137. Uruvelāya samīpe gāmo uruvelagāmo, taṃ uruvelagāmaṃ abhimukhabhāvena sammadeva sabbadhamme bujjhatīti abhisambodhi, sabbaññutaññāṇaṃ, tena samannāgatattā ca bhagavā abhisambuddhoti vuccati.
137. A village near Uruvelā is Uruvelagāma. Uruvelagāma refers to the village where, by facing it, one perfectly understands all phenomena; this is perfect enlightenment (abhisambodhi), omniscience (sabbaññutaññāṇa). Because the Blessed One was endowed with this, he is called Abhisambuddha.
137. Ngôi làng gần Uruvelā là làng Uruvelā, và Đức Thế Tôn được gọi là Abhisambuddho vì Ngài đã trực tiếp giác ngộ tất cả các pháp một cách hoàn hảo, tức là có đầy đủ Trí Toàn Giác.
Tassa pañcacattālīsāya vassesu ādito pannarasa vassāni paṭhamabodhi, idha pana sattāhabbhantarameva adhippetanti āha ‘‘abhisambuddho hutvā antosattāhasmiṃ yevā’’ti.
Of his forty-five years, the first fifteen years were the initial enlightenment. Here, however, only the period within seven days is intended, thus it is said: "having become perfectly enlightened, within seven days."
Trong bốn mươi lăm năm của Ngài, mười lăm năm đầu tiên là thời kỳ giác ngộ sơ khởi; nhưng ở đây, chỉ đề cập đến trong vòng bảy ngày, vì vậy nói ‘‘abhisambuddho hutvā antosattāhasmiṃ yevā’’ (đã giác ngộ trong vòng bảy ngày).
Asukhabhāvena aññehi kātuṃ asakkuṇeyyattā dukkaraṃ karotīti dukkarakāro, so eva itthiliṅgavasena dukkarakārikā.
Because it is difficult for others to perform due to its unpleasant nature, one who performs a difficult deed is a dukkarakāra. That same (deed), in the feminine gender, is dukkarakārikā.
Dukkarakārikā là người thực hành những việc khó khăn, vì chúng khó thực hiện đối với người khác do tính chất đau khổ của chúng; từ này ở dạng giống cái.
Tāya mutto vatamhīti cintesi.
He thought: "I am freed from that."
Ngài đã nghĩ rằng: “Tôi đã thoát khỏi điều đó.”
Yadi evaṃ kasmā taṃ lokanātho chabbassāni samanuyuñjati?
If so, why did the Lord of the world pursue it for six years?
Nếu vậy, tại sao Đức Thế Tôn lại thực hành điều đó trong sáu năm?
Kammapīḷitavasena.
Due to being afflicted by kamma.
Do bị nghiệp lực thúc đẩy.
Vuttañhetaṃ apadāne (apa. thera 1.39.92-94) –
This is stated in the Apadāna:
Điều này đã được nói trong Apadāna (Apa. Thera 1.39.92-94) –
Māretīti vibādheti.
Māreti means hinders.
Māretī có nghĩa là quấy rối.
Vipattiādisaṃyojanañhi sādhūnaṃ paramatthato maraṇaṃ saccapaṭivedhamāraṇattā, pāpatarattā pāpatamoti pāpimā.
Indeed, the fetter of misfortune, etc., is for noble ones, in the ultimate sense, death, because it causes the death of the penetration of truth; being more evil, he is Pāpimā.
Sự ràng buộc của tai họa v.v… đối với những người thiện là cái chết theo nghĩa tối hậu, vì nó ngăn cản sự thấu hiểu chân lý; Pāpimā là kẻ ác nhất vì nó là điều ác nhất.
Sā cassa pāpatamatā pāpavuttitāyāti āha ‘‘pāpe niyutto’’ti.
And his being most evil is due to his evil conduct, thus it is said: "engaged in evil."
Và sự ác nhất của nó là do hành vi ác, vì vậy nói ‘‘pāpe niyutto’’ (bị sai khiến bởi điều ác).
Adhipatīti kāmādhipati.
Adhipati means lord of sensual pleasures.
Adhipatī có nghĩa là chúa tể của dục vọng v.v…
Appahīnakāmarāge attano vase vattetīti vasavattī.
He keeps those whose sensual craving is not abandoned under his sway, thus he is Vasavattī.
Vasavattī có nghĩa là kẻ điều khiển những người chưa đoạn trừ dục lạc theo ý mình.
Tesaṃyeva kusalakammānaṃ antaṃ karotīti antako.
He puts an end to those wholesome kammas, thus he is Antaka.
Antako có nghĩa là kẻ kết thúc những nghiệp thiện đó.
Vaṭṭadukkhato aparimuttapaccayattā namuci.
Because he is a condition for not being freed from the suffering of the cycle of existence, he is Namuci.
Namuci có nghĩa là kẻ không thoát khỏi khổ luân hồi.
Mattānaṃ pamattānaṃ bandhūti pamattabandhu.
The kinsman of the intoxicated, the heedless, is Pamattabandhu.
Pamattabandhu có nghĩa là bạn của những kẻ phóng dật.
Tapokammāti attakilamathānuyogato.
Tapokammā means from self-mortification.
Tapokammā có nghĩa là do sự khổ hạnh tự hành hạ.
Aparaddhoti virajjhasi.
Aparaddho means you err.
Aparaddho có nghĩa là ngươi đã sai lầm.
‘‘Aparādho’’tipi atthi, soyeva attho.
"Aparādho" also exists, and it has the same meaning.
Cũng có từ ‘‘aparādho’’, có cùng nghĩa.
Kāyakilamathaṃ anuyuñjanto yebhuyyena amaratthāya anuyuñjati, so ca kammavādīhi anuyuñjiyamāno devatthāya siyāti āha ‘‘amarabhāvatthāyā’’ti.
One who practices bodily mortification generally practices for immortality, and when practiced by those who believe in kamma, it might be for the state of a deva, thus it is said: "for the state of immortality."
Người thực hành khổ hạnh thân thường là để đạt được sự bất tử, và nếu được những người theo thuyết nghiệp thực hành, thì có thể là để đạt được địa vị chư thiên, vì vậy nói ‘‘amarabhāvatthāyā’’.
Sabbaṃ tapanti sabbaṃ attaparitāpanaṃ.
Sabbaṃ tapaṃ means all self-torment.
Sabbaṃ tapaṃ có nghĩa là tất cả sự tự hành hạ.
Atthāvahaṃ na bhavati bodhiyā anupāyattā.
Atthāvahaṃ na bhavati because it is not a means to enlightenment.
Atthāvahaṃ na bhavati có nghĩa là không mang lại lợi ích vì đó không phải là phương tiện dẫn đến giác ngộ.
Kiñcassāti kiñci siyāti attho.
Kiñcassā means what might it be?
Kiñcassā có nghĩa là có thể có một cái gì đó.
Phiyārittaṃva dhammanīti dhammaṃ vuccati vaṇṇu, so idha ‘‘dhamma’’nti vutto, dhammani vaṇṇupadeseti attho.
Phiyārittaṃva dhammanī means dhamma is said to be a vein, which is here called "dhamma," meaning a teaching on veins.
Phiyārittaṃva dhammanī có nghĩa là dhamma được gọi là vaṇṇu (lạch nước), ở đây được gọi là ‘‘dhamma’’; có nghĩa là chỉ dẫn về lạch nước.
Tenāha ‘‘araññe’’ti.
Therefore, it is said "in the forest."
Vì vậy nói ‘‘araññe’’ (trong rừng).
Ubhosu passesu phiyāhi ākaḍḍheyya ceva arittehi uppīḷeyya ca.
With wedges on both sides, one might both pull and squeeze with sticks.
Kéo bằng phiyā (mái chèo) ở cả hai bên và ép bằng aritta (bánh lái).
Sammāvācākammantājīvā gahitā maggasīlassa adhippetattā.
Right speech, action, and livelihood are included because the morality of the path is intended.
Sammāvācākammantājīvā gahitā có nghĩa là chánh ngữ, chánh nghiệp, chánh mạng được bao gồm vì chúng là một phần của giới trong Đạo.
Samādhino hi gahaṇena sammāvāyāmasatisamādhayo gahitā upakārabhāvato.
By the inclusion of concentration, right effort, mindfulness, and concentration are included due to their supportive nature.
Khi định được bao gồm, sammāvāyāmasatisamādhayo gahitā (chánh tinh tấn, chánh niệm, chánh định được bao gồm) vì chúng là những yếu tố hỗ trợ.
Paññāyāti etthāpi eseva nayo.
The same principle applies to wisdom.
Đối với Paññā, cũng theo cách tương tự.
Bujjhati etenāti bodho.
That by which one awakens is bodha.
Bodho là cái mà nhờ đó người ta giác ngộ.
Maggoti āha ‘‘bodhāyāti maggatthāyā’’ti.
It is the path, thus it is said: "bodhāya means for the path."
Nói là con đường, vì vậy nói ‘‘bodhāyāti maggatthāyā’’ (để giác ngộ, tức là để đạt được con đường).
Kathaṃ pana maggaṃ maggatthāya bhāvetīti āha ‘‘yathā hī’’tiādi.
How then does one cultivate the path for the path? It is said: "just as," etc.
Làm thế nào để tu tập con đường vì con đường? Vì vậy nói ‘‘yathā hī’’ v.v…
Tena yathā yāgupacanārambho yāvadeva yāguattho, evaṃ maggabhāvanārambho maggādhigamatthāyāti dasseti.
Thereby it shows that just as the undertaking of preparing gruel is solely for the purpose of gruel, so too the undertaking of cultivating the path is for the attainment of the path.
Theo cách này, giống như sự khởi đầu của việc nấu cháo chỉ là vì mục đích cháo, thì sự khởi đầu của việc tu tập con đường là vì mục đích đạt được con đường.
Ārambhoti ca ariyamaggabhāvanāya bandhāpanaṃ daṭṭhabbaṃ.
And "undertaking" should be understood as the commitment to cultivating the noble path.
Và ‘‘khởi đầu’’ nên được hiểu là sự thiết lập việc tu tập Thánh Đạo.
Keci pana ‘‘magganti ariyamaggaṃ, bodhāyāti arahattasambodhāya, evañca katvā ‘pattosmi paramasuddhi’nti idampi vacanaṃ samatthita’’nti vadanti, apare pana ‘‘sabbaññutaññāṇasambodhāyāti.
Some say: "Maggaṃ means the noble path, bodhāya means for the perfect enlightenment of Arahantship, and having done so, this statement 'I have attained supreme purity' is also substantiated." Others say: "for the perfect enlightenment of omniscience.
Một số người nói rằng ‘‘magganti’’ là Thánh Đạo, ‘‘bodhāyāti’’ là để đạt được A-la-hán Chánh Đẳng Giác, và như vậy, lời nói ‘‘pattosmi paramasuddhi’’ (tôi đã đạt được sự thanh tịnh tối thượng) cũng được hỗ trợ. Những người khác nói ‘‘sabbaññutaññāṇasambodhāyāti’’ (để đạt được Chánh Đẳng Giác của Trí Toàn Giác).
So hi sabbasmāpi bodhito uttaritaro’’ti.
For that is superior to all other enlightenments."
Vì đó là giác ngộ cao nhất trong tất cả các giác ngộ.
Nihato nibbisevanabhāvaṃ pāpito.
Nihato means brought to a state of being unpracticed.
Nihato có nghĩa là đã đạt đến trạng thái không còn chấp thủ.
Tenāha ‘‘parājito’’ti.
Therefore, it is said: "defeated."
Vì vậy nói ‘‘parājito’’ (đã bị đánh bại).
138. Andhabhāvakāraketi pacurajanassa cakkhuviññāṇuppattinivāraṇena andhabhāvakārake.
138. Andhabhāvakārake means causing blindness by preventing the arising of eye-consciousness in many people.
138. Andhabhāvakārake có nghĩa là gây ra sự mù lòa bằng cách ngăn chặn sự phát sinh của nhãn thức ở nhiều người.
Mahātameti mahati tamasi.
Mahātame means in great darkness.
Mahātame có nghĩa là trong bóng tối lớn.
Pāsāṇaphalake mahācīvaraṃ sīse ṭhapetvāti etena taṃ phalakaṃ apassāya nisinnoti dasseti.
Pāsāṇaphalake mahācīvaraṃ sīse ṭhapetvā means by this it shows that he was seated leaning against that stone slab.
Pāsāṇaphalake mahācīvaraṃ sīse ṭhapetvā có nghĩa là ngồi tựa vào tảng đá đó, đặt đại y trên đầu.
Padhānanti bhāvanaṃ.
Padhānaṃ means exertion.
Padhānaṃ có nghĩa là tu tập.
Pariggaṇhamānoti sabbaso gaṇhanto avissajjento, bhāvanaṃ anuyuñjanto anupubbasamāpattiyo phalasamāpattiñca manasikarontoti attho.
Pariggaṇhamāno means grasping completely, not letting go; engaging in development, meaning attending to the successive attainments and the attainment of fruition.
Pariggaṇhamāno có nghĩa là nắm giữ hoàn toàn không buông bỏ, tức là thực hành thiền định, quán tưởng các tầng thiền liên tiếp và quả thiền.
Tenāha ‘‘nanu cā’’tiādi.
Therefore, he said, beginning with “is it not so?”.
Vì vậy nói ‘‘nanu cā’’ v.v…
Ariṭṭhakoti ariṭṭhakavaṇṇo.
Ariṭṭhaka means of the color of ariṭṭhaka.
Ariṭṭhako có nghĩa là màu của cây ariṭṭhaka.
Tenāha ‘‘kāḷako’’ti.
Therefore, he said, "black."
Do đó nói ‘‘đen’’.
Dīghamaddhānanti cirataraṃ kālaṃ.
Dīghamaddhānaṃ means for a very long time.
Dīghamaddhāna có nghĩa là một thời gian rất dài.
Saṃsaranti āsādanādhippāyena sañcaranto, alaṃ tuyhaṃ etena nippayojananti adhippāyo.
Saṃsarati means roaming with the intention of delighting; the intention is, "this is useless for you, enough of it."
Saṃsara có nghĩa là đi lại với ý định làm hại; ý là: điều vô ích này đủ rồi cho ngươi.
Na hi tena mārassa kāci atthasiddhīti.
For by that, there is no accomplishment of any purpose for Māra.
Bởi vì từ điều đó không có bất kỳ thành tựu lợi ích nào cho Māra.
139. Susaṃvutāti maggasaṃvarena suṭṭhu saṃvutā.
139. Susaṃvutā means perfectly restrained by the restraint of the path.
139. Susaṃvutā có nghĩa là được phòng hộ kỹ lưỡng bằng sự phòng hộ của đạo lộ.
Supihitāti suṭṭhu pihitā.
Supihitā means perfectly closed.
Supihitā có nghĩa là được đóng kín kỹ lưỡng.
Vasānugāti kāyādidvāravasānugā vasavattino na honti.
Vasānugā means that they are not subject to the power of the doors of body, etc., they are not masters.
Vasānugā có nghĩa là không tùy thuộc vào sự chi phối của các căn môn như thân, v.v…; không bị chi phối.
Baddhacarāti paṭibaddhacariyāti.
Baddhacarā means restrained conduct.
Baddhacarā có nghĩa là hành vi bị trói buộc.
140. Upāyamanasikārenāti aniccādīsu aniccādito manasikaraṇena.
140. Upāyamanasikārena means by attending to impermanence, etc., as impermanence, etc.
140. Upāyamanasikārena có nghĩa là tác ý về vô thường, v.v… theo cách vô thường, v.v…
Upāyavīriyenāti anuppannākusalānaṃ anuppādanāya vidhinā pavattavīriyena.
Upāyavīriyena means by effort that proceeds correctly for the non-arising of unarisen unwholesome states.
Upāyavīriyena có nghĩa là tinh tấn được thực hành đúng cách để không làm phát sinh các điều bất thiện chưa phát sinh.
Kāraṇavīriyenāti anuppannānuppādanādiatthassa kāraṇabhūtena vīriyena.
Kāraṇavīriyena means by effort that is the cause of the non-arising of unarisen states, etc.
Kāraṇavīriyena có nghĩa là tinh tấn là nguyên nhân của mục đích không làm phát sinh điều chưa phát sinh, v.v…
Anuppannapāpakānuppādanādiatthāni hi vīriyāni yadatthaṃ honti, taṃ atthaṃ sādhentiyevāti etassa atthassa dīpako sammā-saddo.
For the efforts that are for the purpose of preventing unarisen evil deeds, etc., indeed accomplish that purpose, and the word sammā indicates this meaning.
Bởi vì các sự tinh tấn có mục đích là không làm phát sinh các điều ác chưa phát sinh, v.v…, thì chúng sẽ thành tựu mục đích đó; từ sammā là để chỉ rõ ý nghĩa này.
Yonisosammāsaddena hi upāyakāraṇatthadīpakataṃ sandhāya ‘‘upāyavīriyena kāraṇavīriyenā’’ti vuttaṃ.
For the statement "by effort of means, by causal effort" was made with reference to the correct understanding of means and causes by the word yonisomā.
Bởi vì từ yonisosammā (chánh tư duy đúng đắn) đã được nói đến để chỉ rõ ý nghĩa của phương tiện và nguyên nhân, nên đã nói ‘‘upāyavīriyena kāraṇavīriyena’’ (bằng tinh tấn phương tiện, bằng tinh tấn nguyên nhân).
Arahattaphalavimutti ukkaṭṭhaniddesena.
Arahattaphalavimutti is a superior designation.
Arahattaphalavimutti là sự giải thoát quả A-la-hán, theo cách chỉ định cao nhất.
Mārena ‘‘mayhaṃ kho, bhikkhave’’tiādikaṃ bhagavato vacanaṃ sutvā vuttaṃ ‘‘arahattaṃ patvāpi na tussatī’’tiādi.
Māra, having heard the Blessed One's words, "Indeed, bhikkhus, mine," etc., said, "Even having attained Arahantship, he is not content," etc.
Sau khi nghe lời dạy của Đức Thế Tôn, bắt đầu bằng ‘‘Này các Tỳ-khưu, của ta’’, Māra đã nói ‘‘dù đã đạt A-la-hán cũng không thỏa mãn’’, v.v…
Kilesapāsenāti kilesamārassa upāyabhūtena.
Kilesapāsena means by the means of the defilement-Māra.
Kilesapāsenā có nghĩa là phương tiện của Māra phiền não.
Kilesamāro hi satte kāmaguṇapāsehi nibandhati, na pana sayameva.
For the defilement-Māra binds beings with the snares of sensual pleasures, but not by itself.
Bởi vì Māra phiền não trói buộc chúng sinh bằng các lưới dục lạc, chứ không phải tự thân.
Tenāha ‘‘ye dibbā kāmaguṇasaṅkhātā’’tiādi.
Therefore, it says, "those called divine sensual pleasures," etc.
Do đó nói ‘‘ye dibbā kāmaguṇasaṅkhātā’’ (những dục lạc cõi trời), v.v…
Mārabandhaneti kilesamārassa bandhanaṭṭhāne, bhavacāraketi attho.
Mārabandhane means in the binding place of the defilement-Māra, which is to say, in the prison of existence.
Mārabandhane có nghĩa là nơi trói buộc của Māra phiền não, tức là ngục tù của các cõi hữu.
Na me samaṇa mokkhasīti idaṃ māro ‘‘anuttarā vimutti anuppattā, vimuttā sabbapāsehī’’ti ca bhagavato vacanaṃ asaddahanto vadati saddahantopi vā ‘‘evamayaṃ paresaṃ sattānaṃ mokkhāya ussāhaṃ na kareyyā’’ti attano kohaññe ṭhatvā vadati.
"You are not free, ascetic," this Māra says, disbelieving the Blessed One's words, "unsurpassed liberation has been attained, free from all evils," or, even if he believes, he says it standing in his own wickedness, thinking, "may he not strive for the liberation of other beings in this way."
Na me samaṇa mokkhasī (Này Sa-môn, ngươi sẽ không thoát khỏi ta) – điều này Māra nói vì không tin lời Đức Thế Tôn ‘‘sự giải thoát vô thượng đã được đạt đến, đã giải thoát khỏi mọi điều ác’’, hoặc dù có tin nhưng lại đứng trên lập trường lừa dối của mình mà nói ‘‘người này sẽ không nỗ lực vì sự giải thoát của các chúng sinh khác’’.
Ādimhi kalyāṇaṃ etassāti ādikalyāṇaṃ, tathā sesesu.
That which is good at the beginning is ādikalyāṇaṃ (good in the beginning), and similarly in the rest.
Điều có sự tốt đẹp ở phần đầu được gọi là ādikalyāṇaṃ (tốt đẹp ở phần đầu), và tương tự với các phần còn lại.
Sāsanassa ādi sīlaṃ mūlakattā.
The beginning of the Dispensation is sīla because it is the root.
Giới là phần đầu của giáo pháp vì nó là gốc rễ.
Tassa samathādayo majjhaṃ sāsanasampattiyā vemajjhabhāvato.
Samatha, etc., are its middle due to being the intermediate state of the Dispensation's accomplishments.
Chỉ và các pháp khác là phần giữa của nó, vì chúng ở vị trí trung gian trong sự thành tựu giáo pháp.
Phalanibbānāni pariyosānaṃ tadadhigamato uttari karaṇīyābhāvato.
The fruits and Nibbāna are its end because, after their attainment, there is nothing further to be done.
Quả và Nibbāna là phần cuối vì sau khi đạt được chúng thì không còn việc gì phải làm thêm.
Sāsane sammāpaṭipatti nāma paññāya hoti, tassā ca sīlaṃ samādhi ca mūlanti āha ‘‘sīlasamādhayo vā ādī’’ti.
Right practice in the Dispensation occurs through wisdom, and sīla and samādhi are its roots, thus it says, "or sīla and samādhi are the beginning."
Sự thực hành đúng đắn trong giáo pháp là do tuệ, và giới cùng định là gốc rễ của tuệ, do đó nói ‘‘sīlasamādhayo vā ādī’’ (hoặc giới và định là phần đầu).
Yasmā paññā anubodhapaṭivedhavasena duvidhā, tasmā tadubhayaṃ gaṇhanto ‘‘vipassanāmaggā majjha’’nti āha.
Since wisdom is twofold, by way of realization and penetration, it says, "or insight and the paths are the middle," encompassing both.
Vì tuệ có hai loại theo cách giác ngộ và thấu triệt, nên bao gồm cả hai, nói ‘‘vipassanāmaggā majjha’’ (các đạo lộ thiền quán là phần giữa).
Paññānipphatti phalakiccaṃ, nibbānasacchikiriyā pana sammāpaṭipattiyā pariyosānaṃ tato paraṃ kattabbābhāvatoti āha ‘‘phalanibbānāni pariyosāna’’nti.
The completion of wisdom is the function of the fruits, and the realization of Nibbāna is the end of right practice because there is nothing further to be done after that, thus it says, "the fruits and Nibbāna are the end."
Sự thành tựu tuệ là công việc của quả, còn sự chứng đắc Nibbāna là phần cuối của sự thực hành đúng đắn vì không còn gì phải làm sau đó, do đó nói ‘‘phalanibbānāni pariyosāna’’ (quả và Nibbāna là phần cuối).
Phalaggahaṇena hi saupādisesanibbānaṃ gayhati, itarena itaraṃ, tadubhayavasena paṭipattiyā osānanti āha ‘‘phalanibbānāni pariyosāna’’nti.
By "fruits," saupādisesa-nibbāna is taken; by the other, anupādisesa-nibbāna; and in terms of both, the practice ends, thus it says, "the fruits and Nibbāna are the end."
Bởi vì việc nắm giữ quả bao gồm Nibbāna hữu dư y, còn cái kia là Nibbāna vô dư y, và theo hai cách đó, sự thực hành đạt đến kết thúc, do đó nói ‘‘phalanibbānāni pariyosāna’’ (quả và Nibbāna là phần cuối).
‘‘Tasmātiha tvaṃ, bhikkhu, ādimeva visodhehi kusalesu dhammesu.
"Therefore, bhikkhu, purify the beginning in wholesome states.
Theo lời dạy ‘‘Do đó, này Tỳ-khưu, hãy thanh tịnh hóa phần đầu trong các thiện pháp.
Ko cādi kusalānaṃ dhammānaṃ?
And what is the beginning of wholesome states?
Và phần đầu của các thiện pháp là gì?
Sīlañca suvisuddhaṃ, diṭṭhi ca ujukā’’ti (saṃ. ni. 5.369) vacanato sīladiṭṭhujukatāya matthakabhūtā vipassanā, tadadhiṭṭhānā sīlasamādhīti ime tassa sāsanassa mūlanti āha ‘‘sīlasamādhivipassanā vā ādī’’ti.
Perfectly purified sīla and rectified view" — according to this statement, insight, which is the culmination of rectified sīla and view, and sīla and samādhi, which are its foundation — these are the root of that Dispensation, thus it says, "or sīla, samādhi, and insight are the beginning."
Đó là giới thanh tịnh và chánh kiến ngay thẳng’’ (Saṃ. Ni. 5.369), thiền quán là đỉnh cao của sự thanh tịnh giới và chánh kiến, và giới cùng định là nền tảng của nó, do đó nói ‘‘sīlasamādhivipassanā vā ādī’’ (hoặc giới, định và thiền quán là phần đầu).
Sesaṃ vuttanayameva.
The rest is as already stated.
Các phần còn lại cũng theo cách đã nói.
Kiñcāpi avayavavinimutto samudāyo natthi, yesu pana avayavesu samudāyarūpena apekkhitesu gāthāti samaññā, taṃ tato bhinnaṃ viya katvā dassento ‘‘catuppadikagāthāya tāva paṭhamapādo’’tiādimāha.
Although there is no whole distinct from its parts, yet where a designation "stanza" exists for parts considered as a whole, it says, "the first foot of a four-footed stanza," etc., as if distinguishing it from that.
Mặc dù không có một tập hợp tách rời khỏi các thành phần, nhưng khi các thành phần được xem xét như một tập hợp và được gọi là kệ, thì để chỉ rõ nó khác biệt như vậy, đã nói ‘‘catuppadikagāthāya tāva paṭhamapādo’’ (trước hết, câu thứ nhất của một bài kệ bốn câu), v.v…
Pañcapadachappadānaṃ gāthānaṃ ādipariyosānaggahaṇena itare dutiyādayo tayo cattāro vā majjhanti avuttasiddhamevāti na vuttaṃ.
The others — the second, third, or fourth — are the middle, this is already understood without being stated, when the beginning and end of stanzas with five or six feet are taken, thus it is not stated.
Đối với các bài kệ năm câu, sáu câu, việc nắm giữ phần đầu và phần cuối đã ngụ ý rằng ba hoặc bốn câu còn lại là phần giữa, nên không cần nói thêm.
Ekānusandhikasuttassāti idaṃ bahuvibhāgaṃ yathānusandhinā ekānusandhikaṃ suttaṃ sandhāya vuttaṃ, itarassa pana teyeva desetabbadhammavibhāgena ādimajjhapariyosānabhāgā labbhanti.
Ekānusandhikassa Suttassa refers to a discourse that is one coherent whole in its sequence, even if it has many divisions; for the other, these same divisions of the Dhamma to be taught are obtained as beginning, middle, and end parts.
Ekānusandhikasuttassā (của kinh có một mạch lạc) – điều này được nói đến để chỉ kinh có nhiều phần nhưng có một mạch lạc theo sự liên kết; còn đối với kinh khác, các phần đầu, giữa, cuối được tìm thấy theo sự phân chia các pháp cần được thuyết giảng.
Nidānanti kāladesakaparisādi-apadisanalakkhaṇādiko attho.
Nidāna refers to the meaning characterized by the designation of time, place, assembly, etc.
Nidāna có nghĩa là bối cảnh, như thời gian, địa điểm, hội chúng, và các đặc điểm chỉ định khác.
Idamavocāti iti-saddo ādiattho.
Idamavoca means the word iti has the sense of beginning.
Idamavocā (điều này đã được nói) – từ iti có nghĩa là bắt đầu.
Tena tadavasesanigamanapāḷiṃ saṅgaṇhāti.
By that, it includes the remaining concluding text.
Với từ đó, nó bao gồm phần kết luận còn lại.
Anekānusandhīkassa saha nidānena paṭhamo anusandhi ādi.
For a discourse with multiple coherent parts, the first part, including the introduction, is the beginning.
Đối với kinh Anekānusandhīkassa (có nhiều mạch lạc), mạch lạc đầu tiên cùng với phần dẫn nhập là phần đầu.
Saha nigamanena pacchimo pariyosānaṃ, itarena majjhimantiādimajjhapariyosānāni veditabbāni.
The last part, including the conclusion, is the end; the rest are the middle — thus the beginning, middle, and end should be understood.
Mạch lạc cuối cùng cùng với phần kết luận là phần cuối, và các phần còn lại là phần giữa; như vậy, các phần đầu, giữa, cuối cần được hiểu.
Sātthakanti atthasampattiyā sātthakaṃ katvā.
Sātthakaṃ means made meaningful by the excellence of meaning.
Sātthaka có nghĩa là làm cho có ý nghĩa bằng sự đầy đủ về ý nghĩa.
Sabyañjananti byañjanasampattiyā sabyañjanaṃ.
Sabyañjanaṃ means with excellence of expression, with complete expression.
Sabyañjana có nghĩa là có văn tự đầy đủ bằng sự đầy đủ về văn tự.
Sampatti ca nāma paripuṇṇabyañjanatāti āha ‘‘byañjanehi…pe… desetā’’ti.
Excellence means completeness of expression, thus it says, "by expressions... etc. ... taught."
Và sự đầy đủ có nghĩa là sự đầy đủ về văn tự, do đó nói ‘‘byañjanehi…pe… desetā’’ (bằng văn tự… v.v… được thuyết giảng).
Sakalaparipuṇṇanti sabbaso paripuṇṇaṃ sīlādipañcadhammakkhandhapāripūriyā.
Sakalaparipuṇṇaṃ means entirely complete, through the perfection of the five aggregates of sīla, etc.
Sakalaparipuṇṇa có nghĩa là hoàn toàn đầy đủ, bằng sự đầy đủ của năm uẩn pháp như giới, v.v…
Nirupakkilesaṃ diṭṭhimānādiupakkilesābhāvato.
Nirupakkilesaṃ means without defilements like wrong view and conceit.
Nirupakkilesaṃ có nghĩa là không có các phiền não phụ như tà kiến, ngã mạn, v.v…
Avisesato tisso sikkhā sakale sāsane bhavanti.
Without distinction, the three trainings are present in the entire Dispensation.
Ba học pháp tồn tại trong toàn bộ giáo pháp một cách không phân biệt.
Dhammoti pana brahmacariyaṃ vā sandhāya vuttaṃ ‘‘katamesānaṃ kho, bhante, buddhānaṃ bhagavantānaṃ brahmacariyaṃ ciraṭṭhitikaṃ ahosī’’tiādīsu (pārā. 18) viya.
Dhamma is said with reference to the holy life, as in "Of which Buddhas, Blessed Ones, bhante, was the holy life long-lasting?" etc.
Dhammo (Pháp) được nói đến để chỉ Phạm hạnh, như trong ‘‘Bạch Thế Tôn, Phạm hạnh của các Đức Phật Thế Tôn nào đã tồn tại lâu dài?’’ (Pārā. 18), v.v…
Dukūlasāṇiyā paṭicchannā viya, na tu pākāraselādipaṭicchannā viya.
As if covered by a fine cloth, not as if covered by a wall or a mountain.
Như được che phủ bằng vải lụa mỏng (dukūlasāṇiyā paṭicchannā viya), chứ không phải như được che phủ bằng tường thành, núi đá, v.v…
Tena dhammaniruttiyā sakalakilesānaṃ pahānānubhāvaṃ vadati.
By that, it speaks of the power of abandoning all defilements through the verbal expression of the Dhamma.
Với điều đó, nó nói lên năng lực đoạn trừ mọi phiền não của Pháp ngữ.
Alābhaparihāniyā, na laddhaparihāniyā.
Alābhaparihāniyā means by the loss of non-acquisition, not by the loss of what has been acquired.
Alābhaparihāniyā có nghĩa là không bị tổn thất về sự không đạt được, chứ không phải tổn thất về sự đã đạt được.
Aḍḍhuḍḍhānīti pañcasatādhikāni tīṇi pāṭihāriyasahassāni.
Aḍḍhuḍḍhāni means three thousand five hundred miracles.
Aḍḍhuḍḍhānī có nghĩa là ba ngàn rưỡi phép lạ.
Sātanti sukhaṃ.
Sātaṃ means happiness.
Sāta có nghĩa là an lạc.
142. Surākārakānanti piṭṭhasurāyojanakānaṃ.
142. Surākārakānaṃ means for those who prepare rice beer.
142. Surākārakāna có nghĩa là của những người làm rượu từ bột.
Kosalānaṃ issaroti kosalo, kosalarājassa ayanti kosalikā.
The ruler of the Kosalas is a Kosala; this belongs to the Kosala king is kosalikā.
Người cai quản xứ Kosala là Kosala, người này là của vua Kosala, do đó gọi là kosalikā (người Kosala).
Paribhogapātīti bhattaparibhojanatthāya pāti paribhogapāti.
Paribhogapātī means a bowl for eating food.
Paribhogapātī có nghĩa là cái bát dùng để ăn cơm.
Kammāruddhanapaṇāḷiyāti kammāruddhanapaṇāḷimukhe.
Kammāruddhanapaṇāḷiyā means at the mouth of the blacksmith's furnace pipe.
Kammāruddhanapaṇāḷiyā có nghĩa là ở miệng ống thổi của thợ rèn.
Dhamamānāyāti dhamiyamānāya.
Dhamamānāya means while being blown.
Dhamamānāyā có nghĩa là đang được thổi.
Taṃ pana yasmā bhastavātehi pūritaṃ nāma hoti, tasmā ‘‘bhastavātena pūriyamānāyā’’ti vuttaṃ.
And because that is filled with air from the bellows, it is said, "while being filled with air from the bellows."
Và vì nó được làm đầy bằng hơi từ ống thổi, nên đã nói ‘‘bhastavātena pūriyamānāyā’’ (đang được làm đầy bằng hơi từ ống thổi).
Niyāmabhūmiyanti bhagavato paṭisallānaṭṭhāne sañcarantaṃ māraṃ maṃsacakkhunāva disvā.
Niyāmabhūmiyaṃ means in the place of the Blessed One's meditation, seeing Māra who was roaming with the physical eye itself.
Niyāmabhumiya có nghĩa là thấy Māra đang đi lại ở nơi Đức Thế Tôn tịnh cư, bằng nhục nhãn.
Tenāha ‘‘vijjulatālokenā’’ti.
Therefore, it says, "by the light of a flash of lightning."
Do đó nói ‘‘bằng ánh sáng chớp nhoáng’’.
Seyyatthāyāti seyyānisaṃsāya.
Seyyatthāyā means for the purpose of a superior advantage.
Seyyatthāyā có nghĩa là vì lợi ích của sự tốt đẹp.
Tenāha ‘‘ṭhassāmī’’tiādi.
Therefore, he said, "I shall stand," and so on.
Do đó, Ngài nói: "Ta sẽ đứng vững," v.v.
Attasaññatoti attabhāvena saṃyato.
"Self-controlled" (attasaññato) means restrained in his being.
Attasaññato (tự chế ngự) là người tự chế ngự bản thân.
Tenāha ‘‘saṃyatattabhāvo’’ti.
Therefore, he said, "one whose being is restrained."
Do đó, Ngài nói: "trạng thái tự chế ngự bản thân."
Taṃsaṇṭhitassāti tasmiṃ hatthapādakukkuccarahite buddhamunismiṃ avaṭṭhitassa.
"For one established therein" (taṃsaṇṭhitassa) means for one established in that Buddha-sage who is free from the restlessness of hands and feet.
Taṃsaṇṭhitassā (đối với người đã an trú nơi đó) là đối với người đã an trú trong vị Phật-hiền giả không còn sự băn khoăn về tay chân đó.
Vossajja careyya tattha soti iminā bhagavā taṃ byākaramāno vibhiṃsitā buddhānaṃ kiṃ karissati bhayābhāvato?
"Having given up, he should fare there" (vossajja careyya tattha so) – by this, the Blessed One, in explaining that, asks: "What will intimidation do to the Buddhas, since they are free from fear?"
Vossajja careyya tattha so (người ấy hãy từ bỏ và sống ở đó) – qua lời này, Đức Thế Tôn khi giải thích điều đó, Ngài nói: "Sự sợ hãi sẽ làm gì được các vị Phật, vì các Ngài không có nỗi sợ hãi?"
Kevalaṃ pana anaṭṭhavalikaṃ uppīḷento viya tvameva āyāsaṃ āpajjissasīti māraṃ santajjeti.
Rather, he threatens Māra, saying, "You will only bring trouble upon yourself, like one who presses a rotten stick."
Ngài chỉ đe dọa Ma vương rằng: "Ngươi sẽ tự chuốc lấy phiền não, như thể đang ép một thứ không có dầu."
Bheravāti avītarāgānaṃ bhayajanakā.
"Terrifying" (bheravā) means fear-inducing for those who are not free from lust.
Bheravā (những điều đáng sợ) là những điều gây sợ hãi cho những người chưa ly tham.
Tatthāti taṃnimittaṃ.
"Therein" (tatthā) refers to that cause (of fear).
Tatthā (ở đó) là do nguyên nhân đó.
Phaleyyāti bhijjeyya.
"Would burst" (phaleyyā) means would break.
Phaleyyā (sẽ vỡ) là sẽ tan vỡ.
Sattisallanti sattisaṅkhātaṃ puthusallaṃ.
"A dart-spear" (sattisallaṃ) means a broad spear, which is a dart.
Sattisallaṃ (mũi giáo) là một mũi giáo lớn được gọi là satti.
Urasmiṃ cārayeyyunti phāsuṃ vijjhituṃ ṭhapeyyuṃ uggireyyuṃ.
"They would drive it into the chest" (urasmiṃ cārayeyyuṃ) means they would hold it ready to easily pierce, they would raise it.
Urasmiṃ cārayeyyuṃ (sẽ đâm vào ngực) là sẽ đặt vào để dễ dàng đâm, sẽ nhô ra.
Khandhupadhīsūti khandhasaṅkhātesu upadhīsu.
"In the attachments of the aggregates" (khandhupadhīsu) means in the attachments that are the aggregates.
Khandhupadhīsu (trong các upadhi là các khandha) là trong các upadhi được gọi là các khandha.
Tāṇaṃ karonti nāmāti tato bhayanimittato attano tāṇaṃ karonti nāma.
"Indeed make a shelter" (tāṇaṃ karonti nāmā) means indeed make a shelter for themselves from that cause of fear.
Tāṇaṃ karonti nāmā (thật sự tạo sự che chở) là thật sự tạo sự che chở cho bản thân khỏi nguyên nhân sợ hãi đó.
143. Utugāhāpanatthaṃ dhovitvā, na rajojallavikkhālanatthaṃ.
143. "Having washed" (dhovitvā) for the purpose of taking the proper measure, not for cleaning dirt and grime.
143. Utugāhāpanatthaṃ dhovitvā (rửa để lấy nước theo mùa), không phải để rửa sạch bụi bẩn và cáu ghét.
Tenāha ‘‘buddhānaṃ panā’’tiādi.
Therefore, he said, "For the Buddhas," and so on.
Do đó, Ngài nói: "Nhưng đối với các vị Phật," v.v.
Dhotapādake geheti dhotapādehi akkamitabbake.
"In a house with washed feet" (dhotapādake gehe) means in a place where one's feet should be washed before entering.
Dhotapādake gehe (trong ngôi nhà có chân đã rửa) là trong ngôi nhà mà chân đã được rửa sạch sẽ bước vào.
Vattabhedo nāma natthi dhammassāmibhāvato.
"There is no breaking of observances" (vattabhedo nāma natthi) due to being the master of the Dhamma.
Vattabhedo nāma natthi (không có sự vi phạm giới luật) vì Ngài là bậc chủ của Pháp.
Vattasīse ṭhatvā dhovanti aññesaṃ diṭṭhānugatiāpajjanatthaṃ.
"They wash, standing at the head of the observances" (vattasīse ṭhatvā dhovanti) for others to follow their example.
Vattasīse ṭhatvā dhovanti (đứng ở vị trí hàng đầu của giới luật mà rửa) là để những người khác noi theo.
Soppapariggāhakenāti ettha soppaṃ nāma niddāya antarantarā pavattakiriyamayacittappavattirahitā nirantarabhavaṅgasantatīti taṃ sabhāvato payojanato kālaparicchedato pariggāhakaṃ upariniddesasatisampajaññaṃ sandhāya vuttaṃ ‘‘soppapariggāhakena satisampajaññenā’’ti.
"By the controller of sleep" (soppapariggāhakena) – here, "sleep" (soppaṃ) refers to the uninterrupted continuum of the bhavanga-consciousness, devoid of active thought-processes that occur intermittently during sleep, and the phrase "by the mindfulness and clear comprehension that controls sleep" (soppapariggāhakena satisampajaññenā) is spoken with reference to that, as it comprehends sleep by its nature, purpose, and temporal limits.
Soppapariggāhakena (với sự nắm giữ giấc ngủ) – ở đây, soppaṃ (giấc ngủ) là dòng chảy liên tục của bhavaṅga (tâm hộ kiếp) không có sự vận hành của tâm hành động xen kẽ do buồn ngủ. Nói "soppapariggāhakena satisampajaññena" (với chánh niệm và tỉnh giác nắm giữ giấc ngủ) là ám chỉ đến sự nắm giữ đó về bản chất, mục đích và thời gian giới hạn, tức là chánh niệm và tỉnh giác được đề cập ở trên.
Keci pana ‘‘niddāsoppanā’’ti vadanti, taṃ bhagavato soppaṃ hīḷento vadati.
Some, however, say "sleep and drowsiness" (niddāsoppanā), but that is spoken disparagingly of the Blessed One's sleep.
Một số người nói "niddāsoppanā" (giấc ngủ say), điều đó là nói khinh miệt giấc ngủ của Đức Thế Tôn.
Kiṃ nūti etthaṃ kinti hetunissakke paccattavacananti āha ‘‘kasmā nu supasī’’ti?
"What then?" (kiṃ nū) – here, "what" (kiṃ) is a nominative particle denoting cause, thus he said, "Why then do you sleep?" (kasmā nu supasī).
Kiṃ nū (tại sao) – ở đây, kiṃ (gì) là từ chỉ nguyên nhân, ở cách chủ cách, nên Ngài nói: "kasmā nu supasī" (tại sao ngươi lại ngủ?).
Dubbhago vuccati nissiriko bhinnabhago, so pana matasadiso visaññisadiso ca hotīti āha ‘‘mato viya visaññī viya cā’’ti.
"Unfortunate" (dubbhago) means destitute, one whose fortune is broken, and such a person is like a dead person, like one unconscious, therefore he said, "like a dead person, like one unconscious" (mato viya visaññī viya cā).
Dubbhago (người bất hạnh) được gọi là người không có may mắn, người bị chia cắt phước báu. Người đó giống như người chết, giống như người bất tỉnh, nên Ngài nói: "mato viya visaññī viya cā" (như người chết, như người bất tỉnh).
Ādināti ādi-saddena ‘‘bāhirassa upādāya aṭṭhārasā’’tiādinā (vibha. 842) āgataṃ taṇhākoṭṭhāsaṃ saṅgaṇhāti.
"And so on" (ādinā) – by the word "and so on," it includes the portion of craving mentioned in "the eighteen, based on the external" (bāhirassa upādāya aṭṭhārasā), and so on (Vbha. 842).
Ādinā (v.v.) – với từ ādi (v.v.), Ngài bao gồm phần tham ái được đề cập trong câu "bên ngoài, do chấp thủ, có mười tám" (Vibha. 842) v.v.
Tattha tattha visattatāyāti tammiṃ tasmiṃ ārammaṇe visesato āsattabhāvena.
"By attachment here and there" (tattha tattha visattatāyā) means by being especially attached to this or that object.
Tattha tattha visattatāyā (do sự dính mắc đặc biệt vào từng nơi đó) là do sự dính mắc đặc biệt vào đối tượng đó.
Visassa dukkhanibbattakakammassa hetubhāvato visamūlatā visaṃ vā dukkhadukkhādibhūtavedanā mūlaṃ etassāti visamūlā, taṇhā.
"Having a root of poison" (visamūlatā) due to being the cause of karma that produces suffering, or "having a root of poison" (visamūlā), that is, craving, because poison (i.e., feeling as suffering, suffering of suffering, etc.) is its root.
Do là nguyên nhân của nghiệp tạo ra khổ đau, nên visamūlatā (có gốc là độc); hoặc độc là khổ đau, v.v., cảm thọ là gốc rễ của nó, nên visamūlā (có gốc là độc) là tham ái.
Tassa rūpādikassa dukkhassa paribhogo, na amatassāti visaparibhogatā.
The enjoyment of that suffering, such as material forms, is not of the deathless, hence "enjoyment of poison" (visaparibhogatā).
Sự hưởng thụ khổ đau đó là sắc, v.v., không phải là bất tử, nên visaparibhogatā (sự hưởng thụ độc dược).
Katthaci netunti katthaci bhave sabbathā netuṃ?
"To lead anywhere" (katthaci netuṃ) means to lead to any existence in any way?
Katthaci netuṃ (đưa đến bất cứ đâu) là đưa đến bất cứ cõi nào bằng mọi cách?
Parikkhayāti sabbaso khīṇattā.
"Complete destruction" (parikkhayā) means being completely exhausted.
Parikkhayā (do sự tiêu diệt hoàn toàn) là do đã hoàn toàn đoạn diệt.
Tuyhaṃ kiṃ etthāti sabbupadhiparikkhayā suddhassa mama paṭipattiyaṃ tuyhaṃ kiṃ ujjhāyanaṃ?
"What is it to you here?" (tuyhaṃ kiṃ etthā) means, in my practice, who am pure through the complete destruction of all clinging, what fault do you find?
Tuyhaṃ kiṃ etthā (ngươi có gì ở đây?) là ngươi có gì để phàn nàn về sự thực hành của ta, người đã thanh tịnh do sự đoạn diệt hoàn toàn mọi upadhi?
Kevalaṃ vighātoyeva teti dasseti.
It only demonstrates that it is a hindrance to you.
Ngài chỉ cho thấy rằng đó chỉ là sự phiền não cho ngươi.
145. Paṇṇāsaṃ vā vassāni jīvati vassasatato upari seyyathāpi thero anuruddho.
145. "Lives fifty years" (paṇṇāsaṃ vā vassāni jīvati) beyond a hundred years, just like the elder Anuruddha.
145. Paṇṇāsaṃ vā vassāni jīvati (sống năm mươi năm) trên một trăm năm, như Trưởng lão Anuruddha.
Saṭṭhi vā vassāni seyyathāpi thero bākulo.
"Or sixty years" (saṭṭhi vā vassāni), just like the elder Bākula.
Saṭṭhi vā vassāni (hoặc sáu mươi năm) như Trưởng lão Bākula.
Paṭiharitvā paccanīkabhāve sātaṃ sukhaṃ etassāti paccanīkasāto, tabbhāvo paccanīkasātatā, tāya.
"By being a hostile delight" (paccanīkasātatā) – that which obstructs and is delightful (sātaṃ) or pleasant is hostility (paccanīka); its state is being a hostile delight, by that.
Paccanīkasātatā (do sự đối nghịch dễ chịu) là do trạng thái đối nghịch dễ chịu, tức là sự dễ chịu và hạnh phúc đối với nó trong trạng thái đối nghịch.
Abhibhavitvā abhāsi paṭivacanaṃ jānamānova.
"He spoke, having overcome" (abhibhavitvā abhāsi), knowing the retort.
Abhibhavitvā abhāsi (đã chiến thắng mà nói) là đã nói lời đáp lại trong khi biết rõ.
Na hīḷeyya na jiguccheyya.
"He should not despise" (na hīḷeyya) means he should not disdain.
Na hīḷeyya (không khinh bỉ) là không ghê tởm.
Evanti so dārako viya kiñci acintento sappuriso careyya, evaṃ hissa cittadukkhaṃ na hotīti adhippāyo.
"Thus" (evaṃ) – just as that child, not thinking of anything, a good person should fare; thus, there would be no mental suffering for him, this is the intention.
Evaṃ (như vậy) là người thiện trí nên sống như đứa trẻ đó, không suy nghĩ gì. Ý nghĩa là như vậy thì tâm người đó sẽ không có khổ đau.
Pajjalitasīso viya careyyāti yathā pajjalitasīso puriso aññaṃ kiñci akatvā tasseva vūpasamāya vāyameyya, evaṃ sappuriso āyuṃ parittanti ñatvā teneva nayena sabbasaṅkhāragataṃ aniccaṃ, aniccattā eva dukkhaṃ, anattāti vipassanampi otaritvā taṃ ussukkāpentopi saṅkhāravigamāya careyya paṭipajjeyya.
"He should fare as if his head were ablaze" (pajjalitasīso viya careyyā) – just as a person whose head is ablaze would do nothing else but strive for its extinguishing, so too a good person, knowing that life is short, should in the same way contemplate the impermanence of all conditioned things, that because of impermanence they are suffering, and are non-self; thus, even if he enters vipassanā to that end, he should act and practice for the cessation of conditioned things.
Pajjalitasīso viya careyyā (nên sống như người có đầu bốc cháy) là như một người có đầu bốc cháy sẽ không làm gì khác ngoài việc cố gắng dập tắt nó, thì người thiện trí nên biết rằng tuổi thọ là hữu hạn, và theo cách đó, nên quán chiếu rằng mọi hành là vô thường, do vô thường nên là khổ, là vô ngã, và nên cố gắng để chấm dứt các hành, nên thực hành.
146. Nemīvāti nemisīsena cakkaṃ vadati.
146. "Like a felloe" (nemīvā) refers to the wheel by its rim.
146. Nemīvā (như vành xe) là nói về bánh xe với vành xe.
Kubbaraṃ anupariyāyatīti kubbaraṃ anuparivattati.
"It revolves around the hub" (kubbaraṃ anupariyāyatī) means it turns around the hub.
Kubbaraṃ anupariyāyatī (đi theo trục xe) là xoay quanh trục xe.
Tathābhūto pana so taṃ ajahantovāti āha ‘‘na vijahatī’’ti.
And such a wheel does not abandon the hub, therefore he said, "does not abandon" (na vijahatī).
Người đó, trong trạng thái như vậy, không rời bỏ nó, nên Ngài nói: "na vijahatī" (không rời bỏ).
Āyu anupariyāyatīti maccānaṃ āyu gatampi paccāgacchatīti bhagavato paṭāṇi hutvā vadati, bhagavā pana taṃ abhibhavitvā ‘‘accayanti ahorattā’’tiādinā āyuno accayagamanamaraṇataṃyeva pavedesi.
"Life revolves around" (āyu anupariyāyatī) – Māra speaks, becoming an opponent of the Blessed One, as if the life of mortals, even if it has gone, returns; but the Blessed One, overcoming him, declared only the passing away and death of life by saying, "Days and nights pass," and so on.
Āyu anupariyāyatī (tuổi thọ quay trở lại) là Ma vương nói rằng tuổi thọ của chúng sinh đã qua đi lại quay trở lại, nhưng Đức Thế Tôn đã chiến thắng điều đó và tuyên bố rằng tuổi thọ chỉ đi đến sự chấm dứt, đến cái chết, qua câu "ngày đêm trôi qua," v.v.
148. Vicakkhukammāyāti vicakkhubhāvakāmatāya.
148. "For the sake of blindness" (vicakkhukammāyā) means out of a desire for blindness.
148. Vicakkhukammāyā (vì muốn làm cho không thấy) là vì muốn làm cho không có mắt trí tuệ.
Yathā sā bhagavato desiyamānaṃ dhammaṃ attano paññācakkhunā na passituṃ sakkoti, evaṃ kātuṃ kāmatāya.
As if that assembly cannot see the Dhamma being taught by the Blessed One with its eye of wisdom, with a desire to make it so.
Như vậy, để làm cho cô ta không thể thấy Pháp được Đức Thế Tôn thuyết giảng bằng mắt trí tuệ của mình.
Tenāha ‘‘parisāyā’’tiādi.
Therefore, he said, "for the assembly," and so on.
Do đó, Ngài nói: "của hội chúng," v.v.
Vināsetuṃ na sakkoti bheravārammaṇe bhāyanasseva abhāvato.
"He cannot destroy" (vināsetuṃ na sakkoti) due to the absence of fear even in terrifying circumstances.
Vināsetuṃ na sakkoti (không thể hủy diệt) vì không có nỗi sợ hãi đối với đối tượng đáng sợ.
Dasabalappattāti dasahi balehi samannāgatā.
"Endowed with the ten powers" (dasabalappattā) means endowed with the ten strengths.
Dasabalappattā (đã đạt được mười lực) là được trang bị mười lực.
149. Mandabhāvenāti jaḷabhāvena momūhabhāvenāti mahāmūḷhatāya.
149. "By dullness" (mandabhāvena) means by foolishness; "by great delusion" (momūhabhāvenā) means by extreme delusion.
149. Mandabhāvena (do sự ngu dốt) là do sự ngu si; momūhabhāvena (do sự mê muội lớn) là do sự mê muội cực độ.
Kabbakaraṇena mattoti kabbakiriyāpasutatādivasena matto kabbaṃ katvā.
"Intoxicated by poetic composition" (kabbakaraṇena matto) means having composed a poem, being engrossed in poetic activity, and so on.
Kabbakaraṇena matto (say sưa với việc làm thơ) là làm thơ theo cách say mê với việc làm thơ, v.v.
Kimidaṃ soppasevāti idaṃ tava soppaṃ kimatthaṃ, purisena nāma purisattakarena bhavitabbaṃ, na soppatiyeva.
"Why this sleeping habit?" (kimidaṃ soppasevā) means, what is this sleeping habit of yours for? A man should be a man of action, not just sleep.
Kimidaṃ soppasevā (việc ngủ nghỉ này để làm gì?) là việc ngủ nghỉ này của ngươi để làm gì? Một người nên hành xử như một người đàn ông, không nên chỉ ngủ nghỉ.
Atthaṃ samāgantvāti paramatthaṃ nibbānaṃ sammā āgantvā adhigantvā.
"Having reached the supreme goal" (atthaṃ samāgantvā) means having properly arrived at, having attained, Nibbāna, the ultimate goal.
Atthaṃ samāgantvā (đã đạt được mục đích tối thượng) là đã đạt được Niết Bàn, mục đích tối thượng.
Asaṅga…pe… natthi sabbaso siddhatthabhāvato.
"Without attachment... there is not" (asaṅga…pe… natthi) because of being completely accomplished in the goal.
Asaṅga…pe… natthi (không dính mắc…v.v… không có) vì đã hoàn toàn đạt được mục đích.
Jaggantoti jāgaranto puriso viya, na bhāyāmi bhayahetūnaṃ abhāvā.
"Vigilant" (jagganto) means like a vigilant person; "I do not fear" (na bhāyāmi) due to the absence of causes of fear.
Jagganto (thức tỉnh) là như một người thức tỉnh, na bhāyāmi (tôi không sợ) vì không có nguyên nhân sợ hãi.
Nānutapanti sabbattha sabbadāpi vissaṭṭhabhāvato, māmanti mamaṃ.
"They do not regret" (nānutapanti) because of being released everywhere and always; "māma" (māmaṃ) means "me."
Nānutapanti (không hối tiếc) vì đã hoàn toàn xả bỏ mọi thứ mọi lúc; māmaṃ (tôi) là tôi.
Gāthāsukhatthañhi dīghaṃ katvā vuttaṃ.
Indeed, it is spoken with a long vowel for the sake of metrical ease.
Thật vậy, đã được nói dài ra để tạo sự dễ nghe cho bài kệ.
Ṭhitattāti uddesaparipucchāya paricchijjattā.
"By being established" (ṭhitattā) means by being delimited by the designation and the inquiry.
Ṭhitattā (do đã được xác định) là do đã được xác định qua câu hỏi và câu trả lời.
Hāninti kassaci jāniṃ.
"Loss" (hāniṃ) means harm to anyone.
Hāniṃ (sự tổn hại) là sự tổn hại của bất cứ ai.
150. Anurujjhati etenāti anurodho, rāgo.
150. That by which one is attached is attachment (anurodho), which is lust.
150. Anurodho (sự thuận theo) là sự thuận theo, tức là tham ái.
Virujjhati etenāti virodho, paṭigho.
That by which one is averse is aversion (virodho), which is hatred.
Virodho (sự chống đối) là sự chống đối, tức là sân hận.
Tesu anurodhavirodhesu tannimittaṃ sajjati nāma saṅgaṃ karoti nāma, anurodhavirodhuppādanameva cettha sajjanaṃ.
In these approvals and disapprovals, on account of that, there is attachment, indeed, it makes an attachment; here, the very arising of approvals and disapprovals is attachment.
Trong những sự thuận lòng và nghịch lòng đó, do nguyên nhân đó, gọi là dính mắc, gọi là tạo sự ràng buộc; ở đây, chính sự phát sinh thuận lòng và nghịch lòng là sự dính mắc.
Yadaññamanusāsatīti yaṃ aññesaṃ anusāsanaṃ, taṃ tesaṃ hitesanaṃ anukampanaṃ, tasmā anukampake hitesake sammāsambuddhe anurodhavirodhe āropetvā vikampanatthaṃ micchā vadasīti.
The phrase "When one teaches another" refers to the instruction given to others, which is their well-wishing and compassion. Therefore, by attributing approvals and disapprovals to the compassionate and well-wishing Sammāsambuddhas, you speak wrongly, for the purpose of causing agitation.
“Khi Ngài khuyên dạy người khác” nghĩa là sự khuyên dạy của người khác, đó là sự mong lợi ích, sự thương xót cho họ. Do đó, ngươi đã gán ghép sự thuận lòng và nghịch lòng cho các bậc Chánh Đẳng Giác, những người thương xót, mong lợi ích, để làm cho dao động, ngươi nói sai lầm.
151. Ākāse caranteti pañcābhiññe sandhāya vadati.
The phrase "moving in the sky" is said with reference to those possessing the five supernormal powers (pañcābhiññā).
151. “Đi trên hư không” là nói đến các vị có năm thắng trí.
Antalikkhe carantepi kiccasādhanato antalikkhacaro.
One "moving in the intermediate space" (antalikkhacaro) is also meant, as they accomplish tasks while moving in the intermediate space.
Dù đi trong khoảng không, vì hoàn thành công việc nên “đi trong khoảng không”.
Manasi jātoti mānaso.
Born in the mind, therefore "mental" (mānaso).
Phát sinh trong tâm nên là “mānasā” (thuộc về tâm).
Taṃ pana manasantānasampayuttatāyāti āha ‘‘manasampayutto’’ti.
And that is due to its being conjoined with the mental continuum, thus it is said "conjoined with the mind."
Điều đó là do sự tương ưng với dòng tâm thức, nên nói “tương ưng với tâm”.
152. Pañcannaṃ upādānakkhandhānaṃ lakkhaṇādīni ceva samudayañca assādādīnavanissaraṇāni ca gahetvā sammā tesaṃ lakkhaṇādīnaṃ gahaṇaṃ hotīti āha ‘‘pañca upādānakkhandhe ādiyitvā’’ti.
Taking the characteristics and so forth of the five aggregates of clinging (pañca upādānakkhandha), their origin, their gratification, drawbacks, and escape, one grasps their characteristics and so forth correctly; thus it is said, "having taken hold of the five aggregates of clinging."
152. Sau khi nắm giữ các đặc tính, v.v. và sự tập khởi, sự vị ngọt, sự tai hại, sự xuất ly của năm uẩn chấp thủ, sự nắm giữ các đặc tính, v.v. của chúng một cách đúng đắn xảy ra, nên nói “nắm giữ năm uẩn chấp thủ”.
Ruppanavediyanasañjānanaabhisaṅkharaṇavijānanāni khandhānaṃ sabhāvalakkhaṇāni.
The acts of being oppressed, feeling, perceiving, constructing, and cognizing are the inherent characteristics of the aggregates.
Sự biến hoại, sự cảm thọ, sự nhận biết, sự sắp đặt, sự nhận thức là các đặc tính tự tánh của các uẩn.
Ādi-saddena rasapaccupaṭṭhānapadaṭṭhānāni ceva samudayādīni ca saṅgaṇhāti.
The term "and so forth" (ādi) includes the functions, manifestations, proximate causes, as well as their origin and so forth.
Từ “v.v.” bao gồm vị, sự hiện khởi, nguyên nhân gần, và sự tập khởi, v.v.
Dassetīti paccakkhato dasseti, hatthāmalakaṃ viya pākaṭe vibhūte katvā vibhāveti.
"Shows" means shows directly, making them clear and distinct as if they were a myrobalan fruit in one's hand, thereby revealing them.
“Chỉ bày” nghĩa là chỉ bày một cách trực tiếp, làm cho rõ ràng, hiển lộ như trái xoài trong lòng bàn tay.
Gaṇhāpetīti te dhamme manasā anupekkhite diṭṭhiyā suppaṭividdhe karonto uggaṇhāpeti.
"Causes to grasp" means he causes them to apprehend those phenomena, having observed them mentally and thoroughly penetrated them with right view.
“Làm cho nắm giữ” nghĩa là làm cho các pháp ấy được quán xét bằng tâm, được thấu hiểu rõ ràng bằng kiến giải, khiến họ nắm giữ.
Samādānamhīti tattha atthassa sammadeva ādiyane khandhānañca sammasanavasena aññadhammavasena samādiyane.
"In the taking up" refers to the proper taking up of the meaning therein, and the taking up of the aggregates through discernment and through other phenomena.
“Trong sự nắm giữ” nghĩa là trong sự nắm giữ đúng đắn ý nghĩa ở đó, và trong sự nắm giữ các uẩn theo cách quán xét và theo cách các pháp khác.
Paṭividdhaguṇenāti tāya desanāya, taṃ nissāya paccattapurisakārena ca tesaṃ paṭividdhaguṇena.
"By the quality of penetration" refers to the quality of penetration of those (aggregates) by means of that teaching, and by individual effort reliant on it.
“Bằng phẩm chất đã thấu hiểu” nghĩa là bằng sự thấu hiểu các phẩm chất của chúng nhờ vào lời thuyết giảng ấy, nương vào đó và bằng sự nỗ lực cá nhân.
Jotāpetīti tesaṃ cittasantānaṃ assaddhiyādikilesamalavidhamanena pabhassaraṃ karoti.
"Illuminates" means he makes their mind-continuum luminous by dispelling the defilements of lack of faith and so forth.
“Làm cho sáng chói” nghĩa là làm cho dòng tâm thức của họ sáng chói bằng cách loại bỏ các cấu uế như sự bất tín, v.v.
Aṭṭhiṃ katvāti tāya desanāya pāpetabbaṃ atthaṃ payojanaṃ daḷhaṃ katvā.
"Making it a bone" means making the purpose, the goal to be attained through that teaching, firm.
“Cốt tủy” nghĩa là làm cho ý nghĩa, mục đích cần đạt được bằng lời thuyết giảng ấy trở nên vững chắc.
Tenāha ‘‘ayaṃ no’’tiādi.
Therefore, it is said, "This is our" and so forth.
Do đó, nói “đây là của chúng ta”, v.v.
Kammakārakacittaṃ nāma otaraṇacittaṃ.
"Active mind" (kammakārakacittaṃ) is the mind that enters into.
“Tâm làm việc” là tâm đi vào.
‘‘Yonisomanasikārapubbakaṃ vipassanācitta’’nti keci.
Some say, "The vipassanā mind preceded by wise attention (yonisomanasikāra)."
Một số vị nói: “Tâm thiền quán có sự tác ý đúng đắn làm tiền đề”.
Ohitasotāti anaññavihitatāya dhammassavanāya appitasotā, tato eva tadatthaṃ ṭhapitasotā.
"Attentive" (ohitasotā) means ears applied to the listening of the Dhamma without distraction, and therefore, "ears placed" for that purpose.
“Lắng tai” nghĩa là đặt tai để nghe pháp một cách không xao nhãng, từ đó, “đặt tai” cho mục đích đó.
Ete rūpādayo khandhe yañca saṅkhataṃ samiddhapaccayehi kataṃ, tañca ‘‘eso ahaṃ na homi, etaṃ mayhaṃ na hotī’’ti passantoti yojanā.
The sentence is to be construed as: "These aggregates, such as rūpa, and whatever is conditioned, one sees thus: 'This I am not, this is not mine.'"
“Những uẩn sắc, v.v. này và những gì là hữu vi” (được tạo tác bởi các duyên đầy đủ), và thấy rằng “đây không phải là tôi, đây không phải là của tôi” – đó là cách phối hợp.
Khemo attāti khemattā, taṃ khemattaṃ.
The self is secure, hence "security of self."
Tự ngã an ổn là khemattā (sự an ổn của tự ngã), đó là “sự an ổn”.
Tenāha ‘‘khemibhūtaṃ attabhāva’’nti.
Therefore, it is said, "a secure existence."
Do đó, nói “thân thể đã trở nên an ổn”.
Pariyesamānā mārasenā.
"Searching" refers to Māra's army.
“Đang tìm kiếm” là quân đội của Māra.
153. Sañjāyati etasmāti sañjāti, so eva sampayuttadhammo samosarati etthāti samosaraṇaṃ, so eva attho, tena sañjātisamosaraṇaṭṭhena.
"From which it arises" is origin (sañjāti); the conjoined phenomena converge in it, thus convergence (samosaraṇaṃ); the meaning is the same, hence "in the sense of arising and convergence."
Phát sinh từ đó nên là sañjāti (sự phát sinh), chính pháp tương ưng tụ hội ở đó nên là samosaraṇa (sự tụ hội), ý nghĩa là như vậy, do đó, “theo ý nghĩa sự phát sinh và tụ hội”.
Bhayabheravaṃ sadda nti bhāyati etasmāti bhayaṃ, tadeva yassa kassaci bheravāvahattā bheravaṃ, devādisaddanti attho.
"Sound of fear and terror" (bhayabheravaṃ saddaṃ): that from which one fears is "fear" (bhayaṃ); that which brings terror to anyone is "terror" (bheravaṃ); the meaning is the sound of deities and so forth.
“Tiếng đáng sợ hãi” nghĩa là sợ hãi từ đó nên là bhayaṃ (sự sợ hãi), chính điều đó gây ra sự đáng sợ hãi cho bất kỳ ai nên là bheravaṃ (sự đáng sợ hãi), ý nghĩa là tiếng của chư thiên, v.v.
Vigatavalāhake deve uppātavasena uppajjanakasaddo devadundubhi.
The sound arising in the heavens free of clouds by way of an omen is the "divine drum" (devadundubhi).
Tiếng phát sinh do sự biến động của chư thiên trên bầu trời không mây là “tiếng trống trời”.
Asanipātādisaddo asanipātasaddo.
The sound of a lightning strike and so forth is the "sound of a lightning strike" (asanipātasaddo).
Tiếng sét đánh, v.v. là “tiếng sét đánh”.
Undrīyatīti viparivattati.
"Turns over" (undrīyatī) means it changes drastically.
“Undrīyati” nghĩa là xoay chuyển.
Loko adhimucchitoti atithaddhakāyo viya mucchaṃ āpanno.
"The world is infatuated" (loko adhimucchito) means it has fallen into a swoon, as if having a stiff body.
“Thế gian mê muội” nghĩa là rơi vào trạng thái mê muội như một thân thể quá cứng đờ.
Mārassāti kilesamārassa.
"Of Māra" (Mārassā) refers to Māra of the defilements (kilesamāra).
“Của Māra” là của phiền não Māra.
Ṭhānabhūtanti pavattiṭṭhānabhūtaṃ.
"Ground" (ṭhānabhūtaṃ) refers to the ground of occurrence.
“Nơi tồn tại” là nơi phát sinh.