ ekāyanamaggoti ca cattāro satipaṭṭhānāti ca atthato ekaṃ, byañjanamevettha nānaṃ.
So too, “the direct path” and “the four satipaṭṭhānas” are one in meaning, and only the phrasing here is different.
Cũng vậy, ‘‘đạo lộ độc nhất’’ và ‘‘bốn niệm xứ’’ là một về ý nghĩa, chỉ khác nhau về từ ngữ.
Tasmā maggaṭṭhena ekattā ekavacanaṃ, ārammaṇabhedena satibahuttā bahuvacanaṃ veditabbaṃ.
Therefore, it should be understood that the singular is used because of its oneness in the sense of a path, and the plural is used because of the multiplicity of mindfulness due to the difference in their objects.
Do đó, nên hiểu rằng số ít là do sự đồng nhất theo nghĩa là một con đường, và số nhiều là do có nhiều niệm với sự khác biệt về đối tượng.
Kasmā pana bhagavatā cattārova satipaṭṭhānā vuttā anūnā anadhikāti?
But why did the Blessed One state exactly four satipaṭṭhānas, no fewer, no more?
Tại sao Đức Thế Tôn chỉ thuyết giảng bốn niệm xứ, không ít hơn cũng không nhiều hơn?
Veneyyahitattā.
For the benefit of those to be trained.
Vì lợi ích của những người có thể được giáo hóa.
Taṇhācaritadiṭṭhicaritasamathayānikavipassanāyānikesu hi mandatikkhavasena dvedhā dvedhā pavattesu veneyyesu mandassa taṇhācaritassa oḷārikaṃ kāyānupassanāsatipaṭṭhānaṃ visuddhimaggo, tikkhassa sukhumaṃ vedanānupassanaṃ satipaṭṭhānaṃ.
For among those to be trained—who are of craving-temperament, of wrong-view-temperament, of the samatha vehicle, and of the vipassanā vehicle, proceeding in two ways each based on dull and sharp faculties—for the one of dull faculties with a craving-temperament, the gross contemplation of the body satipaṭṭhāna is the path of purification; for the one with sharp faculties, the subtle contemplation of feeling satipaṭṭhāna.
Trong số những người có thể được giáo hóa, được chia thành hai loại: người có khuynh hướng tham ái và người có khuynh hướng tà kiến, người thiên về Samatha và người thiên về Vipassanā, theo mức độ chậm chạp và sắc bén, đối với người có khuynh hướng tham ái chậm chạp, niệm xứ quán thân thô thiển là con đường thanh tịnh; đối với người sắc bén, niệm xứ quán thọ vi tế là con đường thanh tịnh.
Diṭṭhicaritassāpi mandassa nātippabhedagataṃ cittānupassanāsatipaṭṭhānaṃ visuddhimaggo, tikkhassa atippabhedagataṃ dhammānupassanāsatipaṭṭhānaṃ.
Also for one of dull faculties with a wrong-view-temperament, the contemplation of mind satipaṭṭhāna, which is not greatly diversified, is the path of purification; for the one with sharp faculties, the greatly diversified contemplation of dhammas satipaṭṭhāna.
Đối với người có khuynh hướng tà kiến chậm chạp, niệm xứ quán tâm không quá phân biệt là con đường thanh tịnh; đối với người sắc bén, niệm xứ quán pháp rất phân biệt là con đường thanh tịnh.
Samathayānikassa ca mandassa akicchena adhigantabbanimittaṃ paṭhamaṃ satipaṭṭhānaṃ visuddhimaggo, tikkhassa oḷārikārammaṇe asaṇṭhahanato dutiyaṃ.
And for one of dull faculties of the samatha vehicle, the first satipaṭṭhāna, whose sign is attainable without difficulty, is the path of purification; for one with sharp faculties, since their mind does not settle on a gross object, the second.
Đối với người thiên về Samatha chậm chạp, niệm xứ đầu tiên với tướng dễ đạt được là con đường thanh tịnh; đối với người sắc bén, niệm xứ thứ hai là con đường thanh tịnh vì không an trú vào đối tượng thô thiển.
Vipassanāyānikassapi mandassa nātippabhedagatārammaṇaṃ tatiyaṃ, tikkhassa atippabhedagatārammaṇaṃ catutthaṃ.
Also for one of dull faculties of the vipassanā vehicle, the third, whose object is not greatly diversified; for one with sharp faculties, the fourth, whose object is greatly diversified.
Đối với người thiên về Vipassanā chậm chạp, niệm xứ thứ ba với đối tượng không quá phân biệt là con đường thanh tịnh; đối với người sắc bén, niệm xứ thứ tư với đối tượng rất phân biệt là con đường thanh tịnh.
Iti cattārova vuttā anūnā anadhikāti.
Thus, exactly four were stated, no fewer, no more.
Vì vậy, chỉ có bốn niệm xứ được thuyết giảng, không ít hơn cũng không nhiều hơn.
Subhasukhaniccaattabhāvavipallāsapahānatthaṃ vā.
Or, for the purpose of abandoning the perversions of seeing attractiveness, pleasure, permanence, and self.
Hoặc là để đoạn trừ sự lầm lạc về đẹp đẽ, lạc thú, thường còn và ngã.
Kāyo hi asubho, tattha ca subhavipallāsavipallatthā sattā, tesaṃ tattha asubhabhāvadassanena tassa vipallāsassa pahānatthaṃ paṭhamaṃ satipaṭṭhānaṃ vuttaṃ.
For the body is unattractive, but beings are perverted by the perversion of seeing attractiveness in it. For them, to abandon that perversion by seeing the unattractive nature in it, the first satipaṭṭhāna was taught.
Thân là bất tịnh, và chúng sinh bị lầm lạc bởi sự lầm lạc về đẹp đẽ trong đó. Để đoạn trừ sự lầm lạc đó bằng cách thấy rõ bản chất bất tịnh của thân, niệm xứ đầu tiên đã được thuyết giảng.
Sukhaṃ niccaṃ attāti gahitesupi ca vedanādīsu vedanā dukkhā, cittaṃ aniccaṃ, dhammā anattā, tesu ca sukhaniccaattavipallāsavipallatthā sattā, tesaṃ tattha dukkhādibhāvadassanena tesaṃ vipallāsānaṃ pahānatthaṃ sesāni tīṇi vuttānīti evaṃ subhasukhaniccaattabhāvavipallāsapahānatthaṃ vā cattārova vuttā anūnā anadhikāti veditabbā.
And in feelings and so on, which are perceived as pleasant, permanent, and self, feeling is suffering, mind is impermanent, and dhammas are not-self; but beings are perverted by the perversions of seeing pleasure, permanence, and self in them. To abandon those perversions by seeing the nature of suffering and so on in them, the remaining three were taught. Thus, it should be understood that exactly four were stated, no fewer, no more, for the purpose of abandoning the perversions of seeing attractiveness, pleasure, permanence, and self.
Và đối với các thọ, tâm, pháp, v.v., được chấp thủ là lạc, thường, ngã, thì thọ là khổ, tâm là vô thường, pháp là vô ngã. Chúng sinh bị lầm lạc bởi sự lầm lạc về lạc, thường, ngã trong đó. Để đoạn trừ các sự lầm lạc đó bằng cách thấy rõ bản chất khổ, v.v., của chúng, ba niệm xứ còn lại đã được thuyết giảng. Như vậy, nên hiểu rằng chỉ có bốn niệm xứ được thuyết giảng, không ít hơn cũng không nhiều hơn, là để đoạn trừ sự lầm lạc về đẹp đẽ, lạc thú, thường còn và ngã.
Aṭṭhakathāyaṃ pana saraṇavasena ceva ekattasamosaraṇavasena ca ekameva satipaṭṭhānaṃ ārammaṇavasena cattāroti etadeva vuttaṃ.
In the Aṭṭhakathā, however, it is stated that there is only one satipaṭṭhāna in the sense of its function of remembering and its convergence into one, but four in the sense of its objects.
Tuy nhiên, trong Aṭṭhakathā (Chú giải), chỉ một niệm xứ được nói đến theo nghĩa ghi nhớ và theo nghĩa hội tụ thành một, và bốn niệm xứ theo nghĩa đối tượng.
Yathā hi catudvāre nagare pācīnato āgacchantā pācīnadisāya uṭṭhānakaṃ bhaṇḍaṃ gahetvā pācīnadvārena nagarameva pavisanti, dakkhiṇato pacchimato uttarato āgacchantā uttaradisāya uṭṭhānakaṃ bhaṇḍaṃ gahetvā uttaradvārena nagarameva pavisanti, evaṃsampadamidaṃ veditabbaṃ.
Just as in a city with four gates, those coming from the east, taking goods that originate in the eastern direction, enter the city through the eastern gate, and those coming from the south, west, and north, taking goods that originate in the northern direction, enter the city through the northern gate, so should this matter be understood.
Giống như trong một thành phố có bốn cổng, những người đến từ phía đông mang hàng hóa từ phía đông và đi vào thành phố qua cổng phía đông; những người đến từ phía nam, phía tây, phía bắc mang hàng hóa từ phía bắc và đi vào thành phố qua cổng phía bắc, thì điều này cũng nên được hiểu tương tự.
Nagaraṃ viya hi nibbānamahānagaraṃ.
For the great city of Nibbāna is like the city.
Thành phố ở đây ví như đại thành Nibbāna.
Dvāraṃ viya aṭṭhaṅgiko lokuttaramaggo.
The supramundane Eightfold Path is like the gate.
Cổng ví như Bát chánh đạo siêu thế.
Pācīnadisādayo viya kāyādayo.
The body and so on are like the eastern direction and so forth.
Các hướng đông, v.v., ví như thân, v.v.
Katame cattāroti kathetukamyatā pucchā.
What four? is a question indicating the desire to explain.
Thế nào là bốn? là câu hỏi muốn được giải thích.
Idhāti imasmiṃ sāsane.
Here means in this Dispensation.
Ở đây nghĩa là trong giáo pháp này.
Bhikkhaveti dhammapaṭiggāhakapuggalālapanametaṃ.
Bhikkhus is an address to the individuals who are the recipients of the Dhamma.
Này các Tỳ-kheo là lời gọi những người tiếp nhận giáo pháp.
Bhikkhūti paṭipattisampādakapuggalanidassanametaṃ.
A bhikkhu is an indication of the individual who accomplishes the practice.
Tỳ-kheo là sự chỉ định người thực hành pháp.
Aññepi ca devamanussā paṭipattiṃ sampādentiyeva, seṭṭhattā pana paṭipattiyā bhikkhubhāvadassanato ca, ‘‘bhikkhū’’ti āha.
Other devas and human beings also accomplish the practice, but He said, “a bhikkhu,” because of pre-eminence and because of showing that the state of a bhikkhu is attained through the practice.
Chư thiên và loài người khác cũng thực hành pháp, nhưng vì sự thực hành là tối thượng và vì thấy được trạng thái Tỳ-kheo qua sự thực hành, nên Đức Phật nói: “Tỳ-kheo”.
Bhagavato hi anusāsaniṃ sampaṭicchantesu bhikkhu seṭṭho, sabbappakārāya anusāsaniyā bhājanabhāvato, tasmā seṭṭhattā ‘‘bhikkhū’’ti āha.
Indeed, among those who accept the Blessed One’s instruction, a bhikkhu is pre-eminent, being a vessel for every kind of instruction; therefore, because of this pre-eminence, He said, “a bhikkhu.”
Trong số những người tiếp nhận lời giáo huấn của Đức Thế Tôn, Tỳ-kheo là tối thượng, vì họ là vật chứa đựng mọi loại giáo huấn; do đó, vì sự tối thượng, Ngài nói: “Tỳ-kheo”.
Tasmiṃ gahite pana sesā gahitāva honti rājagamanādīsu rājaggahaṇena sesaparisā viya.
When he is mentioned, the rest are taken as mentioned, just as when a king is mentioned in contexts like the king’s procession, the rest of the retinue is included.
Khi Tỳ-kheo được đề cập, những người khác cũng được bao hàm, giống như khi đề cập đến vua trong các cuộc hành quân của vua, toàn bộ đoàn tùy tùng cũng được bao hàm.
Yo ca imaṃ paṭipattiṃ paṭipajjati, so bhikkhu nāma hotīti paṭipattiyā bhikkhubhāvadassanatopi ‘‘bhikkhū’’ti āha.
He also said, “a bhikkhu,” to show that the state of a bhikkhu is attained through the practice, in that whoever undertakes this practice is called a bhikkhu.
Và người nào thực hành sự thực hành này, người đó được gọi là Tỳ-kheo; do đó, vì thấy được trạng thái Tỳ-kheo qua sự thực hành, Ngài cũng nói: “Tỳ-kheo”.
Paṭipannako hi devo vā hotu manusso vā, ‘‘bhikkhū’’ti saṅkhaṃ gacchatiyeva.
Indeed, whether it be a deva or a human who has undertaken the practice, they are reckoned as a “bhikkhu.”
Thật vậy, dù là chư thiên hay loài người đã thực hành pháp, họ đều được gọi là “Tỳ-kheo”.
Yathāha –
As it is said:
Như đã nói:
Kāyeti rūpakāye.
In the body means in the physical body.
Trong thân là trong sắc thân.
Rūpakāyo hi idha aṅgapaccaṅgānaṃ kesādīnañca dhammānaṃ samūhaṭṭhena hatthikāyarathakāyādayo viya kāyoti adhippeto.
For here the physical body is intended as a 'body' in the sense of a collection of elements like hair, etc., and of major and minor limbs, similar to an 'elephant-body' or 'chariot-body'.
Sắc thân ở đây được hiểu là thân (kāya) theo nghĩa là tập hợp các chi phần và các pháp như tóc, v.v., giống như thân voi, thân xe, v.v.
Yathā ca samūhaṭṭhena, evaṃ kucchitānaṃ āyaṭṭhena.
And just as it is in the sense of a collection, so it is in the sense of being a source of what is disgusting.
Và như theo nghĩa tập hợp, cũng vậy, theo nghĩa là nơi sinh ra những thứ đáng ghê tởm.
Kucchitānañhi paramajegucchānaṃ so āyotipi kāyo.
For it is a source of disgusting things, of the utterly repulsive, hence it is a body (kāya).
Vì thân là nơi sinh ra những thứ đáng ghê tởm, những thứ cực kỳ đáng ghê tởm, nên nó là thân (kāya).
Āyoti uppattideso.
Source (Āya) means a place of origin.
Āya nghĩa là nơi sinh ra.
Tatrāyaṃ vacanattho, āyanti tatoti āyo.
The etymology there is this: they arise from it, therefore it is a source (āya).
Ở đây, nghĩa của từ là: những gì sinh ra từ đó, nên gọi là āya.
Ke āyanti?
What arise?
Những gì sinh ra?
Kucchitā kesādayo.
The disgusting things, such as hair.
Những thứ đáng ghê tởm như tóc, v.v.
Iti kucchitānaṃ āyoti kāyo.
Thus, a source of disgusting things is a body (kāya).
Như vậy, nơi sinh ra những thứ đáng ghê tởm là thân (kāya).
Kāyānupassīti kāyamanupassanasīlo, kāyaṃ vā anupassamāno.
One contemplating the body (kāyānupassī) means one who is in the habit of repeatedly contemplating the body, or one who is repeatedly contemplating the body.
Kāyānupassī nghĩa là người có thói quen quán niệm thân, hoặc người đang quán niệm thân.
‘‘Kāye’’ti ca vatvāpi puna ‘‘kāyānupassī’’ti dutiyaṃ kāyaggahaṇaṃ asammissato vavatthānaghanavinibbhogādidassanatthaṃ katanti veditabbaṃ.
It should be understood that even after saying "in the body," the second mention of "body" in "one contemplating the body" is made to show the non-intermingling, the definition, the deconstruction of solidity, and so on.
Cần phải hiểu rằng, sau khi nói “trong thân” (kāye), việc lặp lại từ “thân” lần thứ hai trong “kāyānupassī” là để chỉ ra sự phân biệt rõ ràng, sự phân chia khối, v.v.
Tena na kāye vedanānupassī vā, cittadhammānupassī vā, atha kho kāyānupassīyevāti kāyasaṅkhāte vatthusmiṃ kāyānupassanākārasseva dassanena asammissato vavatthānaṃ dassitaṃ hoti.
Thereby, it is shown that in the body one is not one contemplating feelings, or one contemplating mind or dhammas, but is only one contemplating the body. Thus, by showing the very act of contemplating the body in the thing called the body, the definition of non-intermingling is shown.
Do đó, không phải là quán niệm thọ, tâm hay pháp trong thân, mà là chỉ quán niệm thân trong thân, cho thấy sự phân biệt rõ ràng không lẫn lộn trong đối tượng gọi là thân.
Tathā na kāye aṅgapaccaṅgavimuttaekadhammānupassī, nāpi kesalomādivinimuttaitthipurisānupassī.
Likewise, in the body, one is not one who contemplates a single dhamma separate from the major and minor limbs, nor one who contemplates a woman or a man separate from hair, body hair, and so on.
Cũng vậy, không phải là quán niệm một pháp duy nhất tách rời khỏi các chi phần của thân, cũng không phải là quán niệm nam hay nữ tách rời khỏi tóc, lông, v.v.
Yopi cettha kesalomādiko bhūtupādāyasamūhasaṅkhāto kāyo, tatthapi na bhūtupādāyavinimuttaekadhammānupassī, atha kho rathasambhārānupassako viya aṅgapaccaṅgasamūhānupassī, nagarāvayavānupassako viya kesalomādisamūhānupassī, kadalikkhandhapattavaṭṭivinibbhujanako viya rittamuṭṭhiviniveṭhako viya ca bhūtupādāyasamūhānupassīyevāti nānappakārato samūhavaseneva kāyasaṅkhātassa vatthuno dassanena ghanavinibbhogo dassito hoti.
Moreover, regarding the body here designated as a collection of primary elements and derived matter, such as hair and body hair, even there one is not one who contemplates a single dhamma separate from the primary elements and derived matter. Rather, like one inspecting the parts of a chariot, one contemplates the collection of major and minor limbs; like one inspecting the components of a city, one contemplates the collection of hair, body hair, etc.; like one peeling away the layers of a plantain trunk, and like one unwrapping an empty fist, one is only one who contemplates the collection of primary elements and derived matter. Thus, by seeing the thing called the body in various ways only in terms of a collection, the deconstruction of solidity is shown.
Và ngay cả khi thân ở đây được nói đến như là tập hợp của các yếu tố vật chất và các yếu tố phụ thuộc (bhūtupādāya), thì cũng không phải là quán niệm một pháp duy nhất tách rời khỏi các yếu tố vật chất và phụ thuộc, mà là quán niệm tập hợp các chi phần giống như người quán niệm các bộ phận của cỗ xe, quán niệm tập hợp tóc, lông, v.v. giống như người quán niệm các bộ phận của thành phố, và quán niệm tập hợp các yếu tố vật chất và phụ thuộc giống như người bóc vỏ cây chuối hay người nắm chặt rồi buông tay không; như vậy, sự phân chia khối được chỉ ra bằng cách quán niệm đối tượng gọi là thân theo nhiều cách khác nhau, theo nghĩa tập hợp.
Na hettha yathāvuttasamūhavinimutto kāyo vā itthī vā puriso vā añño vā koci dhammo dissati, yathāvuttadhammasamūhamatteyeva pana tathā tathā sattā micchābhinivesaṃ karonti.
Indeed, there is not seen here any body, or woman, or man, or any other dhamma separate from the aforesaid collection. It is only in the mere collection of the aforesaid dhammas that beings make a wrong fixation in such and such a way.
Thật vậy, ở đây không có thân, nữ, nam hay bất kỳ pháp nào khác tách rời khỏi tập hợp đã nói; nhưng chúng sinh lại bám chấp sai lầm vào chính tập hợp các pháp đã nói theo cách này hay cách khác.
Tenāhu porāṇā –
Therefore the ancients said:
Do đó, các bậc cổ nhân đã nói:
Ghanavinibbhogādidassanatthanti vuttaṃ.
This was said to show the deconstruction of solidity, and so on.
Đã nói là để chỉ ra sự phân chia khối, v.v.
Ādisaddena cettha ayampi attho veditabbo – ayañhi ekasmiṃ kāye kāyānupassīyeva, na aññadhammānupassī.
And by the word “and so on” (ādi), this meaning should also be understood: this person, in this one body, is only one contemplating the body, not one contemplating other dhammas.
Ở đây, với từ “v.v.”, cần hiểu thêm ý nghĩa này – người này chỉ quán niệm thân trong một thân, không quán niệm các pháp khác.
Kiṃ vuttaṃ hoti?
What is meant by this?
Ý nghĩa là gì?
Yathā anudakabhūtāyapi marīciyā udakānupassino honti, na evaṃ aniccadukkhānattaasubhabhūteyeva imasmiṃ kāye niccasukhaattasubhabhāvānupassī, atha kho kāyānupassī aniccadukkhānattaasubhākārasamūhānupassīyevāti.
Just as there are those who contemplate water in a mirage that is actually waterless, it is not so here. In this body, which is impermanent, suffering, not-self, and unattractive, one is not one who contemplates it as having the nature of permanence, happiness, self, and attractiveness. Rather, one is one who contemplates the body, one who contemplates the collection of aspects that are impermanent, suffering, not-self, and unattractive.
Giống như người ta quán niệm nước trong ảo ảnh dù không có nước, không phải là quán niệm trạng thái thường còn, lạc, ngã, tịnh trong thân này vốn là vô thường, khổ, vô ngã, bất tịnh, mà là người quán niệm thân, chỉ quán niệm tập hợp các trạng thái vô thường, khổ, vô ngã, bất tịnh.
Atha vā yvāyaṃ parato ‘‘idha, bhikkhave, bhikkhu araññagato vā…pe… so satova assasatī’’tiādinā nayena assāsapassāsādicuṇṇikajātaaṭṭhikapariyosāno kāyo vutto, yo ca ‘‘idhekacco pathavikāyaṃ aniccato anupassati āpokāyaṃ tejokāyaṃ vāyokāyaṃ kesakāyaṃ lomakāyaṃ chavikāyaṃ cammakāyaṃ maṃsakāyaṃ ruhirakāyaṃ nahārukāyaṃ aṭṭhikāyaṃ aṭṭhimiñjakāya’’nti paṭisambhidāyaṃ (paṭi. ma. 3.35) kāyo vutto, tassa sabbassa imasmiṃyeva kāye anupassanato ‘‘kāye kāyānupassī’’ti evampi attho daṭṭhabbo.
Alternatively, there is the body mentioned later with the method beginning, “Here, bhikkhus, a bhikkhu, having gone to the forest... he breathes in mindfully,” etc., which ends with the bones scattered and pulverized. And there is the body mentioned in the Paṭisambhidāmagga: “Here, someone contemplates the earth-body as impermanent, the water-body, the fire-body, the wind-body, the hair-body, the body hair-body, the skin-body, the dermis-body, the flesh-body, the blood-body, the sinew-body, the bone-body, the bone marrow-body.” Because all of that is contemplated in this very body, this meaning should also be seen thus: “in the body, one contemplating the body.”
Hoặc, ý nghĩa này cũng cần được hiểu là: “trong thân, quán niệm thân” vì quán niệm tất cả những gì được nói đến sau này, từ “Này các Tỳ-kheo, ở đây một Tỳ-kheo đi vào rừng… v.v… người đó thở vào với chánh niệm” cho đến thân thể được mô tả là tập hợp các hơi thở vào ra, các phần tử nhỏ, và cuối cùng là xương, và cả thân thể được nói đến trong Paṭisambhidā như: “Ở đây, một số người quán niệm tập hợp đất là vô thường, tập hợp nước, tập hợp lửa, tập hợp gió, tập hợp tóc, tập hợp lông, tập hợp da, tập hợp thịt, tập hợp máu, tập hợp gân, tập hợp xương, tập hợp tủy xương” đều là quán niệm trong chính thân này.
Atha vā kāye ahanti vā mamanti vā evaṃ gahetabbassa yassa kassaci ananupassanato tassa tasseva pana kesālomādikassa nānādhammasamūhassa anupassanato kāye kesādidhammasamūhasaṅkhātakāyānupassīti evamattho daṭṭhabbo.
Alternatively, because one does not contemplate anything whatsoever in the body that could be grasped as ‘I’ or ‘mine’, but rather contemplates that very collection of various dhammas such as hair, body hair, and so on, the meaning should be seen thus: in the body, one is one who contemplates the body which is designated as a collection of dhammas such as hair and so on.
Hoặc, ý nghĩa này cũng cần được hiểu là: “trong thân, quán niệm thân” như là tập hợp các pháp như tóc, v.v., vì không quán niệm bất cứ điều gì được nắm giữ như “tôi” hay “của tôi” trong thân, mà chỉ quán niệm tập hợp các pháp khác nhau như tóc, lông, v.v.
Apica ‘‘imasmiṃ kāye aniccato anupassati, no niccato’’tiādinā nayena paṭisambhidāyaṃ āgatanayassa sabbasseva aniccalakkhaṇādino ākārasamūhasaṅkhātassa kāyassānupassanatopi ‘‘kāye kāyānupassī’’ti evampi attho daṭṭhabbo.
Furthermore, also because one contemplates the body, designated as a collection of aspects, which comprises the entire method that has come in the Paṭisambhidāmagga with the approach beginning, “in this body, one contemplates as impermanent, not as permanent,” and which consists of the characteristic of impermanence and so on, this meaning should also be seen thus: “in the body, one contemplating the body.”
Hơn nữa, ý nghĩa này cũng cần được hiểu là: “trong thân, quán niệm thân” vì quán niệm tất cả các khía cạnh của thân như là tập hợp các trạng thái vô thường, v.v., được trình bày trong Paṭisambhidā theo cách như “quán niệm thân này là vô thường, không phải thường còn”, v.v.
Tathā hi ayaṃ kāye kāyānupassanāpaṭipadaṃ paṭipanno bhikkhu imaṃ kāyaṃ aniccānupassanādīnaṃ sattannaṃ anupassanānaṃ vasena aniccato anupassati, no niccato.
For indeed, this bhikkhu who has undertaken the practice of contemplating the body in the body contemplates this body as impermanent, not as permanent, by means of the seven contemplations, such as the contemplation of impermanence.
Thật vậy, Tỳ-kheo thực hành con đường quán niệm thân trong thân này, quán niệm thân này là vô thường, không phải thường còn, theo bảy loại quán niệm như vô thường quán, v.v.
Dukkhato anupassati, no sukhato.
He contemplates as suffering, not as pleasure.
Quán chiếu về khổ, không phải về lạc.
Anattato anupassati, no attato.
He contemplates as not-self, not as self.
Quán chiếu về vô ngã, không phải về ngã.
Nibbindati, no nandati.
He becomes disenchanted, he does not delight.
Chán ghét, không hoan hỷ.
Virajjati, no rajjati.
He becomes dispassionate, he is not passionate.
Ly tham, không đắm nhiễm.
Nirodheti, no samudeti.
He brings to cessation, he does not cause to arise.
Diệt trừ, không sanh khởi.
Paṭinissajjati, no ādiyati.
He relinquishes, he does not grasp.
Xả bỏ, không chấp thủ.
So taṃ aniccato anupassanto niccasaññaṃ pajahati, dukkhato anupassanto sukhasaññaṃ pajahati, anattato anupassanto attasaññaṃ pajahati, nibbindanto nandiṃ pajahati, virajjanto rāgaṃ pajahati, nirodhento samudayaṃ pajahati, paṭinissajjanto ādānaṃ pajahatīti veditabbo.
Contemplating it as impermanent, he abandons the perception of permanence; contemplating it as suffering, he abandons the perception of pleasure; contemplating it as not-self, he abandons the perception of self; becoming disenchanted, he abandons delight; becoming dispassionate, he abandons passion; bringing it to cessation, he abandons its arising; relinquishing it, he abandons grasping—this is how it should be understood.
Người ấy, khi quán chiếu về vô thường thì từ bỏ thường tưởng; khi quán chiếu về khổ thì từ bỏ lạc tưởng; khi quán chiếu về vô ngã thì từ bỏ ngã tưởng; khi chán ghét thì từ bỏ sự hoan hỷ; khi ly tham thì từ bỏ tham ái; khi diệt trừ thì từ bỏ sự sanh khởi; khi xả bỏ thì từ bỏ sự chấp thủ, nên được hiểu là vậy.
Viharatīti iriyati.
Dwells means he carries on his activities.
Sống (Viharatī) nghĩa là hành xử (iriyati).
Ātāpīti tīsu bhavesu kilese ātāpetīti ātāpo, vīriyassetaṃ nāmaṃ.
Ardent: that which scorches the defilements in the three planes of existence is ardour (ātāpo); this is a name for energy (vīriya).
Nhiệt tâm (Ātāpī) nghĩa là ātāpa là thiêu đốt các phiền não trong ba cõi hữu. Đây là tên của tinh tấn (vīriya).
Ātāpo assa atthīti ātāpī.
One who has this ardour is ardent (ātāpī).
Vì người ấy có ātāpa, nên gọi là ātāpī.
Sampajānoti sampajaññasaṅkhātena ñāṇena samannāgato.
Clearly comprehending means endowed with the knowledge known as clear comprehension.
Tỉnh giác (Sampajāno) nghĩa là người được đầy đủ trí tuệ gọi là tỉnh giác (sampajañña).
Satimāti kāyapariggāhikāya satiyā samannāgato.
Mindful means endowed with the mindfulness that apprehends the body.
Chánh niệm (Satimā) nghĩa là người được đầy đủ chánh niệm (sati) để nắm giữ thân.
Ayaṃ pana yasmā satiyā ārammaṇaṃ pariggahetvā paññāya anupassati, na hi sativirahitassa anupassanā nāma atthi.
Furthermore, since this person, having apprehended the object with mindfulness, contemplates it with wisdom, for there is no such thing as contemplation for one who is devoid of mindfulness.
Hơn nữa, vì người này nắm giữ đối tượng bằng chánh niệm rồi quán chiếu bằng tuệ, không có sự quán chiếu nào mà thiếu chánh niệm.
Tenevāha ‘‘satiñca khvāhaṃ, bhikkhave, sabbatthikaṃ vadāmī’’ti (saṃ. ni. 5.234).
Thus it was said: "Mindfulness, O bhikkhus, I declare to be beneficial everywhere."
Chính vì vậy, Ngài đã nói: “Này các tỳ khưu, Ta nói chánh niệm là cần thiết ở khắp mọi nơi” (Saṃ. Ni. 5.234).
Tasmā ettha ‘‘kāye kāyānupassī viharatī’’ti ettāvatā kāyānupassanāsatipaṭṭhānakammaṭṭhānaṃ vuttaṃ hoti.
Therefore, by this much, "dwells contemplating the body in the body," the meditation subject of the establishment of mindfulness through contemplation of the body has been stated.
Do đó, ở đây, chỉ với câu “vị ấy sống quán thân trên thân” là đã nói đến nghiệp xứ Tứ Niệm Xứ quán thân trên thân.
Atha vā yasmā anātāpino antosaṅkhepo antarāyakaro hoti, asampajāno upāyapariggahe anupāyaparivajjane ca sammuyhati, muṭṭhassati upāyāpariccāge anupāyāpariggahe ca asamattho hoti, tenassa taṃ kammaṭṭhānaṃ na sampajjati, tasmā yesaṃ dhammānaṃ ānubhāvena taṃ sampajjati.
Alternatively, since for one lacking ardour, internal constriction becomes an obstacle, and one lacking clear comprehension becomes confused in adopting the means and avoiding what is not the means, and one with lapsed mindfulness is incapable of not abandoning the means and not adopting what is not the means, for that reason his meditation subject does not succeed. Therefore, to show the states through the power of which it does succeed,
Hoặc, vì đối với người không có nhiệt tâm, sự co rút bên trong (tâm) sẽ gây chướng ngại; người không tỉnh giác sẽ bị lầm lẫn trong việc nắm giữ phương tiện và tránh xa các điều không phải phương tiện; người thất niệm sẽ không có khả năng từ bỏ các phương tiện và nắm giữ các điều không phải phương tiện, do đó nghiệp xứ ấy không thành tựu cho người ấy.
Tesaṃ dassanatthaṃ ‘‘ātāpī sampajāno satimāti idaṃ vutta’’nti veditabbaṃ.
it should be understood that "ardent, clearly comprehending, mindful" was said for the purpose of showing those things.
Vì vậy, để chỉ ra những pháp mà nhờ năng lực của chúng mà nghiệp xứ ấy thành tựu, nên cần hiểu rằng câu “ātāpī sampajāno satimā” (nhiệt tâm, tỉnh giác, chánh niệm) này đã được nói ra.
Iti kāyānupassanāsatipaṭṭhānaṃ sampayogaṅgañcassa dassetvā idāni pahānaṅgaṃ dassetuṃ vineyya loke abhijjhādomanassanti vuttaṃ.
Thus, having shown the establishment of mindfulness through contemplation of the body and its associated factors, now, in order to show the factor of abandoning, it is said: having subdued covetousness and displeasure in the world.
Như vậy, sau khi chỉ ra Tứ Niệm Xứ quán thân trên thân và các chi phần tương ưng của nó, bây giờ để chỉ ra chi phần đoạn trừ, nên đã nói “ loại bỏ tham ưu trên đời (vineyya loke abhijjhādomanassaṃ)”.
Tattha vineyyāti tadaṅgavinayena vā vikkhambhanavinayena vā vinayitvā.
Therein, having subdued means having disciplined it by means of momentary subduing or by subduing through suppression.
Trong đó, vineyyā nghĩa là sau khi đoạn trừ bằng sự đoạn trừ từng phần (tadaṅgavinaya) hoặc bằng sự đoạn trừ trấn áp (vikkhambhanavinaya).
Loketi tasmiṃyeva kāye.
In the world means in that very body.
Trên đời (Loke) nghĩa là ngay trên thân ấy.
Kāyo hi idha lujjanapalujjanaṭṭhena lokoti adhippeto.
For here, the body is intended as "world" in the sense of disintegrating and breaking down.
Vì ở đây, thân được hiểu là thế gian theo nghĩa là sự hư hoại và tan rã.
Yasmā panassa na kāyamatteyeva abhijjhādomanassaṃ pahīyati, vedanādīsupi pahīyatiyeva, tasmā ‘‘pañcapi upādānakkhandhā loko’’ti vibhaṅge (vibha. 362) vuttaṃ.
However, since covetousness and displeasure are not abandoned in the body alone, but are also abandoned in feelings and so on, it is therefore said in the Vibhaṅga: "The five aggregates of clinging are the world."
Tuy nhiên, vì tham ưu của người ấy không chỉ được đoạn trừ trên thân, mà còn được đoạn trừ trên thọ, v.v., nên trong Phân Tích (Vibhaṅga) (Vibha. 362) đã nói: “Năm uẩn chấp thủ là thế gian.”
Lokasaṅkhātattā vā tesaṃ dhammānaṃ atthuddhāranayenetaṃ vuttaṃ.
Or, this was said according to the method of extracting the meaning, because those states are designated as "world."
Hoặc, lời này được nói theo phương pháp khai triển ý nghĩa do các pháp ấy được gọi là thế gian.
Yaṃ panāha ‘‘tattha katamo loko?
As for what was said, "Therein, what is the world?
Còn điều đã nói: “Trong đó, thế gian là gì?
Sveva kāyo loko’’ti.
That very body is the world,"
Chính thân này là thế gian.”
Ayamevettha attho, tasmiṃ loke abhijjhādomanassaṃ vineyyāti evaṃ sambandho daṭṭhabbo.
this is precisely the meaning here; the connection should be seen thus: "having subdued covetousness and displeasure in that world."
Đây chính là ý nghĩa ở đây, cần hiểu sự liên kết là: “loại bỏ tham ưu trên thế gian ấy.”
Yasmā panettha abhijjhāgahaṇena kāmacchando, domanassaggahaṇena byāpādo saṅgahaṃ gacchati, tasmā nīvaraṇapariyāpannabalavadhammadvayadassanena nīvaraṇappahānaṃ vuttaṃ hotīti veditabbaṃ.
Since here, by the term covetousness, sensual desire is included, and by the term displeasure, ill will is included, it should be understood that by showing these two powerful states included in the hindrances, the abandoning of the hindrances is stated.
Hơn nữa, vì ở đây, với việc nắm giữ tham (abhijjhā), dục lạc (kāmacchanda) được bao gồm; với việc nắm giữ ưu (domanassa), sân hận (byāpāda) được bao gồm, nên cần hiểu rằng việc đoạn trừ các triền cái được nói đến qua việc chỉ ra hai pháp mạnh mẽ thuộc về các triền cái.
Visesena cettha abhijjhāvinayena kāyasampattimūlakassa anurodhassa, domanassavinayena pana kāyavipattimūlakassa virodhassa, abhijjhāvinayena ca kāye abhiratiyā, domanassavinayena kāyabhāvanāya anabhiratiyā, abhijjhāvinayena kāye abhūtānaṃ subhasukhabhāvādīnaṃ pakkhepassa, domanassavinayena ca kāye bhūtānaṃ asubhāsukhabhāvādīnaṃ apanayanassa ca pahānaṃ vuttaṃ.
Moreover, in particular, by the subduing of covetousness, the abandoning of fondness rooted in the body's well-being is stated; by the subduing of displeasure, the abandoning of aversion rooted in the body's affliction; by the subduing of covetousness, the abandoning of delight in the body; by the subduing of displeasure, the abandoning of non-delight in the development of the body; by the subduing of covetousness, the abandoning of adding unreal qualities of beauty, pleasure, etc., to the body; and by the subduing of displeasure, the abandoning of removing real qualities of foulness, pain, etc., from the body.
Đặc biệt ở đây, với việc đoạn trừ tham (abhijjhā), sự chấp thuận (anurodha) có gốc rễ từ sự thành tựu của thân được đoạn trừ; còn với việc đoạn trừ ưu (domanassa), sự đối kháng (virodha) có gốc rễ từ sự thất bại của thân được đoạn trừ. Với việc đoạn trừ tham, sự hoan hỷ (abhirati) đối với thân được đoạn trừ; với việc đoạn trừ ưu, sự không hoan hỷ (anabhirati) đối với sự tu tập thân được đoạn trừ; với việc đoạn trừ tham, sự gán ghép những điều không thật (như tốt đẹp, hạnh phúc, v.v.) vào thân được đoạn trừ; và với việc đoạn trừ ưu, sự loại bỏ những điều thật (như bất tịnh, khổ, v.v.) khỏi thân cũng được đoạn trừ.
Tena yogāvacarassa yogānubhāvo yogasamatthatā ca dīpitā hoti.
Through this, the meditator's spiritual power and his competence in meditation are revealed.
Nhờ đó, năng lực tu tập và khả năng tu tập của hành giả được chỉ rõ.
Yogānubhāvo hi esa, yadidaṃ anurodhavirodhavippamutto aratiratisaho abhūtapakkhepabhūtāpanayanavirahito ca hoti.
For this is the power of meditation: that one becomes free from fondness and aversion, able to endure non-delight and delight, and free from adding the unreal and removing the real.
Thật vậy, năng lực tu tập là khi người ấy thoát khỏi sự chấp thuận và đối kháng, chịu đựng được sự không hoan hỷ và hoan hỷ, và không gán ghép những điều không thật cũng như không loại bỏ những điều thật.
Anurodhavirodhavippamutto cesa aratiratisaho abhūtaṃ apakkhipanto bhūtañca anapanento yogasamattho hotīti.
And being free from fondness and aversion, able to endure non-delight and delight, not adding the unreal and not removing the real, one becomes competent in meditation.
Và khi người ấy thoát khỏi sự chấp thuận và đối kháng, chịu đựng được sự không hoan hỷ và hoan hỷ, không gán ghép những điều không thật và không loại bỏ những điều thật, thì người ấy có khả năng tu tập.
Aparo nayo ‘‘kāye kāyānupassī’’ti ettha anupassanāya kammaṭṭhānaṃ vuttaṃ.
Another method: in "contemplating the body in the body," the meditation subject is stated by way of contemplation.
Một phương pháp khác: trong câu “quán thân trên thân”, nghiệp xứ của sự quán chiếu được nói đến.
‘‘Viharatī’’ti ettha vuttavihārena kammaṭṭhānikassa kāyapariharaṇaṃ.
In "dwells," by means of the dwelling mentioned, the maintenance of the body of the meditator is stated.
Trong câu “sống (viharati)”, sự duy trì thân của hành giả bằng cách sống đã được nói đến.
‘‘Ātāpī’’tiādīsu ātāpena sammappadhānaṃ, satisampajaññena sabbatthikakammaṭṭhānaṃ, kammaṭṭhānapariharaṇūpāyo vā, satiyā vā kāyānupassanāvasena paṭiladdhasamatho, sampajaññena vipassanā, abhijjhādomanassavinayena bhāvanāphalaṃ vuttanti veditabbaṃ.
In "ardent," etc., by ardour, the right effort is stated; by mindfulness and clear comprehension, the meditation subject applicable everywhere, or the method for maintaining the meditation subject, is stated; or by mindfulness, the serenity attained through contemplation of the body is stated; by clear comprehension, insight; by the subduing of covetousness and displeasure, the fruit of the development is stated—this is how it should be understood.
Trong các từ “ātāpī” v.v., nhiệt tâm (ātāpa) nói đến chánh tinh tấn (sammappadhāna); chánh niệm và tỉnh giác (satisampajañña) nói đến nghiệp xứ cần thiết ở mọi nơi, hoặc là phương tiện để duy trì nghiệp xứ; hoặc chánh định (samatha) đạt được nhờ chánh niệm theo cách quán thân, và tuệ quán (vipassanā) nhờ tỉnh giác; và việc đoạn trừ tham ưu nói đến thành quả của sự tu tập, nên cần được hiểu là vậy.
Vibhaṅge pana ‘‘anupassī’’ti tattha katamā anupassanā?
However, in the Vibhaṅga, it is said: "Contemplator": Therein, what is contemplation?
Tuy nhiên, trong Phân Tích (Vibhaṅga), về từ “anupassī”, quán chiếu là gì?
Yā paññā pajānanā…pe… sammādiṭṭhi.
Whatever is wisdom, understanding... and so on... right view.
Đó là tuệ (paññā), sự hiểu biết (pajānanā)... v.v... chánh kiến (sammādiṭṭhi).
Ayaṃ vuccati anupassanā.
This is called contemplation.
Đây gọi là quán chiếu.
Imāya anupassanāya upeto hoti samupeto upāgato samupāgato upapanno sampanno samannāgato.
He is furnished, fully furnished, come to, fully come to, possessed of, fully possessed of, and endowed with this contemplation.
Người ấy được đầy đủ, được hoàn toàn đầy đủ, được đạt đến, được hoàn toàn đạt đến, được thành tựu, được viên mãn, được đầy đủ với sự quán chiếu này.
Tena vuccati anupassīti.
Therefore, he is called a contemplator.
Vì vậy, được gọi là anupassī.
Vineyya loke abhijjhādomanassanti tattha katamo loko?
Having subdued covetousness and displeasure in the world: Therein, what is the world?
Loại bỏ tham ưu trên đời (Vineyya loke abhijjhādomanassaṃ) nghĩa là trong đó, thế gian là gì?
Sveva kāyo loko, pañcapi upādānakkhandhā loko.
That very body is the world; the five aggregates of clinging are the world.
Chính thân ấy là thế gian, năm uẩn chấp thủ là thế gian.
Ayaṃ vuccati loko.
This is called the world.
Đây gọi là thế gian.
Tattha katamā abhijjhā?
Therein, what is covetousness?
Trong đó, tham (abhijjhā) là gì?
Yo rāgo sārāgo anunayo anurodho nandī nandīrāgo cittassa sārāgo, ayaṃ vuccati abhijjhā.
Whatever is passion, lust, compliance, fondness, delight, attachment to delight, lust of mind—this is called covetousness.
Đó là tham ái (rāga), sự đắm nhiễm (sārāga), sự tùy thuận (anunaya), sự chấp thuận (anurodha), sự hoan hỷ (nandī), sự hoan hỷ và tham ái (nandīrāga), sự đắm nhiễm của tâm (cittassa sārāgo); đây gọi là tham.
Tattha katamaṃ domanassaṃ?
Therein, what is displeasure?
Trong đó, ưu (domanassaṃ) là gì?
Yaṃ cetasikaṃ asātaṃ, cetasikaṃ dukkhaṃ, cetosamphassajaṃ asātaṃ…pe… dukkhā vedanā.
Whatever is mental unpleasantness, mental suffering, the unpleasant... and so on... painful feeling born of mental contact.
Đó là sự không hài lòng trong tâm (cetasikaṃ asātaṃ), khổ trong tâm (cetasikaṃ dukkhaṃ), sự không hài lòng do xúc tâm sanh... v.v... cảm thọ khổ.
Idaṃ vuccati domanassaṃ.
This is called displeasure.
Đây gọi là ưu.
Iti ayañca abhijjhā idañca domanassaṃ imamhi loke vinītā honti paṭivinītā santā vūpasantā samitā vūpasamitā atthaṅgatā abbhatthaṅgatā appitā byappitā sositā visositā byantīkatā, tena vuccati vineyya loke abhijjhādomanassanti (vibha. 356) evametesaṃ padānamattho vutto.
Thus, this covetousness and this displeasure are in this world disciplined, well-disciplined, stilled, calmed, allayed, well-allayed, gone to rest, completely gone to rest, made to disappear, made to vanish, dried up, completely dried up, made an end of; therefore it is said: "having subdued covetousness and displeasure in the world"—in this way the meaning of these terms has been stated.
Như vậy, tham này và ưu này đã được đoạn trừ, được hoàn toàn đoạn trừ, được lắng dịu, được làm cho lắng dịu, được hoàn toàn làm cho lắng dịu, được diệt trừ, được hoàn toàn diệt trừ, được chấm dứt, được làm cho chấm dứt, được làm cho khô cạn, được hoàn toàn làm cho khô cạn, được làm cho không còn tồn tại trên thế gian này; vì vậy, được gọi là loại bỏ tham ưu trên đời (vineyya loke abhijjhādomanassaṃ) (Vibha. 356), ý nghĩa của các từ này đã được nói như vậy.
Tena saha ayaṃ aṭṭhakathānayo yathā saṃsandati, evaṃ veditabbo.
Thus, it should be understood in such a way that this commentary method accords with that.
Cần hiểu rằng phương pháp chú giải này phù hợp với điều đó.
Ayaṃ tāva kāyānupassanāsatipaṭṭhānuddesassa atthavaṇṇanā.
This is the explanation of the meaning of the exposition of the foundation of mindfulness of contemplation of the body.
Đây là phần giải thích ý nghĩa của sự trình bày tóm tắt về Tứ Niệm Xứ quán thân trên thân.
Vedanāsu… citte… dhammesu dhammānupassī viharati…pe… vineyya loke abhijjhādomanassanti ettha pana vedanānupassīti evamādīsu vedanādīnaṃ puna vacane payojanaṃ kāyānupassanāyaṃ vuttanayeneva veditabbaṃ.
Furthermore, in the phrase, "dwells contemplating feelings in feelings... the mind in the mind... dhammas in dhammas...pe... having subdued covetousness and displeasure in the world," the purpose of repeating feelings and so on in "contemplating feelings" and the rest should be understood in the same way as was stated for the contemplation of the body.
Còn trong câu “ quán thọ trên các cảm thọ... tâm trên tâm... pháp trên các pháp, sống... v.v... loại bỏ tham ưu trên đời”, sự lặp lại của thọ, v.v., trong các cụm từ “quán thọ” v.v., cần được hiểu theo cách đã nói trong quán thân trên thân.
Vedanāsu vedanānupassī, citte cittānupassī, dhammesu dhammānupassīti ettha pana vedanāti tisso vedanā, tā ca lokiyā eva.
Contemplating feelings in feelings, contemplating consciousness in consciousness, contemplating dhammas in dhammas. Here, feelings refers to the three feelings, and they are only mundane.
Trong các thọ, quán thọ trên các thọ; trong tâm, quán tâm trên tâm; trong các pháp, quán pháp trên các pháp. Ở đây, thọ là ba thọ, và chúng đều là thế gian.
Cittampi lokiyaṃ, tathā dhammā.
Consciousness is also mundane, as are the dhammas.
Tâm cũng là thế gian, các pháp cũng vậy.
Tesaṃ vibhāgo niddesavāre pākaṭo bhavissati.
Their analysis will become clear in the section on exposition.
Sự phân loại của chúng sẽ trở nên rõ ràng trong phần trình bày chi tiết (niddesa-vāra).
Kevalaṃ panidha yathā vedanā anupassitabbā, tathā anupassanto vedanāsu vedanānupassīti veditabbo.
However, in this context, it should be understood simply that one who contemplates feelings in the way they should be contemplated is called one who contemplates feelings in feelings.
Tuy nhiên, ở đây, cần hiểu rằng một người quán thọ như thế nào thì người ấy quán thọ như vậy, và được gọi là quán thọ trên các thọ.
Esa nayo cittadhammesupi.
This method also applies to consciousness and dhammas.
Nguyên tắc này cũng áp dụng cho tâm và các pháp.
Kathañca vedanā anupassitabbāti?
And how should feelings be contemplated?
Và quán thọ như thế nào?
Sukhā tāva vedanā dukkhato, dukkhā sallato, adukkhamasukhā aniccato.
Pleasant feeling, for instance, should be contemplated as suffering; painful feeling as a dart; neither-painful-nor-pleasant feeling as impermanent.
Trước hết, thọ lạc thì quán là khổ, thọ khổ là mũi tên, thọ không khổ không lạc là vô thường.
Yathāha –
As it is said:
Như đã nói:
Sabbā eva cetā dukkhātipi anupassitabbā.
All of them should also be contemplated as suffering.
Tất cả các thọ này đều phải được quán là khổ.
Vuttañhetaṃ ‘‘yaṃkiñci vedayitaṃ, sabbaṃ taṃ dukkhasminti vadāmī’’ti (saṃ. ni. 4.259).
For it has been said, “Whatever is felt, all that I declare to be within suffering.”
Vì đã nói: “Bất cứ cảm thọ nào, tất cả đều là khổ, Ta nói vậy.”
Sukhadukkhatopi ca anupassitabbā.
They should also be contemplated in terms of pleasure and pain.
Và cũng phải quán thọ là lạc và khổ.
Yathāha ‘‘sukhā vedanā ṭhitisukhā vipariṇāmadukkhā’’ti (ma. ni. 1.464) sabbaṃ vitthāretabbaṃ.
As it is said, “Pleasant feeling is pleasant in its presence, painful in its change,” and so on; all should be elaborated.
Như đã nói: “Thọ lạc là lạc khi tồn tại, là khổ khi biến đổi.” Tất cả cần được giải thích chi tiết.
Apica aniccādisattānupassanāvasenapi anupassitabbā.
Furthermore, they should be contemplated by way of the seven contemplations, such as impermanence.
Hơn nữa, cũng phải quán chiếu bằng bảy quán như vô thường (anicca) v.v.
Sesaṃ niddesavāreyeva pākaṭaṃ bhavissati.
The rest will become clear in the section on exposition.
Phần còn lại sẽ rõ ràng trong phần trình bày chi tiết (niddesa-vāra).
Cittadhammesupi cittaṃ tāva ārammaṇādhipatisahajātabhūmikammavipākakiriyādinānattabhedānaṃ aniccādisattānupassanānaṃ niddesavāre āgatasarāgādibhedānañca vasena anupassitabbaṃ.
Regarding consciousness and dhammas, consciousness, for its part, should be contemplated by way of the various distinctions such as object, dominant factor, co-nascence, plane, kamma, result, and function; by way of the seven contemplations such as impermanence; and by way of the distinctions such as being with greed, which are mentioned in the section on exposition.
Trong tâm và các pháp, trước hết, tâm phải được quán chiếu theo các loại khác nhau như đối tượng (ārammaṇa), quyền năng (adhipati), đồng sinh (sahajāta), cõi (bhūmi), nghiệp (kamma), quả (vipāka), hành (kiriyā) v.v., theo bảy quán như vô thường (anicca) v.v., và theo các loại như có tham (sarāga) v.v., được đề cập trong phần trình bày chi tiết.
Dhammā salakkhaṇasāmaññalakkhaṇānaṃ suññatadhammassa aniccādisattānupassanānaṃ niddesavāre āgatasantāsantādibhedānañca vasena anupassitabbā.
Dhammas should be contemplated by way of their specific and general characteristics, of the dhamma of emptiness, of the seven contemplations such as impermanence, and of the distinctions such as being present or absent, which are mentioned in the section on exposition.
Các pháp phải được quán chiếu theo các đặc tính riêng (salakkhaṇa) và đặc tính chung (sāmañña-lakkhaṇa), theo pháp không (suññata-dhamma), theo bảy quán như vô thường (anicca) v.v., và theo các loại như hiện hữu (santa), không hiện hữu (asanta) v.v., được đề cập trong phần trình bày chi tiết.
Sesaṃ vuttanayameva.
The rest is as has been stated.
Phần còn lại theo cách đã nói.
Kāmañcettha yassa kāyasaṅkhāte loke abhijjhādomanassaṃ pahīnaṃ, tassa vedanādilokesupi taṃ pahīnameva.
Although it is true that for one whose covetousness and displeasure in the world identified with the body have been abandoned, they are also abandoned in the worlds of feelings and so on.
Mặc dù ở đây, đối với người mà sự tham lam (abhijjhā) và ưu phiền (domanassa) đã được đoạn trừ trong thế giới thân (kāya-saṅkhāta loka), thì chúng cũng đã được đoạn trừ trong các thế giới thọ (vedanā-loka) v.v.
Nānāpuggalavasena pana nānācittakkhaṇikasatipaṭṭhānabhāvanāvasena ca sabbattha vuttaṃ.
However, it is stated everywhere with respect to different individuals and with respect to the development of the foundations of mindfulness at different moments of consciousness.
Nhưng điều này được nói ở khắp mọi nơi theo sự khác biệt của các cá nhân và theo sự tu tập chánh niệm từng sát na khác nhau.
Yato vā ekattha pahīnaṃ sesesupi pahīnaṃ hoti.
Or, because when they are abandoned in one, they are abandoned in the others as well.
Hoặc vì khi một điều được đoạn trừ ở một nơi, nó cũng được đoạn trừ ở những nơi còn lại.
Tenevassa tattha pahānadassanatthampi evaṃ vuttanti veditabbanti.
Therefore, it should be understood that it is stated thus to show the abandonment there for that person.
Chính vì thế, để chỉ ra sự đoạn trừ ở đó, điều này đã được nói như vậy.
107. Idāni seyyathāpi nāma cheko vilīvakārako thūlakilañjasaṇhakilañjacaṅkoṭakapeḷāpuṭādīni upakaraṇāni kattukāmo ekaṃ mahāveṇuṃ labhitvā catudhā bhinditvā tato ekekaṃ veṇukhaṇḍaṃ gahetvā phāletvā taṃ taṃ upakaraṇaṃ kareyya, evameva bhagavā satipaṭṭhānadesanāya sattānaṃ anekappakāravisesādhigamaṃ kattukāmo ekameva sammāsatiṃ ‘‘cattāro satipaṭṭhānā.
107. Now, just as a skilled bamboo-worker, wishing to make items such as coarse mats, fine mats, baskets, chests, and containers, having obtained a large bamboo, would split it into four, and then taking each bamboo segment, would split it to make those various items; in the same way, the Blessed One, wishing to bring about the attainment of special qualities of many kinds for beings through the teaching of the foundations of mindfulness, divided the one right mindfulness into four by way of its object with the method beginning, “The four foundations of mindfulness.
107. Giờ đây, ví như một người thợ mây lành nghề, muốn làm các vật dụng như chiếu thô, chiếu mịn, giỏ, hộp v.v., sau khi tìm được một cây tre lớn, ông ta chẻ nó thành bốn phần, rồi lấy từng phần tre đó, tách ra và làm từng vật dụng. Cũng vậy, Thế Tôn, muốn cho chúng sanh đạt được các thành tựu đặc biệt khác nhau qua lời dạy về Tứ Niệm Xứ, đã chẻ một chánh niệm duy nhất thành bốn phần theo đối tượng, như: “Này các tỳ khưu, có bốn niệm xứ. Bốn niệm xứ nào? Ở đây, này các tỳ khưu, một tỳ khưu sống quán thân trên thân,” v.v., rồi lấy từng niệm xứ đó mà phân tích, Ngài bắt đầu trình bày phần chi tiết (niddesa-vāra) bằng cách nói: “Và này các tỳ khưu, như thế nào?”
Katame cattāro?
What are the four?
Ở đây, “Và như thế nào?” v.v. là câu hỏi với ý muốn giải thích chi tiết.
Idha, bhikkhave, bhikkhu kāye kāyānupassī viharatī’’tiādinā nayena ārammaṇavasena catudhā bhinditvā tato ekekaṃ satipaṭṭhānaṃ gahetvā vibhajanto ‘‘kathañca bhikkhave’’tiādinā nayena niddesavāraṃ vattumāraddho.
Here, monks, a monk dwells contemplating the body in the body,” and then, taking each foundation of mindfulness and analyzing it, he began to deliver the section on exposition with the method beginning, “And how, monks?”
Ý nghĩa tóm tắt ở đây là: “Này các tỳ khưu, bằng cách nào mà một tỳ khưu sống quán thân trên thân?”
Tattha kathañcātiādi vitthāretukamyatā pucchā.
Therein, the question beginning And how is a question indicating the desire to elaborate.
Nguyên tắc này cũng áp dụng cho tất cả các câu hỏi.
Ayaṃ panettha saṅkhepattho – bhikkhave, kena ca pakārena bhikkhu kāye kāyānupassī viharatīti?
Herein, this is the meaning in brief: Monks, in what way does a monk dwell contemplating the body in the body?
“Ở đây, này các tỳ khưu, một tỳ khưu” có nghĩa là: “Này các tỳ khưu, trong giáo pháp này, một tỳ khưu.”
Esa nayo sabbapucchāvāresu.
This is the method in all the question passages.
Ở đây, từ “idha” (ở đây) này chỉ rõ giáo pháp là nơi nương tựa cho người tu tập tất cả các loại quán thân, và phủ nhận khả năng đó ở các giáo pháp khác.
Idha, bhikkhave, bhikkhūti, bhikkhave, imasmiṃ sāsane bhikkhu.
Here, monks, a monk: monks, in this Teaching, a monk.
Vì đã nói: “Này các tỳ khưu, chỉ ở đây có sa môn… các giáo phái khác không có sa môn.”
Ayañhettha idha-saddo sabbappakārakāyānupassanānibbattakassa puggalassa sannissayabhūtasāsanaparidīpano aññasāsanassa tathābhāvapaṭisedhano ca.
Here, this word ‘here’ indicates the Teaching which is the supporting condition for the person who generates all kinds of contemplation of the body, and it negates such a state for other teachings.
Vì thế đã nói: “trong giáo pháp này, một tỳ khưu.”
Vuttañhetaṃ ‘‘idheva, bhikkhave, samaṇo…pe… suññā parappavādā samaṇebhi aññehī’’ti (ma. ni. 1.139).
For it has been said: “It is only here, monks, that there is a recluse… other creeds are void of recluses.”
“Đi vào rừng… hoặc đi vào nhà trống” điều này chỉ rõ việc chọn lựa chỗ ở phù hợp với sự tu tập niệm xứ của vị ấy.
Tena vuttaṃ ‘‘imasmiṃ sāsane bhikkhū’’ti.
Therefore, it is said, “in this Teaching, a monk.”
Vì tâm của vị tỳ khưu này, đã quen lan man trong các đối tượng sắc v.v. suốt thời gian dài, không muốn đi vào con đường thiền định (kammaṭṭhāna-vīthi), mà lại chạy lạc lối như cỗ xe kéo bởi con bò ương bướng. Do đó, ví như một người chăn bò, muốn thuần hóa con bê ương bướng đã lớn lên nhờ bú hết sữa từ con bò mẹ ương bướng, ông ta tách con bê khỏi bò mẹ, rồi đào một cây cột lớn ở một bên và buộc con bê vào đó bằng dây thừng. Sau đó, con bê ấy, dù vùng vẫy khắp nơi nhưng không thể chạy thoát, sẽ ngồi hoặc nằm xuống bên cạnh cây cột đó.
‘‘Araññagato vā…pe… suññāgāragato vā’’ti idamassa satipaṭṭhānabhāvanānurūpasenāsanapariggahaparidīpanaṃ.
“Gone to the forest… or gone to an empty place” indicates his taking up of a dwelling suitable for the development of the foundations of mindfulness.
Cũng vậy, vị tỳ khưu này, muốn thuần hóa tâm bất thiện đã lớn lên nhờ uống vị ngọt của các đối tượng sắc v.v. suốt thời gian dài, phải tách tâm khỏi các đối tượng sắc v.v., đưa tâm vào rừng, hoặc gốc cây, hoặc nhà trống, và ở đó, buộc tâm vào cây cột đối tượng niệm xứ bằng dây thừng chánh niệm.
Imassa hi bhikkhuno dīgharattaṃ rūpādīsu ārammaṇesu anuvisaṭaṃ cittaṃ kammaṭṭhānavīthiṃ otarituṃ na icchati, kūṭagoṇayuttaratho viya uppathameva dhāvati, tasmā seyyathāpi nāma gopo kūṭadhenuyā sabbaṃ khīraṃ pivitvā vaḍḍhitaṃ kūṭavacchaṃ dametukāmo dhenuto apanetvā ekamante mahantaṃ thambhaṃ nikhaṇitvā tattha yottena bandheyya.
Indeed, for this monk, the mind that has long been dispersed among objects such as sights does not wish to enter the path of the meditation subject; it runs off-track like a chariot yoked to a rogue ox. Therefore, just as a cowherd, wanting to tame a rogue calf that has grown up by drinking all the milk of a rogue cow, would lead it away from the cow, and in a secluded spot, after planting a large post, would tie it there with a rope.
Như vậy, tâm của vị ấy, dù vùng vẫy khắp nơi nhưng không tìm được đối tượng quen thuộc trước đây, và không thể cắt đứt dây thừng chánh niệm để chạy thoát, sẽ ngồi hoặc nằm xuống bên cạnh chính đối tượng đó, theo cách tiếp cận và nhập định (upacārappanā).
Athassa so vaccho ito cito ca vipphanditvā palāyituṃ asakkonto tameva thambhaṃ upanisīdeyya vā upanipajjeyya vā, evameva imināpi bhikkhunā dīgharattaṃ rūpārammaṇādirasapānavaḍḍhitaṃ duṭṭhacittaṃ dametukāmena rūpādiārammaṇato apanetvā araññaṃ vā rukkhamūlaṃ vā suññāgāraṃ vā pavesetvā tattha satipaṭṭhānārammaṇatthambhe satiyottena bandhitabbaṃ.
Then that calf of his, struggling this way and that but unable to escape, would sit down or lie down close to that very post. In the same way, this monk, wanting to tame the wicked mind that has grown strong from long drinking the flavor of sense-objects such as sights, should lead it away from those objects like sights, and having brought it into a forest, to the root of a tree, or to an empty place, should tie it there to the post of the object of the foundation of mindfulness with the rope of mindfulness.
Vì thế các bậc cổ xưa đã nói:
Evamassa taṃ cittaṃ ito cito ca vipphanditvāpi pubbe āciṇṇārammaṇaṃ alabhamānaṃ satiyottaṃ chinditvā palāyituṃ asakkontaṃ tamevārammaṇaṃ upacārappanāvasena upanisīdati ceva upanipajjati ca.
Thus, his mind, though struggling this way and that, unable to get its previously accustomed objects and unable to break the rope of mindfulness and escape, comes to sit down by and lie down by that very object by way of access and absorption concentration.
“Như người muốn thuần hóa con bê,
Tenāhu porāṇā –
Therefore the ancients said:
Buộc nó vào cột ở đây;
Apica yasmā idaṃ kāyānupassanāya muddhabhūtaṃ sabbabuddhapaccekabuddhabuddhasāvakānaṃ visesādhigamadiṭṭhadhammasukhavihārapadaṭṭhānaṃ ānāpānassatikammaṭṭhānaṃ itthipurisahatthiassādisaddasamākulaṃ gāmantaṃ apariccajitvā na sukaraṃ sampādetuṃ, saddakaṇṭakattā jhānassa.
Furthermore, because this meditation subject of mindfulness of breathing—which is the pinnacle of the contemplation of the body and the basis for the attainment of special qualities and for dwelling happily in the present life for all Buddhas, Paccekabuddhas, and disciples of the Buddha—is not easy to accomplish without leaving behind the vicinity of a village, which is crowded with the sounds of men, women, elephants, horses, and so on; since sound is a thorn to jhāna.
Hơn nữa, vì pháp thiền niệm hơi thở (ānāpānassatikammaṭṭhāna) này, là đỉnh cao của quán thân, là nền tảng cho sự thành tựu đặc biệt và sự sống an lạc trong hiện tại của tất cả chư Phật, chư Phật Độc Giác và chư Thanh Văn Phật, không dễ dàng đạt được nếu không từ bỏ khu vực làng mạc ồn ào với tiếng người, tiếng voi, tiếng ngựa v.v., vì tiếng ồn là chướng ngại cho thiền định.
Agāmake pana araññe sukaraṃ yogāvacarena idaṃ kammaṭṭhānaṃ pariggahetvā ānāpānacatutthajjhānaṃ nibbattetvā tadeva jhānaṃ pādakaṃ katvā saṅkhāre sammasitvā aggaphalaṃ arahattaṃ pāpuṇituṃ.
But in a forest without a village, it is easy for a meditator, having taken up this meditation subject, to generate the fourth jhāna of breathing, and making that very jhāna the basis, to contemplate the formations and attain the supreme fruit, Arahantship.
Nhưng trong rừng vắng làng, một hành giả có thể dễ dàng nắm giữ pháp thiền này, thành tựu Tứ Thiền hơi thở, lấy thiền đó làm nền tảng để quán chiếu các hành (saṅkhāra) và đạt đến quả tối thượng là A-la-hán.
Tasmāssa anurūpasenāsanaṃ dassento bhagavā ‘‘araññagato vā’’tiādimāha.
Therefore, the Blessed One, showing him a suitable dwelling, said, “Gone to the forest,” and so on.
Vì vậy, để chỉ ra chỗ ở phù hợp cho vị ấy, Thế Tôn đã nói: “Đi vào rừng” v.v.
Vatthuvijjācariyo viya hi bhagavā.
Indeed, the Blessed One is like an expert in site-lore.
Thế Tôn ví như một bậc thầy địa lý.
So yathā vatthuvijjācariyo nagarabhūmiṃ passitvā suṭṭhu upaparikkhitvā ‘‘ettha nagaraṃ māpethā’’ti upadisati, sotthinā ca nagare niṭṭhite rājakulato mahāsakkāraṃ labhati, evameva yogāvacarassa anurūpaṃ senāsanaṃ upaparikkhitvā ‘‘ettha kammaṭṭhānaṃ anuyuñjitabba’’nti upadisati.
Just as an expert in site-lore, having seen a site for a city and carefully inspected it, advises, “Build the city here,” and when the city is successfully completed, receives great honor from the royal family; in the same way, having inspected a suitable dwelling for a meditator, he advises, “The meditation subject should be practiced here.”
Như một bậc thầy địa lý sau khi xem xét kỹ lưỡng khu đất thành phố và chỉ dẫn: “Hãy xây thành phố ở đây,” và khi thành phố hoàn thành một cách an toàn, ông ta nhận được sự tôn kính lớn từ hoàng gia. Cũng vậy, Thế Tôn sau khi xem xét chỗ ở phù hợp cho hành giả, chỉ dẫn: “Hãy tinh tấn tu tập thiền định ở đây.”
Tato tattha kammaṭṭhānaṃ anuyuñjantena yoginā anukkamena arahatte patte ‘‘sammāsambuddho vata so bhagavā’’ti mahantaṃ sakkāraṃ labhati.
Then, when the yogī practicing the meditation subject there has, in due course, attained Arahantship, he receives great honor with the thought, “That Blessed One is truly a Perfectly Enlightened One.”
Sau đó, khi hành giả tu tập thiền định ở đó và tuần tự đạt đến A-la-hán, Thế Tôn nhận được sự tôn kính lớn với lời tán thán: “Thật là một bậc Chánh Đẳng Giác!”
Ayaṃ pana bhikkhu dīpisadisoti vuccati.
This monk, however, is said to be like a leopard.
Vị tỳ khưu này được ví như con hổ.
Yathā hi mahādīpirājā araññe tiṇagahanaṃ vā vanagahanaṃ vā pabbatagahanaṃ vā nissāya nilīyitvā vanamahiṃsagokaṇṇasūkarādayo mige gaṇhāti, evameva ayaṃ araññādīsu kammaṭṭhānaṃ anuyuñjanto bhikkhu yathākkamena cattāro magge ceva cattāri ariyaphalāni ca gaṇhāti.
Just as a great leopard king in the forest, relying on a grass thicket, a dense wood, or a mountain jungle, hides and catches wild animals such as wild buffaloes, gokaṇṇas, and boars, so too this bhikkhu, practicing a meditation subject in the forest and other such places, in due course obtains the four paths and the four noble fruits.
Như một chúa sơn lâm lớn, nương náu trong bụi cỏ rậm, rừng cây rậm, hay hang núi trong rừng, ẩn mình rồi bắt các loài thú như trâu rừng, nai sừng tấm, lợn rừng, v.v., cũng vậy, vị Tỳ-khưu này, khi thực hành đề mục thiền (kammaṭṭhāna) ở những nơi hoang dã, tuần tự đạt được bốn Đạo (magga) và bốn Thánh Quả (ariyaphala).
Tenāhu porāṇā –
Therefore, the ancients have said:
Vì thế, các bậc cổ đức đã nói:
Tassa pana imesaṃ ‘‘dīghaṃ vā assasanto dīghaṃ assasāmīti pajānāti…pe… passambhayaṃ kāyasaṅkhāraṃ passasissāmīti sikkhatī’’ti evaṃ vuttānaṃ assāsapassāsānaṃ vasena sikkhato assāsapassāsanimitte cattāri jhānāni uppajjanti.
For one practicing according to these in-breaths and out-breaths which were spoken of thus, "Breathing in long, he knows, 'I am breathing in long'... and so on... He trains himself, 'I will breathe out calming the bodily formation,'" the four jhānas arise in the in-breath and out-breath sign.
Từ đây trở đi, những gì cần nói trong phần Ānāpāna này đã được trình bày trong Thanh Tịnh Đạo (Visuddhimagga).
So jhānā vuṭṭhahitvā assāsapassāse vā pariggaṇhāti jhānaṅgāni vā.
Having emerged from jhāna, he comprehends either the in-breaths and out-breaths or the jhāna factors.
Tuy nhiên, khi vị ấy tu tập theo hơi thở vào và hơi thở ra như đã nói: “Khi thở vào dài, vị ấy biết: ‘Tôi thở vào dài’... v.v. ... ‘Tôi sẽ thở ra làm an tịnh thân hành’ (passambhayaṃ kāyasaṅkhāraṃ passasissāmīti sikkhati)” thì bốn thiền (jhāna) phát sinh nhờ tướng hơi thở vào và hơi thở ra (assāsapassāsanimitta).
Tattha assāsapassāsakammiko ‘‘ime assāsapassāsā kiṃ nissitā, vatthuṃ nissitā, vatthu nāma karajakāyo, karajakāyo nāma cattāri mahābhūtāni upādārūpañcā’’ti evaṃ rūpaṃ pariggaṇhāti, tato tadārammaṇe phassapañcamake nāmanti evaṃ nāmarūpaṃ pariggahetvā tassa paccayaṃ pariyesanto avijjādipaṭiccasamuppādaṃ disvā ‘‘paccayapaccayuppannadhammamattamevetaṃ, añño satto vā puggalo vā natthī’’ti vitiṇṇakaṅkho sappaccayanāmarūpe tilakkhaṇaṃ āropetvā vipassanaṃ vaḍḍhento anukkamena arahattaṃ pāpuṇāti.
Therein, one who works on in-breaths and out-breaths comprehends materiality thus: "On what do these in-breaths and out-breaths depend? They depend on the physical basis. The physical basis is the karajakāya. The karajakāya is the four great elements and derived matter." Then, he comprehends as mentality the five factors with contact at their head that have that materiality as their object. Having thus comprehended mentality and materiality, while searching for their cause, he sees the dependent origination starting with ignorance. Having crossed over doubt with the understanding, "This is merely a phenomenon that is a condition and a conditionally-arisen phenomenon; there is no other being or person," he applies the three characteristics to mentality-and-materiality-with-its-conditions. Developing insight, he gradually attains arahantship.
Vị ấy xuất khỏi thiền rồi nhận biết hơi thở vào và hơi thở ra, hoặc nhận biết các chi thiền (jhānaṅga). Trong đó, vị hành giả hơi thở vào và hơi thở ra (assāsapassāsakammika) nhận biết sắc (rūpa) như sau: “Hơi thở vào và hơi thở ra này nương vào cái gì? Chúng nương vào vật thể (vatthu). Vật thể chính là thân do nghiệp sinh (karajakāya). Thân do nghiệp sinh chính là bốn đại (mahābhūta) và các sắc y sinh (upādārūpa).” Từ đó, vị ấy nhận biết danh (nāma) là các pháp có xúc (phassa) đứng đầu, lấy sắc làm đối tượng. Sau khi nhận biết danh sắc như vậy, vị ấy tìm kiếm nguyên nhân của chúng, thấy được duyên khởi (paṭiccasamuppāda) bắt đầu từ vô minh (avijjā), rồi vượt qua mọi hoài nghi (vitiṇṇakaṅkha) với nhận thức: “Đây chỉ là các pháp duyên sinh và do duyên sinh, không có chúng sinh hay cá nhân nào khác.” Vị ấy áp đặt ba tướng (tilakkhaṇa) lên danh sắc có duyên (sappaccayanāmarūpa), phát triển tuệ quán (vipassanā) và tuần tự đạt đến A-la-hán (arahatta). Đây là con đường giải thoát đến A-la-hán cho một vị Tỳ-khưu.
Idaṃ ekassa bhikkhuno yāva arahattā niyyānamukhaṃ.
This is the way of deliverance up to arahantship for one bhikkhu.
Đây là con đường giải thoát đến A-la-hán cho một vị Tỳ-khưu.
Jhānakammikopi ‘‘imāni jhānaṅgāni kiṃ nissitāni, vatthuṃ nissitāni.
One who works on jhāna also determines mentality-materiality thus: "On what do these jhāna factors depend? They depend on the physical basis. The physical basis is the karajakāya." Thus the jhāna factors are mentality, and the karajakāya is materiality.
Vị hành giả thiền (jhānakammika) cũng vậy, nhận biết: “Các chi thiền này nương vào cái gì? Chúng nương vào vật thể. Vật thể chính là thân do nghiệp sinh.” Sau khi phân biệt danh là các chi thiền và sắc là thân do nghiệp sinh, vị ấy tìm kiếm nguyên nhân của chúng, thấy được duyên khởi bắt đầu từ vô minh, rồi vượt qua mọi hoài nghi với nhận thức: “Đây chỉ là các pháp duyên sinh và do duyên sinh, không có chúng sinh hay cá nhân nào khác.” Vị ấy áp đặt ba tướng lên danh sắc có duyên, phát triển tuệ quán và tuần tự đạt đến A-la-hán. Đây là con đường giải thoát đến A-la-hán cho một vị Tỳ-khưu.
Vatthu nāma karajakāyoti jhānaṅgāni nāmaṃ, karajakāyo rūpa’’nti nāmarūpaṃ vavatthapetvā tassa paccayaṃ pariyesanto avijjādipaccayākāraṃ disvā ‘‘paccayapaccayuppannadhammamattamevetaṃ, añño satto vā puggalo vā natthī’’ti vitiṇṇakaṅkho sappaccayanāmarūpe tilakkhaṇaṃ āropetvā vipassanaṃ vaḍḍhento anukkamena arahattaṃ pāpuṇāti, idaṃ ekassa bhikkhuno yāva arahattā niyyānamukhaṃ.
While searching for its cause, he sees the causal structure beginning with ignorance. Having crossed over doubt with the understanding, "This is merely a phenomenon that is a condition and a conditionally-arisen phenomenon; there is no other being or person," he applies the three characteristics to mentality-and-materiality-with-its-conditions. Developing insight, he gradually attains arahantship. This is the way of deliverance up to arahantship for one bhikkhu.
Vị hành giả thiền (jhānakammika) cũng vậy, nhận biết: “Các chi thiền này nương vào cái gì? Chúng nương vào vật thể. Vật thể chính là thân do nghiệp sinh.” Sau khi phân biệt danh là các chi thiền và sắc là thân do nghiệp sinh, vị ấy tìm kiếm nguyên nhân của chúng, thấy được duyên khởi bắt đầu từ vô minh, rồi vượt qua mọi hoài nghi với nhận thức: “Đây chỉ là các pháp duyên sinh và do duyên sinh, không có chúng sinh hay cá nhân nào khác.” Vị ấy áp đặt ba tướng lên danh sắc có duyên, phát triển tuệ quán và tuần tự đạt đến A-la-hán. Đây là con đường giải thoát đến A-la-hán cho một vị Tỳ-khưu.
Iti ajjhattaṃ vāti evaṃ attano vā assāsapassāsakāye kāyānupassī viharati.
Thus internally means: in this way, he abides contemplating the body in his own body of in-breaths and out-breaths.
Iti ajjhattaṃ vā có nghĩa là: Như vậy, vị ấy an trú quán thân trong chính thân hơi thở vào và hơi thở ra của mình.
Bahiddhā vāti parassa vā assāsapassāsakāye.
Or externally means: in another's body of in-breaths and out-breaths.
Bahiddhā vā có nghĩa là: Hoặc trong thân hơi thở vào và hơi thở ra của người khác.
Ajjhattabahiddhā vāti kālena attano, kālena parassa assāsapassāsakāye.
Or internally and externally means: at times in his own, at times in another's body of in-breaths and out-breaths.
Ajjhattabahiddhā vā có nghĩa là: Lúc thì trong thân hơi thở vào và hơi thở ra của mình, lúc thì của người khác.
Etenassa paguṇakammaṭṭhānaṃ aṭṭhapetvā aparāparaṃ sañcaraṇakālo kathito.
By this, the time for shifting back and forth after having made the meditation subject proficient is described.
Bằng cách này, thời gian để vị ấy chuyển đổi qua lại giữa các đề mục thiền đã thuần thục của mình được nói đến.
Ekasmiṃ kāle panidaṃ ubhayaṃ na labbhati.
But both of these cannot be attained at the same moment.
Tuy nhiên, cả hai điều này không thể xảy ra cùng một lúc.
Samudayadhammānupassī vāti yathā nāma kammārabhastañca gaggaranāḷiñca tajjañca vāyāmaṃ paṭicca vāto aparāparaṃ sañcarati, evaṃ bhikkhuno karajakāyañca nāsāpuṭañca cittañca paṭicca assāsapassāsakāyo aparāparaṃ sañcarati.
Or he abides contemplating origination-phenomena means: just as wind moves back and forth dependent on a blacksmith's bellows, the pipe, and the corresponding effort, so the body of in-breaths and out-breaths moves back and forth dependent on the bhikkhu's karajakāya, nostrils, and mind.
Samudayadhammānupassī vā có nghĩa là: Như hơi thở chuyển động qua lại nhờ vào ống thổi của thợ rèn, lò rèn và sự nỗ lực tương ứng, cũng vậy, thân hơi thở vào và hơi thở ra của vị Tỳ-khưu chuyển động qua lại nhờ vào thân do nghiệp sinh (karajakāya), lỗ mũi và tâm.
Kāyādayo dhammā samudayadhammā, te passanto ‘‘samudayadhammānupassī vā kāyasmiṃ viharatī’’ti vuccati.
The phenomena of the body and so on are origination-phenomena. Contemplating them, one is said to "abide contemplating origination-phenomena in the body."
Các pháp như thân, v.v., là các pháp tập khởi (samudayadhamma). Khi quán sát chúng, vị ấy được gọi là “an trú quán thân nơi thân như là các pháp tập khởi.”
Vayadhammānupassī vāti yathā bhastāya apanītāya gaggaranāḷiyā bhinnāya tajje ca vāyāme asati so vāto nappavattati, evameva kāye bhinne nāsāpuṭe viddhaste citte ca niruddhe assāsapassāsakāyo nāma nappavattatīti kāyādinirodhā assāsapassāsanirodhoti evaṃ passanto ‘‘vayadhammānupassī vā kāyasmiṃ viharatī’’ti vuccati.
Or he abides contemplating dissolution-phenomena means: just as when the bellows are removed, the pipe is broken, and the corresponding effort is absent, that wind does not arise, so too, when the body is broken, the nostrils are destroyed, and the mind has ceased, the body of in-breaths and out-breaths does not arise. Thus, contemplating that "the cessation of in-breaths and out-breaths is due to the cessation of the body and so on," one is said to "abide contemplating dissolution-phenomena in the body."
Vayadhammānupassī vā có nghĩa là: Như khi ống thổi được lấy đi, lò rèn bị vỡ, và không có sự nỗ lực tương ứng, hơi thở đó không còn hoạt động nữa, cũng vậy, khi thân bị hoại diệt, lỗ mũi bị tiêu tan, và tâm bị diệt, thân hơi thở vào và hơi thở ra không còn hoạt động nữa. Vì vậy, khi quán sát rằng sự diệt của hơi thở vào và hơi thở ra là do sự diệt của thân, v.v., vị ấy được gọi là “an trú quán thân nơi thân như là các pháp hoại diệt.”
Samudayavayadhammānupassī vāti kālena samudayaṃ, kālena vayaṃ anupassanto.
Or he abides contemplating origination-and-dissolution-phenomena means: contemplating origination at one time and dissolution at another.
Samudayavayadhammānupassī vā có nghĩa là: Lúc thì quán sát sự tập khởi, lúc thì quán sát sự hoại diệt.
Atthi kāyoti vā panassāti kāyova atthi, na satto, na puggalo, na itthī, na puriso, na attā, na attaniyaṃ, nāhaṃ, na mama, na koci, na kassacīti evamassa sati paccupaṭṭhitā hoti.
Or his mindfulness that 'there is a body' is established in this way: there is only a body, not a being, not a person, not a woman, not a man, not a self, not what belongs to a self, not 'I,' not 'mine,' not anyone, not anyone's.
Atthi kāyoti vā panassā có nghĩa là: Chỉ có thân (kāya) tồn tại, không có chúng sinh, không có cá nhân, không có đàn bà, không có đàn ông, không có tự ngã, không có cái thuộc về tự ngã, không phải tôi, không phải của tôi, không có ai, không thuộc về ai. Như vậy, chánh niệm (sati) của vị ấy được thiết lập.
Yāvadevāti payojanaparicchedavavatthāpanametaṃ.
Just is a determination defining the limit of the purpose.
Yāvadevā đây là sự xác định giới hạn của mục đích.
Idaṃ vuttaṃ hoti – yā sati paccupaṭṭhitā hoti, sā na aññatthāya.
This is what is meant: the mindfulness that is established is not for any other purpose.
Điều này có nghĩa là: Chánh niệm được thiết lập đó không vì mục đích nào khác.
Atha kho yāvadeva ñāṇamattāya aparāparaṃ uttaruttari ñāṇapamāṇatthāya ceva satipamāṇatthāya ca, satisampajaññānaṃ vuḍḍhatthāyāti attho.
Rather, it is just for the sake of knowledge, and for the progressive measure of higher and higher knowledge and the measure of mindfulness. The meaning is: for the growth of mindfulness and clear comprehension.
Mà chính là để đạt đến mức độ tuệ tri (ñāṇamatta), để tuệ tri ngày càng tăng trưởng, để chánh niệm ngày càng tăng trưởng, để chánh niệm và tỉnh giác (satisampajañña) được phát triển, đó là ý nghĩa.
Anissito ca viharatīti taṇhānissayadiṭṭhinissayānaṃ vasena anissito viharati.
And he abides independent means: he abides independent, by way of the dependence on craving and the dependence on views.
Anissito ca viharatī có nghĩa là: Vị ấy an trú không nương tựa (anissito) vào sự nương tựa của tham ái (taṇhānissaya) và sự nương tựa của tà kiến (diṭṭhinissaya).
Na ca kiñci loke upādiyatīti lokasmiṃ kiñci rūpaṃ vā…pe… viññāṇaṃ vā ‘‘ayaṃ me attā vā attaniyaṃ vā’’ti na gaṇhāti.
And he does not cling to anything in the world means: he does not grasp anything in the world—form, etc., up to consciousness—as "this is my self or what belongs to my self."
Na ca kiñci loke upādiyatī có nghĩa là: Trong thế gian, vị ấy không chấp thủ bất kỳ sắc (rūpa) nào… v.v. … hay thức (viññāṇa) nào là “đây là tự ngã của tôi hay cái thuộc về tự ngã của tôi.”
Evampīti upariatthaṃ upādāya sampiṇḍanattho pikāro.
In this way too: the particle 'pi' has the meaning of summing up, with reference to what is to be said further on.
Evampī có nghĩa là: Từ “pī” (cũng) ở đây có ý nghĩa tóm tắt, dựa trên ý nghĩa đã nói ở trên.
Iminā pana padena bhagavā ānāpānapabbadesanaṃ niyyātetvā dasseti.
With this phrase, the Blessed One indicates the conclusion of the discourse on the section of mindfulness of breathing.
Bằng từ này, Đức Thế Tôn đã kết thúc và trình bày bài thuyết giảng về phần Ānāpāna.
108. Evaṃ assāsapassāsavasena kāyānupassanaṃ vibhajitvā idāni iriyāpathavasena vibhajituṃ puna caparantiādimāha.
108. Having thus analyzed the contemplation of the body by way of in-breaths and out-breaths, now, in order to analyze it by way of postures, he said, "And further," and so on.
Sau khi phân tích sự quán thân (kāyānupassanā) theo hơi thở vào và hơi thở ra như vậy, bây giờ để phân tích theo oai nghi, Đức Thế Tôn đã nói: Puna caparaṃ (lại nữa), v.v.
Tattha kāmaṃ soṇasiṅgālādayopi gacchantā ‘‘gacchāmā’’ti jānanti.
Therein, it is true that even dogs, jackals, and so on know "we are going" when they are going.
Trong đó, các loài vật như chó, cáo, v.v., khi đi cũng biết: “Chúng tôi đang đi.”
Na panetaṃ evarūpaṃ jānanaṃ sandhāya vuttaṃ.
But this was not said with reference to such a kind of knowing.
Nhưng lời dạy này không đề cập đến sự hiểu biết như vậy.
Evarūpañhi jānanaṃ sattūpaladdhiṃ na pajahati, attasaññaṃ na ugghāṭeti, kammaṭṭhānaṃ vā satipaṭṭhānabhāvanā vā na hoti.
For such knowing does not abandon the apprehension of a being, does not remove the perception of a self, and does not constitute a meditation subject or the development of the establishment of mindfulness.
Bởi vì sự hiểu biết như vậy không đoạn trừ quan niệm về chúng sinh (sattūpaladdhi), không loại bỏ tà kiến về tự ngã (attasaññā), và không phải là đề mục thiền (kammaṭṭhāna) hay sự tu tập Tứ niệm xứ (satipaṭṭhānabhāvanā).
Imassa pana bhikkhuno jānanaṃ sattūpaladdhiṃ pajahati, attasaññaṃ ugghāṭeti, kammaṭṭhānañceva satipaṭṭhānabhāvanā ca hoti.
But the knowing of this bhikkhu abandons the apprehension of a being, removes the perception of a self, and constitutes both a meditation subject and the development of the establishment of mindfulness.
Tuy nhiên, sự hiểu biết của vị Tỳ-khưu này đoạn trừ quan niệm về chúng sinh, loại bỏ tà kiến về tự ngã, và là cả đề mục thiền lẫn sự tu tập Tứ niệm xứ.
Idañhi ‘‘ko gacchati, kassa gamanaṃ, kiṃ kāraṇā gacchatī’’ti evaṃ sampajānanaṃ sandhāya vuttaṃ.
For this was said with reference to clear comprehension thus: "Who goes? Whose going is it? For what reason does one go?"
Thật vậy, lời dạy này đề cập đến sự hiểu biết rõ ràng (sampajānana) như: “Ai đang đi? Sự đi của ai? Tại sao lại đi?”
Ṭhānādīsupi eseva nayo.
This same method applies to standing and so on.
Đối với các oai nghi đứng, v.v., cũng theo cách này.
Tattha ko gacchatīti na koci satto vā puggalo vā gacchati.
Therein, who goes?: no being or person goes.
Trong đó, Ai đang đi? Không có chúng sinh hay cá nhân nào đang đi.
Kassa gamananti na kassaci sattassa vā puggalassa vā gamanaṃ.
Whose going is it?: it is not the going of any being or person.
Sự đi của ai? Không phải sự đi của bất kỳ chúng sinh hay cá nhân nào.
Kiṃ kāraṇā gacchatīti cittakiriyavāyodhātuvipphārena gacchati.
For what reason does one go?: one goes by the impulse of the element of motion produced by the action of the mind.
Tại sao lại đi? Đi do sự vận hành của tâm và phong đại (vāyodhātu).
Tasmā esa evaṃ pajānāti ‘‘gacchāmī’’ti cittaṃ uppajjati, taṃ vāyaṃ janeti, vāyo viññattiṃ janeti, cittakiriyavāyodhātuvipphārena sakalakāyassa purato abhinīhāro gamananti vuccati.
Therefore, he understands thus: the thought, "I am walking," arises. That generates the air element. The air element generates the intimation (viññatti). The forward projection of the entire body through the diffusion of the mind-originated air element is called walking.
Do đó, hành giả ấy biết như vầy: "Ta sẽ đi" – tâm khởi lên, tâm ấy sinh ra phong đại (vāyo), phong đại sinh ra thân biểu tri (kāyaviññatti). Do sự lan tỏa của phong đại do tâm tạo tác, việc đưa toàn bộ thân về phía trước được gọi là đi.
Ṭhānādīsupi eseva nayo.
This same method applies to standing and so on.
Đối với sự đứng và các tư thế khác cũng theo cách này.
Tatrāpi hi ‘‘tiṭṭhāmī’’ti cittaṃ uppajjati, taṃ vāyaṃ janeti, vāyo viññattiṃ janeti, cittakiriyavāyodhātuvipphārena sakalakāyassa koṭito paṭṭhāya ussitabhāvo ṭhānanti vuccati.
For there, too, the thought, "I am standing," arises. That generates the air element. The air element generates the intimation. The state of being held upright, from the lower extremities of the whole body upwards, through the diffusion of the mind-originated air element is called standing.
Thật vậy, ở đó cũng vậy, "Ta sẽ đứng" – tâm khởi lên, tâm ấy sinh ra phong đại, phong đại sinh ra thân biểu tri. Do sự lan tỏa của phong đại do tâm tạo tác, việc toàn bộ thân được dựng thẳng từ phần dưới lên được gọi là đứng.
‘‘Nisīdāmī’’ti cittaṃ uppajjati, taṃ vāyaṃ janeti, vāyo viññattiṃ janeti, cittakiriyavāyodhātuvipphārena heṭṭhimakāyassa samiñjanaṃ uparimakāyassa ussitabhāvo nisajjāti vuccati.
The thought, "I am sitting," arises. That generates the air element. The air element generates the intimation. The bending of the lower body and the state of being held upright of the upper body, through the diffusion of the mind-originated air element is called sitting.
"Ta sẽ ngồi" – tâm khởi lên, tâm ấy sinh ra phong đại, phong đại sinh ra thân biểu tri. Do sự lan tỏa của phong đại do tâm tạo tác, việc phần thân dưới co lại và phần thân trên dựng thẳng được gọi là ngồi.
‘‘Sayāmī’’ti cittaṃ uppajjati, taṃ vāyaṃ janeti, vāyo viññattiṃ janeti, cittakiriyavāyodhātuvipphārena sakalasarīrassa tiriyato pasāraṇaṃ sayananti vuccatīti.
The thought, "I am lying down," arises. That generates the air element. The air element generates the intimation. The horizontal stretching out of the entire body through the diffusion of the mind-originated air element is called lying down.
"Ta sẽ nằm" – tâm khởi lên, tâm ấy sinh ra phong đại, phong đại sinh ra thân biểu tri. Do sự lan tỏa của phong đại do tâm tạo tác, việc toàn bộ thân được duỗi thẳng theo chiều ngang được gọi là nằm.
Tassa evaṃ pajānato evaṃ hoti ‘‘satto gacchati satto tiṭṭhatī’’ti vuccati.
To one who understands in this way, it occurs thus: "It is said, 'a being walks, a being stands.'"
Đối với người biết như vậy, có suy nghĩ rằng: "Chúng sinh đi, chúng sinh đứng" – đó là cách gọi.
Atthi pana koci satto gacchanto vā ṭhito vā natthi.
But is there any being whatsoever that walks or stands? There is not.
Nhưng thực ra, không có chúng sinh nào đang đi hay đang đứng cả.
Yathā pana ‘‘sakaṭaṃ gacchati sakaṭaṃ tiṭṭhatī’’ti vuccati, na ca kiñci sakaṭaṃ nāma gacchantaṃ vā tiṭṭhantaṃ vā atthi.
It is just like it is said, "the cart goes, the cart stands," but there is no such thing as a cart that goes or stands.
Cũng như người ta nói: "Cỗ xe đi, cỗ xe đứng", nhưng không có cỗ xe nào tự nó đang đi hay đang đứng cả.
Cattāro pana goṇe yojetvā chekamhi sārathimhi pājente ‘‘sakaṭaṃ gacchati sakaṭaṃ tiṭṭhatī’’ti vohāramattameva hoti, evameva ajānanaṭṭhena sakaṭaṃ viya kāyo.
Rather, when four oxen are yoked and driven by a skilled charioteer, it is merely a conventional expression to say "the cart goes, the cart stands." In the same way, the body is like the cart, in the sense of being inanimate.
Khi bốn con bò được thắng vào xe và người đánh xe khéo léo điều khiển, thì chỉ là một cách gọi rằng: "Cỗ xe đi, cỗ xe đứng". Cũng vậy, thân này giống như cỗ xe, vì nó không có sự hiểu biết.
Goṇā viya cittajavātā.
The mind-born winds are like the oxen.
Các luồng gió do tâm sinh ra giống như những con bò.
Sārathi viya cittaṃ.
The mind is like the charioteer.
Tâm giống như người đánh xe.
Gacchāmi tiṭṭhāmīti citte uppanne vāyodhātu viññattiṃ janayamānā uppajjati, cittakiriyavāyodhātuvipphārena gamanādīni pavattanti.
When the thought, "I will walk, I will stand," arises, the air element arises, generating the intimation. Through the diffusion of the mind-originated air element, walking and other postures occur.
Khi tâm "Ta sẽ đi, ta sẽ đứng" khởi lên, phong đại sinh ra thân biểu tri và khởi lên. Do sự lan tỏa của phong đại do tâm tạo tác, các hành động đi lại và các tư thế khác diễn ra.
Tato ‘‘satto gacchati, satto tiṭṭhati, ahaṃ gacchāmi, ahaṃ tiṭṭhāmī’’ti vohāramattaṃ hotīti.
From that, it is merely a conventional expression to say, "a being walks, a being stands; I walk, I stand."
Từ đó, chỉ là một cách gọi rằng: "Chúng sinh đi, chúng sinh đứng, tôi đi, tôi đứng".
Tenāha –
Therefore it is said:
Vì vậy, Đức Phật đã dạy:
Yathā yathā vā panassa kāyo paṇihito hoti, tathā tathā naṃ pajānātīti sabbasaṅgāhikavacanametaṃ.
The phrase, "And in whatever way his body is disposed, he knows it in that way," is an all-inclusive statement.
Vậy chúng sinh nào ở đây, có thể đứng hay đi bằng sức mạnh của mình, mà không cần nhân duyên?
Idaṃ vuttaṃ hoti – yena yena vā ākārena tassa kāyo ṭhito hoti, tena tena naṃ pajānāti.
This is what is meant: in whatever mode his body is positioned, he knows it in that way.
Do đó, hành giả ấy quán sát các hành động đi lại và các tư thế khác diễn ra do nhân duyên như vậy, và biết rằng: khi đi thì biết "ta đi", khi đứng thì biết "ta đứng", khi ngồi thì biết "ta ngồi", khi nằm thì biết "ta nằm".
Gamanākārena ṭhitaṃ gacchatīti pajānāti.
He knows that which is in the mode of walking as "he is walking."
"Hay thân của người ấy được đặt ở tư thế nào, thì người ấy biết tư thế ấy" – đây là một lời nói bao quát tất cả.
Ṭhānanisajjāsayanākārena ṭhitaṃ sayānoti pajānātīti.
He knows that which is in the mode of standing, sitting, or lying down as "he is lying down."
Điều này có nghĩa là: thân của người ấy ở trong tư thế nào, thì người ấy biết tư thế ấy.
Iti ajjhattaṃ vāti evaṃ attano vā catuiriyāpathapariggaṇhanena kāye kāyānupassī viharati.
Thus internally... In this way, by comprehending the four postures in himself, he dwells contemplating the body in the body.
Khi thân ở tư thế đi, thì biết là đang đi.
Bahiddhā vāti parassa vā catuiriyāpathapariggaṇhanena.
Or externally... by comprehending the four postures in another.
Khi thân ở tư thế đứng, ngồi, nằm, thì biết là đang nằm.
Ajjhattabahiddhā vāti kālena attano, kālena parassa catuiriyāpathapariggaṇhanena kāye kāyānupassī viharati.
Or internally and externally... at times in himself, at times in another, by comprehending the four postures, he dwells contemplating the body in the body.
"Như vậy, vị ấy an trú quán thân trên nội thân" – tức là, vị ấy an trú quán thân trên thân mình bằng cách quán sát bốn oai nghi.
Samudayadhammānupassī vātiādīsu pana ‘‘avijjāsamudayā rūpasamudayo’’tiādinā (paṭi. ma. 1.49) nayena pañcahākārehi rūpakkhandhassa samudayo ca vayo ca nīharitabbo.
Furthermore, in the phrases "contemplating origination-dharmas..." and so on, the origination and passing away of the aggregate of material form should be brought out in five ways according to the method of "with the origination of ignorance, there is the origination of material form," and so on.
"Hay trên ngoại thân" – tức là, quán sát bốn oai nghi của người khác.
Tañhi sandhāya idha ‘‘samudayadhammānupassī vā’’tiādi vuttaṃ.
For it is with reference to that, that it is said here "contemplating origination-dharmas..." and so on.
"Hay trên nội thân và ngoại thân" – tức là, lúc thì quán sát bốn oai nghi của mình, lúc thì quán sát bốn oai nghi của người khác, vị ấy an trú quán thân trên thân.
Atthi kāyoti vā panassātiādi vuttasadisameva.
Or his mindfulness that 'there is a body'... and so on is just as has been described.
Trong các câu "Vị ấy an trú quán pháp tập khởi" v.v., cần phải trình bày sự tập khởi và sự hoại diệt của sắc uẩn theo năm phương diện, như đã nói trong "Avijjāsamudayā rūpasamudayo" (Pati. Ma. 1.49) v.v.
109. Evaṃ iriyāpathavasena kāyānupassanaṃ vibhajitvā idāni catusampajaññavasena vibhajituṃ puna caparantiādimāha.
109. Having thus analyzed the contemplation of the body by way of the postures, he now says "And further..." and so on, in order to analyze it by way of the four kinds of clear comprehension.
Như vậy, sau khi đã giải thích sự quán thân theo oai nghi, bây giờ để giải thích theo bốn loại chánh tri kiến, Đức Phật đã nói "Puna caparaṃ" (Hơn nữa, này các Tỳ-khưu) v.v.
Tattha abhikkante paṭikkanteti ettha tāva abhikkantaṃ vuccati gamanaṃ.
Therein, in the phrase "in going forward, in returning," first, "going forward" is called going.
Trong đó, "abhikkante paṭikkante" (khi đi tới, khi đi lui), ở đây, "abhikkantaṃ" được gọi là đi tới.
Paṭikkantaṃ nivattanaṃ.
"Returning" is turning back.
"Paṭikkantaṃ" là đi lui.
Tadubhayampi catūsu iriyāpathesu labbhati.
Both of these are found in the four postures.
Cả hai điều này đều có trong bốn oai nghi.
Gamane tāva purato kāyaṃ abhiharanto abhikkamati nāma.
First, in walking, when one moves the body forward, it is called "going forward."
Trong oai nghi đi, khi thân được đưa về phía trước thì gọi là "abhikkamati" (đi tới).
Paṭinivattento paṭikkamati nāma.
When turning back, it is called "returning."
Khi thân được đưa về phía sau thì gọi là "paṭikkamati" (đi lui).
Ṭhānepi ṭhitakova kāyaṃ purato onāmento abhikkamati nāma.
In standing, too, while still standing, bending the body forward is called going forward.
Trong oai nghi đứng, khi thân đang đứng mà nghiêng về phía trước thì gọi là đi tới.
Pacchato apanāmento paṭikkamati nāma.
Drawing it backward is called returning.
Khi thân được đưa về phía sau thì gọi là đi lui.
Nisajjāyapi nisinnakova āsanassa purimaaṅgābhimukho saṃsaranto abhikkamati nāma.
In sitting, too, while still seated, moving towards the front part of the seat is called going forward.
Trong oai nghi ngồi, khi đang ngồi mà dịch chuyển về phía trước của chỗ ngồi thì gọi là đi tới.
Pacchimaaṅgappadesaṃ pacchā saṃsaranto paṭikkamati nāma.
Moving backward towards the back part of the seat is called returning.
Khi dịch chuyển về phía sau của chỗ ngồi thì gọi là đi lui.
Nipajjāyapi eseva nayo.
This same method applies to lying down.
Trong oai nghi nằm cũng theo cách này.
Sampajānakārī hotīti sampajaññena sabbakiccakārī, sampajaññameva vā kārī.
One acts with clear comprehension means one who performs all actions with clear comprehension, or one who simply makes clear comprehension.
"Sampajānakārī hoti" (vị ấy hành động với chánh tri kiến) có nghĩa là vị ấy hành động mọi việc với chánh tri kiến, hoặc chỉ hành động chánh tri kiến.
So hi abhikkantādīsu sampajaññaṃ karoteva, na katthaci sampajaññavirahito hoti.
For he indeed applies clear comprehension in going forward and so on; he is never devoid of clear comprehension in any instance.
Vì vị ấy luôn thực hành chánh tri kiến trong các hành động đi tới v.v., không bao giờ thiếu chánh tri kiến.
Tattha sātthakasampajaññaṃ sappāyasampajaññaṃ gocarasampajaññaṃ asammohasampajaññanti catubbidhaṃ sampajaññaṃ.
Therein, clear comprehension is fourfold: clear comprehension of purpose, clear comprehension of suitability, clear comprehension of the resort, and clear comprehension of non-delusion.
Ở đây, có bốn loại chánh tri kiến: chánh tri kiến về mục đích (sātthakasampajañña), chánh tri kiến về sự thích hợp (sappāyasampajañña), chánh tri kiến về cảnh giới (gocarasampajañña), và chánh tri kiến về sự không lầm lẫn (asammohasampajañña).
Tattha abhikkamanacitte uppanne cittavaseneva agantvā ‘‘kiṃ nu me ettha gatena attho atthi natthī’’ti atthānatthaṃ pariggaṇhitvā atthapariggahaṇaṃ sātthakasampajaññaṃ.
Therein, when the thought to go forward arises, instead of just going according to the impulse of the thought, one considers the purpose and lack of purpose, thinking, "Is there any purpose for me in going there, or not?" Grasping the purpose is clear comprehension of purpose.
Trong đó, khi tâm muốn đi tới khởi lên, không đi ngay theo ý muốn của tâm, mà quán xét "việc đi đến đây có lợi ích gì cho ta không, hay không có lợi ích gì?", sau khi đã quán xét lợi ích và bất lợi, việc nắm bắt lợi ích được gọi là chánh tri kiến về mục đích (sātthakasampajañña).
Tattha ca atthoti cetiyadassanabodhidassanasaṅghadassanatheradassanaasubhadassanādivasena dhammato vaḍḍhi.
And therein, "purpose" means growth in the Dhamma through seeing a cetiya, seeing a Bodhi tree, seeing the Saṅgha, seeing an elder, seeing an object for meditation on foulness, and so on.
Ở đây, lợi ích là sự tăng trưởng về mặt Pháp, như việc chiêm bái tháp thờ, chiêm bái cây Bồ-đề, chiêm bái Tăng, chiêm bái các vị Trưởng lão, quán bất tịnh v.v.
Cetiyaṃ vā bodhiṃ vā disvāpi hi buddhārammaṇaṃ saṅghadassanena saṅghārammaṇaṃ pītiṃ uppādetvā tadeva khayavayato sammasanto arahattaṃ pāpuṇāti.
For, on seeing a cetiya or a Bodhi tree, one can arouse joy with the Buddha as the object, or with the Saṅgha as the object on seeing the Saṅgha, and by contemplating that very joy in terms of decay and passing away, one can attain Arahantship.
Thật vậy, sau khi chiêm bái tháp thờ hay cây Bồ-đề, vị ấy khởi lên niềm hoan hỷ đối với Đức Phật, hoặc sau khi chiêm bái Tăng, vị ấy khởi lên niềm hoan hỷ đối với Tăng. Khi quán sát niềm hoan hỷ ấy theo sự sinh diệt, vị ấy đạt đến A-la-hán.
There disvā tesaṃ ovāde patiṭṭhāya asubhaṃ disvā tattha paṭhamajjhānaṃ uppādetvā tadeva khayavayato sammasanto arahattaṃ pāpuṇāti.
On seeing elders, by establishing oneself in their advice, or on seeing a foul object, by arousing the first jhāṇa based on it and contemplating that very jhāṇa in terms of decay and passing away, one can attain Arahantship.
Sau khi chiêm bái các vị Trưởng lão và an trú trong lời giáo huấn của các vị ấy, hoặc sau khi quán bất tịnh và khởi lên sơ thiền trên cảnh giới bất tịnh ấy, khi quán sát sơ thiền ấy theo sự sinh diệt, vị ấy đạt đến A-la-hán.
Tasmā etesaṃ dassanaṃ sātthakaṃ.
Therefore, seeing these things has a purpose.
Do đó, việc chiêm bái những điều này là có lợi ích.
Keci pana ‘‘āmisatopi vaḍḍhi atthoyeva, taṃ nissāya brahmacariyānuggahāya paṭipannattā’’ti vadanti.
Some, however, say, "Growth even in material things is also a purpose, because one has undertaken the practice for the support of the holy life based on them."
Một số vị lại nói: "Sự tăng trưởng về mặt vật chất cũng là lợi ích, vì nương vào đó để hỗ trợ cho Phạm hạnh".
Tasmiṃ pana gamane sappāyāsappāyaṃ pariggaṇhitvā sappāyapariggahaṇaṃ sappāyasampajaññaṃ.
Furthermore, in that act of going, having discerned what is suitable and unsuitable, the grasping of what is suitable is clear comprehension of suitability.
Trong việc đi ấy, sau khi quán xét sự thích hợp và không thích hợp, việc nắm bắt sự thích hợp được gọi là chánh tri kiến về sự thích hợp (sappāyasampajañña).
Seyyathidaṃ, cetiyadassanaṃ tāva sātthakaṃ.
For instance, the viewing of a cetiya, for one, is purposeful.
Ví dụ, việc chiêm bái tháp thờ là có lợi ích.
Sace pana cetiyassa mahāpūjāya dasadvādasayojanantare parisā sannipatanti.
But if, for a great festival at the cetiya, an assembly gathers from ten or twelve yojanas away,
Nhưng nếu có một lễ hội lớn tại tháp thờ, nơi quần chúng tụ tập từ mười đến mười hai dojana.
Attano vibhavānurūpaṃ itthiyopi purisāpi alaṅkatappaṭiyattā cittakammarūpakāni viya sañcaranti.
and both women and men, adorned and prepared according to their means, move about like painted figures,
Đàn ông và phụ nữ, tùy theo khả năng của mình, trang điểm lộng lẫy, đi lại như những bức tượng vẽ.
Tatra cassa iṭṭhe ārammaṇe lobho, aniṭṭhe paṭigho, asamapekkhane moho uppajjati, kāyasaṃsaggāpattiṃ vā āpajjati, jīvitabrahmacariyānaṃ vā antarāyo hoti, evaṃ taṃ ṭhānaṃ asappāyaṃ hoti.
There, with a desirable object, greed arises in him; with an undesirable one, aversion; with improper looking, delusion arises. Or he falls into an offense of bodily contact, or there is a danger to his life or the holy life. In this way, that place is unsuitable.
Và ở đó, nếu đối với cảnh ưa thích, tham (lobha) khởi lên; đối với cảnh không ưa thích, sân (paṭigha) khởi lên; đối với sự không quán xét đúng đắn, si (moha) khởi lên; hoặc phạm giới thân xúc chạm (kāyasaṃsagga), hoặc có chướng ngại cho mạng sống hay phạm hạnh (brahmacariya), thì nơi đó là không thích hợp (asappāya).
Vuttappakāraantarāyābhāve sappāyaṃ.
In the absence of the dangers described, it is suitable.
Nếu không có các chướng ngại đã nói trên, thì nơi đó là thích hợp (sappāya).
Bodhidassanepi eseva nayo.
This same method applies also to the seeing of a Bodhi tree.
Đối với việc chiêm ngưỡng cây Bồ-đề (Bodhi) cũng vậy.
Saṅghadassanampi sātthaṃ.
The seeing of the Saṅgha is also purposeful.
Việc chiêm ngưỡng Tăng đoàn (Saṅgha) cũng có lợi ích.
Sace pana antogāme mahāmaṇḍapaṃ kāretvā sabbarattiṃ dhammassavanaṃ kārentesu manussesu vuttappakāreneva janasannipāto ceva antarāyo ca hoti, evaṃ taṃ ṭhānaṃ asappāyaṃ.
But if, in a village, people have a great pavilion constructed and have the Dhamma listened to all night, and a crowd of people gathers and danger arises in the way described, then that place is unsuitable.
Tuy nhiên, nếu trong làng, người ta dựng một đại sảnh (mahāmaṇḍapa) và tổ chức nghe pháp suốt đêm, mà sự tụ tập đông người và chướng ngại như đã nói trên xảy ra, thì nơi đó là không thích hợp (asappāya).
Antarāyābhāve sappāyaṃ.
In the absence of danger, it is suitable.
Nếu không có chướng ngại, thì nơi đó là thích hợp (sappāya).
Mahāparisaparivārānaṃ therānaṃ dassanepi eseva nayo.
This same method applies also to seeing elders who are surrounded by a large following.
Đối với việc chiêm ngưỡng các Trưởng lão (Thera) với đại chúng tùy tùng cũng vậy.
Asubhadassanampi sātthaṃ.
Seeing an asubha is also purposeful.
Việc quán niệm bất tịnh (asubha) cũng có lợi ích.
Tadatthadīpanatthañca idaṃ vatthu – eko kira daharabhikkhu sāmaṇeraṃ gahetvā dantakaṭṭhatthāya gato.
And to illustrate the purpose of that, here is a story: A certain young bhikkhu, it is said, took a novice and went to get a tooth-stick.
Và để làm rõ điều này, có câu chuyện sau: Một vị Tỳ-khưu trẻ nọ, cùng với một Sa-di, đi tìm cây xỉa răng.
Sāmaṇero maggā okkamitvā purato gacchanto asubhaṃ disvā paṭhamajjhānaṃ nibbattetvā tadeva pādakaṃ katvā saṅkhāre sammasanto tīṇi phalāni sacchikatvā uparimaggatthāya kammaṭṭhānaṃ pariggahetvā aṭṭhāsi.
The novice, stepping off the path and walking ahead, saw an asubha, produced the first jhāna, and making just that the basis, while contemplating the formations, he realized the three lower fruits and stood there, having taken up the meditation subject for the sake of the highest path.
Vị Sa-di rời đường, đi phía trước, thấy một vật bất tịnh (asubha), liền phát khởi sơ thiền (paṭhamajjhāna), lấy đó làm nền tảng, quán xét các hành (saṅkhāra), chứng đắc ba quả vị, rồi trụ lại để tiếp tục tu tập thiền đề (kammaṭṭhāna) cho các đạo quả cao hơn.
Daharo taṃ apassanto ‘‘sāmaṇerā’’ti pakkosi.
The young bhikkhu, not seeing him, called out, "Novice!"
Vị Tỳ-khưu trẻ không thấy Sa-di, liền gọi: “Này Sa-di!”
So ‘‘mayā pabbajitadivasato paṭṭhāya bhikkhunā saddhiṃ dve kathā nāma na kathitapubbā.
He thought, "From the day of my going forth, I have never spoken two words with a bhikkhu.
Vị ấy nghĩ: “Từ ngày ta xuất gia đến nay, ta chưa từng nói hai lời với một vị Tỳ-khưu.
Aññasmimpi divase uparivisesaṃ nibbattessāmī’’ti cintetvā ‘‘kiṃ, bhante’’ti paṭivacanaṃ adāsi.
I will produce the higher attainment on another day," and he replied, "What is it, Bhante?"
Vào một ngày khác, ta sẽ chứng đắc các pháp đặc biệt cao hơn,” rồi đáp: “Bạch Đại đức, có việc gì ạ?”
Ehīti ca vutte ekavacaneneva āgantvā ‘‘bhante, iminā tāva maggena gantvā mayā ṭhitokāse muhuttaṃ puratthābhimukho ṭhatvā olokethā’’ti āha.
And when told, "Come," he came with just that one word and said, "Bhante, please go by this path for a little while, and at the place where I was standing, stand facing east and look."
Khi được gọi “Hãy đến đây!”, vị ấy liền đến chỉ với một lời, rồi nói: “Bạch Đại đức, xin Đại đức hãy đi theo con đường này, đứng một lát ở chỗ con đã đứng, và nhìn về hướng đông.”
So tathā katvā tena pattavisesameva pāpuṇi.
He did so and attained the very same special attainment that the novice had.
Vị ấy làm theo như vậy và cũng chứng đắc được những pháp đặc biệt mà vị Sa-di đã chứng đắc.
Evaṃ ekaṃ asubhaṃ dvinnaṃ janānaṃ atthāya jāyati.
Thus, one asubha was for the benefit of two people.
Như vậy, một vật bất tịnh (asubha) đã mang lại lợi ích cho cả hai người.
Evaṃ sātthampi panetaṃ purisassa mātugāmāsubhaṃ asappāyaṃ.
Although it is purposeful in this way, for a man, the asubha of a woman is unsuitable.
Tuy nhiên, đối với một người đàn ông, việc quán niệm bất tịnh của phụ nữ (mātugāmāsubha) là không thích hợp (asappāya), dù nó có lợi ích.
Mātugāmassa ca purisāsubhaṃ sabhāgameva sappāyanti evaṃ sappāyapariggahaṇaṃ sappāyasampajaññaṃ nāma.
And for a woman, the asubha of a man is unsuitable; only one of the same nature is suitable. Thus, the grasping of what is suitable is called sappāya-sampajañña.
Và đối với một phụ nữ, việc quán niệm bất tịnh của đàn ông (purisāsubha) là không thích hợp; chỉ những gì cùng giới tính mới là thích hợp (sappāya). Sự nắm giữ những gì thích hợp như vậy được gọi là Sappāyasampajañña (chánh tri kiến về sự thích hợp).
Evaṃ pariggahitasātthasappāyassa pana aṭṭhatiṃsāya kammaṭṭhānesu attano cittarucitakammaṭṭhānasaṅkhātaṃ gocaraṃ uggahetvā bhikkhācāragocare taṃ gahetvā gamanaṃ gocarasampajaññaṃ nāma.
Now, for one who has thus grasped what is purposeful and suitable, the act of learning a gocara, that is, a meditation subject that is pleasing to his mind from among the thirty-eight meditation subjects, and going to the alms-round resort while holding onto it, is called gocara-sampajañña.
Sau khi đã nắm giữ được những điều có lợi ích và thích hợp như vậy, việc chọn một đề mục thiền (kammaṭṭhāna) phù hợp với tâm ý của mình trong số ba mươi tám đề mục thiền, và mang theo đề mục đó khi đi khất thực (bhikkhācāra-gocara) được gọi là Gocarasampajañña (chánh tri kiến về cảnh giới).
Tassāvibhāvatthaṃ idaṃ catukkaṃ veditabbaṃ.
To make this clear, this tetrad should be understood.
Để làm rõ điều này, cần hiểu về bốn loại sau đây.
Idhekacco bhikkhu harati na paccāharati, ekacco na harati paccāharati, ekacco neva harati na paccāharati, ekacco harati ca paccāharati ca.
Here, a certain bhikkhu carries but does not bring back; a certain one does not carry but brings back; a certain one neither carries nor brings back; and a certain one both carries and brings back.
Ở đây, một số Tỳ-khưu chỉ mang đi mà không mang về; một số thì không mang đi mà chỉ mang về; một số thì không mang đi cũng không mang về; một số thì vừa mang đi vừa mang về.
Tattha yo bhikkhu divasaṃ caṅkamena nisajjāya āvaraṇīyehi dhammehi cittaṃ parisodhetvā tathā rattiyā paṭhamaṃ yāmaṃ majjhime yāme seyyaṃ kappetvā pacchimayāmepi nisajjācaṅkamehi vītināmetvā pageva cetiyaṅgaṇabodhiyaṅgaṇavattaṃ katvā bodhirukkhe udakaṃ abhisiñcitvā pānīyaṃ paribhojanīyaṃ paccupaṭṭhapetvā ācariyupajjhāyavattādīni sabbāni khandhakavattāni samādāya vattati.
Therein, there is the bhikkhu who, having purified his mind from the hindrances during the day through walking and sitting, and likewise through the first watch of the night, having arranged his bedding in the middle watch, and having spent the last watch also with sitting and walking, very early in the morning performs the duties of the cetiya-courtyard and the Bodhi-courtyard, pours water on the Bodhi tree, sets out drinking water and water for use, and lives having undertaken all the duties of the Khandhakas, such as the duties towards his teacher and preceptor.
Trong số đó, vị Tỳ-khưu nào ban ngày tịnh hóa tâm mình khỏi các pháp chướng ngại (āvaraṇīya dhamma) bằng cách đi kinh hành (caṅkama) và ngồi thiền (nisajjā), rồi ban đêm cũng vậy, dành canh đầu để tu tập, canh giữa nghỉ ngơi, và canh cuối cũng trải qua bằng cách ngồi thiền và đi kinh hành; sáng sớm làm các phận sự tại sân tháp (cetiyaṅgaṇa) và sân Bồ-đề (bodhiyaṅgaṇa), tưới nước cho cây Bồ-đề, chuẩn bị nước uống và nước dùng, và thực hành tất cả các phận sự thuộc Khandhaka như phận sự đối với thầy bổn sư (ācariya) và thầy y chỉ (upajjhāya).
So sarīraparikammaṃ katvā senāsanaṃ pavisitvā dve tayo pallaṅke usumaṃ gāhāpento kammaṭṭhānaṃ anuyuñjitvā bhikkhācāravelāya uṭṭhahitvā kammaṭṭhānasīseneva pattacīvaramādāya senāsanato nikkhamitvā kammaṭṭhānaṃ manasikarontova cetiyaṅgaṇaṃ gantvā sace buddhānussatikammaṭṭhānaṃ hoti, taṃ avissajjetvāva cetiyaṅgaṇaṃ pavisati.
Having taken care of his body, he enters his dwelling, and while generating warmth through two or three sitting sessions, he applies himself to his meditation subject. At the time for the alms-round, he gets up, takes his bowl and robe with the meditation subject at the forefront, leaves his dwelling, and while still paying attention to the meditation subject, he goes to the cetiya-courtyard. If his meditation subject is buddhānussati, he enters the cetiya-courtyard without letting go of it.
Vị ấy sau khi vệ sinh thân thể, vào chỗ ở, ngồi kiết già hai hoặc ba lần để làm ấm người, tinh tấn tu tập đề mục thiền (kammaṭṭhāna), rồi đến giờ khất thực thì đứng dậy, mang y bát với tâm chuyên chú vào đề mục thiền, rời chỗ ở, và đi đến sân tháp (cetiyaṅgaṇa) vẫn với tâm quán niệm đề mục thiền. Nếu đó là đề mục Phật tùy niệm (Buddhānussati kammaṭṭhāna), vị ấy không từ bỏ nó mà đi vào sân tháp.
Aññaṃ ce kammaṭṭhānaṃ hoti, sopānapādamūle ṭhatvā hatthena gahitabhaṇḍaṃ viya taṃ ṭhapetvā buddhārammaṇaṃ pītiṃ gahetvā cetiyaṅgaṇaṃ āruyha mahantaṃ cetiyaṃ ce, tikkhattuṃ padakkhiṇaṃ katvā catūsu ṭhānesu vanditabbaṃ.
If it is another meditation subject, he stands at the foot of the stairs and, as if setting down an object held in his hand, he puts that aside, takes up the joy with the Buddha as its object, and ascends to the cetiya-courtyard. If the cetiya is large, he should circumambulate it three times and pay homage at four places.
Nếu là đề mục thiền khác, vị ấy đứng ở chân cầu thang, như thể đặt một vật cầm trong tay, đặt đề mục thiền đó sang một bên, rồi lấy niềm hoan hỷ (pīti) với Đức Phật làm đề mục, bước lên sân tháp. Nếu là một đại tháp, vị ấy đi nhiễu ba vòng và lễ bái ở bốn chỗ.
Khuddakaṃ cetiyaṃ ce, tatheva padakkhiṇaṃ katvā aṭṭhasu ṭhānesu vanditabbaṃ.
If the cetiya is small, he should circumambulate it in the same way and pay homage at eight places.
Nếu là một tháp nhỏ, vị ấy cũng đi nhiễu như vậy và lễ bái ở tám chỗ.
Cetiyaṃ vanditvā bodhiyaṅgaṇaṃ pattenāpi buddhassa bhagavato sammukhā viya nipaccakāraṃ dassetvā bodhi vanditabbo.
Having paid homage to the cetiya, upon reaching the Bodhi-courtyard, he should also pay homage to the Bodhi tree, showing reverence as if in the presence of the Blessed One, the Buddha.
Sau khi lễ bái tháp (cetiya), khi đến sân Bồ-đề (bodhiyaṅgaṇa), vị ấy cũng nên lễ bái cây Bồ-đề như thể đang đối diện với Đức Thế Tôn.
So evaṃ cetiyañca bodhiñca vanditvā paṭisāmitaṭṭhānaṃ gantvā paṭisāmitabhaṇḍakaṃ hatthena gaṇhanto viya nikkhittakammaṭṭhānaṃ gahetvā gāmasamīpe kammaṭṭhānasīseneva cīvaraṃ pārupitvā gāmaṃ piṇḍāya pavisati.
Thus, having paid homage to the cetiya and the Bodhi tree, he goes to the place where he had set it aside and, like picking up a stored object with his hand, he takes up the meditation subject he had laid down. Near the village, with the meditation subject at the forefront, he puts on his robe and enters the village for alms.
Vị ấy sau khi lễ bái tháp và cây Bồ-đề như vậy, đi đến chỗ cất giữ đồ, như thể cầm lại vật đã cất, lấy lại đề mục thiền đã đặt sang một bên, rồi gần làng, đắp y với tâm chuyên chú vào đề mục thiền, và đi vào làng khất thực.
Atha naṃ manussā disvā ‘‘ayyo no āgato’’ti paccuggantvā pattaṃ gahetvā āsanasālāyaṃ vā gehe vā nisīdāpetvā yāguṃ datvā yāva bhattaṃ na niṭṭhāti, tāva pāde dhovitvā telena makkhetvā purato nisīditvā pañhaṃ vā pucchanti, dhammaṃ vā sotukāmā honti.
Then, seeing him, the people say, "Our noble one has come," go to meet him, take his bowl, and having seated him in a rest-house or in a house, they give him gruel. Until the meal is finished, they wash his feet, anoint them with oil, sit before him, and ask questions or are desirous of hearing the Dhamma.
Khi người dân thấy vị ấy, họ liền nói: “Đức Tôn giả của chúng ta đã đến!”, rồi ra đón, nhận bát, mời vị ấy ngồi trong nhà ăn hoặc trong nhà, dâng cháo. Trong khi chờ cơm chưa xong, họ rửa chân, xoa dầu, rồi ngồi trước mặt, hoặc hỏi pháp, hoặc muốn nghe pháp.
Sacepi na kathāpenti, janasaṅgahatthaṃ dhammakathā nāma kātabbāyevāti aṭṭhakathācariyā vadanti.
The commentary teachers say that even if they do not ask him to speak, a Dhamma talk should be given for the purpose of gathering the people.
Các vị Aṭṭhakathācariya (Luận sư) nói rằng, ngay cả khi họ không yêu cầu thuyết pháp, thì cũng nên thuyết pháp để lợi ích cho chúng sinh.
Dhammakathā hi kammaṭṭhānavinimuttā nāma natthi.
For there is no Dhamma talk that is separate from a meditation subject.
Thật vậy, không có bài pháp thoại nào mà không liên quan đến đề mục thiền (kammaṭṭhāna).
Tasmā kammaṭṭhānasīseneva dhammaṃ kathetvā kammaṭṭhānasīseneva āhāraṃ paribhuñjitvā anumodanaṃ katvā nivattiyamānehipi manussehi anugatova gāmato nikkhamitvā tattheva nivattetvā maggaṃ paṭipajjati.
Therefore, having given the Dhamma talk with the meditation subject at the forefront, having consumed the food with the meditation subject at the forefront, and having given the anumodanā, he departs from the village, still followed by the people who are turning back, and having sent them back right there, he proceeds on his way.
Vì vậy, vị ấy thuyết pháp với tâm chuyên chú vào đề mục thiền, thọ dụng thức ăn cũng với tâm chuyên chú vào đề mục thiền, rồi sau khi tùy hỷ (anumodanā), ra khỏi làng vẫn được người dân tiễn đưa, và từ đó trở lại con đường, tiếp tục hành trình.
Atha naṃ puretaraṃ nikkhamitvā bahigāme katabhattakiccā sāmaṇeradaharabhikkhū disvā paccuggantvā pattacīvaramassa gaṇhanti.
Then, the novices and young bhikkhus who had left earlier and finished their meal outside the village see him, go to meet him, and take his bowl and robe.
Lúc đó, các Sa-di và Tỳ-khưu trẻ đã ra khỏi làng sớm hơn, dùng bữa xong ở ngoại ô, thấy vị ấy thì ra đón và nhận y bát của vị ấy.
Porāṇā bhikkhū kira ‘‘na amhākaṃ upajjhāyo ācariyo’’ti mukhaṃ ulloketvā vattaṃ karonti.
The bhikkhus of old, it is said, do not perform their duties by looking at someone's face, thinking, "He is our preceptor, our teacher."
Các vị Tỳ-khưu thời xưa không thực hành phận sự (vatta) bằng cách nhìn mặt mà nói: “Đây là thầy y chỉ của chúng ta, đây là thầy bổn sư của chúng ta.”
Sampattaparicchedeneva karonti.
They do it simply by the measure of having arrived.
Họ thực hành phận sự chỉ dựa vào sự hiện diện của các vị.
Te taṃ pucchanti ‘‘bhante, ete manussā tumhākaṃ kiṃ honti mātupakkhato sambandhā pitipakkhato’’ti.
They ask him, "Bhante, what are these people to you? Are they related on your mother's side or on your father's side?"
Họ hỏi vị ấy: “Bạch Đại đức, những người dân này có quan hệ gì với Đại đức, là bà con bên mẹ hay bên cha?”
Kiṃ disvā pucchathāti.
When asked, "What have you seen that you ask this?"
Vị ấy hỏi: “Các bạn thấy gì mà hỏi vậy?”
Tumhesu etesaṃ pemaṃ bahumānanti.
"We ask because we see their love and great respect for you."
Họ đáp: “Chúng con thấy lòng yêu mến và sự tôn kính lớn lao của họ dành cho Đại đức.”
Āvuso, yaṃ mātāpitūhipi dukkaraṃ, taṃ ete amhākaṃ karonti, pattacīvarampi no etesaṃ santakameva, etesaṃ ānubhāvena neva bhaye bhayaṃ, na chātake chātakaṃ jānāma, edisā nāma amhākaṃ upakārino natthīti tesaṃ guṇe kathento gacchati, ayaṃ vuccati harati na paccāharatīti.
"Friends, what is difficult even for one's mother and father to do, these people do for us. Even our bowl and robes are their property. Through their power, we know no fear in times of danger, nor hunger in times of famine. There are no benefactors for us like these." Speaking thus of their virtues, he goes. This one is called he who carries but does not bring back.
Vị ấy vừa đi vừa kể về công đức của họ: “Này các bạn, điều mà cha mẹ còn khó làm được, họ đã làm cho chúng ta. Y bát của chúng ta cũng là của họ. Nhờ ân đức của họ, chúng ta không biết sợ hãi khi có hiểm nguy, không biết đói khát khi thiếu thốn. Không có những người giúp đỡ chúng ta như vậy.” Vị Tỳ-khưu này được gọi là chỉ mang đi mà không mang về.
Yassa pana pageva vuttappakāraṃ vattapaṭipattiṃ karontassa kammajatejo pajjalati, anupādinnakaṃ muñcitvā upādinnakaṃ gaṇhāti, sarīrato sedā muccanti, kammaṭṭhānavīthiṃ nārohati, so pageva pattacīvaramādāya vegasāva cetiyaṃ vanditvā gorūpānaṃ nikkhamanavelāyameva gāmaṃ yāgubhikkhāya pavisitvā yāguṃ labhitvā āsanasālaṃ gantvā pivati.
But as for the one whose fire element of kamma flares up while performing the afore-mentioned duties in the early morning, releasing the inanimate and seizing the animate, with sweat breaking out from his body, and the meditation subject not arising in his mind's process—he takes his bowl and robe early, pays homage to the cetiya quickly, and at the very time the cattle are leaving, he enters the village for gruel.
Còn vị nào đã thực hành các phận sự như đã nói trên từ sớm, đến nỗi sức nóng của thiền định (kammajatejo) bùng cháy, từ bỏ cái không bị chấp thủ (anupādinna) để nắm giữ cái bị chấp thủ (upādinna), mồ hôi từ thân chảy ra, không thể tiến vào lộ trình thiền định, thì vị ấy sớm mang y bát, nhanh chóng lễ bái tháp, rồi vào làng khất thực cháo vào đúng lúc bò ra khỏi chuồng. Sau khi nhận cháo, vị ấy đến nhà ăn và uống.
Athassa dvattikkhattuṃ ajjhoharaṇamatteneva kammajatejo upādinnakaṃ muñcitvā anupādinnakaṃ gaṇhāti.
Then, after just two or three mouthfuls, the fire element of kamma releases the animate and seizes the inanimate.
Khi ấy, chỉ sau hai hoặc ba lần nuốt, sức nóng của thiền định của vị ấy từ bỏ cái bị chấp thủ (upādinna) để nắm giữ cái không bị chấp thủ (anupādinna).
Ghaṭasatena nhāto viya tejodhātupariḷāhanibbāpanaṃ patvā kammaṭṭhānasīsena yāguṃ paribhuñjitvā pattañca mukhañca dhovitvā antarābhatte kammaṭṭhānaṃ manasikatvā avasesaṭṭhāne piṇḍāya caritvā kammaṭṭhānasīsena āhāraṃ paribhuñjitvā tato paṭṭhāya poṅkhānupoṅkhaṃ upaṭṭhahamānaṃ kammaṭṭhānaṃ gahetvāva āgacchati, ayaṃ vuccati na harati paccāharatīti.
Like one bathed with a hundred pots of water, having reached the quenching of the burning of the fire element, he consumes the rice-gruel with his meditation subject as the chief thing. Having washed his bowl and his mouth, he gives attention to his meditation subject in the time before the meal. Then, having wandered for alms in the remaining places and consumed the food with his meditation subject as the chief thing, from that point on he returns, having grasped the meditation subject that arises in succession. This one is called ‘he does not carry it away, but he brings it back.’
Vị ấy, như được tắm bằng hàng trăm vò nước, đạt đến sự dập tắt sức nóng do yếu tố lửa (tejodhātu), thọ dụng cháo với sự chú tâm vào thiền quán (kammaṭṭhāna), rửa bát và miệng, tác ý thiền quán vào khoảng giữa bữa ăn, sau đó đi khất thực ở những nơi còn lại, thọ dụng thức ăn với sự chú tâm vào thiền quán, và từ đó trở đi, vị ấy đi và mang theo thiền quán hiện khởi liên tục từng bước một. Vị này được gọi là không mang đi mà mang về.
Edisā ca bhikkhū yāguṃ pivitvā vipassanaṃ ārabhitvā buddhasāsane arahattaṃ pattā nāma gaṇanapathaṃ vītivattā, sīhaḷadīpeyeva tesu tesu gāmesu āsanasālāyaṃ na taṃ āsanaṃ atthi, yattha yāguṃ pivitvā arahattappattabhikkhū natthīti.
And such bhikkhus who, having drunk rice-gruel and begun insight meditation, have attained Arahantship in the Buddha's dispensation are beyond counting. In the island of Sīhaḷa alone, in such and such villages, there is no seat in an eating hall where there has not been a bhikkhu who attained Arahantship after drinking rice-gruel.
Những vị Tỳ-khưu như vậy, sau khi uống cháo và bắt đầu thiền minh sát (vipassanā), đã đạt đến quả A-la-hán trong giáo pháp của Đức Phật thì không thể đếm xuể. Ngay cả tại đảo Sīhaḷa (Tích Lan), trong các sảnh đường dùng cơm ở các làng mạc khác nhau, không có chỗ nào mà không có Tỳ-khưu đạt quả A-la-hán sau khi uống cháo.
Yo panāyaṃ harati ca paccāharati cāti vutto, so gatapaccāgatikavattavasena veditabbo.
The one who is said to 'both carry it away and bring it back' should be understood in terms of the practice of going and returning.
Còn vị được nói là mang đi và mang về, thì nên hiểu theo ý nghĩa của giới hạnh đi và trở về (gatapaccāgatikavatta).
Attakāmā hi kulaputtā sāsane pabbajitvā dasapi vīsampi tiṃsampi cattālīsampi paññāsampi satampi ekato vasantā katikavattaṃ katvā viharanti, āvuso, tumhe na iṇaṭṭhā na bhayaṭṭā na jīvikāpakatā pabbajitā, dukkhā muccitukāmā panettha pabbajitā, tasmā gamane uppannakilesaṃ gamaneyeva niggaṇhatha, ṭhāne, nisajjāyaṃ, sayane uppannakilesaṃ sayaneyeva niggaṇhathāti.
For, sons of good family who are desirous of their own welfare, having gone forth in the dispensation, live together—ten, twenty, thirty, forty, fifty, or a hundred of them—after making a formal agreement: "Venerable sirs, you have not gone forth because of debt, nor because of fear, nor for the sake of a livelihood. You have gone forth here desiring to be freed from suffering. Therefore, suppress a defilement that arises while walking, right there while walking. Suppress a defilement that arises while standing, sitting, or lying down, right there while lying down."
Quả thật, những thiện gia nam (kulaputta) mong muốn lợi ích cho bản thân, xuất gia trong giáo pháp, sống chung với mười, hai mươi, ba mươi, bốn mươi, năm mươi, hoặc một trăm vị, đã lập ra một giới nguyện (katikavatta) rằng: "Này chư Hiền, quý vị xuất gia không phải vì nợ nần, không phải vì sợ hãi, không phải vì kế sinh nhai, mà là vì mong muốn thoát khỏi khổ đau. Do đó, hãy diệt trừ phiền não phát sinh khi đi lại ngay trong lúc đi, và diệt trừ phiền não phát sinh khi đứng, ngồi, nằm ngay trong lúc nằm."
Te evaṃ katikavattaṃ katvā bhikkhācāraṃ gacchantā aḍḍhausabhausabhaaḍḍhagāvutagāvutantaresu pāsāṇā honti.
Having made such a formal agreement, as they go on their alms-round, they are like stones at intervals of half an usabha, an usabha, half a gāvuta, or a gāvuta.
Những vị ấy, sau khi lập giới nguyện như vậy, đi khất thực, và có những tảng đá ở khoảng cách nửa dặm, một dặm, nửa gāvuta, hoặc một gāvuta.
Tāya saññāya kammaṭṭhānaṃ manasikarontāva gacchanti.
With that perception, they go along giving attention to their meditation subject.
Với sự nhận biết đó, các vị ấy đi trong khi tác ý thiền quán.
Sace kassaci gamane kileso uppajjati, tattheva naṃ niggaṇhāti.
If a defilement arises in someone while walking, he suppresses it right there.
Nếu phiền não phát sinh nơi ai đó trong lúc đi, vị ấy sẽ diệt trừ nó ngay tại đó.
Tathā asakkonto tiṭṭhati.
Unable to do so, he stands still.
Nếu không thể làm như vậy, vị ấy sẽ dừng lại.
Athassa pacchato āgacchantopi tiṭṭhati.
Then the one coming behind him also stands still.
Khi đó, vị Tỳ-khưu đi phía sau cũng dừng lại.
So ‘‘ayaṃ bhikkhu tuyhaṃ uppannavitakkaṃ jānāti, ananucchavikaṃ te eta’’nti attānaṃ paṭicodetvā vipassanaṃ vaḍḍhetvā tattheva ariyabhūmiṃ okkamati.
Thinking, "This bhikkhu knows the thought that has arisen in you; this is not proper for you," he admonishes himself, develops his insight, and right there descends to the noble plane.
Vị ấy tự trách mình rằng: "Vị Tỳ-khưu này biết được tư duy đã phát sinh trong ngươi, điều này không phù hợp với ngươi," rồi tăng trưởng thiền minh sát và đạt đến Thánh địa (ariyabhūmi) ngay tại đó.
Tathā asakkonto nisīdati.
Unable to do so, he sits down.
Nếu không thể làm như vậy, vị ấy sẽ ngồi xuống.
Athassa pacchato āgacchantopi nisīdatīti soyeva nayo.
Then the one coming behind him also sits down. The same method applies.
Khi đó, vị Tỳ-khưu đi phía sau cũng ngồi xuống, tương tự như vậy.
Ariyabhūmiṃ okkamituṃ asakkontopi taṃ kilesaṃ vikkhambhetvā kammaṭṭhānaṃ manasikarontova gacchati.
Even if he is unable to descend to the noble plane, he suppresses that defilement and continues to walk while giving attention to his meditation subject.
Ngay cả khi không thể đạt đến Thánh địa, vị ấy cũng sẽ tạm thời chế ngự phiền não đó và tiếp tục đi trong khi tác ý thiền quán.
Na kammaṭṭhānavippayuttena cittena pādaṃ uddharati.
He does not lift his foot with a mind disassociated from the meditation subject.
Vị ấy không nhấc chân lên với tâm không liên hệ đến thiền quán.
Uddharati ce, paṭinivattetvā purimapadesaṃ yeva eti āḷindakavāsī mahāphussadevatthero viya.
If he does lift it, he turns back and returns to the previous spot, like the Elder Mahāphussadeva, the resident of Āḷindaka.
Nếu nhấc lên, vị ấy sẽ lùi lại và trở về chỗ cũ, giống như Đại Trưởng lão Mahāphussadeva sống ở Āḷindaka.
So kira ekūnavīsativassāni gatapaccāgatikavattaṃ pūrento eva vihāsi.
It is said that for nineteen years he lived fulfilling the practice of going and returning.
Nghe nói, vị ấy đã sống trong việc hoàn thành giới hạnh đi và trở về (gatapaccāgatikavatta) suốt mười chín năm.
Manussāpi sudaṃ antarāmagge kasantā ca vapantā ca maddantā ca kammāni ca karontā theraṃ tathāgacchantaṃ disvā ‘‘ayaṃ thero punappunaṃ nivattitvā gacchati.
People ploughing, sowing, threshing, and doing other work along the road would see the elder walking in this way and would remark among themselves,
Người dân, khi đang cày cấy, gieo trồng, đập lúa và làm các công việc khác trên đường đi, thấy vị Trưởng lão đi đi lại lại như vậy, liền bàn tán:
Kiṃ nu kho maggamūḷho udāhu kiñci pamuṭṭho’’ti samullapanti.
"This elder repeatedly turns back and walks again. Is he lost, or has he forgotten something?"
"Vị Trưởng lão này cứ quay đi quay lại. Phải chăng ngài bị lạc đường, hay đã quên mất điều gì?"
So taṃ anādiyitvā kammaṭṭhānayuttacitteneva samaṇadhammaṃ karonto vīsativassabbhantare arahattaṃ pāpuṇi.
He, paying no attention to them, practiced the ascetic's duties with a mind yoked to his meditation subject and attained Arahantship within twenty years.
Vị ấy không để ý đến lời bàn tán đó, mà tiếp tục thực hành pháp Sa-môn (samaṇadhamma) với tâm chú tâm vào thiền quán, và đạt đến quả A-la-hán trong vòng hai mươi năm.
Arahattappattadivaseyevassa caṅkamanakoṭiyaṃ adhivatthā devatā aṅgulīhi dīpaṃ ujjāletvā aṭṭhāsi.
On the very day he attained Arahantship, the deity dwelling at the end of his walking path stood there, lighting a lamp with her fingers.
Ngay trong ngày đạt quả A-la-hán, một vị thiên nữ trú ngụ ở cuối đường kinh hành của vị ấy đã thắp sáng một ngọn đèn bằng ngón tay và đứng đó.
Cattāropi mahārājāno sakko ca devānamindo brahmā ca sahampati upaṭṭhānaṃ agamaṃsu.
The four Great Kings, Sakka the lord of the devas, and Brahmā Sahampati came to attend upon him.
Bốn vị Đại Thiên Vương, chư Thiên Đế Thích (Sakko devānamindo), và Phạm Thiên Sahampati đều đến hầu cận.
Tañca obhāsaṃ disvā vanavāsīmahātissatthero taṃ dutiyadivase pucchi ‘‘rattibhāge āyasmato santike obhāso ahosi, kiṃ so obhāso’’ti.
Seeing that radiance, the Elder Mahātissa, the forest-dweller, asked him on the second day, "During the night, there was a radiance near you, venerable sir. What was that radiance?"
Thấy ánh sáng đó, Đại Trưởng lão Vanavāsī Mahātissa đã hỏi vị ấy vào ngày hôm sau: "Vào ban đêm, có ánh sáng ở chỗ Tôn giả. Ánh sáng đó là gì?"
Thero vikkhepaṃ karonto ‘‘obhāso nāma dīpobhāsopi hoti maṇiobhāsopī’’ti evamādimāha.
The elder, trying to evade the question, said such things as, "A radiance can be the light of a lamp, or the light of a gem."
Vị Trưởng lão, để tránh sự phân tâm, nói rằng: "Ánh sáng có thể là ánh sáng đèn hoặc ánh sáng ngọc," và những điều tương tự.
Tato paṭicchādetha tumheti nibaddho āmāti paṭijānitvā ārocesi kālavallimaṇḍapavāsī mahānāgatthero viya ca.
Then, being pressed with, "You are concealing it," he admitted, "Yes," and explained, just like the Elder Mahānāga, the resident of the Kālavallimaṇḍapa.
Sau đó, khi bị thúc ép rằng "Ngài hãy che giấu đi," vị ấy đã thừa nhận "Ồ, đúng vậy" và kể lại, giống như Đại Trưởng lão Mahānāga sống ở Kāḷavallimaṇḍapa.
Sopi kira gatapaccāgatikavattaṃ pūrento paṭhamaṃ tāva bhagavato mahāpadhānaṃ pūjessāmīti satta vassāni ṭhānacaṅkamanameva adhiṭṭhāsi.
It is said that he, too, while fulfilling the practice of going and returning, first resolved to undertake only the postures of standing and walking for seven years, thinking, "I will pay homage to the great striving of the Blessed One."
Vị ấy cũng vậy, trong khi thực hành giới hạnh đi và trở về (gatapaccāgatikavatta), trước tiên đã kiên quyết chỉ đứng và đi kinh hành suốt bảy năm, với ý nghĩ: "Tôi sẽ cúng dường sự đại tinh tấn của Đức Thế Tôn."
Puna soḷasa vassāni gatapaccāgatikavattaṃ pūretvā arahattaṃ pāpuṇi.
Again, for sixteen years, he fulfilled the practice of going and returning and attained Arahantship.
Sau đó, vị ấy đã hoàn thành giới hạnh đi và trở về suốt mười sáu năm, và đạt đến quả A-la-hán.
So kammaṭṭhānayutteneva cittena pādaṃ uddharanto viyuttena uddhate paṭinivattanto gāmassa samīpaṃ gantvā ‘‘gāvī nu pabbajito nū’’ti āsaṅkanīyapadese ṭhatvā cīvaraṃ pārupitvā kacchakantarato udakena pattaṃ dhovitvā udakagaṇḍūsaṃ karoti.
Lifting his foot only with a mind yoked to the meditation subject, and turning back if he lifted it with a disassociated mind, he would go near the village, stand in a place where one might wonder, "Is it a cow or a monk?", put on his robe, wash his bowl with water from his water-pot, and take a mouthful of water.
Vị ấy, nhấc chân lên với tâm chú tâm vào thiền quán, và khi nhấc lên mà tâm không chú tâm, thì lùi lại, đến gần làng, dừng lại ở nơi có thể bị nghi ngờ là "đó là bò hay là Sa-môn?", đắp y, rửa bát bằng nước từ vòi nước và súc miệng.
Kiṃ kāraṇā?
For what reason?
Vì lý do gì?
Mā me bhikkhaṃ dātuṃ vandituṃ vā āgate manusse dīghāyukā hothāti vacanamattenāpi kammaṭṭhānavikkhepo ahosīti.
So that his meditation subject would not be disrupted even by the mere words, "May you be long-lived," spoken to the people who came to give alms or to pay homage.
Để thiền quán của tôi không bị gián đoạn dù chỉ bằng lời nói "Chúc quý vị sống lâu" khi người dân đến cúng dường thức ăn hoặc đảnh lễ.
Ajja, bhante, katimīti divasaṃ vā bhikkhugaṇanaṃ vā pañhe vā pucchito pana udakaṃ gilitvā ārocesi.
However, if he was asked about the date, such as "Venerable sir, what day is it today?", or about the number of bhikkhus, or other questions, he would answer after swallowing the water.
Tuy nhiên, khi được hỏi về ngày tháng (hôm nay là ngày mấy, thưa Tôn giả?), số lượng Tỳ-khưu, hoặc các câu hỏi khác, vị ấy sẽ nuốt nước bọt rồi trả lời.
Sace divasādipucchakā na honti, nikkhamanavelāya gāmadvāre niṭṭhubhitvāva yāti kalambatitthavihāre vassūpagatapaññāsabhikkhū viya.
If there were no people asking about the date and so on, he would spit the water out at the village gate upon leaving, just like the fifty bhikkhus who had entered the Rains-residence at the Kalambatittha monastery.
Nếu không có ai hỏi về ngày tháng, vị ấy sẽ nhổ nước bọt ở cổng làng khi rời đi, giống như năm mươi vị Tỳ-khưu an cư tại tu viện Kalambatittha.
Te kira āsāḷhīpuṇṇamāyaṃ katikavattaṃ akaṃsu ‘‘arahattaṃ appatvā aññamaññaṃ na ālapissāmā’’ti.
It is said that on the full moon day of Āsāḷhī, they made a formal agreement: "Until we attain Arahantship, we will not speak to one another."
Nghe nói, vào ngày trăng tròn Āsāḷhī (tháng 7), các vị ấy đã lập giới nguyện: "Chúng tôi sẽ không nói chuyện với nhau cho đến khi đạt quả A-la-hán."
Gāmañca piṇḍāya pavisantā udakagaṇḍūsaṃ katvā pavisiṃsu.
And when entering the village for alms, they entered after taking a mouthful of water.
Khi vào làng khất thực, các vị ấy súc miệng bằng nước rồi mới vào.
Divasādīsu pucchitesu vuttanayeneva paṭipajjiṃsu.
When asked about the date and so on, they acted in the manner already described.
Khi được hỏi về ngày tháng, các vị ấy cũng hành xử theo cách đã nói.
Tattha manussā niṭṭhubhanaṃ disvā jāniṃsu, ‘‘ajjeko āgato, ajja dve’’ti.
There, the people, seeing the spittle, knew, "Today one has come; today two," and so on.
Ở đó, người dân thấy dấu vết nhổ nước bọt, liền biết: "Hôm nay có một vị đến, hôm nay có hai vị."
Evañca cintesuṃ ‘‘kiṃ nu kho ete amhehiyeva saddhiṃ na sallapanti, udāhu aññamaññampi, yadi aññamaññaṃ na sallapanti, addhā vivādajātā bhavissanti, etha ne aññamaññaṃ khamāpessāmā’’ti sabbe vihāraṃ gantvā paññāsāya bhikkhusu dvepi bhikkhū ekokāse nāddasaṃsu.
And they thought thus: "Do they not speak only with us, or also not with each other? If they do not speak with each other, they must surely have had a dispute. Come, let us make them ask forgiveness of one another." So all of them went to the monastery, but among the fifty bhikkhus, they did not see even two bhikkhus in one place.
Và họ suy nghĩ: "Phải chăng các vị ấy không nói chuyện với chúng ta, hay cũng không nói chuyện với nhau? Nếu không nói chuyện với nhau, chắc chắn là có tranh cãi. Nào, chúng ta hãy đến và làm cho họ hòa giải với nhau." Thế là tất cả mọi người đến tu viện, nhưng không thấy hai vị Tỳ-khưu nào trong số năm mươi vị Tỳ-khưu ở cùng một chỗ.
Tato yo tesu cakkhumā puriso, so āha ‘‘na bho kalahakārakānaṃ okāso īdiso hoti, susammaṭṭhaṃ cetiyaṅgaṇaṃ bodhiyaṅgaṇaṃ, sunikkhittā sammajjaniyo, sūpaṭṭhapitaṃ pānīyaṃ paribhojanīya’’nti.
Then the wise man among them said, "Sirs, the place of those who have quarreled is not like this. The stupa-courtyard and the Bodhi-courtyard are well-swept, the brooms are well-placed, and the drinking and washing water are well-prepared."
Khi đó, một người có trí tuệ trong số họ nói: "Này các bạn, nơi ở của những người gây gổ không phải như thế này. Sân tháp và sân Bồ-đề được quét dọn sạch sẽ, chổi được đặt gọn gàng, nước uống và nước dùng được chuẩn bị chu đáo."
Te tatova nivattā, tepi bhikkhū antotemāseyeva arahattaṃ patvā mahāpavāraṇāya visuddhipavāraṇaṃ pavāresuṃ.
They turned back from there. And those bhikkhus, having attained Arahantship within the three months of the Rains, performed the Pavāraṇā of purity at the Great Pavāraṇā ceremony.
Người dân liền quay về từ đó. Còn các vị Tỳ-khưu kia, trong vòng ba tháng an cư, đã đạt quả A-la-hán và thực hiện lễ Pavāraṇā thanh tịnh vào ngày Đại Pavāraṇā.
Evaṃ kālavallimaṇḍapavāsī mahānāgatthero viya kalambatitthavihāre vassūpagatabhikkhū viya ca kammaṭṭhānayutteneva cittena pādaṃ uddharanto gāmasamīpaṃ patvā udakagaṇḍūsaṃ katvā vīthiyo sallakkhetvā yattha surāsoṇḍadhuttādayo kalahakārakā caṇḍahatthiassādayo vā natthi, taṃ vīthiṃ paṭipajjati.
Thus, like the Elder Mahānāga, the resident of Kālavallimaṇḍapa, and like the bhikkhus who had entered the Rains-residence at the Kalambatittha monastery, lifting his foot only with a mind yoked to the meditation subject, he reaches the vicinity of the village, takes a mouthful of water, observes the streets, and follows a street where there are no drunkards, rogues, quarrelsome people, or fierce elephants, horses, and the like.
Như vậy, giống như Đại Trưởng lão Mahānāga sống ở Kāḷavallimaṇḍapa và các vị Tỳ-khưu an cư tại tu viện Kalambatittha, vị ấy nhấc chân lên với tâm chú tâm vào thiền quán, đến gần làng, súc miệng, quan sát các con đường và đi vào con đường nào không có những kẻ say rượu, những kẻ lừa đảo, những kẻ gây gổ, hoặc những con voi, ngựa hung dữ.
Tattha ca piṇḍāya caramāno na turitaturito viya javena gacchati.
And there, while wandering for alms, he does not go with haste, as if in a great hurry.
Khi khất thực ở đó, vị ấy không đi vội vàng như thể đang chạy.
Na hi javena piṇḍapātiyadhutaṅgaṃ nāma kiñci atthi.
For there is no such ascetic practice of the alms-food-eater (piṇḍapātika-dhutaṅga) that involves speed.
Vì không có giới hạnh nào gọi là "đi nhanh khi khất thực" cả.
Visamabhūmibhāgappattaṃ pana udakasakaṭaṃ viya niccalo hutvā gacchati.
Moreover, he goes on, having become as steady as a water cart that has reached an uneven part of the ground.
Nhưng, giống như một chiếc xe nước đi trên đoạn đường gồ ghề, vị ấy đi một cách vững chãi.
Anugharaṃ paviṭṭho ca taṃ dātukāmaṃ vā adātukāmaṃ vā sallakkhetuṃ tadanurūpaṃ kālaṃ āgamento bhikkhaṃ gahetvā antogāme vā bahigāme vā vihārameva vā āgantvā yathāphāsuke patirūpe okāse nisīditvā kammaṭṭhānaṃ manasikaronto āhāre paṭikūlasaññaṃ upaṭṭhāpetvā akkhabbhañjanavaṇalepanaputtamaṃsūpamāvasena naṃ paccavekkhanto aṭṭhaṅgasamannāgataṃ āhāraṃ āhāreti, neva davāya na madāya na maṇḍanāya na vibhūsanāya.
And having entered from house to house, while waiting for a suitable time to observe whether they wish to give or not, and having received alms, he returns to a place within the village, outside the village, or to the monastery itself. Then, sitting in a suitable and comfortable place, he directs his mind to his meditation subject. Establishing the perception of loathsomeness in regard to the food, and reflecting on it with the similes of anointing an axle, dressing a wound, and the flesh of one's own son, he partakes of the food endowed with eight factors—not for amusement, not for intoxication, not for adornment, not for embellishment.
Khi vào từng nhà để khất thực, vị ấy chờ đợi một khoảng thời gian thích hợp để nhận biết ý muốn của người cúng dường, dù họ muốn cúng hay không muốn cúng. Sau khi nhận được vật thực, vị ấy trở về tu viện, dù ở trong làng hay ngoài làng, ngồi xuống một nơi thích hợp, thoải mái, chú tâm vào đề mục thiền (kammaṭṭhāna), thiết lập tưởng ghê tởm (paṭikūlasañña) đối với vật thực, quán xét nó bằng cách ví như dầu bôi trục xe, thuốc bôi vết thương, hay thịt con trai, rồi thọ dụng vật thực với tám chi phần, không phải để vui đùa, không phải để kiêu mạn, không phải để trang sức, không phải để làm đẹp.
Bhuttāvī ca udakakiccaṃ katvā muhuttaṃ bhattakilamathaṃ paṭippassambhetvā yathā purebhattaṃ, evaṃ pacchābhattaṃ.
And after eating, having performed his duties with water, he allows the fatigue from the meal to subside for a moment; then, just as before the meal, so it is after the meal.
Sau khi ăn xong, vị ấy làm các việc liên quan đến nước, nghỉ ngơi một lát để xua tan sự mệt mỏi do ăn uống, rồi như buổi sáng, buổi chiều cũng vậy.
Yathā purimayāmaṃ, evaṃ pacchimayāmañca kammaṭṭhānameva manasi karoti, ayaṃ vuccati harati ca paccāharati cāti.
Just as in the first watch of the night, so too in the last watch, he directs his mind only to the meditation subject. This is what is called "he carries forth and brings back."
Như canh đầu, canh cuối cũng vậy, vị ấy chỉ chú tâm vào đề mục thiền. Đây được gọi là đi và trở về.
Idaṃ pana haraṇapaccāharaṇasaṅkhātaṃ gatapaccāgatikavattaṃ pūrento yadi upanissayasampanno hoti.
Furthermore, while fulfilling this practice of going and returning, known as carrying forth and bringing back, if he is endowed with the necessary supporting conditions,
Nếu vị ấy hoàn thành hạnh "đi và trở về" này, tức là hạnh đi khất thực rồi trở về, và có đầy đủ các điều kiện hỗ trợ (upanissaya),
Paṭhamavaye eva arahattaṃ pāpuṇāti.
he attains arahantship in the first stage of life.
thì vị ấy sẽ chứng đắc A-la-hán quả ngay trong tuổi trẻ.
No ce paṭhamavaye pāpuṇāti, atha majjhimavaye.
If he does not attain it in the first stage of life, then in the middle stage of life.
Nếu không chứng đắc trong tuổi trẻ, thì trong tuổi trung niên.
No ce majjhimavaye pāpuṇāti, atha pacchimavaye.
If he does not attain it in the middle stage of life, then in the last stage of life.
Nếu không chứng đắc trong tuổi trung niên, thì trong tuổi già.
No ce pacchimavaye pāpuṇāti, atha maraṇasamaye.
If he does not attain it in the last stage of life, then at the time of death.
Nếu không chứng đắc trong tuổi già, thì vào lúc lâm chung.
No ce maraṇasamaye pāpuṇāti, atha devaputto hutvā.
If he does not attain it at the time of death, then after becoming a devaputta.
Nếu không chứng đắc vào lúc lâm chung, thì trở thành một vị thiên tử.
No ce devaputto hutvā pāpuṇāti, anuppanne buddhe nibbatto paccekabodhiṃ sacchikaroti.
If he does not attain it after becoming a devaputta, being reborn when a Buddha has not arisen, he realizes Paccekabodhi.
Nếu không chứng đắc khi trở thành thiên tử, thì khi không có Phật xuất hiện, vị ấy sẽ chứng đắc Bồ-đề Duyên giác (Paccekabodhi).
No ce paccekabodhiṃ sacchikaroti, atha buddhānaṃ sammukhībhāve khippābhiñño vā hoti seyyathāpi thero bāhiyo dārucīriyo, mahāpañño vā seyyathāpi thero sāriputto, mahiddhiko vā seyyathāpi thero mahāmoggallāno, dhutaṅgadharo vā seyyathāpi thero mahākassapo, dibbacakkhuko vā seyyathāpi thero anuruddho, vinayadharo vā seyyathāpi thero upāli, dhammakathiko vā seyyathāpi thero puṇṇo mantāṇiputto, āraññiko vā seyyathāpi thero revato, bahussuto vā seyyathāpi thero ānando, sikkhākāmo vā seyyathāpi thero rāhulo buddhaputtoti.
If he does not realize Paccekabodhi, then in the presence of Buddhas, he either becomes one of swift insight, like the Elder Bāhiya Dārucīriya; or one of great wisdom, like the Elder Sāriputta; or one of great psychic power, like the Elder Mahāmoggallāna; or an observer of the ascetic practices, like the Elder Mahākassapa; or one with the divine eye, like the Elder Anuruddha; or an expert in the Vinaya, like the Elder Upāli; or a preacher of the Dhamma, like the Elder Puṇṇa Mantāṇiputta; or a forest-dweller, like the Elder Revata; or one of great learning, like the Elder Ānanda; or one keen on the training, like the Elder Rāhula, the Buddha's son.
Nếu không chứng đắc Bồ-đề Duyên giác, thì khi Phật xuất hiện, vị ấy sẽ trở thành người nhanh chóng chứng ngộ (khippābhiñño) như Trưởng lão Bāhiya Dārucīriya, hoặc có đại trí tuệ như Trưởng lão Sāriputta, hoặc có đại thần thông như Trưởng lão Mahāmoggallāna, hoặc giữ gìn pháp hạnh đầu đà (dhutaṅga) như Trưởng lão Mahākassapa, hoặc có thiên nhãn như Trưởng lão Anuruddha, hoặc thông thạo Luật tạng như Trưởng lão Upāli, hoặc là bậc thuyết pháp (dhammakathiko) như Trưởng lão Puṇṇa Mantāṇiputta, hoặc là bậc sống trong rừng (āraññiko) như Trưởng lão Revata, hoặc là bậc đa văn (bahussuto) như Trưởng lão Ānanda, hoặc là người ham học hỏi (sikkhākāmo) như Trưởng lão Rāhula, con của Đức Phật.
Iti imasmiṃ catukke yvāyaṃ harati ca paccāharati ca, tassa gocarasampajaññaṃ sikhāpattaṃ hoti.
Thus, in this tetrad, for the one who carries forth and brings back, the clear comprehension of the domain reaches its culmination.
Như vậy, trong bốn loại này, vị nào đi và trở về, thì Gocarasampajañña của vị ấy đạt đến đỉnh cao.
Abhikkamādīsu pana asammuyhanaṃ asammohasampajaññaṃ.
However, not being deluded in activities such as going forward is clear comprehension of non-delusion.
Sự không lầm lẫn trong các hành động như đi tới, v.v., được gọi là Asammohasampajañña (chánh niệm không lầm lẫn).
Taṃ evaṃ veditabbaṃ – idha bhikkhu abhikkamanto vā paṭikkamanto vā yathā andhaputhujjanā abhikkamādīsu ‘‘attā abhikkamati, attanā abhikkamo nibbattito’’ti vā ‘‘ahaṃ abhikkamāmi, mayā abhikkamo nibbattito’’ti vā sammuyhanti.
It should be understood in this way: Herein, a bhikkhu, when going forward or returning, does not become deluded as unenlightened ordinary people do in activities like going forward, thinking "a self goes forward, the act of going forward is produced by a self," or "I go forward, the act of going forward is produced by me."
Điều đó cần được hiểu như sau: Ở đây, một Tỳ-kheo khi đi tới hay đi lui, không lầm lẫn như những phàm nhân mù quáng thường lầm lẫn trong các hành động đi tới, v.v., rằng “tự ngã đang đi tới, sự đi tới được thực hiện bởi tự ngã” hoặc “tôi đang đi tới, sự đi tới được thực hiện bởi tôi”.
Tathā asammuyhanto ‘‘abhikkamāmī’’ti citte uppajjamāne teneva cittena saddhiṃ cittasamuṭṭhānā vāyodhātu viññattiṃ janayamānā uppajjati, iti cittakiriyavāyodhātuvipphāravasena ayaṃ kāyasammato aṭṭhisaṅghāto abhikkamati, tassevaṃ abhikkamato ekekapāduddharaṇe pathavīdhātu āpodhātūti dve dhātuyo omattā honti mandā, itarā dve adhimattā honti balavatiyo, tathā atiharaṇavītiharaṇesu.
Not being deluded in this way, when the thought "I will go forward" arises, along with that very thought, the mind-born air element arises, producing the physical intimation. Thus, it is by the force of this process of mind-activity and the diffusion of the air element that this collection of bones, referred to as the body, goes forward. As it goes forward in this way, in each lifting of the foot, two elements—the earth element and the water element—are diminished and weak, while the other two are predominant and strong. The same applies to the actions of moving forward and moving aside.
Tương tự, khi không lầm lẫn, khi ý nghĩ “tôi đang đi tới” phát sinh, thì cùng với ý nghĩ đó, yếu tố gió (vāyodhātu) phát sinh từ ý nghĩ đó, tạo ra hành vi biểu hiện (viññatti); như vậy, cái khối xương được gọi là thân này đang đi tới theo sự hoạt động của ý nghĩ và sự lan tỏa của yếu tố gió. Khi nó đi tới như vậy, mỗi khi nhấc chân lên, hai yếu tố đất (paṭhavīdhātu) và nước (āpodhātu) trở nên yếu và nhẹ, còn hai yếu tố kia (lửa và gió) trở nên mạnh và nặng. Tương tự đối với việc đưa chân tới và lùi chân về.
Vossajjane tejovāyodhātuyo omattā honti mandā, itarā dve adhimattā honti balavatiyo.
In releasing the foot, the fire and air elements are diminished and weak, while the other two are predominant and strong.
Khi buông chân xuống, yếu tố lửa (tejodhātu) và gió (vāyodhātu) trở nên yếu và nhẹ, còn hai yếu tố kia (đất và nước) trở nên mạnh và nặng.
Tathā sannikkhepanasannirumbhanesu.
The same applies to the actions of placing down and pressing down.
Tương tự đối với việc đặt chân xuống và đè nén.
Tattha uddharaṇe pavattā rūpārūpadhammā atiharaṇaṃ na pāpuṇanti.
Therein, the material and immaterial phenomena that arose during the lifting do not reach the moving forward.
Trong đó, các pháp sắc và vô sắc phát sinh khi nhấc chân lên không tồn tại cho đến khi đưa chân tới.
Tathā atiharaṇe pavattā vītiharaṇaṃ, vītiharaṇe pavattā vossajjanaṃ, vossajjane pavattā sannikkhepanaṃ, sannikkhepane pavattā sannirumbhanaṃ na pāpuṇanti.
Similarly, those that arose during the moving forward do not reach the moving aside; those that arose during the moving aside do not reach the releasing; those that arose during the releasing do not reach the placing down; and those that arose during the placing down do not reach the pressing down.
Tương tự, các pháp phát sinh khi đưa chân tới không tồn tại cho đến khi lùi chân về; các pháp phát sinh khi lùi chân về không tồn tại cho đến khi buông chân xuống; các pháp phát sinh khi buông chân xuống không tồn tại cho đến khi đặt chân xuống; các pháp phát sinh khi đặt chân xuống không tồn tại cho đến khi đè nén.
Tattha tattheva pabbaṃ pabbaṃ sandhi sandhi odhi odhi hutvā tattakapāle pakkhittatilāni viya paṭapaṭāyantā bhijjanti.
There, at each and every point—joint by joint, connection by connection, boundary by boundary—they break up, crackling like sesame seeds thrown on a hot pan.
Tại mỗi thời điểm đó, từng khớp, từng mối nối, từng khoảng cách, chúng tan rã như những hạt mè rang trong chảo nóng, nổ lách tách.
Tattha ko eko abhikkamati?
In that process, what single being goes forward?
Vậy thì ai là người duy nhất đang đi tới?
Kassa vā ekassa abhikkamanaṃ?
Or of what single being is there a going forward?
Hay sự đi tới là của một người duy nhất nào?
Paramatthato hi dhātūnaṃyeva gamanaṃ, dhātūnaṃ ṭhānaṃ, dhātūnaṃ nisajjanaṃ, dhātūnaṃ sayanaṃ, tasmiṃ tasmiñhi koṭṭhāse saddhiṃ rūpena –
In the ultimate sense, it is merely the going of the elements, the standing of the elements, the sitting of the elements, the lying down of the elements. For in each and every part, along with the material form—
Thật ra, theo nghĩa tối hậu, chỉ có sự đi, sự đứng, sự ngồi, sự nằm của các yếu tố (dhātu) mà thôi, và trong mỗi phần đó, cùng với sắc pháp –
Ālokite vilokiteti ettha pana ālokitaṃ nāma purato pekkhanaṃ.
Now, in the phrase "in looking ahead and looking aside," looking ahead (ālokita) means looking straight forward.
Trong cụm từ ālokite vilokite (khi nhìn thẳng, khi nhìn quanh) này, ālokita có nghĩa là nhìn thẳng về phía trước.
Vilokitaṃ nāma anudisāpekkhanaṃ.
Looking aside (vilokita) means looking in a diagonal direction.
Vilokita có nghĩa là nhìn về các hướng phụ.
Aññānipi heṭṭhā upari pacchato pekkhanavasena olokitaullokitāpalokitāni nāma honti, tāni idha na gahitāni.
There are also others, named looking down (olokita), looking up (ullokita), and looking back (apalokita), by way of looking down, up, and behind, but they are not included here.
Các cách nhìn khác như nhìn xuống (olokita), nhìn lên (ullokita), nhìn ra sau (apalokita) cũng có, nhưng ở đây chúng không được đề cập.
Sāruppavasena pana imāneva dve gahitāni, iminā vā mukhena sabbānipi tāni gahitānevāti.
However, on the basis of suitability, just these two are included; or, through this approach, all of them are indeed included.
Tuy nhiên, chỉ hai cách nhìn này được đề cập theo nghĩa thích hợp, hoặc qua hai cách này, tất cả các cách nhìn khác cũng được bao hàm.
Tattha ‘‘ālokessāmī’’ti citte uppanne cittavaseneva anoloketvā atthapariggahaṇaṃ sātthakasampajaññaṃ.
Therein, when the thought "I will look ahead" arises, not looking merely by the force of that thought, but grasping the purpose, is clear comprehension of purposefulness.
Trong đó, khi ý nghĩ “tôi sẽ nhìn thẳng” phát sinh, việc nắm bắt ý nghĩa mà không nhìn thẳng theo ý nghĩ đó được gọi là Sātthakasampajañña (chánh niệm về mục đích).
Taṃ āyasmantaṃ nandaṃ kāyasakkhiṃ katvā veditabbaṃ.
This should be understood by taking the Venerable Nanda as a living witness.
Điều này cần được hiểu bằng cách lấy Tôn giả Nanda làm nhân chứng.
Vuttañhetaṃ bhagavatā – ‘‘sace, bhikkhave, nandassa puratthimā disā āloketabbā hoti, sabbaṃ cetasā samannāharitvā nando puratthimaṃ disaṃ āloketi, evaṃ me puratthimaṃ disaṃ ālokayato na abhijjhādomanassā pāpakā akusalā dhammā anvāssaveyyunti iti so tattha sampajāno hoti, sace, bhikkhave, nandassa pacchimā disā, uttarā disā, dakkhiṇā disā, uddhaṃ, adho, anudisā āloketabbā hoti, sabbaṃ cetaso samannāharitvā nando anudisaṃ āloketi.
For this was said by the Blessed One: "Bhikkhus, if Nanda has to look at the eastern direction, Nanda looks at the eastern direction after having fully attended to it with his whole mind, thinking: 'As I am looking at the eastern direction, may covetousness and displeasure, evil, unwholesome states, not flow in.' Thus he is clearly comprehending in that. Bhikkhus, if Nanda has to look at the western direction, the northern direction, the southern direction, upwards, downwards, or a diagonal direction, Nanda looks at the diagonal direction after having fully attended to it with his whole mind, thinking:
Đức Thế Tôn đã dạy rằng: “Này các Tỳ-kheo, nếu Nanda muốn nhìn về hướng đông, Nanda tập trung toàn bộ tâm ý và nhìn về hướng đông. Khi ta nhìn về hướng đông như vậy, các pháp bất thiện, ác độc như tham lam và bất mãn sẽ không xâm nhập ta. Như vậy, Nanda có chánh niệm ở đó. Này các Tỳ-kheo, nếu Nanda muốn nhìn về hướng tây, hướng bắc, hướng nam, hướng trên, hướng dưới, các hướng phụ, Nanda tập trung toàn bộ tâm ý và nhìn về các hướng phụ.
Evaṃ me anudisaṃ ālokayato…pe… sampajāno hotī’’ti (a. ni. 8.9).
'As I am looking at a diagonal direction... and so on... he is clearly comprehending.'"
Khi ta nhìn về các hướng phụ như vậy... (tức là không có tham lam và bất mãn)... thì Nanda có chánh niệm.”
Apica idhāpi pubbe vuttacetiyadassanādivaseneva sātthakatā ca sappāyatā ca veditabbā.
Moreover, here too, purposefulness and suitability should be understood in the same way as with the viewing of a cetiya mentioned before.
Hơn nữa, ở đây cũng vậy, sự hữu ích (sātthakatā) và sự thích hợp (sappāyatā) cần được hiểu theo cách đã nói trước đây về việc chiêm ngưỡng bảo tháp, v.v.
Kammaṭṭhānassa pana avijahanameva gocarasampajaññaṃ.
However, not abandoning the meditation subject is clear comprehension of the domain.
Việc không từ bỏ đề mục thiền (kammaṭṭhāna) chính là Gocarasampajañña.
Tasmā khandhadhātuāyatanakammaṭṭhānikehi attano kammaṭṭhānavaseneva, kasiṇādikammaṭṭhānikehi vā pana kammaṭṭhānasīseneva ālokanavilokanaṃ kātabbaṃ.
Therefore, by those whose meditation subject is the aggregates, elements, and sense bases, the looking ahead and looking aside should be done in accordance with their own meditation subject. Or else, by those whose meditation subject is a kasina and so on, it should be done with the meditation subject as the main focus.
Do đó, những người thực hành thiền về uẩn (khandha), giới (dhātu), xứ (āyatana) nên nhìn thẳng và nhìn quanh theo đề mục thiền của mình; còn những người thực hành thiền về kasiṇa, v.v., thì nên nhìn thẳng và nhìn quanh theo nguyên tắc đề mục thiền.
Abbhantare attā nāma āloketā vā viloketā vā natthi, ālokessāmīti pana citte uppajjamāne teneva cittena saddhiṃ cittasamuṭṭhānā vāyodhātu viññattiṃ janayamānā uppajjati.
Internally, there is no self who is a looker-ahead or a looker-aside. But when the thought "I will look" arises, along with that very thought, the mind-born air element arises, producing the physical intimation.
Bên trong không có một “tự ngã” nào là người nhìn thẳng hay nhìn quanh. Tuy nhiên, khi ý nghĩ “tôi sẽ nhìn thẳng” phát sinh, thì cùng với ý nghĩ đó, yếu tố gió (vāyodhātu) phát sinh từ ý nghĩ đó, tạo ra hành vi biểu hiện.
Iti cittakiriyavāyodhātuvipphāravaseneva heṭṭhimaṃ akkhidalaṃ adho sīdati, uparimaṃ uddhaṃ laṅgheti, koci yantakena vivaranto nāma natthi, tato cakkhuviññāṇaṃ dassanakiccaṃ sādhentaṃ uppajjatīti.
Thus, it is solely by the power of the diffusion of the mind-made air element that the lower eyelid sinks down and the upper one lifts up; there is no one who opens it with a mechanism. Then, eye-consciousness arises, accomplishing the function of seeing.
Như vậy, chính nhờ sự hoạt động của ý nghĩ và sự lan tỏa của yếu tố gió mà mi mắt dưới hạ xuống, mi mắt trên nhấc lên; không có ai dùng máy móc để mở mắt cả. Từ đó, nhãn thức (cakkhuviññāṇa) phát sinh, hoàn thành chức năng nhìn thấy.
Evaṃ sampajānanaṃ panettha asammohasampajaññaṃ nāma.
Such clear comprehension in this matter is called clear comprehension of non-delusion.
Sự hiểu biết như vậy ở đây được gọi là Asammohasampajañña.
Tattha bhavaṅgaṃ upapattibhavassa aṅgakiccaṃ sādhayamānaṃ pavattati, taṃ āvaṭṭetvā kiriyamanodhātu āvajjanakiccaṃ sādhayamānā, tannirodhā cakkhuviññāṇaṃ dassanakiccaṃ sādhayamānaṃ, tannirodhā vipākamanodhātu sampaṭicchanakiccaṃ sādhayamānā, tannirodhā vipākamanoviññāṇadhātu santīraṇakiccaṃ sādhayamānā, tannirodhā kiriyamanoviññāṇadhātu voṭṭhabbapanakiccaṃ sādhayamānā, tannirodhā sattakkhattuṃ javanaṃ javati.
Therein, the bhavaṅga proceeds, accomplishing the function of being a factor of the existence of rebirth. Having turned that aside, the functional mind-element, accomplishing the function of adverting, arises. Upon its cessation, eye-consciousness, accomplishing the function of seeing, arises. Upon its cessation, the resultant mind-element, accomplishing the function of receiving, arises. Upon its cessation, the resultant mind-consciousness-element, accomplishing the function of investigating, arises. Upon its cessation, the functional mind-consciousness-element, accomplishing the function of determining, arises. Upon its cessation, the javana runs for seven moments.
Trong đó, bhavaṅga vận hành làm tròn phận sự là yếu tố của hữu thể tái sinh (upapattibhava). Sau khi bhavaṅga dao động, kiriyamanodhātu (ý môn hướng tâm) làm tròn phận sự hướng tâm (āvajjana). Sau khi ý môn hướng tâm ấy diệt, cakkhuviññāṇa (nhãn thức) làm tròn phận sự thấy (dassana). Sau khi nhãn thức ấy diệt, vipākamanodhātu (ý giới dị thục) làm tròn phận sự tiếp thọ (sampaṭicchana). Sau khi ý giới dị thục ấy diệt, vipākamanoviññāṇadhātu (ý thức giới dị thục) làm tròn phận sự quan sát (santīraṇa). Sau khi ý thức giới dị thục ấy diệt, kiriyamanoviññāṇadhātu (ý thức giới tác ý) làm tròn phận sự phân đoán (voṭṭhabbana). Sau khi ý thức giới tác ý ấy diệt, javana (tốc hành) khởi lên bảy lần.
Tattha paṭhamajavanepi ‘‘ayaṃ itthī, ayaṃ puriso’’ti rajjanadussanamuyhanavasena ālokitavilokitaṃ na hoti.
Therein, even at the first javana, looking and glancing does not occur with lust, aversion, or delusion, thinking, “This is a woman, this is a man.”
Trong đó, ngay cả trong tốc hành đầu tiên, sự nhìn ngó (ālokitavilokitaṃ) không xảy ra với sự tham đắm, sân hận, si mê theo kiểu “đây là phụ nữ, đây là đàn ông”.
Dutiyajavanepi…pe… sattamajavanepi.
At the second javana... and so on... at the seventh javana.
Cũng vậy, trong tốc hành thứ hai... cho đến tốc hành thứ bảy.
Etesu pana yuddhamaṇḍale yodhesu viya heṭṭhupariyavasena bhijjitvā patitesu ‘‘ayaṃ itthī, ayaṃ puriso’’ti rajjanādivasena ālokitavilokitaṃ hoti.
But when these have broken up and arisen sequentially, like warriors on a battlefield, then looking and glancing occurs with lust and so on, thinking, “This is a woman, this is a man.”
Tuy nhiên, khi những tốc hành này đã bị phá vỡ và suy tàn theo cách trên và dưới như những chiến binh trên chiến trường, thì sự nhìn ngó (ālokitavilokitaṃ) xảy ra với sự tham đắm, v.v., theo kiểu “đây là phụ nữ, đây là đàn ông”.
Evaṃ tāvettha mūlapariññāvasena asammohasampajaññaṃ veditabbaṃ.
Thus, in this matter, asammoha-sampajañña should be understood first by way of comprehending the root.
Như vậy, ở đây, sự hiểu biết rõ ràng không lầm lẫn (asammohasampajaññaṃ) cần được biết theo phương diện hiểu biết căn bản (mūlapariññāvasena).
Cakkhudvāre pana rūpe āpāthagate bhavaṅgacalanato uddhaṃ sakakiccaṃ nipphādanavasena āvajjanādīsu uppajjitvā niruddhesu avasāne javanaṃ uppajjati.
When a form has come into the focus of the eye-door, above the vibrating of the bhavaṅga, after adverting and so on have arisen and ceased by way of accomplishing their respective functions, at the end, the javana arises.
Khi sắc trần đi vào tầm mắt ở nhãn môn, sau sự dao động của bhavaṅga, các tâm āvajjana (hướng tâm), v.v., khởi lên và diệt đi, làm tròn phận sự riêng của chúng. Cuối cùng, javana (tốc hành) khởi lên.
Taṃ pubbe uppannānaṃ āvajjanādīnaṃ gehabhūte cakkhudvāre āgantukapuriso viya hoti.
It is like a visiting person in the eye-door, which is the house of the previously arisen adverting and so on.
Tốc hành ấy giống như một người khách đến nhãn môn, nơi mà các tâm āvajjana, v.v., đã khởi lên trước đó, giống như một ngôi nhà.
Tassa yathā paragehe kiñci yācituṃ paviṭṭhassa āgantukapurisassa gehasāmikesu tuṇhīmāsinesu āṇākaraṇaṃ na yuttaṃ.
Just as it is not proper for a visiting person who has entered another’s house to ask for something to give orders when the homeowners are sitting in silence,
Cũng như đối với một người khách vào nhà người khác để xin điều gì đó, nếu chủ nhà im lặng, thì việc ra lệnh của người khách ấy là không hợp lý.
Evaṃ āvajjanādīnaṃ gehabhūte cakkhudvāre āvajjanādīsupi arajjantesu adussantesu amuyhantesu ca rajjanadussanamuyhanaṃ ayuttanti evaṃ āgantukabhāvavasena asammohasampajaññaṃ veditabbaṃ.
so too, in the eye-door, which is the house of adverting and so on, when adverting and so on are without lust, without aversion, and without delusion, it is improper to have lust, aversion, and delusion. Thus, asammoha-sampajañña should be understood by way of its being like a visitor.
Cũng vậy, ở nhãn môn, nơi là ngôi nhà của āvajjana, v.v., khi āvajjana, v.v., không tham đắm, không sân hận, không si mê, thì sự tham đắm, sân hận, si mê là không hợp lý. Như vậy, sự hiểu biết rõ ràng không lầm lẫn (asammohasampajaññaṃ) cần được biết theo phương diện là kẻ khách (āgantukabhāvavasena).
Yāni pana tāni cakkhudvāre voṭṭhabbapanapariyosānāni cittāni uppajjanti, tāni saddhiṃ sampayuttadhammehi tattha tattheva bhijjanti, aññamaññaṃ na passantīti ittarāni tāvakālikāni honti.
Furthermore, those states of consciousness that arise in the eye-door, ending with determining, break up right then and there, together with their associated states; they do not see one another. Thus they are minor and momentary.
Những tâm khởi lên ở nhãn môn, kết thúc bằng voṭṭhabbana (phân đoán), cùng với các pháp tương ưng của chúng, đều bị diệt ngay tại đó, không thấy lẫn nhau. Do đó, chúng là những tâm tạm thời, tồn tại trong chốc lát.
Tattha yathā ekasmiṃ ghare sabbesu mānusakesu matesu avasesassa ekassa taṅkhaṇeññeva maraṇadhammassa na yuttā naccagītādīsu abhirati nāma, evameva ekadvāre sasampayuttesu āvajjanādīsu tattha tattheva matesu avasesassa taṅkhaṇeññeva maraṇadhammassa javanassāpi rajjanadussanamuyhanavasena abhirati nāma na yuttāti evaṃ tāvakālikabhāvavasena asammohasampajaññaṃ veditabbaṃ.
Just as, when all the people in a house have died, it is not proper for the one remaining, who is himself subject to death at that very moment, to take delight in dancing, singing, and so on; so too, in a single sense-door, when adverting and the rest, along with their associated states, have died right then and there, it is not proper for the remaining javana, which is itself subject to death at that very moment, to take delight with lust, aversion, and delusion. Thus, asammoha-sampajañña should be understood by way of its being momentary.
Trong đó, cũng như trong một ngôi nhà, khi tất cả mọi người đã chết, thì việc một người còn lại, mà bản chất là phải chết ngay trong khoảnh khắc đó, say mê nhảy múa ca hát, v.v., là không hợp lý. Cũng vậy, ở một môn, khi các tâm āvajjana, v.v., cùng với các pháp tương ưng của chúng, đã diệt ngay tại đó, thì việc javana (tốc hành), mà bản chất là phải diệt ngay trong khoảnh khắc đó, say mê tham đắm, sân hận, si mê là không hợp lý. Như vậy, sự hiểu biết rõ ràng không lầm lẫn (asammohasampajaññaṃ) cần được biết theo phương diện là tạm thời (tāvakālikabhāvavasena).
Apica khandhāyatanadhātupaccayapaccavekkhaṇavasenapetaṃ veditabbaṃ.
Furthermore, it should also be understood by way of reviewing the aggregates, sense bases, elements, and conditions.
Hơn nữa, điều này cũng cần được biết theo phương diện quán xét các uẩn (khandha), xứ (āyatana), giới (dhātu) và duyên (paccaya).
Ettha hi cakkhu ceva rūpañca rūpakkhandho, dassanaṃ viññāṇakkhandho, taṃsampayuttā vedanā vedanākkhandho, saññā saññākkhandho, phassādikā saṅkhārakkhandho.
Herein, the eye and form are the form aggregate; seeing is the consciousness aggregate; the feeling associated with it is the feeling aggregate; perception is the perception aggregate; contact and the rest are the formations aggregate.
Ở đây, mắt và sắc là sắc uẩn (rūpakkhandho); sự thấy là thức uẩn (viññāṇakkhandho); thọ tương ưng với nó là thọ uẩn (vedanākkhandho); tưởng là tưởng uẩn (saññākkhandho); các pháp như xúc là hành uẩn (saṅkhārakkhandho).
Evametesaṃ pañcannaṃ khandhānaṃ samavāye ālokanavilokanaṃ paññāyati.
Thus, when these five aggregates converge, looking and glancing is discerned.
Như vậy, khi năm uẩn này kết hợp lại, sự nhìn thẳng và nhìn nghiêng (ālokanavilokanaṃ) được nhận biết.
Tattha ko eko āloketi, ko viloketi?
Therein, what single thing looks? What single thing glances?
Trong đó, ai là người nhìn thẳng, ai là người nhìn nghiêng?
Tathā cakkhu cakkhāyatanaṃ, rūpaṃ rūpāyatanaṃ, dassanaṃ manāyatanaṃ, vedanādayo sampayuttadhammā dhammāyatanaṃ.
Similarly, the eye is the eye-base, form is the form-base, seeing is the mind-base, and the associated states of feeling and so on are the dhamma-base.
Cũng vậy, mắt là nhãn xứ (cakkhāyatanaṃ); sắc là sắc xứ (rūpāyatanaṃ); sự thấy là ý xứ (manāyatanaṃ); các pháp tương ưng như thọ là pháp xứ (dhammāyatanaṃ).
Evametesaṃ catunnaṃ āyatanānaṃ samavāye ālokanavilokanaṃ paññāyati.
Thus, when these four sense bases converge, looking and glancing is discerned.
Như vậy, khi bốn xứ này kết hợp lại, sự nhìn thẳng và nhìn nghiêng (ālokanavilokanaṃ) được nhận biết.
Tattha ko eko āloketi, ko viloketi?
Therein, what single thing looks? What single thing glances?
Trong đó, ai là người nhìn thẳng, ai là người nhìn nghiêng?
Tathā cakkhu cakkhudhātu, rūpaṃ rūpadhātu, dassanaṃ cakkhuviññāṇadhātu, taṃsampayuttā vedanādayo dhammadhātu.
Similarly, the eye is the eye-element, form is the form-element, seeing is the eye-consciousness-element, and the associated states of feeling and so on are the dhamma-element.
Cũng vậy, mắt là nhãn giới (cakkhudhātu); sắc là sắc giới (rūpadhātu); sự thấy là nhãn thức giới (cakkhuviññāṇadhātu); các pháp tương ưng như thọ là pháp giới (dhammadhātu).
Evametāsaṃ catunnaṃ dhātūnaṃ samavāye ālokanavilokanaṃ paññāyati.
Thus, when these four elements converge, looking and glancing is discerned.
Như vậy, khi bốn giới này kết hợp lại, sự nhìn thẳng và nhìn nghiêng (ālokanavilokanaṃ) được nhận biết.
Tattha ko eko āloketi, ko viloketi?
Therein, what single thing looks? What single thing glances?
Trong đó, ai là người nhìn thẳng, ai là người nhìn nghiêng?
Tathā cakkhu nissayapaccayo, rūpaṃ ārammaṇapaccayo, āvajjanaṃ anantarasamanantarūpanissayanatthivigatapaccayo, āloko upanissayapaccayo vedanādayo sahajātapaccayo.
Similarly, the eye is the support condition; form is the object condition; adverting is the proximity, contiguity, decisive support, absence, and disappearance conditions; light is the strong dependence condition; and feeling and so on are the conascence condition.
Cũng vậy, mắt là duyên nương tựa (nissayapaccayo); sắc là duyên đối tượng (ārammaṇapaccayo); āvajjana (hướng tâm) là duyên vô gián (anantarapaccayo), duyên đẳng vô gián (samanantarapaccayo), duyên vô gián y chỉ (anantarūpanissayapaccayo), duyên bất hữu (natthipaccayo), duyên ly khứ (vigatapaccayo); ánh sáng là duyên cận y (upanissayapaccayo); các pháp như thọ là duyên câu sinh (sahajātapaccayo).
Evametesaṃ paccayānaṃ samavāye ālokanavilokanaṃ paññāyati.
Thus, when these conditions converge, looking and glancing is discerned.
Như vậy, khi các duyên này kết hợp lại, sự nhìn thẳng và nhìn nghiêng (ālokanavilokanaṃ) được nhận biết.
Tattha ko eko āloketi, ko viloketīti?
Therein, what single thing looks? What single thing glances?
Trong đó, ai là người nhìn thẳng, ai là người nhìn nghiêng?
Evamettha khandhāyatanadhātupaccayapaccavekkhaṇavasenapi asammohasampajaññaṃ veditabbaṃ.
Thus, in this matter, asammoha-sampajañña should also be understood by way of reviewing the aggregates, sense bases, elements, and conditions.
Như vậy, ở đây, sự hiểu biết rõ ràng không lầm lẫn (asammohasampajaññaṃ) cũng cần được biết theo phương diện quán xét các uẩn, xứ, giới và duyên.
Samiñjite pasāriteti pabbānaṃ samiñjanapasāraṇe.
In flexing and extending means in the flexing and extending of the joints.
Samiñjite pasārite (khi co lại, khi duỗi ra) là sự co duỗi của các chi.
Tattha cittavaseneva samiñjanapasāraṇaṃ akatvā hatthapādānaṃ samiñjanapasāraṇapaccayā atthānatthaṃ pariggahetvā atthapariggahaṇaṃ sātthakasampajaññaṃ.
Therein, not flexing and extending merely by the power of the mind, but grasping the benefit and harm resulting from the flexing and extending of the hands and feet—this grasping of the benefit is the clear comprehension of purpose.
Trong đó, không thực hiện sự co duỗi tay chân chỉ theo ý muốn của tâm, mà phải xem xét lợi ích và bất lợi của sự co duỗi tay chân, rồi thực hiện sự co duỗi có lợi ích, đó là Sātthakasampajañña (chánh niệm về lợi ích).
Tattha hatthapāde aticiraṃ samiñjetvā pasāretvā eva vā ṭhitassa khaṇe khaṇe vedanā uppajjanti, cittaṃ ekaggaṃ na labhati, kammaṭṭhānaṃ paripatati, visesaṃ nādhigacchati.
Therein, for one who remains with hands and feet either flexed or extended for too long, feelings arise moment after moment, the mind does not attain one-pointedness, the meditation subject deteriorates, and one does not attain any special state.
Trong đó, nếu một người giữ tay chân co hoặc duỗi quá lâu, thì cảm thọ sẽ liên tục khởi lên, tâm không thể định tĩnh, đề mục thiền bị suy yếu, và không đạt được sự tiến bộ đặc biệt.
Kāle samiñjentassa kāle pasārentassa pana tā vedanā na uppajjanti, cittaṃ ekaggaṃ hoti, kammaṭṭhānaṃ phātiṃ gacchati, visesamadhigacchatīti evaṃ atthānatthapariggahaṇaṃ veditabbaṃ.
But for one who flexes at the proper time and extends at the proper time, those feelings do not arise, the mind becomes one-pointed, the meditation subject flourishes, and one attains a special state. Thus, the grasping of benefit and harm should be understood.
Tuy nhiên, nếu một người co duỗi đúng lúc, thì những cảm thọ ấy sẽ không khởi lên, tâm sẽ định tĩnh, đề mục thiền sẽ phát triển, và đạt được sự tiến bộ đặc biệt. Như vậy, sự xem xét lợi ích và bất lợi cần được biết.
Atthe pana satipi sappāyāsappāyaṃ pariggaṇhitvā sappāyapariggahaṇaṃ sappāyasampajaññaṃ.
Even when there is a purpose, grasping what is suitable after considering the suitable and unsuitable—this grasping of the suitable is the clear comprehension of suitability.
Ngay cả khi có lợi ích, việc xem xét sự thích hợp và không thích hợp, rồi thực hiện điều thích hợp, đó là Sappāyasampajañña (chánh niệm về sự thích hợp).
Tatrāyaṃ nayo – mahācetiyaṅgaṇe kira daharabhikkhū sajjhāyaṃ gaṇhanti.
Herein, this is the method: It is said that young monks were reciting in the courtyard of the Great Stupa.
Đây là một ví dụ: Tại sân Đại Tháp (Mahācetiyaṅgaṇa), các tỳ khưu trẻ đang tụng kinh.
Tesaṃ piṭṭhipasse daharabhikkhuniyo dhammaṃ suṇanti.
Behind them, young nuns were listening to the Dhamma.
Phía sau họ, các tỳ khưu ni trẻ đang nghe pháp.
Tatreko daharo hatthaṃ pasārento kāyasaṃsaggaṃ patvā teneva kāraṇena gihī jāto.
There, one young monk, while extending his hand, came into physical contact, and for that very reason, he became a layman.
Trong số đó, một tỳ khưu trẻ duỗi tay ra, chạm vào thân thể của một tỳ khưu ni, và vì lý do đó mà hoàn tục.
Aparopi bhikkhu pādaṃ pasārento aggimhi pasāresi, aṭṭhiṃ āhacca pādo jhāyi.
Another monk, extending his foot, extended it into a fire; the foot was burned, hitting the bone.
Một tỳ khưu khác duỗi chân ra, chạm vào lửa, xương bị cháy.
Aparo vammike pasāresi, so āsīvisena daṭṭho.
Another extended it onto an anthill; he was bitten by a venomous snake.
Một người khác duỗi chân vào tổ mối, và bị rắn độc cắn.
Aparo cīvarakuṭidaṇḍake pasāresi, taṃ maṇisappo ḍaṃsi.
Another extended it onto the pole of a robe hut; he was bitten by a green snake.
Một người khác duỗi tay vào cọc treo y, và bị rắn ngọc cắn.
Tasmā evarūpe asappāye apasāretvā sappāye pasāretabbaṃ.
Therefore, one should not extend in such an unsuitable place but should extend in a suitable one.
Do đó, không nên duỗi tay chân vào những nơi không thích hợp như vậy, mà nên duỗi vào những nơi thích hợp.
Idamettha sappāyasampajaññaṃ.
This is the clear comprehension of suitability in this context.
Đây chính là Sappāyasampajañña (chánh niệm về sự thích hợp) ở đây.
Gocarasampajaññaṃ pana mahātheravatthunā dīpetabbaṃ – mahāthero kira divāṭṭhāne nisinno antevāsikehi saddhiṃ kathayamāno sahasā hatthaṃ samiñjetvā puna yathāṭhāne ṭhapetvā saṇikaṃ samiñjesi.
The clear comprehension of the domain should be illustrated by the story of the great elder. It is said that the great elder, while sitting in his day-dwelling and talking with his resident pupils, suddenly flexed his hand, then placed it back in its original position and flexed it slowly.
Gocarasampajañña (chánh niệm về đối tượng hành thiền) cần được giải thích bằng câu chuyện về vị Đại Trưởng Lão: Nghe nói, vị Đại Trưởng Lão đang ngồi ở nơi trú ngụ ban ngày, nói chuyện với các đệ tử, bỗng nhiên co tay lại, rồi đặt về vị trí cũ, sau đó từ từ co lại.
Taṃ antevāsikā pucchiṃsu ‘‘kasmā bhante sahasā hatthaṃ samiñjetvā puna yathāṭhāne ṭhapetvā saṇikaṃ samiñjayitthā’’ti.
His resident pupils asked him, “Venerable sir, why did you suddenly flex your hand, then place it back in its original position and flex it slowly?”
Các đệ tử hỏi Ngài: “Bạch Ngài, vì sao Ngài bỗng nhiên co tay lại, rồi đặt về vị trí cũ, sau đó từ từ co lại?”
Yato paṭṭhāyāhaṃ, āvuso, kammaṭṭhānaṃ manasikātuṃ āraddho, na me kammaṭṭhānaṃ muñcitvā hattho samiñjitapubbo, idāni pana tumhehi saddhiṃ kathayamānena kammaṭṭhānaṃ muñcitvā samiñjito, tasmā puna yathāṭhāne ṭhapetvā samiñjesinti.
“Friends, from the time I began to practice my meditation subject, I have never flexed my hand without adverting to the meditation subject. But just now, while talking with you, I flexed it without adverting to the meditation subject. Therefore, I placed it back in its original position and flexed it again.”
Ngài đáp: “Này các hiền giả, từ khi ta bắt đầu chú tâm vào đề mục thiền, ta chưa bao giờ co tay mà không có đề mục thiền. Nhưng bây giờ, khi đang nói chuyện với các con, ta đã co tay mà không có đề mục thiền, vì vậy ta đã đặt tay về vị trí cũ rồi co lại.”
Sādhu, bhante, bhikkhunā nāma evarūpena bhavitabbanti.
“Excellent, venerable sir, a monk should indeed be like that.”
“Bạch Ngài, thật tốt lành! Một tỳ khưu nên là người như vậy!”
Evametthāpi kammaṭṭhānāvijahanameva gocarasampajaññanti veditabbaṃ.
Thus, here too, the non-abandonment of the meditation subject should be understood as the clear comprehension of the domain.
Như vậy, ở đây, việc không rời bỏ đề mục thiền chính là Gocarasampajañña (chánh niệm về đối tượng hành thiền).
Saṅghāṭipattacīvaradhāraṇeti ettha saṅghāṭicīvarānaṃ nivāsanapārupanavasena pattassa bhikkhāpaṭiggahaṇādivasena paribhogo dhāraṇaṃ nāma.
In the bearing of the outer robe, bowl, and robe, here, the use of the saṅghāṭī and robe by way of wearing and putting on, and of the bowl by way of receiving almsfood and so on, is called bearing.
Trong cụm từ saṅghāṭipattacīvaradhāraṇe (khi mang y saṅghāṭī, bát và y), việc sử dụng y saṅghāṭī và y để mặc và đắp, và sử dụng bát để nhận đồ khất thực v.v... được gọi là sự mang giữ (dhāraṇa).
Tattha saṅghāṭicīvaradhāraṇe tāva nivāsetvā pārupitvā ca piṇḍāya carato āmisalābho ‘‘sītassa paṭighātāyā’’tiādinā nayena bhagavatā vuttappakāroyeva ca attho attho nāma.
Therein, regarding the bearing of the saṅghāṭī and robe, for one who wanders for almsfood after having worn and put them on, the benefit is the gain of material things; and the benefit, called purpose, is of the very kind stated by the Blessed One in the manner beginning with "for the warding off of cold."
Trong số đó, trước hết, khi mang y saṅghāṭī và y, việc mặc và đắp y rồi đi khất thực, sự thọ dụng vật thực là lợi ích (attha) như đã được Đức Phật dạy theo cách thức "để ngăn ngừa cái lạnh" v.v...
Tassa vasena sātthakasampajaññaṃ veditabbaṃ.
By means of that, the clear comprehension of purpose should be understood.
Theo ý nghĩa đó, cần biết đó là sự tỉnh giác về mục đích (sātthakasampajañña).
Uṇhapakatikassa pana dubbalassa ca cīvaraṃ sukhumaṃ sappāyaṃ.
For one of a hot nature and for one who is weak, a fine robe is suitable.
Tuy nhiên, đối với người có bản chất nóng bức và yếu ớt, y mỏng là thích hợp (sappāya).
Sītālukassa ghanaṃ dupaṭṭaṃ.
For one sensitive to cold, a thick, double-layered robe is suitable.
Đối với người sợ lạnh, y dày, hai lớp là thích hợp.
Viparītaṃ asappāyaṃ.
The opposite is unsuitable.
Ngược lại là không thích hợp (asappāya).
Yassa kassaci jiṇṇaṃ asappāyameva.
For anyone, a worn-out robe is simply unsuitable.
Đối với bất kỳ ai, y cũ nát đều không thích hợp.
Aggaḷādidāne hissa taṃ palibodhakaraṃ hoti.
For in giving a patch, it becomes a cause of obstruction for him.
Vì nó sẽ trở thành chướng ngại cho việc cài then cửa v.v...
Tathā paṭṭuṇṇadukūlādibhedaṃ lobhanīyacīvaraṃ.
Likewise, a desirable robe of a kind such as silk, wool, or fine linen is unsuitable.
Tương tự, y rực rỡ như vải lụa, vải len, vải dukūla v.v... là y dễ gây tham ái.
Tādisañhi araññe ekakassa nivāsantarāyakaraṃ jīvitantarāyakaraṃ vāpi hoti.
For such a thing can be a danger to the wearing or even a danger to the life of one dwelling alone in the forest.
Vì một chiếc y như vậy có thể gây nguy hiểm cho chỗ ở hoặc thậm chí nguy hiểm đến tính mạng của một vị sống một mình trong rừng.
Nippariyāyena pana yaṃ nimittakammādimicchājīvavasena uppannaṃ, yañcassa sevamānassa akusalā dhammā abhivaḍḍhanti, kusalā dhammā parihāyanti, taṃ asappāyaṃ.
Unreservedly, however, that which is produced by way of wrong livelihood such as making signs, and that which, when used by him, causes unwholesome states to increase and wholesome states to decline—that is unsuitable.
Tuy nhiên, một cách tuyệt đối, bất kỳ chiếc y nào có được do tà mạng như bói toán, làm bùa chú v.v..., và khi vị ấy sử dụng, các pháp bất thiện tăng trưởng, các pháp thiện suy giảm, thì chiếc y đó hoàn toàn không thích hợp.
Viparītaṃ sappāyaṃ.
The opposite is suitable.
Ngược lại là thích hợp.
Tassa vasenettha sappāyasampajaññaṃ, kammaṭṭhānāvijahanavaseneva ca gocarasampajaññaṃ veditabbaṃ.
By means of that, the clear comprehension of suitability should be understood here, and by means of not abandoning the meditation subject, the clear comprehension of the domain should be understood.
Theo ý nghĩa đó, ở đây cần biết đó là sự tỉnh giác về sự thích hợp (sappāyasampajañña), và sự tỉnh giác về phạm vi hành trì (gocarasampajañña) do không từ bỏ đề mục thiền quán.
Abbhantare attā nāma koci cīvaraṃ pārupanto natthi.
Within, there is no self who puts on the robe.
Bên trong, không có cái gọi là tự ngã (atta) nào đang đắp y.
Vuttappakāracittakiriyavāyodhātuvipphāreneva pana cīvarapārupanaṃ hoti.
But, only by the diffusion of the wind element produced by mind in the aforesaid manner does the putting on of the robe occur.
Tuy nhiên, việc đắp y xảy ra do sự lan tỏa của phong đại được thực hiện bởi tâm như đã nói.
Tattha cīvarampi acetanaṃ, kāyopi acetano.
Therein, the robe is insentient, and the body is insentient.
Ở đây, y cũng là vô tri, thân cũng là vô tri.
Cīvaraṃ na jānāti ‘‘mayā kāyo pāruto’’ti.
The robe does not know, "I have been put on by the body."
Y không biết "ta được thân đắp".
Kāyopi na jānāti ‘‘ahaṃ cīvarena pāruto’’ti, dhātuyova dhātusamūhaṃ paṭicchādenti paṭapilotikāya potthakarūpapaṭicchādane viya.
The body, too, does not know, "I am covered by the robe." It is just elements covering a collection of elements, like covering a puppet made of clay with a piece of cloth.
Thân cũng không biết "ta được y đắp", mà chỉ là các yếu tố (dhātu) che phủ một tập hợp các yếu tố, giống như việc che phủ một hình nộm bằng một mảnh vải cũ.
Tasmā neva sundaraṃ cīvaraṃ labhitvā somanassaṃ kātabbaṃ, na asundaraṃ labhitvā domanassaṃ.
Therefore, one should not feel gladness on receiving a beautiful robe, nor displeasure on receiving an unbeautiful one.
Vì vậy, không nên vui mừng khi nhận được y đẹp, cũng không nên buồn rầu khi nhận được y không đẹp.
Nāgavammikacetiyarukkhādīsu hi keci mālāgandhadhūmavatthādīhi sakkāraṃ karonti, keci gūthamuttakaddamadaṇḍasatthappahārādīhi asakkāraṃ, na te nāgavammikarukkhādayo somanassaṃ vā domanassaṃ vā karonti; evameva neva sundaraṃ cīvaraṃ labhitvā somanassaṃ kātabbaṃ, na asundaraṃ labhitvā domanassanti evaṃ pavattapaṭisaṅkhānavasena panettha asammohasampajaññaṃ veditabbaṃ.
For, in regard to anthills, cetiyas, trees, and so on, some make offerings with garlands, scents, incense, cloth, and so on, while some show disrespect with feces, urine, mud, blows from sticks and weapons, and so on, but those anthills, trees, and so on feel neither gladness nor displeasure; just so, one should not feel gladness on receiving a beautiful robe, nor displeasure on receiving an unbeautiful one. Thus, by way of reflection that proceeds in this way, the clear comprehension of non-delusion should be understood here.
Vì, một số người cúng dường bằng vòng hoa, hương, khói, vải vóc v.v... cho các hang rắn, tháp, cây cối v.v..., một số người lại bất kính bằng cách phóng uế, tiểu tiện, ném bùn, đánh đập bằng gậy, dao v.v..., nhưng các hang rắn, cây cối đó không vui mừng hay buồn rầu; cũng vậy, không nên vui mừng khi nhận được y đẹp, cũng không nên buồn rầu khi nhận được y không đẹp. Theo cách quán xét như vậy, ở đây cần biết đó là sự tỉnh giác không lầm lẫn (asammohasampajañña).
Kisadubbalasarīrassa pana garu patto asappāyo.
For one with a lean and weak body, a heavy bowl is unsuitable.
Tuy nhiên, đối với người thân thể gầy yếu, bát nặng là không thích hợp.
Yassa kassaci catupañcagaṇḍikāhato dubbisodhanīyo asappāyova.
For anyone, a bowl mended with four or five patches, which is difficult to clean, is simply unsuitable.
Đối với bất kỳ ai, bát có bốn năm chỗ vá, khó rửa sạch, thì hoàn toàn không thích hợp.
Duddhotapatto hi na vaṭṭati, taṃ dhovantasseva cassa palibodho hoti.
For a bowl that is difficult to wash is not allowable, and for him, just washing it becomes an obstruction.
Vì bát khó rửa không được phép, và việc rửa nó sẽ gây chướng ngại cho vị ấy.
Maṇivaṇṇapatto pana lobhanīyo cīvare vuttanayeneva asappāyo.
A bowl the color of a gem, however, is desirable, and is unsuitable in the same way as was said for the robe.
Tuy nhiên, bát có màu sắc lộng lẫy như ngọc là bát dễ gây tham ái, không thích hợp theo cách đã nói về y.
Nimittakammādivasena laddho pana yañcassa sevamānassa akusalā dhammā abhivaḍḍhanti, kusalā dhammā parihāyanti, ayaṃ ekantaasappāyova.
But one that is obtained by way of making signs and so on, and that which, when used by him, causes unwholesome states to increase and wholesome states to decline—this is entirely unsuitable.
Tuy nhiên, bát có được do bói toán v.v..., và khi vị ấy sử dụng, các pháp bất thiện tăng trưởng, các pháp thiện suy giảm, thì bát này hoàn toàn không thích hợp.
Viparīto sappāyo.
The opposite is suitable.
Ngược lại là thích hợp.
Tassa vasenettha sappāyasampajaññaṃ, kammaṭṭhānāvijahanavaseneva ca gocarasampajaññaṃ veditabbaṃ.
By means of that, the clear comprehension of suitability should be understood here, and by means of not abandoning the meditation subject, the clear comprehension of the domain should be understood.
Theo ý nghĩa đó, ở đây cần biết đó là sự tỉnh giác về sự thích hợp (sappāyasampajañña), và sự tỉnh giác về phạm vi hành trì (gocarasampajañña) do không từ bỏ đề mục thiền quán.
Abbhantare attā nāma koci pattaṃ gaṇhanto natthi.
Within, there is no self who takes the bowl.
Bên trong, không có cái gọi là tự ngã (atta) nào đang cầm bát.
Vuttappakāracittakiriyavāyodhātuvipphāreneva pana pattaggahaṇaṃ nāma hoti.
But, only by the diffusion of the wind element produced by mind in the aforesaid manner does the taking of the bowl occur.
Tuy nhiên, việc cầm bát xảy ra do sự lan tỏa của phong đại được thực hiện bởi tâm như đã nói.
Tattha pattopi acetano, hatthāpi acetanā.
Therein, the bowl is insentient, and the hands are insentient.
Ở đây, bát cũng là vô tri, tay cũng là vô tri.
Patto na jānāti ‘‘ahaṃ hatthehi gahito’’ti.
The bowl does not know, "I am taken by the hands."
Bát không biết "ta được tay cầm".
Hatthāpi na jānanti ‘‘patto amhehi gahito’’ti.
The hands, too, do not know, "The bowl is taken by us."
Tay cũng không biết "bát được chúng ta cầm".
Dhātuyova dhātusamūhaṃ gaṇhanti saṇḍāsena aggivaṇṇapattaggahaṇe viyāti evaṃ pavattapaṭisaṅkhānavasenettha asammohasampajaññaṃ veditabbaṃ.
It is just elements taking a collection of elements, like taking a piece of red-hot iron with tongs. Thus, by way of reflection that proceeds in this way, the clear comprehension of non-delusion should be understood here.
Chỉ là các yếu tố (dhātu) nắm giữ một tập hợp các yếu tố, giống như việc dùng kẹp để cầm một miếng vàng nóng. Theo cách quán xét như vậy, ở đây cần biết đó là sự tỉnh giác không lầm lẫn (asammohasampajañña).
Apica yathā chinnahatthapāde vaṇamukhehi paggharitapubbalohitakimikule nīlamakkhikasamparikiṇṇe anāthasālāyaṃ nipanne anāthamanusse disvā dayālukā purisā tesaṃ vaṇapaṭṭacoḷakāni ceva kapālādīhi ca bhesajjāni upanāmenti.
Furthermore, compassionate men, upon seeing helpless people with severed hands and feet, with pus and blood flowing from the openings of their wounds, full of maggots, swarmed by blue flies, lying in a hospice, bring them bandages for their wounds and also medicines in clay cups.
Hơn nữa, giống như khi những người có lòng từ bi thấy những người khốn khổ nằm trong nhà tạm trú, với tay chân bị cắt, mủ và máu chảy ra từ vết thương, ruồi nhặng xanh bu đầy, họ mang đến cho những người đó vải băng vết thương và thuốc men trong các bát sành v.v...
Tattha coḷakānipi kesañci saṇhāni, kesañci thūlāni pāpuṇanti.
Therein, some get fine cloths, while others get coarse ones.
Trong số đó, có những mảnh vải mịn màng cho một số người, và những mảnh vải thô ráp cho một số người khác.
Bhesajjakapālakānipi kesañci susaṇṭhānāni, kesañci dussaṇṭhānāni pāpuṇanti, na te tattha sumanā vā dummanā vā honti.
Some get well-shaped medicine cups, while others get ill-shaped ones, yet they are not happy or sad about it.
Những bát sành đựng thuốc cũng có cái đẹp đẽ cho một số người, và cái xấu xí cho một số người khác, nhưng những người đó không vui mừng hay buồn rầu.
Vaṇappaṭicchādanamatteneva hi coḷakena bhesajjapaṭiggahaṇamatteneva ca kapālakena tesamattho, evameva yo bhikkhu vaṇacoḷakaṃ viya cīvaraṃ, bhesajjakapālakaṃ viya pattaṃ, kapāle bhesajjamiva ca patte laddhaṃ bhikkhaṃ sallakkheti.
For their purpose is served simply by a cloth sufficient to cover the wound and by a cup sufficient to receive the medicine. In the very same way, there is the bhikkhu who considers the robe to be like a bandage for a wound, the bowl to be like a medicine cup, and the almsfood received in the bowl to be like medicine in the cup.
Vì đối với họ, mục đích chỉ là che vết thương bằng mảnh vải và nhận thuốc bằng bát sành. Cũng vậy, vị tỳ khưu nào quán xét y như mảnh vải băng vết thương, bát như bát sành đựng thuốc, và đồ khất thực nhận được trong bát như thuốc trong bát sành.
Ayaṃ saṅghāṭipattacīvaradhāraṇe asammohasampajaññena uttamasampajānakārīti veditabbo.
He should be known as one who practices the supreme clear comprehension through the clear comprehension of non-delusion in the bearing of the outer robe, bowl, and robe.
Vị ấy cần được biết là người thực hành sự tỉnh giác tối thượng (uttamasampajānakārī) với sự tỉnh giác không lầm lẫn (asammohasampajañña) trong việc mang y saṅghāṭī, bát và y.
Asitādīsu asiteti piṇḍapātabhojane.
In regard to eating and so on, when one has eaten means in the eating of almsfood.
Trong các từ asitādīsu (ăn, uống v.v...), asite có nghĩa là khi ăn đồ khất thực.
Pīteti yāguādipāne.
When one has drunk means in the drinking of gruel and so on.
Pīte có nghĩa là khi uống cháo v.v...
Khāyiteti piṭṭhakhajjakādikhādane.
When one has chewed means in the chewing of cakes, savories, and so on.
Khāyite có nghĩa là khi nhai bánh bột v.v...
Sāyiteti madhuphāṇitādisāyane.
When one has tasted means in the tasting of honey, molasses, and so on.
Sāyite có nghĩa là khi nếm mật ong, đường phèn v.v...
Tattha ‘‘neva davāyā’’tiādinā nayena vutto aṭṭhavidhopi attho attho nāma.
Therein, the eightfold purpose stated in the way beginning "not for amusement" is called purpose.
Ở đây, lợi ích tám loại được nói theo cách "không phải để vui đùa" v.v... được gọi là lợi ích (attha).
Tassa vasena sātthakasampajaññaṃ veditabbaṃ.
By means of that, the clear comprehension of purpose should be understood.
Theo ý nghĩa đó, cần biết đó là sự tỉnh giác về mục đích (sātthakasampajañña).
Lūkhapaṇītatittamadhurādīsu pana yena bhojanena yassa aphāsu hoti, taṃ tassa asappāyaṃ.
But among coarse and fine, bitter and sweet foods, whatever food is uncomfortable for someone, that is unsuitable for him.
Tuy nhiên, trong các loại thức ăn thô, tinh, đắng, ngọt v.v..., thức ăn nào gây khó chịu cho ai thì thức ăn đó không thích hợp (asappāya) cho người ấy.
Yaṃ pana nimittakammādivasena paṭiladdhaṃ, yañcassa bhuñjato akusalā dhammā abhivaḍḍhanti, kusalā dhammā parihāyanti, taṃ ekantaasappāyameva.
And that which is obtained by way of making signs and so on, and that which, when he eats it, causes unwholesome states to increase and wholesome states to decline, that is entirely unsuitable.
Tuy nhiên, thức ăn nào có được do bói toán v.v..., và khi vị ấy ăn, các pháp bất thiện tăng trưởng, các pháp thiện suy giảm, thì thức ăn đó hoàn toàn không thích hợp.
Viparītaṃ sappāyaṃ.
The opposite is suitable.
Ngược lại là thích hợp.
Tassa vasenettha sappāyasampajaññaṃ, kammaṭṭhānāvijahanavaseneva ca gocarasampajaññaṃ veditabbaṃ.
By means of that, the clear comprehension of suitability should be understood here, and by means of not abandoning the meditation subject, the clear comprehension of the domain should be understood.
Theo ý nghĩa đó, ở đây cần biết đó là sự tỉnh giác về sự thích hợp (sappāyasampajañña), và sự tỉnh giác về phạm vi hành trì (gocarasampajañña) do không từ bỏ đề mục thiền quán.
Abbhantare attā nāma koci bhuñjako natthi, vuttappakāracittakiriyavāyodhātuvipphāravaseneva pana pattapaṭiggahaṇaṃ nāma hoti.
Within, there is no self who eats. But it is only by means of the diffusion of the wind element produced by mind in the aforesaid manner that the receiving of the bowl occurs.
Bên trong, không có cái gọi là người ăn (bhuñjako) nào, tuy nhiên, việc nhận bát xảy ra do sự lan tỏa của phong đại được thực hiện bởi tâm như đã nói.
Cittakiriyavāyodhātuvipphāreneva hatthassa patte otāraṇaṃ nāma hoti.
Only by the diffusion of the wind element produced by mind does the lowering of the hand into the bowl occur.
Việc đưa tay vào bát xảy ra do sự lan tỏa của phong đại được thực hiện bởi tâm.
Cittakiriyavāyodhātuvipphāreneva ālopakaraṇaṃ ālopauddharaṇaṃ mukhavivaraṇañca hoti.
Only by the diffusion of the wind element produced by mind do the making of a morsel, the lifting of the morsel, and the opening of the mouth occur.
Việc tạo thành nắm cơm, đưa nắm cơm lên và mở miệng cũng xảy ra do sự lan tỏa của phong đại được thực hiện bởi tâm.
Na koci kuñcikāya yantakena ca hanukaṭṭhīni vivarati, cittakiriyavāyodhātuvipphāreneva ālopassa mukhe ṭhapanaṃ, uparidantānaṃ musalakiccasādhanaṃ, heṭṭhādantānaṃ udukkhalakiccasādhanaṃ, jivhāya hatthakiccasādhanañca hoti.
No one opens the jawbones with a key or a machine. Only by the diffusion of the wind element produced by mind does the placing of the morsel in the mouth occur, and do the upper teeth accomplish the task of a pestle, the lower teeth accomplish the task of a mortar, and the tongue accomplish the task of a hand.
Không ai dùng chìa khóa hay máy móc để mở xương hàm, mà việc đặt nắm cơm vào miệng, răng trên làm nhiệm vụ chày, răng dưới làm nhiệm vụ cối, và lưỡi làm nhiệm vụ tay, đều xảy ra do sự lan tỏa của phong đại được thực hiện bởi tâm.
Iti taṃ tattha aggajivhāya tanukakheḷo mūlajivhāya bahalakheḷo makkheti.
Thus, there the thin saliva from the tip of the tongue and the thick saliva from the base of the tongue moisten it.
Như vậy, ở đó, đầu lưỡi phết nước bọt loãng, gốc lưỡi phết nước bọt đặc.
Taṃ heṭṭhādantaudukkhale jivhāhatthaparivattitaṃ kheḷaudakatemitaṃ uparidantamusalasañcuṇṇitaṃ koci kaṭacchunā vā dabbiyā vā antopavesento nāma natthi, vāyodhātuyāva pavisati.
No one causes that which has been turned over by the hand of the tongue, moistened by the water of saliva, and ground by the pestle of the upper teeth in the mortar of the lower teeth, to enter inside with a spoon or a ladle; it enters by the wind element alone.
Thức ăn đó, được lưỡi như tay đảo qua đảo lại trong cối là hàm răng dưới, được nước bọt làm ướt, được hàm răng trên như chày nghiền nát, không ai dùng muỗng hay vá mà đưa vào bên trong, mà chính phong đại (vāyodhātu) đưa vào.
Paviṭṭhaṃ paviṭṭhaṃ koci palālasantharaṃ katvā dhārento nāma natthi, vāyodhātuvaseneva tiṭṭhati.
As it enters, no one supports it by making a straw mat; it remains by the power of the wind element alone.
Thức ăn đã vào, đã vào, không ai trải chiếu rơm mà giữ lại, mà chính nhờ sức mạnh của phong đại (vāyodhātu) mà nó tồn tại.
Ṭhitaṃ ṭhitaṃ koci uddhanaṃ katvā aggiṃ jāletvā pacanto nāma natthi, tejodhātuyāva paccati.
As it remains, no one cooks it by making a stove and lighting a fire; it is digested by the fire element alone.
Thức ăn đã tồn tại, đã tồn tại, không ai làm lò đốt lửa mà nấu chín, mà chính hỏa đại (tejodhātu) nấu chín.
Pakkaṃ pakkaṃ koci daṇḍena vā yaṭṭhiyā vā bahi nīhārako nāma natthi, vāyodhātuyeva nīharati.
When it is digested, no one expels it with a stick or a rod; the wind element itself expels it.
Thức ăn đã chín, đã chín, không ai dùng gậy hay que mà đưa ra ngoài, mà chính phong đại (vāyodhātu) đưa ra.
Iti vāyodhātu atiharati ca vītiharati ca dhāreti ca parivatteti ca sañcuṇṇeti visoseti ca nīharati ca.
Thus, the wind element conveys inwards, conveys downwards, supports, turns over, grinds up, dries out, and expels.
Như vậy, phong đại (vāyodhātu) đưa vào và đưa đi, giữ lại, đảo lộn, nghiền nát, làm khô và đưa ra ngoài.
Pathavīdhātu dhāreti ca parivatteti ca sañcuṇṇeti ca visoseti ca.
The earth element supports, turns over, grinds up, and dries out.
Địa đại (pathavīdhātu) giữ lại, đảo lộn, nghiền nát và làm khô.
Āpodhātu sineheti ca allattañca anupāleti.
The water element moistens and maintains the wetness.
Thủy đại (āpodhātu) làm ẩm ướt và duy trì sự ẩm ướt.
Tejodhātu antopaviṭṭhaṃ paripāceti.
The fire element digests what has entered inside.
Hỏa đại (tejodhātu) làm chín thức ăn đã vào bên trong.
Ākāsadhātu añjaso hoti.
The space element provides a path.
Không đại (ākāsadhātu) là lối đi.
Viññāṇadhātu tattha tattha sammāpayogamanvāya ābhujatīti evaṃpavattapaṭisaṅkhānavasenettha asammohasampajaññaṃ veditabbaṃ.
The consciousness element, relying on the appropriate effort in each case, inclines the mind. In this way, clear comprehension of non-delusion should be understood here through reflection on this process.
Thức đại (viññāṇadhātu) tùy theo sự vận dụng đúng đắn vào từng việc mà chú tâm. Như vậy, sự tỉnh giác không mê lầm (asammohasampajañña) cần được biết qua sự quán xét theo cách vận hành này.
Uccārapassāvakammeti uccārassa ca passāvassa ca karaṇe.
In the act of defecating and urinating means in the act of passing feces and urine.
Trong việc đại tiện và tiểu tiện (uccārapassāvakamme) là trong việc làm đại tiện và tiểu tiện.
Tattha pattakāle uccārapassāvaṃ akarontassa sakalasarīrato sedā muccanti, akkhīni bhamanti, cittaṃ na ekaggaṃ hoti, aññe ca rogā uppajjanti.
In this regard, for one who does not defecate and urinate at the appropriate time, sweat is released from the whole body, the eyes spin, the mind is not concentrated, and other diseases arise.
Trong đó, nếu không đại tiện và tiểu tiện đúng lúc, mồ hôi sẽ tiết ra khắp cơ thể, mắt sẽ đảo loạn, tâm không định tĩnh, và các bệnh khác sẽ phát sinh.
Karontassa pana sabbaṃ taṃ na hotīti ayamettha attho.
But for one who does so, none of that happens; this is the purpose here.
Nhưng nếu làm đúng lúc thì tất cả những điều đó sẽ không xảy ra – đây là ý nghĩa ở đây.
Tassa vasena sātthakasampajaññaṃ veditabbaṃ.
By virtue of that purpose, clear comprehension of what is beneficial should be understood.
Sự tỉnh giác có lợi ích (sātthakasampajañña) cần được biết dựa vào điều đó.
Aṭṭhāne uccārapassāvaṃ karontassa pana āpatti hoti, ayaso vaḍḍhati, jīvitantarāyo hoti.
Moreover, for one who defecates and urinates in an inappropriate place, an offense is incurred, ill repute increases, and there is danger to life.
Tuy nhiên, nếu đại tiện và tiểu tiện ở nơi không thích hợp, sẽ phạm giới, danh tiếng xấu sẽ tăng trưởng, và có thể nguy hiểm đến tính mạng.
Patirūpe ṭhāne karontassa sabbaṃ taṃ na hotīti idamettha sappāyaṃ.
For one who does so in a suitable place, none of that happens; this is what is suitable here.
Nếu làm ở nơi thích hợp thì tất cả những điều đó sẽ không xảy ra – đây là sự thích hợp (sappāya) ở đây.
Tassa vasena sappāyasampajaññaṃ, kammaṭṭhānāvijahanavaseneva ca gocarasampajaññaṃ veditabbaṃ.
By virtue of that suitability, clear comprehension of what is suitable, and by virtue of not abandoning the meditation subject, clear comprehension of the domain, should be understood.
Sự tỉnh giác thích hợp (sappāyasampajañña) cần được biết dựa vào điều đó, và sự tỉnh giác đối tượng (gocarasampajañña) cần được biết dựa vào việc không từ bỏ đề mục thiền định (kammaṭṭhāna).
Abbhantare attā nāma koci uccārapassāvaṃ karonto natthi.
Inside, there is no self whatsoever that defecates or urinates.
Bên trong, không có cái gọi là tự ngã (attā) nào đang đại tiện hay tiểu tiện.
Cittakiriyavāyodhātuvipphāreneva pana uccārapassāvakammaṃ hoti.
Rather, the act of defecating and urinating occurs only through the diffusion of the mind-created wind element.
Mà chính do sự vận hành của phong đại (vāyodhātu) do tâm tạo tác mà việc đại tiện, tiểu tiện diễn ra.
Yathā pana pakke gaṇḍe gaṇḍabhedena pubbalohitaṃ akāmatāya nikkhamati, yathā ca atibharitā udakabhājanā udakaṃ akāmatāya nikkhamati, evaṃ pakkāsayamuttavatthīsu sannicitā uccārapassāvā vāyuvegasamuppīḷitā akāmatāyapi nikkhamanti.
Just as when a boil is ripe, pus and blood are discharged unintentionally when the boil bursts, and just as from an overfilled water pot, water flows out unintentionally, so too, feces and urine accumulated in the stomach and bladder, being pressed by the force of the wind, are discharged even unintentionally.
Cũng như khi một vết thương chín, mủ và máu tự động chảy ra khi vết thương vỡ; hoặc như nước tự động chảy ra từ một bình nước quá đầy; tương tự như vậy, đại tiện và tiểu tiện tích tụ trong ruột già và bàng quang, bị áp lực bởi sức mạnh của gió (vāyuvega), cũng tự động chảy ra.
So panāyaṃ evaṃ nikkhamanto uccārapassāvo neva tassa bhikkhuno attano hoti, na parassa.
But these feces and urine, thus discharged, belong neither to that bhikkhu himself nor to another.
Và đại tiện, tiểu tiện chảy ra như vậy không phải là của vị Tỳ-khưu đó, cũng không phải của người khác.
Kevalaṃ sarīranissandova hoti.
It is merely a discharge from the body.
Nó chỉ là chất thải của cơ thể.
Yathā kiṃ?
Like what?
Giống như cái gì?
Yathā udakakumbhato purāṇaudakaṃ chaḍḍentassa neva taṃ attano hoti, na paresaṃ.
Just as for someone emptying old water from a water pot, that water belongs neither to himself nor to others.
Giống như khi đổ nước cũ từ một cái bình nước, nước đó không phải của mình, cũng không phải của người khác.
Kevalaṃ paṭijagganamattameva hoti.
It is merely a matter of cleaning.
Nó chỉ là việc dọn dẹp mà thôi.
Evaṃpavattapaṭisaṅkhānavasenettha asammohasampajaññaṃ veditabbaṃ.
In this way, clear comprehension of non-delusion should be understood here through reflection on this process.
Sự tỉnh giác không mê lầm (asammohasampajañña) cần được biết qua sự quán xét theo cách vận hành này.
Gatādīsu gateti gamane.
In "when going," etc., when going means in the act of going.
Trong các tư thế đi đứng, ngồi, nằm, v.v.: đi (gate) là trong việc đi.
Ṭhiteti ṭhāne.
When standing means in the act of standing.
Đứng (ṭhite) là trong việc đứng.
Nisinneti nisajjāya.
When sitting means in the act of sitting.
Ngồi (nisinne) là trong việc ngồi.
Sutteti sayane.
When asleep means in the act of lying down.
Nằm (sutte) là trong việc nằm.
Jāgariteti jāgaraṇe.
When awake means in the act of being awake.
Thức (jāgarite) là trong việc thức.
Bhāsiteti kathane.
When speaking means in the act of talking.
Nói (bhāsite) là trong việc nói.
Tuṇhībhāveti akathane.
When silent means in the act of not talking.
Im lặng (tuṇhībhāve) là trong việc không nói.
‘‘Gacchanto vā gacchāmīti pajānāti, ṭhito vā ṭhitomhīti pajānāti, nisinno vā nisinnomhīti pajānāti, sayāno vā sayānomhīti pajānātī’’ti imasmiñhi ṭhāne addhānairiyāpathā kathitā.
In the passage, "When going, he knows, 'I am going'; when standing, he knows, 'I am standing'; when sitting, he knows, 'I am sitting'; when lying down, he knows, 'I am lying down'," the long-duration postures are spoken of.
Trong đoạn này: “Khi đi, vị ấy biết: ‘Tôi đang đi’; khi đứng, vị ấy biết: ‘Tôi đang đứng’; khi ngồi, vị ấy biết: ‘Tôi đang ngồi’; khi nằm, vị ấy biết: ‘Tôi đang nằm’”, các oai nghi lớn đã được nói đến.
‘‘Abhikkante paṭikkante ālokite vilokite samiñjite pasārite’’ti imasmiṃ majjhimā.
In the passage, "in going forward and returning, in looking ahead and looking aside, in bending and stretching," the medium-duration postures are spoken of.
Trong đoạn này: “Khi bước tới, bước lui, khi nhìn thẳng, nhìn quanh, khi co tay, duỗi chân”, các oai nghi trung bình đã được nói đến.
‘‘Gate ṭhite nisinne sutte jāgarite’’ti idha pana khuddakacuṇṇikairiyāpathā kathitā.
Here, in "when going, standing, sitting, asleep, awake," the minor, detailed postures are spoken of.
Nhưng ở đây, trong đoạn “đi, đứng, ngồi, nằm, thức”, các oai nghi nhỏ, vụn vặt đã được nói đến.
Tasmā etesupi vuttanayeneva sampajānakāritā veditabbā.
Therefore, in these too, the state of acting with clear comprehension should be understood in the way that has been explained.
Vì vậy, ngay cả trong những điều này, sự thực hành tỉnh giác cũng cần được biết theo cách đã nói.
Tipiṭakamahāsīvatthero panāha – yo ciraṃ gantvā vā caṅkamitvā vā aparabhāge ṭhito iti paṭisañcikkhati ‘‘caṅkamanakāle pavattā rūpārūpadhammā ettheva niruddhā’’ti, ayaṃ gate sampajānakārī nāma.
However, the Elder Mahāsiva of the Tipiṭaka said: Whoever, after going or walking for a long time, stands and reflects, "The material and immaterial phenomena that occurred during the time of walking have ceased right here," is called one who acts with clear comprehension when going.
Đại Trưởng lão Tipiṭaka Mahāsīva đã nói: “Vị nào sau khi đi bộ hoặc kinh hành lâu, rồi đứng lại và quán xét: ‘Các pháp sắc và vô sắc đã sinh khởi trong lúc kinh hành đã diệt tận ngay tại đây’, vị ấy được gọi là người thực hành tỉnh giác trong khi đi (gate sampajānakārī).”
Yo sajjhāyaṃ vā karonto pañhaṃ vā vissajjento kammaṭṭhānaṃ vā manasikaronto ciraṃ ṭhatvā aparabhāge nisinno iti paṭisañcikkhati ‘‘ṭhitakāle pavattā rūpārūpadhammā ettheva niruddhā’’ti, ayaṃ ṭhite sampajānakārī nāma.
Whoever, while reciting, or answering a question, or attending to a meditation subject, stands for a long time and then, having sat down, reflects, "The material and immaterial phenomena that occurred during the time of standing have ceased right here," is called one who acts with clear comprehension when standing.
“Vị nào sau khi tụng kinh, giải đáp câu hỏi, hoặc tác ý đề mục thiền định trong một thời gian dài, rồi ngồi xuống và quán xét: ‘Các pháp sắc và vô sắc đã sinh khởi trong lúc đứng đã diệt tận ngay tại đây’, vị ấy được gọi là người thực hành tỉnh giác trong khi đứng (ṭhite sampajānakārī).”
Yo sajjhāyādikaraṇavaseneva ciraṃ nisīditvā aparabhāge nipanno iti paṭisañcikkhati ‘‘nisinnakāle pavattā rūpārūpadhammā ettheva niruddhā’’ti, ayaṃ nisinne sampajānakārī nāma.
Whoever, having sat for a long time for the purpose of reciting and so on, then lies down and reflects, "The material and immaterial phenomena that occurred during the time of sitting have ceased right here," is called one who acts with clear comprehension when sitting.
“Vị nào sau khi ngồi lâu để tụng kinh, v.v., rồi nằm xuống và quán xét: ‘Các pháp sắc và vô sắc đã sinh khởi trong lúc ngồi đã diệt tận ngay tại đây’, vị ấy được gọi là người thực hành tỉnh giác trong khi ngồi (nisinne sampajānakārī).”
Yo pana nipannako sajjhāyaṃ vā karonto kammaṭṭhānaṃ vā manasikaronto niddaṃ okkamitvā aparabhāge vuṭṭhāya iti paṭisañcikkhati ‘‘sayanakāle pavattā rūpārūpadhammā ettheva niruddhā’’ti, ayaṃ sutte jāgarite ca sampajānakārī nāma.
Whoever, while lying down, is reciting or attending to a meditation subject, falls asleep, and then upon waking up reflects, "The material and immaterial phenomena that occurred during the time of lying down have ceased right here," is called one who acts with clear comprehension when asleep and when awake.
“Vị nào đang nằm, tụng kinh hoặc tác ý đề mục thiền định, rồi ngủ thiếp đi, sau đó thức dậy và quán xét: ‘Các pháp sắc và vô sắc đã sinh khởi trong lúc nằm đã diệt tận ngay tại đây’, vị ấy được gọi là người thực hành tỉnh giác trong khi ngủ và thức (sutte jāgarite ca sampajānakārī).”
Kiriyamayacittānañhi appavattaṃ suttaṃ nāma, pavattaṃ jāgaritaṃ nāmāti.
For the non-occurrence of functional consciousness is called "asleep," and its occurrence is called "awake."
Vì sự không sinh khởi của các tâm hành động (kiriyamayacitta) được gọi là ngủ (sutta), và sự sinh khởi của chúng được gọi là thức (jāgarita).
Yo pana bhāsamāno ‘‘ayaṃ saddo nāma oṭṭhe ca paṭicca dante ca jivhañca tāluñca paṭicca cittassa tadanurūpaṃ payogaṃ paṭicca jāyatī’’ti sato sampajāno bhāsati, ciraṃ vā pana kālaṃ sajjhāyaṃ vā katvā dhammaṃ vā kathetvā kammaṭṭhānaṃ vā parivattetvā pañhaṃ vā vissajjetvā aparabhāge tuṇhībhūto iti paṭisañcikkhati ‘‘bhāsitakāle uppannā rūpārūpadhammā ettheva niruddhā’’ti, ayaṃ bhāsite sampajānakārī nāma.
Whoever, while speaking, mindfully and with clear comprehension speaks, reflecting, "This sound arises in dependence on the lips, teeth, tongue, and palate, and in dependence on the mind's corresponding effort"; or whoever, after reciting for a long time, or preaching the Dhamma, or practicing the meditation subject, or answering a question, becomes silent and reflects, "The material and immaterial phenomena that arose during the time of speaking have ceased right here," is called one who acts with clear comprehension when speaking.
“Vị nào khi nói, biết rõ và tỉnh giác rằng: ‘Âm thanh này sinh khởi do môi, răng, lưỡi, vòm miệng và sự vận dụng thích hợp của tâm’, hoặc sau khi tụng kinh, thuyết pháp, quán xét đề mục thiền định, hoặc giải đáp câu hỏi trong một thời gian dài, rồi im lặng và quán xét: ‘Các pháp sắc và vô sắc đã sinh khởi trong lúc nói đã diệt tận ngay tại đây’, vị ấy được gọi là người thực hành tỉnh giác trong khi nói (bhāsite sampajānakārī).”
Yo tuṇhībhūto ciraṃ dhammaṃ vā kammaṭṭhānaṃ vā manasikatvā aparabhāge iti paṭisañcikkhati ‘‘tuṇhībhūtakāle pavattā rūpārūpadhammā ettheva niruddhā, upādārūpapavattiyā sati bhāsati nāma, asati tuṇhī bhavati nāmā’’ti, ayaṃ tuṇhībhāve sampajānakārī nāmāti.
Whoever, being silent, attends to the Dhamma or a meditation subject for a long time, and afterwards reflects, "The material and immaterial phenomena that occurred during the time of being silent have ceased right here; when there is the occurrence of derived materiality, one is said to 'speak'; when there is not, one is said to be 'silent'," is called one who acts with clear comprehension when silent.
“Vị nào im lặng, tác ý pháp hoặc đề mục thiền định trong một thời gian dài, sau đó quán xét: ‘Các pháp sắc và vô sắc đã sinh khởi trong lúc im lặng đã diệt tận ngay tại đây. Khi có sự sinh khởi của sắc do chấp thủ (upādārūpa), đó gọi là nói (bhāsati); khi không có, đó gọi là im lặng (tuṇhī bhavati)’, vị ấy được gọi là người thực hành tỉnh giác trong khi im lặng (tuṇhībhāve sampajānakārī).”
Tayidaṃ mahāsīvattherena vuttaṃ asammohadhuraṃ imasmiṃ satipaṭṭhānasutte adhippetaṃ.
This which was stated by the Elder Mahāsiva is intended in this Satipaṭṭhāna Sutta with an emphasis on non-delusion.
Sự tỉnh giác không mê lầm (asammohadhura) được Đại Trưởng lão Mahāsīva nói đến này được đề cập trong kinh Niệm Xứ (Satipaṭṭhānasutta) này.
Sāmaññaphale pana sabbampi catubbidhaṃ sampajaññaṃ labbhati.
In the Sāmaññaphala Sutta, however, all four kinds of clear comprehension are found.
Tuy nhiên, trong kinh Sa Môn Quả (Sāmaññaphala), cả bốn loại tỉnh giác đều được tìm thấy.
Tasmā visesato ettha asammohasampajaññasseva vasena sampajānakāritā veditabbā.
Therefore, here especially, acting with clear comprehension should be understood by way of the clear comprehension of non-delusion.
Do đó, ở đây, sự thực hành tỉnh giác cần được biết đặc biệt dựa vào sự tỉnh giác không mê lầm (asammohasampajañña).
Sampajānakārī sampajānakārīti ca sabbapadesu satisampayuttasseva sampajaññassa vasenattho veditabbo.
And in all sections, "acting with clear comprehension, acting with clear comprehension" should be understood to have its meaning by virtue of clear comprehension that is associated with mindfulness.
Và ý nghĩa của “người thực hành tỉnh giác, người thực hành tỉnh giác” trong tất cả các đoạn văn cần được hiểu dựa vào sự tỉnh giác đi kèm với niệm (satisampayutta).
Vibhaṅgappakaraṇe pana, ‘‘sato sampajāno abhikkamati, sato sampajāno paṭikkamatī’’ti (vibha. 523) evametāni padāni vibhattāneva.
In the Vibhaṅga, however, these terms are analyzed thus: "Mindfully, with clear comprehension he goes forward; mindfully, with clear comprehension he returns."
Tuy nhiên, trong Abhidhamma Vibhaṅga (Vibhaṅgappakaraṇa), những từ này được phân tích như sau: “Có niệm, có tỉnh giác khi bước tới; có niệm, có tỉnh giác khi bước lui.”
Iti ajjhattaṃ vāti evaṃ catusampajaññapariggahaṇena attano vā kāye, parassa vā kāye, kālena vā attano, kālena vā parassa kāye kāyānupassī viharati.
Thus internally, or means: In this way, by grasping the four kinds of clear comprehension, one abides contemplating the body in one's own body, or in another's body, or at times in one's own body and at times in another's body.
Iti ajjhattaṃ vā (Như vậy, trong nội thân hay): nghĩa là, như thế, bằng cách nắm giữ bốn loại tỉnh giác, vị ấy an trú quán thân trên thân của chính mình, hay trên thân của người khác; đôi khi trên thân của chính mình, đôi khi trên thân của người khác.
Idha samudayavayadhammānupassītiādīsu rūpakkhandhasseva samudayo ca vayo ca nīharitabbo.
Here, in the passage beginning with contemplating the nature of arising and passing away, the arising and passing away of the aggregate of form alone should be extracted.
Ở đây, trong các câu samudayavayadhammānupassī (quán pháp sinh diệt) và tương tự, sự sinh và diệt của riêng sắc uẩn cần được rút ra.
Sesaṃ vuttasadisameva.
The rest is just as has been stated.
Phần còn lại tương tự như đã nói.
110. Evaṃ catusampajaññavasena kāyānupassanaṃ vibhajitvā idāni paṭikūlamanasikāravasena vibhajituṃ puna caparantiādimāha.
110. Having thus analyzed the contemplation of the body by way of the four kinds of clear comprehension, now, to analyze it by way of the contemplation of the repulsive, he said, And further, and so on.
110. Như vậy, sau khi phân tích pháp quán thân theo Tứ Tỉnh Giác, bây giờ để phân tích theo quán bất tịnh, Đức Phật đã nói câu mở đầu puna caparaṃ (lại nữa) và tương tự.
Tattha imameva kāyantiādīsu yaṃ vattabbaṃ siyā, taṃ sabbaṃ sabbākārena vitthārato visuddhimagge kāyagatāsatikammaṭṭhāne vuttaṃ.
Therein, in the passages beginning with this very body, whatever should be said has all been stated in full detail in every way in the Visuddhimagga, in the section on the meditation subject of mindfulness directed to the body.
Ở đó, những gì cần nói trong các câu imameva kāyaṃ (chính thân này) và tương tự, tất cả đã được giải thích chi tiết trong phần đề mục thiền quán thân niệm (kāyagatāsati kammaṭṭhāna) trong Thanh Tịnh Đạo (Visuddhimagga).
Ubhatomukhāti heṭṭhā ca upari cāti dvīhi mukhehi yuttā.
With an opening at both ends means joined with two openings, that is, below and above.
Ubhatomukhā (hai miệng): nghĩa là có hai miệng, một ở dưới và một ở trên.
Nānāvihitassāti nānāvidhassa.
Of various kinds means of many sorts.
Nānāvihitassā (các loại khác nhau): nghĩa là nhiều loại khác nhau.
Iti ajjhattaṃ vāti evaṃ kesādipariggahaṇena attano vā kāye, parassa vā kāye, kālena vā attano, kālena vā parassa kāye kāyānupassī viharati, ito paraṃ vuttanayameva.
Thus internally, or means: In this way, by grasping the hair of the head and so on, one abides contemplating the body in one's own body, or in another's body, or at times in one's own body and at times in another's body. What follows from this is in the way already stated.
Iti ajjhattaṃ vā (Như vậy, trong nội thân hay): nghĩa là, như thế, bằng cách nắm giữ tóc và tương tự, vị ấy an trú quán thân trên thân của chính mình, hay trên thân của người khác; đôi khi trên thân của chính mình, đôi khi trên thân của người khác; từ đây trở đi, theo cách đã nói.
Kevalañhi idha dvattiṃsākārapariggāhikā sati dukkhasaccanti evaṃ yojanaṃ katvā niyyānamukhaṃ veditabbaṃ.
Only here, the entry point to deliverance should be understood by making the connection thus: the mindfulness that comprehends the thirty-two parts is the truth of suffering.
Ở đây, cần hiểu con đường giải thoát bằng cách kết nối rằng chánh niệm nắm giữ ba mươi hai thể trược là Khổ đế.
Sesaṃ purimasadisamevāti.
The rest is just as before.
Phần còn lại tương tự như trước.
111. Evaṃ paṭikūlamanasikāravasena kāyānupassanaṃ vibhajitvā idāni dhātumanasikāravasena vibhajituṃ puna caparantiādimāha.
111. Having thus analyzed the contemplation of the body by way of the contemplation of the repulsive, now, to analyze it by way of the contemplation of the elements, he said, And further, and so on.
111. Như vậy, sau khi phân tích pháp quán thân theo quán bất tịnh, bây giờ để phân tích theo quán các giới, Đức Phật đã nói câu mở đầu puna caparaṃ (lại nữa) và tương tự.
Tatrāyaṃ opammasaṃsandanena saddhiṃ atthavaṇṇanā – yathā koci goghātako vā tasseva vā bhattavetanabhato antevāsiko gāviṃ vadhitvā vinivijjhitvā catasso disā gatānaṃ mahāpathānaṃ vemajjhaṭṭhānasaṅkhāte catumahāpathe koṭṭhāsaṃ koṭṭhāsaṃ katvā nisinno assa, evameva bhikkhu catunnaṃ iriyāpathānaṃ yena kenaci ākārena ṭhitattā yathāṭhitaṃ, yathāṭhitattā ca yathāpaṇihitaṃ kāyaṃ – ‘‘atthi imasmiṃ kāye pathavīdhātu…pe… vāyodhātū’’ti evaṃ paccavekkhati.
Therein, this is the explanation of the meaning together with a comparison to the simile: just as a cow-butcher or his apprentice, fed on his wages, might kill a cow, and having cut it up, would sit down at a crossroads, that is, at the central point of four main roads going in the four directions, after having divided it into portions; just so, a bhikkhu reviews this body just as it is placed, just as it is disposed—since it stands in any of the four postures—in this way: "There is in this body the earth element... the air element."
Ở đó, đây là lời giải thích ý nghĩa cùng với sự so sánh bằng ví dụ: giống như một người đồ tể hay một người học việc được thuê mướn bởi người đồ tể đó, sau khi giết một con bò, lóc thịt nó, rồi ngồi ở ngã tư đường, nơi giao nhau của bốn con đường lớn đi về bốn hướng, chia thịt thành từng phần; cũng vậy, một vị tỳ khưu quán sát thân này như nó đang ở, như nó đã được đặt, do nó ở trong bất kỳ tư thế nào trong bốn tư thế đi, đứng, nằm, ngồi – “Trong thân này có địa đại…v.v… phong đại.”
Kiṃ vuttaṃ hoti – yathā goghātakassa gāviṃ posentassāpi āghātanaṃ āharantassāpi āharitvā tattha bandhitvā ṭhapentassāpi vadhentassāpi vadhitaṃ mataṃ passantassāpi tāvadeva gāvīti saññā na antaradhāyati, yāva naṃ padāletvā bīlaso na vibhajati.
What is meant by this? Just as for a cow-butcher, while he is raising the cow, bringing it to the slaughterhouse, bringing it and tying it up there, slaughtering it, or looking at it when slaughtered and dead, the perception 'cow' does not disappear for as long as he does not cut it up and divide it into portions.
Ý nghĩa là gì? Giống như đối với người đồ tể, ngay cả khi nuôi bò, ngay cả khi dẫn nó đến lò mổ, ngay cả khi cột nó ở đó, ngay cả khi giết nó, ngay cả khi nhìn thấy con bò đã chết, nhận thức về “con bò” vẫn không biến mất cho đến khi ông ta xẻ thịt nó và chia thành từng phần.
Vibhajitvā nisinnassa pana gāvīti saññā antaradhāyati, maṃsasaññā pavattati, nāssa evaṃ hoti ‘‘ahaṃ gāviṃ vikkiṇāmi, ime gāviṃ harantī’’ti.
But when he is sitting down after having divided it, the perception 'cow' disappears, and the perception 'meat' arises. It does not occur to him, "I am selling a cow; these people are carrying away a cow."
Nhưng đối với người đã chia thịt và đang ngồi, nhận thức về “con bò” biến mất, và nhận thức về “thịt” phát sinh; ông ta không nghĩ: “Tôi bán bò, những người này mang bò đi.”
Atha khvassa ‘‘ahaṃ maṃsaṃ vikkiṇāmi, ime maṃsaṃ haranti’’cceva hoti, evameva imassāpi bhikkhuno pubbe bālaputhujjanakāle gihibhūtassāpi pabbajitassāpi tāvadeva sattoti vā puggaloti vā saññā na antaradhāyati, yāva imameva kāyaṃ yathāṭhitaṃ yathāpaṇihitaṃ ghanavinibbhogaṃ katvā dhātuso na paccavekkhati.
Rather, it only occurs to him, "I am selling meat; these people are carrying away meat." In the very same way, for this bhikkhu, previously in the time of being an ignorant ordinary person, whether as a householder or as one who has gone forth, the perception 'a being' or 'a person' does not disappear for as long as he does not review this very body, just as it is placed, just as it is disposed, by breaking down its compactness and analyzing it by way of the elements.
Mà ông ta chỉ nghĩ: “Tôi bán thịt, những người này mang thịt đi.” Cũng vậy, đối với vị tỳ khưu này, trước đây, khi còn là phàm phu ngu si, dù là cư sĩ hay xuất gia, nhận thức về “chúng sinh” hay “người” vẫn không biến mất cho đến khi vị ấy quán sát chính thân này theo các giới, sau khi đã phân tích kỹ lưỡng như nó đang ở, như nó đã được đặt.
Dhātuso paccavekkhato panassa sattasaññā antaradhāyati, dhātuvaseneva cittaṃ santiṭṭhati.
But for one reviewing it by way of the elements, the perception of 'a being' disappears, and the mind becomes established in the elements alone.
Nhưng khi quán sát theo các giới, nhận thức về “chúng sinh” của vị ấy biến mất, và tâm an trú chỉ theo các giới.
Tenāha bhagavā – ‘‘imameva kāyaṃ yathāṭhitaṃ yathāpaṇihitaṃ dhātuso paccavekkhati, atthi imasmiṃ kāye pathavīdhātu āpodhātu tejodhātu vāyodhātūti.
Therefore the Blessed One said: "He reviews this very body, however it is placed, however it is disposed, by way of the elements: 'There is in this body the earth element, the water element, the fire element, the air element.'
Vì vậy, Đức Thế Tôn đã nói: “Vị ấy quán sát chính thân này như nó đang ở, như nó đã được đặt, theo các giới, rằng: Trong thân này có địa đại, thủy đại, hỏa đại, phong đại.”
Seyyathāpi, bhikkhave, dakkho goghātako vā…pe… vāyodhātū’’ti.
"Just as, bhikkhus, a skilled cow-butcher or... the air element."
“Này các tỳ khưu, giống như một người đồ tể khéo léo…v.v… phong đại.”
Iti ajjhattaṃ vāti evaṃ catudhātupariggahaṇena attano vā kāye, parassa vā kāye, kālena vā attano, kālena vā parassa kāye kāyānupassī viharati.
Thus internally, or means: In this way, by grasping the four elements, one abides contemplating the body in one's own body, or in another's body, or at times in one's own body and at times in another's body.
Iti ajjhattaṃ vā (Như vậy, trong nội thân hay): nghĩa là, như thế, bằng cách nắm giữ Tứ Đại, vị ấy an trú quán thân trên thân của chính mình, hay trên thân của người khác; đôi khi trên thân của chính mình, đôi khi trên thân của người khác.
Ito paraṃ vuttanayameva.
What follows from this is in the way already stated.
Từ đây trở đi, theo cách đã nói.
Kevalañhi idha catudhātupariggāhikā sati dukkhasaccanti evaṃ yojanaṃ katvā niyyānamukhaṃ veditabbaṃ.
Only here, the entry point to deliverance should be understood by making the connection thus: the mindfulness that comprehends the four elements is the truth of suffering.
Ở đây, cần hiểu con đường giải thoát bằng cách kết nối rằng chánh niệm nắm giữ Tứ Đại là Khổ đế.
Sesaṃ purimasadisamevāti.
The rest is just as before.
Phần còn lại tương tự như trước.
112. Evaṃ dhātumanasikāravasena kāyānupassanaṃ vibhajitvā idāni navahi sivathikapabbehi vibhajituṃ, puna caparantiādimāha.
112. Having thus analyzed the contemplation of the body by way of the contemplation of the elements, now, to analyze it by way of the nine charnel ground sections, he said, And further, and so on.
112. Như vậy, sau khi phân tích pháp quán thân theo quán các giới, bây giờ để phân tích bằng chín phẩm tử thi, Đức Phật đã nói câu mở đầu puna caparaṃ (lại nữa) và tương tự.
Tattha seyyathāpi passeyyāti yathā passeyya.
Therein, just as if he were to see means 'as one might see'.
Ở đó, seyyathāpi passeyyā (giống như thấy): nghĩa là như thấy.
Sarīranti matasarīraṃ.
A body means a dead body.
Sarīraṃ (thân): nghĩa là tử thi.
Sivathikāya chaḍḍītanti susāne apaviddhaṃ.
Discarded in a charnel ground means thrown away in a cemetery.
Sivathikāya chaḍḍītaṃ (bị vứt bỏ ở bãi tha ma): nghĩa là bị vứt bỏ ở nghĩa địa.
Ekāhaṃ matassa assāti ekāhamataṃ.
It is dead for one day because it has been dead for one day.
Ekāhamataṃ (chết một ngày): nghĩa là đã chết được một ngày.
Dvīhaṃ matassa assāti dvīhamataṃ.
It is dead for two days because it has been dead for two days.
Dvīhamataṃ (chết hai ngày): nghĩa là đã chết được hai ngày.
Tīhaṃ matassa assāti tīhamataṃ.
It is dead for three days because it has been dead for three days.
Tīhamataṃ (chết ba ngày): nghĩa là đã chết được ba ngày.
Bhastā viya vāyunā uddhaṃ jīvitapariyādānā yathānukkamaṃ samuggatena sūnabhāvena uddhumātattā uddhumātakaṃ.
It is bloated because it is swollen with a state of puffiness that has arisen in sequence since the termination of life, like a bellows filled with wind.
Uddhumātakaṃ (thân sình chướng): nghĩa là sình chướng do bị phồng lên bởi hơi gió tăng dần theo thứ tự sau khi sinh mạng đã chấm dứt, giống như một cái ống bễ.
Vinīlaṃ vuccati viparibhinnavaṇṇaṃ.
Discolored is what is called livid.
Vinīlaṃ (thân xanh xám) được gọi là có màu sắc biến đổi.
Vilīnameva vinīlakaṃ.
Just that which is livid is vinīlakaṃ.
Vinīlakaṃ (thân xanh xám) chính là sự xanh xám.
Paṭikūlattā vā kucchitaṃ vinīlanti vinīlakaṃ.
Or, because it is repulsive, it is contemptibly livid, hence vinīlakaṃ.
Hoặc vinīlakaṃ là sự xanh xám đáng ghê tởm do tính bất tịnh.
Maṃsussadaṭṭhānesu rattavaṇṇassa pubbasannicayaṭṭhānesu setavaṇṇassa yebhuyyena ca nīlavaṇṇassa nīlaṭṭhānesu nīlasāṭakapārutasseva chavasarīrassetaṃ adhivacanaṃ.
This is a designation for the corpse's body which is reddish in color in the places with much flesh, whitish in color in the places where pus has collected, and mostly bluish in color, appearing as if cloaked in a blue cloth in the blue areas.
Đây là tên gọi của tử thi có màu đỏ ở những nơi nhiều thịt, màu trắng ở những nơi tích tụ mủ, và phần lớn là màu xanh ở những nơi màu xanh, giống như được phủ một tấm vải xanh.
Paribhinnaṭṭhānehi navahi vā vaṇamukhehi visandamānaṃ pubbaṃ vipubbaṃ.
Vipubbaṃ is that from which pus is oozing from the broken parts or from the nine wound-openings.
Vipubbaṃ (thân có mủ) là mủ chảy ra từ những nơi bị vỡ hoặc từ chín lỗ vết thương.
Vipubbameva vipubbakaṃ, paṭikūlattā vā kucchitaṃ vipubbanti vipubbakaṃ.
Just vipubbaṃ is vipubbakaṃ; or, because it is repulsive, it is contemptibly festering, hence vipubbakaṃ.
Vipubbakaṃ chính là sự có mủ, hoặc vipubbakaṃ là sự có mủ đáng ghê tởm do tính bất tịnh.
Vipubbakaṃ jātaṃ tathābhāvaṃ gatanti vipubbakajātaṃ.
Having become festering means having reached that state, hence become a festering thing.
Vipubbakajātaṃ (thân đầy mủ): nghĩa là đã trở thành có mủ, đã đạt đến trạng thái đó.
So imameva kāyanti so bhikkhu imaṃ attano kāyaṃ tena kāyena saddhiṃ ñāṇena upasaṃharati upaneti.
He applies this very body means that the bhikkhu applies, brings his own body near to that body with knowledge.
So imameva kāyaṃ (Vị ấy quán chính thân này): vị tỳ khưu đó dùng trí tuệ để so sánh, đối chiếu thân của chính mình với tử thi đó.
Kathaṃ?
How?
Như thế nào?
Ayampi kho kāyo evaṃdhammo evaṃbhāvī evaṃanatītoti.
"This body, too, is of the same nature, it will become like that, it has not gone beyond that state."
Thân này cũng có bản chất như vậy, sẽ trở thành như vậy, không thể thoát khỏi trạng thái như vậy.
Idaṃ vuttaṃ hoti – āyu, usmā, viññāṇanti imesaṃ tiṇṇaṃ dhammānaṃ atthitāya ayaṃ kāyo ṭhānagamanādikhamo hoti imesaṃ pana vigamā ayampi evaṃdhammo evaṃpūtikasabhāvoyeva, evaṃbhāvī evaṃuddhumātādibhedo bhavissati, evaṃanatīto evaṃuddhumātādibhāvaṃ anatikkantoti.
This is what is meant: Due to the existence of these three phenomena—life-faculty, vital heat, and consciousness—this body is capable of standing, going, and so on. But with their departure, this body too has such a nature, the very nature of becoming putrid. 'Of such a nature' means it will become distinct in this way as bloated and so on. 'Not gone beyond this' means it has not gone beyond this state of being bloated and so on.
Điều này có nghĩa là: Do sự hiện hữu của ba pháp này—sinh mạng (āyu), hơi ấm (usmā), và thức (viññāṇa)—thân này có khả năng đứng, đi, v.v. Nhưng khi chúng biến mất, thân này cũng sẽ có bản chất mục nát như vậy, sẽ trở thành như vậy (evaṃbhāvī), nghĩa là sẽ sưng phồng, v.v., không thể vượt qua trạng thái đó (evaṃanatīto), nghĩa là không thể vượt qua trạng thái sưng phồng, v.v.
Khajjamānanti udarādīsu nisīditvā udaramaṃsaoṭṭhamaṃsaakkhikūṭādīni luñcitvā luñcitvā khādiyamānaṃ.
Being devoured means being devoured after they have settled in the abdomen and other parts, and have repeatedly torn off the flesh of the abdomen, the flesh of the lips, the sockets of the eyes, and so on.
Đang bị ăn (khajjamānaṃ): bị ăn mòn từng chút một sau khi các loài vật ngồi trong bụng, v.v., nhổ và ăn thịt bụng, thịt môi, nhãn cầu, v.v.
Samaṃsalohitanti sesāvasesamaṃsalohitayuttaṃ.
With flesh and blood means possessed of the remaining flesh and blood.
Còn thịt và máu (samaṃsalohitaṃ): còn sót lại thịt và máu.
Nimaṃsalohitamakkhitanti maṃse khīṇepi lohitaṃ na sussati, taṃ sandhāya vuttaṃ ‘‘nimaṃsalohitamakkhita’’nti.
Without flesh, smeared with blood means: even when the flesh is gone, the blood has not dried up. It is with reference to this that "without flesh, smeared with blood" is said.
Không thịt nhưng dính máu (nimaṃsalohitamakkhitaṃ): ngay cả khi thịt đã hết, máu vẫn chưa khô; điều này được nói đến khi đề cập đến xương chưa khô máu, tức là ‘‘không thịt nhưng dính máu’’.
Aññenāti aññena disābhāgena.
In another direction means in another region or direction.
Ở một hướng khác (aññena): ở một hướng khác.
Hatthaṭṭhikanti catusaṭṭhibhedampi hatthaṭṭhikaṃ pāṭiyekkaṃ vippakiṇṇaṃ.
A hand-bone means even the hand-bone, which has sixty-four divisions, scattered individually.
Xương tay (hatthaṭṭhikaṃ): xương tay với sáu mươi bốn loại, nằm rải rác riêng lẻ.
Pādaṭṭhikādīsupi eseva nayo.
This same method applies to the foot-bones and so on.
Tương tự đối với xương chân, v.v. (pādaṭṭhikādīsupi eseva nayo).
Terovassikānīti atikkantasaṃvaccharāni.
A year old means having passed a year.
Đã qua một năm (terovassikāni): đã qua nhiều năm.
Pūtīnīti abbhokāse ṭhitāni vātātapavuṭṭhisamphassena terovassikāneva pūtīni honti.
Rotten means: those bones that are in an open space become rotten after a year through contact with wind, sun, and rain.
Mục nát (pūtīni): những bộ xương nằm ngoài trời, do tiếp xúc với gió, nắng và mưa, sau nhiều năm trở nên mục nát.
Antobhūmigatāni pana cirataraṃ tiṭṭhanti.
But those that are underground last much longer.
Còn những bộ xương nằm dưới đất thì tồn tại lâu hơn.
Cuṇṇakajātānīti cuṇṇaṃ cuṇṇaṃ hutvā vippakiṇṇāni.
Become powder means having become fine powder and scattered.
Đã thành bột (cuṇṇakajātāni): đã thành bột và nằm rải rác.
Sabbattha so imamevāti vuttanayena khajjamānādīnaṃ vasena yojanā kātabbā.
In all cases, the application should be made by way of the states of being devoured and so on, according to the method stated as "He compares this very body..."
Ở mọi nơi, sự kết hợp nên được thực hiện theo cách đã nói, như ‘‘vị ấy quán sát chính thân này’’, dựa trên các trạng thái như đang bị ăn, v.v.
Idha pana ṭhatvā navasivathikā samodhānetabbā.
Here, however, one should pause and consolidate the nine charnel ground contemplations.
Ở đây, cần phải tổng hợp chín giai đoạn thi thể ở nghĩa địa.
‘‘Ekāhamataṃ vā’’tiādinā nayena vuttā sabbāpi ekā, ‘‘kākehi vā khajjamāna’’ntiādikā ekā, ‘‘aṭṭhikasaṅkhalikaṃ samaṃsalohitaṃ nhārusambandha’’nti ekā, ‘‘nimaṃsalohitamakkhitaṃ nhārusambandha’’nti ekā, ‘‘apagatamaṃsalohitaṃ nhārusambandha’’nti ekā, ‘‘aṭṭhikāni apagatasambandhānī’’tiādikā ekā, ‘‘aṭṭhikāni setāni saṅkhavaṇṇapaṭibhāgānī’’ti ekā, ‘‘puñjakitāni terovassikānī’’ti ekā, ‘‘pūtīni cuṇṇakajātānī’’ti ekā.
All those mentioned by the method beginning with "dead for one day" are one; the one beginning with "being devoured by crows" is one; "a skeleton with flesh and blood, held together by sinews" is one; "without flesh, smeared with blood, held together by sinews" is one; "without flesh and blood, held together by sinews" is one; the one beginning with "bones with no connections" is one; "bones white, with the color of a conch" is one; "piled up, a year old" is one; "rotten and become powder" is one.
Tất cả các giai đoạn đã nói theo cách ‘‘thi thể chết một ngày’’, v.v., là một; giai đoạn ‘‘đang bị quạ ăn’’, v.v., là một; giai đoạn ‘‘chuỗi xương còn thịt, máu và gân’’, là một; giai đoạn ‘‘không thịt nhưng dính máu và gân’’, là một; giai đoạn ‘‘thịt và máu đã biến mất nhưng còn gân’’, là một; giai đoạn ‘‘xương đã lìa khỏi các khớp’’, v.v., là một; giai đoạn ‘‘xương trắng như vỏ ốc’’, là một; giai đoạn ‘‘xương chất đống đã qua một năm’’, là một; giai đoạn ‘‘xương mục nát đã thành bột’’, là một.
Evaṃ kho, bhikkhaveti idaṃ navasivathikā dassetvā kāyānupassanaṃ niṭṭhapento āha.
So, monks, in this way…: He said this to conclude the contemplation of the body after having shown the nine charnel ground contemplations.
Này các tỳ khưu, như vậy (evaṃ kho, bhikkhave): Đức Thế Tôn nói điều này để kết thúc sự quán thân sau khi trình bày chín giai đoạn thi thể ở nghĩa địa.
Tattha navasivathikapariggāhikā sati dukkhasaccaṃ, tassā samuṭṭhāpikā purimataṇhā samudayasaccaṃ, ubhinnaṃ appavatti nirodhasaccaṃ, dukkhaparijānano samudayapajahano nirodhārammaṇo ariyamaggo maggasaccaṃ.
Therein, the mindfulness that comprehends the nine charnel ground contemplations is the truth of suffering; the preceding craving that gives rise to it is the truth of the origin; the non-occurrence of both is the truth of cessation; the noble path that fully understands suffering, abandons the origin, and has cessation as its object is the truth of the path.
Trong đó, chánh niệm quán sát chín giai đoạn thi thể là Khổ đế (Dukkhasacca); ái dục trước đó là nguyên nhân của nó là Tập đế (Samudayasacca); sự không phát sinh của cả hai là Diệt đế (Nirodhasacca); Bát Chánh Đạo, nhận biết khổ, đoạn trừ tập, lấy diệt làm đối tượng, là Đạo đế (Maggasacca).
Evaṃ catusaccavaseneva ussakkitvā nibbutiṃ pāpuṇātīti idaṃ navasivathikapariggāhakānaṃ bhikkhūnaṃ yāva arahattā niyyānamukhanti.
In this way, by striving according to the Four Truths, one reaches Nibbāna. This is the means of deliverance up to Arahantship for the monks who comprehend the nine charnel ground contemplations.
Như vậy, bằng cách tinh tấn theo bốn Chân lý, vị ấy đạt đến Niết Bàn; đây là con đường giải thoát cho các tỳ khưu quán sát chín giai đoạn thi thể, cho đến khi đạt A-la-hán.
113. Evaṃ bhagavā cuddasavidhena kāyānupassanāsatipaṭṭhānaṃ kathetvā idāni navavidhena vedanānupassanaṃ kathetuṃ kathañca, bhikkhavetiādimāha.
113. In this way, after the Blessed One had explained the establishment of mindfulness through contemplation of the body in fourteen ways, he then, in order to explain the contemplation of feelings in nine ways, spoke the passage beginning with, And how, monks....
Như vậy, sau khi Đức Thế Tôn đã thuyết giảng về Kāyānupassanā Satipaṭṭhāna với mười bốn phương diện, bây giờ Ngài nói: ‘‘Này các tỳ khưu, và như thế nào…’’ (kathañca, bhikkhave) để thuyết giảng về Vedanānupassanā với chín phương diện.
Tattha sukhaṃ vedananti kāyikaṃ vā cetasikaṃ vā sukhaṃ vedanaṃ vedayamāno ‘‘ahaṃ sukhaṃ vedanaṃ vedayāmī’’ti pajānātīti attho.
Therein, a pleasant feeling means that when experiencing a pleasant feeling, whether physical or mental, one knows, "I am experiencing a pleasant feeling." That is the meaning.
Trong đó, thọ lạc (sukhaṃ vedanaṃ) có nghĩa là khi vị ấy cảm thọ lạc, dù là lạc thân hay lạc tâm, vị ấy biết: ‘‘Tôi đang cảm thọ lạc’’.
Tattha kāmaṃ uttānaseyyakāpi dārakā thaññapivanādikāle sukhaṃ vedayamānā ‘‘sukhaṃ vedayāmā’’ti pajānanti, na panetaṃ evarūpaṃ jānanaṃ sandhāya vuttaṃ.
In this context, although even infants lying on their backs know, "We are experiencing a pleasant feeling," when experiencing pleasure at times such as when drinking mother's milk, this was not said with reference to that kind of knowing.
Dù những đứa trẻ sơ sinh nằm ngửa, khi bú sữa, v.v., cảm thọ lạc và biết: ‘‘Chúng tôi đang cảm thọ lạc’’, nhưng đây không phải là loại hiểu biết được nói đến ở đây.
Evarūpaṃ jānanaṃ hi sattūpaladdhiṃ na jahati, sattasaññaṃ na ugghāṭeti, kammaṭṭhānaṃ vā satipaṭṭhānabhāvanā vā na hoti.
For that kind of knowing does not abandon the apprehension of a being, does not dismantle the perception of a being, and is not a meditation subject or the development of the establishment of mindfulness.
Thật vậy, loại hiểu biết đó không từ bỏ quan niệm về chúng sinh, không loại bỏ tưởng về chúng sinh, và không phải là đề mục thiền định hay sự tu tập chánh niệm.
Imassa pana bhikkhuno jānanaṃ sattūpaladdhiṃ jahati, sattasaññaṃ ugghāṭeti, kammaṭṭhānaṃ ceva satipaṭṭhānabhāvanā ca hoti.
But the knowing of this monk abandons the apprehension of a being, dismantles the perception of a being, and is both a meditation subject and the development of the establishment of mindfulness.
Tuy nhiên, sự hiểu biết của vị tỳ khưu này từ bỏ quan niệm về chúng sinh, loại bỏ tưởng về chúng sinh, và vừa là đề mục thiền định vừa là sự tu tập chánh niệm.
Idañhi ‘‘ko vedayati, kassa vedanā, kiṃ kāraṇā vedanā’’ti evaṃ sampajānavediyanaṃ sandhāya vuttaṃ.
For this was said with reference to the experience of one who knows with clear comprehension, asking: "Who feels? Whose feeling is it? What is the cause of feeling?"
Thật vậy, điều này được nói đến khi đề cập đến sự cảm thọ với sự hiểu biết rõ ràng như: ‘‘Ai cảm thọ? Thọ của ai? Vì lý do gì mà có thọ?’’
Tattha ko vedayatīti na koci satto vā puggalo vā vedayati.
Therein, who feels? No being or person feels.
Trong đó, ai cảm thọ? (ko vedayati): Không có chúng sinh hay cá nhân nào cảm thọ.
Kassa vedanāti na kassaci sattassa vā puggalassa vā vedanā.
Whose feeling is it? It is not the feeling of any being or person.
Thọ của ai? (kassa vedanā): Không có thọ của bất kỳ chúng sinh hay cá nhân nào.
Kiṃ kāraṇā vedanāti vatthuārammaṇāva panassa vedanā.
What is the cause of feeling? Feeling has a physical basis and an object as its cause.
Vì lý do gì mà có thọ? (kiṃ kāraṇā vedanā): Thọ chỉ là đối tượng của các căn.
Tasmā esa evaṃ pajānāti – ‘‘taṃ taṃ sukhādīnaṃ vatthuṃ ārammaṇaṃ katvā vedanāva vedayati.
Therefore, he knows thus: "It is feeling itself that feels, taking this or that physical basis of pleasure and so on as its object.
Vì vậy, vị ấy biết rõ như sau: ‘‘Chỉ có thọ cảm thọ, lấy đối tượng là các căn của lạc, v.v.’’
Taṃ pana vedanāpavattiṃ upādāya ‘ahaṃ vedayāmī’ti vohāramattaṃ hotī’’ti.
But depending on the occurrence of that feeling, the mere convention 'I feel' arises."
‘‘Tuy nhiên, dựa trên sự phát sinh của thọ đó, việc nói ‘tôi cảm thọ’ chỉ là một cách gọi thông thường.’’
Evaṃ vedanāva vatthuṃ ārammaṇaṃ katvā vedanāva vedayatīti sallakkhento esa ‘‘sukhaṃ vedanaṃ vedayāmī’’ti pajānātīti veditabbo.
Thus, while observing that "it is feeling itself that feels, taking a physical basis as its object," this person is to be understood as knowing, "I am experiencing a pleasant feeling."
Vị ấy nên được hiểu là biết ‘‘tôi cảm thọ lạc’’ khi quán sát rằng chỉ có thọ cảm thọ, lấy đối tượng là các căn.
Cittalapabbate aññataro thero viya.
Like a certain elder on Cittalapabbata.
Giống như một vị trưởng lão ở núi Cittalapabbata.
Thero kira aphāsukakāle balavavedanāya nitthunanto aparāparaṃ parivattati.
It is said that the elder, at a time of discomfort, was groaning due to a strong feeling and turning over and over.
Nghe nói, khi bị bệnh, vị trưởng lão đau đớn dữ dội, rên rỉ và lăn qua lăn lại.
Tameko daharo āha ‘‘kataraṃ vo, bhante, ṭhānaṃ rujjatī’’ti.
A young monk said to him, "Venerable sir, which part of you is in pain?"
Một vị tỳ khưu trẻ hỏi: ‘‘Bạch Đại đức, chỗ nào của Đại đức đau?’’
Āvuso, pāṭiyekkaṃ rujjanaṭṭhānaṃ nāma natthi, vatthuṃ ārammaṇaṃ katvā vedanāva vedayatīti.
"Friend, there is no particular place of pain; it is feeling itself that feels, taking a physical basis as its object."
Vị trưởng lão trả lời: ‘‘Này hiền giả, không có chỗ đau riêng biệt nào cả. Chỉ có thọ cảm thọ, lấy đối tượng là các căn.’’
Evaṃ jānanakālato paṭṭhāya adhivāsetuṃ vaṭṭati no, bhanteti.
"Venerable sir, from the moment of knowing this, isn't it proper to endure?"
Vị tỳ khưu trẻ hỏi: ‘‘Bạch Đại đức, từ khi biết như vậy, có nên chịu đựng không, bạch Đại đức?’’
Adhivāsemi āvusoti.
"I am enduring, friend."
Vị trưởng lão đáp: ‘‘Này hiền giả, tôi sẽ chịu đựng.’’
Adhivāsanā, bhante, seyyāti.
"Venerable sir, endurance is excellent."
Vị tỳ khưu trẻ nói: ‘‘Bạch Đại đức, sự chịu đựng là tốt nhất.’’
Thero adhivāsesi.
The elder endured.
Vị trưởng lão chịu đựng.
Tato vāto yāva hadayā phālesi, mañcake antāni rāsikatāni ahesuṃ.
Then the wind element tore through him up to his heart; his intestines were piled up on the bed.
Sau đó, gió (trong bụng) xé toạc đến tim, và ruột nằm thành đống trên giường.
Thero daharassa dassesi ‘‘vaṭṭatāvuso, ettakā adhivāsanā’’ti.
The elder showed the young monk, "Friend, is this much endurance proper?"
Vị trưởng lão chỉ cho vị tỳ khưu trẻ và nói: ‘‘Này hiền giả, sự chịu đựng đến mức này có được không?’’
Daharo tuṇhī ahosi.
The young monk was silent.
Vị tỳ khưu trẻ im lặng.
Thero vīriyasamataṃ yojetvā saha paṭisambhidāhi arahattaṃ pāpuṇitvā samasīsī hutvā parinibbāyi.
The elder, having balanced his energy, attained Arahantship together with the analytical knowledges and, having become one whose defilements ended at the same time as his life, he attained final Nibbāna.
Vị trưởng lão kết hợp sự quân bình giữa tinh tấn và định, đạt A-la-hán cùng với các phân tích tuệ (paṭisambhidā), trở thành một vị đồng niên (samasīsī) và nhập Niết Bàn.
Yathā ca sukhaṃ, evaṃ dukkhaṃ…pe… nirāmisaṃ adukkhamasukhaṃ vedanaṃ vedayamāno ‘‘nirāmisaṃ adukkhamasukhaṃ vedanaṃ vedayāmī’’ti pajānāti.
And just as with a pleasant feeling, so too with a painful feeling... and so on... when experiencing a neither-painful-nor-pleasant feeling that is unworldly, he knows, "I am experiencing a neither-painful-nor-pleasant feeling that is unworldly."
Cũng như lạc thọ, tương tự là khổ thọ… (v.v.)… Vị ấy cảm thọ thọ không khổ không lạc không nhiễm ô (nirāmisaṃ adukkhamasukhaṃ vedanaṃ) và biết: ‘‘Tôi đang cảm thọ thọ không khổ không lạc không nhiễm ô.’’
Iti bhagavā rūpakammaṭṭhānaṃ kathetvā arūpakammaṭṭhānaṃ kathento vedanāvasena kathesi.
Thus, having taught a meditation subject based on form, the Blessed One taught a meditation subject based on the formless by way of feelings.
Như vậy, Đức Thế Tôn sau khi thuyết giảng đề mục thiền về sắc (rūpakammaṭṭhāna), đã thuyết giảng đề mục thiền về phi sắc (arūpakammaṭṭhāna) theo phương diện thọ.
Duvidhañhi kammaṭṭhānaṃ rūpakammaṭṭhānañca arūpakammaṭṭhānañca.
For meditation subjects are of two kinds: meditation subjects based on form and meditation subjects based on the formless.
Thật vậy, có hai loại đề mục thiền định: đề mục thiền về sắc và đề mục thiền về phi sắc.
Rūpapariggaho arūpapariggahotipi etadeva vuccati.
This is also called the grasping of form and the grasping of the formless.
Sự quán sát sắc và sự quán sát phi sắc cũng được gọi như vậy.
Tattha bhagavā rūpakammaṭṭhānaṃ kathento saṅkhepamanasikāravasena vā vitthāramanasikāravasena vā catudhātuvavatthānaṃ kathesi.
Therein, when teaching a meditation subject based on form, the Blessed One taught the defining of the four elements either by way of brief contemplation or by way of detailed contemplation.
Trong đó, Đức Thế Tôn khi thuyết giảng đề mục thiền về sắc, đã thuyết giảng về sự phân biệt bốn yếu tố (catudhātuvavatthāna) theo cách quán sát tóm tắt hoặc quán sát chi tiết.
Tadubhayampi sabbākārato visuddhimagge dassitameva.
Both of these have been shown in all their aspects in the Visuddhimagga.
Cả hai điều đó đều đã được trình bày đầy đủ trong bộ Visuddhimagga.
Arūpakammaṭṭhānaṃ pana kathento yebhuyyena vedanāvasena katheti.
But when teaching the immaterial meditation subject, he generally teaches it by way of feeling.
Khi thuyết giảng về đề mục thiền vô sắc (arūpakammaṭṭhāna), Đức Phật thường thuyết giảng theo phương diện thọ (vedanā).
Tividho hi arūpakammaṭṭhāne abhiniveso phassavasena vedanāvasena cittavasenāti.
Indeed, in the immaterial meditation subject, the application of mind is threefold: by way of contact, by way of feeling, and by way of consciousness.
Thật vậy, trong đề mục thiền vô sắc, sự chú tâm có ba loại: theo phương diện xúc (phassa), theo phương diện thọ (vedanā) và theo phương diện tâm (citta).
Kathaṃ?
How so?
Như thế nào?
Ekaccassa hi saṃkhittena vā vitthārena vā pariggahite rūpakammaṭṭhāne tasmiṃ ārammaṇe cittacetasikānaṃ paṭhamābhinipāto taṃ ārammaṇaṃ phusanto uppajjamāno phasso pākaṭo hoti.
For a certain person, when the material meditation subject has been comprehended either briefly or in detail, among the mind and mental factors in that object, the initial impact—the contact that arises while touching that object—is prominent.
Thật vậy, đối với một số người, khi đề mục thiền sắc (rūpakammaṭṭhāna) được nắm giữ một cách tóm tắt hoặc chi tiết, sự tiếp xúc (phassa) khởi lên chạm vào đối tượng ấy, là sự chú tâm đầu tiên của tâm và các tâm sở, trở nên rõ ràng.
Ekaccassa taṃ ārammaṇaṃ anubhavantī uppajjamānā vedanā pākaṭā hoti.
For a certain person, the feeling that arises while experiencing that object is prominent.
Đối với một số người khác, thọ (vedanā) khởi lên cảm nhận đối tượng ấy, trở nên rõ ràng.
Ekaccassa taṃ ārammaṇaṃ pariggahetvā vijānantaṃ uppajjamānaṃ viññāṇaṃ pākaṭaṃ hoti.
For a certain person, the consciousness that arises while discerning that object after having comprehended it is prominent.
Đối với một số người khác, thức (viññāṇa) khởi lên nắm giữ và nhận biết đối tượng ấy, trở nên rõ ràng.
Tattha yassa phasso pākaṭo hoti, sopi ‘‘na kevalaṃ phassova uppajjati, tena saddhiṃ tadeva ārammaṇaṃ anubhavamānā vedanāpi uppajjati, sañjānanamānā saññāpi, cetayamānā cetanāpi, vijānanamānaṃ viññāṇampi uppajjatī’’ti phassapañcamakeyeva pariggaṇhāti.
Among them, for the one to whom contact is prominent, he too comprehends just the five factors with contact as the fifth, thinking: “It is not only contact that arises; along with it, feeling, which experiences that same object, also arises; perception, which perceives, also arises; volition, which wills, also arises; and consciousness, which cognizes, also arises.”
Trong số đó, đối với người mà xúc (phassa) rõ ràng, vị ấy cũng quán xét rằng: “Không chỉ xúc khởi lên, mà cùng với xúc, thọ cảm nhận đối tượng ấy cũng khởi lên, tưởng nhận biết cũng khởi lên, tư tác ý cũng khởi lên, và thức nhận biết cũng khởi lên”, như vậy vị ấy nắm giữ năm pháp có xúc đứng đầu (phassapañcamaka).
Yassa vedanā pākaṭā hoti.
For the one to whom feeling is prominent,
Đối với người mà thọ (vedanā) rõ ràng,
So ‘‘na kevalaṃ vedanāva uppajjati, tāya saddhiṃ tadevārammaṇaṃ phusamāno phassopi uppajjati, sañjānanamānā saññāpi, cetayamānā cetanāpi, vijānanamānaṃ viññāṇampi uppajjatī’’ti phassapañcamakeyeva pariggaṇhāti.
he comprehends just the five factors with contact as the fifth, thinking: “It is not only feeling that arises; along with it, contact, which touches that same object, also arises; perception, which perceives, also arises; volition, which wills, also arises; and consciousness, which cognizes, also arises.”
vị ấy quán xét rằng: “Không chỉ thọ khởi lên, mà cùng với thọ, xúc chạm đối tượng ấy cũng khởi lên, tưởng nhận biết cũng khởi lên, tư tác ý cũng khởi lên, và thức nhận biết cũng khởi lên”, như vậy vị ấy nắm giữ năm pháp có xúc đứng đầu.
Yassa viññāṇaṃ pākaṭaṃ hoti, so ‘‘na kevalaṃ viññāṇameva uppajjati, tena saddhiṃ tadevārammaṇaṃ phusamāno phassopi uppajjati, anubhavamānā vedanāpi, sañjānanamānā saññāpi, cetayamānā cetanāpi uppajjatī’’ti phassapañcamakeyeva pariggaṇhāti.
For the one to whom consciousness is prominent, he comprehends just the five factors with contact as the fifth, thinking: “It is not only consciousness that arises; along with it, contact, which touches that same object, also arises; feeling, which experiences, also arises; perception, which perceives, also arises; and volition, which wills, also arises.”
Đối với người mà thức (viññāṇa) rõ ràng, vị ấy quán xét rằng: “Không chỉ thức khởi lên, mà cùng với thức, xúc chạm đối tượng ấy cũng khởi lên, thọ cảm nhận cũng khởi lên, tưởng nhận biết cũng khởi lên, và tư tác ý cũng khởi lên”, như vậy vị ấy nắm giữ năm pháp có xúc đứng đầu.
So ‘‘ime phassapañcamakā dhammā kiṃ nissitā’’ti upadhārento ‘‘vatthuṃ nissitā’’ti pajānāti.
While investigating, “What do these five factors with contact as the fifth depend on?” he understands, “They depend on a physical basis.”
Vị ấy quán xét: “Năm pháp có xúc đứng đầu này nương tựa vào đâu?”, và vị ấy nhận biết rằng chúng nương tựa vào vật.
Vatthu nāma karajakāyo, yaṃ sandhāya vuttaṃ ‘‘idañca me viññāṇaṃ ettha sitaṃ ettha paṭibaddha’’nti (dī. ni. 1.234,235; ma. ni. 2.252).
The physical basis is the body born of action, concerning which it was said: “And this consciousness of mine is dependent on this and is bound up with this.”
Vật (vatthu) ở đây là thân do nghiệp sinh (karajakāya), như đã nói: “Thức này của ta nương tựa vào đây, bị ràng buộc vào đây” (Dī. Ni. 1.234,235; Ma. Ni. 2.252).
So atthato bhūtāni ceva upādārūpāni ca.
In terms of its essence, it is both the primary elements and derived matter.
Về mặt ý nghĩa, vật đó là các đại hiển hình (bhūta) và các sắc sở tạo (upādārūpa).
Evamettha ‘‘vatthu rūpaṃ, phassapañcamakā nāma’’nti nāmarūpamattameva passati.
Thus, herein, he sees only mind-and-matter, thinking: “The physical basis is matter; the five factors with contact as the fifth are mind.”
Như vậy, ở đây vị ấy chỉ thấy vật là sắc (rūpa) và năm pháp có xúc đứng đầu là danh (nāma), tức là chỉ thấy danh sắc.
Rūpaṃ cettha rūpakkhandho, nāmaṃ cattāro arūpino khandhāti pañcakkhandhamattaṃ hoti.
And herein, matter is the aggregate of matter, and mind is the four immaterial aggregates; thus, it is just the five aggregates.
Sắc ở đây là sắc uẩn, danh là bốn uẩn vô sắc, như vậy chỉ là năm uẩn.
Nāmarūpavinimuttā hi pañcakkhandhā, pañcakkhandhavinimuttañca nāmarūpaṃ natthi.
Indeed, the five aggregates do not exist apart from mind-and-matter, and mind-and-matter do not exist apart from the five aggregates.
Thật vậy, không có năm uẩn nào tách rời danh sắc, và cũng không có danh sắc nào tách rời năm uẩn.
Idha pana bhagavā arūpakammaṭṭhānaṃ kathento vedanāvasena kathesi.
Here, however, the Blessed One, when teaching the immaterial meditation subject, taught it by way of feeling.
Tuy nhiên, ở đây, khi thuyết giảng về đề mục thiền vô sắc (arūpakammaṭṭhāna), Đức Thế Tôn đã thuyết giảng theo phương diện thọ (vedanā).
Phassavasena vā hi viññāṇavasena vā kathīyamānaṃ na pākaṭaṃ hoti, andhakāraṃ viya khāyati.
For if it were taught by way of contact or by way of consciousness, it would not be prominent; it would seem as if dark.
Thật vậy, nếu thuyết giảng theo phương diện xúc (phassa) hoặc thức (viññāṇa) thì không rõ ràng, giống như bóng tối.
Vedanāvasena pana pākaṭaṃ hoti.
But taught by way of feeling, it is prominent.
Nhưng nếu thuyết giảng theo phương diện thọ (vedanā) thì rõ ràng.
Vedanānaṃ uppattipākaṭatāya.
Because of the prominence of the arising of feelings.
Vì sự khởi lên của các thọ là rõ ràng.
Sukhadukkhavedanānañhi uppatti pākaṭā.
Indeed, the arising of pleasant and painful feelings is prominent.
Thật vậy, sự khởi lên của thọ lạc (sukha) và thọ khổ (dukkha) là rõ ràng.
Yadā sukhaṃ uppajjati, sakalasarīraṃ khobhentaṃ maddantaṃ pharamānaṃ abhisandayamānaṃ satadhotaṃ sappiṃ khādāpayantaṃ viya satapākatelaṃ makkhayamānaṃ viya ghaṭasahassena pariḷāhaṃ nibbāpayamānaṃ viya ‘‘aho sukhaṃ aho sukha’’nti vācaṃ nicchārayamānameva uppajjati.
When a pleasant feeling arises, it arises agitating, pressing, pervading, and suffusing the entire body, just as if making one eat ghee washed a hundred times, as if smearing on oil cooked a hundred times, as if extinguishing a fever with a thousand pots of water, while causing one to exclaim, “Oh, how pleasant! Oh, how pleasant!”
Khi lạc khởi lên, nó khuấy động, đè nén, lan tràn, làm ướt khắp toàn thân, giống như đang ăn bơ đã rửa trăm lần, giống như đang xoa dầu đã nấu trăm lần, giống như đang dập tắt cơn nóng bằng ngàn bình nước, và khởi lên kèm theo lời nói: “Ôi lạc, ôi lạc!”
Yadā dukkhaṃ uppajjati, sakalasarīraṃ khobhentaṃ maddantaṃ pharamānaṃ abhisandayamānaṃ tattaphālaṃ pavesentaṃ viya vilīnatambalohena āsiñcantaṃ viya sukkhatiṇavanappatimhi araññe dāruukkākalāpaṃ khipamānaṃ viya ‘‘aho dukkhaṃ aho dukkha’’nti vippalāpayamānameva uppajjati.
When a painful feeling arises, it arises agitating, pressing, pervading, and suffusing the entire body, just as if inserting a heated iron plate, as if pouring molten copper, as if throwing a bundle of burning wood into a forest of dry grass and trees, while causing one to lament, “Oh, how painful! Oh, how painful!”
Khi khổ khởi lên, nó khuấy động, đè nén, lan tràn, làm ướt khắp toàn thân, giống như đang đưa vào một mảnh sắt nung đỏ, giống như đang đổ đồng chảy, giống như đang ném một bó củi lửa vào một khu rừng khô cỏ, và khởi lên kèm theo tiếng than vãn: “Ôi khổ, ôi khổ!”
Iti sukhadukkhavedanānaṃ uppatti pākaṭā hoti.
Thus, the arising of pleasant and painful feelings is prominent.
Như vậy, sự khởi lên của thọ lạc và thọ khổ là rõ ràng.
Adukkhamasukhā pana duddīpanā andhakārāva avibhūtā.
But neither-painful-nor-pleasant feeling is difficult to discern, dark, and indistinct.
Tuy nhiên, thọ không khổ không lạc (adukkhamasukhā) thì khó diễn tả, như bóng tối, không rõ ràng.
Sā sukhadukkhānaṃ apagame sātāsātappaṭikkhepavasena majjhattākārabhūtā adukkhamasukhā vedanāti nayato gaṇhantassa pākaṭā hoti.
It becomes prominent for one who grasps it by inference, thinking: “At the cessation of pleasant and painful feelings, the feeling which has the characteristic of neutrality, by way of rejecting the agreeable and disagreeable, is neither-painful-nor-pleasant feeling.”
Thọ ấy trở nên rõ ràng đối với người nắm giữ theo phương pháp, rằng khi lạc và khổ biến mất, thọ không khổ không lạc là trạng thái trung tính do từ bỏ sự ưa thích và không ưa thích.
Yathā kiṃ?
Like what?
Giống như cái gì?
Yathā antarā piṭṭhipāsāṇaṃ ārohitvā palātassa migassa anupathaṃ gacchanto migaluddako piṭṭhipāsāṇassa orabhāgepi parabhāgepi padaṃ disvā majjhe apassantopi ‘‘ito āruḷho, ito oruḷho, majjhe piṭṭhipāsāṇe iminā padesena gato bhavissatī’’ti nayato jānāti, evaṃ āruḷhaṭṭhāne padaṃ viya hi sukhavedanāya uppatti pākaṭā hoti.
Just as a deer hunter, following the tracks of a deer that has fled after climbing onto the middle of a flat rock, even though not seeing tracks in the middle, having seen them on the near side and the far side of the flat rock, knows by inference, “It must have climbed up from here and descended from there, and must have gone by this route on the flat rock in the middle.” So too, the arising of a pleasant feeling is prominent, like the tracks at the place of ascent.
Giống như người thợ săn hươu đang lần theo dấu vết của con hươu đã trốn thoát sau khi leo lên giữa một tảng đá phẳng, dù không thấy dấu chân ở giữa, nhưng khi thấy dấu chân ở phía bên này và phía bên kia của tảng đá, vị ấy biết theo phương pháp rằng: “Nó đã leo lên từ đây, đã xuống từ đây, và ở giữa tảng đá phẳng, nó hẳn đã đi qua đoạn này”. Tương tự như vậy, sự khởi lên của thọ lạc rõ ràng như dấu chân ở chỗ leo lên.
Oruḷhaṭṭhāne padaṃ viya dukkhavedanāya uppatti pākaṭā hoti.
The arising of a painful feeling is prominent, like the tracks at the place of descent.
Sự khởi lên của thọ khổ rõ ràng như dấu chân ở chỗ đi xuống.
‘‘Ito āruyha ito oruyha majjhe evaṃ gato’’ti nayato gahaṇaṃ viya sukhadukkhānaṃ apagame sātāsātappaṭikkhepavasena majjhattākārabhūtā adukkhamasukhā vedanāti nayato gaṇhantassa pākaṭā hoti.
It becomes prominent for one who grasps it by inference, thinking: “At the cessation of pleasant and painful feelings, the feeling which has the characteristic of neutrality, by way of rejecting the agreeable and disagreeable, is neither-painful-nor-pleasant feeling,” just like grasping by inference, “Having climbed up from here and descended from there, it went thus in the middle.”
Và sự nắm giữ theo phương pháp rằng: “Nó đã leo lên từ đây, xuống từ đây và đi ở giữa như vậy”, thì thọ không khổ không lạc, là trạng thái trung tính do từ bỏ sự ưa thích và không ưa thích khi lạc và khổ biến mất, trở nên rõ ràng đối với người nắm giữ theo phương pháp.
Evaṃ bhagavā paṭhamaṃ rūpakammaṭṭhānaṃ kathetvā pacchā arūpakammaṭṭhānaṃ vedanāvasena nibbattetvāva dassesi.
In this way, the Blessed One, having first taught the material meditation subject, then demonstrated the immaterial meditation subject by producing it by way of feeling.
Như vậy, Đức Thế Tôn đã thuyết giảng đề mục thiền sắc (rūpakammaṭṭhāna) trước, sau đó Ngài đã trình bày đề mục thiền vô sắc (arūpakammaṭṭhāna) bằng cách phát sinh nó theo phương diện thọ.
Na kevalañca idheva evaṃ dassesi, cūḷataṇhāsaṅkhaye, mahātaṇhāsaṅkhaye, cūḷavedalle, mahāvedalle, raṭṭhapālasutte, māgaṇḍiyasutte, dhātuvibhaṅge, āneñjasappāye, dīghanikāyamhi mahānidāne, sakkapañhe, mahāsatipaṭṭhāne, saṃyuttamhi cūḷanidānasutte, rukkhopame, parivīmaṃsanasutte, sakale vedanāsaṃyutteti evaṃ anekesu suttesu paṭhamaṃ rūpakammaṭṭhānaṃ kathetvā pacchā arūpakammaṭṭhānaṃ vedanāvasena nibbattetvā dassesi.
And he did not demonstrate it in this way only here, but in many suttas such as the Cūḷataṇhāsaṅkhaya, Mahātaṇhāsaṅkhaya, Cūḷavedalla, Mahāvedalla, Raṭṭhapālasutta, Māgaṇḍiyasutta, Dhātuvibhaṅga, and Āneñjasappāya; and in the Dīgha Nikāya, in the Mahānidāna, Sakkapañha, and Mahāsatipaṭṭhāna; and in the Saṃyutta Nikāya, in the Cūḷanidānasutta, Rukkhopama, Parivīmaṃsanasutta, and the entire Vedanāsaṃyutta—in these and others, having first taught the material meditation subject, he then demonstrated the immaterial meditation subject by producing it by way of feeling.
Không những Ngài đã trình bày như vậy ở đây, mà còn trong nhiều kinh khác như Cūḷataṇhāsaṅkhaya, Mahātaṇhāsaṅkhaya, Cūḷavedalla, Mahāvedalla, Raṭṭhapālasutta, Māgaṇḍiyasutta, Dhātuvibhaṅga, Āneñjasappāya; trong Trường Bộ Kinh (Dīghanikāya) có Mahānidāna, Sakkapañha, Mahāsatipaṭṭhāna; trong Tương Ưng Bộ Kinh (Saṃyuttamhi) có Cūḷanidānasutta, Rukkhopama, Parivīmaṃsanasutta, và toàn bộ Vedanāsaṃyutta. Trong tất cả các kinh ấy, Ngài đều thuyết giảng đề mục thiền sắc trước, sau đó trình bày đề mục thiền vô sắc bằng cách phát sinh nó theo phương diện thọ.
Yathā ca tesu, evaṃ imasmimpi satipaṭṭhānasutte paṭhamaṃ rūpakammaṭṭhānaṃ kathetvā pacchā arūpakammaṭṭhānaṃ vedanāvasena nibbattetvā dassesi.
And just as in those suttas, so too in this Satipaṭṭhāna Sutta, having first taught the material meditation subject, he then demonstrated the immaterial meditation subject by producing it by way of feeling.
Và giống như trong các kinh đó, trong kinh Satipaṭṭhāna này, Ngài cũng thuyết giảng đề mục thiền sắc trước, sau đó trình bày đề mục thiền vô sắc bằng cách phát sinh nó theo phương diện thọ.
Tattha sukhaṃ vedanantiādīsu ayaṃ aparopi pajānanapariyāyo – sukhaṃ vedanaṃ vedayāmīti pajānātīti sukhavedanākkhaṇe dukkhāya vedanāya abhāvato sukhaṃ vedanaṃ vedayamāno ‘‘sukhaṃ vedanaṃ vedayāmī’’ti pajānāti.
Therein, in the phrases beginning with a pleasant feeling, this is another method of knowing: ‘He knows, “I am experiencing a pleasant feeling”’ means that at the moment of a pleasant feeling, because of the absence of a painful feeling, while experiencing a pleasant feeling, he knows, “I am experiencing a pleasant feeling.”
Trong các đoạn như sukhaṃ vedanaṃ (thọ lạc) v.v..., đây là một phương pháp nhận biết khác: sukhaṃ vedanaṃ vedayāmīti pajānāti (vị ấy biết: “Ta đang cảm thọ lạc thọ”), nghĩa là vào khoảnh khắc của lạc thọ, vì không có khổ thọ, nên khi cảm thọ lạc thọ, vị ấy biết: “Ta đang cảm thọ lạc thọ”.
Tena yā pubbe anubhūtapubbā dukkhā vedanā, tassā idāni abhāvato imissā ca sukhāya vedanāya ito paṭhamaṃ abhāvato vedanā nāma aniccā adhuvā vipariṇāmadhammā, itiha tattha sampajāno hoti.
By that, because of the present absence of the painful feeling that was previously experienced, and because of the absence of this pleasant feeling before this moment, he knows, “Feelings are impermanent, unstable, and of a nature to change.” Thus, in this way, he is clearly comprehending therein.
Do đó, vì khổ thọ đã từng được cảm thọ trước đây giờ không còn, và vì lạc thọ này trước đây chưa từng có, nên thọ là vô thường (aniccā), không bền vững (adhuvā), có bản chất biến đổi (vipariṇāmadhammā). Như vậy, vị ấy có sự tỉnh giác (sampajāno) về điều đó.
‘‘Yasmiṃ aggivessana samaye sukhaṃ vedanaṃ vedeti, neva tasmiṃ samaye dukkhaṃ vedanaṃ vedeti, na adukkhamasukhaṃ vedanaṃ vedeti, sukhaṃyeva tasmiṃ samaye vedanaṃ vedeti, yasmiṃ aggivessana samaye dukkhaṃ…pe… adukkhamasukhaṃ vedanaṃ vedeti, neva tasmiṃ samaye sukhaṃ vedanaṃ vedeti, na dukkhaṃ vedanaṃ vedeti, adukkhamasukhaññeva tasmiṃ samaye vedanaṃ vedeti.
“Aggivessana, at the time when one experiences a pleasant feeling, at that time one does not experience a painful feeling, nor does one experience a neither-painful-nor-pleasant feeling; at that time one experiences only a pleasant feeling. Aggivessana, at the time when one experiences a painful… and so on… at the time when one experiences a neither-painful-nor-pleasant feeling, at that time one does not experience a pleasant feeling, nor does one experience a painful feeling; at that time one experiences only a neither-painful-nor-pleasant feeling.
“Này Aggivessana, khi nào người ấy cảm thọ lạc thọ, vào lúc ấy người ấy không cảm thọ khổ thọ, không cảm thọ bất khổ bất lạc thọ; vào lúc ấy người ấy chỉ cảm thọ lạc thọ. Này Aggivessana, khi nào người ấy cảm thọ khổ thọ… (tương tự như trên đối với khổ thọ và bất khổ bất lạc thọ)… vào lúc ấy người ấy không cảm thọ lạc thọ, không cảm thọ khổ thọ; vào lúc ấy người ấy chỉ cảm thọ bất khổ bất lạc thọ.
Sukhāpi kho aggivessana vedanā aniccā saṅkhatā paṭiccasamuppannā khayadhammā vayadhammā virāgadhammā nirodhadhammā.
Moreover, Aggivessana, a pleasant feeling is impermanent, conditioned, dependently arisen, of a nature to be destroyed, of a nature to vanish, of a nature to fade away, of a nature to cease.
Này Aggivessana, lạc thọ cũng là vô thường (anicca), hữu vi (saṅkhata), duyên sinh (paṭiccasamuppanna), có bản chất hủy diệt (khayadhammā), có bản chất biến mất (vayadhammā), có bản chất ly tham (virāgadhammā), có bản chất đoạn diệt (nirodhadhammā).
Dukkhāpi kho…pe… adukkhamasukhāpi kho aggivessana vedanā aniccā…pe… nirodhadhammā.
Moreover, a painful feeling… and so on… Moreover, Aggivessana, a neither-painful-nor-pleasant feeling is impermanent… and so on… of a nature to cease.
Khổ thọ cũng vậy… (tương tự như trên)… bất khổ bất lạc thọ cũng vậy, này Aggivessana, là vô thường… (tương tự như trên)… có bản chất đoạn diệt.
Evaṃ passaṃ aggivessana sutavā ariyasāvako sukhāyapi vedanāya dukkhāyapi vedanāya adukkhamasukhāyapi vedanāya nibbindati, nibbindaṃ virajjati, virāgā vimuccati, vimuttasmiṃ vimuttamiti ñāṇaṃ hoti.
Seeing thus, Aggivessana, the instructed noble disciple becomes disenchanted with pleasant feeling, with painful feeling, and with neither-painful-nor-pleasant feeling. Being disenchanted, he becomes dispassionate. Through dispassion, he is liberated. In the liberated, the knowledge ‘it is liberated’ arises.
Này Aggivessana, khi thấy như vậy, vị đệ tử Thánh đã nghe pháp (sutavā ariyasāvaka) nhàm chán (nibbindati) đối với lạc thọ, đối với khổ thọ, và đối với bất khổ bất lạc thọ. Khi nhàm chán, vị ấy ly tham (virajjati). Do ly tham, vị ấy giải thoát (vimuccati). Khi giải thoát, vị ấy có trí tuệ (ñāṇaṃ) rằng ‘đã giải thoát’.
‘Khīṇā jāti, vusitaṃ brahmacariyaṃ, kataṃ karaṇīyaṃ, nāparaṃ itthattāyā’ti pajānātī’’ti (ma. ni. 2.205).
He understands: ‘Birth is destroyed, the holy life has been lived, what had to be done has been done, there is nothing further for this state of being.’”
Vị ấy biết rõ: ‘Sanh đã tận, Phạm hạnh đã thành, việc cần làm đã làm, không còn tái sinh vào trạng thái này nữa’.”
Sāmisaṃ vā sukhantiādīsu sāmisā sukhā nāma pañcakāmaguṇāmisanissitā cha gehasitasomanassavedanā.
In the passage beginning Or carnal pleasure, carnal pleasures refer to the six kinds of household-based pleasant mental feeling that are dependent on the taint of the five strands of sensual pleasure.
Trong các câu như “ Lạc hữu ái (Sāmisaṃ vā sukhaṃ)”, v.v… “ Lạc hữu ái (sāmisā sukhā)” là sáu loại thọ hỷ tại gia (gehasitasomanassavedanā) nương vào ái dục ngũ trần.
Nirāmisā sukhā nāma cha nekkhammasitasomanassavedanā.
Spiritual pleasures refer to the six kinds of renunciation-based pleasant mental feeling.
“ Lạc vô ái (Nirāmisā sukhā)” là sáu loại thọ hỷ xuất ly (nekkhammasitasomanassavedanā).
Sāmisā dukkhā nāma cha gehasitadomanassavedanā.
Carnal pains refer to the six kinds of household-based painful mental feeling.
“ Khổ hữu ái (Sāmisā dukkhā)” là sáu loại thọ ưu tại gia (gehasitadomanassavedanā).
Nirāmisā dukkhā nāma cha nekkhammasitadomanassavedanā.
Spiritual pains refer to the six kinds of renunciation-based painful mental feeling.
“ Khổ vô ái (Nirāmisā dukkhā)” là sáu loại thọ ưu xuất ly (nekkhammasitadomanassavedanā).
Sāmisā adukkhamasukhā nāma cha gehasitaupekkhā vedanā.
Carnal neither-painful-nor-pleasant feelings refer to the six kinds of household-based equanimous feeling.
“ Bất khổ bất lạc hữu ái (Sāmisā adukkhamasukhā)” là sáu loại thọ xả tại gia (gehasitaupekkhā vedanā).
Nirāmisā adukkhamasukhā nāma cha nekkhammasitaupekkhā vedanā.
Spiritual neither-painful-nor-pleasant feelings refer to the six kinds of renunciation-based equanimous feeling.
“ Bất khổ bất lạc vô ái (Nirāmisā adukkhamasukhā)” là sáu loại thọ xả xuất ly (nekkhammasitaupekkhā vedanā).
Tāsaṃ vibhāgo uparipaṇṇāsake pāḷiyaṃ āgatoyeva.
Their classification has already come in the Pāḷi text of the Uparipaṇṇāsaka.
Sự phân loại của chúng đã được trình bày trong kinh Pāḷi của Uparipaṇṇāsaka.
Iti ajjhattaṃ vāti evaṃ sukhavedanādipariggahaṇena attano vā vedanāsu, parassa vā vedanāsu, kālena vā attano, kālena vā parassa vedanāsu vedanānupassī viharati.
Thus internally, or…: In this way, by comprehending pleasant feeling and so on, he abides contemplating feelings in feelings, whether in his own feelings, or in the feelings of another, or at one time in his own feelings and at another time in the feelings of another.
Hoặc nội tại (Iti ajjhattaṃ vā): Như vậy, thông qua việc nhận biết các thọ như lạc thọ, vị ấy an trú quán thọ trên các thọ của chính mình, hoặc trên các thọ của người khác, hoặc đôi khi trên các thọ của chính mình, đôi khi trên các thọ của người khác.
Samudayavayadhammānupassī vāti ettha pana ‘‘avijjāsamudayā vedanāsamudayo’’tiādīhi (paṭi. ma. 1.50) pañcahi pañcahi ākārehi vedanānaṃ samudayañca vayañca passanto samudayadhammānupassī vā vedanāsu viharati, vayadhammānupassī vā vedanāsu viharati, kālena samudayadhammānupassī vā, kālena vayadhammānupassī vā vedanāsu viharatīti veditabbo.
Or one who contemplates the phenomena of arising and passing away: Here, it should be understood that, by seeing the arising and passing away of feelings in five ways each, beginning with “with the arising of ignorance, there is the arising of feeling,” he abides contemplating the phenomenon of arising in feelings, or he abides contemplating the phenomenon of passing away in feelings, or at one time he abides contemplating the phenomenon of arising in feelings, and at another time he abides contemplating the phenomenon of passing away in feelings.
Hoặc quán pháp sinh diệt (Samudayavayadhammānupassī vā): Ở đây, cần hiểu rằng vị ấy an trú quán pháp sinh diệt trên các thọ, quán sự sinh khởi và sự diệt mất của các thọ theo năm cách, như “do vô minh sinh khởi nên thọ sinh khởi” (avijjāsamudayā vedanāsamudayo), v.v… hoặc đôi khi quán pháp sinh khởi, đôi khi quán pháp diệt mất trên các thọ.
Ito paraṃ kāyānupassanāyaṃ vuttanayameva.
From here on, the method is the same as that stated in the contemplation of the body.
Từ đây trở đi, phương pháp tương tự như đã nói trong quán thân.
114. Evaṃ navavidhena vedanānupassanāsatipaṭṭhānaṃ kathetvā idāni soḷasavidhena cittānupassanaṃ kathetuṃ kathañca, bhikkhavetiādimāha.
114. Having thus taught the establishment of mindfulness through the contemplation of feeling in nine ways, he now said And how, bhikkhus, etc., to teach the contemplation of the mind in sixteen ways.
114. Sau khi thuyết giảng về niệm xứ quán thọ với chín phương pháp như vậy, bây giờ để thuyết giảng về quán tâm với mười sáu phương pháp, Đức Phật đã nói câu “ Này các tỳ khưu, và như thế nào”, v.v…
Tattha sarāganti aṭṭhavidhaṃ lobhasahagataṃ.
Therein, with lust means the eight kinds of consciousness associated with greed.
Trong đó, có tham (sarāgaṃ) là tám loại tâm tương ưng với tham (lobhasahagataṃ).
Vītarāganti lokiyakusalābyākataṃ.
Without lust means mundane wholesome and indeterminate consciousness.
Không tham (vītarāgaṃ) là tâm thiện và tâm vô ký thuộc thế gian.
Idaṃ pana yasmā sammasanaṃ na dhammasamodhānaṃ, tasmā idha ekapadepi lokuttaraṃ na labbhati.
However, since this is a matter of insight contemplation and not a consolidation of dhammas, the supramundane is not obtained in either term here.
Tuy nhiên, vì đây là sự suy xét chứ không phải là sự tập hợp các pháp, nên không có pháp siêu thế nào được chấp nhận ở đây, ngay cả trong một từ.
Sesāni cattāri akusalacittāni neva purimapadaṃ, na pacchimapadaṃ bhajanti.
The remaining four unwholesome states of mind do not belong to the former term nor to the latter term.
Bốn tâm bất thiện còn lại không thuộc về từ đầu cũng không thuộc về từ sau.
Sadosanti duvidhaṃ dosasahagataṃ.
With hate means the two kinds of consciousness associated with hate.
Có sân (sadosaṃ) là hai loại tâm tương ưng với sân (dosasahagataṃ).
Vītadosanti lokiyakusalābyākataṃ.
Without hate means mundane wholesome and indeterminate consciousness.
Không sân (vītadosaṃ) là tâm thiện và tâm vô ký thuộc thế gian.
Sesāni dasākusalacittāni neva purimaṃ padaṃ, na pacchimaṃ padaṃ bhajanti.
The remaining ten unwholesome states of mind do not belong to the former term nor to the latter term.
Mười tâm bất thiện còn lại không thuộc về từ đầu cũng không thuộc về từ sau.
Samohanti vicikicchāsahagatañceva uddhaccasahagatañcāti duvidhaṃ.
With delusion means the two kinds: that associated with uncertainty and that associated with restlessness.
Có si (samohaṃ) là hai loại tâm: tâm tương ưng với hoài nghi (vicikicchāsahagataṃ) và tâm tương ưng với phóng dật (uddhaccasahagataṃ).
Yasmā pana moho sabbākusalesu uppajjati, tasmā tānipi idha vaṭṭantiyeva.
However, since delusion arises in all unwholesome states, they are also applicable here.
Tuy nhiên, vì si (moha) sinh khởi trong tất cả các tâm bất thiện, nên những tâm đó cũng được xem là phù hợp ở đây.
Imasmiṃyeva hi duke dvādasākusalacittāni pariyādiṇṇānīti.
For in this very dyad, the twelve unwholesome states of mind are included.
Thật vậy, trong cặp pháp này, mười hai tâm bất thiện đã được bao gồm.
Vītamohanti lokiyakusalābyākataṃ.
Without delusion means mundane wholesome and indeterminate consciousness.
Không si (vītamohaṃ) là tâm thiện và tâm vô ký thuộc thế gian.
Saṃkhittanti thinamiddhānupatitaṃ, etañhi saṃkuṭitacittaṃ nāma.
Contracted means overcome by sloth and torpor, for this is called a shrunken mind.
Thu nhiếp (saṅkhittaṃ) là tâm bị hôn trầm (thina) và thụy miên (middha) chi phối, vì đây là tâm bị co rút.
Vikkhittanti uddhaccasahagataṃ, etañhi pasaṭacittaṃ nāma.
Distracted means associated with restlessness, for this is called a scattered mind.
Phân tán (vikkhittaṃ) là tâm tương ưng với phóng dật (uddhaccasahagataṃ), vì đây là tâm bị lan tràn.
Mahaggatanti rūpārūpāvacaraṃ.
Exalted means belonging to the fine-material and immaterial spheres.
Cao thượng (mahaggataṃ) là tâm thuộc sắc giới và vô sắc giới.
Amahaggatanti kāmāvacaraṃ.
Unexalted means belonging to the sense-sphere.
Không cao thượng (amahaggataṃ) là tâm thuộc dục giới.
Sauttaranti kāmāvacaraṃ.
With a superior means belonging to the sense-sphere.
Có thượng (sauttaraṃ) là tâm thuộc dục giới.
Anuttaranti rūpāvacarañca arūpāvacarañca.
Unsurpassed means belonging to the fine-material sphere and the immaterial sphere.
Vô thượng (anuttaraṃ) là tâm thuộc sắc giới và vô sắc giới.
Tatrāpi sauttaraṃ rūpāvacaraṃ, anuttaraṃ arūpāvacarameva.
Even there, belonging to the fine-material sphere is ‘with a superior’, while only belonging to the immaterial sphere is ‘unsurpassed’.
Trong đó, tâm có thượng (sauttaraṃ) là tâm thuộc sắc giới, và tâm vô thượng (anuttaraṃ) là tâm thuộc vô sắc giới.
Samāhitanti yassa appanāsamādhi upacārasamādhi vā atthi.
Concentrated means that which has either absorption concentration or access concentration.
Định tĩnh (samāhitaṃ) là tâm có định an chỉ (appanāsamādhi) hoặc định cận hành (upacārasamādhi).
Asamāhitanti ubhayasamādhivirahitaṃ.
Unconcentrated means that which is devoid of both kinds of concentration.
Không định tĩnh (asamāhitaṃ) là tâm không có cả hai loại định trên.
Vimuttanti tadaṅgavikkhambhanavimuttīhi vimuttaṃ.
Liberated means liberated through liberation by substitution of opposites and liberation by suppression.
Giải thoát (vimuttaṃ) là tâm đã giải thoát khỏi phiền não bằng tadaṅgavimutti (giải thoát từng phần) và vikkhambhanavimutti (giải thoát bằng cách trấn áp).
Avimuttanti ubhayavimuttivirahitaṃ, samucchedapaṭippassaddhinissaraṇavimuttīnaṃ pana idha okāsova natthi.
Unliberated means that which is devoid of both kinds of liberation, for there is no opportunity here at all for liberation by cutting off, liberation by tranquillization, and liberation by escape.
Chưa giải thoát (avimuttaṃ) là tâm không có cả hai loại giải thoát trên, còn giải thoát đoạn diệt (samucchedavimutti), giải thoát an tịnh (paṭippassaddhivimutti) và giải thoát xuất ly (nissaraṇavimutti) thì không có chỗ ở đây.
Iti ajjhattaṃ vāti evaṃ sarāgādipariggahaṇena yasmiṃ yasmiṃ khaṇe yaṃ yaṃ cittaṃ pavattati, taṃ taṃ sallakkhento attano vā citte, parassa vā citte, kālena vā attano, kālena vā parassa citte cittānupassī viharati.
Thus internally, or…: In this way, by comprehending the mind with lust and so on, discerning whatever mind is occurring at whatever moment, he abides contemplating the mind in the mind, whether in his own mind, or in the mind of another, or at one time in his own mind and at another time in the mind of another.
Hoặc nội tại (Iti ajjhattaṃ vā): Như vậy, thông qua việc nhận biết các tâm như tâm có tham, v.v… trong mỗi khoảnh khắc tâm nào sinh khởi, vị ấy nhận biết tâm đó, an trú quán tâm trên tâm của chính mình, hoặc trên tâm của người khác, hoặc đôi khi trên tâm của chính mình, đôi khi trên tâm của người khác.
Samudayavayadhammānupassīti ettha pana ‘‘avijjāsamudayā viññāṇasamudayo’’ti (paṭi. ma. 1.50) evaṃ pañcahi pañcahi ākārehi viññāṇassa samudayo ca vayo ca nīharitabbo.
One who contemplates the phenomena of arising and passing away: Here, the arising and passing away of consciousness should be explained in five ways each, as in “with the arising of ignorance, there is the arising of consciousness.”
Quán pháp sinh diệt (Samudayavayadhammānupassī): Ở đây, sự sinh khởi và sự diệt mất của thức (viññāṇa) cần được trình bày theo năm cách, như “do vô minh sinh khởi nên thức sinh khởi” (avijjāsamudayā viññāṇasamudayo).
Ito paraṃ vuttanayameva.
From here on, the method is the same as that already stated.
Từ đây trở đi, phương pháp tương tự như đã nói.
115. Evaṃ soḷasavidhena cittānupassanāsatipaṭṭhānaṃ kathetvā idāni pañcavidhena dhammānupassanaṃ kathetuṃ kathañca, bhikkhavetiādimāha.
115. Having thus taught the establishment of mindfulness through the contemplation of the mind in sixteen ways, he now said And how, bhikkhus, etc., to teach the contemplation of dhammas in five ways.
115. Sau khi thuyết giảng về niệm xứ quán tâm với mười sáu phương pháp như vậy, bây giờ để thuyết giảng về quán pháp với năm phương pháp, Đức Phật đã nói câu “ Này các tỳ khưu, và như thế nào”, v.v…
Apica bhagavatā kāyānupassanāya suddharūpapariggaho kathito, vedanācittānupassanāhi suddhaarūpapariggaho.
Moreover, in the contemplation of the body, the Blessed One taught the comprehension of pure materiality; in the contemplations of feeling and mind, he taught the comprehension of pure immateriality.
Hơn nữa, Đức Thế Tôn đã thuyết giảng về sự nhận biết sắc pháp thuần túy trong quán thân, và sự nhận biết danh pháp thuần túy trong quán thọ và quán tâm.
Idāni rūpārūpamissakapariggahaṃ kathetuṃ ‘‘kathañca, bhikkhave’’tiādimāha.
Now, to teach the comprehension of the mixture of materiality and immateriality, he said, “And how, bhikkhus,” etc.
Bây giờ, để thuyết giảng về sự nhận biết hỗn hợp sắc pháp và danh pháp, Đức Phật đã nói câu “Này các tỳ khưu, và như thế nào”, v.v…
Kāyānupassanāya vā rūpakkhandhapariggahova kathito, vedanānupassanāya vedanākkhandhapariggahova, cittānupassanāya viññāṇakkhandhapariggahovāti idāni saññāsaṅkhārakkhandhapariggahampi kathetuṃ ‘‘kathañca, bhikkhave’’tiādimāha.
Alternatively, in the contemplation of the body, only the comprehension of the aggregate of materiality was taught; in the contemplation of feeling, only the comprehension of the aggregate of feeling; in the contemplation of the mind, only the comprehension of the aggregate of consciousness. Now, to also teach the comprehension of the aggregates of perception and formations, he said, “And how, bhikkhus,” etc.
Hoặc, trong quán thân, chỉ thuyết giảng về sự nhận biết sắc uẩn; trong quán thọ, chỉ thuyết giảng về sự nhận biết thọ uẩn; trong quán tâm, chỉ thuyết giảng về sự nhận biết thức uẩn. Bây giờ, để thuyết giảng về sự nhận biết tưởng uẩn (saññākkhandha) và hành uẩn (saṅkhārakkhandha), Đức Phật đã nói câu “Này các tỳ khưu, và như thế nào”, v.v…
Tattha subhanimitte ayonisomanasikārena kāmacchandassa uppādo hoti.
Therein, the arising of sensual desire occurs through unwise attention to a sign of beauty.
Trong đó, dục tham sinh khởi do tác ý không như lý (ayoniso manasikāra) về tướng khả ái (subhanimitta).
Subhanimittaṃ nāma subhampi subhanimittaṃ, subhārammaṇampi subhanimittaṃ.
A sign of beauty can be a beautiful thing as a sign of beauty, or a beautiful object as a sign of beauty.
Tướng khả ái (subhanimitta) là cái khả ái cũng là tướng khả ái, và đối tượng khả ái cũng là tướng khả ái.
Ayonisomanasikāro nāma anupāyamanasikāro uppathamanasikāro anicce niccanti vā dukkhe sukhanti vā anattani attāti vā asubhe subhanti vā manasikāro, taṃ tattha bahulaṃ pavattayato kāmacchando uppajjati.
Unwise attention means attention that is not the means, attention that is the wrong path; it is attention to the impermanent as permanent, or to the unpleasant as pleasant, or to what is not-self as self, or to the foul as beautiful. For one who frequently applies it there, sensual desire arises.
Ayonisomanasikāro (phi như lý tác ý) là tác ý không phải phương tiện, tác ý sai đường, là tác ý về vô thường là thường, về khổ là lạc, về vô ngã là ngã, về bất tịnh là tịnh. Khi một người thường xuyên thực hành tác ý như vậy ở đó, dục tham sẽ sinh khởi.
Tenāha bhagavā – ‘‘atthi, bhikkhave, subhanimittaṃ, tattha ayonisomanasikārabahulīkāro, ayamāhāro anuppannassa vā kāmacchandassa uppādāya uppannassa vā kāmacchandassa bhiyyobhāvāya vepullāyā’’ti (saṃ. ni. 5.232).
Therefore the Blessed One said: “Bhikkhus, there is the sign of the beautiful; frequent application of unwise attention to it is the nutriment for the arising of unarisen sensual desire, or for the increase and expansion of arisen sensual desire.”
Vì vậy, Đức Thế Tôn đã dạy: “Này các Tỳ-khưu, có tịnh tướng (subhanimitta). Việc thường xuyên thực hành phi như lý tác ý ở đó là thức ăn cho dục tham chưa sinh khởi được sinh khởi, và cho dục tham đã sinh khởi được tăng trưởng và phát triển.”
Asubhanimitte pana yonisomanasikārenassa pahānaṃ hoti.
But its abandonment occurs through wise attention to the sign of the foul.
Tuy nhiên, đối với bất tịnh tướng, nhờ như lý tác ý mà dục tham được đoạn trừ.
Asubhanimittaṃ nāma asubhampi asubhārammaṇampi.
The sign of the foul means both the foulness meditation and the object of foulness.
Asubhanimittaṃ (bất tịnh tướng) là bất tịnh (asubha) hoặc đối tượng của bất tịnh (asubhārammaṇa).
Yonisomanasikāro nāma upāyamanasikāro pathamanasikāro anicce aniccanti vā dukkhe dukkhanti vā anattani anattāti vā asubhe asubhanti vā manasikāro, taṃ tattha bahulaṃ pavattayato kāmacchando pahīyati.
Wise attention means attention that is the means, attention that is the path; it is attention to the impermanent as impermanent, or to the unpleasant as unpleasant, or to what is not-self as not-self, or to the foul as foul. For one who frequently applies it there, sensual desire is abandoned.
Yonisomanasikāro (như lý tác ý) là tác ý đúng phương tiện, tác ý đúng đường, là tác ý về vô thường là vô thường, về khổ là khổ, về vô ngã là vô ngã, về bất tịnh là bất tịnh. Khi một người thường xuyên thực hành tác ý như vậy ở đó, dục tham sẽ được đoạn trừ.
Tenāha bhagavā – ‘‘atthi, bhikkhave, asubhanimittaṃ, tattha yonisomanasikārabahulīkāro, ayamanāhāro anuppannassa vā kāmacchandassa anuppādāya uppannassa vā kāmacchandassa pahānāyā’’ti (saṃ. ni. 5.232).
Therefore the Blessed One said: “Bhikkhus, there is the sign of the foul; frequent application of wise attention to it is the non-nutriment for the non-arising of unarisen sensual desire, or for the abandonment of arisen sensual desire.”
Vì vậy, Đức Thế Tôn đã dạy: “Này các Tỳ-khưu, có bất tịnh tướng. Việc thường xuyên thực hành như lý tác ý ở đó là không phải thức ăn cho dục tham chưa sinh khởi được sinh khởi, và cho dục tham đã sinh khởi được đoạn trừ.”
Apica cha dhammā kāmacchandassa pahānāya saṃvattanti asubhanimittassa uggaho asubhabhāvanānuyogo indriyesu guttadvāratā bhojane mattaññutā kalyāṇamittatā sappāyakathāti.
Furthermore, six things lead to the abandonment of sensual desire: grasping the sign of the foul, application to the development of foulness meditation, guardedness of the sense faculties, knowing the right measure in food, good friendship, and suitable talk.
Hơn nữa, có sáu pháp dẫn đến sự đoạn trừ dục tham: nắm giữ bất tịnh tướng, chuyên cần tu tập bất tịnh, giữ gìn các căn, biết đủ trong việc ăn uống, có bạn lành, và nói chuyện thích hợp.
Dasavidhañhi asubhanimittaṃ uggaṇhantassāpi kāmacchando pahīyati, bhāventassāpi, indriyesu pihitadvārassāpi, catunnaṃ pañcannaṃ ālopānaṃ okāse sati udakaṃ pivitvā yāpanasīlatāya bhojane mattaññunopi.
Indeed, sensual desire is abandoned even for one who learns the ten kinds of signs of the foul, for one who develops it, for one with guarded sense faculties, and for one who knows the right measure in food with the practice of sustaining oneself by drinking water when there is still room for four or five mouthfuls.
Dục tham được đoạn trừ ngay cả khi một người nắm giữ mười loại bất tịnh tướng, ngay cả khi tu tập chúng, ngay cả khi giữ gìn các căn, ngay cả khi biết đủ trong việc ăn uống bằng cách uống nước để duy trì sự sống sau khi ăn bốn hoặc năm miếng cơm.
Tenetaṃ vuttaṃ –
Therefore it was said:
Vì vậy, điều này đã được nói:
Paṭighanimitte ayonisomanasikārena pana byāpādassa uppādo hoti.
But through unwise attention to the sign of irritation, the arising of ill will occurs.
Tuy nhiên, đối với paṭighanimitta (tướng sân hận), nhờ ayonisomanasikāra (phi như lý tác ý) mà sân hận (byāpāda) sinh khởi.
Tattha paṭighampi paṭighanimittaṃ, paṭighārammaṇampi paṭighanimittaṃ.
Therein, both irritation itself is the sign of irritation, and the object of irritation is the sign of irritation.
Ở đây, paṭigha (sân hận) cũng là paṭighanimitta, và đối tượng của sân hận (paṭighārammaṇa) cũng là paṭighanimitta.
Ayonisomanasikāro sabbattha ekalakkhaṇova.
Unwise attention has the same single characteristic everywhere.
Ayonisomanasikāro có cùng đặc tính ở khắp mọi nơi.
Taṃ tasmiṃ nimitte bahulaṃ pavattayato byāpādo uppajjati.
For one who frequently applies it to that sign, ill will arises.
Khi một người thường xuyên thực hành nó đối với tướng đó, sân hận sẽ sinh khởi.
Tenāha bhagavā – ‘‘atthi, bhikkhave, paṭighanimittaṃ, tattha ayonisomanasikārabahulīkāro, ayamāhāro anuppannassa vā byāpādassa uppādāya uppannassa vā byāpādassa bhiyyobhāvāya vepullāyā’’ti (saṃ. ni. 5.232).
Therefore the Blessed One said: “Bhikkhus, there is the sign of irritation; frequent application of unwise attention to it is the nutriment for the arising of unarisen ill will, or for the increase and expansion of arisen ill will.”
Vì vậy, Đức Thế Tôn đã dạy: “Này các Tỳ-khưu, có tướng sân hận (paṭighanimitta). Việc thường xuyên thực hành phi như lý tác ý ở đó là thức ăn cho sân hận chưa sinh khởi được sinh khởi, và cho sân hận đã sinh khởi được tăng trưởng và phát triển.”
Mettāya pana cetovimuttiyā yonisomanasikārenassa pahānaṃ hoti.
But its abandonment occurs through wise attention to the liberation of mind through loving-kindness.
Tuy nhiên, nhờ mettā cetovimutti (tâm giải thoát từ bi) với yonisomanasikāra (như lý tác ý) mà sân hận được đoạn trừ.
Tattha tattha ‘‘mettā’’ti vutte appanāpi upacāropi vaṭṭati.
Therein, when “loving-kindness” is said, both absorption and access concentration are applicable.
Trong ngữ cảnh đó, khi nói “mettā” (từ bi), cả appanā (thiền định nhập định) và upacāra (thiền định cận định) đều có thể được áp dụng.
‘‘Cetovimuttī’’ti appanāva.
When “liberation of mind” is said, only absorption is applicable.
Khi nói “cetovimutti” (tâm giải thoát), chỉ có appanā được áp dụng.
Yonisomanasikāro vuttalakkhaṇova.
Wise attention has the same characteristic as described.
Yonisomanasikāro có đặc tính đã nói ở trên.
Taṃ tattha bahulaṃ pavattayato byāpādo pahīyati.
For one who frequently applies it there, ill will is abandoned.
Khi một người thường xuyên thực hành nó ở đó, sân hận sẽ được đoạn trừ.
Tenāha bhagavā – ‘‘atthi, bhikkhave, mettā cetovimutti, tattha yonisomanasikārabahulīkāro, ayamanāhāro anuppannassa vā byāpādassa anuppādāya uppannassa vā byāpādassa pahānāyā’’ti (saṃ. ni. 5.232).
Therefore the Blessed One said: “Bhikkhus, there is the liberation of mind through loving-kindness; frequent application of wise attention to it is the non-nutriment for the non-arising of unarisen ill will, or for the abandonment of arisen ill will.”
Vì vậy, Đức Thế Tôn đã dạy: “Này các Tỳ-khưu, có mettā cetovimutti (tâm giải thoát từ bi). Việc thường xuyên thực hành như lý tác ý ở đó là không phải thức ăn cho sân hận chưa sinh khởi được sinh khởi, và cho sân hận đã sinh khởi được đoạn trừ.”
Apica cha dhammā byāpādassa pahānāya saṃvattanti mettānimittassa uggaho mettābhāvanānuyogo kammassakatāpaccavekkhaṇā paṭisaṅkhānabahutā kalyāṇamittatā sappāyakathāti.
Furthermore, six things lead to the abandonment of ill will: grasping the sign of loving-kindness, application to the development of loving-kindness, reflection on ownership of kamma, abundance of analytical consideration, good friendship, and suitable talk.
Hơn nữa, có sáu pháp dẫn đến sự đoạn trừ sân hận: nắm giữ tướng từ bi (mettānimitta), chuyên cần tu tập từ bi, quán xét nghiệp của chính mình (kammassakatāpaccavekkhaṇā), thường xuyên quán xét (paṭisaṅkhānabahutā), có bạn lành, và nói chuyện thích hợp.
Odhisakaanodhisakadisāpharaṇānañhi aññataravasena mettaṃ uggaṇhantassāpi byāpādo pahīyati, odhiso anodhiso disāpharaṇavasena mettaṃ bhāventassāpi.
Ill will is abandoned for one who learns loving-kindness in one of the ways, whether by specified, unspecified, or directional pervasion; and also for one who develops loving-kindness by means of specified, unspecified, and directional pervasion.
Sân hận được đoạn trừ ngay cả khi một người nắm giữ từ bi theo cách phổ quát hoặc không phổ quát, hoặc theo cách trải rộng các phương hướng; và cũng được đoạn trừ ngay cả khi tu tập từ bi theo cách phổ quát, không phổ quát, và trải rộng các phương hướng.
‘‘Tvaṃ etassa kuddho kiṃ karissasi, kimassa sīlādīni nāsetuṃ sakkhissasi, nanu tvaṃ attano kammena āgantvā attano kammeneva gamissasi, parassa kujjhanaṃ nāma vītaccitaṅgāra-tattaayasalāka-gūthādīni gahetvā paraṃ paharitukāmatāsadisaṃ hoti.
“Being angry with this person, what can you do? Will you be able to destroy his virtue and so on? Is it not so that you have come by your own kamma and will go by your own kamma? Being angry with another is like wanting to strike another after taking hold of flameless embers, red-hot iron rods, excrement, and so on.
“Ngươi nổi giận với người này thì sẽ làm gì? Ngươi có thể hủy hoại giới hạnh của người ấy không? Chẳng phải ngươi đến với nghiệp của chính mình và đi với nghiệp của chính mình sao? Nổi giận với người khác giống như việc muốn đánh người khác bằng cách cầm than hồng không lửa, thanh sắt nung đỏ, phân, v.v.
Esopi tava kuddho kiṃ karissati, kiṃ te sīlādīni vināsetuṃ sakkhissati, esa attano kammeneva āgantvā attano kammena gamissati, appaṭicchitapaheṇakaṃ viya paṭivātaṃ khittarajomuṭṭhi viya ca etassevesa kodho matthake patissatī’’ti evaṃ attano ca parassa ca kammassakataṃ paccavekkhatopi, ubhayakammassakataṃ paccavekkhitvā paṭisaṅkhāne ṭhitassāpi, assaguttattherasadise mettābhāvanārate kalyāṇamitte sevantassāpi byāpādo pahīyati.
And that person, being angry with you, what can he do? Will he be able to destroy your virtue and so on? He has come by his own kamma and will go by his own kamma. Just like an unaccepted gift, and like a fistful of dust thrown against the wind, this anger of his will fall right on his own head.” Thus, ill will is abandoned for one who reflects on the ownership of kamma of both oneself and others; and for one who, after reflecting on the ownership of kamma of both, abides in analytical consideration; and for one who associates with good friends who delight in the development of loving-kindness, like the Elder Assagutta.
Người này nổi giận với ngươi thì sẽ làm gì? Người ấy có thể hủy hoại giới hạnh của ngươi không? Người ấy đến với nghiệp của chính mình và đi với nghiệp của chính mình. Cơn giận này sẽ rơi lên đầu người ấy, giống như một món quà không được nhận hoặc một nắm bụi bị ném ngược gió.” Sân hận được đoạn trừ ngay cả khi một người quán xét nghiệp của chính mình và của người khác như vậy, ngay cả khi đã quán xét nghiệp của cả hai và an trú trong sự quán xét, ngay cả khi thân cận những bạn lành chuyên tu tập từ bi như Trưởng lão Assagutta.
Ṭhānanisajjādīsu mettānissitasappāyakathāyapi pahīyati.
It is also abandoned through suitable talk connected with loving-kindness during postures of standing, sitting, and so on.
Sân hận cũng được đoạn trừ nhờ những lời nói thích hợp liên quan đến từ bi trong các tư thế đứng, ngồi, v.v.
Tena vuttaṃ ‘‘cha dhammā byāpādassa pahānāya saṃvattantī’’ti.
Therefore it was said, “six things lead to the abandonment of ill will.”
Vì vậy, đã nói rằng “sáu pháp dẫn đến sự đoạn trừ sân hận.”
Imehi pana chahi dhammehi pahīnassa byāpādassa anāgāmimaggena āyatiṃ anuppādo hotīti pajānāti.
He understands that for ill will abandoned through these six things, there is non-arising in the future through the path of non-returning.
Và vị ấy biết rằng sân hận đã được đoạn trừ nhờ sáu pháp này sẽ không tái sinh trong tương lai nhờ A-na-hàm đạo.
Aratiādīsu ayonisomanasikārena thinamiddhassa uppādo hoti.
Through unwise attention to discontent and so on, the arising of sloth and torpor occurs.
Trong arati (không hoan hỷ) và các pháp khác, nhờ ayonisomanasikāra (phi như lý tác ý) mà thinamiddha (hôn trầm thụy miên) sinh khởi.
Arati nāma ukkaṇṭhitā.
Discontent means dissatisfaction.
Arati là sự chán nản.
Tandī nāma kāyālasiyatā.
Languor means physical laziness.
Tandī là sự lười biếng của thân.
Vijambhitā nāma kāyavināmanā.
Stretching means contorting the body.
Vijambhitā là sự uốn éo thân thể.
Bhattasammado nāma bhattamucchā bhattapariḷāho.
Drowsiness after meals means faintness due to food, a burning sensation due to food.
Bhattasammado là sự mê mờ do thức ăn, sự khó chịu do thức ăn.
Cetaso līnattaṃ nāma cittassa līnākāro.
Shrinking of the mind means the shrunken state of the mind.
Cetaso līnattaṃ là trạng thái co rút của tâm.
Imesu aratiādīsu ayonisomanasikāraṃ bahulaṃ pavattayato thinamiddhaṃ uppajjati.
For one who frequently applies unwise attention to these things—discontent and so on—sloth and torpor arise.
Khi một người thường xuyên thực hành phi như lý tác ý đối với arati và các pháp khác này, thinamiddha sẽ sinh khởi.
Tenāha – ‘‘atthi, bhikkhave, arati tandī vijambhitā bhattasammado cetaso līnattaṃ, tattha ayonisomanasikārabahulīkāro, ayamāhāro anuppannassa vā thinamiddhassa uppādāya uppannassa vā thinamiddhassa bhiyyobhāvāya vepullāyā’’ti (saṃ. ni. 5.232).
Therefore he said: “Bhikkhus, there are discontent, languor, stretching, drowsiness after meals, and shrinking of the mind; frequent application of unwise attention to them is the nutriment for the arising of unarisen sloth and torpor, or for the increase and expansion of arisen sloth and torpor.”
Vì vậy, đã dạy: “Này các Tỳ-khưu, có arati (không hoan hỷ), tandī (lười biếng), vijambhitā (uốn éo), bhattasammado (mê mờ do thức ăn), cetaso līnattaṃ (tâm co rút). Việc thường xuyên thực hành phi như lý tác ý ở đó là thức ăn cho hôn trầm thụy miên chưa sinh khởi được sinh khởi, và cho hôn trầm thụy miên đã sinh khởi được tăng trưởng và phát triển.”
Ārambhadhātuādīsu pana yonisomanasikārenassa pahānaṃ hoti.
But its abandonment occurs through wise attention to the element of initiating energy and so on.
Tuy nhiên, nhờ yonisomanasikāra (như lý tác ý) đối với ārambhadhātu (giới khởi sự) và các pháp khác mà hôn trầm thụy miên được đoạn trừ.
Ārambhadhātu nāma paṭhamārambhavīriyaṃ.
The element of initiating energy means the initial effort of arousal.
Ārambhadhātu là tinh tấn khởi đầu.
Nikkamadhātu nāma kosajjato nikkhantatāya tato balavataraṃ.
The element of exertion is stronger than that, being a departure from laziness.
Nikkamadhātu là tinh tấn mạnh hơn, do thoát khỏi sự lười biếng.
Parakkamadhātu nāma paraṃ paraṃ ṭhānaṃ akkamanato tatopi balavataraṃ.
The element of striving is even stronger than that, being the advancing to a progressively higher state.
Parakkamadhātu là tinh tấn mạnh hơn nữa, do tiến lên từng bước.
Imasmiṃ tippabhede vīriye yonisomanasikāraṃ bahulaṃ pavattayato thinamiddhaṃ pahīyati.
For one who frequently applies wise attention to this threefold type of energy, sloth and torpor are abandoned.
Khi một người thường xuyên thực hành như lý tác ý đối với ba loại tinh tấn này, thinamiddha sẽ được đoạn trừ.
Tenāha – ‘‘atthi, bhikkhave, ārambhadhātu nikkamadhātu parakkamadhātu, tattha yonisomanasikārabahulīkāro, ayamāhāro anuppannassa vā thinamiddhassa anuppādāya uppannassa vā thinamiddhassa pahānāyā’’ti (saṃ. ni. 5.232).
Therefore he said: “Bhikkhus, there are the element of initiating energy, the element of exertion, and the element of striving; frequent application of wise attention to them is the nutriment for the non-arising of unarisen sloth and torpor, or for the abandonment of arisen sloth and torpor.”
Vì vậy, đã dạy: “Này các Tỳ-khưu, có ārambhadhātu (giới khởi sự), nikkamadhātu (giới nỗ lực), parakkamadhātu (giới tinh cần). Việc thường xuyên thực hành như lý tác ý ở đó là không phải thức ăn cho hôn trầm thụy miên chưa sinh khởi được sinh khởi, và cho hôn trầm thụy miên đã sinh khởi được đoạn trừ.”
Apica cha dhammā thinamiddhassa pahānāya saṃvattanti, atibhojane nimittaggāho iriyāpathasamparivattanatā ālokasaññāmanasikāro abbhokāsavāso kalyāṇamittatā sappāyakathāti.
Furthermore, six things lead to the abandoning of sloth and torpor: grasping the sign in overeating, changing one's posture, attending to the perception of light, living in the open air, good friendship, and suitable conversation.
Hơn nữa, có sáu pháp dẫn đến sự đoạn trừ hôn trầm (thinamiddha): nắm giữ tướng (của hôn trầm) trong việc ăn quá độ, thay đổi oai nghi, tác ý tưởng sáng, sống nơi khoảng trống, có bạn lành, và nói chuyện thích hợp.
Āharahatthakatatravaṭṭakaalaṃsāṭakakākamāsakabhuttavamitakabhojanaṃ bhuñjitvā rattiṭṭhāne divāṭṭhāne nisinnassa hi samaṇadhammaṃ karoto thinamiddhaṃ mahāhatthī viya ottharantaṃ āgacchati.
Indeed, for one who sits down at a place for the night or a place for the day to practice the ascetic’s duties after eating like the brahmins Āhārahathaka, Bhuttavamitaka, Tatravaṭṭaka, Alaṃsāṭaka, and Kākamāsaka, sloth and torpor come, overwhelming him like a great elephant.
Thật vậy, đối với một vị Sa-môn đang thực hành pháp Sa-môn, sau khi ăn bữa ăn như của các Bà-la-môn Āharahatthaka, Bhuttavamitaka, Tatravaṭṭaka, Alaṃsāṭaka, Kākamāsaka, rồi ngồi ở chỗ nghỉ đêm hoặc chỗ nghỉ ngày, thì hôn trầm sẽ đến bao trùm như một con voi lớn.
Catupañcaālopaokāsaṃ pana ṭhapetvā pānīyaṃ pivitvā yāpanasīlassa bhikkhuno taṃ na hotīti evaṃ atibhojane nimittaṃ gaṇhantassāpi thinamiddhaṃ pahīyati.
But it does not occur for a bhikkhu who has the habit of sustaining himself by drinking water after leaving aside a space for four or five mouthfuls. Thus, for one who grasps the sign in overeating in this way, sloth and torpor are abandoned.
Nhưng đối với vị Tỳ-khưu có thói quen sống bằng cách uống nước sau khi chừa lại chỗ cho bốn hoặc năm vắt cơm, thì điều đó không xảy ra. Như vậy, ngay cả khi nắm giữ tướng (của hôn trầm) trong việc ăn quá độ, hôn trầm cũng được đoạn trừ.
Yasmiṃ iriyāpathe thinamiddhaṃ okkamati, tato aññaṃ parivattentassāpi, rattiṃ candālokadīpālokaukkāloke divā sūriyālokaṃ manasikarontassāpi, abbhokāse vasantassāpi, mahākassapattherasadise pahīnathinamiddhe kalyāṇamitte sevantassāpi thinamiddhaṃ pahīyati.
It is also abandoned for one who changes to another posture from that posture in which sloth and torpor descended; and for one who at night attends to the light of the moon, the light of a lamp, or the light of a torch, and by day attends to the light of the sun; and for one who lives in the open air; and for one who associates with good friends who have abandoned sloth and torpor, such as the elder Mahākassapa, sloth and torpor are abandoned.
Hôn trầm cũng được đoạn trừ đối với người thay đổi oai nghi khi hôn trầm khởi lên, đối với người tác ý ánh sáng mặt trăng, ánh sáng đèn, ánh sáng dầu vào ban đêm, hoặc ánh sáng mặt trời vào ban ngày, đối với người sống nơi khoảng trống, và đối với người thân cận những bạn lành đã đoạn trừ hôn trầm, như Tôn giả Mahākassapa.
Ṭhānanisajjādīsu dhutaṅganissitasappāyakathāyapi pahīyati.
It is also abandoned through suitable talk connected with the ascetic practices in postures of standing, sitting, and so on.
Hôn trầm cũng được đoạn trừ nhờ nói chuyện thích hợp liên quan đến các pháp đầu đà (dhutaṅga) trong các oai nghi đứng, ngồi, v.v.
Tena vuttaṃ ‘‘cha dhammā thinamiddhassa pahānāya saṃvattantī’’ti.
Therefore it was said: “Six things lead to the abandoning of sloth and torpor.”
Vì thế, đã nói rằng: “Sáu pháp dẫn đến sự đoạn trừ hôn trầm.”
Imehi pana chahi dhammehi pahīnassa thinamiddhassa arahattamaggena āyatiṃ anuppādo hotīti pajānāti.
He understands that for sloth and torpor abandoned by these six things, there is non-arising in the future through the path of arahantship.
Vị ấy biết rằng, khi hôn trầm đã được đoạn trừ bằng sáu pháp này, thì sự không tái sinh của hôn trầm trong tương lai sẽ xảy ra bằng đạo A-la-hán.
Cetaso avūpasame ayonisomanasikārena uddhaccakukkuccassa uppādo hoti.
Restlessness and worry arise due to unwise attention to an unsettled state of mind.
Do tác ý không như lý (ayoniso manasikāra) trong sự bất an của tâm, phóng dật và hối hận (uddhaccakukkucca) khởi lên.
Avūpasamo nāma avūpasantākāro.
Unsettled state means the state of being unpacified.
Bất an (avūpasamo) có nghĩa là trạng thái không an tịnh.
Uddhaccakukkuccamevetaṃ atthato.
In terms of its essence, it is just restlessness and worry.
Theo nghĩa tối hậu, chính điều này là phóng dật và hối hận.
Tattha ayonisomanasikāraṃ bahulaṃ pavattayato uddhaccakukkuccaṃ uppajjati.
For one who frequently applies unwise attention to that, restlessness and worry arise.
Ở đó, đối với người thường xuyên thực hành tác ý không như lý, phóng dật và hối hận khởi lên.
Tenāha ‘‘atthi, bhikkhave, cetaso avūpasamo, tattha ayonisomanasikārabahulīkāro, ayamāhāro anuppannassa vā uddhaccakukkuccassa uppādāya uppannassa vā uddhaccakukkuccassa bhiyyobhāvāya vepullāyā’’ti (saṃ. ni. 5.232).
Therefore He said: “Bhikkhus, there is an unsettled state of mind. Frequent unwise attention to it is the nutriment for the arising of unarisen restlessness and worry, or for the increase and expansion of arisen restlessness and worry.”
Vì thế, đã nói: “Này các Tỳ-khưu, có sự bất an của tâm. Ở đó, sự thường xuyên thực hành tác ý không như lý là thức ăn cho sự khởi lên của phóng dật và hối hận chưa khởi lên, hoặc cho sự tăng trưởng và phát triển của phóng dật và hối hận đã khởi lên.”
Apica cha dhammā uddhaccakukkuccassa pahānāya saṃvattanti bahussutatā paripucchakatā vinaye pakataññutā vuddhasevitā kalyāṇamittatā sappāyakathāti.
Furthermore, six things lead to the abandoning of restlessness and worry: being learned, being one who questions frequently, being experienced in the Vinaya, associating with elders, good friendship, and suitable conversation.
Hơn nữa, có sáu pháp dẫn đến sự đoạn trừ phóng dật và hối hận: đa văn, thường xuyên hỏi han, thông thạo về Giới luật (Vinaya), thân cận bậc trưởng lão, có bạn lành, và nói chuyện thích hợp.
Bāhusaccenapi hi ekaṃ vā dve vā tayo vā cattāro vā pañca vā nikāye pāḷivasena ca atthavasena ca uggaṇhantassāpi uddhaccakukkuccaṃ pahīyati.
Indeed, restlessness and worry are abandoned even for one who is learned, who has mastered one, two, three, four, or five Nikāyas both in terms of the text and the meaning.
Thật vậy, phóng dật và hối hận cũng được đoạn trừ đối với người đa văn, học thuộc một, hai, ba, bốn hoặc năm bộ Nikāya cả về văn bản (pāḷi) lẫn ý nghĩa (attha).
Kappiyākappiyaparipucchābahulassāpi, vinayapaññattiyaṃ ciṇṇavasibhāvatāya pakataññunopi, vuddhe mahallakatthere upasaṅkamantassāpi, upālittherasadise vinayadhare kalyāṇamitte sevantassāpi uddhaccakukkuccaṃ pahīyati.
Restlessness and worry are also abandoned for one who frequently asks questions about what is allowable and not allowable; for one experienced through proficiency in the Vinaya regulations; for one who approaches venerable, senior elders; and for one who associates with good friends who are masters of the Vinaya, such as the elder Upāli.
Phóng dật và hối hận cũng được đoạn trừ đối với người thường xuyên hỏi về điều hợp lệ và không hợp lệ, đối với người thông thạo về các giới luật (Vinaya) do đã thực hành thành thục, đối với người thân cận các bậc trưởng lão, các vị Trưởng lão cao tuổi, và đối với người thân cận những bạn lành giữ Giới luật như Tôn giả Upāli.
Ṭhānanisajjādīsu kappiyākappiyanissitasappāyakathāyapi pahīyati.
It is also abandoned through suitable talk connected with what is allowable and not allowable in postures of standing, sitting, and so on.
Phóng dật và hối hận cũng được đoạn trừ nhờ nói chuyện thích hợp liên quan đến điều hợp lệ và không hợp lệ trong các oai nghi đứng, ngồi, v.v.
Tena vuttaṃ – ‘‘cha dhammā uddhaccakukkuccassa pahānāya saṃvattantī’’ti.
Therefore it was said: “Six things lead to the abandoning of restlessness and worry.”
Vì thế, đã nói rằng: “Sáu pháp dẫn đến sự đoạn trừ phóng dật và hối hận.”
Imehi pana chahi dhammehi pahīne uddhaccakukkucce uddhaccassa arahattamaggena kukkuccassa anāgāmimaggena āyatiṃ anuppādo hotīti pajānāti.
He understands that for restlessness and worry abandoned by these six things, there is non-arising in the future—for restlessness through the path of arahantship, and for worry through the path of non-returning.
Vị ấy biết rằng, khi phóng dật và hối hận đã được đoạn trừ bằng sáu pháp này, thì sự không tái sinh của phóng dật trong tương lai sẽ xảy ra bằng đạo A-la-hán, và của hối hận bằng đạo Bất hoàn (Anāgāmī).
Vicikicchāṭṭhānīyesu dhammesu ayonisomanasikārena vicikicchāya uppādo hoti.
Doubt arises due to unwise attention to things that are grounds for doubt.
Do tác ý không như lý trong các pháp là nguyên nhân của hoài nghi (vicikicchā), hoài nghi khởi lên.
Vicikicchāṭṭhānīyā dhammā nāma punappunaṃ vicikicchāya kāraṇattā vicikicchāva.
Things that are grounds for doubt are so called because they are a cause for recurring doubt; they are doubt itself.
Các pháp là nguyên nhân của hoài nghi (vicikicchāṭṭhānīyā dhammā) có nghĩa là chính hoài nghi, vì chúng là nguyên nhân của sự hoài nghi lặp đi lặp lại.
Tattha ayonisomanasikāraṃ bahulaṃ pavattayato vicikicchā uppajjati.
For one who frequently applies unwise attention to them, doubt arises.
Ở đó, đối với người thường xuyên thực hành tác ý không như lý, hoài nghi khởi lên.
Tenāha – ‘‘atthi, bhikkhave, vicikicchāṭṭhānīyā dhammā, tattha ayonisomanasikārabahulīkāro, ayamāhāro anuppannāya vā vicikicchāya uppādāya uppannāya vā vicikicchāya bhiyyobhāvāya vepullāyā’’ti (saṃ. ni. 5.232).
Therefore He said: “Bhikkhus, there are things that are grounds for doubt. Frequent unwise attention to them is the nutriment for the arising of unarisen doubt, or for the increase and expansion of arisen doubt.”
Vì thế, đã nói: “Này các Tỳ-khưu, có các pháp là nguyên nhân của hoài nghi. Ở đó, sự thường xuyên thực hành tác ý không như lý là thức ăn cho sự khởi lên của hoài nghi chưa khởi lên, hoặc cho sự tăng trưởng và phát triển của hoài nghi đã khởi lên.”
Apica cha dhammā vicikicchāya pahānāya saṃvattanti bahussutatā paripucchakatā vinaye pakataññutā adhimokkhabahulatā kalyāṇamittatā sappāyakathāti.
Furthermore, six things lead to the abandoning of doubt: being learned, being one who questions frequently, being experienced in the Vinaya, being full of conviction, good friendship, and suitable conversation.
Hơn nữa, có sáu pháp dẫn đến sự đoạn trừ hoài nghi: đa văn, thường xuyên hỏi han, thông thạo về Giới luật (Vinaya), có nhiều sự quyết đoán (adhimokkha), có bạn lành, và nói chuyện thích hợp.
Bāhusaccenapi hi ekaṃ vā…pe… pañca vā nikāye pāḷivasena atthavasena ca uggaṇhantassāpi vicikicchā pahīyati.
Indeed, doubt is abandoned even for one who is learned, who has mastered one… and so on… or five Nikāyas both in terms of the text and the meaning.
Thật vậy, hoài nghi cũng được đoạn trừ đối với người đa văn, học thuộc một... hoặc năm bộ Nikāya cả về văn bản (pāḷi) lẫn ý nghĩa (attha).
Tīṇi ratanāni ārabbha paripucchābahulassāpi, vinaye ciṇṇavasibhāvassāpi, tīsu ratanesu okappaniyasaddhāsaṅkhātaadhimokkhabahulassāpi, saddhādhimutte vakkalittherasadise kalyāṇamitte sevantassāpi vicikicchā pahīyati.
Doubt is also abandoned for one who frequently asks questions concerning the Three Jewels; for one who has attained proficiency in the Vinaya; for one who is full of conviction, that is, faith that has settled on the Three Jewels; and for one who associates with good friends who are resolved in faith, such as the elder Vakkali.
Hoài nghi cũng được đoạn trừ đối với người thường xuyên hỏi han về Ba Ngôi Báu, đối với người đã thực hành thành thục về Giới luật (Vinaya), đối với người có nhiều sự quyết đoán, tức là đức tin vững chắc vào Ba Ngôi Báu, và đối với người thân cận những bạn lành có lòng tin kiên cố như Tôn giả Vakkali.
Ṭhānanisajjādīsu tiṇṇaṃ ratanānaṃ guṇanissitasappāyakathāyapi pahīyati.
It is also abandoned through suitable talk connected with the qualities of the Three Jewels in postures of standing, sitting, and so on.
Hoài nghi cũng được đoạn trừ nhờ nói chuyện thích hợp liên quan đến phẩm hạnh của Ba Ngôi Báu trong các oai nghi đứng, ngồi, v.v.
Tena vuttaṃ – ‘‘cha dhammā vicikicchāya pahānāya saṃvattantī’’ti.
Therefore it was said: “Six things lead to the abandoning of doubt.”
Vì thế, đã nói rằng: “Sáu pháp dẫn đến sự đoạn trừ hoài nghi.”
Imehi pana chahi dhammehi pahīnāya vicikicchāya sotāpattimaggena āyatiṃ anuppādo hotīti pajānāti.
He understands that for doubt abandoned by these six things, there is non-arising in the future through the path of stream-entry.
Vị ấy biết rằng, khi hoài nghi đã được đoạn trừ bằng sáu pháp này, thì sự không tái sinh của hoài nghi trong tương lai sẽ xảy ra bằng đạo Nhập lưu (Sotāpatti).
Iti ajjhattaṃ vāti evaṃ pañcanīvaraṇapariggahaṇena attano vā dhammesu, parassa vā dhammesu, kālena vā attano, kālena vā parassa dhammesu dhammānupassī viharati.
Thus internally or means that in this way, by grasping the five hindrances, he abides contemplating the Dhamma in his own dhammas, or in another’s dhammas, or at times in his own dhammas and at other times in another’s dhammas.
Như vậy, hoặc bên trong chính mình (iti ajjhattaṃ vā) có nghĩa là vị ấy an trú quán pháp trong các pháp của chính mình, hoặc trong các pháp của người khác, hoặc đôi khi trong các pháp của chính mình, đôi khi trong các pháp của người khác, bằng cách nắm giữ năm triền cái như đã giải thích.
Samudayavayā panettha subhanimitta asubhanimittādīsu ayonisomanasikārayonisomanasikāravasena pañcasu nīvaraṇesu vuttanayena nīharitabbā.
Here, arising and passing away should be drawn out in connection with the five hindrances according to the method stated, by way of wise and unwise attention to such things as the sign of the beautiful and the sign of the foul.
Ở đây, sự sinh khởi và hoại diệt cần được suy diễn theo phương pháp đã nói về năm triền cái, tùy theo tác ý không như lý và tác ý như lý trong các tướng tốt, tướng xấu, v.v.
Ito paraṃ vuttanayameva.
From here on, the method is as already stated.
Từ đây trở đi cũng theo phương pháp đã nói.
116. Evaṃ pañcanīvaraṇavasena dhammānupassanaṃ vibhajitvā idāni pañcakkhandhavasena vibhajituṃ puna caparantiādimāha.
Having thus expounded the contemplation of the Dhamma by way of the five hindrances, now, in order to expound it by way of the five aggregates, he says And further and so on.
Như vậy, sau khi phân tích sự quán pháp theo năm triền cái, giờ đây, để phân tích theo năm uẩn, Đức Phật đã nói câu bắt đầu bằng “Hơn nữa” (puna caparaṃ).
Tattha pañcasu upādānakkhandhesūti upādānassa khandhā upādānakkhandhā, upādānassa paccayabhūtā dhammapuñjā dhammarāsayoti attho.
Therein, in the five aggregates of clinging: the aggregates of clinging are the aggregates of that which is clung to; the meaning is the collections of things, the masses of things, which are a condition for clinging.
Ở đó, trong năm thủ uẩn (pañcasu upādānakkhandhesu) có nghĩa là các uẩn là đối tượng của chấp thủ (upādāna), tức là các tập hợp pháp, các khối pháp là nhân duyên của chấp thủ.
Ayamettha saṅkhepo.
This is the summary here.
Đây là phần tóm tắt.
Vitthārato pana khandhakathā visuddhimagge vuttā.
But the discussion of the aggregates has been stated in detail in the Visuddhimagga.
Phần giải thích chi tiết về các uẩn (khandha) được trình bày trong Thanh Tịnh Đạo (Visuddhimagga).
Iti rūpanti ‘‘idaṃ rūpaṃ, ettakaṃ rūpaṃ, na ito paraṃ rūpaṃ atthī’’ti sabhāvato rūpaṃ pajānāti.
Thus is form: He understands form according to its intrinsic nature, thinking, “This is form, this much is form, there is no form beyond this.”
Sắc này (iti rūpaṃ) có nghĩa là vị ấy biết sắc theo bản chất: “Đây là sắc, sắc chỉ có chừng này, không có sắc nào khác ngoài cái này.”
Vedanādīsupi eseva nayo.
This is the same method for feeling and so on.
Đối với thọ, v.v. (vedanādīsu) cũng theo cách tương tự.
Ayamettha saṅkhepo.
This is the summary here.
Đây là phần tóm tắt.
Vitthārena pana rūpādīni visuddhimagge khandhakathāyameva vuttāni.
In detail, however, material form and so on have been spoken of in the Visuddhimagga itself, in the discourse on the aggregates.
Tuy nhiên, các pháp như sắc (rūpa) v.v... đã được giải thích chi tiết trong Thanh Tịnh Đạo (Visuddhimagga), ngay trong phần Khuddakakathā (phần nói về các uẩn).
Iti rūpassa samudayoti evaṃ avijjāsamudayādivasena pañcahākārehi rūpassa samudayo.
Thus the origin of material form means: in this way, the origin of material form is in five ways, by means of the origin of ignorance and so on.
"Như vậy là sự tập khởi của sắc" (Iti rūpassa samudayo) có nghĩa là sự tập khởi của sắc theo năm phương diện như sự tập khởi của vô minh (avijjā) v.v...
Iti rūpassa atthaṅgamoti evaṃ avijjānirodhādivasena pañcahākārehi rūpassa atthaṅgamo, vedanādīsupi eseva nayo.
Thus the passing away of material form means: in this way, the passing away of material form is in five ways, by means of the cessation of ignorance and so on. This same method applies to feeling and so on.
"Như vậy là sự diệt tận của sắc" (Iti rūpassa atthaṅgamo) có nghĩa là sự diệt tận của sắc theo năm phương diện như sự diệt trừ vô minh (avijjā) v.v... Đối với thọ (vedanā) v.v... cũng theo cách này.
Ayamettha saṅkhepo.
This is the summary here.
Đây là tóm tắt về điều đó.
Vitthāro pana visuddhimagge udayabbayañāṇakathāyaṃ vutto.
The detailed explanation, however, is given in the Visuddhimagga in the discourse on the knowledge of arising and passing away.
Phần giải thích chi tiết đã được trình bày trong Thanh Tịnh Đạo (Visuddhimagga), trong phần nói về trí tuệ sinh diệt (udayabbayañāṇa).
Iti ajjhattaṃ vāti evaṃ pañcakkhandhapariggahaṇena attano vā dhammesu, parassa vā dhammesu, kālena vā attano, kālena vā parassa dhammesu dhammānupassī viharati.
Thus internally, or means: in this way, by comprehending the five aggregates, he dwells contemplating dhammas in his own dhammas, or in another's dhammas, or at one time in his own dhammas, and at another time in another's dhammas.
"Hoặc nội phần" (Iti ajjhattaṃ vā) có nghĩa là, theo cách này, vị ấy an trú quán pháp trên các pháp của chính mình, hoặc trên các pháp của người khác, hoặc đôi khi trên các pháp của chính mình, đôi khi trên các pháp của người khác, bằng cách nắm giữ năm uẩn.
Samudayavayā panettha ‘‘avijjāsamudayā rūpasamudayo’’tiādīnaṃ (paṭi. ma. 1.50) pañcasu khandhesu vuttānaṃ paññāsāya lakkhaṇānaṃ vasena nīharitabbā.
Here, origin and passing away should be drawn out by means of the fifty characteristics stated for the five aggregates, such as “With the origin of ignorance, there is the origin of material form.”
Ở đây, sự tập khởi và hoại diệt cần được rút ra theo năm mươi đặc tính đã được trình bày trong năm uẩn, như "do sự tập khởi của vô minh mà có sự tập khởi của sắc" (avijjāsamudayā rūpasamudayo) v.v...
Ito paraṃ vuttanayameva.
From this point on, it is just as has been stated.
Từ đây trở đi, vẫn theo cách đã được trình bày.
117. Evaṃ pañcakkhandhavasena dhammānupassanaṃ vibhajitvā idāni āyatanavasena vibhajituṃ puna caparantiādimāha.
117. Having thus analyzed the contemplation of dhammas by way of the five aggregates, he now said And further and so on to analyze it by way of the sense bases.
Sau khi đã phân tích pháp quán pháp theo năm uẩn như vậy, bây giờ để phân tích theo các xứ (āyatana), Đức Phật đã nói câu mở đầu: "Lại nữa" (puna caparaṃ) v.v...
Tattha chasu ajjhattikabāhiresu āyatanesūti cakkhu sotaṃ ghānaṃ jivhā kāyo manoti imesu chasu ajjhattikesu rūpaṃ saddo gandho raso phoṭṭhabbo dhammāti imesu chasu bāhiresu.
Therein, in the six internal and external sense bases means: in these six internal ones—the eye, ear, nose, tongue, body, and mind; and in these six external ones—sights, sounds, smells, tastes, tangibles, and dhammas.
Trong đó, "trong sáu xứ nội và ngoại" (chasu ajjhattikabāhiresu āyatanesu) là trong sáu xứ nội này: mắt (cakkhu), tai (sota), mũi (ghāna), lưỡi (jivhā), thân (kāya), ý (mano); và trong sáu xứ ngoại này: sắc (rūpa), tiếng (sadda), hương (gandha), vị (rasa), xúc (phoṭṭhabba), pháp (dhammā).
Cakkhuṃ ca pajānātīti cakkhupasādaṃ yāthāvasarasalakkhaṇavasena pajānāti.
He knows the eye means: he knows the eye-sensitivity by way of its function and characteristic as it really is.
"Vị ấy biết mắt" (Cakkhuṃ ca pajānāti) có nghĩa là vị ấy biết nhãn tịnh sắc (cakkhupasāda) theo đặc tính bản chất và chức năng của nó.
Rūpe ca pajānātīti bahiddhā catusamuṭṭhānikarūpañca yāthāvasarasalakkhaṇavasena pajānāti.
And he knows sights means: he knows external material form, arisen from four causes, by way of its function and characteristic as it really is.
"Và biết các sắc" (Rūpe ca pajānāti) có nghĩa là vị ấy biết sắc do bốn nguyên nhân sinh ra ở bên ngoài theo đặc tính bản chất và chức năng của nó.
Yañca tadubhayaṃ paṭicca uppajjati saṃyojananti yañca taṃ cakkhuṃ ceva rūpe cāti ubhayaṃ paṭicca kāmarāgasaṃyojanaṃ paṭigha-māna-diṭṭhi-vicikicchā-sīlabbataparāmāsa-bhavarāga-issā-macchariyāvijjāsaṃyojananti dasavidhaṃ saṃyojanaṃ uppajjati, tañca yāthāvasarasalakkhaṇavasena pajānāti.
And whatever fetter arises in dependence on both means: and he also knows, by way of its function and characteristic as it really is, whichever of the ten kinds of fetter arises in dependence on both, that is, the eye and sights—the fetter of sensual lust, and the fetters of aversion, conceit, views, doubt, adherence to rites and rituals, lust for existence, envy, stinginess, and ignorance.
"Và biết các kiết sử (saṃyojana) phát sinh do duyên cả hai" (Yañca tadubhayaṃ paṭicca uppajjati saṃyojanaṃ) có nghĩa là vị ấy biết mười loại kiết sử phát sinh do duyên cả hai, tức là mắt (cakkhu) và sắc (rūpa), đó là kiết sử tham dục (kāmarāgasaṃyojana), sân hận (paṭigha), mạn (māna), tà kiến (diṭṭhi), hoài nghi (vicikicchā), giới cấm thủ (sīlabbataparāmāsa), tham hữu (bhavarāga), tật đố (issā), xan tham (macchariya), và vô minh (avijjā); vị ấy biết chúng theo đặc tính bản chất và chức năng của chúng.
Kathaṃ panetaṃ uppajjatīti?
But how does this arise?
Vậy chúng phát sinh như thế nào?
Cakkhudvāre tāva āpāthagataṃ iṭṭhārammaṇaṃ kāmassādavasena assādayato abhinandato kāmarāgasaṃyojanaṃ uppajjati.
First, at the eye-door, for one who savors and delights in a desirable object that has come into range by way of relishing sensual pleasure, the fetter of sensual lust arises.
Trước hết, ở cửa mắt, khi một đối tượng khả ái đi vào phạm vi giác quan, do nếm trải vị ngọt của dục lạc và hoan hỷ với nó, kiết sử tham dục (kāmarāgasaṃyojana) phát sinh.
Aniṭṭhārammaṇe kujjhato paṭighasaṃyojanaṃ uppajjati.
For one who gets angry at an undesirable object, the fetter of aversion arises.
Khi giận dữ với đối tượng không khả ái, kiết sử sân hận (paṭighasaṃyojana) phát sinh.
‘‘Ṭhapetvā maṃ na koci añño etaṃ ārammaṇaṃ vibhāvetuṃ samattho atthī’’ti maññato mānasaṃyojanaṃ uppajjati.
For one who thinks, “Apart from me, there is no one else capable of discerning this object,” the fetter of conceit arises.
Khi nghĩ rằng "ngoài ta ra, không ai khác có khả năng nhận biết đối tượng này", kiết sử mạn (mānasaṃyojana) phát sinh.
‘‘Etaṃ rūpārammaṇaṃ niccaṃ dhuva’’nti gaṇhato diṭṭhisaṃyojanaṃ uppajjati.
For one who grasps, “This visual object is permanent and stable,” the fetter of views arises.
Khi nắm giữ ý niệm "đối tượng sắc này là thường, là bền vững", kiết sử tà kiến (diṭṭhisaṃyojana) phát sinh.
‘‘Etaṃ rūpārammaṇaṃ satto nu kho, sattassa nu kho’’ti vicikicchato vicikicchāsaṃyojanaṃ uppajjati.
For one who doubts, “Is this visual object a being, or does it belong to a being?” the fetter of doubt arises.
Khi hoài nghi "đối tượng sắc này là một chúng sinh, hay thuộc về một chúng sinh?", kiết sử hoài nghi (vicikicchāsaṃyojana) phát sinh.
‘‘Sampattibhave vata no idaṃ sulabhaṃ jāta’’nti bhavaṃ patthentassa bhavarāgasaṃyojanaṃ uppajjati.
For one who wishes for existence, thinking, “Indeed, in a state of good fortune this has become easy for us to obtain,” the fetter of lust for existence arises.
Khi mong cầu sự tồn tại, với ý nghĩ "ôi, thật dễ dàng để đạt được điều này trong đời sống hạnh phúc", kiết sử tham hữu (bhavarāgasaṃyojana) phát sinh.
‘‘Āyatimpi evarūpaṃ sīlabbataṃ samādiyitvā sakkā laddhu’’nti sīlabbataṃ samādiyantassa sīlabbataparāmāsasaṃyojanaṃ uppajjati.
For one who undertakes rites and rituals, thinking, “In the future, too, it can be obtained by undertaking such rites and rituals,” the fetter of adherence to rites and rituals arises.
Khi chấp giữ giới cấm thủ, với ý nghĩ "trong tương lai cũng có thể đạt được điều tương tự bằng cách thực hành giới cấm thủ như vậy", kiết sử giới cấm thủ (sīlabbataparāmāsasaṃyojana) phát sinh.
‘‘Aho vata etaṃ rūpārammaṇaṃ aññe na labheyyu’’nti usūyato issāsaṃyojanaṃ uppajjati.
For one who is envious, thinking, “Oh, if only others would not obtain this visual object!” the fetter of envy arises.
Khi ganh tị, với ý nghĩ "mong sao những người khác không đạt được đối tượng sắc này", kiết sử tật đố (issāsaṃyojana) phát sinh.
Attanā laddhaṃ rūpārammaṇaṃ aññassa maccharāyato macchariyasaṃyojanaṃ uppajjati.
For one who is stingy with a visual object he has obtained, not wanting to share it with another, the fetter of stinginess arises.
Khi xan tham đối tượng sắc mà mình đã đạt được không muốn người khác có, kiết sử xan tham (macchariyasaṃyojana) phát sinh.
Sabbeheva sahajātaaññāṇavasena avijjāsaṃyojanaṃ uppajjati.
By way of the ignorance co-arisen with all of them, the fetter of ignorance arises.
Kiết sử vô minh (avijjāsaṃyojana) phát sinh cùng với tất cả các kiết sử khác do sự không biết (moha) đồng sinh.
Yathā ca anuppannassāti yena kāraṇena asamudācāravasena anuppannassa tassa dasavidhassāpi saṃyojanassa uppādo hoti, tañca kāraṇaṃ pajānāti.
And how there is the arising of an unarisen fetter means: he knows the cause by which there is the arising of an unarisen fetter, any of those ten kinds, in the sense of its not having been manifested.
"Và như thế nào là sự phát sinh của cái chưa phát sinh" (Yathā ca anuppannassā) có nghĩa là vị ấy biết nguyên nhân khiến mười loại kiết sử chưa phát sinh sẽ phát sinh do chưa được đoạn trừ.
Yathā ca uppannassāti appahīnaṭṭhena pana samudācāravasena vā uppannassa tassa dasavidhassāpi saṃyojanassa yena kāraṇena pahānaṃ hoti, tañca kāraṇaṃ pajānāti.
And how there is the abandoning of an arisen fetter means: he knows the cause by which there is the abandoning of an arisen fetter, any of those ten kinds, in the sense of its not having been abandoned or in the sense of its manifestation.
"Và như thế nào là sự đoạn trừ của cái đã phát sinh" (Yathā ca uppannassā) có nghĩa là vị ấy biết nguyên nhân khiến mười loại kiết sử đã phát sinh (do chưa được đoạn trừ hoặc do đã được biểu hiện) sẽ được đoạn trừ.
Yathā ca pahīnassāti tadaṅgavikkhambhanappahānavasena pahīnassāpi tassa dasavidhassa saṃyojanassa yena kāraṇena āyatiṃ anuppādo hoti, tañca pajānāti.
And how there is the future non-arising of an abandoned fetter means: he knows the cause by which there is the future non-arising of a fetter, any of those ten kinds, that has been abandoned by way of abandonment by substitution of opposites or abandonment by suppression.
"Và như thế nào là sự không phát sinh trở lại trong tương lai của cái đã được đoạn trừ" (Yathā ca pahīnassā) có nghĩa là vị ấy biết nguyên nhân khiến mười loại kiết sử đã được đoạn trừ (bằng tadaṅga-pahāna và vikkhambhana-pahāna) sẽ không phát sinh trở lại trong tương lai.
Kena kāraṇena panassa āyatiṃ anuppādo hoti?
By what cause is there its future non-arising?
Vậy nguyên nhân nào khiến chúng không phát sinh trở lại trong tương lai?
Diṭṭhivicikicchāsīlabbataparāmāsaissāmacchariyabhedassa tāva pañcavidhassa saṃyojanassa sotāpattimaggena āyatiṃ anuppādo hoti.
First, for the five kinds of fetters—the varieties of views, doubt, adherence to rites and rituals, envy, and stinginess—there is future non-arising through the path of stream-entry.
Trước hết, năm loại kiết sử gồm tà kiến (diṭṭhi), hoài nghi (vicikicchā), giới cấm thủ (sīlabbataparāmāsa), tật đố (issā), và xan tham (macchariya) sẽ không phát sinh trở lại trong tương lai nhờ Đạo Tu-đà-hoàn (sotāpattimagga).
Kāmarāgapaṭighasaṃyojanadvayassa oḷārikassa sakadāgāmimaggena, aṇusahagatassa anāgāmimaggena, mānabhavarāgāvijjāsaṃyojanattayassa arahattamaggena āyatiṃ anuppādo hoti.
For the gross aspect of the pair of fetters of sensual lust and aversion, there is future non-arising through the path of the once-returner; for their subtle aspect, through the path of the non-returner; and for the three fetters of conceit, lust for existence, and ignorance, there is future non-arising through the path of arahatship.
Hai loại kiết sử thô thiển là tham dục (kāmarāga) và sân hận (paṭigh) sẽ không phát sinh trở lại trong tương lai nhờ Đạo Tư-đà-hàm (sakadāgāmimagga); hai loại kiết sử vi tế là tham dục (kāmarāga) và sân hận (paṭigh) sẽ không phát sinh trở lại trong tương lai nhờ Đạo A-na-hàm (anāgāmimagga); ba loại kiết sử là mạn (māna), tham hữu (bhavarāga), và vô minh (avijjā) sẽ không phát sinh trở lại trong tương lai nhờ Đạo A-la-hán (arahattamagga).
Iti ajjhattaṃ vāti evaṃ ajjhattikāyatanapariggahaṇena attano vā dhammesu, bāhirāyatanapariggahaṇena parassa vā dhammesu, kālena vā attano, kālena vā parassa dhammesu dhammānupassī viharati.
Thus internally, or means: in this way, by comprehending the internal sense bases, he dwells contemplating dhammas in his own dhammas; by comprehending the external sense bases, in another's dhammas; or at one time in his own dhammas, and at another time in another's dhammas.
"Hoặc nội phần" (Iti ajjhattaṃ vā) có nghĩa là, theo cách này, vị ấy an trú quán pháp trên các pháp của chính mình bằng cách nắm giữ các xứ nội, hoặc trên các pháp của người khác bằng cách nắm giữ các xứ ngoại, hoặc đôi khi trên các pháp của chính mình, đôi khi trên các pháp của người khác.
Samudayavayā panettha ‘‘avijjāsamudayā cakkhusamudayo’’ti rūpāyatanassa rūpakkhandhe, arūpāyatanesu manāyatanassa viññāṇakkhandhe, dhammāyatanassa sesakkhandhesu vuttanayena nīharitabbā.
Here, origin and passing away should be drawn out in the way that has been stated—such as “With the origin of ignorance, there is the origin of the eye”—for the material sense bases in the material aggregate, for the mind-base among the immaterial sense bases in the consciousness-aggregate, and for the dhamma-base in the remaining aggregates.
Ở đây, sự tập khởi và hoại diệt cần được rút ra theo cách đã trình bày trong sắc uẩn (rūpakkhandha) đối với các xứ sắc (rūpāyatana) như "do sự tập khởi của vô minh mà có sự tập khởi của mắt" (avijjāsamudayā cakkhusamudayo); trong thức uẩn (viññāṇakkhandha) đối với ý xứ (manāyatana) trong các xứ vô sắc (arūpāyatana); và trong các uẩn còn lại đối với pháp xứ (dhammāyatana).
Lokuttaradhammā na gahetabbā.
Supramundane dhammas should not be included.
Không nên bao gồm các pháp siêu thế (lokuttaradhammā).
Ito paraṃ vuttanayameva.
From this point on, it is just as has been stated.
Từ đây trở đi, vẫn theo cách đã được trình bày.
118. Evaṃ cha ajjhattikabāhirāyatanavasena dhammānupassanaṃ vibhajitvā idāni bojjhaṅgavasena vibhajituṃ puna caparanti ādimāha.
118. Having thus analyzed the contemplation of dhammas by way of the six internal and external sense bases, he now said And further and so on to analyze it by way of the factors of enlightenment.
Sau khi đã phân tích pháp quán pháp theo sáu xứ nội và ngoại như vậy, bây giờ để phân tích theo các giác chi (bojjhaṅga), Đức Phật đã nói câu mở đầu: "Lại nữa" (puna caparaṃ) v.v...
Tattha bojjhaṅgesūti bujjhanakasattassa aṅgesu.
Therein, in the factors of enlightenment means: in the factors of a being who is awakening.
Trong đó, "trong các giác chi" (bojjhaṅgesu) có nghĩa là trong các yếu tố của chúng sinh có khả năng giác ngộ.
Santanti paṭilābhavasena saṃvijjamānaṃ.
Existing means: present by way of having been attained.
"Có" (santaṃ) có nghĩa là hiện hữu trong tự thân do đã đạt được.
Satisambojjhaṅganti satisaṅkhātaṃ sambojjhaṅgaṃ.
The enlightenment-factor of mindfulness means: the enlightenment factor called mindfulness.
"Niệm giác chi" (Satisambojjhaṅgaṃ) là giác chi được gọi là niệm (sati).
Ettha hi sambujjhati āraddhavipassakato paṭṭhāya yogāvacaroti sambodhi, yāya vā so satiādikāya sattadhammasāmaggiyā sambujjhati kilesaniddāto uṭṭhāti, saccāni vā paṭivijjhati, sā dhammasāmaggī sambodhi.
For here, a practitioner, from the moment he has initiated insight, awakens; this is sambodhi. Or, that combination of seven dhammas, starting with mindfulness, by which he awakens, that is, he rises up from the sleep of the defilements, or he penetrates the truths—that combination of dhammas is sambodhi.
Ở đây, "Giác ngộ" (sambodhi) là sự giác ngộ của hành giả (yogāvacara) từ khi bắt đầu thực hành thiền quán (vipassanā); hoặc sự hòa hợp của bảy pháp (sattadhamma) như niệm (sati) v.v... mà nhờ đó hành giả giác ngộ, thức dậy khỏi giấc ngủ phiền não, hoặc thâm nhập các Chân lý; sự hòa hợp của các pháp đó chính là giác ngộ (sambodhi).
Tassa sambodhissa, tassā vā sambodhiyā aṅganti sambojjhaṅgaṃ.
A factor of that awakening, or of that sambodhi, is an enlightenment-factor (sambojjhaṅga).
Yếu tố của sự giác ngộ đó, hoặc của sự giác ngộ đó, chính là giác chi (sambojjhaṅgaṃ).
Tena vuttaṃ ‘‘satisaṅkhātaṃ sambojjhaṅga’’nti.
Therefore it was said, “the enlightenment factor called mindfulness.”
Do đó, đã nói "giác chi được gọi là niệm" (satisaṅkhātaṃ sambojjhaṅgaṃ).
Sesasambojjhaṅgesupi imināva nayena vacanattho veditabbo.
In the other enlightenment factors, too, the meaning of the word should be understood in this same way.
Đối với các giác chi còn lại cũng cần hiểu ý nghĩa của từ theo cách này.
Asantanti appaṭilābhavasena avijjamānaṃ.
Non-existing means: not present by way of not having been attained.
"Không có" (asantaṃ) có nghĩa là không hiện hữu do chưa đạt được.
Yathā ca anuppannassātiādīsu pana satisambojjhaṅgassa tāva – ‘‘atthi, bhikkhave, satisambojjhaṅgaṭṭhānīyā dhammā, tattha yonisomanasikārabahulīkāro, ayamāhāro anuppannassa vā satisambojjhaṅgassa uppādāya, uppannassa vā satisambojjhaṅgassa bhiyyobhāvāya vepullāya bhāvanāya pāripūriyā saṃvattatī’’ti (saṃ. ni. 5.183) evaṃ uppādo hoti.
Now, in such passages as, “And how for the unarisen...”, concerning the enlightenment factor of mindfulness, its arising occurs in this way: “Monks, there are things that are a basis for the enlightenment factor of mindfulness; frequently giving wise attention to them, this is the nutriment for the arising of the unarisen enlightenment factor of mindfulness, or for the increase, maturation, development, and completion of the arisen enlightenment factor of mindfulness.”
Trong các đoạn như "Yathā ca anuppannassā" (Cũng như đối với điều chưa sanh), trước hết, đối với chi giác ngộ niệm (satisambojjhaṅga), sự sanh khởi của nó là như thế này: "Này các Tỳ-khưu, có những pháp làm nền tảng cho chi giác ngộ niệm. Tại đó, sự thực hành nhiều tác ý đúng đắn (yonisomanasikāra) là thức ăn để làm sanh khởi chi giác ngộ niệm chưa sanh, hoặc để làm tăng trưởng, phát triển, tu tập và hoàn thiện chi giác ngộ niệm đã sanh."
Tattha satiyeva satisambojjhaṅgaṭṭhānīyā dhammā.
Therein, it is mindfulness itself that are the things which are a basis for the enlightenment factor of mindfulness.
Trong đó, chính niệm là các pháp làm nền tảng cho chi giác ngộ niệm.
Yonisomanasikāro vuttalakkhaṇoyeva, taṃ tattha bahulaṃ pavattayato satisambojjhaṅgo uppajjati.
Wise attention is just as has been described; for one who frequently applies it therein, the enlightenment factor of mindfulness arises.
Tác ý đúng đắn (yonisomanasikāra) là cái đã được định nghĩa. Khi hành giả thực hành tác ý đúng đắn đó một cách thường xuyên, chi giác ngộ niệm sẽ sanh khởi.
Apica cattāro dhammā satisambojjhaṅgassa uppādāya saṃvattanti satisampajaññaṃ muṭṭhassatipuggalaparivajjanatā upaṭṭhitassatipuggalasevanatā tadadhimuttatāti.
Moreover, four things lead to the arising of the enlightenment factor of mindfulness: mindfulness and clear comprehension, the avoidance of persons with lapsed mindfulness, the association with persons of established mindfulness, and the inclination towards that.
Hơn nữa, có bốn pháp dẫn đến sự sanh khởi của chi giác ngộ niệm: niệm và tỉnh giác (satisampajañña), tránh xa những người thất niệm, thân cận những người có niệm hiện hành, và có khuynh hướng thiên về niệm đó.
Abhikkantādīsu hi sattasu ṭhānesu satisampajaññena bhattanikkhittakākasadise muṭṭhassatipuggale parivajjanena tissadattattheraabhayattherasadise upaṭṭhitassatipuggale sevanena ṭhānanisajjādīsu satisamuṭṭhāpanatthaṃ ninnapoṇapabbhāracittatāya ca satisambojjhaṅgo uppajjati.
Indeed, through mindfulness and clear comprehension in the seven instances beginning with going forward; through avoiding persons with lapsed mindfulness, who are like crows where food is thrown down; through associating with persons of established mindfulness, who are like the Elder Tissadatta and the Elder Abhaya; and through having a mind that is sloping, tending, and inclined towards the establishment of mindfulness in standing, sitting, and so on, the enlightenment factor of mindfulness arises.
Trong bảy trường hợp như đi tới, v.v., chi giác ngộ niệm sanh khởi nhờ niệm và tỉnh giác, nhờ tránh xa những người thất niệm giống như con quạ bỏ thức ăn, nhờ thân cận những người có niệm hiện hành giống như Trưởng lão Tissadatta và Trưởng lão Abhaya, và nhờ có tâm hướng về, nghiêng về, thiên về việc thiết lập niệm trong các tư thế đứng, ngồi, v.v.
Evaṃ catūhi kāraṇehi uppannassa panassa arahattamaggena bhāvanāpāripūrī hotīti pajānāti.
He understands that, for this factor which has thus arisen from four causes, the completion of its development comes about through the path of arahantship.
Và vị ấy biết rằng, đối với chi giác ngộ niệm đã sanh khởi do bốn nguyên nhân này, sự tu tập được hoàn thiện nhờ đạo A-la-hán.
Apica satta dhammā dhammavicayasambojjhaṅgassa uppādāya saṃvattanti paripucchakatā vatthuvisadakiriyā indriyasamattapaṭipādanā duppaññapuggalaparivajjanā paññavantapuggalasevanā gambhīrañāṇacariyapaccavekkhaṇā tadadhimuttatāti.
Moreover, seven things lead to the arising of the enlightenment factor of investigation of states: frequent questioning, making the basis clear, establishing a balance of the faculties, avoidance of persons with little wisdom, association with wise persons, reflection on the domain of profound knowledge, and the inclination towards that.
Hơn nữa, có bảy pháp dẫn đến sự sanh khởi của chi giác ngộ trạch pháp: thường xuyên hỏi han, làm cho vật thể trong sạch, làm cho các căn được quân bình, tránh xa những người kém trí tuệ, thân cận những người có trí tuệ, quán xét những hành vi trí tuệ sâu sắc, và có khuynh hướng thiên về điều đó.
Tattha paripucchakatāti khandhadhātuāyatanaindriyabalabojjhaṅgamaggaṅgajhānaṅgasamathavipassanānaṃ atthasannissitaparipucchābahulatā.
Therein, frequent questioning is being one who frequently asks questions concerning the meaning of the aggregates, elements, sense bases, faculties, powers, enlightenment factors, path factors, jhāna factors, serenity, and insight.
Trong đó, thường xuyên hỏi han là việc hỏi han nhiều về ý nghĩa liên quan đến uẩn, giới, xứ, căn, lực, giác chi, đạo chi, thiền chi, tịnh chỉ (samatha) và quán chiếu (vipassanā).
Vatthuvisadakiriyāti ajjhattikabāhirānaṃ vatthūnaṃ visadabhāvakaraṇaṃ.
Making the basis clear is the clarification of the internal and external bases.
Làm cho vật thể trong sạch là làm cho các vật thể bên trong và bên ngoài được trong sạch.
Yadā hissa kesanakhalomā atidīghā honti, sarīraṃ vā ussannadosañceva sedamalamakkhitañca, tadā ajjhattikaṃ vatthu avisadaṃ hoti aparisuddhaṃ.
For when one’s hair, nails, and body hair are very long, or the body has an excess of humors and is smeared with sweat and dirt, then the internal basis is unclear, impure.
Thật vậy, khi tóc, móng, lông của vị ấy quá dài, hoặc thân thể đầy những bệnh tật và dơ bẩn do mồ hôi, thì vật thể bên trong trở nên không trong sạch, không thanh tịnh.
Yadā pana cīvaraṃ jiṇṇaṃ kiliṭṭhaṃ duggandhaṃ hoti, senāsanaṃ vā uklāpaṃ, tadā bāhiraṃ vatthu avisadaṃ hoti aparisuddhaṃ.
And when one’s robe is old, stained, and foul-smelling, or the lodging is cluttered, then the external basis is unclear, impure.
Khi y phục cũ nát, dơ bẩn, hôi hám, hoặc chỗ ở bừa bộn, thì vật thể bên ngoài trở nên không trong sạch, không thanh tịnh.
Tasmā kesādicchedāpanena uddhaṃvirecanaadhovirecanādīhi sarīrasallahukabhāvakaraṇena ucchādananhāpanena ca ajjhattikaṃ vatthu visadaṃ kātabbaṃ.
Therefore, the internal basis should be made clear by having one's hair and so on cut, by making the body light through emetics, purgatives, and the like, and by anointing and bathing.
Vì vậy, vật thể bên trong phải được làm cho trong sạch bằng cách cắt tóc, v.v., làm cho thân thể nhẹ nhàng bằng cách uống thuốc xổ trên, thuốc xổ dưới, v.v., và bằng cách xoa bóp, tắm rửa.
Sūcikammadhovanarajanaparibhaṇḍakaraṇādīhi bāhiraṃ vatthu visadaṃ kātabbaṃ.
The external basis should be made clear by mending, washing, dyeing, and tidying up.
Vật thể bên ngoài phải được làm cho trong sạch bằng cách may vá, giặt giũ, nhuộm y, sắp xếp đồ dùng, v.v.
Etasmiñhi ajjhattikabāhire vatthusmiṃ avisade uppannesu cittacetasikesu ñāṇampi aparisuddhaṃ hoti, aparisuddhāni dīpakapallakavaṭṭitelāni nissāya uppannadīpasikhāya obhāso viya.
Indeed, when this internal and external basis is unclear, in the mind and mental factors that arise, knowledge is also impure, like the light from a lamp flame that has arisen depending on an impure lamp bowl, wick, and oil.
Khi các tâm và tâm sở sanh khởi trong vật thể bên trong và bên ngoài không trong sạch này, trí tuệ cũng không thanh tịnh, giống như ánh sáng của ngọn đèn sanh khởi nhờ đèn, bấc và dầu không trong sạch.
Visade pana ajjhattikabāhire vatthumhi uppannesu cittacetasikesu ñāṇampi visadaṃ hoti, parisuddhāni dīpakapallakavaṭṭitelāni nissāya uppannadīpasikhāya obhāso viya.
But when the internal and external basis is clear, in the mind and mental factors that arise, knowledge is also clear, like the light from a lamp flame that has arisen depending on a pure lamp bowl, wick, and oil.
Nhưng khi các tâm và tâm sở sanh khởi trong vật thể bên trong và bên ngoài trong sạch, trí tuệ cũng trong sạch, giống như ánh sáng của ngọn đèn sanh khởi nhờ đèn, bấc và dầu thanh tịnh.
Tena vuttaṃ – ‘‘vatthuvisadakiriyā dhammavicayasambojjhaṅgassa uppādāya saṃvattatī’’ti.
Therefore it was said: “Making the basis clear leads to the arising of the enlightenment factor of investigation of states.”
Do đó, đã nói rằng: "Làm cho vật thể trong sạch dẫn đến sự sanh khởi của chi giác ngộ trạch pháp."
Indriyasamattapaṭipādanā nāma saddhādīnaṃ indriyānaṃ samabhāvakaraṇaṃ.
Establishing a balance of the faculties is making the faculties of faith and so on equal in strength.
Làm cho các căn được quân bình là làm cho các căn như tín, v.v., được cân bằng.
Sace hissa saddhindriyaṃ balavaṃ hoti, itarāni mandāni.
If the faith faculty is strong and the others are weak,
Thật vậy, nếu căn tín của vị ấy mạnh mẽ, còn các căn khác yếu ớt.
Tato vīriyindriyaṃ paggahakiccaṃ, satindriyaṃ upaṭṭhānakiccaṃ, samādhindriyaṃ avikkhepakiccaṃ, paññindriyaṃ dassanakiccaṃ kātuṃ na sakkoti.
then the energy faculty cannot perform its function of uplifting, the mindfulness faculty its function of establishing, the concentration faculty its function of non-distraction, and the wisdom faculty its function of seeing.
Khi đó, căn tinh tấn không thể thực hiện chức năng nâng đỡ, căn niệm không thể thực hiện chức năng hiện tiền, căn định không thể thực hiện chức năng không tán loạn, căn tuệ không thể thực hiện chức năng thấy biết.
Tasmā taṃ dhammasabhāvapaccavekkhaṇena vā yathā vā manasikaroto balavaṃ jātaṃ, tathā amanasikārena hāpetabbaṃ.
Therefore, it should be weakened by reflecting on the true nature of things, or by not attending to it in the way that made it become strong.
Vì vậy, căn tín đó phải được làm giảm bớt bằng cách quán xét bản chất của pháp hoặc bằng cách không tác ý theo cách đã làm cho nó trở nên mạnh mẽ.
Vakkalittherassa vatthu cettha nidassanaṃ.
The story of the Elder Vakkali is an example here.
Câu chuyện về Trưởng lão Vakkali là một ví dụ ở đây.
Sace pana vīriyindriyaṃ balavaṃ hoti, atha neva saddhindriyaṃ adhimokkhakiccaṃ kātuṃ sakkoti, na itarāni itarakiccabhedaṃ.
But if the energy faculty is strong, then the faith faculty cannot perform its function of resolution, nor can the others perform their respective functions.
Nếu căn tinh tấn mạnh mẽ, thì căn tín không thể thực hiện chức năng quyết định, và các căn khác cũng không thể thực hiện các chức năng riêng biệt của chúng.
Tasmā taṃ passaddhādibhāvanāya hāpetabbaṃ.
Therefore, it should be weakened by developing tranquility and so on.
Vì vậy, căn tinh tấn đó phải được làm giảm bớt bằng cách tu tập sự khinh an (passaddhi), v.v.
Tatrāpi soṇattherassa vatthu dassetabbaṃ.
There, too, the story of the Elder Soṇa should be shown.
Trong trường hợp đó, câu chuyện về Trưởng lão Soṇa cũng nên được kể ra.
Evaṃ sesesupi ekassa balavabhāve sati itaresaṃ attano kiccesu asamatthatā veditabbā.
In this way, it should be understood that when one of the remaining faculties is strong, the others are incapable of their own functions.
Tương tự, đối với các căn còn lại, khi một căn mạnh mẽ, sự bất lực của các căn khác trong việc thực hiện chức năng của chúng phải được hiểu.
Visesato panettha saddhāpaññānaṃ samādhivīriyānaṃ ca samataṃ pasaṃsanti.
In particular, they praise the balance of faith and wisdom, and of concentration and energy.
Đặc biệt ở đây, các bậc hiền trí khen ngợi sự quân bình giữa tín và tuệ, cũng như giữa định và tinh tấn.
Balavasaddho hi mandapañño mudhāpasanno hoti, avatthusmiṃ pasīdati.
For one with strong faith but weak wisdom has misplaced confidence; he has confidence in what is not a proper object.
Thật vậy, người có tín mạnh nhưng tuệ yếu thì dễ tin một cách mù quáng, tin vào những điều không đúng đắn.
Balavapañño mandasaddho kerāṭikapakkhaṃ bhajati.
One with strong wisdom but weak faith inclines towards the side of craftiness.
Người có tuệ mạnh nhưng tín yếu thì thuộc phe hoài nghi.
Bhesajjasamuṭṭhito viya rogo atekiccho hoti.
Like a disease arising from a medicine, he becomes difficult to cure.
Giống như bệnh phát sinh do thuốc thì khó chữa trị.
Cittuppādamatteneva kusalaṃ hotīti atidhāvitvā dānādīni akaronto niraye uppajjati.
Thinking, “Merit occurs merely through the arising of a thought,” he rushes on, and not performing acts of giving and so on, he arises in hell.
Chỉ với ý nghĩ thiện là đủ, vị ấy sẽ bỏ qua việc bố thí, v.v., và sanh vào địa ngục.
Ubhinnaṃ samatāya vatthusmiṃyeva pasīdati.
Through the balance of the two, one has confidence only in a proper object.
Nhờ sự quân bình của cả hai, vị ấy chỉ tin vào những điều đúng đắn.
Balavasamādhiṃ pana mandavīriyaṃ samādhissa kosajjapakkhattā kosajjaṃ adhibhavati.
But one with strong concentration and weak energy is overcome by laziness, because concentration is on the side of laziness.
Còn người có định mạnh nhưng tinh tấn yếu thì sự biếng nhác sẽ chế ngự do định thuộc về phe biếng nhác.
Balavavīriyaṃ mandasamādhiṃ vīriyassa uddhaccapakkhattā uddhaccaṃ adhibhavati.
One with strong energy and weak concentration is overcome by restlessness, because energy is on the side of restlessness.
Người có tinh tấn mạnh nhưng định yếu thì sự phóng dật sẽ chế ngự do tinh tấn thuộc về phe phóng dật.
Samādhi pana vīriyena saṃyojito kosajje patituṃ na labhati.
But concentration, when conjoined with energy, does not fall into laziness.
Tuy nhiên, định khi được kết hợp với tinh tấn thì không thể rơi vào biếng nhác.
Vīriyaṃ samādhinā saṃyojitaṃ uddhacce patituṃ na labhati.
Energy, when conjoined with concentration, does not fall into restlessness.
Tinh tấn khi được kết hợp với định thì không thể rơi vào phóng dật.
Tasmā tadubhayaṃ samaṃ kātabbaṃ.
Therefore, that pair should be made equal.
Vì vậy, cả hai phải được làm cho quân bình.
Ubhayasamatāya hi appanā hoti.
For through the balance of the two, absorption occurs.
Thật vậy, nhờ sự quân bình của cả hai mà sự nhập định (appanā) mới sanh khởi.
Apica samādhikammikassa balavatīpi saddhā vaṭṭati.
Moreover, for one practicing concentration, even strong faith is suitable.
Hơn nữa, đối với người hành thiền định (samathakammika), tín mạnh mẽ cũng phù hợp.
Evaṃ saddahanto okappento appanaṃ pāpuṇissati.
Thus, by having faith and being confident, he will attain absorption.
Người có tín tâm như vậy, khi tin tưởng và quyết định, sẽ đạt đến sự nhập định.
Samādhipaññāsu pana samādhikammikassa ekaggatā balavatī vaṭṭati, evañhi so appanaṃ pāpuṇāti.
Between concentration and wisdom, for one practicing concentration, strong one-pointedness is suitable, for in this way he attains absorption.
Trong định và tuệ, đối với người hành thiền định, sự nhất tâm mạnh mẽ là phù hợp, vì như vậy vị ấy sẽ đạt đến sự nhập định.
Vipassanākammikassa paññā balavatī vaṭṭati, evañhi so lakkhaṇappaṭivedhaṃ pāpuṇāti.
For one practicing insight, strong wisdom is suitable, for in this way he attains the penetration of the characteristics.
Đối với người hành thiền quán (vipassanākammika), tuệ mạnh mẽ là phù hợp, vì như vậy vị ấy sẽ đạt đến sự thâm nhập các đặc tính (lakkhaṇa).
Ubhinnaṃ pana samatāyapi appanā hotiyeva.
But absorption occurs also through the balance of the two.
Tuy nhiên, ngay cả khi cả hai quân bình, sự nhập định vẫn sanh khởi.
Sati pana sabbattha balavatī vaṭṭati.
However, strong mindfulness is suitable in all cases.
Còn niệm thì luôn luôn phải mạnh mẽ.
Sati hi cittaṃ uddhaccapakkhikānaṃ saddhāvīriyapaññānaṃ vasena uddhaccapātato, kosajjapakkhikena ca samādhinā kosajjapātato rakkhati.
For mindfulness protects the mind from falling into restlessness by means of faith, energy, and wisdom, which are on the side of restlessness, and from falling into laziness by means of concentration, which is on the side of laziness.
Thật vậy, niệm bảo vệ tâm khỏi sự phóng dật do tín, tinh tấn và tuệ thuộc về phe phóng dật, và khỏi sự biếng nhác do định thuộc về phe biếng nhác.
Tasmā sā loṇadhūpanaṃ viya sabbabyañjanesu sabbakammikaamacco viya ca sabbarājakiccesu sabbattha icchitabbā.
Therefore, it should be desired everywhere, like salt seasoning in all curries, and like an all-purpose minister in all royal affairs.
Vì vậy, niệm được mong muốn ở khắp mọi nơi, giống như muối ướp trong tất cả các món ăn, và giống như vị quan chuyên trách mọi việc trong tất cả các công việc của nhà vua.
Tenāha – ‘‘sati ca pana sabbatthikā vuttā bhagavatā.
Hence it is said: “And mindfulness was said by the Blessed One to be universally applicable.
Do đó, đã nói rằng: "Và niệm đã được Thế Tôn nói là cần thiết ở khắp mọi nơi.
Kiṃ kāraṇā?
For what reason?
Vì lý do gì?
Cittañhi sati paṭisaraṇaṃ, ārakkhapaccupaṭṭhānā ca sati, na ca vinā satiyā cittassa paggahaniggaho hotī’’ti.
The mind has mindfulness as its refuge, and mindfulness has protection as its manifestation, and without mindfulness there is no uplifting and restraining of the mind.”
Vì niệm là nơi nương tựa của tâm, và niệm có chức năng bảo vệ và hiện tiền, và không có niệm thì tâm không thể được nâng đỡ hay chế ngự."
Duppaññapuggalaparivajjanā nāma khandhādibhede anogāḷhapaññānaṃ dummedhapuggalānaṃ ārakāva parivajjanaṃ.
Avoidance of persons with little wisdom is keeping far away from dull-witted persons whose wisdom has not penetrated the division of the aggregates and so on.
Tránh xa những người kém trí tuệ là tránh xa những người ngu dốt, những người có trí tuệ không thâm nhập được vào các pháp như uẩn, v.v., từ xa.
Paññavantapuggalasevanā nāma samapaññāsalakkhaṇapariggāhikāya udayabbayapaññāya samannāgatapuggalasevanā.
Associating with wise persons means associating with a person endowed with the wisdom of rise and fall, which grasps the fifty characteristics of wisdom.
Thân cận người có trí tuệ (Paññāvantapuggalasevanā) là thân cận với người đầy đủ tuệ quán sinh diệt (udayabbayañāṇa) có khả năng nắm giữ năm mươi đặc tính.
Gambhīrañāṇacariyapaccavekkhaṇā nāma gambhīresu khandhādīsu pavattāya gambhīrapaññāya pabhedapaccavekkhaṇā.
Contemplating the practice of profound knowledge means contemplating the various divisions with profound wisdom that occurs in relation to the profound aggregates and so on.
Quán xét hành vi trí tuệ sâu sắc (Gambhīrañāṇacariyapaccavekkhaṇā) là quán xét các phân biệt bằng trí tuệ sâu sắc phát sinh trong các pháp sâu sắc như các uẩn, v.v.
Tadadhimuttatā nāma ṭhānanisajjādīsu dhammavicayasambojjhaṅgasamuṭṭhāpanatthaṃ ninnapoṇapabbhāracittatā.
Inclination towards that means having a mind that is sloped, bent, and inclined towards arousing the enlightenment factor of investigation of dhammas in postures such as standing and sitting.
Hướng tâm đến điều đó (Tadadhimuttatā) là tâm có khuynh hướng, xu hướng, thiên về sự phát sinh chi giác ngộ Trạch pháp (dhammavicayasambojjhaṅga) trong các tư thế đứng, ngồi, v.v.
Evaṃ uppannassa panassa arahattamaggena bhāvanāpāripūrī hotīti pajānāti.
He understands that, for this enlightenment factor that has thus arisen, the culmination of its development occurs through the path of arahatship.
Người đã phát sinh điều đó biết rằng sự viên mãn của sự tu tập sẽ đến bằng đạo A-la-hán (arahattamagga).
Tattha nirayesu pañcavidhabandhanakammakāraṇato paṭṭhāya mahādukkhaṃ anubhavanakālepi, tiracchānayoniyaṃ jālakkhipakumīnādīhi gahitakālepi, pājanakaṇṭakādippahāratunnassa pana sakaṭavāhanādikālepi, pettivisaye anekānipi vassasahassāni ekaṃ buddhantarampi khuppipāsāhi āturitakālepi, kālakañjikaasuresu saṭṭhihatthaasītihatthappamāṇena aṭṭhicammamatteneva attabhāvena vātātapādidukkhānubhavanakālepi na sakkā vīriyasambojjhaṅgaṃ uppādetuṃ.
Among these, it is not possible to arouse the enlightenment factor of energy when experiencing great suffering in the hells, starting from the infliction of the five kinds of bondage; nor in the animal realm, when caught by nets, traps, fish-baskets, and so on; nor when, as an ox, one is prodded and struck by goads, thorns, etc., while pulling a cart; nor in the realm of the petas, when tormented by hunger and thirst for many thousands of years, even for an entire Buddha-interval; nor among the kālakañjika asuras, when experiencing the suffering of wind, sun, etc., with a body of merely sixty or eighty cubits that is only skin and bones.
Trong số đó, không thể phát sinh chi giác ngộ Tinh tấn ngay cả khi đang trải nghiệm đại khổ trong các địa ngục, từ việc bị trói buộc và hành hạ bằng năm cách; ngay cả khi bị bắt bằng lưới, bẫy, v.v. trong loài súc sanh; ngay cả khi bị đánh, bị đâm bằng roi, gai, v.v. khi kéo xe, v.v. của loài súc sanh; ngay cả khi bị đói khát hành hạ trong hàng ngàn năm, thậm chí một thời kỳ giữa hai Đức Phật trong cõi ngạ quỷ; ngay cả khi trải nghiệm khổ đau do gió, nắng, v.v. với thân thể chỉ bằng xương và da, cao sáu mươi hay tám mươi cánh tay của các A-tu-la Kāḷakañjika.
Ayameva te bhikkhu kālo vīriyakaraṇāyāti evaṃ apāyabhayaṃ paccavekkhantassāpi vīriyasambojjhaṅgo uppajjati.
“This, bhikkhu, is your time for making effort.” Thus, for one who contemplates the fear of the planes of misery, the enlightenment factor of energy also arises.
Này tỳ-khưu, đây chính là lúc để ngươi tinh tấn – ngay cả khi quán xét nỗi sợ hãi về khổ cảnh như vậy, chi giác ngộ Tinh tấn cũng phát sinh.
‘‘Na sakkā kusītena navalokuttaradhammaṃ laddhuṃ, āraddhavīriyeneva sakkā ayamānisaṃso vīriyassā’’ti evaṃ ānisaṃsadassāvinopi uppajjati.
“It is not possible for a lazy person to attain the nine supramundane dhammas; only one with aroused energy can.” Seeing the benefits in this way, it also arises.
“Kẻ biếng nhác không thể đạt được chín pháp siêu thế (navalokuttaradhamma), chỉ người tinh tấn mới có thể đạt được – đây là lợi ích của sự tinh tấn.” – ngay cả người thấy rõ lợi ích như vậy cũng phát sinh (chi giác ngộ Tinh tấn).
‘‘Sabbabuddhapaccekabuddhamahāsāvakehi te gatamaggo gantabbo, so ca na sakkā kusītena gantu’’nti evaṃ gamanavīthiṃ paccavekkhantassāpi uppajjati.
“You must travel the path traveled by all Buddhas, Paccekabuddhas, and great disciples, and that path cannot be traveled by a lazy person.” Contemplating the path to be traveled in this way, it also arises.
“Ngươi phải đi trên con đường mà tất cả chư Phật, chư Độc Giác Phật và các Đại Thanh văn đã đi, và kẻ biếng nhác không thể đi trên con đường đó.” – ngay cả người quán xét con đường như vậy cũng phát sinh (chi giác ngộ Tinh tấn).
‘‘Ye taṃ piṇḍapātādīhi upaṭṭhahanti, ime te manussā neva ñātakā, na dāsakammakarā, nāpi ‘taṃ nissāya jīvissāmā’ti te paṇītāni piṇḍapātādīni denti, atha kho attano kārānaṃ mahapphalataṃ paccāsīsamānā denti, satthārāpi ‘ayaṃ ime paccaye paribhuñjitvā kāyadaḷhībahulo sukhaṃ viharissatī’ti na evaṃ sampassatā tuyhaṃ paccayā anuññātā, atha kho ‘ayaṃ ime paribhuñjamāno samaṇadhammaṃ katvā vaṭṭadukkhato muccissatī’ti te paccayā anuññātā, so dāni tvaṃ kusīto viharanto na taṃ piṇḍaṃ apacāyissasi, āraddhavīriyasseva hi piṇḍapātāpacāyanaṃ nāma hotī’’ti evaṃ piṇḍapātāpacāyanaṃ paccavekkhantassāpi uppajjati mahāmittattherassa viya.
“Those people who support you with almsfood and so on are not your relatives, nor your slaves or workers, nor do they give you fine almsfood thinking, ‘We will live by depending on him.’ Rather, they give, hoping for the great fruitfulness of their actions. The Teacher, too, did not permit you these requisites thinking, ‘Consuming these requisites, this one will live happily, stout and strong of body.’ Rather, he permitted you these requisites thinking, ‘Consuming these, he will practice the ascetic’s duties and be liberated from the suffering of the round of existences.’ Now, if you live lazily, you will not be revering that almsfood. Indeed, reverence for almsfood belongs only to one with aroused energy.” Thus, for one who contemplates showing reverence for almsfood, it also arises, as it did for the Elder Mahāmitta.
“Những người cúng dường vật thực khất thực, v.v. cho ngươi, những người này không phải là thân quyến của ngươi, không phải là nô lệ hay người làm công, cũng không phải họ cúng dường vật thực khất thực cao cấp, v.v. cho ngươi với ý nghĩ ‘chúng tôi sẽ sống nhờ vào ngươi.’ Mà họ cúng dường với mong muốn quả báo lớn cho những việc làm của mình. Đức Đạo Sư cũng không cho phép ngươi thọ dụng các vật dụng này với ý nghĩ ‘người này sẽ thọ dụng các vật dụng này, sống an lạc với thân thể cường tráng.’ Mà các vật dụng này được cho phép ngươi với ý nghĩ ‘người này thọ dụng chúng, thực hành pháp Sa-môn, sẽ thoát khỏi khổ luân hồi.’ Vậy thì, nếu ngươi sống biếng nhác, ngươi sẽ không đền đáp vật thực khất thực đó. Việc đền đáp vật thực khất thực chỉ dành cho người tinh tấn mà thôi.” – ngay cả người quán xét việc đền đáp vật thực khất thực như vậy cũng phát sinh (chi giác ngộ Tinh tấn), giống như trường hợp của Đại Trưởng lão Mahāmitta.
Thero kira kassakaleṇe nāma paṭivasati.
It is said that the elder lived in the Kassaka Cave.
Nghe nói, vị Trưởng lão trú tại một hang động tên là Kassakaleṇa.
Tassa ca gocaragāme ekā mahāupāsikā theraṃ puttaṃ katvā paṭijaggati.
In his alms-round village, a great female lay follower looked after the elder, having adopted him as her son.
Trong làng khất thực của vị ấy, có một nữ cư sĩ lớn tuổi chăm sóc vị Trưởng lão như con trai mình.
Sā ekadivasaṃ araññaṃ gacchantī dhītaraṃ āha – ‘‘amma asukasmiṃ ṭhāne purāṇataṇḍulā, asukasmiṃ khīraṃ, asukasmiṃ sappi, asukasmiṃ phāṇitaṃ, tava bhātikassa ayyamittassa āgatakāle bhattaṃ pacitvā khīrasappiphāṇitehi saddhiṃ dehi, tvaṃ ca bhuñjeyyāsi, ahaṃ pana hiyyo pakkaṃ pārivāsikabhattaṃ kañjikena bhuttāmhī’’ti.
One day, as she was going to the forest, she said to her daughter, “My dear, in such-and-such a place there is old rice, in such-and-such a place milk, in such-and-such a place ghee, in such-and-such a place molasses. When your brother, the venerable Mitta, comes, cook a meal and give it to him with the milk, ghee, and molasses. And you may eat as well. As for me, I have eaten last night's leftover rice with rice-gruel.”
Một hôm, bà đi vào rừng và nói với con gái: “Con ơi, chỗ này có gạo cũ, chỗ kia có sữa, chỗ kia có bơ lỏng, chỗ kia có mật. Khi anh con, Đại đức Mitta, đến, hãy nấu cơm và dâng cùng với sữa, bơ lỏng và mật. Con cũng hãy ăn phần còn lại. Còn mẹ, hôm qua mẹ đã ăn cơm thừa với cháo chua rồi.”
Divā kiṃ bhuñjissasi ammāti?
“Mother, what will you eat during the day?”
“Mẹ ơi, ban ngày mẹ sẽ ăn gì?”
Sākapaṇṇaṃ pakkhipitvā kaṇataṇḍulehi ambilayāguṃ pacitvā ṭhapehi ammāti.
“Cook some sour gruel with broken rice, adding some vegetable leaves, and set it aside, my dear.”
“Con ơi, hãy nấu cháo chua bằng gạo tấm, cho rau vào rồi để đó.”
Thero cīvaraṃ pārupitvā pattaṃ nīharantova taṃ saddaṃ sutvā attānaṃ ovadi – ‘‘mahāupāsikā kira kañjiyena pārivāsikabhattaṃ bhuñji, divāpi kaṇapaṇṇambilayāguṃ bhuñjissati, tuyhaṃ atthāya pana purāṇataṇḍulādīni ācikkhati, taṃ nissāya kho panesā neva khettaṃ na vatthuṃ na bhattaṃ na vatthaṃ paccāsīsati, tisso pana sampattiyo patthayamānā deti, tvaṃ etissā tā sampattiyo dātuṃ sakkhissasi na sakkhissasīti, ayaṃ kho pana piṇḍapāto tayā sarāgena sadosena samohena na sakkā gaṇhitunti pattaṃ thavikāya pakkhipitvā gaṇṭhikaṃ muñcitvā nivattitvā kassakaleṇameva gantvā pattaṃ heṭṭhāmañce cīvaraṃ cīvaravaṃse ṭhapetvā arahattaṃ apāpuṇitvā na nikkhamissāmī’’ti vīriyaṃ adhiṭṭhahitvā nisīdi.
Just as the elder was wrapping his robe and taking out his bowl, he heard this sound and admonished himself, “The great lay follower, it seems, ate leftover rice with rice-gruel, and during the day she will eat sour gruel with broken rice and vegetable leaves. But for your sake, she mentions old rice and so on. She does not expect fields, property, food, or cloth from you. Rather, she gives, aspiring for the three kinds of success. Will you be able to give her those successes or not? This almsfood cannot be accepted by you with greed, with hatred, with delusion.” With this, he put his bowl in its bag, untied his belt, turned back, and went to the Kassaka Cave itself. Placing the bowl on the low couch and the robe on the robe-rack, he sat down, making the resolution, “I will not leave until I have attained arahatship.”
Vị Trưởng lão, vừa đắp y vừa lấy bát ra, nghe thấy tiếng nói đó, tự răn mình: “Nữ cư sĩ lớn tuổi đã ăn cơm thừa với cháo chua. Ban ngày bà ấy cũng sẽ ăn cháo chua với rau và gạo tấm. Vậy mà vì lợi ích của ta, bà ấy chỉ ra những thứ như gạo cũ, v.v. Nương tựa vào ta, bà ấy không mong ruộng đất, không mong nhà cửa, không mong thức ăn, không mong y phục. Mà bà ấy cúng dường vì mong cầu ba sự thành tựu (tisso sampattiyo). Ta có thể mang lại những sự thành tựu đó cho bà ấy hay không? Hơn nữa, vật thực khất thực này, ngươi không thể thọ nhận với tâm tham ái, tâm sân hận, tâm si mê.” – Với ý nghĩ như vậy, vị ấy đặt bát vào túi, tháo dây buộc, quay trở lại hang động Kassakaleṇa. Đặt bát dưới ghế, y trên sào y, vị ấy kiên quyết tinh tấn rằng “Ta sẽ không ra ngoài cho đến khi đạt được A-la-hán quả” và ngồi xuống.
Dīgharattaṃ appamatto hutvā nivutthabhikkhu vipassanaṃ vaḍḍhetvā purebhattameva arahattaṃ patvā vikasitaṃ viya padumaṃ mahākhīṇāsavo sitaṃ karontova nikkhami.
Having been diligent for a long time, the bhikkhu who had dwelled thus developed insight and, before the morning meal, attained arahatship. Like a blossoming lotus, the great one whose cankers were destroyed came out smiling.
Vị tỳ-khưu đã sống không phóng dật trong một thời gian dài, phát triển thiền quán (vipassanā), và ngay trước bữa ăn sáng đã đạt được A-la-hán quả. Vị Đại A-la-hán ấy mỉm cười như một đóa sen nở rộ rồi bước ra.
Leṇadvāre rukkhamhi adhivatthā devatā –
A deity dwelling in a tree at the cave entrance said:
Vị thiên nữ trú trên cây ở cửa hang động –
Thero uṭṭhahitvā dvāraṃ vivaritvā kālaṃ olokento pātoyevāti ñatvā pattacīvaramādāya gāmaṃ pāvisi.
The elder got up, opened the door, and looking at the time, knew it was early morning. Taking his bowl and robe, he entered the village.
Vị Trưởng lão đứng dậy, mở cửa, nhìn thời gian, biết rằng vẫn còn sớm, liền mang bát và y vào làng.
Dārikāpi bhattaṃ sampādetvā ‘‘idāni me bhātā āgamissati, idāni āgamissatī’’ti dvāraṃ olokayamānā nisīdi.
The girl, having prepared the meal, sat looking at the door, thinking, “Now my brother will come, now he will come.”
Cô bé cũng chuẩn bị thức ăn, ngồi nhìn ra cửa, nghĩ: “Bây giờ anh mình sẽ đến, bây giờ sẽ đến.”
Sā there gharadvāraṃ sampatte pattaṃ gahetvā sappiphāṇitayojitassa khīrapiṇḍapātassa pūretvā hatthe ṭhapesi.
When the elder arrived at the door of the house, she took his bowl, filled it with milk-rice mixed with ghee and molasses, and placed it in his hands.
Khi vị Trưởng lão đến cửa nhà, cô bé nhận bát, đổ đầy vật thực khất thực là cơm sữa trộn bơ lỏng và mật vào, rồi đặt vào tay vị ấy.
Thero ‘‘sukhaṃ hotū’’ti anumodanaṃ katvā pakkāmi.
The elder departed after giving the blessing, “May you be happy.”
Vị Trưởng lão nói lời tùy hỷ “Chúc an lạc” rồi rời đi.
Sāpi taṃ olokayamānāva aṭṭhāsi.
She stood watching him.
Cô bé cũng đứng nhìn theo vị ấy.
Therassa hi tadā ativiya parisuddho chavivaṇṇo ahosi, vippasannāni indriyāni, mukhaṃ bandhanā pamuttatālapakkaṃ viya ativiya virocittha.
For at that time, the elder's skin complexion was exceedingly pure, his faculties were serene, and his face shone exceedingly, like a ripe palmyra fruit released from its stalk.
Lúc đó, sắc da của vị Trưởng lão vô cùng thanh tịnh, các căn của vị ấy trong sáng, khuôn mặt rạng rỡ như trái thốt nốt đã được giải thoát khỏi vỏ.
Mahāupāsikā araññā āgantvā ‘‘kiṃ amma, bhātiko te āgato’’ti pucchi.
The great female lay disciple, having come from the forest, asked, "Dear, has your brother come?"
Nữ cư sĩ lớn tuổi từ rừng trở về, hỏi: “Con ơi, anh con đã về chưa?”
Sā sabbaṃ taṃ pavattiṃ ārocesi.
She told her that whole story.
Cô bé kể lại toàn bộ câu chuyện.
Sā upāsikā ‘‘ajja me puttassa pabbajitakiccaṃ matthakaṃ patta’’nti ñatvā ‘‘abhiramati te amma bhātā buddhasāsane na ukkaṇṭhatī’’ti āha.
That female lay disciple, knowing, "Today the duty of my son's going forth has reached its culmination," said, "Dear, does your brother delight in the Buddha's dispensation, is he not discontented?"
Vị nữ cư sĩ biết rằng “Hôm nay, việc xuất gia của con trai ta đã thành tựu,” liền nói: “Con ơi, anh con có hoan hỷ trong giáo pháp của Đức Phật không, hay anh ấy đã chán nản?”
‘‘Mahantaṃ kho panetaṃ satthu dāyajjaṃ, yadidaṃ sattaariyadhanaṃ nāma, taṃ na sakkā kusītena gahetuṃ.
“Indeed, this inheritance of the Teacher, namely the seven noble treasures, is great; it cannot be grasped by a lazy person.
Này, tài sản thừa kế của Đức Bổn Sư thật vĩ đại, đó chính là bảy tài sản của bậc Thánh (sattaariyadhana). Kẻ biếng nhác không thể nào thọ nhận được tài sản ấy.
Yathā hi vippaṭipannaṃ puttaṃ mātāpitaro ‘ayaṃ amhākaṃ aputto’ti paribāhiraṃ karonti, so tesaṃ accayena dāyajjaṃ na labhati, evaṃ kusītopi idaṃ ariyadhanadāyajjaṃ na labhati, āraddhavīriyova labhatī’’ti dāyajjamahattataṃ paccavekkhatopi uppajjati.
Just as parents exclude a misbehaving son, saying, ‘This is no son of ours,’ and he does not receive the inheritance upon their death, so too, a lazy person does not receive this inheritance of the noble treasures; only one with aroused energy receives it.” It also arises in one who reflects on the greatness of the inheritance.
Như cha mẹ loại bỏ đứa con hư hỏng, nói rằng ‘đây không phải là con của chúng ta’, rồi khi cha mẹ qua đời, đứa con ấy không được thừa hưởng tài sản. Cũng vậy, người biếng nhác không thể thọ nhận tài sản thừa kế của bậc Thánh này, chỉ người tinh tấn mới thọ nhận được.” Khi quán xét sự vĩ đại của tài sản thừa kế như vậy, tinh tấn (vīriya) cũng khởi lên.
‘‘Mahā kho pana te satthā, satthuno hi mātukucchismiṃ paṭisandhiggahaṇakālepi abhinikkhamanepi abhisambodhiyampi dhammacakkappavattanayamakapāṭihāriyadevorohaṇa-āyusaṅkhāravossajjanesupi parinibbānakālepi dasasahassilokadhātu kampittha, yuttaṃ nu te evarūpassa satthuno sāsane ‘pabbajitvā kusītena bhavitu’’’nti evaṃ satthumahattaṃ paccavekkhatopi uppajjati.
“Indeed, your Teacher is great. At the time of the Teacher's conception in his mother's womb, at his renunciation, at his full enlightenment, at the turning of the Wheel of Dhamma, at the twin miracle, at the descent from the celestial world, at the relinquishing of the life formation, and at the time of his final Nibbāna, the ten-thousand-world-system quaked. Is it proper for you, having gone forth in the dispensation of such a Teacher, to be lazy?” Thus it also arises in one who reflects on the greatness of the Teacher.
“Đức Bổn Sư của ngươi thật vĩ đại. Quả thật, khi Đức Bổn Sư thọ thai trong bụng mẹ, khi xuất gia, khi đạt giác ngộ tối thượng, khi chuyển Pháp luân, khi thực hiện song thần thông, khi giáng trần từ cõi trời, khi xả bỏ thọ hành, và khi nhập Niết Bàn, mười ngàn thế giới đã chấn động. Ngươi xuất gia trong giáo pháp của một Đức Bổn Sư vĩ đại như vậy, lẽ nào lại sống biếng nhác?” Khi quán xét sự vĩ đại của Đức Bổn Sư như vậy, tinh tấn cũng khởi lên.
Jātiyāpi – ‘‘tvaṃ idāni na lāmakajātiko, asambhinnāya mahāsammatapaveṇiyā āgato, ukkākarājavaṃse jātosi, suddhodhanamahārājassa mahāmāyādeviyā ca nattā, rāhulabhaddassa kaniṭṭho, tayā nāma evarūpena jinaputtena hutvā na yuttaṃ kusītena viharitu’’nti evaṃ jātimahattaṃ paccavekkhatopi uppajjati.
Also by birth: “You are not now of lowly birth; you come from the unbroken lineage of Mahāsammata, born in the royal dynasty of Ukkāka. You are the grandson of the great king Suddhodana and Queen Mahāmāyā, and the younger brother of the noble Rāhula. Is it proper for such a one as you, being a son of the Victor, to dwell lazily?” Thus it also arises in one who reflects on the greatness of his birth.
Về dòng dõi: “Ngươi bây giờ không phải là người thuộc dòng dõi thấp kém, mà đến từ dòng dõi Đại Thắng (Mahāsammata) không bị pha tạp, sinh ra trong dòng dõi vua Ukkāka, là cháu của Đại Vương Suddhodana và Hoàng hậu Mahāmāyā, là em của Rāhulabhadda. Một đấng Jinaputta như ngươi lẽ nào lại sống biếng nhác?” Khi quán xét sự vĩ đại của dòng dõi như vậy, tinh tấn cũng khởi lên.
‘‘Sāriputtamoggallānā ceva asīti ca mahāsāvakā vīriyeneva lokuttaradhammaṃ paṭivijjhiṃsu, tvaṃ etesaṃ sabrahmacārīnaṃ maggaṃ paṭipajjissasi na paṭipajjissasī’’ti evaṃ sabrahmacārimahattaṃ paccavekkhatopi uppajjati.
“Sāriputta, Moggallāna, and the eighty great disciples penetrated the supramundane Dhamma through energy alone. Will you follow the path of these spiritual companions or not?” Thus it also arises in one who reflects on the greatness of his spiritual companions.
“Trưởng lão Sāriputta và Moggallāna cùng tám mươi vị Đại Thanh Văn đã chứng đắc các pháp siêu thế (lokuttaradhamma) chỉ bằng tinh tấn. Ngươi sẽ noi theo con đường của các vị đồng Phạm hạnh ấy, hay sẽ không noi theo?” Khi quán xét sự vĩ đại của các vị đồng Phạm hạnh như vậy, tinh tấn cũng khởi lên.
Kucchiṃ pūretvā ṭhitaajagarasadise vissaṭṭhakāyikacetasikavīriye kusītapuggale parivajjantassāpi, āraddhavīriye pahitatte puggale sevantassāpi, ṭhānanisajjādīsu vīriyuppādanatthaṃ ninnapoṇapabbhāracittassāpi uppajjati.
It also arises in one who avoids lazy persons who have abandoned bodily and mental energy, like a python that lies still after filling its belly; in one who associates with persons of aroused energy and dedicated effort; and in one whose mind is inclined, sloped, and slanted toward arousing energy in the postures of standing, sitting, and so on.
Tinh tấn cũng khởi lên nơi người tránh xa những kẻ biếng nhác có tinh tấn thân và tinh tấn tâm buông lơi, giống như con trăn nằm no bụng; nơi người thân cận những kẻ tinh tấn, đã dốc hết tâm lực; và nơi người có tâm hướng về, nghiêng về, thiên về việc phát sinh tinh tấn trong các oai nghi đứng, ngồi, v.v.
Evaṃ uppannassa panassa arahattamaggena bhāvanāpāripūrī hotīti pajānāti.
And he understands that for this factor, thus arisen, the culmination of its development occurs through the path of arahatship.
Và người ấy biết rằng, khi tinh tấn đã khởi lên như vậy, sự viên mãn của sự tu tập sẽ đạt được qua con đường A-la-hán (arahattamagga).
Buddhaguṇe anussarantassāpi hi yāva upacārā sakalasarīraṃ pharamāno pītisambojjhaṅgo uppajjati.
For, in one who recollects the qualities of the Buddha, the enlightenment factor of rapture arises, pervading the entire body up to the point of access concentration.
Khi niệm tưởng các đức của Đức Phật, Hỷ giác chi khởi lên, lan tỏa khắp toàn thân cho đến cận định (upacāra).
Dhammasaṅghaguṇe anussarantassāpi, dīgharattaṃ akhaṇḍaṃ katvā rakkhitaṃ catupārisuddhisīlaṃ paccavekkhantassāpi, gihino dasasīlapañcasīlaṃ paccavekkhantassāpi, dubbhikkhabhayādīsu paṇītaṃ bhojanaṃ sabrahmacārīnaṃ datvā ‘‘evaṃ nāma adamhā’’ti cāgaṃ paccavekkhantassāpi, gihinopi evarūpe kāle sīlavantānaṃ dinnadānaṃ paccavekkhantassāpi, yehi guṇehi samannāgatā devatā devattaṃ pattā, tathārūpānaṃ guṇānaṃ attani atthitaṃ paccavekkhantassāpi, ‘‘samāpattiyā vikkhambhitā kilesā saṭṭhipi, sattatipi vassāni na samudācarantī’’ti paccavekkhantassāpi, cetiyadassanabodhidassanatheradassanesu asakkaccakiriyāya saṃsūcitalūkhabhāve buddhādīsu pasādasinehābhāvena gadrabhapiṭṭhe rajasadise lūkhapuggale parivajjantassāpi, buddhādīsu pasādabahule muducitte siniddhapuggale sevantassāpi, ratanattayaguṇaparidīpake pasādanīye suttante paccavekkhantassāpi, ṭhānanisajjādīsu pītiuppādanatthaṃ ninnapoṇapabbhāracittassāpi uppajjati.
It arises in one who recollects the qualities of the Dhamma and the Saṅgha; in one who reflects on the Fourfold Purity of Virtue which has been kept unbroken for a long time; in a householder who reflects on the ten precepts or the five precepts; in one who, having given fine food to his spiritual companions during times of famine, danger, etc., reflects on his generosity, thinking, “Such indeed was given by us”; in a householder who reflects on a gift given to the virtuous at such a time; in one who reflects on the presence in himself of qualities similar to those by which deities attained their divine state; in one who reflects, “Defilements suppressed by attainment do not arise for sixty or even seventy years”; in one who avoids coarse persons, who are like dust on a donkey's back due to their lack of confidence and affection for the Buddha and others, indicated by their disrespectful actions when seeing a cetiya, a Bodhi tree, or an elder; in one who associates with refined, gentle-minded persons who have abundant confidence in the Buddha and others; in one who reflects on inspiring discourses that illuminate the qualities of the Three Jewels; and in one whose mind is inclined, sloped, and slanted toward arousing rapture in the postures of standing, sitting, and so on.
Cũng vậy, khi niệm tưởng các đức của Pháp và Tăng; khi quán xét giới Tứ Thanh Tịnh (catupārisuddhisīla) đã giữ gìn không sứt mẻ trong thời gian dài; khi người cư sĩ quán xét Thập giới (dasasīla) và Ngũ giới (pañcasīla); khi quán xét sự bố thí đã cho chư Phạm hạnh những món ăn ngon trong thời kỳ nạn đói, v.v., nghĩ rằng “chúng ta đã bố thí như vậy”; khi người cư sĩ quán xét sự bố thí đã cho những người giữ giới trong những lúc như vậy; khi quán xét sự hiện hữu nơi mình những đức tính tương tự như những đức tính mà nhờ đó chư thiên đã đạt được địa vị chư thiên; khi quán xét rằng “các phiền não đã bị trấn áp bởi thiền định (samāpatti) không khởi lên trong sáu mươi hoặc bảy mươi năm”; khi tránh xa những người thô tháo, giống như bụi bặm trên lưng lừa, những người có vẻ thô tháo được biểu lộ qua sự bất kính trong việc chiêm bái tháp, chiêm bái cây Bồ đề, chiêm bái các vị Trưởng lão, do không có niềm tịnh tín và tình cảm đối với Đức Phật, v.v.; khi thân cận những người hiền hòa, có tâm nhu hòa, đầy tịnh tín đối với Đức Phật, v.v.; khi quán xét những kinh điển đáng hoan hỷ, làm sáng tỏ các đức của Tam Bảo; và khi có tâm hướng về, nghiêng về, thiên về việc phát sinh hỷ trong các oai nghi đứng, ngồi, v.v., hỷ giác chi cũng khởi lên.
Evaṃ uppannassa panassa arahattamaggena bhāvanāpāripūrī hotīti pajānāti.
And he understands that for this factor, thus arisen, the culmination of its development occurs through the path of arahatship.
Và người ấy biết rằng, khi hỷ đã khởi lên như vậy, sự viên mãn của sự tu tập sẽ đạt được qua con đường A-la-hán.
Paṇītañhi siniddhaṃ sappāyabhojanaṃ bhuñjantassāpi, sītuṇhesu utūsu ṭhānādīsu iriyāpathesu sappāyaṃ utuṃ ca iriyāpathaṃ ca sevantassāpi passaddhi uppajjati.
For one who eats fine, rich, and suitable food, and for one who makes use of a suitable climate and posture in cold and hot seasons and in postures of standing, etc., tranquility arises.
Khi thọ dụng món ăn ngon, nhuận trạch và thích hợp, khinh an cũng khởi lên. Cũng vậy, khi thọ dụng thời tiết và oai nghi thích hợp trong các mùa lạnh nóng, trong các oai nghi đứng, v.v., khinh an cũng khởi lên.
Yo pana mahāpurisajātiko sabbautuiriyāpathakkhamova hoti, na taṃ sandhāyetaṃ vuttaṃ.
But this is not said with reference to one who is by nature a great being and is tolerant of all climates and postures.
Tuy nhiên, điều này không nói đến những bậc Đại nhân có khả năng chịu đựng mọi thời tiết và mọi oai nghi.
Yassa sabhāgavisabhāgatā atthi, tasseva visabhāge utuiriyāpathe vajjetvā sabhāge sevantassāpi uppajjati.
It arises only for one for whom there is compatibility and incompatibility, when he avoids incompatible climates and postures and makes use of compatible ones.
Chỉ đối với người có sự tương hợp và không tương hợp, khinh an mới khởi lên khi tránh những thời tiết và oai nghi không tương hợp và thọ dụng những điều tương hợp.
Majjhattapayogo vuccati attano ca parassa ca kammassakatāpaccavekkhaṇā, iminā majjhattapayogena uppajjati.
The application of neutrality refers to reflecting on the fact that oneself and others are owners of their kamma. Through this application of neutrality, it arises.
Sự thực hành trung dung (majjhattapayoga) được gọi là sự quán xét nghiệp của mình và của người khác là của riêng mình. Khinh an khởi lên nhờ sự thực hành trung dung này.
Yo leḍḍudaṇḍādīhi paraṃ viheṭhayamānova vicarati.
One who wanders about harming others with clods, sticks, and the like.
Người nào đi lại làm hại người khác bằng gạch đá, gậy gộc, v.v.
Evarūpaṃ sāraddhakāyaṃ puggalaṃ parivajjantassāpi, saṃyatapādapāṇiṃ passaddhakāyaṃ puggalaṃ sevantassāpi, ṭhānanisajjādīsu passaddhiuppādanatthāya ninnapoṇapabbhāracittassāpi uppajjati.
It also arises in one who avoids such a person with an agitated body; in one who associates with a person with a tranquil body, whose hands and feet are restrained; and in one whose mind is inclined, sloped, and slanted toward arousing tranquility in the postures of standing, sitting, and so on.
Khi tránh xa người có thân bất an như vậy; khi thân cận người có thân khinh an, tay chân được chế ngự; và khi có tâm hướng về, nghiêng về, thiên về việc phát sinh khinh an trong các oai nghi đứng, ngồi, v.v., khinh an cũng khởi lên.
Evaṃ uppannassa panassa arahattamaggena bhāvanāpāripūrī hotīti pajānāti.
And he understands that for this factor, thus arisen, the culmination of its development occurs through the path of arahatship.
Và người ấy biết rằng, khi khinh an đã khởi lên như vậy, sự viên mãn của sự tu tập sẽ đạt được qua con đường A-la-hán.
Samādhisambojjhaṅgassa – ‘‘atthi, bhikkhave, samathanimittaṃ abyagganimittaṃ, tattha yonisomanasikārabahulīkāro, ayamāhāro anuppannassa vā samādhisambojjhaṅgassa uppādāya, uppannassa vā samādhisambojjhaṅgassa bhiyyobhāvāya vepullāya bhāvanāya pāripūriyā saṃvattatī’’ti (saṃ. ni. 5.232) evaṃ uppādo hoti.
Of the enlightenment factor of concentration: “There are, monks, the sign of serenity and the sign of non-distraction. Frequent wise attention to them is the nutriment for the unarisen enlightenment factor of concentration to arise, and for the arisen enlightenment factor of concentration to be brought to growth, expansion, development, and culmination.” Thus it arises.
Đối với Định giác chi (Samādhisambojjhaṅga): “Này các tỳ khưu, có tướng chỉ (samathanimitta) và tướng không tán loạn (abyagganimitta). Việc thường xuyên tác ý đúng đắn là thức ăn để Định giác chi chưa sinh khởi được sinh khởi, và Định giác chi đã sinh khởi được tăng trưởng, phát triển, tu tập và viên mãn.” (Saṃ. Ni. 5.232) Sự sinh khởi là như vậy.
Tattha samathova samathanimittaṃ, avikkhepaṭṭhena ca abyagganimittanti.
Therein, serenity itself is the sign of serenity, and it is the sign of non-distraction in the sense of non-wavering.
Ở đây, chính chỉ (samatha) là tướng chỉ, và theo nghĩa không tán loạn, đó là tướng không tán loạn.
Apica ekādasa dhammā samādhisambojjhaṅgassa uppādāya saṃvattanti vatthuvisadakiriyatā indriyasamattapaṭipādanatā nimittakusalatā samaye cittassa paggahaṇatā samaye cittassa niggahaṇatā samaye sampahaṃsanatā samaye ajjhupekkhanatā asamāhitapuggalaparivajjanatā samāhitapuggalasevanatā jhānavimokkhapaccavekkhaṇatā tadadhimuttatāti.
Furthermore, eleven things conduce to the arising of the concentration enlightenment-factor: making the basis pure, bringing the faculties into balance, skill in the sign, uplifting the mind at the proper time, restraining the mind at the proper time, gladdening the mind at the proper time, looking on with equanimity at the proper time, avoiding unconcentrated persons, associating with concentrated persons, reflecting on the jhānas and liberations, and being resolved on that.
Hơn nữa, có mười một pháp đưa đến sự phát sinh của định giác chi (samādhisambojjhaṅga): sự làm cho vật trong sạch, sự làm cho các căn được quân bình, sự thiện xảo trong tướng (nimitta), sự nâng đỡ tâm đúng lúc, sự kìm giữ tâm đúng lúc, sự làm cho tâm hoan hỷ đúng lúc, sự xả tâm đúng lúc, sự tránh xa người không định tĩnh, sự thân cận người định tĩnh, sự quán xét thiền và giải thoát, và sự hướng tâm đến điều đó.
Tattha vatthuvisadakiriyatā ca indriyasamattapaṭipādanatā ca vuttanayeneva veditabbā.
Therein, making the basis pure and bringing the faculties into balance should be understood in the way already stated.
Trong đó, sự làm cho vật trong sạch và sự làm cho các căn được quân bình nên được hiểu theo cách đã nói.
Nimittakusalatā nāma kasiṇanimittassa uggahaṇakusalatā.
Skill in the sign means skill in grasping the kasiṇa sign.
Sự thiện xảo trong tướng (nimitta) là sự thiện xảo trong việc nắm giữ tướng (nimitta) của kasiṇa.
Samaye cittassa paggahaṇatāti yasmiṃ samaye atisithilavīriyatādīhi līnaṃ cittaṃ hoti, tasmiṃ samaye dhammavicayavīriyasambojjhaṅgasamuṭṭhāpanena tassa paggahaṇaṃ.
Uplifting the mind at the proper time means that at a time when the mind is sluggish due to excessively lax energy and so on, one uplifts it by arousing the enlightenment-factors of investigation-of-dhammas, energy, and joy.
Sự nâng đỡ tâm đúng lúc là khi tâm bị chìm đắm do sự biếng nhác quá mức hoặc các yếu tố tương tự, vào lúc đó, tâm được nâng đỡ bằng cách phát khởi trạch pháp giác chi (dhammavicayasambojjhaṅga) và tinh tấn giác chi (vīriyasambojjhaṅga).
Samaye cittassa niggahaṇatāti yasmiṃ samaye accāraddhavīriyatādīhi uddhataṃ cittaṃ hoti, tasmiṃ samaye passaddhisamādhiupekkhāsambojjhaṅgasamuṭṭhāpanena tassa niggahaṇaṃ.
Restraining the mind at the proper time means that at a time when the mind is agitated due to excessively exerted energy and so on, one restrains it by arousing the enlightenment-factors of tranquility, concentration, and equanimity.
Sự kìm giữ tâm đúng lúc là khi tâm bị phóng dật do sự tinh tấn quá mức hoặc các yếu tố tương tự, vào lúc đó, tâm được kìm giữ bằng cách phát khởi khinh an giác chi (passaddhisambojjhaṅga), định giác chi (samādhisambojjhaṅga) và xả giác chi (upekkhāsambojjhaṅga).
Samaye sampahaṃsanatāti yasmiṃ samaye cittaṃ paññāpayogamandatāya vā upasamasukhānadhigamena vā nirassādaṃ hoti, tasmiṃ samaye aṭṭhasaṃvegavatthupaccavekkhaṇena saṃvejeti.
Gladdening the mind at the proper time means that at a time when the mind is joyless due to weakness in the application of wisdom or through not having attained the happiness of peace, one inspires it with a sense of urgency by reflecting on the eight grounds for spiritual urgency.
Sự làm cho tâm hoan hỷ đúng lúc là khi tâm bị vô vị do sự kém cỏi trong việc thực hành trí tuệ hoặc không đạt được an lạc tịch tịnh, vào lúc đó, tâm được làm cho xúc động (saṃvejeti) bằng cách quán xét tám đối tượng gây xúc động.
Aṭṭha saṃvegavatthūni nāma jātijarābyādhimaraṇāni cattāri, apāyadukkhaṃ pañcamaṃ, atīte vaṭṭamūlakaṃ dukkhaṃ, anāgate vaṭṭamūlakaṃ dukkhaṃ, paccuppanne āhārapariyeṭṭhimūlakaṃ dukkhanti.
The eight grounds for spiritual urgency are: birth, old age, sickness, and death as the four; the suffering in the planes of misery as the fifth; suffering in the past rooted in the round of existence; suffering in the future rooted in the round of existence; and suffering in the present rooted in the search for food.
Tám đối tượng gây xúc động là: sanh, già, bệnh, chết (bốn điều); khổ cảnh giới thấp (apāya) là thứ năm; khổ do luân hồi trong quá khứ; khổ do luân hồi trong tương lai; và khổ do sự tìm kiếm thức ăn trong hiện tại.
Ratanattayaguṇānussaraṇena ca pasādaṃ janeti.
And one generates confidence by recollecting the qualities of the Three Jewels.
Và tâm làm phát sinh niềm tin (pasāda) bằng cách hồi tưởng các đức tính của Tam Bảo.
Ayaṃ vuccati ‘‘samaye sampahaṃsanatā’’ti.
This is called “gladdening at the proper time.”
Điều này được gọi là “sự làm cho tâm hoan hỷ đúng lúc”.
Samaye ajjhupekkhanatā nāma yasmiṃ samaye sammāpaṭipattiṃ āgamma alīnaṃ anuddhataṃ anirassādaṃ ārammaṇe samappavattaṃ samathavīthipaṭipannaṃ cittaṃ hoti, tadāssa paggahaniggahasampahaṃsanesu na byāpāraṃ āpajjati sārathi viya samappavattesu.
Looking on with equanimity at the proper time means that at a time when, through right practice, the mind is not sluggish, not agitated, not joyless, is proceeding evenly towards the object, and has entered the path of serenity, then one does not engage in the effort of uplifting, restraining, or gladdening it, just like a charioteer with evenly-pacing horses.
Sự xả tâm đúng lúc là khi tâm đã đạt được sự thực hành đúng đắn, không bị chìm đắm, không bị phóng dật, không bị vô vị, vận hành đều đặn trên đối tượng, đã đi vào con đường tịnh chỉ (samatha), bấy giờ, tâm không cần phải bận tâm đến việc nâng đỡ, kìm giữ hay làm hoan hỷ, giống như người đánh xe không cần phải bận tâm đến những con ngựa đã chạy đều.
Assesu.
horses.
Đó là những con ngựa.
Ayaṃ vuccati ‘‘samaye ajjhupekkhanatā’’ti.
This is called “looking on with equanimity at the proper time.”
Điều này được gọi là “sự xả tâm đúng lúc”.
Asamāhitapuggalaparivajjanatā nāma upacāraṃ vā appanaṃ vā appattānaṃ vikkhittacittānaṃ puggalānaṃ ārakā parivajjanaṃ.
Avoiding unconcentrated persons means keeping far away from persons with scattered minds who have not attained either access or absorption concentration.
Sự tránh xa người không định tĩnh là sự tránh xa những người có tâm tán loạn, chưa đạt đến cận định (upacāra) hoặc an chỉ định (appanā).
Samāhitapuggalasevanatā nāma upacārena vā appanāya vā samāhitacittānaṃ sevanā bhajanā payirupāsanā.
Associating with concentrated persons means associating with, attending upon, and serving those whose minds are concentrated through either access or absorption.
Sự thân cận người định tĩnh là sự thân cận, giao du, phụng sự những người có tâm định tĩnh nhờ cận định hoặc an chỉ định.
Tadadhimuttatā nāma ṭhānanisajjādīsu samādhiuppādanatthaṃyeva ninnapoṇapabbhāracittatā.
Being resolved on that means, in postures of standing, sitting, and so on, having a mind that is inclined, sloped, and bent solely toward the arising of concentration.
Sự hướng tâm đến điều đó là sự có tâm hướng về, nghiêng về, thiên về việc phát sinh định (samādhi) trong các tư thế đứng, ngồi, v.v.
Evañhi paṭipajjato esa uppajjati.
For one who practises in this way, it arises.
Khi một người thực hành như vậy, định giác chi này sẽ phát sinh.
Evaṃ uppannassa panassa arahattamaggena bhāvanāpāripūrī hotīti pajānāti.
He understands that for this enlightenment-factor, once arisen, the development is brought to fulfillment by the path of arahantship.
Và khi nó đã phát sinh như vậy, người ấy biết rằng sự viên mãn của sự tu tập sẽ đạt được bằng A-la-hán đạo (arahattamagga).
Tattha dvīhākārehi sattamajjhattataṃ samuṭṭhāpeti – ‘‘tvaṃ attano kammena āgantvā attano kammena gamissasi, esopi attano kammena āgantvā attano kammena gamissati, tvaṃ kaṃ kelāyasī’’ti evaṃ kammassakatāpaccavekkhaṇena ca, ‘‘paramatthato sattoyeva natthi, so tvaṃ kaṃ kelāyasī’’ti evaṃ nissattapaccavekkhaṇena ca.
Therein, one arouses neutrality towards beings in two ways: by reflecting on the ownership of kamma thus, "You have come by your own kamma and you will go by your own kamma; this person too has come by his own kamma and will go by his own kamma. Whom are you cherishing?"; and by reflecting on non-self thus, "Ultimately, a being does not exist. So whom are you cherishing?".
Trong đó, sự xả đối với chúng sanh được phát khởi theo hai cách: bằng cách quán xét nghiệp là của riêng mình (kammassakatā) như “Ngươi đến bằng nghiệp của chính mình và sẽ đi bằng nghiệp của chính mình; người này cũng đến bằng nghiệp của chính mình và sẽ đi bằng nghiệp của chính mình; ngươi chấp thủ ai?” và bằng cách quán xét không có chúng sanh (nissatta) như “Thực ra không có chúng sanh nào cả; vậy ngươi chấp thủ ai?”
Dvīhevākārehi saṅkhāramajjhattataṃ samuṭṭhāpeti – ‘‘idaṃ cīvaraṃ anupubbena vaṇṇavikāraṃ ceva jiṇṇabhāvaṃ ca upagantvā pādapuñchanacoḷakaṃ hutvā yaṭṭhikoṭiyā chaḍḍanīyaṃ bhavissati, sace panassa sāmiko bhaveyya, nāssa evaṃ vinassituṃ dadeyyā’’ti evaṃ asāmikabhāvaṃ paccavekkhaṇena, ‘‘anaddhaniyaṃ idaṃ tāvakālika’’nti evaṃ tāvakālikatāpaccavekkhaṇena ca.
One arouses neutrality towards formations in two ways: by reflecting on their lack of a master thus, "This robe will gradually undergo a change of color and become old, and after becoming a foot-wiping cloth, it will have to be discarded with the tip of a staff. If it had a master, he would not let it be destroyed like this"; and by reflecting on its temporariness thus, "This is not long-lasting; it is only temporary".
Sự xả đối với các hành được phát khởi theo hai cách: bằng cách quán xét không có chủ sở hữu (asāmikabhāva) như “Chiếc y này dần dần sẽ thay đổi màu sắc và trở nên cũ nát, rồi trở thành một miếng giẻ lau chân và sẽ bị vứt bỏ bằng đầu gậy. Nếu nó có chủ sở hữu, người ấy sẽ không để nó hư hoại như vậy.” và bằng cách quán xét tính tạm thời (tāvakālikatā) như “Điều này không bền lâu, chỉ là tạm thời.”
Yathā ca cīvare, evaṃ pattādīsupi yojanā kātabbā.
And just as with the robe, this application should be made to the bowl and other requisites as well.
Cũng như đối với y, sự áp dụng cũng nên được thực hiện đối với bát và các vật dụng khác.
Sattasaṅkhārakelāyanapuggalaparivajjanatāti ettha yo puggalo gihi vā attano puttadhītādike, pabbajito vā attano antevāsikasamānupajjhāyakādike mamāyati, sahattheneva nesaṃ kesacchedanasūcikammacīvaradhovanarajanapattapacanādīni karoti, muhuttampi apassanto ‘‘asuko sāmaṇero kuhiṃ, asuko daharo kuhi’’nti bhantamigo viya ito cito ca āloketi, aññena kesacchedanādīnaṃ atthāya ‘‘muhuttaṃ tāva asukaṃ pesethā’’ti yācīyamānopi ‘‘amhepi taṃ attano kammaṃ na kārema, tumhe taṃ gahetvā kilamessathā’’ti na deti.
Avoiding persons who cherish beings and formations: Herein, whatever person, whether a householder who cherishes his sons, daughters, and so on, or one gone forth who cherishes his pupils, those with the same preceptor, and so on; who with his own hands performs for them tasks like cutting hair, needlework, washing and dyeing robes, firing bowls, etc.; who, not seeing them for even a moment, looks here and there like a startled deer, thinking, "Where is such-and-such a novice? Where is such-and-such a young monk?"; and who, when asked by another, "Please send such-and-such a person for a moment for the purpose of cutting hair," does not give him, saying, "We ourselves are not having him do our own work; you will take him and make him tired."
Sự tránh xa người chấp thủ chúng sanh và các hành – ở đây, người nào, dù là cư sĩ chấp thủ con cái, v.v., của mình, hay là người xuất gia chấp thủ đệ tử (antevāsika), đồng sư (samānupajjhāyaka), v.v., của mình; tự tay làm các việc như cắt tóc, may vá, giặt y, nhuộm y, nấu cơm bát, v.v., cho họ; nếu không thấy họ dù chỉ một lát, người ấy sẽ nhìn quanh đây đó như một con nai hoảng loạn, hỏi “Vị Sa-di kia ở đâu? Vị tiểu tăng kia ở đâu?”; khi được người khác yêu cầu “Xin hãy sai vị kia đến một lát để cắt tóc, v.v.”, người ấy sẽ không cho đi mà nói “Chúng tôi cũng không sai họ làm việc của mình, quý vị mà đưa họ đi thì sẽ làm họ mệt mỏi.”
Ayaṃ sattakelāyano nāma.
This person is called one who cherishes beings.
Người này được gọi là người chấp thủ chúng sanh.
Yo pana pattacīvarathālakakattarayaṭṭhiādīni mamāyati, aññassa hatthena parāmasitumpi na deti, tāvakālikaṃ yācito ‘‘mayampi idaṃ mamāyantā na paribhuñjāma, tumhākaṃ kiṃ dassāmā’’ti vadati.
But one who cherishes his bowl, robe, plate, scissors, staff, and so on, not allowing another even to touch them with his hand, and when asked for something temporarily, says, "We ourselves, though cherishing this, do not use it. What can we give to you?".
Còn người nào chấp thủ bát, y, chén, dao, gậy, v.v., không cho người khác chạm vào bằng tay; khi được yêu cầu tạm thời, người ấy nói “Chúng tôi cũng không sử dụng nó vì chấp thủ, làm sao chúng tôi có thể cho quý vị được?”
Ayaṃ saṅkhārakelāyano nāma.
This person is called one who cherishes formations.
Người này được gọi là người chấp thủ các hành.
Yo pana tesu dvīsupi vatthūsu majjhatto udāsino.
But one who is neutral and indifferent towards both these things,
Còn người nào trung lập, thờ ơ đối với cả hai đối tượng đó.
Ayaṃ sattasaṅkhāramajjhatto nāma.
is called one who is neutral towards beings and formations.
Người này được gọi là người xả đối với chúng sanh và các hành.
Iti ayaṃ upekkhāsambojjhaṅgo evarūpaṃ sattasaṅkhārakelāyanaṃ puggalaṃ ārakā parivajjantassāpi, sattasaṅkhāramajjhattapuggalaṃ sevantassāpi, ṭhānanisajjādīsu taduppādanatthaṃ ninnapoṇapabbhāracittassāpi uppajjati.
Thus, this equanimity enlightenment-factor arises for one who keeps far away from such a person who cherishes beings and formations, for one who associates with a person neutral towards beings and formations, and for one whose mind, in postures of standing, sitting, and so on, is inclined, sloped, and bent toward its arising.
Như vậy, xả giác chi này phát sinh đối với người tránh xa người chấp thủ chúng sanh và các hành như vậy, đối với người thân cận người xả đối với chúng sanh và các hành, và đối với người có tâm hướng về, nghiêng về, thiên về việc phát sinh xả giác chi trong các tư thế đứng, ngồi, v.v.
Evaṃ uppannassa panassa arahattamaggena bhāvanāpāripūrī hotīti pajānāti.
He understands that for this enlightenment-factor, once arisen, the development is brought to fulfillment by the path of arahantship.
Và khi nó đã phát sinh như vậy, người ấy biết rằng sự viên mãn của sự tu tập sẽ đạt được bằng A-la-hán đạo.
Tattha idaṃ dukkhanti yathābhūtaṃ pajānātīti ṭhapetvā taṇhaṃ tebhūmake dhamme ‘‘idaṃ dukkha’’nti yathāsabhāvato pajānāti, tasseva kho pana dukkhassa janikaṃ samuṭṭhāpikaṃ purimataṇhaṃ ‘‘ayaṃ dukkhasamudayo’’ti, ubhinnaṃ appavattiṃ nibbānaṃ ‘‘ayaṃ dukkhanirodho’’ti, dukkhaparijānanaṃ samudayapajahanaṃ nirodhasacchikaraṇaṃ ariyamaggaṃ ‘‘ayaṃ dukkhanirodhagāminī paṭipadā’’ti yathāsabhāvato pajānātīti attho.
Therein, he understands as it really is, ‘This is suffering,’ means: setting aside craving, he understands as it really is, in its true nature, that the phenomena of the three planes are ‘suffering.’ He understands as it really is, in its true nature, the pre-existing craving that generates and produces that very suffering as, ‘This is the origin of suffering.’ He understands as it really is, in its true nature, Nibbāna, which is the non-occurrence of both, as, ‘This is the cessation of suffering.’ He understands as it really is, in its true nature, the noble path—which fully understands suffering, abandons the origin, and realizes cessation—as, ‘This is the path leading to the cessation of suffering.’ This is the meaning.
Ở đây, biết như thật rằng đây là Khổ, nghĩa là: trừ bỏ ái (taṇhā), vị ấy biết như thật về các pháp thuộc ba cõi rằng “đây là Khổ”; vị ấy biết như thật về ái trước, cái phát sinh và tạo ra chính cái Khổ ấy, rằng “đây là Khổ tập (dukkhasamudaya)”; vị ấy biết như thật về Nibbāna, sự không còn phát sinh của cả hai (Khổ và Tập), rằng “đây là Khổ diệt (dukkhanirodha)”; vị ấy biết như thật về Bát Chánh Đạo (ariyamagga), con đường để liễu tri Khổ, đoạn trừ Tập và chứng ngộ Diệt, rằng “đây là Con đường đưa đến Khổ diệt (dukkhanirodhagāminī paṭipadā)”.
Avasesā ariyasaccakathā visuddhimagge vitthāritāyeva.
The remaining discussion of the Noble Truths is already explained in detail in the Visuddhimagga.
Phần còn lại của bài giảng về các Thánh đế đã được giải thích chi tiết trong Thanh Tịnh Đạo.
Ettāvatā ānāpānaṃ catuiriyāpathaṃ catusampajaññaṃ dvattiṃsākāraṃ catudhātuvavatthānaṃ navasivathikā vedanānupassanā cittānupassanā nīvaraṇapariggaho khandhapariggaho āyatanapariggaho bojjhaṅgapariggaho saccapariggahoti ekavīsati kammaṭṭhānāni vuttāni.
Thus far, twenty-one meditation subjects have been discussed: mindfulness of breathing, the four postures, the four kinds of clear comprehension, the thirty-two parts, the analysis of the four elements, the nine charnel ground contemplations, the contemplation of feeling, the contemplation of mind, the comprehension of the hindrances, the comprehension of the aggregates, the comprehension of the sense bases, the comprehension of the enlightenment factors, and the comprehension of the truths.
Với điều này, đã nói đến hai mươi mốt đề mục thiền quán: hơi thở vào ra (ānāpāna), bốn oai nghi (catuiriyāpatha), bốn sự tỉnh giác (catusampajañña), ba mươi hai thể trược (dvattiṃsākāra), quán xét Tứ đại (catudhātuvavatthāna), chín loại tử thi (navasivathikā), quán thọ (vedanānupassanā), quán tâm (cittānupassanā), quán năm triền cái (nīvaraṇapariggaho), quán năm uẩn (khandhapariggaho), quán mười hai xứ (āyatanapariggaho), quán bảy giác chi (bojjhaṅgapariggaho) và quán Tứ Thánh đế (saccapariggaho).
Tesu ānāpānaṃ dvattiṃsākāro navasivathikāti ekādasa appanākammaṭṭhānāni honti.
Among these, mindfulness of breathing, the thirty-two parts, and the nine charnel ground contemplations—these eleven are meditation subjects that lead to appanā.
Trong số đó, hơi thở vào ra, ba mươi hai thể trược và chín loại tử thi là mười một đề mục thiền định có thể đạt đến an chỉ (appanā).
Dīghabhāṇakamahāsīvatthero pana ‘‘navasivathikā ādīnavānupassanāvasena vuttā’’ti āha.
However, the Elder Mahāsīva, the reciter of the Dīgha Nikāya, said: "The nine charnel ground contemplations were taught by way of contemplation of danger."
Tuy nhiên, Trưởng lão Mahāsīva, người trì tụng Trường Bộ Kinh, nói rằng “chín loại tử thi được nói đến theo cách quán xét sự nguy hiểm (ādīnava)”.
Tasmā tassa matena dveyeva appanākammaṭṭhānāni, sesāni upacārakammaṭṭhānāni.
Therefore, according to his view, there are only two meditation subjects that lead to appanā; the rest are meditation subjects that lead to upacāra.
Do đó, theo quan điểm của ngài, chỉ có hai đề mục thiền định có thể đạt đến an chỉ, còn lại là các đề mục thiền cận định (upacāra).
Kiṃ panetesu sabbesu abhiniveso jāyatīti?
But does absorption arise in all of these?
Có phải sự chú tâm (abhinivesa) phát sinh trong tất cả các đề mục này không?
Na jāyati.
It does not arise.
Không phát sinh.
Iriyāpathasampajaññanīvaraṇabojjhaṅgesu hi abhiniveso na jāyati, sesesu jāyatīti.
Indeed, absorption does not arise in the postures, clear comprehension, the hindrances, and the enlightenment factors; in the rest, it does arise.
Thật vậy, sự chú tâm không phát sinh trong oai nghi, tỉnh giác, triền cái và giác chi, nhưng phát sinh trong các đề mục còn lại.
Mahāsīvatthero panāha – ‘‘etesupi abhiniveso jāyati, ayañhi atthi nu kho me cattāro iriyāpathā, udāhu natthi, atthi nu kho me catusampajaññaṃ, udāhu natthi, atthi nu kho me pañcanīvaraṇā, udāhu natthi, atthi nu kho me sattabojjhaṅgā, udāhu natthīti evaṃ pariggaṇhāti, tasmā sabbattha abhiniveso jāyatī’’ti.
But the Elder Mahāsīva said: "Absorption arises in these too. For one comprehends thus: ‘Are the four postures present in me, or are they not? Is the fourfold clear comprehension present in me, or is it not? Are the five hindrances present in me, or are they not? Are the seven enlightenment factors present in me, or are they not?’ Therefore, absorption arises in all."
Tuy nhiên, Trưởng lão Mahāsīva nói: “Sự chú tâm cũng phát sinh trong những điều này, bởi vì vị ấy quán xét như vậy: 'Ta có bốn oai nghi không? Hay không có? Ta có bốn sự tỉnh giác không? Hay không có? Ta có năm triền cái không? Hay không có? Ta có bảy giác chi không? Hay không có?' Do đó, sự chú tâm phát sinh trong tất cả.”
137. Yo hi koci, bhikkhaveti yo hi koci bhikkhu vā bhikkhunī vā upāsako vā upāsikā vā.
137. Whoever, monks... means: any monk or nun, male lay follower or female lay follower.
137. Này các Tỳ-khưu, bất cứ ai nghĩa là: bất cứ Tỳ-khưu, Tỳ-khưu-ni, cư sĩ nam hay cư sĩ nữ nào.
Evaṃ bhāveyyāti ādito paṭṭhāya vuttena bhāvanānukkamena bhāveyya.
Should develop it thus means: one should develop it according to the sequence of development taught from the beginning.
Nếu tu tập như vậy nghĩa là: tu tập theo trình tự tu tập đã nói từ ban đầu.
Pāṭikaṅkhanti paṭikaṅkhitabbaṃ, avassaṃ bhāvīti attho.
Is to be expected means: it is to be desired; the meaning is that it is certain to happen.
Có thể mong đợi nghĩa là: điều có thể mong đợi, chắc chắn sẽ xảy ra.
Aññāti arahattaṃ.
Final knowledge means: Arahantship.
Trí tuệ tối thượng (aññā) nghĩa là: A-la-hán quả.
Sati vā upādiseseti upādānasese vā sati aparikkhīṇe.
Or if there is a remainder of clinging means: or if there is a remainder of the aggregates of clinging that has not been completely destroyed.
Hoặc nếu còn dư y (upādisese) nghĩa là: nếu còn dư y thủ (upādānasesa), chưa đoạn tận.
Anāgāmitāti anāgāmibhāvo.
The state of non-returning means: the state of being a non-returner.
Bất hoàn (anāgāmitā) nghĩa là: trạng thái của bậc Bất hoàn.
Evaṃ sattannaṃ vassānaṃ vasena sāsanassa niyyānikabhāvaṃ dassetvā puna tato appatarepi kāle dassento ‘‘tiṭṭhantu, bhikkhave’’tiādimāha.
Thus, having shown the liberating nature of the teaching by way of seven years, he then said, "Let be, monks..." and so on, to show it in an even shorter time.
Sau khi trình bày tính chất dẫn đến giải thoát của Giáo pháp theo cách bảy năm như vậy, Đức Thế Tôn lại nói “Này các Tỳ-khưu, hãy ở lại…” để trình bày về thời gian ngắn hơn nữa.
Sabbampi cetaṃ majjhimasseva neyyapuggalassa vasena vuttaṃ.
All of this was said with reference to a person of average capacity to be trained.
Tất cả những điều này được nói đến dựa trên hạng người trung bình có khả năng được giáo hóa.
Tikkhapaññaṃ pana sandhāya – ‘‘pāto anusiṭṭho sāyaṃ visesaṃ adhigamissati, sāyaṃ anusiṭṭho pāto visesaṃ adhigamissatī’’ti (ma. ni. 2.345) vuttaṃ.
But with reference to a person of keen wisdom, it is said: "If instructed in the morning, he will attain distinction in the evening; if instructed in the evening, he will attain distinction in the morning."
Đối với người có trí tuệ sắc bén, đã nói rằng: “Nếu được giáo huấn vào buổi sáng, vị ấy sẽ đạt được sự đặc biệt vào buổi tối; nếu được giáo huấn vào buổi tối, vị ấy sẽ đạt được sự đặc biệt vào buổi sáng” (M.ii.345).