Table of Contents

Sagāthāvagga-aṭṭhakathā

Edit
43

1. Devatāsaṃyuttaṃ

1. Devatāsaṃyutta

1. Tương Ưng Chư Thiên

44

1. Naḷavaggo

1. Naḷavagga

1. Phẩm Naḷa

45
1. Oghataraṇasuttavaṇṇanā
1. Commentary on the Oghataraṇa Sutta
1. Giải Thích Kinh Oghataraṇa
46
Tattha saṃyuttāgamo nāma sagāthāvaggo, nidānavaggo, khandhakavaggo, saḷāyatanavaggo, mahāvaggoti pañcavaggo hoti.
Therein, the Saṃyuttāgama consists of five vaggas: Sagāthāvagga, Nidānavagga, Khandhakavagga, Saḷāyatanavagga, and Mahāvagga.
Ở đây, bộ Saṃyutta Āgama (Tương Ưng Bộ) bao gồm năm phẩm: Sagāthāvagga (Phẩm Có Kệ), Nidānavagga (Phẩm Nhân Duyên), Khandhavagga (Phẩm Uẩn), Saḷāyatanavagga (Phẩm Sáu Xứ), Mahāvagga (Phẩm Đại).
Suttato –
According to the suttas:
Theo kinh:
47
‘‘Satta suttasahassāni, satta suttasatāni ca;
“Seven thousand suttas,
"Bảy ngàn bài kinh, bảy trăm bài kinh,
48
Dvāsaṭṭhi ceva suttāni, eso saṃyuttasaṅgaho’’.
seven hundred suttas, and sixty-two suttas – this is the compilation of the Saṃyutta.”
và sáu mươi hai bài kinh, đó là tổng hợp của Tương Ưng Bộ."
49
Bhāṇavārato bhāṇavārasataṃ hoti.
In terms of recitation sections (bhāṇavāra), it comprises one hundred bhāṇavāras.
Về số lượng bhāṇavāra, có một trăm bhāṇavāra.
Tassa vaggesu sagāthāvaggo ādi, suttesu oghataraṇasuttaṃ.
Among its vaggas, the Sagāthāvagga is the beginning, and among the suttas, the Oghataraṇa Sutta is the first.
Trong các phẩm của nó, Sagāthāvagga là phẩm đầu tiên, và trong các bài kinh, Oghataraṇasutta là bài kinh đầu tiên.
Tassāpi ‘‘evaṃ me suta’’ntiādikaṃ āyasmatā ānandena paṭhamamahāsaṅgītikāle vuttaṃ nidānamādi.
Even of that (sutta), the introductory passage beginning with “Evaṃ me sutaṃ” (Thus have I heard), spoken by Venerable Ānanda during the First Great Council, is the beginning.
Phần dẫn nhập bắt đầu bằng "Evaṃ me sutaṃ" (Như vầy tôi nghe) của bài kinh đó đã được Tôn giả Ānanda thuyết giảng trong kỳ Đại Kết Tập lần thứ nhất.
Sā panesā paṭhamamahāsaṅgīti sumaṅgalavilāsiniyā dīghanikāyaṭṭhakathāya ādimhi vitthāritā, tasmā sā tattha vitthāritanayeneva veditabbā.
And this First Great Council has been extensively described by me at the beginning of the Dīghanikāya Commentary, called Sumaṅgalavilāsinī; therefore, it should be understood according to the extensive description found there.
Kỳ Đại Kết Tập lần thứ nhất này đã được trình bày chi tiết ở phần đầu của bộ chú giải Dīghanikāya (Trường Bộ) tên là Sumaṅgalavilāsinī, do đó, cần phải hiểu theo cách đã được trình bày chi tiết ở đó.
50
1. Yaṃ panetaṃ ‘‘evaṃ me suta’’ntiādikaṃ nidānaṃ, tattha evanti nipātapadaṃ.
1. Regarding this introductory passage beginning with “Evaṃ me sutaṃ”, evaṃ is an indeclinable particle (nipātapada).
1. Phần dẫn nhập bắt đầu bằng "Evaṃ me sutaṃ" (Như vầy tôi nghe), trong đó, từ evaṃ là một giới từ (nipātapada).
Metiādīni nāmapadāni.
Me and so forth are nouns (nāmapadāni).
Các từ như me là danh từ (nāmapadāni).
Sāvatthiyaṃ viharatīti ettha ti upasaggapadaṃ, haratīti ākhyātapadanti iminā tāva nayena padavibhāgo veditabbo.
In “Sāvatthiyaṃ viharati” (dwells at Sāvatthī), is a prefix (upasaggapada), and harati is a finite verb (ākhyātapadanti); in this way, the division of words (padavibhāgo) should be understood initially.
Trong câu "Sāvatthiyaṃ viharatī" (trú tại Sāvatthī), từ là một tiền tố (upasaggapada), và haratī là một động từ (ākhyātapadanti). Theo cách này, sự phân tích từ ngữ cần được hiểu.
51
Atthato pana evaṃsaddo tāva upamūpadesa-sampahaṃsana-garahaṇa-vacanasampaṭiggahākāranidassanāvadhāraṇādi-anekatthappabhedo.
However, in terms of meaning, the word evaṃ has many distinct meanings, such as simile, instruction, commendation, censure, acceptance of a statement, manner, exemplification, and ascertainment.
Về ý nghĩa, từ evaṃ có nhiều nghĩa khác nhau như so sánh, hướng dẫn, tán thán, khiển trách, chấp nhận lời nói, cách thức, minh họa, xác định.
Tathā hesa – ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti (dha. pa. 53) evamādīsu upamāyaṃ āgato.
For instance, in passages like “Evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu” (Thus, by one born as a mortal, much wholesome action should be done), it is used in the sense of a simile.
Chẳng hạn, từ này xuất hiện trong nghĩa so sánh trong các câu như: "Một người sinh ra như vậy, cần phải làm nhiều điều thiện" (Dhp. 53).
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In passages like “Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabbaṃ” (Thus should you go forward, thus should you go back), it is used in the sense of instruction.
Trong nghĩa hướng dẫn: "Ngươi phải tiến lên như vậy, ngươi phải lùi lại như vậy" (A. IV, 122).
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In passages like “Evametaṃ bhagavā, evametaṃ sugatā” (So it is, Blessed One; so it is, Sugata), it is used in the sense of commendation.
Trong nghĩa tán thán: "Thưa Thế Tôn, đúng vậy; thưa Thiện Thệ, đúng vậy" (A. III, 66).
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In passages like “Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī” (So indeed this wretch, in whatever way, speaks in praise of that bald-headed ascetic), it is used in the sense of censure.
Trong nghĩa khiển trách: "Cũng như vậy, người phụ nữ hạ tiện này, dù trong bất cứ trường hợp nào, cũng tán thán vị Sa-môn đầu trọc đó" (S. I, 187).
‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (ma. ni. 1.1) vacanasampaṭiggahe.
In passages like “Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosuṃ” (Yes, Venerable Sir, those bhikkhus assented to the Blessed One), it is used in the sense of acceptance of a statement.
Trong nghĩa chấp nhận lời nói: "Thưa Tôn giả, đúng vậy, các Tỳ-kheo ấy đã vâng lời Đức Thế Tôn" (M. I, 1).
‘‘Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In passages like “Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī” (Indeed, Venerable Sir, I understand the Dhamma taught by the Blessed One in this manner), it is used in the sense of manner.
Trong nghĩa cách thức: "Thưa Tôn giả, tôi hiểu Pháp do Đức Thế Tôn thuyết giảng theo cách này" (M. I, 398).
‘‘Ehi tvaṃ māṇavaka, yena samaṇo ānando tenupasaṅkama; upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha – ‘subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’ti.
In passages like “Come, young man, approach the recluse Ānanda; having approached, in my name, ask the recluse Ānanda if he is free from illness and affliction, robust, strong, and living comfortably.
Trong nghĩa minh họa: "Này thanh niên, hãy đi đến chỗ Sa-môn Ānanda; sau khi đến, hãy thay mặt ta hỏi thăm Sa-môn Ānanda về sức khỏe, bệnh tật, sự nhẹ nhàng, sức mạnh, và sự an trú của ngài – ‘Thanh niên Subha, con trai của Todeyya, hỏi thăm Tôn giả Ānanda về sức khỏe, bệnh tật, sự nhẹ nhàng, sức mạnh, và sự an trú’.
Evañca vadehi – ‘sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’ti’’ādīsu (dī. ni. 1.445) nidassane.
And say this: ‘It would be good, Venerable Ānanda, if you would approach the dwelling of the young man Subha, son of Todeyya, out of compassion’”, it is used in the sense of exemplification.
Và hãy nói như vầy: ‘Thưa Tôn giả Ānanda, xin ngài vui lòng đến nhà của thanh niên Subha, con trai của Todeyya, vì lòng từ bi’" (D. I, 445).
‘‘Taṃ kiṃ maññatha kālāmā, ime dhammā kusalā vā akusalā vāti?
“What do you think, Kālāmā, are these qualities wholesome or unwholesome?
"Này các Kālāma, các ông nghĩ sao, những pháp này là thiện hay bất thiện?
Akusalā, bhante.
Unwholesome, Venerable Sir.
Thưa Tôn giả, là bất thiện.
Sāvajjā vā anavajjā vāti?
Blameworthy or blameless?
Có lỗi hay không có lỗi?
Sāvajjā, bhante.
Blameworthy, Venerable Sir.
Thưa Tôn giả, có lỗi.
Viññugarahitā vā viññuppasatthā vāti?
Condemned by the wise or praised by the wise?
Bị người trí khiển trách hay được người trí tán thán?
Viññugarahitā, bhante.
Condemned by the wise, Venerable Sir.
Thưa Tôn giả, bị người trí khiển trách.
Samattā samādinnā ahitāya dukkhāya saṃvattanti vā no vā, kathaṃ vo ettha hotīti?
When undertaken and practiced, do they lead to harm and suffering, or not? How does it seem to you in this matter?
Nếu được thực hành và chấp nhận, chúng có dẫn đến bất lợi và khổ đau hay không? Các ông nghĩ sao về điều này?
Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’tiādīsu (a. ni. 3.66) avadhāraṇe.
When undertaken and practiced, Venerable Sir, they lead to harm and suffering; so it seems to us in this matter,” it is used in the sense of ascertainment.
Thưa Tôn giả, nếu được thực hành và chấp nhận, chúng dẫn đến bất lợi và khổ đau, chúng tôi nghĩ như vậy" (A. III, 66).
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
Here, it should be understood in the senses of manner, exemplification, and ascertainment.
Ở đây, từ này cần được hiểu theo nghĩa cách thức, minh họa và xác định.
52
Tattha ākāratthena evaṃsaddena etamatthaṃ dīpeti – nānānayanipuṇaṃ anekajjhāsayasamuṭṭhānaṃ atthabyañjanasampannaṃ vividhapāṭihāriyaṃ dhammatthadesanā paṭivedhagambhīraṃ sabbasattānaṃ sakasakabhāsānurūpato sotapathamāgacchantaṃ tassa bhagavato vacanaṃ sabbappakārena ko samattho viññātuṃ?
Therein, by the word evaṃ in the sense of manner, this meaning is made clear: Who is capable of understanding in every way the Buddha’s discourse, which is subtle in various methods, arises from diverse intentions, is rich in meaning and expression, brings forth various wonders, is profound in Dhamma, meaning, teaching, and penetration, and reaches the ear of all beings according to their respective languages?
Trong đó, với nghĩa cách thức, từ evaṃ làm sáng tỏ ý nghĩa này: Ai có thể hoàn toàn hiểu được lời dạy của Đức Thế Tôn, vốn tinh vi với nhiều phương pháp, phát sinh từ nhiều ý định khác nhau, đầy đủ ý nghĩa và từ ngữ, có nhiều phép lạ, sâu sắc về giáo pháp và sự chứng ngộ, và đến tai tất cả chúng sinh theo ngôn ngữ riêng của họ?
Sabbathāmena pana sotukāmataṃ janetvāpi evaṃ me sutaṃ, mayāpi ekenākārena sutanti.
But, having aroused the desire to hear with all one’s might, “Thus have I heard,” meaning “I, too, have heard in one particular manner.”
Tuy nhiên, sau khi phát sinh ý muốn lắng nghe với tất cả sức lực, tôi đã nghe như vậy, và tôi cũng đã nghe theo một cách thức nào đó.
53
Nidassanatthena – ‘‘nāhaṃ sayambhū, na mayā idaṃ sacchikata’’nti attānaṃ parimocento – ‘‘evaṃ me sutaṃ, mayāpi evaṃ suta’’nti idāni vattabbaṃ sakalasuttaṃ nidasseti.
In the sense of exemplification, by freeing himself from the thought “I am not self-born, nor have I realized this myself,” he exemplifies the entire sutta to be recited now: “Thus have I heard; I, too, have heard thus.”
Với nghĩa minh họa, để tự giải thoát mình khỏi ý nghĩ "Tôi không phải là bậc Tự Giác, tôi không tự mình chứng ngộ điều này", Tôn giả Ānanda minh họa toàn bộ bài kinh sắp được thuyết giảng bằng cách nói "Evaṃ me sutaṃ" (Như vầy tôi nghe), tức là "Tôi cũng đã nghe như vậy."
54
Avadhāraṇatthena – ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.220-223) evaṃ bhagavatā – ‘‘āyasmā ānando atthakusalo dhammakusalo byañjanakusalo niruttikusalo pubbāparakusalo’’ti (a. ni. 5.169) evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti – ‘‘evaṃ me sutaṃ, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
With the meaning of ascertainment, the venerable Ānanda, showing his own power of retention in accordance with the praise bestowed by the Blessed One—"Monks, among my bhikkhu disciples who are greatly learned, Ānanda is the foremost; among those who are wise, mindful, resolute, and attendants, Ānanda is the foremost"—and by the General of the Dhamma—"Venerable Ānanda is skilled in purpose, skilled in Dhamma, skilled in expression, skilled in language, skilled in the sequence of what comes before and after"—generates the desire to listen in beings, by saying, "Thus have I heard, and that recollection is neither deficient nor excessive in meaning or wording; it should be understood exactly thus, and not otherwise."
Với ý nghĩa xác quyết – Đức Thế Tôn đã tán thán rằng: “Này các tỳ khưu, trong số các đệ tử tỳ khưu đa văn của Ta, người đứng đầu là Ānanda. Trong số những người có trí tuệ, có niệm, có kiên trì, có sự phục vụ, người đứng đầu là Ānanda.” Và vị Pháp tướng quân (Sāriputta) cũng đã tán thán rằng: “Tôn giả Ānanda là người thiện xảo về nghĩa (attha), thiện xảo về pháp (dhamma), thiện xảo về văn tự (byañjana), thiện xảo về ngữ nguyên (nirutti), thiện xảo về trước sau (pubbāpara).” Như vậy, để phù hợp với sự tán thán đó, Tôn giả Ānanda đã thể hiện sức mạnh ghi nhớ của mình, khiến chúng sinh phát sinh ý muốn lắng nghe, rằng: “Tôi đã nghe như vầy, và điều tôi đã nghe đó không thiếu không thừa, cả về nghĩa lẫn văn tự, phải được hiểu đúng như vậy, không được khác đi.”
55
Mesaddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me (tôi) được thấy có ba nghĩa.
Tathā hissa – ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (su. ni. 81) mayāti attho.
Indeed, in phrases like "What is sung for by verse is not to be eaten by me," the meaning is "by me."
Như trong câu: “Gāthābhigītaṃ me abhojaneyya” (Tôi không nên thọ dụng vật phẩm được cúng dường bằng cách xướng kệ), từ này có nghĩa là “mayā” (bởi tôi).
‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū ’’ tiādīsu (saṃ. ni. 4.88) mayhanti attho.
In phrases like "It would be good, venerable sir, if the Blessed One were to teach me the Dhamma in brief," the meaning is "to me."
Trong câu: “Sādhu me, bhante, Bhagavā saṃkhittena dhammaṃ desetū” (Bạch Thế Tôn, xin Thế Tôn hãy thuyết pháp tóm tắt cho con), từ này có nghĩa là “mayhaṃ” (cho tôi).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases like "Be my heirs in the Dhamma, monks," the meaning is "my."
Trong câu: “Dhammadāyādā me, bhikkhave, bhavathā” (Này các tỳ khưu, hãy là những người thừa tự Pháp của Ta), từ này có nghĩa là “mama” (của tôi).
Idha pana ‘‘mayā suta’’nti ca ‘‘mama suta’’nti ca atthadvaye yujjati.
Here, however, it is applicable in both meanings: "I have heard" and "it was heard by me."
Ở đây, từ này được sử dụng với cả hai nghĩa: “mayā sutaṃ” (tôi đã nghe) và “mama sutaṃ” (điều tôi đã nghe).
56
Sutanti ayaṃ sutasaddo saupasaggo anupasaggo ca gamana-vissuta-kilinnaupacitānuyoga-sotaviññeyya-sotadvārānusāraviññātādianekatthappabhedo.
The word sutaṃ (heard) — this word suta (heard), both with and without a prefix, has many distinctions in meaning, such as going, renowned, soaked, accumulated, diligent, cognizable by ear-consciousness, and known by following the ear-door.
Từ sutaṃ (đã nghe) này, dù có tiền tố hay không có tiền tố, có nhiều nghĩa khác nhau như: đi, nổi tiếng, bị ướt, tích lũy, chuyên tâm, được biết qua tai, được hiểu theo dòng chảy của cửa tai.
Tathā hissa – ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
Indeed, in phrases like "gone forth with the army," the meaning is "going."
Như trong câu: “Senāya pasuto” (đi cùng quân đội), từ này có nghĩa là “gacchanto” (đang đi).
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases like "for one who has heard the Dhamma and seen," the meaning is "one who has heard the renowned Dhamma."
Trong câu: “Sutadhammassa passato” (của người đã nghe Pháp và thấy Pháp), từ này có nghĩa là “vissutadhammassa” (của người đã nghe Pháp nổi tiếng).
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilinnākilinnassāti attho.
In phrases like "soaked for the one who is soaked," the meaning is "soaked for the one who is defiled."
Trong câu: “Avassutā avassutassā” (người nữ bị dâm dục làm ướt át đối với người nam bị dâm dục làm ướt át), từ này có nghĩa là “kilinnākilinnassa” (người bị ướt át đối với người bị ướt át).
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In phrases like "You have accumulated not a little merit," the meaning is "accumulated."
Trong câu: “Tumhehi puññaṃ pasutaṃ anappaka” (Các người đã tích lũy công đức không ít), từ này có nghĩa là “upacitaṃ” (đã tích lũy).
‘‘Ye jhānapasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases like "Those wise ones who are diligent in jhāna," the meaning is "devoted to jhāna."
Trong câu: “Ye jhānapasutā dhīrā” (những bậc trí chuyên tâm vào thiền định), từ này có nghĩa là “jhānānuyuttā” (chuyên tâm vào thiền định).
‘‘Diṭṭhaṃ sutaṃ muta’’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases like "seen, heard, perceived," the meaning is "cognizable by ear-consciousness."
Trong câu: “Diṭṭhaṃ sutaṃ muta” (điều đã thấy, đã nghe, đã cảm nhận), từ này có nghĩa là “sotaviññeyyaṃ” (điều được biết qua tai).
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases like "Dhamma-bearer, Dhamma-hoarder," the meaning is "bearer of what is known by following the ear-door."
Trong câu: “Sutadharo sutasannicayo” (người ghi nhớ điều đã nghe, người tích lũy điều đã nghe), từ này có nghĩa là “sotadvārānusāraviññātadharo” (người ghi nhớ điều đã được biết theo dòng chảy của cửa tai).
Idha panassa sotadvārānusārena upadhāritanti vā upadhāraṇanti vā attho.
Here, however, its meaning is either "recollected by following the ear-door" or "recollection by following the ear-door."
Ở đây, từ này có nghĩa là “upadhāritaṃ” (đã được ghi nhớ) hoặc “upadhāraṇaṃ” (sự ghi nhớ) thông qua dòng chảy của cửa tai.
Me-saddassa hi mayāti atthe sati – ‘‘evaṃ mayā sutaṃ, sotadvārānusārena upadhārita’’nti yujjati.
For when the word me means "by me," then "thus it was heard by me, recollected by following the ear-door" is applicable.
Khi từ “me” có nghĩa là “mayā” (bởi tôi), thì câu “evaṃ mayā sutaṃ, sotadvārānusārena upadhāritaṃ” (như vậy tôi đã nghe, đã được ghi nhớ qua dòng chảy của cửa tai) là hợp lý.
Mamāti atthe sati – ‘‘evaṃ mama sutaṃ, sotadvārānusārena upadhāraṇa’’nti yujjati.
When the word me means "my," then "thus my hearing, recollection by following the ear-door" is applicable.
Khi từ “me” có nghĩa là “mama” (của tôi), thì câu “evaṃ mama sutaṃ, sotadvārānusārena upadhāraṇaṃ” (như vậy điều tôi đã nghe, sự ghi nhớ qua dòng chảy của cửa tai) là hợp lý.
57
Evametesu tīsu padesu evanti sotaviññāṇādiviññāṇakiccanidassanaṃ.
Thus, among these three terms, evaṃ indicates the function of consciousness, such as ear-consciousness.
Như vậy, trong ba từ này, evaṃ là sự chỉ rõ chức năng của thức (viññāṇa) như thính thức (sotaviññāṇa) và các thức khác.
Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ.
Me indicates the individual endowed with the aforementioned consciousness.
Me là sự chỉ rõ cá nhân có đầy đủ thức đã nói.
Sutanti assavanabhāvapaṭikkhepato anūnānadhikāviparītaggahaṇanidassanaṃ.
Sutaṃ indicates a reception that is neither deficient nor excessive nor mistaken, by refuting the state of not having heard.
Sutaṃ là sự chỉ rõ sự nắm bắt không thiếu, không thừa, không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Tathā evanti tassa sotadvārānusārena pavattāya viññāṇavīthiyā nānappakārena ārammaṇe pavattibhāvappakāsanaṃ.
Likewise, evaṃ clarifies the manner in which the consciousness-process, arising through the ear-door, occurs in various ways with regard to the object.
Cũng vậy, evaṃ là sự công bố trạng thái vận hành của lộ trình thức (viññāṇavīthi) đã khởi lên theo dòng chảy của cửa tai, vận hành trên đối tượng theo nhiều cách khác nhau.
Meti attappakāsanaṃ.
Me is the expression of oneself.
Me là sự công bố về bản thân.
Sutanti dhammappakāsanaṃ.
Sutaṃ is the expression of the Dhamma.
Sutaṃ là sự công bố về Pháp.
Ayañhettha saṅkhepo – ‘‘nānappakārena ārammaṇe pavattāya viññāṇavīthiyā mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo suto’’ti.
The summary here is: "By the consciousness-process occurring in various ways regarding the object, nothing else was done by me; but this was done; this Dhamma was heard."
Đây là tóm tắt ở đây: “Tôi không làm điều gì khác ngoài việc nghe Pháp này bằng lộ trình thức đã vận hành trên đối tượng theo nhiều cách khác nhau.”
58
Tathā evanti niddisitabbappakāsanaṃ.
Likewise, evaṃ reveals what is to be indicated.
Cũng vậy, evaṃ là sự công bố điều cần được chỉ rõ.
Meti puggalappakāsanaṃ.
Me reveals the individual.
Me là sự công bố về cá nhân.
Sutanti puggalakiccappakāsanaṃ.
Sutaṃ reveals the individual's function.
Sutaṃ là sự công bố về hành động của cá nhân.
Idaṃ vuttaṃ hoti – ‘‘yaṃ suttaṃ niddisissāmi, taṃ mayā evaṃ suta’’nti.
This is what is meant: "The Sutta that I shall indicate was heard by me in this manner."
Điều này có nghĩa là: “Bất cứ bài kinh nào tôi sẽ trình bày, bài kinh đó tôi đã nghe như vầy.”
59
Tathā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanagahaṇaṃ hoti, tassa nānākāraniddeso.
Likewise, evaṃ is the indication of the various modes of the mind-continuum, by the various modes of its occurrence, by which the grasping of various meanings and expressions takes place.
Cũng vậy, evaṃ là sự chỉ rõ các cách khác nhau của dòng tâm thức (cittasantāna) mà nhờ sự vận hành đa dạng của nó, sự nắm bắt các nghĩa và văn tự khác nhau xảy ra.
Evanti hi ayaṃ ākārapaññatti.
Indeed, evaṃ is a designation of mode.
Thật vậy, evaṃ là một sự chế định về cách thức.
Meti kattuniddeso.
Me is the designation of the agent.
Me là sự chỉ rõ người thực hiện.
Sutanti visayaniddeso.
Sutaṃ is the designation of the object.
Sutaṃ là sự chỉ rõ đối tượng.
Ettāvatā nānākārappavattena cittasantānena taṃsamaṅgino kattuvisaye gahaṇasanniṭṭhānaṃ kataṃ hoti.
By this much, it is affirmed that the grasping of the object of the agent, who is endowed with that mind-continuum that has occurred in various modes, has taken place.
Cho đến đây, sự quyết định về việc nắm bắt đối tượng của người thực hiện, người có dòng tâm thức vận hành theo nhiều cách khác nhau, đã được thực hiện.
60
Atha vā evanti puggalakiccaniddeso.
Alternatively, evaṃ is the indication of the individual's function.
Hoặc, evaṃ là sự chỉ rõ hành động của cá nhân.
Sutanti viññāṇakiccaniddeso.
Sutaṃ is the indication of the consciousness's function.
Sutaṃ là sự chỉ rõ hành động của thức.
Meti ubhayakiccayuttapuggalaniddeso.
Me is the indication of the individual endowed with both functions.
Me là sự chỉ rõ cá nhân có liên quan đến cả hai hành động.
Ayaṃ panettha saṅkhepo – ‘‘mayā savanakiccaviññāṇasamaṅginā puggalena viññāṇavasena laddhasavanakiccavohārena suta’’nti.
The summary here is: "I, the individual endowed with the consciousness of the hearing function, heard it by the conventional expression of having received the hearing function by way of consciousness."
Đây là tóm tắt ở đây: “Tôi, một cá nhân có đầy đủ thức của hành động lắng nghe, đã nghe bằng cách sử dụng thuật ngữ hành động lắng nghe thông qua thức.”
61
Tattha evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
In this context, both evaṃ and me are designations that do not exist in the ultimate sense of true reality.
Trong đó, evaṃme là những chế định không tồn tại theo nghĩa chân đế tuyệt đối.
Kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha.
For what here truly exists in the ultimate sense that could be designated as "thus" or "by me"?
Thật vậy, cái gì ở đây tồn tại theo nghĩa tuyệt đối mà có thể được chỉ định là “evaṃ” hay “me”?
Sutanti vijjamānapaññatti.
Sutaṃ is an existing designation.
Sutaṃ là một chế định tồn tại.
Yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
For what was perceived here by the ear exists in the ultimate sense.
Vì điều đã được nhận biết bằng tai ở đây là tồn tại theo nghĩa tuyệt đối.
Tathā evanti ca meti ca taṃ taṃ upādāya vattabbato upādāpaññatti.
Likewise, both evaṃ and me are designations based on dependence, because they are spoken of by reference to various things.
Cũng vậy, evaṃme là những chế định nương tựa (upādāpaññatti), bởi vì chúng được nói ra dựa trên những điều đó.
Sutanti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a designation based on comparison, because it is spoken of by referring to what has been seen, and so on.
Sutaṃ là một chế định đối chiếu (upanidhāpaññatti), bởi vì nó được nói ra bằng cách so sánh với những điều đã thấy, v.v.
62
Ettha ca evanti vacanena asammohaṃ dīpeti.
Here, by the word evaṃ, he demonstrates non-confusion.
Ở đây, bằng lời nói evaṃ, Tôn giả Ānanda thể hiện sự không lầm lẫn.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti.
For one who is confused is not capable of penetrating things in various ways.
Vì người lầm lẫn không thể thấu hiểu nhiều cách khác nhau.
Sutanti vacanena sutassa asammosaṃ dīpeti.
By the word sutaṃ, he demonstrates the non-forgetfulness of what was heard.
Bằng lời nói sutaṃ, Tôn giả thể hiện sự không quên lãng điều đã nghe.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantarena mayā sutanti paṭijānāti.
For if what a person has heard is forgotten, he does not later acknowledge, "I heard it."
Vì người mà điều đã nghe bị quên lãng thì sau này không thể xác nhận rằng “tôi đã nghe điều này.”
Iccassa asammohena paññāsiddhi, asammosena pana satisiddhi.
Thus, by his non-confusion, the attainment of wisdom is achieved; by his non-forgetfulness, the attainment of mindfulness is achieved.
Như vậy, nhờ sự không lầm lẫn mà trí tuệ được thành tựu, còn nhờ sự không quên lãng mà niệm được thành tựu.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā, satipubbaṅgamāya paññāya atthapaṭivedhasamatthatā.
In this, with mindfulness preceded by wisdom, there is the ability to ascertain the wording; with wisdom preceded by mindfulness, there is the ability to penetrate the meaning.
Trong đó, nhờ niệm có trí tuệ dẫn đầu mà có khả năng ghi nhớ văn tự, và nhờ trí tuệ có niệm dẫn đầu mà có khả năng thấu hiểu nghĩa.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthato dhammabhaṇḍāgārikattasiddhi.
By being endowed with the ability in both, the attainment of being the Treasurer of the Dhamma is achieved, due to being capable of preserving the treasury of Dhamma, rich in both meaning and wording.
Nhờ khả năng kép này, và nhờ khả năng bảo vệ kho tàng Pháp (dhammakosa) đầy đủ cả nghĩa và văn tự, mà sự thành tựu của người giữ kho tàng Pháp (dhammabhaṇḍāgārika) được xác lập.
63
Aparo nayo – evanti vacanena yoniso manasikāraṃ dīpeti, ayoniso manasikaroto hi nānappakārapaṭivedhābhāvato.
Another method: By the word evaṃ, he indicates proper attention, for there is no penetration in various ways for one who pays improper attention.
Một cách giải thích khác – bằng lời nói evaṃ, Tôn giả thể hiện sự tác ý đúng đắn (yoniso manasikāra), vì người tác ý sai lầm (ayoniso manasikāra) thì không có khả năng thấu hiểu nhiều cách khác nhau.
Sutanti vacanena avikkhepaṃ dīpeti vikkhittacittassa savanābhāvato.
By the word sutaṃ, he indicates non-distraction, for there is no hearing for one whose mind is distracted.
Bằng lời nói sutaṃ, Tôn giả thể hiện sự không xao nhãng, vì người có tâm xao nhãng thì không thể lắng nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Thus, indeed, even if a distracted person is spoken to with every perfection, he says, "I did not hear, please speak again."
Thật vậy, một người có tâm xao nhãng, dù được nói cho nghe tất cả mọi điều, vẫn nói: “Tôi chưa nghe, xin hãy nói lại.”
Yoniso manasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti, sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Through proper attention, he accomplishes right aspiration for oneself and accumulated merit from previous existences, as it is absent in one who has not rightly aspired oneself or one who has not accumulated merit before.
Ở đây, nhờ tác ý đúng đắn mà Tôn giả thành tựu sự tự định hướng đúng đắn và công đức đã tạo trong quá khứ, vì người không tự định hướng đúng đắn hoặc chưa tạo công đức trong quá khứ thì không có những điều đó.
Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti.
Through non-distraction, he accomplishes hearing the true Dhamma and associating with good people.
Nhờ không xao nhãng mà Tôn giả thành tựu việc lắng nghe Chánh pháp và sự nương tựa vào bậc thiện trí (sappurisūpanissaya).
Na hi vikkhittacitto sotuṃ sakkoti, na ca sappurise anupanissayamānassa savanaṃ atthīti.
For a distracted person cannot hear, and there is no hearing for one who does not associate with good people.
Vì người có tâm xao nhãng không thể lắng nghe, và người không nương tựa vào bậc thiện trí thì không có sự lắng nghe.
64
Aparo nayo – yasmā ‘‘evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso’’ti vuttaṃ, so ca evaṃ bhaddako ākāro na sammā appaṇihitattano pubbe akatapuññassa vā hoti, tasmā evanti iminā bhaddakena ākārena pacchimacakkadvayasampattimattano dīpeti.
Another method: Since it was stated, "by evaṃ is indicated the various modes of the mind-continuum, by the various modes of its occurrence, by which the grasping of various meanings and expressions takes place," and such an excellent mode does not occur for one who has not rightly aspired oneself or one who has not accumulated merit before, therefore, by this excellent mode of evaṃ, he indicates his own attainment of the two latter factors (right aspiration and accumulated merit).
Một cách giải thích khác – bởi vì đã nói rằng “evaṃ là sự chỉ rõ các cách khác nhau của dòng tâm thức mà nhờ sự vận hành đa dạng của nó, sự nắm bắt các nghĩa và văn tự khác nhau xảy ra,” và cách thức tốt đẹp này không có ở người không tự định hướng đúng đắn hoặc chưa tạo công đức trong quá khứ, do đó, bằng cách thức tốt đẹp này, Tôn giả thể hiện sự thành tựu của hai bánh xe cuối cùng.
Sutanti savanayogena purimacakkadvayasampattiṃ.
By sutaṃ (heard), he indicates the attainment of the two former factors (residing in a suitable place and associating with good people) through the act of hearing.
Sutaṃ thể hiện sự thành tựu của hai bánh xe đầu tiên thông qua sự lắng nghe.
Na hi appatirūpadese vasato sappurisūpanissayavirahitassa vā savanaṃ atthi.
For there is no hearing for one who dwells in an unsuitable place or who is without the support of good people.
Vì người sống ở nơi không thích hợp hoặc người không nương tựa vào bậc thiện trí thì không có sự lắng nghe.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhi siddhā hoti, purimacakkadvayasiddhiyā payogasuddhi, tāya ca āsayasuddhiyā adhigamabyattisiddhi, payogasuddhiyā āgamabyattisiddhi.
Thus, by the accomplishment of his two latter wheels, purity of aspiration is accomplished; by the accomplishment of his two former wheels, purity of application. And by that purity of aspiration, proficiency in attainment is accomplished; by purity of application, proficiency in learning is accomplished.
Do sự thành tựu của hai bánh xe sau, ý chí của vị ấy (Ānanda) được thanh tịnh; do sự thành tựu của hai bánh xe trước, sự tinh tấn được thanh tịnh. Và do sự thanh tịnh của ý chí đó, trí tuệ chứng đắc được thành tựu; do sự thanh tịnh của tinh tấn, trí tuệ về kinh điển được thành tựu.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggaṃ viya sūriyassa udayato, yoniso manasikāro viya ca kusalakammassa, arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento evaṃ me sutantiādimāha.
Thus, the utterance of such a venerable one, pure in application and aspiration, accomplished in learning and attainment, is fit to be a precursor to the Buddha’s word, just as the rising dawn is to the rising sun, and proper attention to wholesome kamma. Wishing to establish a prelude in the proper place, he said, " Thus have I heard," and so on.
Như vậy, lời nói của vị có tinh tấn và ý chí thanh tịnh, đầy đủ kinh điển và chứng đắc, xứng đáng làm tiền đề cho lời dạy của Đức Bhagavā, giống như bình minh là điềm báo mặt trời mọc, và sự tác ý đúng đắn (yoniso manasikāra) là điềm báo của nghiệp thiện. Do đó, muốn đặt lời dẫn nhập vào chỗ thích hợp, Ngài (Ānanda) đã nói câu mở đầu là “Như vầy tôi nghe” (Evaṃ me sutaṃ).
65
Aparo nayo – evanti iminā nānappakārapaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another method: With the word " Evaṃ" (Thus), which indicates the penetration of various kinds of meaning, he reveals the presence of his own accomplishment in the paṭisambhidās of meaning (attha-paṭisambhidā) and ready wit (paṭibhāna-paṭisambhidā).
Một cách giải thích khác – Với lời nói “Như vầy” (Evaṃ), biểu thị sự thấu hiểu đa dạng, Ngài (Ānanda) biểu lộ sự thành tựu của mình về tuệ phân tích nghĩa (atthapaṭibhāna-paṭisambhidā).
Sutanti iminā sotabbabhedapaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ.
With the word " Sutaṃ" (heard), which indicates the penetration of the varieties of what is to be heard, he reveals the presence of his accomplishment in the paṭisambhidās of Dhamma (dhamma-paṭisambhidā) and language (nirutti-paṭisambhidā).
Với lời nói “tôi nghe” (sutaṃ), biểu thị sự thấu hiểu các loại điều đáng nghe, Ngài biểu lộ sự thành tựu của mình về tuệ phân tích pháp (dhamma-paṭisambhidā) và tuệ phân tích ngôn ngữ (nirutti-paṭisambhidā).
Evanti ca idaṃ yoniso manasikāradīpakavacanaṃ bhāsamāno – ‘‘ete mayā dhammā manasānupekkhitā diṭṭhiyā suppaṭividdhā’’ti dīpeti.
Moreover, by uttering this word " Evaṃ," which indicates proper attention (yoniso manasikāra), he reveals, "These Dhammas have been reflected upon by me with the mind and well penetrated with wisdom (diṭṭhiyā suppaṭividdhā)."
Và khi nói lời “Như vầy” (Evaṃ), lời nói biểu thị sự tác ý đúng đắn (yoniso manasikāra), Ngài biểu lộ rằng: “Những pháp này đã được tôi quán xét bằng tâm, đã được tôi thấu hiểu rõ ràng bằng tuệ.”
Sutanti idaṃ savanayogadīpakavacanaṃ bhāsamāno – ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By uttering this word " Sutaṃ," which indicates the suitability for listening, he reveals, "Many Dhammas have been heard by me, held in mind, and well-recited verbally."
Khi nói lời “tôi nghe” (sutaṃ), lời nói biểu thị sự thích hợp để nghe, Ngài biểu lộ rằng: “Nhiều pháp đã được tôi nghe, đã được tôi ghi nhớ, đã được tôi thực hành bằng lời nói.”
Tadubhayenapi atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both of these, he shows the completeness of meaning and expression, and thus generates respect for listening.
Bằng cả hai điều đó, Ngài biểu lộ sự viên mãn về nghĩa và văn, và khơi dậy lòng kính trọng đối với việc lắng nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti ādaraṃ janetvā sakkaccaṃ dhammo sotabboti.
Indeed, one who does not listen respectfully to Dhamma complete with meaning and expression is excluded from great benefit. Therefore, generating respect, the Dhamma should be listened to with care.
Vì người không lắng nghe Giáo Pháp đầy đủ nghĩa và văn một cách kính trọng sẽ bị thiếu mất lợi ích lớn lao; do đó, sau khi khơi dậy lòng kính trọng, Ngài muốn nói rằng Giáo Pháp cần được lắng nghe một cách cẩn trọng.
66
Evaṃ me sutanti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammaṃ attano adahanto asappurisabhūmiṃ atikkamati, sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati.
Furthermore, by this entire phrase, " Evaṃ me sutaṃ," Venerable Ānanda, by not attributing the Dhamma proclaimed by the Tathāgata to himself, transcends the stage of a bad person, and by declaring himself a disciple, he enters the stage of a good person.
Tuy nhiên, với toàn bộ lời nói “Như vầy tôi nghe” (Evaṃ me sutaṃ), Tôn giả Ānanda không tự nhận mình là người đã tạo ra Giáo Pháp do Đức Như Lai thuyết giảng, Ngài vượt qua địa vị của kẻ không phải bậc thiện nhân. Ngài tự nhận mình là một đệ tử, Ngài bước vào địa vị của bậc thiện nhân.
Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti.
Similarly, he causes the mind to rise from false Dhamma and establishes the mind in true Dhamma.
Cũng vậy, Ngài đưa tâm thoát khỏi tà pháp và đặt tâm vững chắc vào chánh pháp.
‘‘Kevalaṃ sutamevetaṃ mayā, tasseva pana bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
By indicating, "This was merely heard by me; it is indeed the word of the Bhagavā," he frees himself, points to the Teacher, sets forth the word of the Conqueror, and establishes the guiding principle of the Dhamma.
Ngài biểu lộ: “Đây chỉ là điều tôi đã nghe, là lời dạy của chính Đức Bhagavā đó,” Ngài tự giải thoát mình, Ngài chỉ rõ Đức Đạo Sư, Ngài trình bày lời dạy của Đức Phật, Ngài thiết lập con đường của Giáo Pháp.
67
Apica ‘‘evaṃ me suta’’nti attanā uppāditabhāvaṃ appaṭijānanto purimavacanaṃ vivaranto – ‘‘sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa vacanaṃ, na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kattabbā’’ti sabbadevamanussānaṃ imasmiṃ dhamme assaddhiyaṃ vināseti, saddhāsampadaṃ uppādetīti.
Moreover, by not claiming that the Dhamma was produced by himself, but rather by revealing the former statement, " Evaṃ me sutaṃ" ("This word was received by me directly from that Bhagavā, who is fearless through the four kinds of self-confidence, endowed with the ten powers, established in the state of the Chief Bull, roaring the lion's roar, supreme among all beings, the lord of Dhamma, the King of Dhamma, the master of Dhamma, the lamp of Dhamma, the refuge of Dhamma, the noble universal monarch of the True Dhamma, the Perfectly Self-Enlightened One. There should be no doubt or indecision concerning the meaning, the Dhamma, the word, or the letter herein"), he dispels the lack of faith in this Dhamma among all devas and humans, and generates the accomplishment of faith.
Hơn nữa, khi nói “Như vầy tôi nghe” (Evaṃ me sutaṃ), Ngài không tự nhận là mình đã tạo ra, mà Ngài giải thích lời nói trước đó rằng: “Lời dạy này đã được tôi tiếp nhận trực tiếp từ Đức Bhagavā, bậc đã thông suốt bốn sự vô úy, bậc nắm giữ mười lực, bậc đứng vững ở vị trí tối thượng, bậc rống tiếng sư tử hống, bậc tối thượng trong tất cả chúng sanh, bậc chủ tể của Pháp, bậc Pháp vương, bậc lãnh đạo của Pháp, ngọn đèn của Pháp, nơi nương tựa của Pháp, bậc Chuyển luân vương tối thượng của Chánh pháp, bậc Chánh Đẳng Giác. Không có sự nghi ngờ hay hoài nghi nào cần phải có về nghĩa, về Pháp, về từ ngữ hay về văn tự trong lời dạy này.” Như vậy, Ngài tiêu diệt sự bất tín của tất cả chư thiên và loài người đối với Giáo Pháp này, và tạo ra sự thành tựu về niềm tin.
Tenetaṃ vuccati –
Therefore, it is said:
Vì thế, điều này được nói:
68
‘‘Vināsayati assaddhaṃ, saddhaṃ vaḍḍheti sāsane;
“He destroys the faithless, and increases faith in the Dispensation;
“Đệ tử của Đức Gotama,
69
Evaṃ me sutamiccevaṃ, vadaṃ gotamasāvako’’ti.
Such is the disciple of Gotama, saying, ‘Thus have I heard.’”
Khi nói ‘Như vầy tôi nghe’,
70
Ekanti gaṇanaparicchedaniddeso.
" Ekaṃ" is an indication of numerical specification.
Diệt trừ sự bất tín,
Samayanti paricchinnaniddeso.
" Samayaṃ" is a specific indication.
Tăng trưởng niềm tin trong Giáo Pháp.”
Ekaṃ samayanti aniyamitaparidīpanaṃ.
" Ekaṃ samayaṃ" is an unspecified indication.
“Một” (Ekaṃ) là sự chỉ định phân định số lượng.
Tattha samayasaddo –
Here, the word " samaya"
“Lúc” (Samayaṃ) là sự chỉ định được phân định.
71
‘‘Samavāye khaṇe kāle, samūhe hetudiṭṭhisu;
"Is seen in the meanings of concurrence, moment, time, assembly, cause, and view;
“Một lúc” (Ekaṃ samayaṃ) là sự biểu thị không xác định.
72
Paṭilābhe pahāne ca, paṭivedhe ca dissati’’.
And in attainment, abandonment, and penetration."
Trong đó, từ samaya (lúc) –
73
Tathā hissa ‘‘appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho.
Thus, in passages like "Perhaps tomorrow we might approach, having regard for the time and the occasion," the meaning is concurrence.
“Được thấy trong sự tụ hội, khoảnh khắc, thời gian, tập hợp, nguyên nhân, quan điểm,
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo.
In passages like "There is indeed, bhikkhus, only one moment, one occasion for the practice of the holy life," the meaning is moment.
Trong sự đạt được, sự từ bỏ, và sự thấu hiểu.”
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
In passages like "Hot season, oppressive season," the meaning is time.
Thật vậy, đối với từ này, trong các câu như “Có lẽ ngày mai chúng ta sẽ đến, tùy theo thời gian và sự hội tụ” (Dī. Ni. 1.447), nghĩa là sự tụ hội.
‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho.
In passages like "A great assembly in the forest," the meaning is assembly.
Trong các câu như “Này các tỳ khưu, chỉ có một khoảnh khắc và một thời điểm để sống đời Phạm hạnh” (A. Ni. 8.29), nghĩa là khoảnh khắc.
‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati – ‘bhaddāli, nāma bhikkhu satthusāsane sikkhāya aparipūrakārī’ti.
In passages like "But, Bhaddāli, that occasion was not fully understood by you. The Bhagavā is dwelling at Sāvatthī. The Bhagavā will know me: ‘The bhikkhu named Bhaddāli is one who is not fulfilling the training in the Teacher’s Dispensation.’ This occasion, too, Bhaddāli, was not fully understood by you," the meaning is cause.
Trong các câu như “Mùa nóng, mùa oi bức” (Pāci. 358), nghĩa là thời gian.
Ayampi kho te, bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
In passages like "At that time, the wandering ascetic Uggāhamāno, son of Samaṇamuṇḍikā, was residing in the Tindukācīra, in a single hall in Mallikā's park, where disputants on views (samayappavādaka) gathered," the meaning is view.
Trong các câu như “Đại hội trong rừng” (Dī. Ni. 2.332), nghĩa là tập hợp.
‘‘Tena kho pana samayena uggāhamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
In passages like "Then, at that time, the wandering ascetic Uggāhamāno, son of Samaṇamuṇḍikā, was residing in a single hall with a tinduka-tree enclosure in Mallikā's park, where those who proclaim views (samayappavādake) gathered," the meaning is view.
Trong các câu như “Này Bhaddāli, nguyên nhân đó cũng không được ông thấu hiểu. Đức Bhagavā đang trú tại Sāvatthī, Đức Bhagavā sẽ biết ta – ‘Tỳ khưu tên Bhaddāli là người không hoàn thành giới luật trong giáo pháp của Đức Đạo Sư.’ Này Bhaddāli, nguyên nhân này cũng không được ông thấu hiểu” (Ma. Ni. 2.135), nghĩa là nguyên nhân.
74
‘‘Diṭṭhe dhamme ca yo attho, yo cattho samparāyiko;
“That benefit which is visible, and that benefit which is for the future;
Trong các câu như “Vào lúc đó, du sĩ Uggāhamāno, con trai của Samaṇamuṇḍikā, đang trú tại Tindukācīra, một ngôi nhà duy nhất trong khu vườn Mallikā, nơi có những người thuyết giảng các quan điểm khác nhau” (Ma. Ni. 2.260), nghĩa là quan điểm.
75
Atthābhisamayā dhīro, paṇḍitoti pavuccatī’’ti–
A wise person, through the attainment of benefit, is called a paṇḍita.”
“Người trí tuệ, do thấu hiểu nghĩa,
76
Ādīsu (saṃ. ni. 1.129) paṭilābho.
In passages like these, the meaning is attainment.
Được gọi là bậc hiền trí, cả về lợi ích hiện tại và lợi ích mai sau.”
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (ma. ni. 1.28) pahānaṃ.
In passages like "Through the right abandonment of conceit, he made an end of suffering," the meaning is abandonment.
Trong các câu như trên (Saṃ. Ni. 1.129), nghĩa là sự đạt được.
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. ma. 2.8) paṭivedho.
In passages like "Suffering has the meaning of affliction, the meaning of being conditioned, the meaning of torment, the meaning of change, the meaning of penetration," the meaning is penetration.
Trong các câu như “Do thấu hiểu đúng đắn sự kiêu mạn, đã chấm dứt khổ đau” (Ma. Ni. 1.28), nghĩa là sự từ bỏ.
Idha panassa kālo attho.
But here, its meaning is time.
Trong các câu như “Nghĩa của khổ là bị bức bách, là được tạo tác, là bị thiêu đốt, là biến đổi, là được thấu hiểu” (Paṭi. Ma. 2.8), nghĩa là sự thấu hiểu.
Tena saṃvacchara-utu-māsaḍḍhamāsa-ratti-diva-pubbaṇha-majjhanhika-sāyanha-paṭhamamajjhimapacchimayāma-muhuttādīsu kālappabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
Thereby, it indicates one occasion among the various divisions of time, such as years, seasons, months, half-months, nights, days, forenoons, mid-days, evenings, first, middle, and last watches of the night, and moments.
Ở đây, nghĩa của từ đó là thời gian.
77
Tattha kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yasmiṃ yasmiṃ saṃvacchare utumhi māse pakkhe rattibhāge divasabhāge vā vuttaṃ, sabbaṃ taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Even though the Elder knew well and had perfectly comprehended with wisdom every Sutta that was spoken in any particular year, season, month, fortnight, night-part, or day-part among these times—years and so on—
Do đó, từ này biểu thị “một lúc” trong các thời điểm phân loại theo thời gian như năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, buổi trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v.
Yasmā pana ‘‘evaṃ me sutaṃ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vā’’ti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
However, since it would be difficult to memorize, recite, or have others recite if it were stated, "This Sutta was heard by me in such and such a year, in such and such a season, in such and such a month, in such and such a fortnight, in such and such a night-part, or in such and such a day-part," and it would involve much to say, therefore, he summarized that meaning with a single word and said, " Ekaṃ samayaṃ."
Trong đó, mặc dù Tôn giả Ānanda đã biết rõ và phân định rõ ràng bằng tuệ về năm, mùa, tháng, nửa tháng, phần đêm hay phần ngày mà mỗi bài kinh được thuyết giảng; nhưng vì nếu nói “Như vầy tôi nghe vào năm này, mùa này, tháng này, nửa tháng này, phần đêm này, hoặc phần ngày này” thì không thể dễ dàng ghi nhớ, hoặc tự học, hoặc dạy người khác học, và sẽ phải nói rất nhiều; do đó, Ngài đã tóm tắt ý nghĩa đó chỉ bằng một từ và nói “Ekaṃ samayaṃ” (Một lúc).
78
Ye vā ime gabbhokkantisamayo jātisamayo saṃvegasamayo abhinikkhamanasamayo dukkarakārikasamayo māravijayasamayo abhisambodhisamayo diṭṭhadhammasukhavihārasamayo desanāsamayo parinibbānasamayoti evamādayo bhagavato devamanussesu ativiya suppakāsā anekakālappabhedā eva samayā.
Or there are these many diverse times of the Bhagavā, which are extremely well-known among devas and humans: the time of conception, the time of birth, the time of spiritual urgency, the time of renunciation, the time of severe ascetic practices, the time of Māra's defeat, the time of full enlightenment, the time of dwelling in present happiness, the time of teaching, and the time of parinibbāna.
Hoặc những thời điểm như thời điểm nhập thai, thời điểm đản sanh, thời điểm khởi phát cảm hứng, thời điểm xuất gia, thời điểm khổ hạnh, thời điểm chiến thắng Ma vương, thời điểm giác ngộ tối thượng, thời điểm an trú hạnh phúc trong hiện tại, thời điểm thuyết pháp, thời điểm nhập Niết Bàn – những thời điểm này của Đức Bhagavā rất rõ ràng đối với chư thiên và loài người, và chính là những phân loại thời gian đa dạng.
Tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Among these times, he indicates one time, specifically the time of teaching.
Trong những thời điểm đó, Ngài biểu thị “một lúc” là thời điểm thuyết pháp.
Yo cāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahitapaṭipattisamayesu parahitapaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammikathāsamayo, desanāpaṭipattisamayesu desanāsamayo, tesupi samayesu aññataraṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
Referring to one of these times also—the time of the duty of compassion among the times of the duties of knowledge and compassion, the time of practice for the welfare of others among the times of practice for one's own welfare and the welfare of others, the time of Dhamma talk among the times of the two duties for those who have gathered, and the time of teaching among the times of teaching and practice—he said, " Ekaṃ samayaṃ."
Và trong các thời điểm của công việc trí tuệ và công việc từ bi, đó là thời điểm của công việc từ bi; trong các thời điểm thực hành lợi ích cho mình và lợi ích cho người khác, đó là thời điểm thực hành lợi ích cho người khác; trong các thời điểm của hai việc cần làm của các vị đã tụ hội, đó là thời điểm thuyết pháp; trong các thời điểm thuyết pháp và thực hành, đó là thời điểm thuyết pháp; trong những thời điểm đó, Ngài cũng đề cập đến một trong số đó và nói “Ekaṃ samayaṃ” (Một lúc).
79
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacara’’nti ca ito aññesu suttapadesu ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī’’ti ca bhummavacanena niddeso kato, vinaye ca ‘‘tena samayena buddho bhagavā’’ti karaṇavacanena, tathā akatvā ‘‘ekaṃ samaya’’nti upayogavacanena niddeso katoti.
Why is it that here, unlike in the Abhidhamma where "in which time, kāma-realm..." and in other Sutta passages where "in which time, bhikkhus, a bhikkhu secluded from sense pleasures..." are stated with the locative case, and in the Vinaya where "at that time, the Buddha, the Bhagavā..." is stated with the instrumental case, here it is stated with the accusative case " ekaṃ samayaṃ"?
Tại sao ở đây không dùng cách chỉ định bằng cách dùng cách nói vị trí (locative case) như trong Abhidhamma “Yasmiṃ samaye kāmāvacara…” (Vào lúc nào, thuộc về cõi dục…) và trong các bài kinh khác “Yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī…” (Này các tỳ khưu, vào lúc nào, một tỳ khưu ly dục…), và trong Vinaya dùng cách nói công cụ (instrumental case) “Tena samayena buddho bhagavā…” (Vào lúc đó, Đức Phật, Đức Bhagavā…), mà lại dùng cách nói đối cách (accusative case) “Ekaṃ samayaṃ” (Một lúc)?
Tattha tathā, idha ca aññathā atthasambhavato.
Because the meaning is thus in those cases, and otherwise here.
Ở đó là như vậy, và ở đây là khác, do sự khác biệt về ý nghĩa.
Tattha hi abhidhamme ito aññesu suttapadesu ca adhikaraṇattho bhāvenabhāvalakkhaṇattho ca sambhavati.
For in the Abhidhamma and in other suttas besides this, the meaning of location (adhikaraṇa) and the meaning of characteristic of being (bhāvenabhāvalakkhaṇa) are possible.
Trong tạng Abhidhamma và trong các đoạn kinh khác ngoài (kinh này), ý nghĩa của túc từ (adhikaraṇa) và ý nghĩa của dấu hiệu hành động (bhāvenabhāvalakkhaṇa) đều có thể xảy ra.
Adhikaraṇañhi kālattho samūhattho ca samayo, tattha vuttānaṃ phassādidhammānaṃ khaṇasamavāyahetusaṅkhātassa ca samayassa bhāvena tesaṃ bhāvo lakkhīyati.
For the term 'samaya' signifies time and collection (samūha), and in it, the existence of the phenomena such as contact (phassa) that are mentioned is characterized by the existence of the samaya, which refers to the moment (khaṇa), concomitance (samavāya), and cause (hetu).
Quả thật, từ ‘samaya’ (thời) có nghĩa là thời gian (kāla) hoặc tập hợp (samūha) là túc từ cho các pháp như xúc (phassa) đã được nói đến trong đó. Và do sự hiện hữu của ‘samaya’ được gọi là sát-na (khaṇa), sự đồng thời (samavāya) và nhân (hetu), sự hiện hữu của các pháp ấy được nhận biết.
Tasmā tadatthajotanatthaṃ tattha bhummavacananiddeso kato.
Therefore, to illuminate that meaning, the locative case (bhummavacana) is used there.
Vì vậy, để làm rõ ý nghĩa đó, cách dùng từ ở thể sở thuộc (bhummavacana) đã được sử dụng ở đó.
80
Vinaye ca hetuattho karaṇattho ca sambhavati.
And in the Vinaya, the meaning of cause (hetu) and the meaning of instrument (karaṇa) are possible.
Trong Luật tạng (Vinaya), ý nghĩa của nguyên nhân (hetu) và ý nghĩa của công cụ (karaṇa) đều có thể xảy ra.
Yo hi so sikkhāpadapaññattisamayo sāriputtādīhipi dubbiññeyyo, tena samayena hetubhūtena karaṇabhūtena ca sikkhāpadāni paññāpayanto sikkhāpadapaññattihetuñca apekkhamāno bhagavā tattha tattha vihāsi.
For the time of the promulgation of the training rule (sikkhāpada), which was difficult even for Sāriputta and others to discern, the Blessed One resided here and there, using that time as a cause and as an instrument for promulgating the training rules, and anticipating the reason for the promulgation of the training rules.
Quả thật, Đức Thế Tôn đã trú ở nhiều nơi, ban hành các giới luật (sikkhāpada) với ‘samaya’ (thời) ấy làm nguyên nhân và công cụ, và Ngài cũng đã cân nhắc đến nguyên nhân ban hành giới luật, mà ngay cả các bậc Thượng thủ như Xá-lợi-phất cũng khó lòng thấu hiểu.
Tasmā tadatthajotanatthaṃ tattha karaṇavacanena niddeso kato.
Therefore, to illuminate that meaning, the instrumental case (karaṇavacana) is used there.
Vì vậy, để làm rõ ý nghĩa đó, cách dùng từ ở thể công cụ (karaṇavacana) đã được sử dụng ở đó.
81
Idha pana aññasmiṃ ca evaṃjātike accantasaṃyogattho sambhavati.
Here, however, and in other instances of this kind, the meaning of continuous association (accantasaṃyoga) is possible.
Tuy nhiên, ở đây và trong các trường hợp tương tự khác, ý nghĩa của sự liên kết tuyệt đối (accantasaṃyoga) có thể xảy ra.
Yañhi samayaṃ bhagavā imaṃ aññaṃ vā suttantaṃ desesi, accantameva taṃ samayaṃ karuṇāvihārena vihāsi.
For during whichever time the Blessed One taught this or another Sutta, for that entire time, he continuously resided in a state of compassion (karuṇāvihāra).
Quả thật, vào bất cứ thời điểm nào Đức Thế Tôn thuyết giảng kinh này hay một kinh khác, Ngài luôn luôn trú trong lòng bi mẫn (karuṇāvihāra) trong suốt thời gian đó.
Tasmā tadatthajotanatthaṃ idha upayogavacananiddeso katoti.
Therefore, to illuminate that meaning, the accusative case (upayogavacana) is used here.
Vì vậy, để làm rõ ý nghĩa đó, cách dùng từ ở thể đối cách (upayogavacana) đã được sử dụng ở đây.
82
Tenetaṃ vuccati –
Because of this, it is said:
Vì vậy, điều này được nói là:
83
‘‘Taṃ taṃ atthamapekkhitvā, bhummena karaṇena ca;
“Considering each meaning,
“Cân nhắc từng ý nghĩa,
84
Aññatra samayo vutto, upayogena so idhā’’ti.
Elsewhere, 'samaya' is stated with the locative and instrumental cases, but here, it is with the accusative.”
‘Samaya’ được nói bằng thể sở thuộc và thể công cụ ở nơi khác, nhưng ở đây là bằng thể đối cách.”
85
Porāṇā pana vaṇṇayanti – ‘‘tasmiṃ samaye’’ti vā ‘‘tena samayenā’’ti vā ‘‘ekaṃ samaya’’nti vā abhilāpamattabhedo esa, sabbattha bhummameva atthoti.
However, the ancients explain: “Whether it is 'tasmiṃ samaye' or 'tena samayena' or 'ekaṃ samayaṃ', this is merely a difference in expression; everywhere, the meaning is that of the locative case.”
Tuy nhiên, các vị trưởng lão giải thích rằng: “tasmiṃ samaye” (vào thời điểm đó), “tena samayenā” (bằng thời điểm đó), hay “ekaṃ samayaṃ” (một thời điểm) chỉ là sự khác biệt về cách diễn đạt, ý nghĩa sở thuộc (bhumma) là chung cho tất cả.
Tasmā ‘‘ekaṃ samaya’’nti vuttepi ‘‘ekasmiṃ samaye’’ti attho veditabbo.
Therefore, even when "ekaṃ samayaṃ" is stated, the meaning should be understood as "ekasmiṃ samaye" (at one time).
Vì vậy, khi nói “ekaṃ samayaṃ”, phải hiểu là “ekasmiṃ samaye” (vào một thời điểm).
86
Bhagavāti garu.
Bhagavā means worthy of respect.
Bhagavā (Đức Thế Tôn) nghĩa là đáng kính.
Garuṃ hi loke ‘‘bhagavā’’ti vadanti.
Indeed, in the world, one who is worthy of respect is called "Bhagavā."
Quả thật, trong thế gian, người đáng kính được gọi là “Bhagavā”.
Ayañca sabbaguṇavisiṭṭhatāya sabbasattānaṃ garu, tasmā ‘‘bhagavā’’ti veditabbo.
And this One is worthy of respect for all beings due to His superiority in all qualities; therefore, He should be understood as "Bhagavā."
Và Ngài, do sự siêu việt về mọi phẩm hạnh, là bậc đáng kính của tất cả chúng sinh, vì vậy phải hiểu là “Bhagavā”.
Porāṇehipi vuttaṃ –
It has also been said by the ancients:
Các vị trưởng lão cũng đã nói:
87
‘‘Bhagavāti vacanaṃ seṭṭhaṃ, bhagavāti vacanamuttamaṃ;
“The word 'Bhagavā' is supreme, the word 'Bhagavā' is excellent;
“Từ ‘Bhagavā’ là tối thượng, từ ‘Bhagavā’ là cao cả;
88
Garu gāravayutto so, bhagavā tena vuccatī’’ti.(visuddhi. 1.142);
He is worthy of reverence and endowed with reverence, therefore He is called Bhagavā.”
Ngài là bậc đáng kính, đầy đủ sự tôn trọng, vì vậy Ngài được gọi là Bhagavā.”
89
Apica –
Furthermore:
Hơn nữa:
90
‘‘Bhagyavā bhaggavā yutto, bhagehi ca vibhattavā;
“Fortunate, destroyer, endowed with good qualities (bhaga), and having distinguished (dhammas);
“Ngài có phước (bhagyavā), đã phá hoại (bhaggavā), đầy đủ các đức (bhaga), đã phân chia (vibhattavā);
91
Bhattavā vantagamano, bhavesu bhagavā tato’’ti–
One who has resorted (to solitude), one who has vomited (gone forth from craving), in existences, therefore Bhagavā”—
Đã thọ dụng (bhattavā), đã nhổ bỏ sự đi lại (vantagamano) trong các cõi hữu, vì vậy Ngài là Bhagavā.”
92
Imissā gāthāya vasenassa padassa vitthārato attho veditabbo.
The meaning of this word should be understood in detail according to this verse.
Theo bài kệ này, ý nghĩa của từ này phải được hiểu một cách rộng rãi.
So ca visuddhimagge (visuddhi. 1.144) buddhānussatiniddese vuttoyeva.
And that is already stated in the Visuddhimagga, in the description of the recollection of the Buddha (Buddhānussati-niddesa).
Điều đó đã được nói đến trong phần giải thích Phật tùy niệm (Buddhānussati) của Thanh Tịnh Đạo.
93
Ettāvatā cettha evaṃ me sutanti vacanena yathāsutaṃ dhammaṃ dassento bhagavato dhammasarīraṃ paccakkhaṃ karoti.
Thus far, with the words "Evaṃ me sutaṃ" (Thus have I heard), Ananda, by showing the Dhamma as it was heard, makes the Dhamma-body of the Blessed One manifest.
Cho đến đây, với câu “ Evaṃ me sutaṃ” (Như vầy tôi nghe), Tôn giả A-nan-đà đã trình bày Giáo Pháp như đã được nghe, làm cho Pháp thân của Đức Thế Tôn trở nên hiện tiền.
Tena ‘‘nayidaṃ atikkantasatthukaṃ pāvacanaṃ, ayaṃ vo satthā’’ti satthu adassanena ukkaṇṭhitaṃ janaṃ samassāseti.
Thereby, he reassures the people who are distressed by the absence of the Teacher, saying, "This teaching is not without a Teacher who has passed away; this Dhamma is your Teacher."
Điều này an ủi những người đang buồn rầu vì không thấy Đức Bổn Sư, rằng: “Giáo pháp này không phải là không có Bổn Sư. Đây là Bổn Sư của quý vị.”
Ekaṃ samayaṃ bhagavāti vacanena tasmiṃ samaye bhagavato avijjamānabhāvaṃ dassento rūpakāyaparinibbānaṃ sādheti.
By the words "Ekaṃ samayaṃ Bhagavā" (At one time the Blessed One), Ananda, by showing the non-existence of the Blessed One's physical form at that time, establishes His Parinibbāna in the rūpakāya (physical body).
Với câu “ Ekaṃ samayaṃ Bhagavā” (Một thời Đức Thế Tôn), Tôn giả A-nan-đà đã chứng minh sự nhập Niết-bàn của sắc thân Đức Thế Tôn, bằng cách cho thấy sự vắng mặt của Ngài vào thời điểm đó.
Tena ‘‘evaṃvidhassa nāma ariyadhammassa desako dasabaladharo vajirasaṅghātasamānakāyo sopi bhagavā parinibbuto, kena aññena jīvite āsā janetabbā’’ti jīvitamadamattaṃ janaṃ saṃvejeti, saddhamme cassa ussāhaṃ janeti.
Thereby, he inspires fear in people intoxicated by the pride of life, by saying, "The Dasabala-holder, whose body is like a diamond cluster, the teacher of such noble Dhamma, even that Blessed One has attained Parinibbāna; by whom else should hope for life be generated?" and he generates enthusiasm for the Dhamma in them.
Điều này làm cho những người say đắm vào sự sống phải xúc động, rằng: “Ngay cả Đức Thế Tôn, bậc thuyết giảng Chánh pháp cao quý như vậy, bậc có mười lực, thân thể kiên cố như kim cương, Ngài cũng đã nhập Niết-bàn. Ai khác có thể hy vọng vào sự sống nữa?” Và điều này cũng tạo ra sự nhiệt tâm trong Chánh pháp cho họ.
Evanti ca bhaṇanto desanāsampattiṃ niddisati.
And by stating "Evaṃ" (Thus), he indicates the perfection of the teaching.
Và khi nói “ Evaṃ” (Như vầy), Tôn giả A-nan-đà chỉ ra sự viên mãn của bài thuyết pháp.
Me sutanti sāvakasampattiṃ.
By "Me sutaṃ" (I heard), the perfection of the disciple.
Me sutaṃ” (tôi nghe) chỉ ra sự viên mãn của thính chúng.
Ekaṃ samayanti kālasampattiṃ.
By "Ekaṃ samayaṃ" (At one time), the perfection of the time.
Ekaṃ samayaṃ” (một thời) chỉ ra sự viên mãn của thời gian.
Bhagavāti desakasampattiṃ.
By "Bhagavā" (the Blessed One), the perfection of the teacher.
Bhagavā” (Đức Thế Tôn) chỉ ra sự viên mãn của bậc thuyết pháp.
94
Sāvatthiyanti evaṃnāmake nagare.
Sāvatthiyaṃ means "in the city so named."
Sāvatthiyaṃ (Tại Xá-vệ) nghĩa là tại thành phố có tên như vậy.
Samīpatthe cetaṃ bhummavacanaṃ.
And this is a locative case (bhummavacana) in the sense of proximity.
Đây là cách dùng từ ở thể sở thuộc với ý nghĩa gần kề.
Viharatīti avisesena iriyāpathadibbabrahmaariyavihāresu aññataravihārasamaṅgīparidīpanametaṃ.
Viharati (resides) is a general indication of being endowed with one of the postures (iriyāpatha), divine abidings (dibbavihāra), Brahma-abidings (brahmavihāra), or noble abidings (ariyavihāra).
Viharatī (trú) là sự trình bày về việc đầy đủ một trong các tư thế oai nghi (iriyāpatha), trú xứ thiên thượng (dibbavihāra), trú xứ phạm thiên (brahmavihāra), hoặc trú xứ thánh nhân (ariyavihāra) một cách không phân biệt.
Idha pana ṭhānagamananisajjāsayanappabhedesu iriyāpathesu aññatarairiyāpathasamāyogaparidīpanaṃ, tena ṭhitopi gacchantopi nisinnopi sayānopi bhagavā viharaticceva veditabbo.
Here, however, it is an indication of being endowed with one of the postures, which are standing, walking, sitting, and lying down. Therefore, it should be understood that whether the Blessed One is standing, walking, sitting, or lying down, He is said to be "viharati."
Tuy nhiên, ở đây, nó trình bày sự kết hợp với một trong các tư thế oai nghi như đứng, đi, ngồi, nằm. Vì vậy, phải hiểu rằng Đức Thế Tôn trú dù Ngài đang đứng, đang đi, đang ngồi hay đang nằm.
So hi ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā aparipatantaṃ attabhāvaṃ harati pavatteti, tasmā ‘‘viharatī’’ti vuccati.
For He sustains and maintains His body, preventing it from falling, by interrupting the discomfort of one posture with another; therefore, He is called "viharati."
Quả thật, Ngài đã chấm dứt sự khó chịu của một tư thế oai nghi bằng một tư thế oai nghi khác, duy trì và tiếp tục thân thể của mình không bị suy sụp, vì vậy Ngài được gọi là “viharatī”.
95
Jetavaneti jetassa rājakumārassa vane.
Jetavane means "in the park of Prince Jeta."
Jetavane (Tại Kỳ-đà-lâm) nghĩa là trong khu vườn của hoàng tử Jeta.
Tañhi tena ropitaṃ saṃvaḍḍhitaṃ paripālitaṃ ahosi, tasmā ‘‘jetavana’’nti saṅkhaṃ gataṃ.
For it was planted, cultivated, and protected by him; therefore, it became known as "Jetavana."
Khu vườn đó đã được hoàng tử trồng, nuôi dưỡng và bảo vệ, vì vậy nó được gọi là “Jetavana”.
Tasmiṃ jetavane.
In that Jetavana.
Tại Kỳ-đà-lâm đó.
Anāthapiṇḍikassa ārāmeti anāthapiṇḍikena gahapatinā catupaññāsahiraññakoṭipariccāgena buddhappamukhassa bhikkhusaṅghassa niyyātitattā ‘‘anāthapiṇḍikassa ārāmo’’ti saṅkhaṃ gate ārāme.
Anāthapiṇḍikassa ārāme (in Anāthapiṇḍika’s monastery) means "in the monastery that became known as 'Anāthapiṇḍika’s monastery' because it was dedicated by the householder Anāthapiṇḍika to the Saṅgha of bhikkhus, headed by the Buddha, with the sacrifice of fifty-four crores of gold."
Anāthapiṇḍikassa ārāme (Trong tịnh xá của Cấp Cô Độc) nghĩa là trong tịnh xá được gọi là “tịnh xá của Cấp Cô Độc” vì gia chủ Anāthapiṇḍika đã cúng dường 540 triệu đồng vàng cho Tăng đoàn do Đức Phật đứng đầu.
Ayamettha saṅkhepo, vitthāro pana papañcasūdaniyā majjhimaṭṭhakathāya sabbāsavasuttavaṇṇanāyaṃ (ma. ni. aṭṭha. 1.14) vutto.
This is the brief explanation here; the detailed explanation is given in the Papañcasūdanī, the Majjhima Commentary, in the commentary on the Sabbāsava Sutta.
Đây là phần tóm tắt, phần chi tiết đã được nói đến trong phần giải thích kinh Sabbāsava trong Trung Bộ Chú Giải (Papañcasūdanī).
96
Tattha siyā – yadi tāva bhagavā sāvatthiyaṃ viharati, ‘‘jetavane’’ti na vattabbaṃ.
There might be a question: if the Blessed One resides in Sāvatthī, then "in Jetavana" should not be stated.
Ở đây có thể có câu hỏi – nếu Đức Thế Tôn trú tại Xá-vệ, thì không cần nói “tại Kỳ-đà-lâm”.
Atha tattha viharati, ‘‘sāvatthiya’’nti na vattabbaṃ.
But if he resides there, then "in Sāvatthī" should not be stated.
Nếu Ngài trú tại đó, thì không cần nói “tại Xá-vệ”.
Na hi sakkā ubhayattha ekaṃ samayaṃ viharitunti.
For it is not possible to reside in both places at the same time.
Vì không thể trú tại hai nơi cùng một lúc.
Na kho panetaṃ evaṃ daṭṭhabbaṃ.
But this should not be understood in that way.
Nhưng điều này không nên được hiểu như vậy.
97
Nanu avocumha ‘‘samīpatthe bhummavacana’’nti.
Did we not say that "the locative case is used in the sense of proximity"?
Chẳng phải chúng ta đã nói “thể sở thuộc với ý nghĩa gần kề” sao?
Tasmā yathā gaṅgāyamunādīnaṃ samīpe goyūthāni carantāni ‘‘gaṅgāyaṃ caranti, yamunāyaṃ carantī’’ti vuccati, evamidhāpi yadidaṃ sāvatthiyā samīpe jetavanaṃ, tattha viharanto vuccati ‘‘sāvatthiyaṃ viharati jetavane’’ti.
Therefore, just as herds of cattle grazing near the Gaṅgā and Yamunā rivers are said to "graze in the Gaṅgā, graze in the Yamunā," so too here, when one resides in Jetavana, which is near Sāvatthī, it is said, "He resides in Sāvatthī, in Jetavana."
Vì vậy, giống như việc đàn bò đang ăn cỏ gần sông Hằng, sông Yamunā được nói là “đang ăn cỏ trên sông Hằng, đang ăn cỏ trên sông Yamunā”, thì ở đây cũng vậy, Đức Thế Tôn trú tại Kỳ-đà-lâm, nơi gần Xá-vệ, được nói là “trú tại Xá-vệ, tại Kỳ-đà-lâm”.
Gocaragāmanidassanatthaṃ hissa sāvatthivacanaṃ, pabbajitānurūpanivāsaṭṭhānanidassanatthaṃ sesavacanaṃ.
For the mention of Sāvatthī is to indicate His alms-round village, and the remaining mention is to indicate a suitable dwelling place for renunciants.
Việc nói đến Xá-vệ là để chỉ ra nơi khất thực của Ngài, còn việc nói đến phần còn lại là để chỉ ra nơi trú ngụ phù hợp cho các vị xuất gia.
98
Aññatarā devatāti nāmagottavasena apākaṭā ekā devatāti attho.
Aññatarā devatā (a certain deity) means "a certain deity whose name and clan are not well-known."
Aññatarā devatā (Một vị thiên nhân nào đó) nghĩa là một vị thiên nhân không rõ tên họ.
‘‘Abhijānāti no, bhante, bhagavā ahu ñātaññatarassa mahesakkhassa yakkhassa saṃkhittena taṇhāsaṅkhayavimuttiṃ bhāsitā’’ti ettha pana abhiññāto sakkopi devarājā ‘‘aññataro’’ti vutto.
However, in the passage, “Does the Blessed One know, venerable sir, that to a certain powerful yakkha, a concise liberation through the destruction of craving was taught?”, even Sakka, the king of devas, who is well-known, is referred to as “a certain one.”
Tuy nhiên, trong câu “Bạch Thế Tôn, Đức Thế Tôn có biết không, rằng Ngài đã thuyết giảng vắn tắt về sự giải thoát khỏi sự đoạn tận tham ái cho một vị Dạ-xoa có đại oai lực đã biết trước?” thì ngay cả Sakka, vua chư thiên, cũng được gọi là “aññataro” (một vị nào đó) dù đã được biết rõ.
‘‘Devatā’’ti ca idaṃ devānampi devadhītānampi sādhāraṇavacanaṃ.
And this word "devatā" is common to both male devas and female devas (devadhītā).
Và từ “ devatā” là từ chung cho cả chư thiên nam và chư thiên nữ.
Imasmiṃ panatthe devo adhippeto, so ca kho rūpāvacarānaṃ devānaṃ aññataro.
In this context, however, a male deva is intended, and indeed, he is one of the devas of the Rūpāvacara realm.
Nhưng trong ngữ cảnh này, ý muốn nói đến một vị thiên nam, và vị đó là một trong các vị Phạm thiên thuộc cõi sắc giới.
99
Abhikkantāya rattiyāti ettha abhikkanta-saddo khayasundarābhirūpaabbhānumodanādīsu dissati.
In Abhikkantāya rattiyā (when the night was far spent), the word 'abhikkanta' is seen in meanings such as completion, beauty, comeliness, and approval.
Trong cụm từ Abhikkantāya rattiyā (khi đêm đã quá nửa), từ ‘abhikkanta’ được thấy trong các ý nghĩa như chấm dứt, đẹp đẽ, khả ái, hoan hỷ, v.v.
Tattha ‘‘abhikkantā, bhante, ratti, nikkhanto paṭhamo yāmo, ciranisinno bhikkhusaṅgho, uddisatu, bhante, bhagavā bhikkhūnaṃ pātimokkha’’nti evamādīsu (a. ni. 8.20; cūḷava. 383) khaye dissati.
There, in passages such as “The night is far spent, venerable sir; the first watch is gone; the Saṅgha of bhikkhus has been seated for a long time; let the Blessed One recite the Pātimokkha to the bhikkhus,” it refers to completion.
Trong các đoạn như “Bạch Thế Tôn, đêm đã qua, canh đầu đã hết, Tăng chúng đã ngồi lâu, xin Thế Tôn hãy đọc Pātimokkha cho các Tỳ-khưu” thì nó được thấy với ý nghĩa chấm dứt.
‘‘Ayaṃ imesaṃ catunnaṃ puggalānaṃ abhikkantataro ca paṇītataro cā’’ti evamādīsu (a. ni. 4.100) sundare.
In passages such as “This one is more excellent and more distinguished than these four types of individuals,” it refers to beauty.
Trong các đoạn như “Vị này trong bốn hạng người này là ưu việt và thù thắng hơn” thì nó được thấy với ý nghĩa đẹp đẽ.
100
‘‘Ko me vandati pādāni, iddhiyā yasasā jalaṃ;
“Who, shining with power and glory,
“Ai đang đảnh lễ chân tôi,
101
Abhikkantena vaṇṇena, sabbā obhāsayaṃ disā’’ti–
With an exceedingly radiant complexion, illuminating all directions, worships my feet?”—
Rực rỡ với thần thông và uy đức,
102
Evamādīsu (vi. va. 857) abhirūpe.
In passages such as these, it refers to comeliness.
Với sắc tướng khả ái, chiếu sáng khắp mọi phương?”
‘‘Abhikkantaṃ bho gotama, abhikkantaṃ bho gotamā’’ti evamādīsu (pārā. 15) abbhānumodane.
In passages such as “Excellent, venerable Gotama! Excellent, venerable Gotama!”, it refers to approval.
Trong các đoạn như vậy, nó được thấy với ý nghĩa khả ái.
Idha pana khaye.
Here, however, it means completion.
Trong các đoạn như “Thật tuyệt vời, thưa Gotama! Thật tuyệt vời, thưa Gotama!” thì nó được thấy với ý nghĩa hoan hỷ.
Tena abhikkantāya rattiyā, parikkhīṇāya rattiyāti vuttaṃ hoti.
Therefore, "abhikkantāya rattiyā" means "when the night was completely spent."
Ở đây, nó có nghĩa là chấm dứt. Do đó, “abhikkantāya rattiyā” có nghĩa là khi đêm đã chấm dứt, khi đêm đã tàn.
Tatthāyaṃ devaputto majjhimayāmasamanantare āgatoti veditabbo.
It should be understood that this devaputta arrived immediately after the middle watch.
Cần phải hiểu rằng vị thiên tử này đã đến ngay sau canh giữa.
Niyāmo hi kiresa devatānaṃ yadidaṃ buddhānaṃ vā buddhasāvakānaṃ vā upaṭṭhānaṃ āgacchantā majjhimayāmasamanantareyeva āgacchanti.
Indeed, it is a rule for devas that when they come to attend upon the Buddhas or the disciples of the Buddhas, they arrive immediately after the middle watch.
Thật vậy, đây là quy luật của chư thiên: khi đến hầu Phật hay các đệ tử của Phật, họ luôn đến ngay sau canh giữa.
103
Abhikkantavaṇṇāti idha abhikkanta-saddo abhirūpe, vaṇṇa-saddo pana chavithuti-kulavagga-kāraṇa-saṇṭhānappamāṇa-rūpāyatanādīsu dissati.
Here, regarding Abhikkantavaṇṇā, the word abhikkanta is understood in the sense of 'beautiful', while the word vaṇṇa is seen in the sense of 'skin', 'praise', 'class or lineage', 'reason', 'form or shape', 'measure', 'visual object', and so on.
Abhikkantavaṇṇā (sắc đẹp thù thắng): Ở đây, từ abhikkanta được dùng với nghĩa “đẹp đẽ”, còn từ vaṇṇa thì được thấy trong các nghĩa như da thịt, tán thán, chủng tộc, nguyên nhân, hình dáng, kích thước, sắc xứ, v.v.
Tattha ‘‘suvaṇṇavaṇṇosi bhagavā’’ti evamādīsu (su. ni. 553) chaviyā.
There, in phrases like "Bhagavā, you are golden-skinned," it refers to skin.
Trong các trường hợp như ‘‘Bạch Thế Tôn, ngài có sắc da vàng ròng’’ thì có nghĩa là da thịt.
‘‘Kadā saññūḷhā pana te, gahapati, ime samaṇassa vaṇṇā’’ti evamādīsu (ma. ni. 2.77) thutiyaṃ.
In phrases like "Householder, when were these qualities of the ascetic Gotama thoroughly known to you?", it refers to praise.
Trong các trường hợp như ‘‘Này gia chủ, những lời tán thán vị Sa-môn này đã được ông ghi nhớ từ bao giờ?’’ thì có nghĩa là tán thán.
‘‘Cattārome, bho gotama, vaṇṇā’’ti evamādīsu (dī. ni. 3.115) kulavagge.
In phrases like "There are these four classes, venerable Gotama," it refers to class or lineage.
Trong các trường hợp như ‘‘Này tôn giả Gotama, có bốn loại chủng tộc này’’ thì có nghĩa là chủng tộc.
‘‘Atha kena nu vaṇṇena, gandhathenoti vuccatī’’ti evamādīsu (saṃ. ni. 1.234) kāraṇe.
In phrases like "Then by what reason is one called a 'thief of scent'?", it refers to reason.
Trong các trường hợp như ‘‘Vậy do nguyên nhân nào mà tôi được gọi là kẻ trộm hương?’’ thì có nghĩa là nguyên nhân.
‘‘Mahantaṃ hatthirājavaṇṇaṃ abhinimminitvā’’ti evamādīsu (saṃ. ni. 1.138) saṇṭhāne.
In phrases like "Having created the magnificent form of a king elephant," it refers to shape.
Trong các trường hợp như ‘‘Sau khi hóa hiện hình dáng một vị vua voi to lớn’’ thì có nghĩa là hình dáng.
‘‘Tayo pattassa vaṇṇā’’ti evamādīsu (pārā. 602) pamāṇe.
In phrases like "Three measures of the bowl," it refers to measure.
Trong các trường hợp như ‘‘Ba loại kích thước bát’’ thì có nghĩa là kích thước.
‘‘Vaṇṇo gandho raso ojā’’ti evamādīsu rūpāyatane.
In phrases like "Color, smell, taste, nutritive essence," it refers to visual object.
Trong các trường hợp như ‘‘Sắc, hương, vị, oja’’ thì có nghĩa là sắc xứ.
So idha chaviyā daṭṭhabbo.
Here, it should be understood in the sense of skin.
Ở đây, từ đó cần được hiểu là da thịt.
Tena abhikkantavaṇṇā abhirūpacchavi, iṭṭhavaṇṇā manāpavaṇṇāti vuttaṃ hoti.
Thus, it is said that "abhikkantavaṇṇā" means 'of beautiful skin', 'of pleasing appearance', 'of lovely hue'.
Do đó, abhikkantavaṇṇā có nghĩa là có sắc da đẹp đẽ, có sắc da khả ái, có sắc da đáng hài lòng.
Devatā hi manussalokaṃ āgacchamānā pakativaṇṇaṃ pakatiiddhiṃ jahitvā oḷārikaṃ attabhāvaṃ katvā atirekavaṇṇaṃ atirekaiddhiṃ māpetvā naṭasamajjādīni gacchantā manussā viya abhisaṅkhatena kāyena āgacchanti.
For when devas come to the human world, they abandon their natural appearance and natural power, assume a gross body, create a superior appearance and superior power, and arrive with an artificially created body, like humans going to a theatrical performance.
Khi chư thiên đến cõi người, họ từ bỏ sắc thân và thần thông tự nhiên của mình, tạo ra một sắc thân thô thiển hơn, hóa hiện sắc đẹp và thần thông vượt trội, và đến với thân đã được tạo tác, giống như con người đi xem hội hè.
Tattha kāmāvacarā anabhisaṅkhatenapi āgantuṃ sakkonti, rūpāvacarā pana na sakkonti.
Among them, Kāma-world devas can also come without creating such, but Rūpa-world devas cannot.
Trong số đó, chư thiên cõi Dục có thể đến mà không cần tạo tác, nhưng chư thiên cõi Sắc thì không thể.
Tesañhi atisukhumo attabhāvo, na tena iriyāpathakappanaṃ hoti.
Their body is extremely subtle; it is not possible to assume postures with it.
Vì thân của họ rất vi tế, không thể thực hiện các oai nghi cử chỉ với thân đó.
Tasmā ayaṃ devaputto abhisaṅkhateneva āgato.
Therefore, this devaputta came with an artificially created body.
Do đó, vị thiên tử này đã đến với thân đã được tạo tác.
Tena vuttaṃ ‘‘abhikkantavaṇṇā’’ti.
Thus, it is said "abhikkantavaṇṇā".
Vì vậy, đã nói là ‘‘abhikkantavaṇṇā’’ (sắc đẹp thù thắng).
104
Kevalakappanti ettha kevala-saddo anavasesa-yebhuyyābyāmissānatirekadaḷhatthavisaṃyogādianekattho.
Here, in kevalakappaṃ, the word kevala has many meanings, such as 'without remainder', 'mostly', 'unmixed', 'not excessive', 'firm', 'disjunction', and so on.
Kevalakappaṃ: Ở đây, từ kevala có nhiều nghĩa như không còn sót lại, phần lớn, không pha trộn, không quá mức, kiên cố, không liên kết, v.v.
Tathā hissa ‘‘kevalaparipuṇṇaṃ parisuddhaṃ brahmacariya’’nti evamādīsu (pārā. 1) anavasesatthamattho.
Thus, in phrases like "a completely full, utterly pure holy life," its meaning is 'without remainder'.
Thật vậy, trong các trường hợp như ‘‘Phạm hạnh hoàn toàn viên mãn, thanh tịnh’’ thì có nghĩa là không còn sót lại.
‘‘Kevalakappā ca aṅgamagadhā pahūtaṃ khādanīyabhojanīyaṃ ādāya upasaṅkamissantī’’ti evamādīsu (mahāva. 43) yebhuyyatā.
In phrases like "The majority of Anga and Magadha will come bringing abundant solid and soft food," it means 'mostly'.
Trong các trường hợp như ‘‘Phần lớn dân chúng xứ Aṅga và Magadha sẽ mang theo nhiều đồ ăn thức uống mà đến’’ thì có nghĩa là phần lớn.
‘‘Kevalassa dukkhakkhandhassa samudayo hotī’’ti evamādīsu (vibha. 225) abyāmissatā.
In phrases like "the arising of the entire mass of suffering takes place," it means 'unmixed'.
Trong các trường hợp như ‘‘Toàn bộ khối khổ đau này phát sinh’’ thì có nghĩa là không pha trộn.
‘‘Kevalaṃ saddhāmattakaṃ nūna ayamāyasmā’’ti evamādīsu (mahāva. 244) anatirekatā.
In phrases like "Indeed, this Venerable One has only faith," it means 'not excessive'.
Trong các trường hợp như ‘‘Chắc chắn vị Tôn giả này chỉ có niềm tin mà thôi’’ thì có nghĩa là không quá mức.
‘‘Āyasmato, bhante, anuruddhassa bāhiyo nāma saddhivihāriko kevalakappaṃ saṅghabhedāya ṭhito’’ti evamādīsu (a. ni. 4.243) daḷhatthatā.
In phrases like "Venerable sir, the Venerable Anuruddha's co-resident, named Bāhiya, was firmly intent on causing a schism in the Sangha," it means 'firm'.
Trong các trường hợp như ‘‘Bạch Thế Tôn, vị đệ tử đồng phạm hạnh tên Bāhiya của Tôn giả Anuruddha đã kiên cố đứng về phía phá hòa hợp Tăng’’ thì có nghĩa là kiên cố.
‘‘Kevalī vusitavā uttamapurisoti vuccatī’’ti evamādīsu (saṃ. ni. 3.57) visaṃyogo attho.
In phrases like "One who is perfect, one who has lived the holy life, is called a supreme person," it means 'disjunction'.
Trong các trường hợp như ‘‘Vị đã hoàn tất (Phạm hạnh), đã sống Phạm hạnh được gọi là bậc tối thượng nhân’’ thì có nghĩa là không liên kết.
Idha panassa anavasesattho adhippeto.
Here, however, the meaning 'without remainder' is intended.
Ở đây, nghĩa được muốn nói là không còn sót lại.
105
Kappa-saddo panāyaṃ abhisaddahana-vohāra-kāla-paññatti-chedana-vikappa-lesasamantabhāvādianekattho.
This word kappa also has many meanings, such as 'belief', 'custom', 'time', 'designation', 'cutting', 'alternative', 'slight indication', 'all-around presence', and so on.
Còn từ kappa này có nhiều nghĩa như niềm tin, tục lệ, thời gian, chế định, cắt tỉa, tùy nghi, cách thức, toàn diện, v.v.
Tathā hissa ‘‘okappaniyametaṃ bhoto gotamassa, yathā taṃ arahato sammāsambuddhassā’’ti evamādīsu (ma. ni. 1.387) abhisaddahanamattho.
Thus, in phrases like "This is appropriate for the venerable Gotama, as he is an Arahant, a Fully Enlightened One," its meaning is 'belief'.
Thật vậy, trong các trường hợp như ‘‘Lời dạy này của Tôn giả Gotama là đáng tin cậy, như lời của một bậc A-la-hán, Chánh Đẳng Giác’’ thì có nghĩa là niềm tin.
‘‘Anujānāmi, bhikkhave, pañcahi samaṇakappehi phalaṃ paribhuñjitu’’nti evamādīsu (cūḷava. 250) vohāro.
In phrases like "Monks, I allow you to partake of fruit in five ways permitted to ascetics," it means 'custom'.
Trong các trường hợp như ‘‘Này các Tỳ-khưu, Ta cho phép thọ dụng trái cây với năm tục lệ của Sa-môn’’ thì có nghĩa là tục lệ.
‘‘Yena sudaṃ niccakappaṃ viharāmī’’ti evamādīsu (ma. ni. 1.387) kālo.
In phrases like "By which I always dwell," it means 'time'.
Trong các trường hợp như ‘‘Nhờ đó tôi thường an trú mọi lúc’’ thì có nghĩa là thời gian.
‘‘Iccāyasmā kappo’’ti evamādīsu paññatti.
In phrases like "So, Venerable Kappa," it means 'designation'.
Trong các trường hợp như ‘‘Vị Tôn giả Kappa này’’ thì có nghĩa là chế định.
‘‘Alaṅkato kappitakesamassū’’ti evamādīsu (vi. va. 1094, 1101) chedanaṃ.
In phrases like "Adorned, with hair and beard trimmed," it means 'cutting'.
Trong các trường hợp như ‘‘Đã trang điểm, tóc râu đã được cắt tỉa’’ thì có nghĩa là cắt tỉa.
‘‘Kappati dvaṅgulakappo’’ti evamādīsu (cūḷava. 446) vikappo.
In phrases like "A two-finger length shadow is permissible," it means 'alternative'.
Trong các trường hợp như ‘‘Được phép tùy nghi hai ngón tay’’ thì có nghĩa là tùy nghi.
‘‘Ātthi kappo nipajjitu’’nti evamādīsu (a. ni. 8.80) leso.
In phrases like "Is there an occasion to lie down?", it means 'slight indication'.
Trong các trường hợp như ‘‘Có cách nào để nằm xuống không?’’ thì có nghĩa là cách thức.
‘‘Kevalakappaṃ veḷuvanaṃ obhāsetvā’’ti evamādīsu (saṃ. ni. 1.94) samantabhāvo.
In phrases like "Having illuminated the entire Veḷuvana," it means 'all-around presence'.
Trong các trường hợp như ‘‘Chiếu sáng toàn bộ rừng Trúc Lâm’’ thì có nghĩa là toàn diện.
Idha panassa samantabhāvattho adhippeto.
Here, however, the meaning 'all-around presence' is intended for it.
Ở đây, nghĩa được muốn nói là toàn diện.
Tasmā kevalakappaṃ jetavananti ettha ‘‘anavasesaṃ samantato jetavana’’nti evamattho daṭṭhabbo.
Therefore, in the phrase kevalakappaṃ Jetavanaṃ, the meaning should be understood as "the entire Jetavana, all around, without remainder."
Do đó, trong câu kevalakappaṃ jetavana (toàn bộ tinh xá Jetavana), cần hiểu là ‘‘toàn bộ tinh xá Jetavana không còn sót lại, khắp mọi nơi’’.
106
Obhāsetvāti vatthālaṅkārasarīrasamuṭṭhitāya ābhāya pharitvā, candimā viya sūriyo viya ca ekobhāsaṃ ekapajjotaṃ karitvāti attho.
Obhāsetvā means having spread light with the radiance arising from clothing, ornaments, and body, making it a single glow, a single illumination, like the moon or the sun.
Obhāsetvā (chiếu sáng): có nghĩa là làm cho lan tỏa ánh sáng phát ra từ y phục, trang sức và thân thể, làm cho toàn bộ một nơi trở nên sáng rực, như mặt trăng hay mặt trời.
107
Yenāti bhummatthe karaṇavacanaṃ.
Yenā is an instrumental case word in the locative sense.
Yenā (nơi mà): là một từ chỉ công cụ được dùng với nghĩa vị trí (locative).
Yena bhagavā tenupasaṅkamīti tasmā ‘‘yattha bhagavā, tattha upasaṅkamī’’ti evamettha attho daṭṭhabbo.
Therefore, in the phrase Yena Bhagavā tenupasaṅkamī, the meaning here should be understood as "where the Bhagavā was, there he approached."
Do đó, trong câu Yena Bhagavā tenupasaṅkamī (đến nơi Thế Tôn ngự), cần hiểu là ‘‘đến nơi Thế Tôn đang ngự’’.
Yena vā kāraṇena bhagavā devamanussehi upasaṅkamitabbo, tena kāraṇena upasaṅkamīti evamettha attho daṭṭhabbo.
Or, the meaning here should be understood as "by which reason the Bhagavā should be approached by devas and humans, by that reason he approached."
Hoặc, cần hiểu rằng vị thiên tử này đã đến vì lý do mà chư thiên và loài người nên đến gần Thế Tôn.
Kena ca kāraṇena bhagavā upasaṅkamitabbo?
And by what reason should the Bhagavā be approached?
Và vì lý do nào mà chư thiên và loài người nên đến gần Thế Tôn?
Nānappakāraguṇavisesādhigamādhippāyena, sāduphalūpabhogādhippāyena dijagaṇehi niccaphalitamahārukkho viya.
With the intention of attaining various special qualities, like a great tree always bearing fruit which is approached by flocks of birds with the intention of enjoying delicious fruits.
Với ý định đạt được các phẩm chất đặc biệt khác nhau, giống như đàn chim luôn đến cây đại thụ sai trái ngọt với ý định hưởng thụ trái cây ngon lành.
Upasaṅkamīti ca gatāti vuttaṃ hoti.
And upasaṅkamī means he went.
Upasaṅkamī (đến gần) có nghĩa là đã đến.
Upasaṅkamitvāti upasaṅkamanapariyosānadīpanaṃ.
Upasaṅkamitvā indicates the completion of the approach.
Upasaṅkamitvā (sau khi đến gần): chỉ sự kết thúc của hành động đến gần.
Atha vā evaṃ gatā tato āsannataraṃ ṭhānaṃ bhagavato samīpasaṅkhātaṃ gantvātipi vuttaṃ hoti.
Or, it means having gone to a place closer than that, a place called "near the Bhagavā."
Hoặc, cũng có nghĩa là sau khi đã đến như vậy, vị thiên tử này đã đến một nơi gần hơn, tức là đến gần Thế Tôn.
108
Idāni yenatthena loke aggapuggalassa upaṭṭhānaṃ āgatā, taṃ pucchitukāmā dasanakhasamodhānasamujjalaṃ añjuliṃ sirasi patiṭṭhapetvā ekamantaṃ aṭṭhāsi.
Now, desiring to ask the purpose for which he had come to attend upon the foremost person in the world, he placed his resplendent añjali, shining with ten fingernails pressed together, on his head and stood to one side.
Bấy giờ, vì muốn hỏi về mục đích mà vị thiên tử đã đến hầu bậc tối thượng trong thế gian, vị ấy đã chắp tay cung kính, mười móng tay sáng chói đặt trên đỉnh đầu, rồi đứng sang một bên.
Ekamantanti bhāvanapuṃsakaniddeso – ‘‘visamaṃ candimasūriyā parivattantī’’tiādīsu (a. ni. 4.70) viya.
Ekamantaṃ is a designation of a neuter noun in the sense of state or manner—as in phrases like "the sun and moon revolve unevenly."
Ekamantaṃ (sang một bên): là một cách diễn đạt ở thể trung tính, chỉ trạng thái, giống như trong các câu ‘‘Mặt trăng và mặt trời xoay chuyển không đều’’.
Tasmā yathā ṭhitā ekamantaṃ ṭhitā hoti, tathā aṭṭhāsīti evamettha attho daṭṭhabbo.
Therefore, the meaning here should be understood as "he stood in such a manner that he was standing to one side."
Do đó, ở đây cần hiểu là vị ấy đã đứng theo cách mà một người đứng sang một bên.
Bhummatthe vā etaṃ upayogavacanaṃ.
Or, this is an accusative case word in the locative sense.
Hoặc, đây là một từ chỉ công cụ được dùng với nghĩa vị trí (locative).
Aṭṭhāsīti ṭhānaṃ kappesi.
Aṭṭhāsī means he established a standing position.
Aṭṭhāsi (đứng): có nghĩa là giữ vị trí.
Paṇḍitā hi devamanussā garuṭṭhāniyaṃ upasaṅkamitvā āsanakusalatāya ekamantaṃ tiṭṭhanti, ayañca devo tesaṃ aññataro, tasmā ekamantaṃ aṭṭhāsi.
For wise devas and humans, having approached a venerable one, stand to one side, being skilled in choosing a proper sitting/standing place, and this deva was one of them; therefore, he stood to one side.
Thật vậy, chư thiên và loài người có trí tuệ khi đến gần bậc đáng kính, do khéo léo chọn chỗ ngồi, họ đứng sang một bên; và vị thiên tử này là một trong số đó, vì vậy đã đứng sang một bên.
109
Kathaṃ ṭhito pana ekamantaṃ ṭhito hotīti?
And how does one stand so as to be standing to one side?
Vậy, đứng như thế nào thì được gọi là đứng sang một bên?
Cha ṭhānadose vajjetvā.
By avoiding six faults of position.
Là tránh sáu lỗi về vị trí.
Seyyathidaṃ – atidūraṃ, accāsannaṃ, uparivātaṃ, unnatappadesaṃ, atisammukhaṃ, atipacchāti.
Namely: too far, too near, upwind, on higher ground, directly in front, and too far behind.
Đó là: quá xa, quá gần, ngược gió, ở chỗ cao hơn, quá đối diện, và quá phía sau.
Atidūre ṭhito hi sace kathetukāmo hoti, uccāsaddena kathetabbaṃ hoti.
If one stands too far away and wishes to speak, one must speak in a loud voice.
Nếu đứng quá xa mà muốn nói chuyện, thì phải nói bằng giọng lớn.
Accāsanne ṭhito saṅghaṭṭanaṃ karoti.
If one stands too near, one causes a disturbance.
Nếu đứng quá gần, sẽ gây va chạm.
Uparivāte ṭhito sarīragandhena bādhati.
If one stands upwind, one offends with one's body odor.
Nếu đứng ngược gió, sẽ làm phiền bằng mùi cơ thể.
Unnatappadese ṭhito agāravaṃ pakāseti.
If one stands on higher ground, one displays disrespect.
Nếu đứng ở chỗ cao hơn, sẽ thể hiện sự bất kính.
Atisammukhā ṭhito sace daṭṭhukāmo hoti, cakkhunā cakkhuṃ āhacca daṭṭhabbaṃ hoti.
If one stands directly in front and wishes to see, one must look eye-to-eye.
Nếu đứng quá đối diện mà muốn nhìn, thì phải nhìn thẳng vào mắt.
Atipacchā ṭhito sace daṭṭhukāmo hoti, gīvaṃ pasāretvā daṭṭhabbaṃ hoti.
If one stands too far behind and wishes to see, one must crane one's neck to look.
Nếu đứng quá phía sau mà muốn nhìn, thì phải rướn cổ ra để nhìn.
Tasmā ayampi ete cha ṭhānadose vajjetvā aṭṭhāsi.
Therefore, this deva also stood, avoiding these six faults of position.
Vì vậy, vị thiên tử này cũng đã tránh sáu lỗi về vị trí này mà đứng.
Tena vuttaṃ ‘‘ekamantaṃ aṭṭhāsī’’ti.
Thus, it is said, "ekamantaṃ aṭṭhāsi."
Do đó, đã nói là ‘‘ekamantaṃ aṭṭhāsi’’ (đứng sang một bên).
110
Etadavocāti etaṃ avoca.
Etadavocā means "he said this."
Etadavocā (đã nói điều này): có nghĩa là đã nói điều đó.
Kathaṃ nūti kāraṇapucchā.
Kathaṃ nū is a question regarding the reason.
Kathaṃ nu (làm sao): là câu hỏi về nguyên nhân.
Bhagavato hi tiṇṇoghabhāvo dasasahassilokadhātuyā pākaṭo, tenimissā devatāya tattha kaṅkhā natthi, iminā pana kāraṇena ‘‘tiṇṇo’’ti na jānāti, tena sā taṃ kāraṇaṃ pucchamānā evamāha.
For indeed, the Blessed One's state of having crossed the flood is manifest in the ten-thousand-world-system; therefore, there is no doubt for that devatā regarding that. But he does not know by what means he crossed, and therefore, desiring to ask that reason, he said thus.
Thật vậy, việc Thế Tôn đã vượt qua các dòng thác là điều hiển nhiên trong mười ngàn thế giới, nên vị thiên nhân ấy không có nghi ngờ gì về điều đó. Nhưng vị ấy không biết bằng nguyên nhân nào mà Ngài đã vượt qua, nên vị ấy muốn hỏi nguyên nhân đó và đã nói như vầy.
111
Mārisāti devatānaṃ piyasamudācāravacanametaṃ.
Mārisa is a loving address of devas.
Mārisa là lời xưng hô thân ái của chư thiên.
Niddukkhāti vuttaṃ hoti.
It means "one free from suffering."
Nghĩa là không có khổ.
Yadi evaṃ ‘‘yadā kho te, mārisa, saṅkunā saṅku hadaye samāgaccheyya, atha naṃ tvaṃ jāneyyāsi ‘vassasahassaṃ me niraye paccamānassā’’’ti (ma. ni. 1.512) idaṃ virujjhati.
If that is so, then this statement: ‘‘When, Mārisa, a stake meets a stake in your heart, then you will know, ‘I have been tormented in hell for a thousand years’’’ contradicts it.
Nếu vậy, câu nói “Này Mārisa, khi một cái cọc đâm vào tim ngươi, thì ngươi sẽ biết ‘ta đã bị nung nấu trong địa ngục một ngàn năm’” sẽ mâu thuẫn.
Na hi nerayikasatto niddukkho nāma hoti.
For a being in hell is certainly not free from suffering.
Vì chúng sinh trong địa ngục không thể nào không có khổ.
Kiñcāpi na niddukkho, ruḷhīsaddena pana evaṃ vuccati.
Even though he is not free from suffering, it is said thus by conventional usage.
Mặc dù không không khổ, nhưng từ ngữ này được dùng theo nghĩa thông thường.
Pubbe kira paṭhamakappikānaṃ niddukkhānaṃ sukhasamappitānaṃ esa vohāro, aparabhāge dukkhaṃ hotu vā mā vā, ruḷhīsaddena ayaṃ vohāro vuccateva nippadumāpi nirudakāpi vā pokkharaṇī pokkharaṇī viya.
Indeed, this expression was formerly used by the first beings of the kalpa, who were free from suffering and endowed with happiness. Later, whether there is suffering or not, this expression is used conventionally, just as a pond is called a pond even if it has no lotuses or no water.
Xưa kia, đây là cách xưng hô của những người sống trong thời sơ kiếp, những người không có khổ và tràn đầy hạnh phúc. Về sau, dù có khổ hay không, cách xưng hô này vẫn được dùng theo nghĩa thông thường, giống như một hồ sen vẫn được gọi là hồ sen dù không có sen hay không có nước.
112
Oghamatarīti ettha cattāro oghā, kāmogho bhavogho diṭṭhogho avijjoghoti.
Here in the phrase crossed the flood, there are four floods: the flood of sensual desire (kāmogha), the flood of existence (bhavogha), the flood of wrong views (diṭṭhogha), and the flood of ignorance (avijjogha).
Ở đây, các dòng thác (Ogha) đã vượt qua (Oghamatarī) có bốn loại dòng thác: dục lưu (kāmogha), hữu lưu (bhavogha), kiến lưu (diṭṭhogha), và vô minh lưu (avijjogha).
Tattha pañcasu kāmaguṇesu chandarāgo kāmogho nāma.
Among these, passionate desire for the five strands of sensual pleasure is called the flood of sensual desire.
Trong đó, tham ái đối với năm dục cảnh được gọi là dục lưu.
Rūpārūpabhavesu chandarāgo jhānanikanti ca bhavogho nāma.
Passionate desire for existences in the form and formless realms, and delight in jhānas, are called the flood of existence.
Tham ái đối với các cõi sắc và vô sắc, cùng với sự ưa thích thiền định, được gọi là hữu lưu.
Dvāsaṭṭhi diṭṭhiyo diṭṭhogho nāma.
The sixty-two wrong views are called the flood of wrong views.
Sáu mươi hai tà kiến được gọi là kiến lưu.
Catūsu saccesu aññāṇaṃ avijjogho nāma.
Ignorance of the four noble truths is called the flood of ignorance.
Sự vô tri đối với bốn sự thật được gọi là vô minh lưu.
Tattha kāmogho aṭṭhasu lobhasahagatesu cittuppādesu uppajjati, bhavogho catūsu diṭṭhigatavippayuttalobhasahagatesu cittuppādesu uppajjati, diṭṭhogho catūsu diṭṭhigatasampayuttesu cittuppādesu uppajjati, avijjogho sabbākusalesu uppajjati.
Among these, the kāmogha arises in the eight states of consciousness accompanied by greed; the bhavogha arises in the four states of consciousness accompanied by greed that are disconnected from wrong views; the diṭṭhogha arises in the four states of consciousness associated with wrong views; the avijjogha arises in all unwholesome states.
Trong đó, dục lưu phát sinh trong tám tâm sở tham hợp; hữu lưu phát sinh trong bốn tâm sở tham hợp không liên quan đến tà kiến; kiến lưu phát sinh trong bốn tâm sở tham hợp có liên quan đến tà kiến; vô minh lưu phát sinh trong tất cả các tâm bất thiện.
113
Sabbopi cesa avahananaṭṭhena rāsaṭṭhena ca oghoti veditabbo.
All of this should be understood as a flood by virtue of its sweeping away and by virtue of its vastness.
Tất cả những điều này phải được hiểu là dòng thác (Ogha) theo nghĩa cuốn trôi (avahananaṭṭhena) và theo nghĩa tích tụ (rāsaṭṭhena).
Avahananaṭṭhenāti adhogamanaṭṭhena.
By virtue of sweeping away means by virtue of leading downwards.
Theo nghĩa cuốn trôi (Avahananaṭṭhenā) là theo nghĩa kéo xuống thấp.
Ayañhi attano vasaṃ gate satte adho gameti, nirayādibhedāya duggatiyaṃyeva nibbatteti, uparibhāvaṃ vā nibbānaṃ gantuṃ adento adho tīsu bhavesu catūsu yonīsu pañcasu gatīsu sattasu viññāṇaṭṭhitīsu navasu sattāvāsesu ca gametītipi attho.
For this sweeps down beings who have fallen under its power, giving rise to them only in miserable states such as hell, or it means that it leads them downwards through the three existences, the four wombs, the five destinations, the seven stations of consciousness, and the nine abodes of beings, not allowing them to attain the higher state of Nibbāna.
Vì dòng thác này kéo những chúng sinh bị nó chi phối xuống thấp, chỉ tái sinh vào các khổ cảnh như địa ngục, v.v., hoặc không cho đi lên Nibbāna, mà kéo xuống ba cõi, bốn loài, năm đường, bảy trú xứ của thức, và chín trú xứ của chúng sinh; đây cũng là ý nghĩa.
Rāsaṭṭhenāti mahantaṭṭhena.
By virtue of vastness means by virtue of its immensity.
Theo nghĩa tích tụ (Rāsaṭṭhenā) là theo nghĩa rộng lớn.
Mahā heso kilesarāsi avīcito paṭṭhāya yāva bhavaggā patthaṭo, yadidaṃ pañcasu kāmaguṇesu chandarāgo nāma.
Indeed, this mass of defilements is immense, spread from Avīci up to the highest existence, which is passionate desire for the five strands of sensual pleasure.
Thật vậy, khối phiền não này rất lớn, trải dài từ địa ngục Avīci cho đến đỉnh hữu (Bhavagga), đó là tham ái đối với năm dục cảnh.
Sesesupi eseva nayo.
The same principle applies to the remaining floods.
Đối với các loại còn lại cũng vậy.
Evamayaṃ rāsaṭṭhenāpi oghoti veditabbo.
Thus, this should be understood as a flood by virtue of its vastness.
Như vậy, điều này cũng phải được hiểu là dòng thác theo nghĩa tích tụ.
Atarīti imaṃ catubbidhampi oghaṃ kena nu tvaṃ, mārisa, kāraṇena tiṇṇoti pucchati.
Crossed means, “By what means, Mārisa, did you cross this fourfold flood?” the devatā asks.
Atarī (đã vượt qua) là hỏi: “Này Mārisa, Ngài đã vượt qua bốn dòng thác này bằng nguyên nhân nào?”
114
Athassā bhagavā pañhaṃ vissajjento appatiṭṭhaṃ khvāhantiādimāha.
Then the Blessed One, answering her question, began with without standing still (appatiṭṭhaṃ khvāhaṃ).
Bấy giờ, Thế Tôn đã trả lời câu hỏi của vị thiên nhân ấy bằng cách nói appatiṭṭhaṃ khvāhaṃ (ta không đứng lại) và những lời tiếp theo.
Tattha appatiṭṭhanti appatiṭṭhahanto.
Here, without standing still means not resting.
Trong đó, appatiṭṭhaṃ có nghĩa là không đứng lại.
Anāyūhanti anāyūhanto, avāyamantoti attho.
Without striving means not exerting, not making an effort.
Anāyūhaṃ có nghĩa là không nỗ lực, không cố gắng; đây là ý nghĩa.
Iti bhagavā gūḷhaṃ paṭicchannaṃ katvā pañhaṃ kathesi.
Thus, the Blessed One spoke the answer in a hidden, concealed manner.
Như vậy, Thế Tôn đã trả lời câu hỏi một cách ẩn mật, che giấu.
Devatāpi naṃ sutvā ‘‘bāhirakaṃ tāva oghaṃ tarantā nāma ṭhātabbaṭṭhāne tiṭṭhantā taritabbaṭṭhāne āyūhantā taranti, ayaṃ pana avīcito yāva bhavaggā patthaṭaṃ kilesoghaṃ kilesarāsiṃ appatiṭṭhahanto anāyūhanto atarinti āha.
The devatā, hearing him, thought: "Those who cross an external flood, for instance, cross it by stopping at a place where they can rest and exerting themselves at a place where they should cross. But this one says he crossed the flood of defilements, the mass of defilements, which extends from Avīci up to the highest existence, without stopping and without striving.
Vị thiên nhân ấy nghe xong cũng nghĩ: “Những người vượt qua dòng sông bên ngoài thì phải đứng lại ở chỗ có thể đứng và nỗ lực ở chỗ có thể nỗ lực mới vượt qua được. Còn vị này lại nói rằng Ngài đã vượt qua dòng thác phiền não, khối phiền não trải dài từ Avīci cho đến Bhavagga mà không đứng lại, không nỗ lực.
Kiṃ nu kho etaṃ?
What can this mean?
Điều này là gì?
Kathaṃ nu kho eta’’nti?
How can this be?"
Điều này là như thế nào?”
Vimatiṃ pakkhantā pañhassa atthaṃ na aññāsi.
She fell into doubt and did not understand the meaning of the question.
Vị ấy rơi vào nghi ngờ và không hiểu ý nghĩa của câu hỏi.
115
Kiṃ pana bhagavatā yathā sattā na jānanti, evaṃ kathanatthāya pāramiyo pūretvā sabbaññutā paṭividdhāti?
Did the Blessed One, then, fulfill the perfections and attain omniscience so that beings would not understand, as he spoke?
Phải chăng Thế Tôn đã hoàn thành các ba-la-mật và chứng đắc Nhất thiết trí để thuyết pháp theo cách mà chúng sinh không thể hiểu được?
Na etadatthāya paṭividdhā.
He did not attain it for that purpose.
Ngài không chứng đắc vì mục đích đó.
Dve pana bhagavato desanā niggahamukhena ca anuggahamukhena ca.
But the Blessed One's teachings are twofold: through admonition and through encouragement.
Thế Tôn có hai cách thuyết pháp: một là theo cách khiển trách (niggahamukhena), hai là theo cách khuyến khích (anuggahamukhena).
Tattha ye paṇḍitamānino honti aññātepi ñātasaññino pañcasatā brāhmaṇapabbajitā viya, tesaṃ mānaniggahatthaṃ yathā na jānanti, evaṃ mūlapariyāyādisadisaṃ dhammaṃ deseti.
Among these, to those who are conceited and consider themselves wise even when they are ignorant, like the five hundred brahmins and ascetics, he teaches the Dhamma like the Mūlapariyāya Sutta to admonish their conceit, so that they do not understand.
Trong đó, đối với những người tự cho mình là thông thái, dù không biết nhưng lại nghĩ mình đã biết, như năm trăm vị Bà-la-môn xuất gia, Ngài thuyết pháp như Mūlapariyāya Sutta, v.v., theo cách mà họ không thể hiểu được, để khiển trách sự kiêu mạn của họ.
Ayaṃ niggahamukhena desanā.
This is teaching through admonition.
Đây là cách thuyết pháp theo lối khiển trách.
Vuttampi cetaṃ ‘‘niggayha niggayhāhaṃ, ānanda, vakkhāmi, pavayha pavayha, ānanda, vakkhāmi, yo sāro, so ṭhassatī’’ti (ma. ni. 3.196).
It was also said: "I will admonish and admonish you, Ānanda; I will encourage and encourage you, Ānanda. What is the essence will remain."
Điều này cũng đã được nói: “Này Ānanda, Ta sẽ khiển trách và khiển trách, Ta sẽ khuyến khích và khuyến khích. Điều cốt lõi sẽ còn lại.”
Ye pana ujukā sikkhākāmā, tesaṃ suviññeyyaṃ katvā ākaṅkheyyasuttādisadisaṃ dhammaṃ deseti, ‘‘abhirama, tissa, abhirama, tissa, ahamovādena ahamanuggahena ahamanusāsaniyā’’ti (saṃ. ni. 3.84) ca ne samassāseti.
But to those who are upright and desirous of learning, he teaches the Dhamma, making it easy to understand, like the Ākaṅkheyya Sutta, and he comforts them, saying: "Delight, Tissa, delight, Tissa. I am here to advise you, to encourage you, to instruct you."
Còn đối với những người chân thật, muốn học hỏi, Ngài thuyết pháp như Ākaṅkheyya Sutta, v.v., làm cho dễ hiểu, và an ủi họ rằng: “Này Tissa, hãy an vui, hãy an vui! Ta sẽ giáo huấn, Ta sẽ khuyến khích, Ta sẽ chỉ dạy.”
Ayaṃ anuggahamukhena desanā.
This is teaching through encouragement.
Đây là cách thuyết pháp theo lối khuyến khích.
116
Ayaṃ pana devaputto mānatthaddho paṇḍitamānī, evaṃ kirassa ahosi – ahaṃ oghaṃ jānāmi, tathāgatassa oghatiṇṇabhāvaṃ jānāmi, ‘‘iminā pana kāraṇena tiṇṇo’’ti ettakamattaṃ na jānāmi.
But this devaputta was stiff with conceit, conceited that he was wise. He thought: "I know the flood, I know that the Tathāgata has crossed the flood. But I do not know just by what means he crossed.
Còn vị thiên tử này thì kiêu mạn và tự cho mình là thông thái. Vị ấy đã nghĩ như vầy: “Ta biết các dòng thác (Ogha). Ta biết Thế Tôn đã vượt qua các dòng thác. Ta chỉ không biết nguyên nhân Ngài đã vượt qua.
Iti mayhaṃ ñātameva bahu, appaṃ aññātaṃ, tamahaṃ kathitamattameva jānissāmi.
Thus, what I know is much, and what I do not know is little. I will know that little just by being told.
Như vậy, điều ta đã biết thì nhiều, điều ta chưa biết thì ít. Ta sẽ biết ngay khi Ngài nói ra.
Kiñhi nāma taṃ bhagavā vadeyya, yassāhaṃ atthaṃ na jāneyyanti.
For what could the Blessed One say, the meaning of which I would not know?"
Làm sao Thế Tôn có thể nói điều gì mà ta không hiểu được?”
Atha satthā ‘‘ayaṃ kiliṭṭhavatthaṃ viya raṅgajātaṃ abhabbo imaṃ mānaṃ appahāya desanaṃ sampaṭicchituṃ, mānaniggahaṃ tāvassa katvā puna nīcacittena pucchantassa pakāsessāmī’’ti paṭicchannaṃ katvā pañhaṃ kathesi.
Then the Teacher thought: "This devatā is like a dirty cloth that is unfit to receive dye; he is unfit to receive the teaching without abandoning this conceit. Having first admonished his conceit, I will then reveal it to him when he asks with a humble mind." So, he gave a concealed answer to the question.
Bấy giờ, Đạo Sư nghĩ: “Vị thiên nhân này giống như một mảnh vải dơ đã nhuộm màu, không thể nhận thêm thuốc nhuộm. Nếu không từ bỏ sự kiêu mạn này, vị ấy không thể tiếp nhận giáo pháp. Ta sẽ khiển trách sự kiêu mạn của vị ấy trước, sau đó khi vị ấy hỏi với tâm khiêm hạ, Ta sẽ giải thích.” Thế Tôn đã trả lời câu hỏi một cách ẩn mật.
Sopi nihatamāno ahosi, sā cassa nihatamānatā uttaripañhapucchaneneva veditabbā.
And he became one whose conceit was struck down; that state of his struck-down conceit should be understood by his asking a further question.
Vị thiên nhân ấy cũng đã từ bỏ sự kiêu mạn. Việc vị ấy từ bỏ sự kiêu mạn có thể được biết qua việc vị ấy hỏi thêm câu hỏi.
Tassa pana pañhapucchanassa ayamattho – kathaṃ pana tvaṃ, mārisa, appatiṭṭhaṃ anāyūhaṃ oghamatari, yathāhaṃ jānāmi, evaṃ me kathehīti.
The meaning of his question was: "How, Mārisa, did you cross the flood without standing still and without striving? Tell me, so that I may understand."
Ý nghĩa của câu hỏi đó là: “Thưa Thế Tôn, Ngài đã vượt qua các dòng thác mà không đứng lại, không nỗ lực như thế nào? Xin Ngài hãy giải thích cho con để con hiểu rõ.”
117
Athassa bhagavā kathento yadāsvāhantiādimāha.
Then the Blessed One, answering him, began with when I (yadāsvāhaṃ).
Bấy giờ, Thế Tôn đã giải thích cho vị ấy bằng cách nói yadāsvāhaṃ (khi ta) và những lời tiếp theo.
Tattha yadā svāhanti yasmiṃ kāle ahaṃ.
Here, when I means at what time I.
Trong đó, yadā svāhaṃ có nghĩa là “vào lúc nào ta”.
Sukāro nipātamattaṃ.
The particle su is merely an expletive.
Âm “su” chỉ là một giới từ.
Yathā ca ettha, evaṃ sabbapadesu.
And as here, so in all passages.
Ở đây như vậy, và ở tất cả các đoạn khác cũng vậy.
Saṃsīdāmīti paṭicchannaṃ katvā ataranto tattheva osīdāmi.
I would sink means, if I were to cross by concealing, I would sink right there.
Saṃsīdāmi (ta chìm xuống) có nghĩa là ta chìm xuống ngay tại đó khi không vượt qua, che giấu.
Nibbuyhāmīti ṭhātuṃ asakkonto ativattāmi.
I would be swept away means, being unable to stay, I would be carried past.
Nibbuyhāmi (ta trôi đi) có nghĩa là ta bị cuốn trôi khi không thể đứng vững.
Iti ṭhāne ca vāyāme ca dosaṃ disvā atiṭṭhanto avāyamanto oghamatarinti evaṃ bhagavatā pañho kathito.
Thus, seeing fault in both stopping and striving, the Blessed One answered the question by saying that he crossed the flood without stopping and without striving.
Như vậy, Thế Tôn đã trả lời câu hỏi rằng Ngài đã vượt qua các dòng thác mà không đứng lại và không nỗ lực, vì Ngài đã thấy lỗi lầm trong việc đứng lại và nỗ lực.
Devatāyapi paṭividdho, na pana pākaṭo, tassa pākaṭīkaraṇatthaṃ satta dukā dassitā.
The devatā understood it, but it was not clear to him; to make it clear, seven pairs of explanations are given.
Vị thiên nhân ấy cũng đã hiểu, nhưng chưa rõ ràng. Để làm cho rõ ràng, bảy cặp đối lập đã được trình bày.
Kilesavasena hi santiṭṭhanto saṃsīdati nāma, abhisaṅkhāravasena āyūhanto nibbuyhati nāma.
Indeed, one who stands still due to defilements is said to sink, and one who strives due to volitional formations (abhisaṅkhāra) is said to be swept away.
Thật vậy, khi đứng lại theo nghiệp phiền não, người ta chìm xuống; khi nỗ lực theo nghiệp tạo tác, người ta trôi đi.
Taṇhādiṭṭhīhi vā santiṭṭhanto saṃsīdati nāma, avasesakilesānañceva abhisaṅkhārānañca vasena āyūhanto nibbuyhati nāma.
Or, one who stands still due to craving (taṇhā) and views (diṭṭhi) is said to sink, and one who strives due to the remaining defilements and volitional formations is said to be swept away.
Hoặc khi đứng lại bởi tham ái và tà kiến, người ta chìm xuống; khi nỗ lực bởi các phiền não còn lại và các nghiệp tạo tác, người ta trôi đi.
Taṇhāvasena vā santiṭṭhanto saṃsīdati nāma, diṭṭhivasena āyūhanto nibbuyhati nāma.
Or, one who stands still due to craving is said to sink, and one who strives due to views is said to be swept away.
Hoặc khi đứng lại bởi tham ái, người ta chìm xuống; khi nỗ lực bởi tà kiến, người ta trôi đi.
Sassatadiṭṭhiyā vā santiṭṭhanto saṃsīdati nāma, ucchedadiṭṭhiyā āyūhanto nibbuyhati nāma.
Or, one who stands still due to eternalism (sassatadiṭṭhi) is said to sink, and one who strives due to annihilationism (ucchedadiṭṭhi) is said to be swept away.
Hoặc khi đứng lại bởi thường kiến, người ta chìm xuống; khi nỗ lực bởi đoạn kiến, người ta trôi đi.
Olīyanābhinivesā hi bhavadiṭṭhi, atidhāvanābhinivesā vibhavadiṭṭhi.
For the attachment to existence (bhavadiṭṭhi) is an inclination to cling, and the attachment to non-existence (vibhavadiṭṭhi) is an inclination to rush forward.
Vì chấp thủ hữu kiến là sự bám víu vào sự trì trệ, còn chấp thủ vô hữu kiến là sự bám víu vào sự phóng dật.
Līnavasena vā santiṭṭhanto saṃsīdati nāma, uddhaccavasena āyūhanto nibbuyhati nāma.
Or, one who stands still due to lethargy (līna) is said to sink, and one who strives due to restlessness (uddhacca) is said to be swept away.
Hoặc khi đứng lại bởi sự lười biếng, người ta chìm xuống; khi nỗ lực bởi sự phóng dật, người ta trôi đi.
Tathā kāmasukhallikānuyogavasena santiṭṭhanto saṃsīdati nāma, attakilamathānuyogavasena āyūhanto nibbuyhati nāma.
Similarly, one who stands still due to indulgence in sensual pleasures is said to sink, and one who strives due to devotion to self-mortification is said to be swept away.
Tương tự, khi đứng lại bởi sự tận hưởng dục lạc, người ta chìm xuống; khi nỗ lực bởi sự khổ hạnh ép xác, người ta trôi đi.
Sabbākusalābhisaṅkhāravasena santiṭṭhanto saṃsīdati nāma, sabbalokiyakusalābhisaṅkhāravasena āyūhanto nibbuyhati nāma.
By standing firm due to all unwholesome volitional formations, one is said to sink; by striving due to all worldly wholesome volitional formations, one is said to be carried away.
Khi an trú theo mọi hành bất thiện (apuññābhisaṅkhāra) thì gọi là chìm đắm, khi nỗ lực theo mọi hành thiện thế gian (puññābhisaṅkhāra) thì gọi là bị cuốn trôi.
Vuttampi cetaṃ – ‘‘seyyathāpi, cunda, ye keci akusalā dhammā, sabbe te adhobhāgaṅgamanīyā, ye keci kusalā dhammā, sabbe te uparibhāgaṅgamanīyā’’ti (ma. ni. 1.86).
And this was also stated: ‘Just as, Cunda, whatever unwholesome states there are, all of them lead to the lower realms; whatever wholesome states there are, all of them lead to the higher realms.’
Điều này cũng đã được nói: “Này Cunda, phàm những pháp bất thiện nào, tất cả đều đưa đến phần hạ; phàm những pháp thiện nào, tất cả đều đưa đến phần thượng.”
118
Imaṃ pañhavissajjanaṃ sutvāva devatā sotāpattiphale patiṭṭhāya tuṭṭhā pasannā attano tuṭṭhiñca pasādañca pakāsayantī cirassaṃ vatāti gāthamāha.
Having heard this answer to the question, the deity, having established herself in the fruition of stream-entry, delighted and pleased, expressing her delight and pleasure, spoke the verse, " It has been a long time!"
Sau khi nghe lời giải đáp vấn nạn này, vị thiên nhân ấy đã an trú vào quả Dự lưu, hoan hỷ và tịnh tín, bày tỏ sự hoan hỷ và tịnh tín của mình, đã nói bài kệ “Đã lâu lắm rồi”.
Tattha cirassanti cirassa kālassa accayenāti attho.
Here, " cirassaṃ" means after a long time.
Trong đó, cirassaṃ có nghĩa là sau khi một thời gian dài đã trôi qua.
Ayaṃ kira devatā kassapasammāsambuddhaṃ disvā tassa parinibbānato paṭṭhāya antarā aññaṃ buddhaṃ na diṭṭhapubbā, tasmā ajja bhagavantaṃ disvā evamāha.
It is said that this deity, having seen the Perfectly Enlightened Buddha Kassapa, had not seen another Buddha in between, from the time of his Parinibbāna, and therefore spoke thus today upon seeing the Blessed One.
Vị thiên nhân này đã từng thấy Đức Phật Chánh Đẳng Giác Kassapa, và kể từ khi Ngài nhập Niết Bàn, vị ấy chưa từng thấy một vị Phật nào khác. Do đó, hôm nay khi thấy Đức Thế Tôn, vị ấy đã nói như vậy.
Kiṃ panimāya devatāya ito pubbe satthā na diṭṭhapubboti.
"But had this deity not seen the Teacher before this?"
Há vị thiên nhân này chưa từng thấy Đức Đạo Sư trước đây sao?
Diṭṭhapubbo vā hotu adiṭṭhapubbo vā, dassanaṃ upādāya evaṃ vattuṃ vaṭṭati.
Whether he had been seen before or not, it is fitting to speak thus based on the seeing.
Dù đã từng thấy hay chưa từng thấy, việc nói như vậy là thích hợp dựa trên sự thấy hiện tại.
Brāhmaṇanti bāhitapāpaṃ khīṇāsavabrāhmaṇaṃ.
" Brāhmaṇaṃ" means a brāhmaṇa whose defilements have been cast out, one whose taints are destroyed.
Brāhmaṇaṃ là một vị Bà-la-môn đã loại bỏ tội lỗi, một vị A-la-hán đã diệt trừ các lậu hoặc.
Parinibbutanti kilesanibbānena nibbutaṃ.
" Parinibbutaṃ" means one who is extinguished by the extinguishment of defilements.
Parinibbutaṃ là đã tịch diệt bằng sự tịch diệt phiền não.
Loketi sattaloke.
" Loke" means in the world of beings.
Loke là trong thế giới chúng sinh.
Visattikanti rūpādīsu ārammaṇesu āsattavisattatādīhi kāraṇehi visattikā vuccati taṇhā, taṃ visattikaṃ appatiṭṭhamānaṃ anāyūhamānaṃ tiṇṇaṃ nittiṇṇaṃ uttiṇṇaṃ cirassaṃ vata khīṇāsavabrāhmaṇaṃ passāmīti attho.
" Visattikaṃ" means craving is called visattikā due to reasons such as attachment and entanglement in sense objects like visible forms; the meaning is, "Oh, it has been a long time since I have seen a brāhmaṇa whose taints are destroyed, who does not cling (to visattikā), who does not strive, who has crossed over (the three defilements), who has truly crossed over (the four floods), and who has thoroughly crossed over."
Visattikaṃ là tham ái được gọi là visattikā do các nguyên nhân như sự bám víu và dính mắc vào các đối tượng như sắc pháp, v.v. Có nghĩa là: “Đã lâu lắm rồi, ta mới thấy một vị Bà-la-môn đã diệt trừ các lậu hoặc, không bám víu, không nỗ lực, đã vượt qua, đã hoàn toàn vượt qua, đã siêu việt khỏi ba cõi (tham ái, tà kiến, phiền não bám víu).”
119
Samanuñño satthā ahosīti tassā devatāya vacanaṃ citteneva samanumodi, ekajjhāsayo ahosi.
" Samanuñño Satthā ahosī" means the Teacher approved of the deity's words with His mind, becoming of the same disposition.
Samanuñño satthā ahosī có nghĩa là Đức Đạo Sư đã hoan hỷ trong tâm với lời nói của vị thiên nhân ấy, có cùng ý chí.
Antaradhāyīti abhisaṅkhatakāyaṃ jahitvā attano pakatiupādiṇṇakakāyasmiṃyeva ṭhatvā laddhāsā laddhapatiṭṭhā hutvā dasabalaṃ gandhehi ca mālehi ca pūjetvā attano bhavanaṃyeva agamāsīti.
" Antaradhāyī" means that having abandoned the created body, she remained in her own natural, taken-up body, having achieved her aspiration and established herself, she honored the Dasabala with fragrances and garlands, and then returned to her own abode.
Antaradhāyī có nghĩa là vị ấy đã từ bỏ thân do ý sinh, an trú trong thân hữu y của mình, đã đạt được hy vọng và sự an trú, đã cúng dường Đức Thập Lực bằng hương và hoa, rồi trở về cung điện của mình.
120
Oghataraṇasuttavaṇṇanā niṭṭhitā.
The commentary on the Oghataraṇa Sutta is concluded.
Phần chú giải bài kinh Oghataraṇa đã hoàn tất.
121
2. Nimokkhasuttavaṇṇanā
2. Commentary on the Nimokkha Sutta
2. Chú giải bài kinh Nimokkha
122
2. Idāni dutiyasuttato paṭṭhāya paṭhamamāgatañca uttānatthañca pahāya yaṃ yaṃ anuttānaṃ, taṃ tadeva vaṇṇayissāma.
Now, starting from the second sutta, we will comment only on what is not clear, omitting what has appeared previously and what is obvious.
2. Bây giờ, bắt đầu từ bài kinh thứ hai, chúng ta sẽ chỉ giải thích những gì không rõ ràng, bỏ qua những gì đã được giải thích trước đó và những gì có nghĩa rõ ràng.
Jānāsi noti jānāsi nu.
" Jānāsi no" means "Do you know?"
Jānāsi no có nghĩa là jānāsi nu (ngài có biết không?).
Nimokkhantiādīni maggādīnaṃ nāmāni.
" Nimokkha" and so forth are names for the path and so on.
Nimokkha và các từ khác là tên gọi của Đạo và các quả.
Maggena hi sattā kilesabandhanato nimuccanti, tasmā maggo sattānaṃ nimokkhoti vutto.
For by means of the path, beings are freed from the bondage of defilements; therefore, the path is called " nimokkha" (liberation) for beings.
Thật vậy, nhờ Đạo mà chúng sinh được giải thoát khỏi sự trói buộc của phiền não, do đó Đạo được gọi là nimokkha của chúng sinh.
Phalakkhaṇe pana te kilesabandhanato pamuttā, tasmā phalaṃ sattānaṃ pamokkhoti vuttaṃ.
At the moment of fruition (phala), they are completely liberated from the bondage of defilements; therefore, fruition is called " pamokkha" (complete liberation) for beings.
Đến lúc chứng quả, họ được giải thoát hoàn toàn khỏi sự trói buộc của phiền não, do đó Quả được gọi là pamokkha của chúng sinh.
Nibbānaṃ patvā sattānaṃ sabbadukkhaṃ viviccati, tasmā nibbānaṃ vivekoti vuttaṃ.
Having attained Nibbāna, all suffering is separated from beings; therefore, Nibbāna is called " viveka" (seclusion).
Khi đạt đến Nibbāna, mọi khổ đau của chúng sinh đều được chấm dứt, do đó Nibbāna được gọi là viveka.
Sabbāni vā etāni nibbānasseva nāmāni.
Alternatively, all these are names for Nibbāna itself.
Hoặc tất cả những điều này đều là tên gọi của Nibbāna.
Nibbānañhi patvā sattā sabbadukkhato nimuccanti pamuccanti viviccanti, tasmā tadeva ‘‘nimokkho pamokkho viveko’’ti vuttaṃ.
For having attained Nibbāna, beings are liberated, completely liberated, and secluded from all suffering; therefore, Nibbāna itself is called "nimokkha, pamokkha, viveka."
Thật vậy, khi đạt đến Nibbāna, chúng sinh được giải thoát, được hoàn toàn giải thoát, được chấm dứt khỏi mọi khổ đau, do đó Nibbāna được gọi là “nimokkha, pamokkha, viveka”.
Jānāmi khvāhanti jānāmi kho ahaṃ.
" Jānāmi khvāhaṃ" means "I surely know."
Jānāmi khvāhaṃ có nghĩa là jānāmi kho ahaṃ (chắc chắn tôi biết).
Avadhāraṇattho khokāro.
The particle kho has the meaning of emphasis.
Tiểu từ kho có nghĩa là xác quyết.
Ahaṃ jānāmiyeva.
I surely know.
Tôi chắc chắn biết.
Sattānaṃ nimokkhādijānanatthameva hi mayā samatiṃsa pāramiyo pūretvā sabbaññutaññāṇaṃ paṭividdhanti sīhanādaṃ nadati.
Indeed, the Buddha roars a lion's roar, saying, "It was precisely for the sake of knowing the liberation and so forth of beings that I fulfilled the thirty perfections and penetrated Omniscience."
Thật vậy, để biết được sự giải thoát của chúng sinh, v.v., tôi đã hoàn thành ba mươi Ba-la-mật và chứng đắc Nhất thiết trí – Đức Thế Tôn đã rống lên tiếng rống sư tử như vậy.
Buddhasīhanādaṃ nāma kira etaṃ suttaṃ.
It is said that this sutta is a lion's roar of the Buddha.
Bài kinh này được gọi là tiếng rống sư tử của Đức Phật.
123
Nandībhavaparikkhayāti nandīmūlakassa kammabhavassa parikkhayena.
" Nandībhavaparikkhayā" means by the destruction of kamma-bhava that has nandī (delight) as its root.
Nandībhavaparikkhayā có nghĩa là do sự đoạn diệt của nghiệp hữu (kammabhava) có gốc rễ là hoan hỷ (nandī).
Nandiyā ca bhavassa cātipi vaṭṭati.
It is also suitable to say "by the destruction of nandī and bhava."
Cũng có thể hiểu là do sự đoạn diệt của hoan hỷ và hữu.
Tattha hi purimanaye nandībhavena tividhakammābhisaṅkhāravasena saṅkhārakkhandho gahito, saññāviññāṇehi taṃsampayuttā ca dve khandhā.
Here, in the former interpretation, by nandībhava, the saṅkhārakkhandha (volitional formations aggregate) is taken in the sense of the three kinds of kammābhisaṅkhāra; and by saññā and viññāṇa, the two aggregates associated with it are taken.
Trong cách giải thích trước, từ nandībhava được dùng để chỉ uẩn hành (saṅkhārakkhandha) theo ba loại nghiệp hành, và hai uẩn còn lại (tưởng và thức) cũng được bao hàm do liên hệ với uẩn hành.
Tehi pana tīhi khandhehi sampayuttā vedanā tesaṃ gahaṇena gahitāvāti anupādiṇṇakānaṃ catunnaṃ arūpakkhandhānaṃ appavattivasena saupādisesaṃ nibbānaṃ kathitaṃ hoti.
The vedanākkhandha (feeling aggregate) associated with these three aggregates is implicitly taken with their inclusion, thus Nibbāna with a remnant of substratum (saupādisesa-nibbāna) is described as the non-occurrence of the four non-appropriated formless aggregates.
Khi ba uẩn này được bao hàm, thọ uẩn (vedanākkhandha) liên hệ với chúng cũng được bao hàm. Như vậy, Nibbāna hữu dư y (saupādisesa-nibbāna) được nói đến là sự không tái diễn của bốn uẩn vô sắc không bị chấp thủ.
Vedanānaṃ nirodhā upasamāti upādiṇṇakavedanānaṃ nirodhena ca upasamena ca.
" Vedanānaṃ nirodhā upasamā" means by the cessation and appeasement of the appropriated feelings.
Vedanānaṃ nirodhā upasamā có nghĩa là do sự diệt trừ và chấm dứt các thọ uẩn bị chấp thủ.
Tattha vedanāgahaṇena taṃsampayuttā tayo khandhā gahitāva honti, tesaṃ vatthārammaṇavasena rūpakkhandhopi.
Here, by the mention of feelings, the three aggregates associated with it are implicitly taken, and also the rūpakkhandha (form aggregate) in terms of its basis and object.
Trong đó, khi thọ uẩn được đề cập, ba uẩn liên hệ với nó cũng được bao hàm, và sắc uẩn (rūpakkhandha) cũng được bao hàm do liên hệ với nền tảng và đối tượng của chúng.
Evaṃ imesaṃ upādiṇṇakānaṃ pañcannaṃ khandhānaṃ appavattivasena anupādisesaṃ nibbānaṃ kathitaṃ hoti.
Thus, Nibbāna without a remnant of substratum (anupādisesa-nibbāna) is described as the non-occurrence of these five appropriated aggregates.
Như vậy, Nibbāna vô dư y (anupādisesa-nibbāna) được nói đến là sự không tái diễn của năm uẩn bị chấp thủ này.
Dutiyanaye pana nandiggahaṇena saṅkhārakkhandho gahito, bhavaggahaṇena upapattibhavasaṅkhāto rūpakkhandho, saññādīhi sarūpeneva tayo khandhā.
In the second interpretation, by the mention of nandī, the saṅkhārakkhandha is taken; by the mention of bhava, the rūpakkhandha referred to as upapattibhava (rebirth-existence) is taken; and by saññā, etc., the three aggregates are taken in their literal sense.
Trong cách giải thích thứ hai, từ nandī được dùng để chỉ uẩn hành, từ bhava được dùng để chỉ sắc uẩn dưới dạng tái sinh hữu (upapattibhava), và ba uẩn còn lại (tưởng, thức, thọ) được nói đến trực tiếp bằng chính tên gọi của chúng.
Evaṃ imesaṃ pañcannaṃ khandhānaṃ appavattivasena nibbānaṃ kathitaṃ hotīti veditabbaṃ.
Thus, Nibbāna is described as the non-occurrence of these five aggregates. This should be understood.
Như vậy, cần phải hiểu rằng Nibbāna được nói đến là sự không tái diễn của năm uẩn này.
Imameva ca nayaṃ catunikāyikabhaṇḍikatthero roceti.
And the Elder Bandika, expert in the four Nikāyas, approves of this very method.
Trưởng lão Bhāṇḍika, người thông thạo bốn bộ Nikāya, cũng tán thành cách giải thích này.
Iti nibbānavaseneva bhagavā desanaṃ niṭṭhāpesīti.
Thus, the Blessed One concluded the teaching primarily by referring to Nibbāna.
Như vậy, Đức Thế Tôn đã kết thúc bài thuyết pháp của mình bằng cách nói về Nibbāna.
124
Nimokkhasuttavaṇṇanā niṭṭhitā.
The commentary on the Nimokkha Sutta is concluded.
Phần chú giải bài kinh Nimokkha đã hoàn tất.
125
3. Upanīyasuttavaṇṇanā
3. Commentary on the Upanīya Sutta
3. Chú giải bài kinh Upanīya
126
3. Tatiye upanīyatīti parikkhīyati nirujjhati, upagacchati vā, anupubbena maraṇaṃ upetīti attho.
In the third*, " upanīyati" means it is worn out, it ceases, or it approaches, meaning it gradually approaches death.
3. Trong bài kinh thứ ba, upanīyatī có nghĩa là bị tiêu diệt, bị chấm dứt, hoặc đi đến, có nghĩa là dần dần đi đến cái chết.
Yathā vā gopālena gogaṇo nīyati, evaṃ jarāya maraṇasantikaṃ upanīyatīti attho.
Or, just as a herdsman leads a herd of cows, so too old age leads one to death.
Hoặc, như người chăn bò dẫn đàn bò đi, tương tự, tuổi già dẫn đến cái chết.
Jīvitanti jīvitindriyaṃ.
" Jīvitaṃ" means the life-faculty.
Jīvitaṃ là sinh mạng (jīvitindriya).
Appanti parittaṃ thokaṃ.
" Appaṃ" means little, small.
Appaṃ là ít ỏi, nhỏ nhoi.
Tassa dvīhākārehi parittatā veditabbā sarasaparittatāya ca khaṇaparittatāya ca.
Its shortness should be understood in two ways: shortness in terms of its natural flow and shortness in terms of its momentariness.
Sự ít ỏi của nó cần được hiểu theo hai cách: ít ỏi về bản chất và ít ỏi về sát-na.
Sarasaparittatāyapi hi ‘‘yo, bhikkhave, ciraṃ jīvati, so vassasataṃ appaṃ vā bhiyyo’’ti (dī. ni. 2.7; saṃ. ni. 2.143) vacanato parittaṃ.
Even in terms of its natural shortness, it is short, as stated: "Monks, whoever lives long, lives a hundred years or a little more."
Về sự ít ỏi về bản chất, nó là ít ỏi theo lời dạy: “Này các Tỳ-khưu, ai sống lâu thì sống một trăm năm, hoặc hơn một chút.”
Khaṇaparittatāyapi.
And in terms of its momentary shortness.
Về sự ít ỏi về sát-na.
Paramatthato hi atiparitto sattānaṃ jīvitakkhaṇo ekacittappavattimattoyeva.
For in the ultimate sense, the life-moment of beings is extremely short, lasting only for a single thought-moment.
Thật vậy, xét về mặt tối hậu, sát-na sinh mạng của chúng sinh là cực kỳ ít ỏi, chỉ bằng một sát-na tâm khởi lên mà thôi.
Yathā nāma rathacakkaṃ pavattamānampi ekeneva nemippadesena pavattati, tiṭṭhamānampi ekeneva tiṭṭhati, evamevaṃ ekacittakkhaṇikaṃ sattānaṃ jīvitaṃ, tasmiṃ citte niruddhamatte satto niruddhoti vuccati.
Just as a chariot wheel, even when moving, moves with only one part of its rim, and even when standing still, rests on only one part, so too the life of beings is momentary, lasting for a single thought-moment, and as soon as that thought ceases, the being is said to have ceased.
Như bánh xe đang lăn cũng chỉ lăn trên một điểm của vành, khi dừng lại cũng chỉ dừng trên một điểm, tương tự, sinh mạng của chúng sinh chỉ kéo dài một sát-na tâm. Khi tâm ấy diệt, chúng sinh được gọi là đã diệt.
Yathāha – atīte cittakkhaṇe jīvittha na jīvati na jīvissati, anāgate cittakkhaṇe jīvissati na jīvati na jīvittha, paccuppanne cittakkhaṇe jīvati na jīvittha na jīvissati.
As it is said: In the past thought-moment, one lived, one does not live now, one will not live in the future; in the future thought-moment, one will live, one does not live now, one did not live in the past; in the present thought-moment, one lives, one did not live in the past, one will not live in the future.
Như đã nói: “Trong sát-na tâm quá khứ, đã sống, không sống hiện tại, không sống tương lai. Trong sát-na tâm tương lai, sẽ sống, không sống hiện tại, không sống quá khứ. Trong sát-na tâm hiện tại, đang sống, không sống quá khứ, không sống tương lai.”
127
‘‘Jīvitaṃ attabhāvo ca, sukhadukkhā ca kevalā;
"Life and being itself, and all happiness and suffering;
“Sinh mạng và tự ngã,
128
Ekacittasamāyuttā, lahuso vattate khaṇo.
Associated with a single thought, the moment quickly passes.
Cùng tất cả khổ lạc,
129
‘‘Ye niruddhā marantassa, tiṭṭhamānassa vā idha;
Those aggregates that ceased for one dying, or for one existing here,
Chỉ liên kết một sát-na tâm,
130
Sabbepi sadisā khandhā, gatā appaṭisandhikā.
All are similar aggregates, gone without rebirth-linking.
Sát-na trôi qua nhanh chóng.
131
‘‘Anibbattena na jāto, paccuppannena jīvati;
By that which has not yet arisen, one is not born; by that which is present, one lives;
Những uẩn đã diệt của người chết,
132
Cittabhaṅgā mato loko, paññatti paramatthiyā’’ti.(mahāni. 10);
The world dies with the breaking of thought, for the sake of ultimate designation."
Hay của người đang sống ở đây,
133
Jarūpanītassāti jaraṃ upagatassa, jarāya vā maraṇasantikaṃ upanītassa.
" Jarūpanītassā" means for one who has approached old age, or for one led to death by old age.
Tất cả đều giống nhau, đã đi không tái sinh.
Na santi tāṇāti tāṇaṃ leṇaṃ saraṇaṃ bhavituṃ samatthā nāma keci natthi.
" Na santi tāṇā" means there is no one capable of being a protector, a shelter, a refuge.
Không phải bởi cái chưa sinh mà sinh,
Etaṃ bhayanti etaṃ jīvitindriyassa maraṇūpagamanaṃ, āyuparittatā, jarūpanītassa tāṇābhāvoti tividhaṃ bhayaṃ bhayavatthu bhayakāraṇanti attho.
" Etaṃ bhayaṃ" means this three-fold fear: the approach of death for the life-faculty, the shortness of life, and the absence of a protector for one led by old age, which is a cause of fear, a situation of fear.
Bởi cái hiện tại mà sống;
Puññāni kayirātha sukhāvahānīti viññū puriso sukhāvahāni sukhadāyakāni puññāni kareyya.
" Puññāni kayirātha sukhāvahānī" means a wise person should perform meritorious deeds that bring happiness, that give happiness.
Thế gian chết do tâm diệt, với sự chế định tối hậu.”
Iti devatā rūpāvacarajjhānaṃ sandhāya pubbacetanaṃ aparacetanaṃ muñcacetanañca gahetvā bahuvacanavasena ‘‘puññānī’’ti āha.
Thus, the deva, referring to the rūpāvacara jhāna, and taking the previous volition (pubbacetanā), the subsequent volition (aparacetanā), and the abandoning volition (muñcacetanā), spoke of "merits" (puññāni) in the plural.
Như vậy, vị thiên nhân ấy, nhắm đến thiền sắc giới (rūpāvacarajjhāna), đã lấy tư tâm sở (cetanā) trước (pubbacetanā), tư tâm sở sau (aparacetanā) và tư tâm sở xả (muñcacetanā), rồi dùng số nhiều mà nói là ‘các công đức’ (puññāni).
Jhānassādaṃ jhānanikantiṃ jhānasukhañca gahetvā ‘‘sukhāvahānī’’ti āha.
Taking the delight in jhāna (jhānassāda), the craving for jhāna (jhānanikanti), and the pleasure of jhāna (jhānasukha), he said, "bringing happiness" (sukhāvahāni).
Lấy sự hoan hỷ của thiền (jhānassāda), sự yêu thích thiền (jhānanikanti) và sự an lạc của thiền (jhānasukha), vị ấy nói là ‘đem lại an lạc’ (sukhāvahāni).
Tassā kira devatāya sayaṃ dīghāyukaṭṭhāne brahmaloke nibbattattā heṭṭhā kāmāvacaradevesu parittāyukaṭṭhāne cavamāne upapajjamāne ca thullaphusitake vuṭṭhipātasadise satte disvā etadahosi ‘‘ahovatime sattā jhānaṃ bhāvetvā aparihīnajjhānā kālaṃ katvā brahmaloke ekakappa-dvekappa-catukappa-aṭṭhakappa-soḷasakappa-dvattiṃsakappa-catusaṭṭhikappappamāṇaṃ addhānaṃ tiṭṭheyyu’’nti.
Now, because that deva himself had been reborn in the Brahma-world, a state of long life, he saw beings in the lower Kāma-worlds, realms of short life, passing away and being reborn like falling large raindrops, and it occurred to him: "Oh, if these beings were to cultivate jhāna, and after dying with unimpared jhāna, were to remain in the Brahma-world for a period of one, two, four, eight, sixteen, thirty-two, or sixty-four kappas! How wonderful!"
Vị thiên nhân ấy, vì tự mình tái sinh vào cõi Phạm thiên là nơi có tuổi thọ dài, đã thấy các chúng sinh ở các cõi trời dục giới bên dưới, nơi có tuổi thọ ngắn ngủi, đang hoại diệt và tái sinh, giống như những hạt mưa lớn rơi xuống, nên đã nghĩ rằng: “Ôi, ước gì những chúng sinh này, sau khi tu tập thiền và không bị suy thoái thiền, sẽ chết và tái sinh vào cõi Phạm thiên, sống lâu một kiếp, hai kiếp, bốn kiếp, tám kiếp, mười sáu kiếp, ba mươi hai kiếp, sáu mươi bốn kiếp!”.
Tasmā evamāha.
Therefore, he spoke thus.
Vì thế, vị ấy nói như vậy.
134
Atha bhagavā – ‘‘ayaṃ devatā aniyyānikaṃ vaṭṭakathaṃ kathetī’’ti vivaṭṭamassā dassento dutiyaṃ gāthamāha.
Then, the Blessed One, seeing that "this deva is speaking words pertaining to saṃsāra, which do not lead to liberation," spoke the second stanza, showing him the end of saṃsāra.
Khi đó, Đức Thế Tôn, thấy rằng “vị thiên nhân này đang nói về luân hồi (vaṭṭa) không đưa đến giải thoát (aniyyānikaṃ)”, nên đã nói kệ thứ hai để chỉ cho vị ấy thấy sự thoát ly (vivaṭṭa).
Tattha lokāmisanti dve lokāmisā pariyāyena ca nippariyāyena ca.
Here, lokāmisa (worldly allurements) are of two kinds: indirect (pariyāyena) and direct (nippariyāyena).
Trong đó, lợi lộc thế gian (lokāmisaṃ) có hai loại: theo cách gián tiếp (pariyāya) và trực tiếp (nippariyāya).
Pariyāyena tebhūmakavaṭṭaṃ lokāmisaṃ, nippariyāyena cattāro paccayā.
Indirectly, the cycle of the three realms (tebhūmaka vaṭṭa) is lokāmisa; directly, the four requisites are lokāmisa.
Theo cách gián tiếp, luân hồi ba cõi (tebhūmaka-vaṭṭa) là lợi lộc thế gian; theo cách trực tiếp, bốn vật dụng (paccaya) là lợi lộc thế gian.
Idha pariyāyalokāmisaṃ adhippetaṃ.
Here, the indirect lokāmisa is intended.
Ở đây, lợi lộc thế gian theo cách gián tiếp (pariyāyalokāmisaṃ) được đề cập.
Nippariyāyalokāmisampi vaṭṭatiyeva.
The direct lokāmisa is also appropriate.
Lợi lộc thế gian theo cách trực tiếp (nippariyāyalokāmisaṃ) cũng phù hợp.
Santipekkhoti nibbānasaṅkhātaṃ accantasantiṃ pekkhanto icchanto patthayantoti.
Santipekkho means one who seeks, desires, or yearns for the absolute peace known as Nibbāna.
Người tìm cầu sự an tịnh (santipekkho) nghĩa là người tìm kiếm, mong muốn, khao khát sự an tịnh tối thượng, tức là Niết Bàn (nibbāna).
135
Upanīyasuttavaṇṇanā niṭṭhitā.
The commentary on the Upaniyasutta is concluded.
Chú giải kinh Upanīya đã xong.
136
4. Accentisuttavaṇṇanā
4. Commentary on the Accentisutta
4. Chú giải kinh Accenti
137
4. Catutthe accentīti atikkamanti.
In the fourth (sutta), accenti means they pass beyond.
4. Trong kinh thứ tư, họ trôi qua (accenti) nghĩa là họ vượt qua.
Kālāti purebhattādayo kālā.
Kālā refers to times such as the time before a meal.
Thời gian (kālā) là các thời gian như trước bữa ăn.
Tarayanti rattiyoti rattiyo atikkamamānā puggalaṃ maraṇūpagamanāya tarayanti sīghaṃ sīghaṃ gamayanti.
Tarayanti rattiyo means that the nights, as they pass, carry the individual swiftly towards death.
Các đêm trôi qua (tarayanti rattiyo) nghĩa là các đêm trôi qua, khiến con người nhanh chóng tiến đến cái chết.
Vayoguṇāti paṭhamamajjhimapacchimavayānaṃ guṇā, rāsayoti attho.
Vayoguṇā means the aggregates of the first, middle, and last ages; that is, the heaps.
Các đặc tính của tuổi tác (vayoguṇā) là các đặc tính của tuổi thơ, tuổi trung niên và tuổi già, nghĩa là các giai đoạn tuổi tác.
‘‘Anujānāmi, bhikkhave, ahatānaṃ vatthānaṃ diguṇaṃ saṅghāṭi’’nti (mahāva. 348) ettha hi paṭalaṭṭho guṇaṭṭho.
For instance, in "Monks, I allow a double outer robe of unstitched cloth" (Vin. Mahāvagga 348), guṇa means a layer.
Trong câu “Này các Tỳ-khưu, Ta cho phép dùng y Saṅghāṭi hai lớp bằng vải mới” (Mahāva. 348), chữ guṇa ở đây có nghĩa là lớp.
‘‘Sataguṇā dakkhiṇā pāṭikaṅkhitabbā’’ti (ma. ni. 3.379) ettha ānisaṃsaṭṭho.
In "a hundredfold reward is to be expected from the offering" (MN 3.379), it means benefit or advantage.
Trong câu “Dakkhiṇā được mong đợi có trăm guṇa” (Ma. Ni. 3.379), chữ guṇa ở đây có nghĩa là lợi ích.
‘‘Antaṃ antaguṇa’’nti ettha koṭṭhāsaṭṭho.
In "large intestine, small intestine," it means a section or part.
Trong câu “ruột già, ruột non” (antaṃ antaguṇaṃ), chữ guṇa ở đây có nghĩa là phần.
‘‘Kayirā mālāguṇe bahū’’ti (dha. pa. 53) ettha rāsaṭṭho.
In "one should make many garlands" (Dhp. 53), it means a heap or cluster.
Trong câu “có thể làm nhiều vòng hoa” (kayirā mālāguṇe bahū) (Dha. Pa. 53), chữ guṇa ở đây có nghĩa là vòng.
‘‘Pañca kāmaguṇā’’ti ettha bandhanaṭṭho.
In "the five strands of sensuality," it means a bond.
Trong câu “năm dục lạc” (pañca kāmaguṇā), chữ guṇa ở đây có nghĩa là sự ràng buộc.
Idha pana rāsaṭṭho guṇaṭṭho.
But here, guṇa means a heap or cluster.
Nhưng ở đây, chữ guṇa có nghĩa là giai đoạn.
Tasmā vayoguṇāti vayorāsayo veditabbā.
Therefore, vayoguṇā should be understood as heaps of ages.
Do đó, các đặc tính của tuổi tác (vayoguṇā) nên được hiểu là các giai đoạn của tuổi tác.
Anupubbaṃ jahantīti anupaṭipāṭiyā puggalaṃ jahanti.
Anupubbaṃ jahantī means they abandon the individual in succession.
Họ tuần tự rời bỏ (anupubbaṃ jahanti) nghĩa là họ tuần tự rời bỏ con người.
Majjhimavaye ṭhitaṃ hi paṭhamavayo jahati, pacchimavaye ṭhitaṃ dve paṭhamamajjhimā jahanti, maraṇakkhaṇe pana tayopi vayā jahanteva.
Indeed, the first age abandons one who is in the middle age; the first and middle ages abandon one who is in the last age; and at the moment of death, all three ages abandon.
Thật vậy, tuổi thơ rời bỏ người ở tuổi trung niên; tuổi thơ và tuổi trung niên rời bỏ người ở tuổi già; còn vào khoảnh khắc cái chết, cả ba tuổi tác đều rời bỏ.
Etaṃ bhayanti etaṃ kālānaṃ atikkamanaṃ, rattidivānaṃ taritabhāvo, vayoguṇānaṃ jahanabhāvoti tividhaṃ bhayaṃ.
Etaṃ bhayaṃ refers to this threefold fear: the passing of times, the swift passing of days and nights, and the abandoning by the aggregates of ages.
Nỗi sợ hãi này (etaṃ bhayaṃ) là ba loại sợ hãi: sự trôi qua của thời gian, sự trôi qua của ngày đêm, và sự rời bỏ của các giai đoạn tuổi tác.
Sesaṃ purimasadisamevāti.
The rest is similar to the previous (sutta).
Phần còn lại tương tự như trước.
138
Accentisuttavaṇṇanā niṭṭhitā.
The commentary on the Accentisutta is concluded.
Chú giải kinh Accenti đã xong.
139
5. Katichindasuttavaṇṇanā
5. Commentary on the Katichindasutta
5. Chú giải kinh Katichinda
140
5. Pañcame kati chindeti chindanto kati chindeyya.
In the fifth (sutta), kati chinde means "how many should one cut?"
5. Trong kinh thứ năm, bao nhiêu nên đoạn trừ (kati chinde) nghĩa là khi đoạn trừ, nên đoạn trừ bao nhiêu.
Sesapadesupi eseva nayo.
The same method applies to the remaining phrases as well.
Các đoạn văn còn lại cũng theo cách này.
Ettha ca ‘‘chinde jahe’’ti atthato ekaṃ.
Here, "chinde" (cut) and "jahe" (abandon) are one in meaning.
Ở đây, “đoạn trừ” (chinde) và “loại bỏ” (jahe) có cùng ý nghĩa.
Gāthābandhassa pana maṭṭhabhāvatthaṃ ayaṃ devatā saddapunaruttiṃ vajjayantī evamāha.
However, for the sake of the refinement of the poetic meter, this deva avoided verbal repetition and spoke thus.
Nhưng để làm cho cấu trúc bài kệ (gāthābandha) thêm trau chuốt, vị thiên nhân này đã tránh lặp lại từ ngữ và nói như vậy.
Kati saṅgātigoti kati saṅge atigato, atikkantoti attho.
Kati saṅgātigo means "how many bonds has one overcome, transcended?"
Vượt qua bao nhiêu sự ràng buộc (kati saṅgātigo) nghĩa là đã vượt qua bao nhiêu sự ràng buộc.
Saṅgātikotipi pāṭho, ayameva attho.
"Saṅgātiko" is also a reading, and the meaning is the same.
Cũng có bản đọc là Saṅgātiko, ý nghĩa vẫn như vậy.
Pañca chindeti chindanto pañca orambhāgiyasaṃyojanāni chindeyya.
Pañca chinde means, "when cutting, one should cut the five lower fetters (orambhāgiyasaṃyojanāni)."
Nên đoạn trừ năm (pañca chinde) nghĩa là khi đoạn trừ, nên đoạn trừ năm hạ phần kiết sử (orambhāgiyasaṃyojanāni).
Pañca jaheti jahanto pañcuddhambhāgiyasaṃyojanāni jaheyya.
Pañca jahe means, "when abandoning, one should abandon the five higher fetters (uddhambhāgiyasaṃyojanāni)."
Nên loại bỏ năm (pañca jahe) nghĩa là khi loại bỏ, nên loại bỏ năm thượng phần kiết sử (uddhambhāgiyasaṃyojanāni).
Idhāpi chindanañca jahanañca atthato ekameva, bhagavā pana devatāya āropitavacanānurūpeneva evamāha.
Here too, cutting and abandoning are one in meaning, but the Blessed One spoke thus in accordance with the words attributed to the deva.
Ở đây, việc đoạn trừ và loại bỏ cũng chỉ là một ý nghĩa, nhưng Đức Thế Tôn đã nói như vậy theo đúng lời vị thiên nhân đã nêu ra.
Atha vā pādesu baddhapāsasakuṇo viya pañcorambhāgiyasaṃyojanāni heṭṭhā ākaḍḍhamānākārāni honti, tāni anāgāmimaggena chindeyyāti vadati.
Alternatively, the five lower fetters are like a bird caught in a snare by its feet, pulling it downwards, and he means that one should cut them with the Anāgāmi path.
Hoặc, năm hạ phần kiết sử giống như con chim bị mắc bẫy ở chân, kéo xuống dưới, nên nói rằng hãy đoạn trừ chúng bằng đạo quả Bất Lai (Anāgāmimagga).
Hatthehi gahitarukkhasākhā viya pañcuddhambhāgiyasaṃyojanāni upari ākaḍḍhamānākārāni honti, tāni arahattamaggena jaheyyāti vadati.
The five higher fetters are like tree branches grasped by the hands, pulling one upwards, and he means that one should abandon them with the Arahantship path.
Năm thượng phần kiết sử giống như cành cây bị nắm bằng tay, kéo lên trên, nên nói rằng hãy loại bỏ chúng bằng đạo quả A-la-hán (Arahattamagga).
Pañca cuttari bhāvayeti etesaṃ saṃyojanānaṃ chindanatthāya ceva pahānatthāya ca uttari atirekaṃ visesaṃ bhāvento saddhāpañcamāni indriyāni bhāveyyāti attho.
Pañca cuttari bhāvaye means that, in order to cut and abandon these fetters, one should cultivate the faculties (indriyāni), the fifth of which is faith (saddhā), as an extra, special cultivation.
Nên tu tập thêm năm (pañca cuttari bhāvaye) nghĩa là để đoạn trừ và loại bỏ các kiết sử này, nên tu tập thêm các căn (indriya) với tín (saddhā) là thứ năm.
Pañca saṅgātigoti rāgasaṅgo dosasaṅgo mohasaṅgo mānasaṅgo diṭṭhisaṅgoti ime pañca saṅge atikkanto.
Pañca saṅgātigo means one who has overcome these five bonds: the bond of lust (rāgasaṅga), the bond of hatred (dosasaṅga), the bond of delusion (mohasaṅga), the bond of conceit (mānasaṅga), and the bond of wrong view (diṭṭhisaṅga).
Vượt qua năm sự ràng buộc (pañca saṅgātigo) nghĩa là đã vượt qua năm sự ràng buộc này: sự ràng buộc của tham (rāgasaṅgo), sự ràng buộc của sân (dosasaṅgo), sự ràng buộc của si (mohasaṅgo), sự ràng buộc của mạn (mānasaṅgo), sự ràng buộc của tà kiến (diṭṭhisaṅgo).
Oghatiṇṇoti vuccatīti caturoghatiṇṇoti kathīyati.
Oghatiṇṇoti vuccatī means one is called "one who has crossed the four floods (ogha)."
Được gọi là người đã vượt qua dòng nước lũ (oghatiṇṇoti vuccatī) nghĩa là được gọi là người đã vượt qua bốn dòng nước lũ (ogha).
Imāya pana gāthāya pañcindriyāni lokiyalokuttarāni kathitānīti.
And by this stanza, the five faculties, both mundane (lokiya) and supramundane (lokuttara), are taught.
Và trong bài kệ này, năm căn (pañcindriyāni) được nói đến là cả thế gian (lokiya) và siêu thế (lokuttara).
141
Katichindasuttavaṇṇanā niṭṭhitā.
The commentary on the Katichindasutta is concluded.
Chú giải kinh Katichinda đã xong.
142
6. Jāgarasuttavaṇṇanā
6. Commentary on the Jāgarasutta
6. Chú giải kinh Jāgara
143
6. Chaṭṭhe jāgaratanti jāgarantānaṃ.
In the sixth (sutta), jāgarataṃ means "of those who are awake."
6. Trong kinh thứ sáu, người thức tỉnh (jāgarataṃ) nghĩa là những người đang thức tỉnh.
Pañca jāgaratanti vissajjanagāthāyaṃ pana saddhādīsu pañcasu indriyesu jāgarantesu pañca nīvaraṇā suttā nāma.
In the answering stanza, pañca jāgarataṃ means that when the five faculties (saddhā, etc.) are awake, the five hindrances are said to be asleep.
Trong bài kệ giải đáp (vissajjanagāthā) về năm người thức tỉnh (pañca jāgarataṃ), năm triền cái (nīvaraṇā) được gọi là đang ngủ khi năm căn như tín (saddhā) v.v. đang thức tỉnh.
Kasmā?
Why?
Tại sao?
Yasmā taṃsamaṅgīpuggalo yattha katthaci nisinno vā ṭhito vā aruṇaṃ uṭṭhapentopi pamādatāya akusalasamaṅgitāya sutto nāma hoti.
Because a person endowed with those (hindrances), whether sitting or standing anywhere, even at dawn, is said to be asleep due to heedlessness and being endowed with unwholesome states.
Vì một người có đầy đủ các triền cái đó, dù đang ngồi hay đứng ở bất cứ đâu, thậm chí khi bình minh ló dạng, vẫn được gọi là đang ngủ vì sự phóng dật (pamāda) và sự đầy đủ bất thiện (akusalasamaṅgitā).
Evaṃ suttesu pañcasu nīvaraṇesu pañcindriyāni jāgarāni nāma.
Similarly, when the five hindrances are asleep, the five faculties are said to be awake.
Tương tự như vậy, khi năm triền cái đang ngủ, năm căn được gọi là đang thức tỉnh.
Kasmā?
Why?
Tại sao?
Yasmā taṃsamaṅgīpuggalo yattha katthaci nipajjitvā niddāyantopi appamādatāya kusalasamaṅgitāya jāgaro nāma hoti.
Because a person endowed with those (faculties), even lying down and sleeping anywhere, is said to be awake due to heedfulness and being endowed with wholesome states.
Vì một người có đầy đủ các căn đó, dù đang nằm ngủ ở bất cứ đâu, vẫn được gọi là đang thức tỉnh vì sự không phóng dật (appamāda) và sự đầy đủ thiện (kusalasamaṅgitā).
Pañcahi pana nīvaraṇeheva kilesarajaṃ ādiyati gaṇhāti parāmasati.
Indeed, it is through the five hindrances that one takes, grasps, and wrongly applies the defilements' dust.
Tuy nhiên, con người thu nhận (ādiyati), nắm giữ (gaṇhāti), và bám víu (parāmasati) bụi phiền não (kilesarajaṃ) chỉ bằng năm triền cái.
Purimā hi kāmacchandādayo pacchimānaṃ paccayā hontīti pañcahi indriyehi parisujjhatīti ayamattho veditabbo.
For indeed, the former states like sensual desire are causes for the latter, and therefore, it should be understood that one is purified by the five faculties.
Thật vậy, các pháp như dục tham (kāmacchanda) v.v. trước là nhân duyên cho các pháp sau, nên ý nghĩa cần được hiểu là người đó được thanh tịnh hoàn toàn nhờ năm căn.
Idhāpi pañcindriyāni lokiyalokuttarāneva kathitānīti.
Here too, the five faculties, both mundane and supramundane, are taught.
Ở đây, năm căn cũng được nói đến là cả thế gian và siêu thế.
144
Jāgarasuttavaṇṇanā niṭṭhitā.
The commentary on the Jāgarasutta is concluded.
Chú giải kinh Jāgara đã xong.
145
7. Appaṭividitasuttavaṇṇanā
7. Commentary on the Appaṭividitasutta
7. Chú giải kinh Appaṭividita
146
7. Sattame dhammāti catusaccadhammā.
In the seventh (sutta), dhammā refers to the four Noble Truths (catusaccadhammā).
7. Trong kinh thứ bảy, các pháp (dhammā) là các pháp Tứ Thánh Đế (catusaccadhammā).
Appaṭividitāti ñāṇena appaṭividdhā.
Appaṭividitā means "not penetrated by wisdom."
Chưa được thấu hiểu (appaṭividitā) nghĩa là chưa được thấu suốt bằng trí tuệ (ñāṇa).
Paravādesūti dvāsaṭṭhidiṭṭhigatavādesu.
Paravādesu refers to the sixty-two wrong views.
Trong các giáo phái khác (paravādesu) là trong các giáo phái của sáu mươi hai tà kiến (dvāsaṭṭhidiṭṭhigatavādesu).
Te hi ito paresaṃ titthiyānaṃ vādattā paravādā nāma.
Indeed, these are called "paravādā" (other views) because they are the views of other teachers (titthiya).
Thật vậy, chúng được gọi là các giáo phái khác (paravādā) vì chúng là các giáo phái của các ngoại đạo.
Nīyareti attano dhammatāyapi gacchanti, parenapi nīyanti.
Nīyare means they go by their own nature, and they are also led by others.
Họ bị dẫn đi (nīyare) nghĩa là họ tự đi theo bản chất của mình, và cũng bị người khác dẫn đi.
Tattha sayameva sassatādīni gaṇhantā gacchanti nāma, parassa vacanena tāni gaṇhantā nīyanti nāma.
Here, going means that they themselves grasp views such as eternalism; being led means that they grasp those views by the words of others.
Trong đó, việc tự đi nghĩa là họ tự chấp thủ các kiến chấp như thường kiến (sassata) v.v.; việc bị dẫn đi nghĩa là họ chấp thủ chúng theo lời của người khác.
Kālo tesaṃ pabujjhitunti tesaṃ puggalānaṃ pabujjhituṃ ayaṃ kālo.
Kālo tesaṃ pabujjhituṃ means "this is the time for those individuals to awaken."
Đã đến lúc họ thức tỉnh (kālo tesaṃ pabujjhituṃ) nghĩa là đây là lúc để những người đó thức tỉnh.
Lokasmiñhi buddho uppanno, dhammo desiyati, saṅgho suppaṭipanno, paṭipadā bhaddikā, ime ca pana mahājanā vaṭṭe suttā nappabujjhantīti devatā āha.
Indeed, the deva said, "A Buddha has arisen in the world, the Dhamma is taught, the Saṅgha is well-practiced, the path is excellent, yet these common people sleep in saṃsāra and do not awaken."
Thật vậy, vị thiên nhân nói: “Đức Phật đã xuất hiện trên thế gian, Pháp đang được thuyết giảng, Tăng chúng đang thực hành đúng đắn, con đường tu tập là tốt đẹp, nhưng những chúng sinh này vẫn đang ngủ trong luân hồi và không thức tỉnh”.
Sambuddhāti sammā hetunā kāraṇena buddhā.
Sambuddhā means "rightly awakened by cause and reason."
Những người giác ngộ hoàn toàn (sambuddhā) nghĩa là những người đã giác ngộ đúng đắn bằng nhân và duyên.
Cattāro hi buddhā – sabbaññubuddho, paccekabuddho, catusaccabuddho, sutabuddhoti.
There are four kinds of Buddhas: the Omniscient Buddha (Sabbaññubuddha), the Paccekabuddha, the Catusaccabuddha, and the Sutabuddha.
Thật vậy, có bốn loại Phật: Chánh Đẳng Giác (Sabbaññubuddha), Độc Giác (Paccekabuddha), Giác Ngộ Tứ Thánh Đế (Catusaccabuddha), và Giác Ngộ nhờ nghe Pháp (Sutabuddha).
Tattha samatiṃsapāramiyo pūretvā sammāsambodhiṃ patto sabbaññubuddho nāma.
Among these, one who has fulfilled thirty perfections and attained perfect self-awakening is called a Sabbaññubuddha.
Trong đó, người đã viên mãn ba mươi ba Ba-la-mật và đạt được Chánh Đẳng Giác (Sammāsambodhi) được gọi là Chánh Đẳng Giác.
Kappasatasahassādhikāni dve asaṅkhyeyyāni pāramiyo pūretvā sayambhutaṃ patto paccekabuddho nāma.
One who has fulfilled perfections for two asaṅkhyeyyas and one hundred thousand kappas and attained self-awakening is called a Paccekabuddha.
Người đã viên mãn Ba-la-mật trong hai A-tăng-kỳ và một trăm ngàn đại kiếp, và đạt được sự tự giác ngộ (sayambhutaṃ) được gọi là Độc Giác.
Avasesā khīṇāsavā catusaccabuddhā nāma.
The remaining Arahants are called Catusaccabuddhas.
Các vị A-la-hán còn lại được gọi là Giác Ngộ Tứ Thánh Đế.
Bahussuto sutabuddho nāma.
One who is learned is called a Sutabuddha.
Người đa văn (bahussuta) được gọi là Giác Ngộ nhờ nghe Pháp.
Imasmiṃ atthe tayopi purimā vaṭṭanti.
In this context, all three former types are applicable.
Trong ngữ cảnh này, cả ba loại Phật đầu tiên đều phù hợp.
Sammadaññāti sammā hetunā kāraṇena jānitvā.
Sammadaññā means having known well, through proper reason and cause.
Sammadaññā có nghĩa là biết rõ ràng, đúng đắn, có lý do, có nguyên nhân.
Caranti visame samanti visame vā lokasannivāse visame vā sattanikāye visame vā kilesajāte samaṃ carantīti.
They fare evenly in the uneven means they fare evenly in the uneven state of human society, or among uneven beings (lacking mindfulness and wisdom), or among uneven defilements such as greed.
Caranti visame sama có nghĩa là sống bình đẳng giữa thế gian bất bình đẳng, giữa chúng sinh bất bình đẳng, hoặc giữa các phiền não bất bình đẳng.
147
Appaṭividitasuttavaṇṇanā niṭṭhitā.
The commentary on the Appaṭividita Sutta is finished.
Chú giải Kinh Appaṭividita đã hoàn tất.
148
8. Susammuṭṭhasuttavaṇṇanā
8. Commentary on the Susammuṭṭha Sutta
8. Chú giải Kinh Susammuṭṭha
149
8. Aṭṭhame susammuṭṭhāti paññāya appaṭividdhabhāveneva sunaṭṭhā.
8. In the eighth*, susammuṭṭhā means utterly lost simply due to not having penetrated with wisdom.
8. Trong kinh thứ tám, susammuṭṭhā có nghĩa là hoàn toàn bị hủy hoại do không thấu hiểu bằng tuệ.
Yathā hi dve khettāni kasitvā, ekaṃ vapitvā, bahudhaññaṃ adhigatassa avāpitakhettato aladdhaṃ sandhāya ‘‘bahuṃ me dhaññaṃ naṭṭha’’nti vadanto aladdhameva ‘‘naṭṭha’’nti vadati, evamidhāpi appaṭividitāva susammuṭṭhā nāma.
Just as one who has tilled two fields, sown one, and obtained much grain, but says "much of my grain is lost" referring to what was not obtained from the unsown field, speaking of what was not obtained as "lost"; so too here, those who have not penetrated are called susammuṭṭhā (utterly lost).
Ví như, một người cày hai thửa ruộng, gieo trồng một thửa, và thu được nhiều lúa. Khi nói “Tôi đã mất nhiều lúa” để chỉ số lúa không thu được từ thửa ruộng không gieo trồng, người ấy nói “mất” là chỉ những gì không có được. Tương tự như vậy ở đây, chỉ những gì không được thấu hiểu mới được gọi là susammuṭṭhā.
Asammuṭṭhāti paññāya paṭividdhabhāveneva anaṭṭhā.
Asammuṭṭhā means not lost, simply due to having penetrated with wisdom.
Asammuṭṭhā có nghĩa là không bị hủy hoại do đã thấu hiểu bằng tuệ.
Sesaṃ purimasadisamevāti.
The rest is similar to the preceding*.
Phần còn lại tương tự như trước.
150
Susammuṭṭhasuttavaṇṇanā niṭṭhitā.
The commentary on the Susammuṭṭha Sutta is finished.
Chú giải Kinh Susammuṭṭha đã hoàn tất.
151
9. Mānakāmasuttavaṇṇanā
9. Commentary on the Mānakāma Sutta
9. Chú giải Kinh Mānakāma
152
9. Navame mānakāmassāti mānaṃ kāmentassa icchantassa.
9. In the ninth*, mānakāmassā means one who longs for, desires, conceit.
9. Trong kinh thứ chín, mānakāmassā có nghĩa là của người mong muốn, khao khát ngã mạn.
Damoti evarūpassa puggalassa samādhipakkhiko damo natthīti vadati.
Damo (self-control) means that a person of such a nature does not possess self-control belonging to the concentration-group of factors.
Damo có nghĩa là người như vậy không có sự chế ngự thuộc về định.
‘‘Saccena danto damasā upeto, vedantagū vusitabrahmacariyo’’ti (saṃ. ni. 1.195) ettha hi indriyasaṃvaro damoti vutto.
For here, in "Tamed by truth, endowed with self-control, one who has reached the end of knowledge, who has lived the holy life" (Saṃ. Ni. 1.195), control of the faculties is called dama.
Ở đây, trong câu ‘‘Saccena danto damasā upeto, vedantagū vusitabrahmacariyo’’ (Saṃ. Ni. 1.195), sự chế ngự các căn được gọi là damo.
‘‘Yadi saccā damā cāgā, khantyā bhiyyodha vijjatī’’ti (saṃ. ni. 1.246; su. ni. 191) ettha paññā.
In "If there is still more of truth, self-control, relinquishment, and patience here" (Saṃ. Ni. 1.246; Su. Ni. 191), it refers to wisdom.
Trong câu ‘‘Yadi saccā damā cāgā, khantyā bhiyyodha vijjatī’’ (Saṃ. Ni. 1.246; Su. Ni. 191), đó là tuệ.
‘‘Dānena damena saṃyamena saccavajjena atthi puññaṃ, atthi puññassa āgamo’’ti (saṃ. ni. 4.365) ettha uposathakammaṃ.
In "Through generosity, self-control, restraint, and truthfulness there is merit, there is an accumulation of merit" (Saṃ. Ni. 4.365), it refers to the observance of Uposatha.
Trong câu ‘‘Dānena damena saṃyamena saccavajjena atthi puññaṃ, atthi puññassa āgamo’’ (Saṃ. Ni. 4.365), đó là việc giữ giới uposatha.
‘‘Sakkhissasi kho tvaṃ, puṇṇa, iminā damūpasamena samannāgato sunāparantasmiṃ janapade viharitu’’nti (saṃ. ni. 4.88; ma. ni. 3.396) ettha adhivāsanakhanti.
In "Surely, Puṇṇa, being endowed with this self-control and peacefulness, you will be able to dwell in the country of Sunāparanta" (Saṃ. Ni. 4.88; Ma. Ni. 3.396), it refers to the patience of endurance (adhivāsanakhanti).
Trong câu ‘‘Sakkhissasi kho tvaṃ, Puṇṇa, iminā damūpasamena samannāgato sunāparantasmiṃ janapade viharitu’’ (Saṃ. Ni. 4.88; Ma. Ni. 3.396), đó là sự nhẫn nại cam chịu (adhivāsanakhantī).
Imasmiṃ pana sutte damoti samādhipakkhikadhammānaṃ etaṃ nāmaṃ.
In this sutta, however, dama is a name for the qualities belonging to the concentration-group.
Tuy nhiên, trong kinh này, damo là tên gọi của các pháp thuộc về định.
Tenevāha – ‘‘na monamatthi asamāhitassā’’ti.
Therefore, it says: "There is no sagehood for one who is not concentrated."
Do đó, Đức Phật đã dạy: ‘‘na monamatthi asamāhitassā’’ (không có sự tịch tịnh cho người không có định).
Tattha monanti catumaggañāṇaṃ, tañhi munātīti monaṃ, catusaccadhamme jānātīti attho.
There, monaṃ means the knowledge of the four paths; for that is mona (sagehood) because it munāti (knows), meaning it knows the truths of the four Noble Truths.
Ở đây, monaṃ là Tứ đạo trí, vì nó biết (munāti) nên gọi là monaṃ, tức là biết Tứ diệu đế.
Maccudheyyassāti tebhūmakavaṭṭassa.
Maccudheyyassā refers to the three realms of existence (tebhūmakavaṭṭa).
Maccudheyyassā là ba cõi luân hồi (tebhūmakavaṭṭa).
Tañhi maccuno patiṭṭhānaṭṭhena maccudheyyanti vuccati.
For that is called maccudheyya (the domain of Death) in the sense of being the dwelling place of Death.
Vì nó là nơi nương tựa của tử thần, nên được gọi là maccudheyya.
Pāranti tasseva pāraṃ nibbānaṃ.
Pāraṃ is the other shore of that very*, Nibbāna.
Pāraṃ là Niết Bàn, bờ bên kia của chính nó.
Tareyyāti paṭivijjheyya pāpuṇeyya vā.
Tareyyā means to penetrate or to reach.
Tareyyā có nghĩa là thấu hiểu hoặc đạt đến.
Idaṃ vuttaṃ hoti – eko araññe viharanto pamatto puggalo maccudheyyassa pāraṃ na tareyya na paṭivijjheyya na pāpuṇeyyāti.
This is what is meant: A heedless person dwelling alone in the forest would not cross, would not penetrate, would not reach the other shore of Death's domain.
Điều này có nghĩa là: một người sống trong rừng, nếu phóng dật, sẽ không thể vượt qua, không thể thấu hiểu, không thể đạt đến bờ bên kia của cõi tử thần.
153
Mānaṃ pahāyāti arahattamaggena navavidhamānaṃ pajahitvā.
Mānaṃ pahāyā means having abandoned the nine kinds of conceit through the path of Arahantship.
Mānaṃ pahāyā có nghĩa là đã từ bỏ chín loại ngã mạn bằng đạo A-la-hán.
Susamāhitattoti upacārappanāsamādhīhi suṭṭhu samāhitatto.
Susamāhitatto means having a mind well concentrated by access concentration and absorption concentration.
Susamāhitatto có nghĩa là tâm đã được định tốt đẹp bằng định cận hành và định an chỉ.
Sucetasoti ñāṇasampayuttatāya sundaracitto.
Sucetaso means having a beautiful mind due to being associated with knowledge.
Sucetaso có nghĩa là tâm thanh tịnh do có trí tuệ đi kèm.
Ñāṇavippayuttacittena hi sucetasoti na vuccati, tasmā ñāṇasampayuttena sucetaso hutvāti attho.
Indeed, a mind dissociated from knowledge is not called sucetaso; therefore, the meaning is: having become sucetaso (beautiful-minded) by being associated with knowledge.
Vì một tâm không có trí tuệ thì không được gọi là sucetaso, do đó, sucetaso có nghĩa là có một tâm thanh tịnh đi kèm với trí tuệ.
Sabbadhi vippamuttoti sabbesu khandhāyatanādīsu vippamutto hutvā.
Sabbadhi vippamutto means having become completely liberated from all aggregates, sense bases, and so forth.
Sabbadhi vippamutto có nghĩa là đã hoàn toàn giải thoát khỏi tất cả các uẩn, xứ, v.v.
Tareyyāti ettha tebhūmakavaṭṭaṃ samatikkamanto nibbānaṃ paṭivijjhanto taratīti paṭivedhataraṇaṃ nāma vuttaṃ.
Here, in Tareyyā, crossing by penetration is spoken of, meaning one who transcends the three realms of existence, penetrating Nibbāna, thereby crosses.
Ở đây, Tareyyā có nghĩa là vượt qua ba cõi luân hồi, thấu hiểu Niết Bàn, tức là sự vượt qua bằng sự thấu hiểu.
Iti imāya gāthāya tisso sikkhā kathitā honti.
Thus, by this verse, the three trainings are expounded.
Như vậy, với bài kệ này, ba học pháp đã được giảng giải.
Kathaṃ – māno nāmāyaṃ sīlabhedano, tasmā ‘‘mānaṃ pahāyā’’ti iminā adhisīlasikkhā kathitā hoti.
How? This conceit is a breaker of sīla; therefore, by "Mānaṃ pahāyā," the training in higher sīla (adhisīla) is expounded.
Thế nào? Ngã mạn này là kẻ phá hoại giới hạnh, do đó, với câu ‘‘mānaṃ pahāyā’’ (từ bỏ ngã mạn), giới tăng thượng học (adhisīlasikkhā) đã được giảng giải.
‘‘Susamāhitatto’’ti iminā adhicittasikkhā.
By "Susamāhitatto," the training in higher consciousness (adhicitta)*.
Với câu ‘‘Susamāhitatto’’ (tâm đã được định tốt đẹp), tâm tăng thượng học (adhicittasikkhā) đã được giảng giải.
‘‘Sucetaso’’ti ettha cittena paññā dassitā, tasmā iminā adhipaññāsikkhā kathitā.
In "Sucetaso," wisdom is shown by means of the mind; therefore, by this, the training in higher wisdom (adhipaññā) is expounded.
Trong câu ‘‘Sucetaso’’ (tâm thanh tịnh), trí tuệ được thể hiện qua tâm, do đó, với câu này, tuệ tăng thượng học (adhipaññāsikkhā) đã được giảng giải.
Adhisīlañca nāma sīle sati hoti, adhicittaṃ citte sati, adhipaññā paññāya sati.
Higher sīla arises when there is sīla; higher consciousness when there is consciousness; higher wisdom when there is wisdom.
Giới tăng thượng học có khi có giới (sīla), tâm tăng thượng học có khi có tâm (citta), tuệ tăng thượng học có khi có tuệ (paññā).
Tasmā sīlaṃ nāma pañcapi dasapi sīlāni, pātimokkhasaṃvaro adhisīlaṃ nāmāti veditabbaṃ.
Therefore, sīla refers to the five or ten precepts, and the restraint of the Pātimokkha is to be understood as higher sīla.
Do đó, giới (sīla) là năm giới hoặc mười giới, còn giới luật Pātimokkha (pātimokkhasaṃvaro) được biết là giới tăng thượng học (adhisīlaṃ).
Aṭṭha samāpattiyo cittaṃ, vipassanāpādakajjhānaṃ adhicittaṃ.
The eight attainments are consciousness, and the jhāna based on vipassanā is higher consciousness.
Tám thiền chứng (aṭṭha samāpattiyo) là tâm (citta), thiền làm nền tảng cho thiền quán (vipassanāpādakajjhāna) là tâm tăng thượng học (adhicittaṃ).
Kammassakatañāṇaṃ paññā, vipassanā adhipaññā.
The knowledge of the ownership of kamma is wisdom, and vipassanā is higher wisdom.
Trí tuệ về nghiệp và quả của nghiệp (kammassakatañāṇaṃ) là tuệ (paññā), thiền quán (vipassanā) là tuệ tăng thượng học (adhipaññā).
Anuppannepi hi buddhuppāde pavattatīti pañcasīlaṃ dasasīlaṃ sīlameva, pātimokkhasaṃvarasīlaṃ buddhuppādeyeva pavattatīti adhisīlaṃ.
For the five precepts and ten precepts are indeed sīla, as they prevail even without the arising of a Buddha, but the sīla of Pātimokkha restraint prevails only with the arising of a Buddha, and is thus higher sīla.
Ngay cả khi Đức Phật chưa xuất hiện, năm giới và mười giới vẫn tồn tại và là giới (sīla) thuần túy. Giới Pātimokkha chỉ tồn tại khi Đức Phật xuất hiện, do đó nó là giới tăng thượng học (adhisīlaṃ).
Cittapaññāsupi eseva nayo.
The same method applies to consciousness and wisdom.
Tương tự cũng áp dụng cho tâm và tuệ.
Apica nibbānaṃ patthayantena samādinnaṃ pañcasīlampi dasasīlampi adhisīlameva.
Furthermore, even the five precepts or ten precepts undertaken by one aspiring to Nibbāna are indeed higher sīla.
Hơn nữa, năm giới và mười giới mà người mong cầu Niết Bàn đã thọ trì cũng là giới tăng thượng học.
Samāpannā aṭṭha samāpattiyopi adhicittameva.
The eight attainments entered into by one aspiring to Nibbāna are indeed higher consciousness.
Tám thiền chứng đã nhập cũng là tâm tăng thượng học.
Sabbampi vā lokiyasīlaṃ sīlameva, lokuttaraṃ adhisīlaṃ.
Alternatively, all mundane sīla is indeed sīla, while supramundane sīla is higher sīla.
Hoặc tất cả các giới thuộc thế gian đều là giới (sīla), còn giới siêu thế là giới tăng thượng học (adhisīlaṃ).
Cittapaññāsupi eseva nayoti.
The same method applies to consciousness and wisdom.
Tương tự cũng áp dụng cho tâm và tuệ.
Iti imāya gāthāya samodhānetvā tisso sikkhā sakalasāsanaṃ kathitaṃ hotīti.
Thus, by integrating these three trainings through this verse, the entire Dispensation is expounded.
Như vậy, với bài kệ này, ba học pháp, tức là toàn bộ giáo pháp, đã được giảng giải.
154
Mānakāmasuttavaṇṇanā niṭṭhitā.
The commentary on the Mānakāma Sutta is finished.
Chú giải Kinh Mānakāma đã hoàn tất.
155
10. Araññasuttavaṇṇanā
10. Commentary on the Arañña Sutta
10. Chú giải Kinh Arañña
156
10. Dasame santānanti santakilesānaṃ, paṇḍitānaṃ vā.
10. In the tenth*, santānaṃ means of those whose defilements are calmed, or of the wise.
10. Trong kinh thứ mười, santānaṃ có nghĩa là của những người có phiền não đã lắng dịu, hoặc của những bậc hiền trí.
‘‘Santo have sabbhi pavedayanti (jā. 2.21.413), dūre santo pakāsantī’’tiādīsu (dha. pa. 304) hi paṇḍitāpi santoti vuttā.
For in phrases like "The good surely make themselves known to the virtuous (Jā. 2.21.413), the good shine forth from afar" (Dha. Pa. 304), the wise are also called "good" (santa).
Trong các câu như ‘‘Santo have sabbhi pavedayanti, dūre santo pakāsantī’’ (Jā. 2.21.413; Dhp. 304), các bậc hiền trí cũng được gọi là santo.
Brahmacārinanti seṭṭhacārīnaṃ maggabrahmacariyavāsaṃ vasantānaṃ.
Brahmacārinaṃ means of those who practice the noble conduct, who live the holy life of the path.
Brahmacārinaṃ có nghĩa là của những người sống phạm hạnh cao thượng, sống đời phạm hạnh của đạo.
Kena vaṇṇo pasīdatīti kena kāraṇena chavivaṇṇo pasīdatīti pucchati.
Kena vaṇṇo pasīdatī means by what cause does the complexion become clear? she asks.
Kena vaṇṇo pasīdatī có nghĩa là hỏi: “Do nguyên nhân nào mà sắc diện trở nên trong sáng?”
Kasmā panesā evaṃ pucchati?
But why does she ask thus?
Vì sao vị ấy lại hỏi như vậy?
Esā kira vanasaṇḍavāsikā bhummadevatā āraññake bhikkhū pacchābhattaṃ piṇḍapātapaṭikkante araññaṃ pavisitvā rattiṭṭhānadivāṭṭhānesu mūlakammaṭṭhānaṃ gahetvā nisinne passati.
This earth-deity, dwelling in a forest grove, saw the forest-dwelling bhikkhus, after their meal and return from alms-round, entering the forest, taking their fundamental meditation subjects, and sitting in their night-quarters and day-quarters.
Vị thiên nữ trú trong khu rừng này đã thấy các Tỳ-kheo sống trong rừng, sau khi thọ trai và trở về từ việc khất thực, đi vào rừng và ngồi thiền quán căn bản tại các nơi trú ngụ ban đêm và ban ngày.
Tesañca evaṃ nisinnānaṃ balavacittekaggatā uppajjati.
And as they sat thus, strong one-pointedness of mind arose in them.
Khi các vị ấy ngồi như vậy, sự định tâm mạnh mẽ phát sinh.
Tato visabhāgasantati vūpasammati, sabhāgasantati okkamati, cittaṃ pasīdati.
Then, the heterogeneous mental continuum subsided, the homogeneous mental continuum entered, and the mind became clear.
Từ đó, dòng tâm thức không tương thích lắng dịu, dòng tâm thức tương thích khởi lên, tâm trở nên thanh tịnh.
Citte pasanne lohitaṃ pasīdati, cittasamuṭṭhānāni upādārūpāni parisuddhāni honti, vaṇṭā pamuttatālaphalassa viya mukhassa vaṇṇo hoti.
When the mind became clear, the blood became clear, and the derived material forms born of mind became purified, and the complexion of their faces was like a ripe palm fruit freed from its stalk.
Khi tâm thanh tịnh, máu cũng thanh tịnh, các sắc pháp do tâm sinh ra trở nên trong sạch, sắc diện giống như quả chà là rụng khỏi cuống.
Taṃ disvā devatā cintesi – ‘‘sarīravaṇṇo nāmāyaṃ paṇītāni rasasampannāni bhojanāni sukhasamphassāni nivāsanapāpuraṇasayanāni utusukhe tebhūmikādibhede ca pāsāde mālāgandhavilepanādīni ca labhantānaṃ pasīdati, ime pana bhikkhū piṇḍāya caritvā missakabhattaṃ bhuñjanti, viraḷamañcake vā phalake vā silāya vā sayanāni kappenti, rukkhamūlādīsu vā abbhokāse vā vasanti, kena nu kho kāraṇena etesaṃ vaṇṇo pasīdatī’’ti.
Seeing this, the deity thought: "This bodily complexion usually becomes clear for those who receive excellent foods rich in flavour, comfortable clothing and bedding, and dwell in pleasant palaces of three levels, etc., enjoying garlands, scents, ointments, and so on. But these bhikkhus, after wandering for alms, eat mixed food, make their beds on sparse beds, planks, or stones, and dwell at the foot of trees or in the open air. By what cause, then, does their complexion become clear?"
Thấy vậy, vị thiên nữ suy nghĩ: ‘‘Sắc diện cơ thể này trở nên trong sáng là do những người được hưởng các món ăn ngon, đầy đủ hương vị, các y phục, chăn mền, giường nằm êm ái, các cung điện ba tầng trong thời tiết dễ chịu, và các loại hoa, hương, dầu thơm, v.v. Nhưng các Tỳ-kheo này lại đi khất thực, ăn cơm trộn, ngủ trên những chiếc giường cũ kỹ, trên ván gỗ hoặc trên đá, sống dưới gốc cây hoặc ngoài trời. Vậy do nguyên nhân nào mà sắc diện của các vị ấy lại trong sáng như vậy?’’
Tasmā pucchi.
Therefore, she asked.
Vì vậy, vị ấy đã hỏi.
157
Athassā bhagavā kāraṇaṃ kathento dutiyaṃ gāthaṃ āha.
Then the Blessed One, explaining the cause to her, spoke the second verse.
Bấy giờ, Đức Thế Tôn đã nói bài kệ thứ hai để giải thích nguyên nhân cho vị ấy.
Tattha atītanti atīte asuko nāma rājā dhammiko ahosi, so amhākaṃ paṇīte paccaye adāsi.
There, atītaṃ (the past) refers to: "Such and such a king in the past was righteous, and he gave us excellent requisites.
Ở đây, atītaṃ có nghĩa là: ‘‘Ngày xưa có vị vua tên là X là người công chính, ngài đã cúng dường cho chúng ta những vật dụng cao cấp.
Ācariyupajjhāyā lābhino ahesuṃ.
Our teachers and preceptors were fortunate.
Các vị thầy và giới sư đã nhận được nhiều lợi lộc.
Atha mayaṃ evarūpāni bhojanāni bhuñjimhā, cīvarāni pārupimhāti evaṃ ekacce paccayabāhullikā viya ime bhikkhū atītaṃ nānusocanti.
Then we ate such foods and wore such robes" - these bhikkhus do not grieve over the past like some who are excessively attached to requisites.
Sau đó, chúng ta đã thọ dụng những món ăn như vậy, mặc những y phục như vậy.’’ Các Tỳ-kheo này không than khóc về quá khứ như những người quá chú trọng vào vật dụng.
Nappajappanti nāgatanti anāgate dhammiko rājā bhavissati, phītā janapadā bhavissanti, bahūni sappinavanītādīni uppajjissanti, ‘‘khādatha bhuñjathā’’ti tattha tattha vattāro bhavissanti, tadā mayaṃ evarūpāni bhojanāni bhuñjissāma, cīvarāni pārupissāmāti evaṃ anāgataṃ na patthenti.
"Nappajappanti nāgata"nti (they do not long for the future) means that they do not long for the future thus: "In the future, a righteous king will arise, prosperous will the districts be, many kinds of ghee, fresh butter, and so on will appear, there will be people saying 'Eat and enjoy!' here and there, and then we will eat such foods and wear such robes."
Không mong cầu tương lai nghĩa là: "Trong tương lai, sẽ có một vị vua sống theo Chánh pháp, các vùng đất sẽ thịnh vượng, nhiều bơ sữa tươi (sappinavanītādīni) sẽ xuất hiện, sẽ có những người ở khắp nơi nói rằng: 'Hãy ăn đi, hãy thọ dụng đi!', khi đó chúng ta sẽ thọ dụng những món ăn như vậy, sẽ khoác những y phục như vậy." Như vậy, họ không mong cầu tương lai.
Paccuppannenāti yena kenaci taṅkhaṇe laddhena yāpenti.
Paccuppannenāti (with what is present) means they sustain themselves with whatever they receive at that moment, without regard for quality.
Với hiện tại nghĩa là: Họ duy trì cuộc sống với bất cứ thứ gì nhận được ngay lúc đó.
Tenāti tena tividhenāpi kāraṇena.
Tenāti (by that) means by that threefold reason.
Với điều đó nghĩa là: Với cả ba lý do đó.
158
Evaṃ vaṇṇasampattiṃ dassetvā idāni tasseva vaṇṇassa vināsaṃ dassento anantaraṃ gāthamāha.
Having thus shown the beauty of complexion, the Buddha now speaks the next verse, showing the destruction of that very beauty.
Sau khi trình bày về sự viên mãn của sắc diện như vậy, bây giờ, để chỉ ra sự hoại diệt của chính sắc diện đó, Đức Phật đã nói bài kệ tiếp theo.
Tattha anāgatappajappāyāti anāgatassa patthanāya.
There, anāgatappajappāyāti (by longing for the future) means by desiring what has not yet arrived.
Trong đó, do mong cầu tương lai nghĩa là: do sự mong cầu những gì chưa đến.
Etenāti etena kāraṇadvayena.
Etenāti (by this) means by these two reasons.
Với điều này nghĩa là: với hai lý do này.
Naḷova harito lutoti yathā harito naḷo lāyitvā uṇhapāsāṇe pakkhitto sussati, evaṃ sussantīti.
Naḷova harito lutoti (like green reeds cut down) means just as a green reed, when cut and thrown on a hot rock, dries up, so do they dry up.
Như lau xanh bị cắt nghĩa là: giống như cây lau xanh bị cắt rồi phơi trên đá nóng sẽ khô héo, cũng vậy, họ sẽ khô héo.
159
*Araññasuttavaṇṇanā niṭṭhitā.
The commentary on the Arañña Sutta is concluded.
*Chú giải kinh Arañña đã hoàn tất.
Naḷavaggo paṭhamo.*
The Naḷavagga is the first.
Phẩm Naḷa thứ nhất.*
160

2. Nandanavaggo

2. Nandanavagga

2. Phẩm Nandana

161
1. Nandanasuttavaṇṇanā
1. Commentary on the Nandana Sutta
1. Chú giải kinh Nandana
162
11. Nandanavaggassa paṭhame tatrāti tasmiṃ ārāme.
11. In the first (sutta) of the Nandanavagga, tatrāti (there) means in that monastery.
11. Trong kinh đầu tiên của phẩm Nandana, ở đó nghĩa là: trong khu vườn đó.
Khoti byañjanasiliṭṭhatāvasena nipātamattaṃ.
Khoti is merely a particle to smooth the phrasing.
Kho là một từ ngữ chỉ để làm cho văn phong trôi chảy hơn.
Bhikkhū āmantesīti parisajeṭṭhake bhikkhū jānāpesi.
Bhikkhū āmantesīti (he addressed the bhikkhus) means he informed the chief bhikkhus of the assembly.
Đức Phật đã gọi các Tỳ-khưu nghĩa là: Đức Phật đã thông báo cho các Tỳ-khưu trưởng lão trong hội chúng.
Bhikkhavoti tesaṃ āmantanākāradīpanaṃ.
Bhikkhavoti (bhikkhus!) indicates the manner of addressing them.
Này các Tỳ-khưu là lời chỉ ra cách thức gọi của Ngài.
Bhadanteti pativacanadānaṃ.
Bhadanteti (venerable sir!) is the reply given.
Bạch Thế Tôn là lời đáp lại.
Te bhikkhūti ye tattha sammukhībhūtā dhammapaṭiggāhakā bhikkhū.
Te bhikkhūti (those bhikkhus) refers to those bhikkhus present there who were receptive to the Dhamma.
Các Tỳ-khưu đó nghĩa là: những Tỳ-khưu đang có mặt ở đó để thọ nhận Pháp.
Bhagavato paccassosunti bhagavato vacanaṃ patiassosuṃ, abhimukhā hutvā suṇiṃsu sampaṭicchiṃsūti attho.
Bhagavato paccassosunti (they assented to the Blessed One) means they assented to the word of the Blessed One; the meaning is that they listened and accepted, facing Him.
Đã vâng lời Đức Thế Tôn nghĩa là: đã vâng lời Đức Thế Tôn, có nghĩa là họ đã lắng nghe và chấp nhận lời Ngài.
Etadavocāti etaṃ idāni vattabbaṃ ‘‘bhūtapubba’’ntiādivacanaṃ avoca.
Etadavocāti (He said this) means He spoke these words, beginning with "bhūtapubba" (formerly), which are now to be stated.
Đã nói điều này nghĩa là: đã nói lời "Thuở xưa" (bhūtapubba) và những lời khác sắp được nói ra đây.
Tattha tāvatiṃsakāyikāti tāvatiṃsakāye nibbattā.
There, tāvatiṃsakāyikāti (belonging to the Tāvatiṃsa realm) means born in the Tāvatiṃsa realm.
Trong đó, chư thiên cõi Tam Thập Tam Thiên nghĩa là: được tái sinh trong cõi Tam Thập Tam Thiên.
Tāvatiṃsakāyo nāma dutiyadevaloko vuccati.
The Tāvatiṃsa realm is called the second deva-world.
Cõi Tam Thập Tam Thiên (Tāvatiṃsakāyo) được gọi là cõi trời thứ hai.
Maghena māṇavena saddhiṃ macalagāme kālaṃ katvā tattha uppanne tettiṃsa devaputte upādāya kira tassa devalokassa ayaṃ paṇṇatti jātāti vadanti.
It is said that this designation for that deva-world arose because thirty-three devaputtas were born there after the māṇava named Magha and his companions passed away in the village of Macala.
Người ta nói rằng, tên gọi của cõi trời này xuất phát từ ba mươi ba vị thiên tử được tái sinh ở đó sau khi cùng với Maṅgha (Māṇavena) chết tại làng Macala.
Yasmā pana sesacakkavāḷesupi cha kāmāvacaradevalokā atthi.
However, since there are also six kāma-worlds in other universes,
Tuy nhiên, vì ở các thế giới khác cũng có sáu cõi trời Dục giới,
Vuttampi cetaṃ ‘‘sahassaṃ cātumahārājikānaṃ sahassaṃ tāvatiṃsāna’’nti (a. ni. 10.29), tasmā nāmapaṇṇattiyevesā tassa devalokassāti veditabbā.
and it is also stated: "a thousand Cātumahārājika devas, a thousand Tāvatiṃsa devas" (AN 10.29), it should be understood that this is merely a nominal designation for that deva-world.
và điều này cũng được nói: "Một ngàn cõi trời Tứ Đại Thiên Vương, một ngàn cõi trời Tam Thập Tam Thiên", do đó, cần phải hiểu rằng đây chỉ là một tên gọi quy ước cho cõi trời đó.
Evañhi niddosaṃ padaṃ hoti.
Only then is the word faultless.
Như vậy thì từ ngữ này mới không có lỗi.
163
Nandane vaneti ettha taṃ vanaṃ paviṭṭhe paviṭṭhe nandayati tosetīti nandanaṃ.
Nandane vaneti (in the Nandana Grove): Here, that grove is called Nandana because it delights and pleases all who enter it.
Trong khu vườn Nandana (Nandane vane): Khu vườn này làm cho những ai bước vào đều hoan hỷ, đều vui thích, nên gọi là Nandana.
Pañcasu hi maraṇanimittesu uppannesu ‘‘sampattiṃ pahāya cavissāmā’’ti paridevamānā devatā sakko devānamindo ‘‘mā paridevittha, abhijjanadhammā nāma saṅkhārā natthī’’ti ovaditvā tattha pavesāpeti.
Indeed, when the five signs of death appear, the devas lamenting "We will cast off our prosperity and fall away," are admonished by Sakka, the king of devas, saying, "Do not lament, for there are no formations that are not subject to decay," and he causes them to enter there.
Quả thật, khi năm dấu hiệu của cái chết xuất hiện, các vị chư thiên than khóc rằng: “Chúng ta sẽ chết, từ bỏ mọi tài sản!”, thì Sakka, Vua của các vị trời, khuyên nhủ: “Đừng than khóc! Các pháp hữu vi (saṅkhārā) không có pháp nào là không hoại diệt cả!” rồi cho họ vào khu vườn đó.
Tāsaṃ aññāhi devatāhi bāhāsu gahetvā pavesitānampi tassa sampattiṃ disvāva maraṇasoko vūpasammati, pītipāmojjameva uppajjati.
Even those who are led in by other devas holding their arms, upon seeing the splendor of that grove, their sorrow of death subsides, and only joy and delight arise.
Dù được các vị chư thiên khác nắm tay dẫn vào, nhưng khi nhìn thấy sự tráng lệ của khu vườn, nỗi sầu muộn về cái chết của họ liền lắng xuống, chỉ còn niềm vui và sự hân hoan dâng trào.
Atha tasmiṃ kīḷamānā eva uṇhasantatto himapiṇḍo viya vilīyanti, vātāpahatadīpasikhā viya vijjhāyantīti evaṃ yaṃkiñci anto paviṭṭhaṃ nandayati tosetiyevāti nandanaṃ, tasmiṃ nandane.
Then, while playing in that grove, they dissolve like a lump of snow heated by the sun, or they are extinguished like a lamp flame struck by the wind; thus, whatever enters within delights and pleases, hence it is Nandana; in that Nandana (grove).
Rồi khi đang vui chơi trong đó, họ tan chảy như một khối băng bị nắng nóng làm tan rã, và tắt lịm như ngọn đèn bị gió thổi. Như vậy, bất cứ ai bước vào đều được hoan hỷ, đều vui thích, nên gọi là Nandana. Trong khu vườn Nandana đó.
Accharāsaṅghaparivutāti accharāti devadhītānaṃ nāmaṃ, tāsaṃ samūhena parivutā.
Accharāsaṅghaparivutāti (surrounded by throngs of nymphs): Accharā is a name for deva-daughters, surrounded by their host.
Được vây quanh bởi đoàn Apsara (Accharāsaṅghaparivutā): Apsara là tên gọi của các thiên nữ, được vây quanh bởi đoàn thiên nữ đó.
164
Dibbehīti devaloke nibbattehi.
Dibbehīti (divine) means born in the deva-world.
Thiên thượng nghĩa là: được sinh ra ở cõi trời.
Pañcahi kāmaguṇehīti manāpiyarūpasaddagandharasaphoṭṭhabbasaṅkhātehi pañcahi kāmabandhanehi kāmakoṭṭhāsehi vā.
Pañcahi kāmaguṇehīti (with the five strands of sensual pleasure) means with the five bonds of sensuality, or portions of sensuality, that consist of agreeable sights, sounds, smells, tastes, and tactile objects.
Với năm dục lạc nghĩa là: với năm sự ràng buộc của dục lạc, tức là sắc, thinh, hương, vị, xúc đáng yêu; hoặc là với năm phần của dục lạc.
Samappitāti upetā.
Samappitāti (endowed) means possessed of.
Được ban tặng nghĩa là: được đầy đủ.
Itaraṃ tasseva vevacanaṃ.
The other term (samangibhūtā) is merely a synonym for that.
Từ khác là đồng nghĩa với từ đó.
Paricārayamānāti ramamānā, tesu tesu vā rūpādīsu indriyāni sañcārayamānā.
Paricārayamānāti (indulging) means enjoying themselves, or directing their senses towards those sights and so on.
Đang hưởng thụ nghĩa là: đang vui thú, hoặc đang điều khiển các căn (indriya) của mình trên các sắc (rūpa) và các đối tượng khác.
Tāyaṃ velāyanti tasmiṃ paricāraṇakāle.
Tāyaṃ velāyanti (at that time) refers to that period of indulgence.
Vào lúc đó nghĩa là: vào thời điểm đang hưởng thụ đó.
So panassa devaputtassa adhunā abhinibbattakālo veditabbo.
This refers to the time when that devaputta had just been born.
Và thời điểm đó cần được hiểu là thời điểm vị thiên tử ấy vừa mới tái sinh.
Tassa hi paṭisandhikkhaṇeyeva rattasuvaṇṇakkhandho viya virocayamāno tigāvutappamāṇo attabhāvo nibbatti.
At the very moment of his rebirth, an existence three gāvutas high appeared, radiant like a mass of pure gold.
Quả thật, ngay vào khoảnh khắc tái sinh của vị ấy, một thân thể cao ba gāvuta (tigāvutappamāṇo) đã xuất hiện, rực rỡ như một khối vàng đỏ.
So dibbavatthanivattho dibbālaṅkārapaṭimaṇḍito dibbamālāvilepanadharo dibbehi candanacuṇṇehi samaṃ vikiriyamāno dibbehi pañcahi kāmaguṇehi ovuto nivuto pariyonaddho lobhābhibhūto hutvā lobhanissaraṇaṃ nibbānaṃ apassanto āsabhiṃ vācaṃ bhāsanto viya mahāsaddena ‘‘na te sukhaṃ pajānantī’’ti imaṃ gāthaṃ gāyamāno nandanavane vicari.
Wearing divine garments, adorned with divine ornaments, bearing divine garlands and perfumes, with divine sandalwood powder scattered around him, enveloped, surrounded, and enmeshed by the five divine sensual pleasures, overwhelmed by craving, and unable to perceive Nibbāna, the escape from craving, he wandered in the Nandana Grove, singing this verse, "They do not know happiness," with a great voice, as if uttering a noble declaration.
Vị ấy, mặc thiên y, trang sức bằng thiên trang sức, đội thiên hoa, thoa thiên hương, được rắc đều bằng thiên phấn gỗ chiên đàn, bị năm dục lạc thiên thượng bao phủ, vây bọc, bị tham ái chế ngự, không thấy được Niết bàn là sự thoát ly tham ái, đã đi trong vườn Nandana, ca hát bài kệ này với tiếng nói lớn như một vị anh hùng (āsabhiṃ vācaṃ) đang tuyên bố: "Họ không biết hạnh phúc".
Tena vuttaṃ – ‘‘tāyaṃ velāyaṃ imaṃ gāthaṃ abhāsī’’ti.
Therefore, it is said: "At that time, he uttered this verse."
Vì vậy, có lời nói rằng: "Vào lúc đó, vị ấy đã nói bài kệ này."
165
Ye na passanti nandananti ye tatra pañcakāmaguṇānubhavanavasena nandanavanaṃ na passanti.
Ye na passanti nandananti (those who do not see Nandana) means those who do not see the Nandana Grove in that place in terms of experiencing the five sensual pleasures.
Những ai không thấy Nandana nghĩa là: những ai không thấy khu vườn Nandana theo cách hưởng thụ năm dục lạc ở đó.
Naradevānanti devanarānaṃ, devapurisānanti attho.
Naradevānanti (of human-devas) means of deva-men, or of male devas; this is the meaning.
Của các vị trời người nghĩa là: của các vị trời người, tức là của các vị nam thần.
Tidasānanti tikkhattuṃ dasannaṃ.
Tidasānanti (of the Thirty) means of the thirty (devas).
Của ba mươi ba vị nghĩa là: của ba mươi ba vị.
Yasassinanti parivārasaṅkhātena yasena sampannānaṃ.
Yasassinanti (glorious) means endowed with glory in the form of a retinue.
Có uy danh nghĩa là: đầy đủ uy danh do sự tùy tùng.
166
Aññatarā devatāti ekā ariyasāvikā devatā.
Aññatarā devatāti (a certain deva) refers to a certain female noble disciple deva.
Một vị thiên nữ khác nghĩa là: một vị thiên nữ là Thánh đệ tử.
Paccabhāsīti ‘‘ayaṃ bāladevatā imaṃ sampattiṃ niccaṃ acalaṃ maññati, nāssā chedanabhedanaviddhaṃsanadhammataṃ jānātī’’ti adhippāyaṃ vivaṭṭetvā dassentī ‘‘na tvaṃ bāle’’ti imāya gāthāya patiabhāsi.
Paccabhāsīti (replied) means she rebutted the intention of that devaputta, thinking, "This foolish deva believes this prosperity to be permanent and unmoving; he does not know its nature of being subject to cutting, breaking, and destruction," and so she replied with this verse, "You, fool, do not know."
Đã đáp lời nghĩa là: đã đáp lời bằng bài kệ "Này kẻ si mê, ngươi không biết" này, để làm rõ ý rằng: "Vị thiên tử ngu muội này nghĩ rằng tài sản này là vĩnh cửu, bất động, nhưng lại không biết rằng nó có bản chất bị hủy hoại, tan rã và phá vỡ."
Yathā arahataṃ vacoti yathā arahantānaṃ vacanaṃ, tathā tvaṃ na jānāsīti.
Yathā arahataṃ vacoti (as is the word of the Arahants) means "You do not know as is the word of the Arahants."
Theo lời của các bậc Arahant nghĩa là: ngươi không biết như lời của các bậc Arahant.
Evaṃ tassā adhippāyaṃ paṭikkhipitvā idāni arahantānaṃ vacanaṃ dassentī aniccātiādimāha.
Thus rejecting his intention, she now speaks aniccātiādimāha (impermanent, etc.) showing the word of the Arahants.
Như vậy, sau khi bác bỏ ý kiến của vị thiên tử đó, bây giờ, để chỉ ra lời của các bậc Arahant, vị thiên nữ đã nói: Các pháp hữu vi là vô thường và các câu tiếp theo.
Tattha aniccā vata saṅkhārāti sabbe tebhūmakasaṅkhārā hutvā abhāvatthena aniccā.
There, aniccā vata saṅkhārāti (impermanent, indeed, are all formations) means all formations of the three realms are impermanent in the sense that they exist and then cease to exist.
Trong đó, Các pháp hữu vi quả thật vô thường nghĩa là: tất cả các pháp hữu vi thuộc ba cõi đều vô thường do bản chất là đã có rồi không còn nữa.
Uppādavayadhamminoti uppādavayasabhāvā.
Uppādavayadhamminoti (of the nature to arise and cease) means having the nature of arising and ceasing.
Có bản chất sinh diệt nghĩa là: có bản chất sinh và diệt.
Uppajjitvā nirujjhantīti idaṃ purimasseva vevacanaṃ.
Uppajjitvā nirujjhantīti (having arisen, they cease) is merely a synonym for the former statement.
Sinh rồi diệt đi là đồng nghĩa với câu trước.
Yasmā vā uppajjitvā nirujjhanti, tasmā uppādavayadhamminoti.
Or, since they arise and cease, therefore they are of the nature to arise and cease.
Hoặc là, vì chúng sinh rồi diệt đi, nên chúng có bản chất sinh diệt.
Uppādavayaggahaṇena cettha tadanantarā vemajjhaṭṭhānaṃ gahitameva hoti.
By the mention of arising and ceasing, the intermediate state between them (the static moment) is also implicitly included here.
Và ở đây, với việc nắm bắt sự sinh và diệt, trạng thái trung gian ngay sau đó cũng được bao hàm.
Tesaṃ vūpasamo sukhoti tesaṃ saṅkhārānaṃ vūpasamasaṅkhātaṃ nibbānameva sukhaṃ.
Tesaṃ vūpasamo sukhoti (the appeasement of these is happiness) means Nibbāna, which is the appeasement of those formations, is truly happiness.
Sự tịch diệt của chúng là an lạc nghĩa là: Niết bàn, tức là sự tịch diệt của các pháp hữu vi đó, chính là an lạc.
Idaṃ arahataṃ vacoti.
This is the word of the Arahants.
Đây là lời của các bậc Arahant.
167
Nandanasuttavaṇṇanā niṭṭhitā.
The commentary on the Nandana Sutta is concluded.
Chú giải kinh Nandana đã hoàn tất.
168
2. Nandatisuttavaṇṇanā
2. Commentary on the Nandati Sutta
2. Chú giải kinh Nandati
169
12. Dutiye nandatīti tussati attamano hoti.
12. In the second (sutta), nandatīti (rejoices) means is pleased and joyful.
12. Trong kinh thứ hai, hoan hỷ nghĩa là: vui mừng, tâm ý hoan hỷ.
Puttimāti bahuputto.
Puttimāti (one with sons) means one who has many sons.
Người có con nghĩa là: người có nhiều con.
Tassa hi ekacce puttā kasikammaṃ katvā dhaññassa koṭṭhe pūrenti, ekacce vaṇijjaṃ katvā hiraññasuvaṇṇaṃ āharanti, ekacce rājānaṃ upaṭṭhahitvā yānavāhanagāmanigamādīni labhanti.
Indeed, some of his sons fill granaries by cultivating, some bring silver and gold by trading, and some serve the king and obtain vehicles, conveyances, villages, townships, and so on.
Quả thật, một số con cái của người đó làm nông nghiệp, lấp đầy các kho lúa; một số khác buôn bán, mang về vàng bạc; một số khác hầu hạ vua, nhận được xe cộ, làng mạc, thị trấn, v.v.
Atha tesaṃ ānubhāvasaṅkhātaṃ siriṃ anubhavamānā mātā vā pitā vā nandati.
Then, the mother or father rejoices, experiencing the prosperity associated with their power.
Rồi cha hoặc mẹ, khi hưởng thụ sự giàu sang do uy lực của những người con đó, thì hoan hỷ.
Chaṇadivasādīsu vā maṇḍitapasādhite putte sampattiṃ anubhavamāne disvā nandatīti, ‘‘nandati puttehi puttimā’’ti āha.
Or, on festive days, seeing their sons, adorned and dressed, enjoying prosperity, they rejoice; thus, it is said, "One with sons rejoices through his sons."
Hoặc vào những ngày lễ hội, khi nhìn thấy con cái được trang điểm, ăn mặc đẹp đẽ đang hưởng thụ tài sản, thì hoan hỷ. Vì vậy, Đức Phật nói: "Người có con hoan hỷ với con cái."
Gohi tathevāti yathā puttimā puttehi, tathā gosāmikopi sampannaṃ gomaṇḍalaṃ disvā gāvo nissāya gorasasampattiṃ anubhavamāno gohi nandati.
Gohi tathevāti (and so too with cattle) means just as one with sons rejoices through his sons, so too the owner of cattle rejoices through his cattle, seeing his prosperous herd of cows and experiencing the abundance of milk products due to the cows.
Cũng vậy với người có bò nghĩa là: giống như người có con hoan hỷ với con cái, người chủ bò cũng vậy, khi nhìn thấy đàn bò sung túc, hưởng thụ sự giàu có từ sữa bò nhờ vào bò, thì hoan hỷ với bò.
Upadhī hi narassa nandanāti, ettha upadhīti cattāro upadhī – kāmūpadhi, khandhūpadhi, kilesūpadhi, abhisaṅkhārūpadhīti.
"Indeed, upadhi are a man's delight"—here, 'upadhi' refers to four kinds of upadhi: kāmūpadhi (sensual attachments), khandhūpadhi (attachments to aggregates), kilesūpadhi (attachments to defilements), and abhisaṅkhārūpadhi (attachments to volitional formations).
Upadhī hi narassa nandanā (Quả thật, các Upa-đhī là niềm vui của con người), ở đây, upadhī là bốn loại upa-đhī: kāmūpadhi (upa-đhī dục), khandhūpadhi (upa-đhī uẩn), kilesūpadhi (upa-đhī phiền não), abhisaṅkhārūpadhi (upa-đhī hành).
Kāmāpi hi ‘‘yaṃ pañca kāmaguṇe paṭicca uppajjati sukhaṃ somanassaṃ, ayaṃ kāmānaṃ assādo’’ti (ma. ni. 1.166) evaṃ vuttassa sukhassa adhiṭṭhānabhāvato ‘‘upadhiyati ettha sukha’’nti iminā vacanatthena upadhīti vuccati.
And because sensual pleasures (kāma), being the basis for the happiness that arises dependent on the five cords of sensual pleasure—as stated: "The delight of sensual pleasures is the happiness and joy that arises dependent on the five cords of sensual pleasure"—are thus called 'upadhi' by the meaning of the word "that on which happiness is based (upadhiyati)."
Quả thật, các dục cũng được gọi là upa-đhī theo nghĩa là “niềm vui được đặt vào đây”, vì chúng là nền tảng của niềm vui đã được nói đến như sau: “Niềm vui và sự hoan hỷ nào phát sinh do duyên năm dục công đức, đó là vị ngọt của các dục” (Ma. Ni. 1.166).
Khandhāpi khandhamūlakassa dukkhassa adhiṭṭhānabhāvato, kilesāpi apāyadukkhassa adhiṭṭhānabhāvato, abhisaṅkhārāpi bhavadukkhassa adhiṭṭhānabhāvatoti.
Similarly, the aggregates (khandha) are called 'upadhi' because they are the basis of suffering rooted in the aggregates; defilements (kilesa) because they are the basis of suffering in the lower realms; and volitional formations (abhisaṅkhāra) because they are the basis of suffering in existence.
Các uẩn cũng được gọi là upa-đhī vì chúng là nền tảng của khổ đau bắt nguồn từ uẩn; các phiền não cũng được gọi là upa-đhī vì chúng là nền tảng của khổ đau trong các cõi đọa xứ; và các hành cũng được gọi là upa-đhī vì chúng là nền tảng của khổ đau trong các cõi hữu.
Idha pana kāmūpadhi adhippeto.
However, here, kāmūpadhi (sensual attachments) is intended.
Nhưng ở đây, kāmūpadhi (upa-đhī dục) được đề cập đến.
Pañca hi kāmaguṇā tebhūmikādipāsāda-uḷārasayana-vatthālaṅkāra-nāṭakaparivārādivasena paccupaṭṭhitā pītisomanassaṃ upasaṃharamānā naraṃ nandayanti.
Indeed, the five cords of sensual pleasure, present as palaces, excellent beds, clothes, ornaments, dancers, and retinues, bringing joy and happiness, delight a person.
Quả thật, năm dục công đức, được biểu hiện dưới dạng cung điện ba cõi, giường nằm cao quý, y phục, trang sức, ca múa, tùy tùng, v.v., mang lại niềm vui và sự hoan hỷ, khiến con người hoan hỷ.
Tasmā yathā puttā ca gāvo ca, evaṃ imepi upadhī hi narassa nandanāti veditabbā.
Therefore, just as sons and cattle, so too are these upadhi to be understood as a man's delight.
Do đó, cần phải hiểu rằng, cũng như con cái và bò, những upa-đhī này quả thật là niềm vui của con người.
Na hi so nandati yo nirūpadhīti yo kāmaguṇasampattirahito daliddo dullabhaghāsacchādano, na hi so nandati.
"He who is without upadhi does not delight"—this refers to the poor person who is deprived of the enjoyment of sensual pleasures, one who finds sustenance and clothing difficult to obtain; such a person does not delight.
Na hi so nandati yo nirūpadhī (Người không có upa-đhī thì không hoan hỷ) nghĩa là người nghèo khó, thiếu thốn thực phẩm và y phục, không có sự sung túc về dục công đức, người đó không hoan hỷ.
Evarūpo manussapeto ca manussanerayiko ca kiṃ nandissati bhagavāti āha.
"How can such a human ghost or a human denizen of hell delight, O Blessed One?" the deity asks.
Bạch Thế Tôn, một người ngạ quỷ trong loài người và một người địa ngục trong loài người như vậy thì làm sao có thể hoan hỷ được? – vị thiên nhân nói.
170
Idaṃ sutvā satthā cintesi – ‘‘ayaṃ devatā sokavatthumeva nandavatthuṃ karoti, sokavatthubhāvamassā dīpessāmī’’ti phalena phalaṃ pātento viya tāyeva upamāya tassā vādaṃ bhindanto tameva gāthaṃ parivattetvā socatīti āha.
Hearing this, the Teacher reflected, "This deity makes the cause of sorrow into a cause of delight; I shall demonstrate to him its nature as a cause of sorrow." Like striking fruit with fruit, breaking his argument with the very same simile, the Blessed One responded by turning the verse around and saying, "He grieves."
Nghe điều này, Đức Thế Tôn suy nghĩ: “Vị thiên nhân này biến điều đáng sầu muộn thành điều đáng hoan hỷ. Ta sẽ chỉ rõ cho vị ấy bản chất đáng sầu muộn của nó.” Ngài liền, như thể dùng quả để đánh rụng quả, phá bỏ lập luận của vị ấy bằng chính ví dụ đó, và xoay ngược bài kệ đó mà nói: socati (sầu muộn).
Tattha socati puttehīti videsagamanādivasena puttesu naṭṭhesupi nassantesupi idāni nassissantīti nāsasaṅkīpi socati, tathā matesupi marantesupi corehi rājapurisehi gahitesu vā paccatthikānaṃ hatthaṃ upagatesu vā maraṇasaṅkīpi hutvā socati.
Here, "He grieves on account of sons"—even when sons are lost or in the process of being lost due to reasons like going abroad, or even when one suspects they will be lost now, one grieves. Similarly, even when they have died or are dying, or have been seized by thieves or royal officers, or have fallen into the hands of enemies, one grieves out of fear of their death.
Trong đó, socati puttehī (sầu muộn vì con cái) nghĩa là, ngay cả khi con cái bị mất mát do đi xa xứ hoặc đang mất mát, hoặc khi có sự nghi ngờ rằng chúng sẽ mất mát, người cha mẹ vẫn sầu muộn. Tương tự, ngay cả khi chúng đã chết, đang chết, hoặc bị bắt bởi kẻ trộm hoặc quan lại, hoặc rơi vào tay kẻ thù, người cha mẹ vẫn sầu muộn vì lo sợ cái chết.
Rukkhapabbatādīhi patitvā hatthapādādīnaṃ bhedavasena bhinnesupi bhijjantesupi bhedasaṅkīpi hutvā socati.
Even when they are broken or in the process of being broken, such as when they fall from trees or mountains, resulting in broken hands or feet, one grieves out of fear of their breakage.
Khi con cái té từ cây cối, núi non, v.v., bị gãy tay chân hoặc đang bị gãy, hoặc khi có sự nghi ngờ rằng chúng sẽ bị gãy, người cha mẹ vẫn sầu muộn.
Yathā ca puttehi puttimā, gosāmikopi tatheva navahākārehi gohi socati.
And just as one with sons grieves on account of sons, so too does the owner of cattle grieve on account of cattle in nine ways.
Cũng như người có con sầu muộn vì con cái, chủ bò cũng sầu muộn vì bò theo chín cách như vậy.
Upadhī hi narassa socanāti yathā ca puttagāvo, evaṃ pañca kāmaguṇopadhīpi –
"Indeed, upadhi are a man's sorrow"—just as sons and cattle, so too do the five sensual pleasure upadhi—
Upadhī hi narassa socanā (Quả thật, các Upa-đhī là nỗi sầu muộn của con người) nghĩa là, cũng như con cái và bò, năm dục công đức là upa-đhī cũng khiến con người sầu muộn –
171
‘‘Tassa ce kāmayānassa, chandajātassa jantuno;
"If for a being desiring, to whom desire has arisen,
“Nếu những dục vọng đó của chúng sinh
172
Te kāmā parihāyanti, sallaviddhova ruppatī’’ti.(su. ni. 773) –
those sensual pleasures vanish, he is tormented as if pierced by a dart."
đang khao khát và khởi lên tham ái bị tiêu tan,
173
Vuttanayena naraṃ socanti.
—cause a man to sorrow in the manner stated.
người ấy sẽ đau khổ như bị tên bắn.”
Tasmā narassa socanā sokavatthukamevāti veditabbā.
Therefore, it should be understood that upadhi are a cause of sorrow for a person.
Theo cách đã nói, chúng khiến con người sầu muộn. Do đó, cần phải hiểu rằng chúng là nguyên nhân của sự sầu muộn của con người.
Na hi so socati, yo nirūpadhīti yassa pana catubbidhāpete upadhiyo natthi, so nirupadhi mahākhīṇāsavo kiṃ socissati, na socati devateti.
"He who is without upadhi does not grieve"—but for whom these four kinds of upadhi do not exist, that great Arahant who is without upadhi, what would he grieve about? "He does not grieve, O deity."
Na hi so socati, yo nirūpadhī (Người không có upa-đhī thì không sầu muộn) nghĩa là, vị A-la-hán vĩ đại, người không có bốn loại upa-đhī này, thì làm sao có thể sầu muộn được, thưa thiên nhân? Vị ấy không sầu muộn.
174
Nandatisuttavaṇṇanā niṭṭhitā.
The commentary on the Nandati Sutta is concluded.
Chú giải Nandatisutta đã hoàn tất.
175
3. Natthiputtasamasuttavaṇṇanā
3. Commentary on the Natthiputtasama Sutta
3. Chú giải Natthiputtasamasutta
176
13. Tatiye natthi puttasamaṃ pemanti virūpepi hi attano puttake suvaṇṇabimbakaṃ viya maññanti, mālāguḷe viya sīsādīsu katvā pariharamānā tehi ohaditāpi omuttikāpi gandhavilepanapatitā viya somanassaṃ āpajjanti.
In the third*, "There is no love like that for a son." Indeed, even ugly children are regarded by their parents as if they were golden images. Carrying them on their heads and other places like garlands, even when the children excrete or urinate on them, they feel joy as if fragrant unguents had fallen on them.
13. Trong bài kệ thứ ba, natthi puttasamaṃ pema (không có tình yêu nào bằng tình yêu con cái) nghĩa là, ngay cả với những đứa con xấu xí, người ta vẫn nghĩ chúng như tượng vàng, và khi bế chúng trên đầu hoặc các bộ phận khác như vòng hoa, dù chúng có đại tiện hay tiểu tiện, người ta vẫn cảm thấy hoan hỷ như thể hương liệu rơi vào.
Tenāha – ‘‘natthi puttasamaṃ pema’’nti.
Therefore, it is said: "There is no love like that for a son."
Vì vậy, Ngài nói: “Không có tình yêu nào bằng tình yêu con cái.”
Puttapemasamaṃ pemaṃ nāma natthīti vuttaṃ hoti.
It means that there is no love equal to a son's love.
Điều đó có nghĩa là không có tình yêu nào sánh bằng tình yêu con cái.
Gosamitaṃ dhananti gohi samaṃ godhanasamaṃ godhanasadisaṃ aññaṃ dhanaṃ nāma natthi bhagavāti āha.
"Wealth like cattle"—the deity says: "O Blessed One, there is no other wealth like cattle, no wealth comparable to cattle."
Gosamitaṃ dhanaṃ (tài sản ngang bằng bò) nghĩa là, bạch Thế Tôn, không có tài sản nào khác sánh bằng tài sản là bò, hoặc tương đương với tài sản là bò – vị thiên nhân nói.
Sūriyasamā ābhāti sūriyābhāya samā aññā ābhā nāma natthīti dasseti.
"Light like the sun"—this shows that there is no other light comparable to the light of the sun.
Sūriyasamā ābhā (ánh sáng ngang bằng mặt trời) nghĩa là, không có ánh sáng nào khác sánh bằng ánh sáng mặt trời – Ngài chỉ ra.
Samuddaparamāti ye keci aññe sarā nāma, sabbe te samuddaparamā, samuddo tesaṃ uttamo, samuddasadisaṃ aññaṃ udakanidhānaṃ nāma natthi, bhagavāti.
"The ocean is supreme"—the deity says: "O Blessed One, whatever other rivers there may be, all of them have the ocean as their ultimate limit; the ocean is superior to them. There is no other reservoir of water like the ocean."
Samuddaparamā (biển là tối thượng) nghĩa là, bạch Thế Tôn, tất cả các hồ nước khác đều lấy biển làm tối thượng, biển là tối cao của chúng; không có nơi chứa nước nào khác sánh bằng biển.
177
Yasmā pana attapemena samaṃ pemaṃ nāma natthi.
However, there is no love like self-love.
Vì không có tình yêu nào sánh bằng tình yêu bản thân.
Mātāpitādayo hi chaḍḍetvāpi puttadhītādayo ca aposetvāpi sattā attānameva posenti.
Indeed, beings sustain themselves even abandoning parents, and not supporting sons and daughters.
Quả thật, chúng sinh, dù bỏ cha mẹ và không nuôi dưỡng con cái, vẫn tự nuôi dưỡng bản thân mình.
Dhaññena ca samaṃ dhanaṃ nāma natthi.(Yadā hi sattā dubbhikkhā honti), tathārūpe hi kāle hiraññasuvaṇṇādīni gomahiṃsādīnipi dhaññaggahaṇatthaṃ dhaññasāmikānameva santikaṃ gahetvā gacchanti.
And there is no wealth like grain. (When beings suffer famine), in such a time, even gold, silver, etc., and cattle, buffalo, etc., are taken to the owners of grain for the purpose of obtaining grain.
Không có tài sản nào sánh bằng lúa gạo. (Khi chúng sinh gặp nạn đói), vào những thời điểm như vậy, vàng bạc, châu báu, bò, trâu, v.v., đều được mang đến cho những người chủ lúa gạo để đổi lấy lúa gạo.
Paññāya ca samā ābhā nāma natthi.
And there is no light like wisdom.
Không có ánh sáng nào sánh bằng trí tuệ.
Sūriyādayo hi ekadesaṃyeva obhāsanti, paccuppannameva ca tamaṃ vinodenti.
For the sun and others illuminate only a part, and dispel only the present darkness.
Quả thật, mặt trời và các nguồn sáng khác chỉ chiếu sáng một phần nhỏ và chỉ xua tan bóng tối hiện tại.
Paññā pana dasasahassimpi lokadhātuṃ ekappajjotaṃ kātuṃ sakkoti, atītaṃsādipaṭicchādakañca tamaṃ vidhamati.
But wisdom can make even ten thousand world-systems shine at once, and it dispels the darkness that conceals the past and other times.
Nhưng trí tuệ có thể làm cho mười ngàn thế giới trở thành một ánh sáng duy nhất, và xua tan bóng tối che phủ quá khứ, v.v.
Meghavuṭṭhiyā ca samo saro nāma natthi.
And there is no river like a rain shower.
Không có hồ nước nào sánh bằng mưa rào.
Nadīvāpi hotu talākādīni vā, vuṭṭhisamo saro nāma natthi.
Whether it be a river or tanks, there is no river like a rain shower.
Dù là sông hay ao hồ, không có hồ nước nào sánh bằng mưa rào.
Meghavuṭṭhiyā hi pacchinnāya mahāsamuddo aṅgulipabbatemanamattampi udakaṃ na hoti, vuṭṭhiyā pana pavattamānāya yāva ābhassarabhavanāpi ekodakaṃ hoti.
For when rain stops, the great ocean does not have even enough water to wet a finger joint; but when rain is falling, it becomes one sheet of water up to the Ābhassarabhava (Realm of Streaming Radiance).
Quả thật, khi mưa rào ngừng, đại dương không còn đủ nước để ngón tay nhúng vào. Nhưng khi mưa rào tiếp tục, nước sẽ dâng lên đến tận cõi Ābhassara.
Tasmā bhagavā devatāya paṭigāthaṃ vadanto natthi attasamaṃ pemantiādimāhāti.
Therefore, the Blessed One, in response to the deity's verse, spoke words beginning with "There is no love like self-love."
Do đó, Đức Thế Tôn, khi đáp lại bài kệ của vị thiên nhân, đã nói câu natthi attasamaṃ pema (không có tình yêu nào bằng tình yêu bản thân), v.v.
178
Natthiputtasamasuttavaṇṇanā niṭṭhitā.
The commentary on the Natthiputtasama Sutta is concluded.
Chú giải Natthiputtasamasutta đã hoàn tất.
179
4. Khattiyasuttavaṇṇanā
4. Commentary on the Khattiya Sutta
4. Chú giải Khattiyasutta
180
14. Catutthe khattiyo dvipadanti dvipadānaṃ rājā seṭṭho.
In the fourth*, "A warrior is best among two-footed beings"—the king is supreme among two-footed beings.
14. Trong bài kệ thứ tư, khattiyo dvipadaṃ (vị Sát-đế-lợi trong loài hai chân) nghĩa là vua là người tối thượng trong loài hai chân.
Komārīti kumārikāle gahitā.
"Komārī" means one taken in maidenhood.
Komārī (người phụ nữ trẻ) nghĩa là người được cưới từ khi còn là thiếu nữ.
Ayaṃ sesabhariyānaṃ seṭṭhāti vadati.
This implies that she is supreme among other wives.
Điều này nói rằng cô ấy là người tối thượng trong số các bà vợ khác.
Pubbajoti paṭhamaṃ jāto kāṇo vāpi hotu kuṇiādīnaṃ vā aññataro, yo paṭhamaṃ jāto, ayameva putto imissā devatāya vāde seṭṭho nāma hoti.
"The firstborn" (Pubbajo)—whether he is blind or crippled or otherwise, the one who is born first, this very son is considered supreme according to the deity's statement.
Pubbajo (người con đầu lòng) nghĩa là, dù người con đầu lòng có bị mù hay què, hay bất kỳ khuyết tật nào khác, người con đầu lòng này là người con tối thượng theo lập luận của vị thiên nhân này.
Yasmā pana dvipadādīnaṃ buddhādayo seṭṭhā, tasmā bhagavā paṭigāthaṃ āha.
However, since the Buddhas and others are supreme among two-footed beings and so on, the Blessed One spoke a counter-verse.
Tuy nhiên, vì Đức Phật và các vị khác là tối thượng trong số các loài hai chân, v.v., nên Đức Thế Tôn đã nói bài kệ đáp lại.
Tattha kiñcāpi bhagavā sabbesaṃyeva apadādibhedānaṃ sattānaṃ seṭṭho, uppajjamāno panesa sabbasattaseṭṭho dvipadesuyeva uppajjati, tasmā sambuddho dvipadaṃ seṭṭhoti āha.
Although the Blessed One is supreme among all beings, including those without feet, etc., when he arises, he arises among two-footed beings as the supreme of all beings. Therefore, it is said: "The Fully Awakened One is supreme among two-footed beings."
Trong đó, mặc dù Đức Thế Tôn là tối thượng trong tất cả các loài chúng sinh, dù không chân hay có chân, nhưng khi xuất hiện, Ngài xuất hiện trong loài hai chân là tối thượng trong tất cả chúng sinh, do đó Ngài nói: sambuddho dvipadaṃ seṭṭho (Đức Phật Chánh Đẳng Giác là tối thượng trong loài hai chân).
Dvipadesu uppannassa cassa sabbasattaseṭṭhabhāvo appaṭihatova hoti.
And his supremacy among all beings, having arisen among two-footed beings, is unimpeded.
Và khi Ngài xuất hiện trong loài hai chân, sự tối thượng của Ngài trong tất cả chúng sinh là không thể ngăn cản.
Ājānīyoti hatthī vā hotu assādīsu aññataro vā, yo kāraṇaṃ jānāti, ayaṃ ājānīyova catuppadānaṃ seṭṭhoti attho.
"Ājānīyo" means a knowledgeable one—whether an elephant or a horse or any other kind*, one who understands the situation; this knowledgeable one is supreme among quadrupeds.
Ājānīyo (giống tốt) nghĩa là, dù là voi hay bất kỳ loài ngựa nào khác, con vật nào biết nguyên nhân, con vật giống tốt đó là tối thượng trong loài bốn chân.
Kūṭakaṇṇarañño guḷavaṇṇaasso viya.
Like King Kūṭakaṇṇa's horse, Guḷavaṇṇa.
Như con ngựa Guḷavaṇṇa của Vua Kūṭakaṇṇa.
Rājā kira pācīnadvārena nikkhamitvā cetiyapabbataṃ gamissāmīti kalambanadītīraṃ sampatto, asso tīre ṭhatvā udakaṃ otarituṃ na icchati, rājā assācariyaṃ āmantetvā, ‘‘aho vata tayā asso sikkhāpito udakaṃ otarituṃ na icchatī’’ti āha.
It is said that the king, having departed through the eastern gate intending to go to Cetiyapabbata, reached the Kalambanadī riverbank. The horse stood at the bank and refused to enter the water. The king summoned the horse-trainer and said, "Alas, your horse has been trained in such a way that it does not want to enter the water."
Được biết, nhà vua đã ra khỏi cổng phía đông để đến núi Cetiyapabbata và đến bờ sông Kalambanadī. Con ngựa đứng trên bờ và không muốn xuống nước. Nhà vua gọi người huấn luyện ngựa và nói: “Ôi! Ngươi đã huấn luyện con ngựa thế nào mà nó không muốn xuống nước!”
Ācariyo ‘‘susikkhāpito deva asso, etassa hi cittaṃ – ‘sacāhaṃ udakaṃ otarissāmi, vālaṃ temissati, vāle tinte rañño aṅge udakaṃ pāteyyā’ti, evaṃ tumhākaṃ sarīre udakapātanabhayena na otarati, vālaṃ gaṇhāpethā’’ti āha.
The trainer said, "Your Majesty, the horse is well-trained. Its thought is, 'If I enter the water, my tail will get wet, and if my tail is wet, it might splash water on the king's body.' Thus, out of fear of splashing water on your body, it does not enter. Please hold its tail."
Người huấn luyện nói: “Tâu Đại vương, con ngựa đã được huấn luyện rất tốt. Tâm trí của nó nghĩ: ‘Nếu ta xuống nước, đuôi ta sẽ ướt, và khi đuôi ướt, nước sẽ bắn vào người Đại vương.’ Vì sợ bắn nước vào người Đại vương nên nó không xuống. Xin hãy giữ đuôi nó lại.”
Rājā tathā kāresi.
The king did so.
Nhà vua đã làm như vậy.
Asso vegena otaritvā pāraṃ gato.
The horse swiftly entered and crossed to the other side.
Con ngựa lập tức xuống và sang bờ bên kia.
Sussūsāti sussūsamānā.
"Sussūsā" refers to one who is eager to listen.
Sussūsā (người vâng lời) nghĩa là người đang vâng lời.
Kumārikāle vā gahitā hotu pacchā vā, surūpā vā virūpā vā, yā sāmikaṃ sussūsati paricarati toseti, sā bhariyānaṃ seṭṭhā.
Whether taken in girlhood or later, whether beautiful or plain, the wife who serves, attends to, and pleases her husband, she is the best among wives.
Dù được cưới khi còn trẻ hay sau này, dù xinh đẹp hay xấu xí, người vợ nào vâng lời, phục vụ và làm hài lòng chồng, người đó là tối thượng trong các bà vợ.
Assavoti āsuṇamāno.
Assavo means one who is obedient and listens.
Assavo (người tuân theo) nghĩa là người đang lắng nghe.
Jeṭṭho vā hi hotu kaniṭṭho vā, yo mātāpitūnaṃ vacanaṃ suṇāti, sampaṭicchati, ovādapaṭikaro hoti, ayaṃ puttānaṃ seṭṭho, aññehi sandhicchedakādicorehi puttehi ko attho devateti.
Whether he is the eldest or the youngest, the son who listens to the words of his parents, accepts them, and acts according to their advice, he is the best among sons. What is the use of other sons, O deity, who are like house-breaking thieves and so forth?
Dù là con lớn hay con nhỏ, người con nào lắng nghe lời cha mẹ, chấp nhận và tuân thủ lời khuyên dạy, người con ấy là bậc tối thượng trong số các con. Hỡi chư thiên, có ích gì với những người con khác là những kẻ trộm cắp, phá tường v.v.?
181
Khattiyasuttavaṇṇanā niṭṭhitā.
The commentary on the Khattiya Sutta is concluded.
Chú giải Kinh Khattiya đã hoàn tất.
182
5. Saṇamānasuttavaṇṇanā
5. Commentary on the Saṇamāna Sutta
5. Chú giải Kinh Saṇamāna
183
15. Pañcame ṭhite majjhanhiketi ṭhitamajjhanhike.
15. In the fifth, ṭhite majjhanhike means at high noon, when the sun stands directly overhead.
Trong kinh thứ năm, ṭhite majjhanhike nghĩa là khi mặt trời đứng bóng giữa trưa.
Sannisīvesūti yathā phāsukaṭṭhānaṃ upagantvā sannisinnesu vissamamānesu.
Sannisīvesu means when they are gathered and resting, having gone to a comfortable place.
Sannisīvesu nghĩa là khi chúng đã đến nơi thuận tiện và ngồi xuống nghỉ ngơi.
Ṭhitamajjhanhikakālo nāmesa sabbasattānaṃ iriyāpathadubbalyakālo.
This time of high noon is indeed the time when the physical postures of all beings are weak.
Thời điểm giữa trưa là thời điểm mà tất cả chúng sinh đều yếu ớt trong oai nghi.
Idha pana pakkhīnaṃyeva vasena dassito.
Here, however, it is shown specifically in relation to birds.
Ở đây, điều này được thể hiện chỉ riêng cho loài chim.
Saṇatevāti saṇati viya mahāviravaṃ viya muccati.
Saṇatevā means it sounds as if it is making a great roar, as if it is emitting a loud noise.
Saṇatevā nghĩa là như phát ra tiếng kêu, như phát ra một tiếng ồn lớn.
Saṇamānameva cettha ‘‘saṇatevā’’ti vuttaṃ.
Here, "saṇatevā" is said of that which is making a sound.
Ở đây, chính tiếng ồn đó được gọi là "saṇatevā".
Tappaṭibhāgaṃ nāmetaṃ.
This is a corresponding term.
Đây là một từ đồng nghĩa.
Nidāghasamayasmiñhi ṭhitamajjhanhikakāle catuppadagaṇesu ceva pakkhīgaṇesu ca sannisinnesu vātapūritānaṃ susirarukkhānañceva chiddaveṇupabbānañca khandhena khandhaṃ sākhāya sākhaṃ saṅghaṭṭayantānaṃ pādapānañca araññamajjhe mahāsaddo uppajjati.
Indeed, in the summer season, at high noon, when groups of quadrupeds and birds are gathered, a great sound arises in the middle of the forest from hollow trees filled with wind, and from hollow bamboo clumps, and from trees whose trunks strike against other trunks and whose branches strike against other branches.
Vào mùa nóng, giữa trưa, khi các loài động vật bốn chân và các loài chim đã ngồi xuống, một tiếng ồn lớn phát ra giữa rừng từ những cây rỗng ruột chứa đầy gió, từ những đốt tre rỗng, và từ những cây va chạm cành với cành, thân với thân.
Taṃ sandhāyetaṃ vuttaṃ.
It is with reference to that sound that this is said.
Điều này được nói đến để chỉ điều đó.
Taṃ bhayaṃ paṭibhāti manti taṃ evarūpe kāle mahāaraññassa saṇamānaṃ mayhaṃ bhayaṃ hutvā upaṭṭhāti.
Taṃ bhayaṃ paṭibhāti manti means that resounding of the great forest at such a time appears to me as fear.
Taṃ bhayaṃ paṭibhāti maṃ nghĩa là vào thời điểm như vậy, tiếng ồn ào của khu rừng lớn ấy hiện ra như một nỗi sợ hãi đối với tôi.
Dandhapaññā kiresā devatā tasmiṃ khaṇe attano nisajjaphāsukaṃ kathāphāsukaṃ dutiyakaṃ alabhantī evamāha.
This deity, being of dull wisdom, said this at that moment, not finding a companion comfortable for sitting or comfortable for conversation.
Vị thiên nhân này, được cho là có trí tuệ chậm lụt, đã nói như vậy vào khoảnh khắc đó khi không tìm được người thứ hai để chia sẻ sự thoải mái khi ngồi và sự thoải mái khi nói chuyện.
Yasmā pana tādise kāle piṇḍapātapaṭikkantassa vivitte araññāyatane kammaṭṭhānaṃ gahetvā nisinnassa bhikkhuno anappakaṃ sukhaṃ uppajjati, yaṃ sandhāya vuttaṃ –
However, because in such a time, great bliss arises for a bhikkhu who has returned from his alms round, and is sitting in a secluded forest hermitage, having taken up a meditation subject, concerning which it is said:
Tuy nhiên, vì vào thời điểm như vậy, một tỳ khưu đã trở về sau khi khất thực, ngồi xuống thiền định trong một khu rừng vắng vẻ, sẽ phát sinh một niềm an lạc không nhỏ, điều mà đã được nói đến để chỉ –
184
‘‘Suññāgāraṃ paviṭṭhassa, santacittassa bhikkhuno;
“For a bhikkhu who has entered an empty house, whose mind is tranquil,
“Đối với vị tỳ khưu vào nhà trống, với tâm thanh tịnh;
185
Amānusī ratī hoti, sammā dhammaṃ vipassato’’ti.(dha. pa. 373) ca,
There is superhuman delight, as he rightly discerns the Dhamma,” and,
Niềm vui phi nhân phát sinh, khi quán chiếu Chánh Pháp đúng đắn.”
186
‘‘Purato pacchato vāpi, aparo ce na vijjati;
“If there is no other ahead or behind,
“Nếu không có ai khác, phía trước hay phía sau;
187
Atīva phāsu bhavati, ekassa vasato vane’’ti.(theragā. 537) ca;
It is indeed very comfortable for one living alone in the forest,”—
Thật là an lạc khi sống một mình trong rừng.”
188
Tasmā bhagavā dutiyaṃ gāthamāha.
Therefore, the Blessed One spoke the second verse.
Do đó, Đức Thế Tôn đã nói kệ thứ hai.
Tattha sā rati paṭibhāti manti yā evarūpe kāle ekakassa nisajjā nāma, sā rati mayhaṃ upaṭṭhātīti attho.
There, sā rati paṭibhāti manti means, "that delight which is sitting alone at such a time, that delight appears to me." This is the meaning.
Ở đó, sā rati paṭibhāti maṃ có nghĩa là, niềm an lạc khi ngồi một mình vào thời điểm như vậy hiện ra đối với tôi.
Sesaṃ tādisamevāti.
The rest is similar.
Phần còn lại cũng tương tự như vậy.
189
Saṇamānasuttavaṇṇanā niṭṭhitā.
The commentary on the Saṇamāna Sutta is concluded.
Chú giải Kinh Saṇamāna đã hoàn tất.
190
6. Niddātandīsuttavaṇṇanā
6. Commentary on the Niddātandī Sutta
6. Chú giải Kinh Niddātandī
191
16. Chaṭṭhe niddāti, ‘‘abhijānāmahaṃ, aggivessana, gimhānaṃ pacchime māse niddaṃ okkamitā’’ti (ma. ni. 1.387) evarūpāya abyākataniddāya pubbabhāgāparabhāgesu sekhaputhujjanānaṃ sasaṅkhārikaakusale citte uppannaṃ thinamiddhaṃ.
16. In the sixth, niddā refers to thinamiddha (sloth and torpor) arisen in the unskillful minds of trainees and ordinary individuals in the periods preceding and following undeterminable sleep of this kind: "I recollect, Aggivessana, having fallen asleep in the last month of the hot season."
Trong kinh thứ sáu, niddā là sự hôn trầm (thīna-middha) phát sinh trong tâm bất thiện có tác ý của các bậc hữu học (sekha) và phàm phu (puthujjana) ở phần đầu và phần cuối của giấc ngủ vô ký (abyākata-niddā) như trong câu: “Này Aggivessana, ta biết rằng ta đã ngủ vào tháng cuối cùng của mùa hè.”
Tandīti aticchātātisītādikālesu uppannaṃ āgantukaṃ ālasiyaṃ.
Tandī refers to adventitious laziness arisen at times of excessive hunger or cold.
Tandī là sự lười biếng (ālasya) khách quan phát sinh vào những thời điểm quá đói hoặc quá lạnh.
Vuttampi cetaṃ – ‘‘tattha katamā tandī?
It is also said: "What is tandī there?
Điều này cũng đã được nói: “Ở đó, sự lười biếng nào? Đó là sự lười biếng, sự lười biếng, sự lười biếng, sự uể oải, sự uể oải, sự uể oải, đó được gọi là sự lười biếng.”
Yā tandī tandiyanā tandimanatā ālasyaṃ ālasyāyanā ālasyāyitattaṃ, ayaṃ vuccati tandī’’ti (vibha. 857).
That sluggishness, being sluggish, sluggishness of mind, idleness, being idle, state of being idle: this is called tandī."
Sự uể oải, sự lười biếng, sự lười nhác, sự biếng nhác, sự lười nhác hóa, sự trở nên lười nhác, đây được gọi là ‘tandī’ (sự uể oải).
Vijambhitāti kāyavijambhanā.
Vijambhitā means stretching of the body.
Vijambhitā là sự vươn vai của thân thể.
Aratīti akusalapakkhā ukkaṇṭhitatā.
Aratī means discontent, belonging to the unskillful side.
Aratī là sự chán nản thuộc về phe bất thiện.
Bhattasammadoti bhattamucchā bhattakilamatho.
Bhattasammado means food-intoxication, food-weariness.
Bhattasammado là sự say sưa do thức ăn, sự mệt mỏi do thức ăn.
Vitthāro pana tesaṃ – ‘‘tattha katamā vijambhitā?
Their elaboration is already given in the Abhidhamma in the manner beginning: "What is vijambhitā there?
Tuy nhiên, sự giải thích chi tiết về chúng – “Ở đó, sự vươn vai nào? Đó là sự vươn vai, sự vươn vai của thân thể” v.v. đã được trình bày trong Abhidhamma.
Yā kāyassa jambhanā vijambhanā’’tiādinā nayena abhidhamme āgatova.
That stretching, stretching of the body."
“Sự uể oải của thân, sự uể oải hoàn toàn của thân”, v.v. đã được đề cập trong Abhidhamma theo cách này.
Etenāti etena niddādinā upakkilesena upakkiliṭṭho nivāritapātubhāvo.
Etenā means stained by this defilement such as sloth, its manifestation is hindered.
Etenā nghĩa là bị ô nhiễm bởi những cấu uế như giấc ngủ này, sự hiện hữu bị ngăn cản.
Nappakāsatīti na jotati, na pātubhavatīti attho.
Nappakāsatī means it does not shine, it does not manifest. This is the meaning.
Nappakāsatī nghĩa là không tỏa sáng, không hiện hữu.
Ariyamaggoti lokuttaramaggo.
Ariyamaggo means the supramundane path.
Ariyamaggo là con đường siêu thế (lokuttara-magga).
Idhāti imasmiṃ loke.
Idhā means in this world.
Idhā là trong thế giới này.
Pāṇinanti sattānaṃ.
Pāṇinaṃ means for beings.
Pāṇinaṃ là của chúng sinh.
Vīriyenāti maggasahajātavīriyena.
Vīriyenā means by the effort concomitant with the path.
Vīriyenā là với tinh tấn đồng sinh với Đạo.
Naṃ paṇāmetvāti etaṃ kilesajātaṃ nīharitvā.
Naṃ paṇāmetvā means having removed this mass of defilements.
Naṃ paṇāmetvā là sau khi loại bỏ nhóm phiền não này.
Ariyamaggoti lokiyalokuttaramaggo.
Ariyamaggo means the mundane and supramundane path.
Ariyamaggo là con đường thế gian và siêu thế.
Iti maggeneva upakkilese nīharitvā maggassa visuddhi vuttāti.
Thus, by the path itself, having removed defilements, the purity of the path is declared.
Như vậy, sự thanh tịnh của Đạo đã được nói đến bằng cách loại bỏ các cấu uế chính bằng Đạo.
192
Niddātandīsuttavaṇṇanā niṭṭhitā.
The commentary on the Niddātandī Sutta is concluded.
Chú giải Kinh Niddātandī đã hoàn tất.
193
7. Dukkarasuttavaṇṇanā
7. Commentary on the Dukkara Sutta
7. Chú giải Kinh Dukkara
194
17. Sattame duttitikkhanti dukkhamaṃ duadhivāsiyaṃ.
17. In the seventh, duttitikkhaṃ means difficult to bear, difficult to endure.
Trong kinh thứ bảy, duttitikkhaṃ nghĩa là khó chịu đựng, khó nhẫn nại.
Abyattenāti bālena.
Abyattenā means by the foolish.
Abyattenā nghĩa là bởi người ngu si.
Sāmaññanti samaṇadhammo.
Sāmaññaṃ means the practice of a recluse.
Sāmaññaṃ là pháp của Sa-môn.
Iminā devatā idaṃ dasseti – yaṃ paṇḍitā kulaputtā dasapi vassāni vīsatipi saṭṭhipi vassāni dante abhidantamādhāya jivhāya tāluṃ āhaccapi cetasā cittaṃ abhiniggaṇhitvāpi ekāsanaṃ ekabhattaṃ paṭisevamānā āpāṇakoṭikaṃ brahmacariyaṃ carantā sāmaññaṃ karonti.
By this, the deity shows that the noble practice which wise young men undertake—practicing the brahmacariya up to the end of life, for ten, twenty, or even sixty years, eating only one meal and sitting in one posture, pressing the lower teeth against the upper, pressing the tongue against the palate, and restraining the mind with the mind—
Qua đó, vị thiên nhân này cho thấy rằng: những người con của gia đình có trí tuệ, dù sống mười năm, hai mươi năm, hay sáu mươi năm, giữ răng dưới chạm răng trên, lưỡi chạm vòm miệng, và kìm nén tâm bằng ý chí, thực hành đời sống Phạm hạnh đến hơi thở cuối cùng, chỉ ăn một bữa và ngồi một chỗ, họ thực hành Sa-môn hạnh.
Taṃ bhagavā bālo abyatto kātuṃ na sakkotīti.
That the Blessed One, as a foolish and unskilled one, cannot perform it.
Đức Thế Tôn nói rằng một người ngu si, không khéo léo, không thể thực hành điều đó.
Bahū hi tattha sambādhāti tasmiṃ sāmaññasaṅkhāte ariyamagge bahū sambādhā maggādhigamāya paṭipannassa pubbabhāge bahū parissayāti dasseti.
Bahū hi tattha sambādhā indicates that in that noble path called the practice of a recluse, there are many obstacles; for one who has entered the path to attainment, there are many dangers in the initial stages, such as sensual thoughts.
Bahū hi tattha sambādhā cho thấy rằng trong con đường Thánh (ariyama-gga) được gọi là Sa-môn hạnh đó, có nhiều chướng ngại, nhiều hiểm nguy ở giai đoạn đầu đối với người đang thực hành để đạt đến Đạo.
195
Cittañce na nivārayeti yadi ayoniso uppannaṃ cittaṃ na nivāreyya, kati ahāni sāmaññaṃ careyya?
Cittañce na nivāraye means if one does not restrain the mind arisen unwisely, for how many days could one practice the recluse's life?
Cittañce na nivāraye nghĩa là nếu không kìm nén tâm đã phát sinh một cách không đúng đắn, thì người đó có thể thực hành Sa-môn hạnh được bao nhiêu ngày?
Ekadivasampi na careyya.
One could not practice even for a single day.
Thậm chí một ngày cũng không thể thực hành.
Cittavasiko hi samaṇadhammaṃ kātuṃ na sakkoti.
For one who is under the sway of the mind cannot perform the recluse's practice.
Vì người bị tâm chi phối không thể thực hành pháp Sa-môn.
Pade padeti ārammaṇe ārammaṇe.
Pade pade means at every object.
Pade pade nghĩa là ở mỗi đối tượng.
Ārammaṇañhi idha padanti adhippetaṃ.
Indeed, the object is here intended by "pada".
Ở đây, đối tượng được hiểu là "pada".
Yasmiṃ yasmiṃ hi ārammaṇe kileso uppajjati, tattha tattha bālo visīdati nāma.
For at whatever object defilement arises, there the fool sinks.
Vì ở mỗi đối tượng mà phiền não phát sinh, ở đó người ngu si sẽ chìm đắm.
Iriyāpathapadampi vaṭṭati.
The "pada" of posture is also applicable.
Từ "pada" cũng có thể chỉ oai nghi.
Gamanādīsu hi yattha yattha kileso uppajjati, tattha tattheva visīdati nāma.
For in whatever posture, such as walking, defilement arises, there one sinks.
Vì ở mỗi oai nghi như đi lại mà phiền não phát sinh, ở đó người đó sẽ chìm đắm.
Saṅkappānanti kāmasaṅkappādīnaṃ.
Saṅkappānaṃ refers to sensual thoughts and so forth.
Saṅkappānaṃ là của các tư duy như tư duy dục (kāmasaṅkappa).
196
Kummo vāti kacchapo viya.
Kummo vā means like a tortoise.
Kummo vā nghĩa là như con rùa.
Aṅgānīti gīvapañcamāni aṅgāni.
Aṅgāni means the limbs, with the neck as the fifth.
Aṅgāni là năm chi, với cổ là chi thứ năm.
Samodahanti samodahanto, samodahitvā vā.
Samodahaṃ means gathering, or having gathered.
Samodahanti nghĩa là đang thu mình lại, hoặc đã thu mình lại.
Manovitakketi manamhi uppannavitakke.
Manovitakke means thoughts arisen in the mind.
Manovitakke là các tư duy phát sinh trong tâm.
Ettāvatā idaṃ dasseti – yathā kummo soṇḍipañcamāni aṅgāni sake kapāle samodahanto siṅgālassa otāraṃ na deti, samodahitvā cassa appasayhataṃ āpajjati, evamevaṃ bhikkhu manamhi uppannavitakke sake ārammaṇakapāle samodahaṃ mārassa otāraṃ na deti, samodahitvā cassa appasayhataṃ āpajjatīti.
By this much, it shows that just as a tortoise, gathering its limbs (which are five, including its snout) into its own shell, gives no opportunity to the jackal, and by gathering them becomes unassailable to it, even so a bhikkhu, gathering the thoughts arisen in his mind into the shell of his own object (of meditation), gives no opportunity to Māra, and by gathering them becomes unassailable to him.
Qua đó, điều này được cho thấy rằng: giống như con rùa thu năm chi của mình (bốn chân và cổ) vào mai của nó, không cho chồn cơ hội, và khi đã thu mình lại thì không thể bị chồn tấn công; cũng vậy, một tỳ khưu thu các tư duy phát sinh trong tâm vào mai đối tượng của mình, không cho Māra cơ hội, và khi đã thu mình lại thì không thể bị Māra tấn công.
Anissitoti taṇhādiṭṭhinissayehi anissito hutvā.
Anissito means having become independent of the supports of craving and wrong view.
Anissito nghĩa là không nương tựa vào sự nương tựa của tham ái và tà kiến.
Aheṭhayānoti avihiṃsamāno.
Aheṭhayāno means not harming.
Aheṭhayāno nghĩa là không làm hại.
Parinibbutoti kilesanibbānena parinibbuto.
Parinibbuto means completely extinguished by the extinction of defilements.
Parinibbuto nghĩa là đã nhập Niết Bàn bằng sự diệt trừ phiền não (kilesa-nibbāna).
Nūpavadeyya kañcīti yaṃkiñci puggalaṃ ācāravipattiādīsu yāya kāyaci maṅkuṃ kātukāmo hutvā na vadeyya, ‘‘kālena vakkhāmi no akālenā’’tiādayo pana pañca dhamme ajjhattaṃ upaṭṭhapetvā ullumpanasabhāvasaṇṭhitena cittena kāruññataṃ paṭicca vadeyyāti.
Nūpavadeyya kañcī means one should not speak ill of any person, desiring to cause embarrassment regarding their misconduct and so forth; rather, having established the five qualities within oneself, such as "I will speak at the right time, not at the wrong time," one should speak out of compassion with a mind intent on deliverance from moral decline.
Nūpavadeyya kañcī nghĩa là không nên nói xấu bất cứ ai vì muốn làm cho họ xấu hổ về những lỗi lầm trong hành vi, v.v., mà nên đặt năm pháp như "Ta sẽ nói đúng lúc, không nói sai lúc" vào trong tâm, và với tâm ý muốn giúp đỡ, nói với lòng từ bi.
197
Dukkarasuttavaṇṇanā niṭṭhitā.
The commentary on the Dukkara Sutta is concluded.
Chú giải Kinh Dukkara đã hoàn tất.
198
8. Hirīsuttavaṇṇanā
8. Commentary on the Hirī Sutta
8. Chú giải Kinh Hirī
199
18. Aṭṭhame hirīnisedhoti hiriyā akusale dhamme nisedhetīti hirīnisedho.
18. In the eighth, hirīnisedho means one who restrains unskillful actions by modesty (hirī).
Trong kinh thứ tám, hirīnisedho là sự ngăn cấm các pháp bất thiện bằng sự hổ thẹn (hirī).
Koci lokasmiṃ vijjatīti koci evarūpo vijjatīti pucchati.
Koci lokasmiṃ vijjatī means "Is there anyone in the world of such a kind?" he asks.
Koci lokasmiṃ vijjatī là hỏi rằng có ai như vậy trong thế gian không.
Yo nindaṃ apabodhatīti yo garahaṃ apaharanto bujjhati.
Yo nindaṃ apabodhatī means one who awakens, removing blame.
Yo nindaṃ apabodhatī là người nào thức tỉnh bằng cách loại bỏ sự khiển trách.
Asso bhadro kasāmivāti yathā bhadro assājānīyo kasaṃ apaharanto bujjhati, patodacchāyaṃ disvā saṃvijjhanto viya kasāya attani nipātaṃ na deti, evameva yo bhikkhu bhūtassa dasaakkosavatthuno attani nipātaṃ adadanto nindaṃ apabodhati apaharanto bujjhati, evarūpo koci khīṇāsavo vijjatīti pucchati.
"Just as a noble thoroughbred horse understands by avoiding the whip, and seeing the shadow of the goad, it does not allow the whip to fall on itself, as if startled; in the same way, the devatā asks, 'Is there any such bhikkhu, an Arahant, who, not allowing the ten grounds of true abuse to fall upon himself, understands by warding off censure?'"
Như con ngựa hiền tránh roi – như con ngựa thuần thục, khi thấy bóng roi, biết tránh roi không để roi chạm vào mình, như thể giật mình khi thấy bóng roi không để roi chạm vào thân mình; cũng vậy, vị Tỷ-kheo nào không để mười điều mắng nhiếc có thật chạm vào thân mình, mà biết tránh sự quở trách, thì có vị A-la-hán nào như thế không? – vị thiên nhân hỏi.
Abhūtakkosena pana parimutto nāma natthi.
However, there is no one who is free from false accusation.
Nhưng không có ai thoát khỏi lời mắng nhiếc không có thật.
Tanuyāti tanukā, hiriyā akusale dhamme nisedhetvā carantā khīṇāsavā nāma appakāti attho.
Regarding tanuyā: "Few are the Arahants who live by restraining unwholesome states through hiri (moral shame)." This is the meaning.
Ít ỏi – nghĩa là ít ỏi; những vị A-la-hán sống bằng sự hổ thẹn (hiri) ngăn chặn các pháp bất thiện thì ít ỏi.
Sadā satāti niccakālaṃ sativepullena samannāgatā.
Regarding sadā satā: "They are always endowed with an abundance of mindfulness."
Luôn luôn chánh niệm – luôn luôn đầy đủ sự chánh niệm.
Antaṃ dukkhassa pappuyyāti vaṭṭadukkhassa koṭiṃ antabhūtaṃ nibbānaṃ pāpuṇitvā.
Regarding antaṃ dukkhassa pappuyyā: "Having reached Nibbāna, which is the end, the culmination of the suffering of saṃsāra."
Đạt đến cuối cùng của khổ đau – đạt đến Niết-bàn, là điểm cuối cùng của khổ đau luân hồi.
Sesaṃ vuttanayamevāti.
The rest is in the manner already explained.
Phần còn lại cũng theo cách đã nói.
200
Hirīsuttavaṇṇanā niṭṭhitā.
The commentary on the Hiri Sutta is concluded.
Chấm dứt phần chú giải kinh Hiri.
201
9. Kuṭikāsuttavaṇṇanā
9. Commentary on the Kuṭikā Sutta
9. Chú giải kinh Kuṭikā
202
19. Navame kacci te kuṭikāti ayaṃ devatā dasa māse antovasanaṭṭhānaṭṭhena mātaraṃ kuṭikaṃ katvā, yathā sakuṇā divasaṃ gocarapasutā rattiṃ kulāvakaṃ allīyanti, evamevaṃ sattā tattha tattha gantvāpi mātugāmassa santikaṃ āgacchanti, ālayavasena bhariyaṃ kulāvakaṃ katvā.
19. In the ninth*, regarding kacci te kuṭikā: This devatā, making her mother a "hut" (kuṭikā) in the sense of a dwelling place for ten months in the womb, and just as birds, busy foraging during the day, cling to their nests at night, so too beings, even after going hither and thither, come back to a woman's presence, making a wife a "nest" out of attachment.
19. Trong kinh thứ chín, Túp lều của ông có không? – vị thiên nhân này đã xem mẹ là túp lều vì đã ở trong bụng mẹ mười tháng; giống như chim chóc ban ngày đi kiếm ăn, ban đêm lại trở về tổ; cũng vậy, chúng sanh dù đi đến đâu rồi cũng trở về với người nữ, xem vợ là tổ ấm do sự luyến ái. Xem dòng dõi gia đình là sự nối tiếp, xem con cái là sự nối tiếp, xem tham ái là sự ràng buộc, vị ấy đã kết hợp những câu hỏi này thành một bài kệ và hỏi Đức Thế Tôn. Đức Thế Tôn cũng đã trả lời vị ấy, nói lời Chắc chắn rồi và những lời khác.
Kulapaveṇiṃ santānakaṭṭhena putte santānake katvā, taṇhaṃ bandhanaṃ katvā, gāthābandhanena ime pañhe samodhānetvā bhagavantaṃ pucchi, bhagavāpissā vissajjento tagghātiādimāha.
Making children "webs" in the sense of a lineage, binding them with craving as a "bond", and thus forming these questions into stanzas, he questioned the Blessed One. The Blessed One, in answering him, spoke the words beginning with tagghā.
Trong đó, Chắc chắn rồi (tagghā) là một trạng từ dùng để khẳng định.
Tattha tagghāti ekaṃsavacane nipāto.
Therein, tagghā is a particle indicating certainty.
Không có – vì đã từ bỏ và xuất gia, nên không còn sự tái sinh trong bụng mẹ, không còn sự nuôi dưỡng vợ con hay sự sinh con cái trong luân hồi.
Natthīti pahāya pabbajitattā vaṭṭasmiṃ vā puna mātukucchivāsassa dārabharaṇassa puttanibbattiyā vā abhāvato natthi.
Natthī (there is not) means there is not, due to having renounced and gone forth, and due to the absence of dwelling again in a mother's womb, or supporting a wife, or the arising of children in saṃsāra.
Vị thiên nhân suy nghĩ: “Ta đã hỏi những câu hỏi bí mật được chuẩn bị kỹ lưỡng, và vị Sa-môn này đã trả lời ngay khi được hỏi. Phải chăng Ngài biết được ý định của ta mà nói, hay Ngài không biết mà nói đại những gì xuất hiện trong miệng?” – rồi hỏi tiếp: Ta là gì của Ngài? và những lời khác.
203
Devatā ‘‘mayā sannāhaṃ bandhitvā guḷhā pañhā pucchitā, ayañca samaṇo pucchitamatteyeva vissajjesi, jānaṃ nu kho me ajjhāsayaṃ kathesi, udāhu ajānaṃ yaṃ vā taṃ vā mukhāruḷhaṃ kathesī’’ti cintetvā puna kintāhantiādimāha.
The devatā, thinking, "I asked a profound question, having tightly bound it, and this recluse answered as soon as it was asked. Did he speak knowing my intention, or did he speak whatever came to his lips without knowing it?", and then spoke the words beginning with kintāhaṃ.
Trong đó, kintāhaṃ là cách đọc rút gọn của “kiṃ te ahaṃ” (ta là gì của ngài).
Tattha kintāhanti kiṃ te ahaṃ.
Therein, kintāhaṃ means "What am I to you?"
Rồi Đức Thế Tôn đã giảng giải cho vị ấy, nói lời Mẹ và những lời khác.
Athassā bhagavā ācikkhanto mātarantiādimāha.
Then the Blessed One, explaining to him, spoke the words beginning with mātaraṃ.
Lành thay cho Ngài – sau khi hoan hỷ và vui mừng với bài kệ, vị ấy đã đảnh lễ Đức Thế Tôn, cúng dường bằng hương hoa và các thứ khác, rồi trở về cõi trời của mình.
Sāhu teti gāthāya anumoditvā sampahaṃsitvā bhagavantaṃ vanditvā gandhamālādīhi pūjetvā attano devaṭṭhānameva gatāti.
The devatā, having rejoiced and become greatly gladdened by the stanza, having venerated the Blessed One and honored him with perfumes, garlands, etc., went back to her own divine abode.
.
204
Kuṭikāsuttavaṇṇanā niṭṭhitā.
The commentary on the Kuṭikā Sutta is concluded.
Chấm dứt phần chú giải kinh Kuṭikā.
205
10. Samiddhisuttavaṇṇanā
10. Commentary on the Samiddhi Sutta
10. Chú giải kinh Samiddhi
206
20. Dasame tapodārāmeti tapodassa tattodakassa rahadassa vasena evaṃ laddhanāme ārāme.
20. In the tenth*, tapodārāme means "in the Tapoda monastery", an ārāma that acquired this name because of the hot water spring (tapoda) and lake.
20. Trong kinh thứ mười, Tại công viên Tapoda – tại công viên được đặt tên như vậy do có hồ nước nóng (tapoda).
Vebhārapabbatassa kira heṭṭhā bhummaṭṭhakanāgānaṃ pañcayojanasatikaṃ nāgabhavanaṃ devalokasadisaṃ maṇimayena talena ārāmuyyānehi ca samannāgataṃ.
It is said that below the Vebhāra mountain, there is a five-hundred yojana long Nāga abode belonging to the earth-dwelling Nāgas, resembling a deva realm, endowed with a jeweled ground and parks and gardens.
Nghe nói, bên dưới núi Vebhāra, có một cung điện của chư Nāga sống dưới đất, dài năm trăm do-tuần, giống như cõi trời, với nền đất bằng ngọc báu và đầy đủ vườn tược.
Tattha nāgānaṃ kīḷanaṭṭhāne mahāudakarahado, tato tapodā nāma nadī sandati kuthitā uṇhodakā.
There, in the playing ground of the Nāgas, is a great hot water lake, from which a river called Tapodā flows, boiling with hot water.
Tại nơi vui chơi của chư Nāga có một hồ nước lớn, từ đó sông Tapodā chảy ra, nước sôi sùng sục, nóng bỏng.
Kasmā panesā edisā?
But why is it like this?
Tại sao nó lại như vậy?
Rājagahaṃ kira parivāretvā mahāpetaloko tiṭṭhati, tattha dvinnaṃ mahālohakumbhinirayānaṃ antarena ayaṃ tapodā āgacchati, tasmā kuthitā sandati.
It is said that a great realm of hungry ghosts (petas) surrounds Rājagaha, and there, this Tapodā river flows between two great Lohakumbhī hells; therefore, it flows boiling.
Nghe nói, thành Rājagaha được bao quanh bởi một cõi ngạ quỷ lớn, và sông Tapodā này chảy qua giữa hai địa ngục Loha Kumbhī lớn; do đó, nước sông sôi sùng sục.
Vuttampi cetaṃ –
And it was also said:
Điều này cũng đã được nói:
207
‘‘Yatāyaṃ, bhikkhave, tapodā sandati, so daho acchodako sītodako sātodako setodako suppatittho ramaṇīyo pahūtamacchakacchapo, cakkamattāni ca padumāni pupphanti.
"Monks, the lake from which this Tapodā flows has clear, cool, sweet, and clean water, with good landing places, delightful, and abundant with fish and turtles, and lotuses the size of cartwheels bloom there. But, monks, this Tapodā river flows through the midst of two great hells; that is why this Tapodā flows boiling."
“Này các Tỷ-kheo, nơi sông Tapodā chảy ra, hồ nước đó trong sạch, mát lạnh, ngọt ngào, trắng tinh, có bến tắm tốt đẹp, đáng yêu, có nhiều cá và rùa, và hoa sen nở to bằng bánh xe.
Apicāyaṃ, bhikkhave, tapodā dvinnaṃ mahānirayānaṃ antarikāya āgacchati, tenāyaṃ tapodā kuthitā sandatī’’ti (pārā. 231).
Furthermore, bhikkhus, this Tapodā comes through the interval of two great hells; therefore, this Tapodā flows boiling."
Nhưng này các Tỷ-kheo, sông Tapodā này chảy qua giữa hai đại địa ngục, do đó sông Tapodā này sôi sùng sục.”
208
Imassa pana ārāmassa abhimukhaṭṭhāne tato mahāudakarahado jāto, tassa vasenāyaṃ vihāro ‘‘tapodārāmo’’ti vuccati.
However, a great hot water lake was formed in the area facing this monastery; because of it, this monastery is called "Tapodārāma".
Tuy nhiên, tại vị trí đối diện với công viên này, một hồ nước lớn đã hình thành từ đó, và do đó, tu viện này được gọi là “Tapodārāma”.
209
Samiddhīti tassa kira therassa attabhāvo samiddho abhirūpo pāsādiko, tasmā ‘‘samiddhī’’tveva saṅkhaṃ gato.
Samiddhī: It is said that the body of that elder was prosperous, handsome, and pleasing; therefore, he was known simply as "Samiddhi".
Samiddhi – nghe nói, thân thể của vị Trưởng lão ấy đầy đủ (samiddho), rất đẹp đẽ (abhirūpo), và đáng kính (pāsādiko); do đó, Ngài được gọi là “Samiddhi”.
Gattāni parisiñcitunti padhānikatthero esa, balavapaccūse uṭṭhāyāsanā sarīraṃ utuṃ gāhāpetvā bahi saṭṭhihatthamatte mahācaṅkame aparāparaṃ caṅkamitvā ‘‘sedagahitehi gattehi paribhuñjamānaṃ senāsanaṃ kilissatī’’ti maññamāno gattāni parisiñcanatthaṃ sarīradhovanatthaṃ upasaṅkami.
Gattāni parisiñcituṃ: This elder was one devoted to exertion. Having risen from his seat in the early morning, and after warming his body by closing doors to block the wind, he walked back and forth on a great walking path about sixty cubits long outside. Thinking, "the lodging used with a body soaked in sweat will become dirty", he approached to sprinkle his body, to wash his body.
Để dội nước lên thân – vị Trưởng lão này là một vị tu tập tinh cần. Ngài thức dậy vào lúc rạng đông, rời chỗ ngồi, để thân thể thích nghi với khí hậu, rồi đi kinh hành tới lui trên một con đường kinh hành lớn dài sáu mươi cubit bên ngoài. Nghĩ rằng “chỗ nằm sẽ bị dơ bẩn nếu dùng khi thân thể còn đẫm mồ hôi”, Ngài đến để dội nước lên thân, tức là để tắm rửa thân thể.
Ekacīvaro aṭṭhāsīti nivāsanaṃ nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ hatthena gahetvā aṭṭhāsi.
Ekacīvaro aṭṭhāsī: He stood wearing his lower robe, with his waist-band tied, holding his outer robe in his hand.
Đứng với một y – Ngài mặc y nội, thắt dây lưng, cầm y tăng-già-lê bằng tay và đứng.
210
Gattāni pubbāpayamānoti gattāni pubbasadisāni vodakāni kurumāno.
Gattāni pubbāpayamāno: Making his body dry and without water droplets, like before (i.e., before getting wet with sweat).
Làm cho thân khô ráo – làm cho thân thể không còn nước, như trạng thái trước khi có mồ hôi.
Allasarīre pārutaṃ hi cīvaraṃ kilissati duggandhaṃ hoti, na cetaṃ vattaṃ.
For a robe worn on a wet body becomes dirty and ill-smelling, and this is not proper observance.
Thật vậy, y bị mặc trên thân thể ướt sẽ bị dơ bẩn và có mùi hôi, điều này không đúng với bổn phận (vatta).
Thero pana vattasampanno, tasmā vatte ṭhitova nhāyitvā paccuttaritvā aṭṭhāsi.
But the elder was perfect in his observances; therefore, he bathed while adhering to the observances, came out of the water, and stood.
Nhưng vị Trưởng lão này là người đầy đủ bổn phận, do đó, Ngài đã tắm rửa và bước ra khỏi nước, đứng yên trong khi giữ bổn phận.
Tattha idaṃ nhānavattaṃ – udakatitthaṃ gantvā yattha katthaci cīvarāni nikkhipitvā vegena ṭhitakeneva na otaritabbaṃ, sabbadisā pana oloketvā vivittabhāvaṃ ñatvā khāṇugumbalatādīni vavatthapetvā tikkhattuṃ ukkāsitvā avakujja ṭhitena uttarāsaṅgacīvaraṃ apanetvā pasāretabbaṃ, kāyabandhanaṃ mocetvā cīvarapiṭṭheyeva ṭhapetabbaṃ.
This is the bathing observance: One should not hastily enter the water by simply discarding the robes wherever, but should first look in all directions, ascertain the seclusion of the place, identify any stumps, bushes, vines, etc., clear one's throat three times, then, stooping down, remove the upper robe and spread it out. The waist-band should be untied and placed directly on the robe.
Trong đó, đây là bổn phận khi tắm: không nên vội vàng xuống nước ngay sau khi đến bến nước và đặt y ở bất cứ đâu, mà nên nhìn khắp các hướng, biết được nơi vắng vẻ, ghi nhớ các gốc cây, bụi rậm, dây leo, v.v., hắng giọng ba lần, rồi cúi người xuống, cởi y thượng y ra và trải ra; tháo dây lưng và đặt ngay trên y.
Sace udakasāṭikā natthi, udakante ukkuṭikaṃ nisīditvā nivāsanaṃ mocetvā sace sinnaṭṭhānaṃ atthi, pasāretabbaṃ.
If there is no bathing cloth, one should sit squatting by the water's edge, remove the lower robe, and if there is a sweaty spot, it should be spread out.
Nếu không có y tắm, hãy ngồi xổm bên bờ nước, tháo y nội ra, nếu có chỗ bị ướt mồ hôi thì trải ra.
No ce atthi, saṃharitvā ṭhapetabbaṃ.
If there is no sweaty spot, it should be folded and kept aside.
Nếu không có, hãy gấp lại và đặt sang một bên.
Udakaṃ otarantena saṇikaṃ nābhippamāṇamattaṃ otaritvā vīciṃ anuṭṭhāpentena saddaṃ akarontena nivattitvā āgatadisābhimukhena nimujjitabbaṃ, evaṃ cīvaraṃ rakkhitaṃ hoti.
When entering the water, one should descend slowly, only to the depth of the navel, without causing ripples, without making noise, and then, turning around to face the direction from which one came, immerse oneself. In this way, the robe is protected.
Khi xuống nước, nên từ từ xuống đến ngang rốn, không làm nổi sóng, không gây tiếng động, quay lại và lặn xuống hướng về phía mình đã đến; làm như vậy, y sẽ được bảo vệ.
Ummujjantenapi saddaṃ akarontena saṇikaṃ ummujjitvā nhānapariyosāne udakante ukkuṭikena nisīditvā nivāsanaṃ parikkhipitvā uṭṭhāya suparimaṇḍalaṃ nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ apārupitvāva ṭhātabbanti.
When emerging, one should also do so slowly and without making noise, and at the end of the bath, sit squatting by the water's edge, wrap the lower robe around, stand up, put on the lower robe neatly, tie the waist-band, and then stand with the outer robe put on.
Khi nổi lên cũng không gây tiếng động, từ từ nổi lên, sau khi tắm xong, ngồi xổm bên bờ nước, quấn y nội, đứng dậy, mặc y một cách ngay ngắn, thắt dây lưng, và chỉ nên đứng sau khi đã đắp y tăng-già-lê.
211
Theropi tathā nhāyitvā paccuttaritvā vigacchamānaudakaṃ kāyaṃ olokayamāno aṭṭhāsi.
The elder also bathed in this way, came out of the water, and stood watching his body as the water receded.
Vị Trưởng lão cũng đã tắm như vậy, rồi bước ra khỏi nước, đứng nhìn thân thể khô dần.
Tassa pakatiyāpi pāsādikassa paccūsasamaye sammā pariṇatāhārassa uṇhodakena nhātassa ativiya mukhavaṇṇo viroci, bandhanā pavuttatālaphalaṃ viya pabhāsampanno puṇṇacando viya taṅkhaṇavikasitapadumaṃ viya mukhaṃ sassirikaṃ ahosi, sarīravaṇṇopi vippasīdi.
His naturally pleasing countenance, after a proper meal in the early morning and a bath with hot water, shone exceedingly. His face was radiant, like a lustrous fully-risen moon, or a freshly bloomed lotus that had burst from its sheath, and his body's complexion also brightened.
Vốn dĩ Ngài đã có vẻ ngoài đoan trang, vào lúc rạng đông, sau khi đã tiêu hóa tốt thức ăn và tắm nước ấm, sắc mặt Ngài càng rạng rỡ hơn; khuôn mặt Ngài trở nên tươi tắn như một quả cau vừa rụng khỏi cuống, rạng ngời như trăng tròn, như hoa sen vừa nở, và sắc thân Ngài cũng trở nên trong sáng.
Tasmiṃ samaye vanasaṇḍe adhivatthā bhummadevatā pāsādikaṃ bhikkhuṃ olokayamānā samanaṃ niggahetuṃ asakkontī kāmapariḷāhābhibhūtā hutvā, ‘‘theraṃ palobhessāmī’’ti attabhāvaṃ uḷārena alaṅkārena alaṅkaritvā sahassavaṭṭipadīpaṃ pajjalamānā viya candaṃ uṭṭhāpayamānā viya sakalārāmaṃ ekobhāsaṃ katvā theraṃ upasaṅkamitvā avanditvāva vehāse ṭhitā gāthaṃ abhāsi.
At that time, a forest-dwelling earth devatā, looking at the pleasing bhikkhu, and being unable to subdue the recluse, became overcome by the burning of sensual desire, and thinking, "I will entice the elder," adorned herself with splendid ornaments, and like a lamp with a thousand wicks, or like raising the moon, she illuminated the entire monastery, approached the elder, and without venerating him, stood in the air and spoke a stanza.
Vào lúc đó, một vị địa thiên nữ sống trong khu rừng, nhìn thấy vị Tỷ-kheo đoan trang, không thể chế ngự được mình, bị dục vọng thiêu đốt, bèn nghĩ: “Ta sẽ cám dỗ vị Trưởng lão này.” Vị ấy trang điểm thân mình bằng những đồ trang sức lộng lẫy, như ngọn đèn ngàn bấc đang cháy sáng, như mặt trăng đang mọc, làm cho cả khu rừng sáng rực, rồi đến gần vị Trưởng lão, không đảnh lễ mà đứng trên không trung và nói lên bài kệ.
Tena vuttaṃ – ‘‘atha kho aññatarā devatā…pe… ajjhabhāsī’’ti.
Therefore, it is said: "Then a certain devatā…pe… addressed him."
Do đó, đã nói: “Rồi một vị thiên nữ… và… đã nói.”
212
Abhutvāti pañca kāmaguṇe aparibhuñjitvā.
Abhutvā means without enjoying the five sense pleasures.
Abhutvā có nghĩa là không thọ hưởng năm dục lạc.
Bhikkhasīti piṇḍāya carasi.
Bhikkhasī means you wander for alms.
Bhikkhasī có nghĩa là đi khất thực.
Mā taṃ kālo upaccagāti ettha kālo nāma pañcakāmaguṇapaṭisevanakkhamo daharayobbanakālo.
Regarding the phrase, " Mā taṃ kālo upaccagā," the word kālo refers to the time of youthful vigor, which is suitable for enjoying the five sense pleasures.
Ở đây, cụm từ mā taṃ kālo upaccagā có nghĩa là thời gian, tức là thời tuổi trẻ sung mãn, có thể thọ hưởng năm dục lạc.
Jarājiṇṇena hi obhaggena daṇḍaparāyaṇena pavedhamānena kāsasāsābhibhūtena na sakkā kāme paribhuñjituṃ.
Indeed, one who is old and decrepit, bent, dependent on a staff, trembling, and afflicted by cough and asthma, cannot enjoy sense pleasures.
Thật vậy, khi đã già nua, lưng còng, phải nương tựa vào gậy, run rẩy, bị ho hen và khó thở hành hạ, thì không thể thọ hưởng dục lạc được.
Iti imaṃ kālaṃ sandhāya devatā ‘‘mā taṃ kālo upaccagā’’ti āha.
It is with this time in mind that the deity said, "May this time not pass you by."
Vì vậy, vị devatā đã nói câu này, ám chỉ thời gian đó: “Thời gian đừng vượt qua ngươi.”
Tattha mā upaccagāti mā atikkami.
There, mā upaccagā means may it not pass by.
Trong đó, mā upaccagā có nghĩa là đừng vượt qua.
213
Kālaṃ vohaṃ na jānāmīti ettha voti nipātamattaṃ.
Regarding the phrase, " Kālaṃ vohaṃ na jānāmi," vo is merely a particle.
Ở đây, cụm từ Kālaṃ vohaṃ na jānāmi, vo chỉ là một tiểu từ.
Kālaṃ na jānāmīti maraṇakālaṃ sandhāya vadati.
" Kālaṃ na jānāmi" refers to the time of death.
Kālaṃ na jānāmi có nghĩa là không biết thời điểm chết.
Sattānañhi –
Indeed, for beings—
Thật vậy, đối với chúng sinh –
214
‘‘Jīvitaṃ byādhi kālo ca, dehanikkhepanaṃ gati;
“Life, illness, time, the laying down of the body, and destiny;
“Tuổi thọ, bệnh tật, thời gian,
215
Pañcete jīvalokasmiṃ, animittā na nāyare’’.
These five in the world of living beings are without sign and unknown.”
Nơi thân thể bị vứt bỏ, và cõi tái sinh;
216
Tattha jīvitaṃ tāva ‘‘ettakameva, na ito para’’nti vavatthānābhāvato animittaṃ.
First, life is without sign, because there is no definite demarcation like "only this long, not beyond this."
Năm điều này trong thế gian chúng sinh, không có dấu hiệu, không thể biết trước.”
Kalalakālepi hi sattā maranti, abbuda-pesi-ghana-aḍḍhamāsa-ekamāsa-dvemāsa-temāsa-catumāsapañcamāsa…pe… dasamāsakālepi, kucchito nikkhantasamayepi, tato paraṃ vassasatassa antopi bahipi marantiyeva.
Indeed, beings die even in the kalala (fluid) stage, and in the abbuda (gelatinous), pesi (flesh), ghana (solid) stages, at one and a half months, one month, two months, three months, four months, five months… up to ten months, even at the time of emerging from the womb, and beyond that, within or outside of a hundred years, they still die.
Trong đó, jīvitaṃ (tuổi thọ) là vô tướng vì không có giới hạn “chỉ đến đây, không hơn nữa”. Thật vậy, chúng sinh chết ngay cả khi còn là hợp chất (kalala), khi là bọt (abbuda), khi là thịt (pesi), khi là khối cứng (ghana), khi được nửa tháng, một tháng, hai tháng, ba tháng, bốn tháng, năm tháng... cho đến mười tháng, ngay cả khi vừa ra khỏi bụng mẹ, và sau đó trong vòng một trăm năm hoặc hơn nữa, họ vẫn chết.
Byādhipi ‘‘imināva byādhinā sattā maranti, na aññenā’’ti vavatthānābhāvato animitto.
Illness is also without sign, because there is no definite demarcation like "beings die only from this illness, not from another."
Byādhi (bệnh tật) cũng là vô tướng vì không có giới hạn “chúng sinh chết vì bệnh này chứ không phải bệnh khác”.
Cakkhurogenapi hi sattā maranti sotarogādīnaṃ aññatarenapi.
Indeed, beings die even from eye diseases, or from any other ailment like ear diseases and so on.
Thật vậy, chúng sinh chết vì bệnh mắt hoặc bất kỳ bệnh nào khác như bệnh tai, v.v.
Kālopi, ‘‘imasmiṃ yeva kāle maritabbaṃ, na aññasmi’’nti evaṃ vavatthānābhāvato animitto.
Time is also without sign, because there is no definite demarcation like "one must die only at this time, not at another."
Kālo (thời gian) cũng là vô tướng vì không có giới hạn “phải chết vào thời điểm này chứ không phải thời điểm khác”.
Pubbaṇhepi hi sattā maranti majjhanhikādīnaṃ aññatarasmimpi.
Indeed, beings die even in the forenoon, or at any other time like midday and so on.
Thật vậy, chúng sinh chết vào buổi sáng hoặc vào bất kỳ thời điểm nào khác như buổi trưa, v.v.
Dehanikkhepanampi, ‘‘idheva mīyamānānaṃ dehena patitabbaṃ, na aññatthā’’ti evaṃ vavatthānābhāvato animittaṃ.
The laying down of the body is also without sign, because there is no definite demarcation like "the body of those dying must fall only here, not elsewhere."
Dehanikkhepana (nơi thân thể bị vứt bỏ) cũng là vô tướng vì không có giới hạn “khi chết, thân thể phải rơi ở đây chứ không phải ở nơi khác”.
Antogāme jātānañhi bahigāmepi attabhāvo patati, bahigāmepi jātānaṃ antogāmepi.
Indeed, for those born inside a village, their body may fall outside the village; and for those born outside a village, their body may fall inside the village.
Thật vậy, những người sinh ra trong làng cũng có thể chết bên ngoài làng, và những người sinh ra bên ngoài làng cũng có thể chết trong làng.
Tathā thalajānaṃ jale, jalajānaṃ thaleti anekappakārato vitthāretabbaṃ.
Similarly, for those born on land, in water; for those born in water, on land; this should be elaborated in many ways.
Tương tự, những sinh vật trên cạn chết dưới nước, những sinh vật dưới nước chết trên cạn, v.v., cần được giải thích theo nhiều cách khác nhau.
Gatipi, ‘‘ito cutena idha nibbattitabba’’nti evaṃ vavatthānābhāvato animittā.
Destiny is also without sign, because there is no definite demarcation like "having passed away from here, one must be reborn there."
Gati (cõi tái sinh) cũng là vô tướng vì không có giới hạn “sau khi chết ở đây, phải tái sinh ở đây”.
Devalokato hi cutā manussesupi nibbattanti, manussalokato cutā devalokādīnaṃ yattha katthaci nibbattantīti evaṃ yante yuttagoṇo viya gatipañcake loko samparivattati.
Indeed, those who pass away from the deva world are reborn among humans; those who pass away from the human world are reborn anywhere among the deva worlds and so on; thus, the world revolves in the five destinies like an ox yoked to a mill.
Thật vậy, chúng sinh sau khi chết từ cõi trời cũng tái sinh làm người, và sau khi chết từ cõi người cũng tái sinh ở bất cứ đâu trong các cõi trời, v.v., như một con bò được buộc vào cỗ xe, thế gian xoay vần trong năm cõi tái sinh.
Tassevaṃ samparivattato ‘‘imasmiṃ nāma kāle maraṇaṃ bhavissatī’’ti imaṃ maraṇassa kālaṃ vohaṃ na jānāmi.
Because it revolves in this way, I do not know this time of death, when death will occur.
Khi thế gian xoay vần như vậy, tôi không biết thời điểm chết này, tức là “cái chết sẽ xảy ra vào thời điểm nào”.
217
Channo kālo na dissatīti ayaṃ kālo mayhaṃ paṭicchanno avibhūto na paññāyati.
" Channo kālo na dissatī" means this time is hidden from me, not manifest, not discernible.
Channo kālo na dissatī có nghĩa là thời điểm này đối với tôi bị che khuất, không rõ ràng, không thể nhận biết.
Tasmāti yasmā ayaṃ kālo paṭicchanno na paññāyati, tasmā pañca kāmaguṇe abhutvāva bhikkhāmi.
Tasmā means, because this time is hidden and not discernible, therefore I wander for alms without enjoying the five sense pleasures.
Tasmā có nghĩa là vì thời điểm này bị che khuất và không thể nhận biết, nên tôi đi khất thực mà không thọ hưởng năm dục lạc.
Mā maṃ kālo upaccagāti ettha samaṇadhammakaraṇakālaṃ sandhāya ‘‘kālo’’ti āha.
In the phrase, " Mā maṃ kālo upaccagā," kālo refers to the time for practicing the ascetic life (samaṇadhamma).
Trong đó, cụm từ mā maṃ kālo upaccagā, “kālo” (thời gian) ám chỉ thời điểm thực hành pháp Sa-môn.
Ayañhi samaṇadhammo nāma pacchime kāle tisso vayosīmā atikkantena obhaggena daṇḍaparāyaṇena pavedhamānena kāsasāsābhibhūtena na sakkā kātuṃ.
Indeed, this samaṇadhamma cannot be practiced in old age, when one has passed beyond the three stages of life, is bent, dependent on a staff, trembling, and afflicted by cough and asthma.
Thật vậy, pháp Sa-môn này không thể thực hành được khi đã ở tuổi xế chiều, vượt qua ba giai đoạn của tuổi thọ, lưng còng, phải nương tựa vào gậy, run rẩy, bị ho hen và khó thở hành hạ.
Tadā hi na sakkā hoti icchiticchitaṃ buddhavacanaṃ vā gaṇhituṃ, dhutaṅgaṃ vā paribhuñjituṃ, araññavāsaṃ vā vasituṃ, icchiticchitakkhaṇe samāpattiṃ vā samāpajjituṃ, padabhāṇa-sarabhaññadhammakathā-anumodanādīni vā kātuṃ, taruṇayobbanakāle panetaṃ sabbaṃ sakkā kātunti ayaṃ samaṇadhammakaraṇassa kālo mā maṃ upaccagā, yāva maṃ nātikkamati, tāva kāme abhutvāva samaṇadhammaṃ karomīti āha.
For then it is not possible to learn as much of the Buddha's words as one desires, nor to observe the dhutaṅgas, nor to dwell in the forest, nor to enter into samāpatti at will, nor to perform recitations (padabhāṇa), melodious chanting (sarabhañña), Dhamma talks, or rejoice at merits. But all this is possible in youthful vigor. Therefore, he said, "May this time for practicing the samaṇadhamma not pass me by; as long as it has not passed me by, I will practice the samaṇadhamma without enjoying sense pleasures."
Vì lúc đó không thể học được những lời Phật dạy mong muốn, không thể thực hành các pháp đầu đà (dhutaṅga), không thể sống trong rừng, không thể nhập định vào thời điểm mong muốn, cũng không thể thực hiện các bài tụng (padabhāṇa), tụng thơ (sarabhañña), thuyết pháp (dhammakathā), tùy hỷ (anumodanā), v.v. Nhưng tất cả những điều này đều có thể thực hiện được khi còn trẻ và sung sức. Vì vậy, vị Tỳ-kheo nói rằng: “Thời điểm thực hành pháp Sa-môn này đừng vượt qua tôi; chừng nào nó chưa vượt qua tôi, tôi sẽ thực hành pháp Sa-môn mà không thọ hưởng dục lạc.”
218
Pathaviyaṃ patiṭṭhahitvāti sā kira devatā – ‘‘ayaṃ bhikkhu samaṇadhammakaraṇassa kālaṃ nāma katheti, akālaṃ nāma katheti, sahetukaṃ katheti sānisaṃsa’’nti ettāvatāva there lajjaṃ paccupaṭṭhāpetvā mahābrahmaṃ viya aggikkhandhaṃ viya ca naṃ maññamānā gāravajātā ākāsā oruyha pathaviyaṃ aṭṭhāsi, taṃ sandhāyetaṃ vuttaṃ.
" Pathaviyaṃ patiṭṭhahitvā" means that deity, having realized that "this bhikkhu speaks of the proper time for practicing samaṇadhamma, and of the improper time, speaks with reason and with benefit," and having thus caused shame to arise in the Elder, descended from the sky and stood on the ground, revering him as if he were a Mahābrahmā or a blazing fire, referring to which this was said.
Pathaviyaṃ patiṭṭhahitvā (đứng trên mặt đất) có nghĩa là vị devatā đó, sau khi khiến vị Trưởng lão cảm thấy hổ thẹn bằng lời nói “Vị Tỳ-kheo này nói về thời điểm thực hành pháp Sa-môn, nói về thời điểm không thực hành, nói về nguyên nhân và lợi ích”, đã coi vị Trưởng lão như Đại Phạm Thiên hay một khối lửa, và với lòng tôn kính, đã từ trên không trung hạ xuống đứng trên mặt đất. Lời này được nói để ám chỉ điều đó.
Kiñcāpi pathaviyaṃ ṭhitā, yena panatthena āgatā, punapi tameva gahetvā daharo tvantiādimāha.
Although she stood on the ground, she took up her original intention and spoke again, starting with, " Daharo tvaṃ" (You are young).
Mặc dù đã đứng trên mặt đất, nhưng vị ấy vẫn giữ nguyên ý định ban đầu và tiếp tục nói: daharo tvaṃ (ngươi còn trẻ), v.v.
Tattha susūti taruṇo.
There, susū means very young.
Trong đó, susū có nghĩa là trẻ trung.
Kāḷakesoti suṭṭhu kāḷakeso.
Kāḷakeso means with very black hair.
Kāḷakeso có nghĩa là tóc đen nhánh.
Bhadrenāti bhaddakena.
Bhadrenā means with a beautiful (youth).
Bhadrenā có nghĩa là tốt lành.
Ekacco hi daharopi samāno kāṇo vā hoti kuṇiādīnaṃ vā aññataro, so bhadrena yobbanena samannāgato nāma na hoti.
For some, even though young, may be blind or afflicted by some other disability like a hunchback; such a one is not endowed with beautiful youth.
Thật vậy, có người dù còn trẻ nhưng lại bị mù hoặc bị tật nguyền, v.v., người đó không được xem là có tuổi trẻ tốt lành.
Yo pana abhirūpo hoti dassanīyo pāsādiko sabbasampattisampanno, yaṃ yadeva alaṅkāraparihāraṃ icchati, tena tena alaṅkato devaputto viya carati, ayaṃ bhadrena yobbanena samannāgato nāma hoti.
But one who is handsome, delightful, pleasing, endowed with all perfections, and adorns themselves as they wish with various ornaments and embellishments, walking like a divine prince, such a one is said to be endowed with beautiful youth.
Nhưng người nào có hình dáng đẹp đẽ, đáng chiêm ngưỡng, dễ thương, đầy đủ mọi phước lành, và muốn trang sức hay chăm sóc bản thân thế nào cũng được, trang điểm như một vị thiên tử, người đó được xem là có tuổi trẻ tốt lành.
Thero ca uttamarūpasampanno, tena naṃ evamāha.
The Elder was endowed with supreme beauty, therefore she spoke to him thus.
Vị Trưởng lão có hình dáng tối thượng, vì vậy vị devatā đã nói với ngài như vậy.
219
Anikkīḷitāvī kāmesūti kāmesu akīḷitakīḷo abhuttāvī, akatakāmakīḷoti attho.
" Anikkīḷitāvī kāmesū" means one who has not played in sense pleasures, has not experienced them, has not engaged in sensual play; this is the meaning.
Anikkīḷitāvī kāmesu có nghĩa là chưa từng vui đùa trong dục lạc, chưa từng thọ hưởng, chưa từng thực hiện trò chơi dục lạc.
Mā sandiṭṭhikaṃ hitvāti yebhuyyena hi tā adiṭṭhasaccā avītarāgā aparacittavidūniyo devatā bhikkhū dasapi vassāni vīsatimpi…pe… saṭṭhimpi vassāni parisuddhaṃ akhaṇḍaṃ brahmacariyaṃ caramāne disvā – ‘‘ime bhikkhū mānusake pañca kāmaguṇe pahāya dibbe kāme patthayantā samaṇadhammaṃ karontī’’ti saññaṃ uppādenti, ayampi tattheva uppādesi.
" Mā sandiṭṭhikaṃ hitvā" means that mostly these deities, who have not realized the truths, are not free from craving, and do not know the minds of others, when they see bhikkhus practicing the pure, unbroken holy life for ten, twenty... even sixty years, they generate the perception that "these bhikkhus abandon human sense pleasures, desiring divine pleasures, and thus practice the samaṇadhamma." This deity also generated the same perception.
Mā sandiṭṭhikaṃ hitvā (Đừng từ bỏ cái hiện tại) – Thật vậy, hầu hết các vị devatā chưa thấy chân lý, chưa thoát ly tham ái, và không biết tâm người khác, khi thấy các Tỳ-kheo thực hành Phạm hạnh thanh tịnh, không gián đoạn trong mười năm, hai mươi năm... cho đến sáu mươi năm, họ nghĩ rằng: “Các Tỳ-kheo này từ bỏ năm dục lạc của loài người, mong cầu dục lạc của chư thiên mà thực hành pháp Sa-môn.” Vị devatā này cũng nảy sinh suy nghĩ tương tự.
Tasmā mānusake kāme sandiṭṭhike, dibbe ca kālike katvā evamāha.
Therefore, making human pleasures "directly visible" (sandiṭṭhika) and divine pleasures "temporal" (kālika), she spoke thus.
Vì vậy, vị ấy coi dục lạc của loài người là sandiṭṭhika (hiện tại) và dục lạc của chư thiên là kālika (tương lai), rồi nói như vậy.
220
Na kho ahaṃ, āvusoti, āvuso, ahaṃ sandiṭṭhike kāme hitvā kālike kāme na anudhāvāmi na patthemi na pihemi.
" Na kho ahaṃ, āvuso" means, friend, I do not pursue, do not desire, do not long for temporal pleasures, having abandoned directly visible pleasures.
Na kho ahaṃ, āvuso (Này hiền giả, tôi không) – Này hiền giả, tôi không từ bỏ dục lạc hiện tại để theo đuổi, mong cầu hay yêu thích dục lạc tương lai.
Kalikañca kho ahaṃ, āvusoti ahaṃ kho, āvuso, kālikaṃ kāmaṃ hitvā sandiṭṭhikaṃ lokuttaradhammaṃ anudhāvāmi.
" Kalikañca kho ahaṃ, āvuso" means, friend, having abandoned temporal pleasures, I pursue directly visible supramundane Dhamma.
Kalikañca kho ahaṃ, āvuso (Này hiền giả, tôi từ bỏ cái tương lai) – Này hiền giả, tôi từ bỏ dục lạc tương lai để theo đuổi pháp siêu thế hiện tại.
Iti thero cittānantaraṃ aladdhabbatāya dibbepi mānusakepi pañca kāmaguṇe kālikāti akāsi, cittānantaraṃ laddhabbatāya lokuttaradhammaṃ sandiṭṭhikanti.
Thus, the Elder referred to both divine and human sense pleasures as " kālikā" (temporal) due to their not being attainable immediately after a thought, and the supramundane Dhamma as " sandiṭṭhika" (directly visible) due to its attainability immediately after a thought.
Như vậy, vị Trưởng lão đã gọi năm dục lạc của cả cõi trời và cõi người là kālika (tương lai) vì chúng không thể đạt được ngay lập tức sau khi tâm mong muốn khởi lên, và gọi pháp siêu thế là sandiṭṭhika (hiện tại) vì nó có thể đạt được ngay lập tức sau khi tâm mong muốn khởi lên.
Pañcakāmaguṇesu samohitesupi sampannakāmassāpi kāmino cittānantaraṃ icchiticchitārammaṇānubhavanaṃ na sampajjati.
Even for a person replete with sensual enjoyment, though sense pleasures may be accumulated, the experience of desired objects is not achieved immediately after a thought.
Ngay cả khi năm dục lạc được hội tụ đầy đủ, một người khao khát dục lạc cũng không thể trải nghiệm đối tượng mong muốn ngay lập tức sau khi tâm khởi lên.
Cakkhudvāre iṭṭhārammaṇaṃ anubhavitukāmena hi cittakārapotthakārarūpakārādayo pakkosāpetvā, ‘‘idaṃ nāma sajjethā’’ti vattabbaṃ hoti.
Indeed, one who wishes to experience a desirable object through the eye-door must summon painters, sculptors, artisans, etc., and instruct them, "Prepare such and such a thing."
Thật vậy, một người muốn trải nghiệm đối tượng khả ái qua nhãn môn phải gọi thợ vẽ, thợ điêu khắc, thợ tạo hình, v.v., và nói: “Hãy sắp đặt điều này.”
Etthantare anekakoṭisatasahassāni cittāni uppajjitvā nirujjhanti.
In the meantime, hundreds of thousands of crores of thoughts arise and cease.
Trong khoảng thời gian đó, hàng trăm ngàn vạn tâm đã sinh khởi rồi diệt đi.
Atha pacchā taṃ ārammaṇaṃ sampāpuṇāti.
Then, only afterwards, does that object arrive.
Sau đó, đối tượng đó mới được đạt đến.
Sesadvāresupi eseva nayo.
The same method applies to the other doors (senses).
Đối với các môn khác cũng vậy.
Sotāpattimaggānantaraṃ pana sotāpattiphalameva uppajjati, antarā aññassa cittassa vāro natthi.
However, immediately after the path of stream-entry (sotāpattimagga), the fruit of stream-entry (sotāpattiphala) itself arises; there is no interval for any other thought.
Tuy nhiên, ngay sau Sơ đạo (Sotāpattimagga), Sơ quả (Sotāpattiphala) liền sinh khởi, không có tâm nào khác xen vào giữa.
Sesaphalesupi eseva nayoti.
The same method applies to the other fruits.
Đối với các quả vị còn lại cũng vậy. Đó là ý nghĩa.
221
So tamevatthaṃ gahetvā kālikā hi, āvusotiādimāha.
Taking this very meaning, he said, " Kālikā hi, āvuso," and so on.
Vị ấy đã nắm bắt ý nghĩa đó và nói: kālikā hi, āvuso, v.v.
Tattha kālikāti vuttanayena samohitasampattināpi kālantare pattabbā.
There, kālikā means attainable after a period of time, even for one with accumulated perfections, as explained.
Trong đó, kālikā (tương lai) có nghĩa là phải đạt được vào một thời điểm khác, ngay cả với sự hội tụ đầy đủ như đã nói.
Bahudukkhāti pañca kāmaguṇe nissāya pattabbadukkhassa bahutāya bahudukkhā.
Bahudukkhā means having much suffering, due to the abundance of suffering to be experienced dependent on the five sense pleasures.
Bahudukkhā (nhiều khổ đau) có nghĩa là nhiều khổ đau vì khổ đau phải chịu đựng do năm dục lạc là rất nhiều.
Taṃvatthukasseva upāyāsassa bahutāya bahupāyāsā.
The state of having many struggles (bahupāyāsā) because of the abundance of severe weariness, which has that same suffering as its basis.
Do sự phiền não (upāyāsa) có cùng một đối tượng (vatthu) ấy rất nhiều nên được gọi là nhiều phiền não (bahupāyāsā).
Ādīnavo ettha bhiyyoti pañca kāmaguṇe nissāya laddhabbasukhato ādīnavo bhiyyo, dukkhameva bahutaranti attho.
More disadvantage here means that the disadvantage is greater than the happiness to be gained by relying on the five sense pleasures, meaning that suffering is much more abundant.
Sự nguy hiểm ở đây nhiều hơn có nghĩa là: sự nguy hiểm nhiều hơn so với lạc thú có được nhờ nương tựa năm dục lạc, tức là khổ đau nhiều hơn.
Sandiṭṭhiko ayaṃ dhammoti ayaṃ lokuttaradhammo yena yena adhigato hoti, tena tena parasaddhāya gantabbataṃ hitvā paccavekkhaṇañāṇena sayaṃ daṭṭhabboti sandiṭṭhiko.
This Dhamma is directly visible (sandiṭṭhika) means that this supramundane Dhamma, by whomever it is attained, should be seen by that person himself with the knowledge of review (paccavekkhaṇañāṇa), abandoning the need to go by the faith of another. Hence, it is sandiṭṭhika.
Pháp này thiết thực hiện tại (sandiṭṭhiko ayaṃ dhammo) là: Pháp siêu thế này, do vị nào chứng đắc, vị ấy tự mình phải thấy bằng tuệ quán xét, bỏ qua việc phải đi theo niềm tin của người khác, nên gọi là thiết thực hiện tại (sandiṭṭhiko).
Attano phaladānaṃ sandhāya nāssa kāloti akālo, akāloyeva akāliko.
Regarding its fruit-giving, there is no time for it (nāssa kālo), thus it is timeless (akālo); this timelessness itself is immediate (akāliko).
Không có thời gian (kāla) để tự mình mang lại quả, nên không có thời gian, chính là không có thời gian (akāliko).
Yo ettha ariyamaggadhammo, so attano pavattisamanantarameva phalaṃ detīti attho.
The meaning is that the noble path Dhamma here yields its fruit immediately after its arising.
Pháp Thánh đạo ở đây, tức là tự nó mang lại quả ngay sau khi phát sinh.
‘‘Ehi passa imaṃ dhamma’’nti evaṃ pavattaṃ ehipassavidhiṃ arahatīti ehipassiko.
It is inviting to come and see (ehipassiko) because it is worthy of the "come and see this Dhamma" method of proclamation.
Nó xứng đáng với lời mời gọi “Hãy đến mà thấy pháp này” như vậy, nên gọi là đến để mà thấy (ehipassiko).
Ādittaṃ celaṃ vā sīsaṃ vā ajjhupekkhitvāpi bhāvanāvasena attano citte upanayaṃ arahatīti opaneyyiko.
It is leading inwards (opaneyyiko) because it is worthy of being brought into one's own mind through meditation, even after neglecting a burning cloth or a burning head.
Nó xứng đáng được đưa vào tâm mình bằng cách tu tập, thậm chí bỏ qua chiếc y đang cháy hoặc cái đầu đang cháy, nên gọi là có khả năng hướng thượng (opaneyyiko).
Sabbehi ugghaṭitaññūādīhi viññūhi ‘‘bhāvito me maggo, adhigataṃ phalaṃ, sacchikato nirodho’’ti attani attani veditabboti paccattaṃ veditabbo viññūhīti.
It is to be personally experienced by the wise (paccattaṃ veditabbo viññūhi), for all the wise, such as the ugghaṭitaññū, should know for themselves: "The path has been cultivated by me, the fruit has been attained, Nibbāna has been realized."
Tất cả những người trí, như bậc ugghaṭitaññū và những người khác, đều phải tự mình biết rằng: “Đạo đã được tôi tu tập, quả đã được tôi chứng đắc, Niết bàn đã được tôi thực chứng”, nên gọi là người trí tự mình chứng biết (paccattaṃ veditabbo viññūhī).
Ayamettha saṅkhepo, vitthāro pana visuddhimagge (visuddhi. 1.146 ādayo) dhammānussativaṇṇanāyaṃ vutto.
This is the brief explanation here; the detailed account is given in the description of Dhammānussati in the Visuddhimagga.
Đây là phần tóm tắt, còn phần chi tiết đã được trình bày trong phần giải thích về Tùy niệm Pháp (Dhammānussati) trong bộ Thanh Tịnh Đạo (Visuddhimagga).
222
Idāni sā devatā andho viya rūpavisesaṃ therena kathitassa atthe ajānantī kathañca bhikkhūtiādimāha.
Now, that deity, like a blind person unaware of special forms, not understanding the meaning of what the Elder had spoken, said: And how, bhikkhu? and so forth.
Bây giờ, vị thiên nữ ấy, giống như người mù không hiểu được ý nghĩa của những gì vị Trưởng lão đã nói về sự đặc biệt của sắc, đã nói câu “Bạch Tỳ-kheo, như thế nào…” và những câu tương tự.
Tattha kathañcātipadassa ‘‘kathañca bhikkhu kālikā kāmā vuttā bhagavatā, kathaṃ bahudukkhā, kathaṃ bahupāyāsā’’ti?
Here, the word kathañcāti (and how) should be understood as connected with all the words thus: "And how, bhikkhu, were sensual pleasures said by the Blessed One to be kālika, how to be full of suffering, how to be full of struggle?"
Trong đó, từ “kathañcā” phải được hiểu là: “Bạch Tỳ-kheo, Đức Thế Tôn đã nói các dục là kālika (có thời gian) như thế nào? Chúng nhiều khổ như thế nào? Chúng nhiều phiền não như thế nào?”
Evaṃ sabbapadehi sambandho veditabbo.
This connection should be understood with all the terms.
Như vậy, phải hiểu sự liên kết với tất cả các từ.
223
Navoti aparipuṇṇapañcavasso hi bhikkhu navo nāma hoti, pañcavassato paṭṭhāya majjhimo, dasavassato paṭṭhāya thero.
Navo (new) refers to a bhikkhu who has not completed five Vassas. One who has completed five Vassas onwards is called Majjhima, and one who has completed ten Vassas onwards is called Thera.
Tỳ-kheo mới (navo): Tỳ-kheo chưa đủ năm hạ là Tỳ-kheo mới (nava); từ năm hạ trở lên là trung niên (majjhima); từ mười hạ trở lên là Trưởng lão (thera).
Aparo nayo – aparipuṇṇadasavasso navo, dasavassato paṭṭhāya majjhimo, vīsativassato paṭṭhāya thero.
Another method: one who has not completed ten Vassas is new; from ten Vassas onwards, he is Majjhima; from twenty Vassas onwards, he is Thera.
Một cách khác: vị chưa đủ mười hạ là mới (nava); từ mười hạ trở lên là trung niên (majjhima); từ hai mươi hạ trở lên là Trưởng lão (thera).
Tesaṃ ahaṃ navoti vadati.
He says: "I am new among them."
Vị ấy nói: “Trong số đó, tôi là một Tỳ-kheo mới.”
224
Navopi ekacco sattaṭṭhavassakāle pabbajitvā dvādasaterasavassāni sāmaṇerabhāveneva atikkanto cirapabbajito hoti, ahaṃ pana acirapabbajitoti vadati.
Even a new bhikkhu, having gone forth at seven or eight years of age, and having spent twelve or thirteen years as a sāmaṇera, may be long-ordained. But I am not long-ordained, he says.
Một số Tỳ-kheo mới, dù xuất gia từ bảy, tám tuổi, nhưng đã trải qua mười hai, mười ba năm trong thân phận Sa-di, nên là người xuất gia lâu năm. Còn tôi thì mới xuất gia, vị ấy nói.
Imaṃ dhammavinayanti imaṃ dhammañca vinayañca.
This Dhamma-Vinaya means this Dhamma and this Vinaya.
Pháp và Luật này (imaṃ dhammavinayaṃ): Pháp này và Luật này.
Ubhayampetaṃ sāsanasseva nāmaṃ.
Both of these are names for the Dispensation itself.
Cả hai điều này đều là tên gọi của Giáo pháp.
Dhammena hettha dve piṭakāni vuttāni, vinayena vinayapiṭakaṃ, iti tīhi piṭakehi pakāsitaṃ paṭipattiṃ adhunā āgatomhīti vadati.
Here, Dhamma refers to the two Piṭakas, and Vinaya refers to the Vinaya Piṭaka. Thus, he says, "I have recently come to this practice (paṭipatti) proclaimed by the three Piṭakas."
Ở đây, Pháp (Dhamma) được nói đến là hai Tạng (Sutta và Abhidhamma), Luật (Vinaya) là Tạng Luật (Vinayapiṭaka). Như vậy, vị ấy nói: “Tôi mới đến với sự thực hành được công bố bởi ba Tạng.”
225
Mahesakkhāhīti mahāparivārāhi.
Mahesakkhāhi means with a large retinue.
Với các vị có uy lực lớn (mahesakkhāhi): Với các vị có nhiều tùy tùng.
Ekekassa hi devarañño koṭisatampi koṭisahassampi parivāro hoti, te attānaṃ mahante ṭhāne ṭhapetvā tathāgataṃ passanti.
Indeed, for each king of devas, there are hundreds of millions, or thousands of millions, of attendants; they, placing themselves in a great position, see the Tathāgata.
Thật vậy, mỗi vị thiên vương có đến hàng trăm triệu, hàng ngàn triệu tùy tùng. Họ đặt mình ở vị trí cao quý rồi đến yết kiến Đức Như Lai.
Tattha amhādisānaṃ appesakkhānaṃ mātugāmajātikānaṃ kuto okāsoti dasseti.
It shows that for those like us, who have little might and belong to the female gender, there is no opportunity.
Ở đây, vị ấy cho thấy: “Chúng tôi, những nữ nhân có uy lực nhỏ bé như thế này, làm sao có cơ hội?”
226
Mayampi āgaccheyyāmāti idaṃ sā devatā ‘‘sacepi cakkavāḷaṃ pūretvā parisā nisinnā hoti, mahatiyā buddhavīthiyā satthu santikaṃ gantuṃ labhatī’’ti ñatvā āha.
We too may come — this the deity said, knowing that "even if an assembly fills the cakkavāḷa, one can go to the Teacher by the great Buddha-path."
Vị thiên nữ ấy nói câu “Chúng tôi cũng sẽ đến (mayampi āgaccheyyāmā)” sau khi biết rằng: “Dù có một hội chúng đông kín cả thế giới, họ vẫn có thể đến gần Đức Phật bằng con đường Phật đạo rộng lớn.”
Puccha bhikkhu, puccha bhikkhūti thirakaraṇavasena āmeḍitaṃ kataṃ.
Ask, bhikkhu, ask, bhikkhu is a repetition made for emphasis.
“Hãy hỏi, Tỳ-kheo! Hãy hỏi, Tỳ-kheo!” là lời lặp lại nhằm củng cố.
227
Akkheyyasaññinoti ettha ‘‘devo, manusso, gahaṭṭho, pabbajito, satto, puggalo, tisso, phusso’’tiādinā nayena akkheyyato sabbesaṃ akkhānānaṃ sabbāsaṃ kathānaṃ vatthubhūtato pañcakkhandhā ‘‘akkheyyā’’ti vuccanti.
Here, in akkheyyasaññino (perceiving what can be expressed), the five aggregates are called "akkheyyā" (what can be expressed) because they are the basis for all designations and all talks, such as "deva, human, householder, renunciant, being, person, Tissa, Phussa," and so forth.
Trong từ “akkheyyasaññino” này, năm uẩn được gọi là “akkheyya” (đối tượng để gọi) vì chúng là đối tượng của tất cả các cách gọi, của tất cả các lời nói theo cách như: “chư thiên, loài người, gia chủ, xuất gia, chúng sanh, cá nhân, Tissa, Phussa,” v.v.
‘‘Satto naro poso puggalo itthī puriso’’ti evaṃ saññā etesaṃ atthīti saññino, akkheyyesveva saññinoti akkheyyasaññino, pañcasu khandhesu sattapuggalādisaññinoti attho.
They have the perception "being, man, person, individual, woman, man," and so forth; thus, they are saññino (perceiving). They are akkheyyasaññino (perceiving what can be expressed) because they perceive only in terms of what can be expressed, meaning they perceive beings, individuals, and so forth, in the five aggregates.
Họ có nhận thức (saññā) như “chúng sanh, người, cá nhân, đàn bà, đàn ông,” v.v., nên gọi là saññino (người có nhận thức); họ có nhận thức chỉ trong các akkheyya, nên gọi là akkheyyasaññino, nghĩa là họ có nhận thức về chúng sanh, cá nhân, v.v., trong năm uẩn.
Akkheyyasmiṃ patiṭṭhitāti pañcasu khandhesu aṭṭhahākārehi patiṭṭhitā.
Established in what can be expressed (akkheyyasmiṃ patiṭṭhitā) means established in the five aggregates by eight modes.
An trú trong akkheyya (akkheyyasmiṃ patiṭṭhitā): An trú trong năm uẩn bằng tám cách.
Ratto hi rāgavasena patiṭṭhito hoti, duṭṭho dosavasena, mūḷho mohavasena, parāmaṭṭho diṭṭhivasena, thāmagato anusayavasena, vinibaddho mānavasena, aniṭṭhaṅgato vicikicchāvasena, vikkhepagato uddhaccavasena patiṭṭhito hoti.
One who is infatuated (ratto) is established by way of passion (rāga); one who is malicious (duṭṭho) is established by way of hatred (dosa); one who is deluded (mūḷho) is established by way of delusion (moha); one who grasps (parāmaṭṭho) is established by way of wrong view (diṭṭhi); one who is firmly rooted (thāmagato) is established by way of underlying tendencies (anusaya); one who is bound (vinibaddho) is established by way of conceit (māna); one who is uncertain (aniṭṭhaṅgato) is established by way of doubt (vicikicchā); one who is distracted (vikkhepagato) is established by way of restlessness (uddhacca).
Thật vậy, người tham đắm an trú theo cách tham ái; người sân hận an trú theo cách sân hận; người si mê an trú theo cách si mê; người chấp thủ an trú theo cách tà kiến; người kiên cố an trú theo cách tùy miên; người bị trói buộc an trú theo cách mạn; người không quyết định an trú theo cách hoài nghi; người bị phóng dật an trú theo cách trạo cử.
Akkheyyaṃ apariññāyāti pañcakkhandhe tīhi pariññāhi aparijānitvā.
Not fully understanding what can be expressed (akkheyyaṃ apariññāyā) means not fully understanding the five aggregates through the three types of full understanding (pariññā).
Không liễu tri akkheyya (akkheyyaṃ apariññāyā): Không liễu tri năm uẩn bằng ba sự liễu tri.
Yogamāyanti maccunoti maccuno yogaṃ payogaṃ pakkhepaṃ upakkhepaṃ upakkamaṃ abbhantaraṃ āgacchanti, maraṇavasaṃ gacchantīti attho.
They approach the bond of death (yogamāyanti maccuno) means they enter into the use, application, imposition, successive imposition, and inner sphere of Death, meaning they fall under the power of death.
Đi đến sự trói buộc của tử thần (yogamāyanti maccuno): Nghĩa là họ đi đến sự trói buộc, sự áp dụng, sự ném vào, sự ném xuống, sự xâm nhập vào bên trong của tử thần; họ đi đến sự kiểm soát của cái chết.
Evamimāya gāthāya kālikā kāmā kathitā.
Thus, with this verse, kālika sensual pleasures are described.
Như vậy, bằng bài kệ này, các dục kālika đã được nói đến.
228
Pariññāyāti ñātapariññā, tīraṇapariññā, pahānapariññāti imāhi tīhi pariññāhi parijānitvā.
Pariññāyā means having fully understood through the three kinds of full understanding: full understanding by knowing (ñātapariññā), full understanding by scrutinizing (tīraṇapariññā), and full understanding by abandoning (pahānapariññā).
Liễu tri (pariññāyā): Liễu tri bằng sự biết rõ (ñātapariññā), sự thẩm định (tīraṇapariññā), và sự đoạn trừ (pahānapariññā) này.
Tattha katamā ñātapariññā? Pañcakkhandhe parijānāti – ‘‘ayaṃ rūpakkhandho, ayaṃ vedanākkhandho, ayaṃ saññākkhandho, ayaṃ saṅkhārakkhandho, ayaṃ viññāṇakkhandho, imāni tesaṃ lakkhaṇarasapaccupaṭṭhānapadaṭṭhānānī’’ti, ayaṃ ñātapariññā.
Among these, what is ñātapariññā? It is when one fully understands the five aggregates, saying, "This is the rūpakkhandha, this is the vedanākkhandha, this is the saññakkhandha, this is the saṅkhārakkhandha, this is the viññāṇakkhandha, and these are their characteristics, functions, manifestations, and proximate causes." This is ñātapariññā.
Trong đó, ñātapariññā là gì? Liễu tri năm uẩn rằng: “Đây là sắc uẩn, đây là thọ uẩn, đây là tưởng uẩn, đây là hành uẩn, đây là thức uẩn, đây là các đặc tính, chức năng, biểu hiện, và nguyên nhân gần của chúng.” Đây là ñātapariññā.
Katamā tīraṇapariññā? Evaṃ ñātaṃ katvā pañcakkhandhe tīreti aniccato dukkhato rogatoti dvācattālīsāya ākārehi.
What is tīraṇapariññā? It is when, having known the five aggregates in this way, one scrutinizes them in forty-two ways as impermanent, suffering, and diseased.
Tīraṇapariññā là gì? Sau khi biết rõ như vậy, vị ấy thẩm định năm uẩn bằng bốn mươi hai phương diện như vô thường, khổ, bệnh.
Ayaṃ tīraṇapariññā.
This is tīraṇapariññā.
Đây là tīraṇapariññā.
Katamā pahānapariññā? Evaṃ tīrayitvā aggamaggena pañcasu khandhesu chandarāgaṃ pajahati.
What is pahānapariññā? It is when, having scrutinized them in this way, one abandons sensual desire (chandarāga) for the five aggregates through the highest path.
Pahānapariññā là gì? Sau khi thẩm định như vậy, vị ấy đoạn trừ tham ái (chandarāga) trong năm uẩn bằng Thánh đạo cao nhất.
Ayaṃ pahānapariññā.
This is pahānapariññā.
Đây là pahānapariññā.
229
Akkhātāraṃ na maññatīti evaṃ tīhi pariññāhi pañcakkhandhe parijānitvā khīṇāsavo bhikkhu akkhātāraṃ puggalaṃ na maññati.
He does not conceive of the 'speaker' (akkhātāraṃ na maññati) means that a bhikkhu who has destroyed the asavas (khīṇāsava), having fully understood the five aggregates through these three kinds of full understanding, does not conceive of a 'person who can be spoken of'.
Không nhận thức về người được nói đến (akkhātāraṃ na maññatī): Vị Tỳ-kheo đã diệt tận các lậu hoặc (khīṇāsava), sau khi liễu tri năm uẩn bằng ba sự liễu tri như vậy, không nhận thức về người được nói đến.
Akkhātāranti kammavasena kāraṇaṃ veditabbaṃ, akkhātabbaṃ kathetabbaṃ puggalaṃ na maññati, na passatīti attho.
Akkhātāraṃ should be understood as the agent in the sense of action; it means he does not conceive of or see a person who can be spoken of or described.
Người được nói đến (akkhātāraṃ): Phải hiểu là nguyên nhân theo nghiệp; nghĩa là không nhận thức, không thấy người đáng được nói đến, đáng được kể đến.
Kinti akkhātabbanti?
How should one be spoken of?
Nói đến điều gì?
‘‘Tisso’’ti vā ‘‘phusso’’ti vā evaṃ yena kenaci nāmena vā gottena vā pakāsetabbaṃ.
One to be described by some name or clan, such as "Tissa" or "Phussa."
Được công bố bằng bất kỳ tên hay dòng họ nào như “Tissa” hay “Phussa” chẳng hạn.
Tañhi tassa na hotīti taṃ tassa khīṇāsavassa na hoti.
For that is not his (tañhi tassa na hotī) means that is not for that khīṇāsava.
Điều đó không thuộc về vị ấy (tañhi tassa na hotī): Điều đó không thuộc về vị Tỳ-kheo đã diệt tận các lậu hoặc.
Yena naṃ vajjāti yena naṃ ‘‘rāgena ratto’’ti vā ‘‘dosena duṭṭho’’ti vā ‘‘mohena mūḷho’’ti vāti koci vadeyya, taṃ kāraṇaṃ tassa khīṇāsavassa natthi.
By which one might name him (yena naṃ vajjā) means that there is no such cause for that khīṇāsava by which someone might say of him, "He is infatuated with passion," or "He is corrupted by hatred," or "He is deluded by delusion."
Bởi vì điều đó không thể được nói về vị ấy (yena naṃ vajjā): Nghĩa là không có nguyên nhân nào mà người ta có thể nói về vị Tỳ-kheo đã diệt tận các lậu hoặc đó rằng: “Vị ấy bị tham ái trói buộc,” hay “Vị ấy bị sân hận làm ô uế,” hay “Vị ấy bị si mê che lấp.”
230
Sace vijānāsi vadehīti sace evarūpaṃ khīṇāsavaṃ jānāsi, ‘‘jānāmī’’ti vadehi.
If you know, tell (sace vijānāsi vadehi) means if you know such a khīṇāsava, say, "I know."
Nếu bạn biết, hãy nói (sace vijānāsi vadehi): Nếu bạn biết một vị A-la-hán như vậy, hãy nói “Tôi biết.”
No ce jānāsi, atha ‘‘na jānāmī’’ti vadehi.
If you do not know, then say, "I do not know."
Nếu bạn không biết, thì hãy nói “Tôi không biết.”
Yakkhāti devataṃ ālapanto āha.
Yakkha he said, addressing the deity.
Hỡi Dạ-xoa (yakkhā): Vị ấy nói khi gọi thiên nữ.
Iti imāya gāthāya sandiṭṭhiko navavidho lokuttaradhammo kathito.
Thus, with this verse, the ninefold supramundane Dhamma, which is directly visible (sandiṭṭhika), is described.
Như vậy, bằng bài kệ này, chín loại pháp siêu thế thiết thực hiện tại đã được nói đến.
Sādhūti āyācanatthe nipāto.
Sādhu is a particle in the sense of a request.
Sādhu là một từ bất biến trong ý nghĩa cầu xin.
231
Yo maññatīti yo attānaṃ ‘‘ahaṃ samo’’ti vā ‘‘visesī’’ti vā ‘‘nihīno’’ti vā maññati.
He who conceives (yo maññati) means he who conceives himself to be "I am equal," or "superior," or "inferior."
Người nào nhận thức (yo maññatī): Người nào nhận thức mình là “bằng người khác” hay “hơn người khác” hay “thấp kém hơn người khác.”
Etena ‘‘seyyohamasmī’’tiādayo tayo mānā gahitāva.
By this, the three kinds of conceit, "I am superior," etc., are included.
Bằng cách này, ba loại kiêu mạn như “Tôi hơn người” đã được bao gồm.
Tesu gahitesu nava mānā gahitāva honti.
When these are included, the nine kinds of conceit are included.
Khi ba loại đó được bao gồm, chín loại kiêu mạn cũng được bao gồm.
So vivadetha tenāti so puggalo teneva mānena yena kenaci puggalena saddhiṃ – ‘‘kena maṃ tvaṃ pāpuṇāsi, kiṃ jātiyā pāpuṇāsi, udāhu gottena, kulapadesena, vaṇṇapokkharatāya, bāhusaccena, dhutaguṇenā’’ti evaṃ vivadeyya.
He would dispute with that (so vivadetha tenā) means that person, with that very conceit, would dispute with any person, saying, "How do you reach me? Do you reach me by birth, or by clan, by family origin, by complexion, by great learning, or by ascetic qualities (dhutaguṇa)?"
Người đó sẽ tranh cãi với điều đó (so vivadetha tenā): Người đó, với chính sự kiêu mạn ấy, sẽ tranh cãi với bất kỳ người nào rằng: “Ngươi đạt được ta bằng cách nào? Ngươi đạt được ta bằng chủng tộc ư, hay bằng dòng họ, bằng địa vị gia đình, bằng vẻ đẹp, bằng sự học rộng, hay bằng hạnh đầu đà?”
Iti imāyapi upaḍḍhagāthāya kālikā kāmā kathitā.
Thus, with this half-verse too, kālika sensual pleasures are described.
Như vậy, bằng nửa bài kệ này, các dục kālika cũng đã được nói đến.
232
Tīsu vidhāsūti tīsu mānesu.
In the three vidhās means in the three forms of conceit.
Tīsu vidhāsū có nghĩa là trong ba loại kiêu mạn.
‘‘Ekavidhena rūpasaṅgaho’’tiādīsu (dha. sa. 584) hi koṭṭhāso ‘‘vidho’’ti vutto.
Indeed, in passages like “the comprehension of material form by one vidhā (mode),” a component is called vidhā.
Trong các câu như “Ekavidhena rūpasaṅgaho” (Sự tập hợp sắc theo một cách), v.v., “vidho” được nói đến như một phần.
‘‘Kathaṃvidhaṃ sīlavantaṃ vadanti, kathaṃvidhaṃ paññavantaṃ vadantī’’tiādīsu (saṃ. ni. 1.95) ākāro.
In passages like “What kind of virtuous one do they call, what kind of wise one do they call?” it means an aspect.
Trong các câu như “Kathaṃvidhaṃ sīlavantaṃ vadanti, kathaṃvidhaṃ paññavantaṃ vadantī” (Họ nói người có giới là loại người như thế nào? Họ nói người có tuệ là loại người như thế nào?), v.v., nó có nghĩa là đặc tính.
‘‘Tisso imā, bhikkhave, vidhā.
“Bhikkhus, these are three vidhās.
“Này các Tỳ-khưu, có ba loại kiêu mạn này.
Katamā tisso?
Which three?
Thế nào là ba loại?
Seyyohamasmīti vidhā, sadisohamasmīti vidhā, hīnohamasmīti vidhā’’tiādīsu (saṃ. ni. 5.162) māno ‘‘vidhā’’ti vutto.
The vidhā ‘I am superior,’ the vidhā ‘I am equal,’ the vidhā ‘I am inferior’”—in these, māna (conceit) is called vidhā.
Kiêu mạn ‘Ta hơn’, kiêu mạn ‘Ta bằng’, kiêu mạn ‘Ta kém’”, v.v. trong các câu này, kiêu mạn được gọi là “vidhā”.
Idhāpi mānova.
Here too, it is just māna.
Ở đây cũng chính là kiêu mạn.
Tena vuttaṃ ‘‘tīsu vidhāsūti tīsu mānesū’’ti.
Therefore, it is said, “‘in the three vidhās’ means in the three forms of conceit.”
Vì thế đã nói “tīsu vidhāsūti tīsu mānesū” (tīsu vidhāsū có nghĩa là trong ba loại kiêu mạn).
Avikampamānoti so puggalo etesu saṅkhepato tīsu, vitthārato navasu mānesu na kampati, na calati.
Unshaken: that person is not agitated, not disturbed by these three forms of conceit in brief, or nine in detail.
Avikampamāno có nghĩa là người đó không run rẩy, không dao động trước ba loại kiêu mạn này (tóm tắt) và chín loại (chi tiết).
Samo visesīti na tassa hotīti tassa pahīnamānassa khīṇāsavassa ‘‘ahaṃ sadiso’’ti vā ‘‘seyyo’’ti vā ‘‘hīno’’ti vā na hotīti dasseti.
‘Equal, superior—these do not exist for him’: this shows that for that one whose conceit is abandoned, the arahat, there is no thought of “I am equal,” or “I am superior,” or “I am inferior.”
Samo visesīti na tassa hotī cho thấy rằng đối với bậc A-la-hán đã đoạn trừ kiêu mạn, không có ý niệm “ta bằng” hay “ta hơn” hay “ta kém”.
Pacchimapadaṃ vuttanayameva.
The latter clause is in accordance with the method stated before.
Vế sau cũng theo cách đã nói.
Iti imāyapi upaḍḍhagāthāya navavidho sandiṭṭhiko lokuttaradhammo kathito.
Thus, with this latter half of the verse too, the ninefold immediately visible supramundane Dhamma has been taught.
Như vậy, với nửa bài kệ này, Pháp siêu thế hiện tiền (sandiṭṭhika lokuttaradhamma) chín loại đã được thuyết giảng.
233
Pahāsi saṅkhanti, ‘‘paṭisaṅkhā yoniso āhāraṃ āhāretī’’tiādīsu (saṃ. ni. 4.120, 239) paññā ‘‘saṅkhā’’ti āgatā.
He abandoned reckoning: In passages like “having reflected wisely, he takes his food,” wisdom is referred to as saṅkhā.
Pahāsi saṅkha (đoạn trừ saṅkhā). Trong các câu như “paṭisaṅkhā yoniso āhāraṃ āhāretī” (sau khi quán xét kỹ lưỡng, thọ dụng vật thực), v.v., tuệ được gọi là “saṅkhā”.
‘‘Atthi te koci gaṇako vā muddiko vā saṅkhāyako vā, yo pahoti gaṅgāya vālukaṃ gaṇetu’’nti (saṃ. ni. 4.410) ettha gaṇanā.
In “Is there any calculator, counter, or reckoner of yours who is able to count the sands of the Ganges?” here it means calculation.
Ở đây, trong câu “Atthi te koci gaṇako vā muddiko vā saṅkhāyako vā, yo pahoti gaṅgāya vālukaṃ gaṇetuṃ” (Ngươi có người đếm, người tính, hay người tính toán nào có thể đếm cát sông Hằng không?), là sự đếm.
‘‘Saññānidānā hi papañcasaṅkhā’’tiādīsu (su. ni. 880) koṭṭhāso.
In passages like “For the proliferations of conceiving arise from perception,” it means a component.
Trong các câu như “Saññānidānā hi papañcasaṅkhā” (Vì các khái niệm về sự phóng dật có nguồn gốc từ tưởng), v.v., là một phần.
‘‘Yā tesaṃ tesaṃ dhammānaṃ saṅkhā samaññā’’ti (dha. sa. 1313-1315) ettha paṇṇatti ‘‘saṅkhā’’ti āgatā.
In “the designation, the appellation of those various phenomena,” here paññatti (concept) is referred to as saṅkhā.
Trong câu “Yā tesaṃ tesaṃ dhammānaṃ saṅkhā samaññā” (Cái được gọi là saṅkhā, samaññā của các pháp ấy), khái niệm được gọi là “saṅkhā”.
Idhāpi ayameva adhippetā.
Here, this very meaning is intended.
Ở đây, chính điều này được đề cập.
Pahāsi saṅkhanti padassa hi ayamevattho – ratto duṭṭho mūḷho iti imaṃ paṇṇattiṃ khīṇāsavo pahāsi jahi pajahīti.
Indeed, the meaning of the phrase He abandoned reckoning is this: the arahat has abandoned, given up, utterly relinquished this designation of being infatuated, hateful, or deluded.
Vì ý nghĩa của cụm từ pahāsi saṅkha chính là: bậc A-la-hán đã đoạn trừ, từ bỏ, hoàn toàn từ bỏ khái niệm “người tham ái, người sân hận, người si mê”.
234
Na vimānamajjhagāti navabhedaṃ tividhamānaṃ na upagato.
He did not arrive at a dwelling means he did not approach the ninefold, threefold conceit.
Na vimānamajjhagā có nghĩa là không đạt đến chín loại kiêu mạn, ba loại kiêu mạn.
Nivāsaṭṭhena vā mātukucchi ‘‘vimāna’’nti vuccati, taṃ āyatiṃ paṭisandhivasena na upagacchītipi attho.
Alternatively, the mother’s womb is called a “dwelling” by way of being a place of abode; the meaning is also that he will not approach it in the future by way of rebirth-linking.
Hoặc cũng có nghĩa là: bụng mẹ được gọi là “vimāna” theo nghĩa là nơi trú ngụ, và người đó sẽ không tái sinh vào đó trong tương lai.
Anāgatatthe atītavacanaṃ.
The past tense is used for a future meaning.
Động từ quá khứ được dùng cho ý nghĩa tương lai.
Acchecchīti chindi.
He cut off means he severed.
Acchecchī có nghĩa là đã cắt đứt.
Chinnaganthanti cattāro ganthe chinditvā ṭhitaṃ.
With ties severed means having severed the four ties.
Chinnagantha có nghĩa là đã cắt đứt bốn kiết sử.
Anīghanti niddukkhaṃ.
Unhindered means free from suffering.
Anīgha có nghĩa là không khổ đau.
Nirāsanti nittaṇhaṃ.
Without longing means free from craving.
Nirāsa có nghĩa là không tham ái.
Pariyesamānāti olokayamānā.
Searching means looking for.
Pariyesamānā có nghĩa là đang tìm kiếm.
Nājjhagamunti na adhigacchanti na vindanti na passanti.
They do not find means they do not attain, do not discover, do not see.
Nājjhagamu có nghĩa là không đạt được, không tìm thấy, không nhìn thấy.
Vattamānatthe atītavacanaṃ.
The past tense is used for a present meaning.
Động từ quá khứ được dùng cho ý nghĩa hiện tại.
Idha vā huraṃ vāti idhaloke vā paraloke vā.
Here or beyond means in this world or in the next world.
Idha vā huraṃ vā có nghĩa là ở đời này hay ở đời sau.
Sabbanivesanesūti tayo bhavā, catasso yoniyo, pañca gatiyo, satta viññāṇaṭṭhitiyo, nava sattāvāsā, iti imesupi sabbesu sattanivesanesu evarūpaṃ khīṇāsavaṃ kāyassa bhedā uppajjamānaṃ vā uppannaṃ vā na passantīti attho.
In all abodes means the three existences, the four kinds of birth, the five destinies, the seven stations of consciousness, the nine abodes of beings—in all these abodes of beings, they do not see an arahat of such a nature either arising after the breaking up of the body or already arisen.
Sabbanivesanesū có nghĩa là ở tất cả các nơi cư ngụ của chúng sinh này – ba cõi, bốn loài sinh, năm nẻo luân hồi, bảy trú xứ của thức, chín trú xứ của chúng sinh – họ không nhìn thấy một bậc A-la-hán như vậy đang sinh ra hay đã sinh ra sau khi thân hoại mạng chung.
Imāya gāthāya sandiṭṭhikaṃ lokuttaradhammameva kathesi.
With this verse, too, the immediately visible supramundane Dhamma has been taught.
Với bài kệ này, Ngài đã thuyết giảng về Pháp siêu thế hiện tiền (sandiṭṭhika lokuttaradhamma).
235
Imañca gāthaṃ sutvā sāpi devatā atthaṃ sallakkhesi, teneva kāraṇena imassa khvāhaṃ, bhantetiādimāha.
Having heard this verse, that deity also apprehended its meaning, and for that very reason, she spoke the words beginning, “ I understand this, Venerable Sir.”
Vị thiên nhân đó sau khi nghe bài kệ này cũng đã hiểu ý nghĩa, chính vì lý do đó mà vị ấy đã nói “Imassa khvāhaṃ, bhante” (Bạch Thế Tôn, con đã hiểu điều này), v.v.
Tattha pāpaṃ na kayirāti gāthāya dasakusalakammapathavasenapi kathetuṃ vaṭṭati aṭṭhaṅgikamaggavasenapi.
In that, the verse “ One should do no evil” can be explained both in terms of the tenfold wholesome courses of action and in terms of the Noble Eightfold Path.
Trong đó, bài kệ Pāpaṃ na kayirā (không làm điều ác) có thể được giải thích theo mười thiện nghiệp đạo hoặc theo Bát Chánh Đạo.
Dasakusalakammapathavasena tāva vacasāti catubbidhaṃ vacīsucaritaṃ gahitaṃ.
First, in terms of the tenfold wholesome courses of action, by word includes the fourfold wholesome verbal conduct.
Trước hết, theo mười thiện nghiệp đạo, vacasā (bằng lời nói) bao gồm bốn loại thiện hạnh về lời nói.
Manasāti tividhaṃ manosucaritaṃ gahitaṃ.
By mind includes the threefold wholesome mental conduct.
Manasā (bằng ý) bao gồm ba loại thiện hạnh về ý.
Kāyena vā kiñcana sabbaloketi tividhaṃ kāyasucaritaṃ gahitaṃ.
Or by body anything in the whole world includes the threefold wholesome bodily conduct.
Kāyena vā kiñcana sabbaloke (bằng thân, bất cứ điều gì trên thế gian) bao gồm ba loại thiện hạnh về thân.
Ime tāva dasakusalakammapathadhammā honti.
These are, first, the Dhamma of the tenfold wholesome courses of action.
Đây là mười pháp thiện nghiệp đạo.
Kāme pahāyāti iminā pana kāmasukhallikānuyogo paṭikkhitto.
By the phrase abandoning sensual pleasures, however, the devotion to sensual pleasures is rejected.
Tuy nhiên, với câu Kāme pahāyā (đoạn trừ các dục), sự chấp trước vào lạc thú của dục đã bị bác bỏ.
Satimā sampajānoti iminā dasakusalakammapathakāraṇaṃ satisampajaññaṃ gahitaṃ.
By the phrase mindful and clearly comprehending, the mindfulness and clear comprehension that are the cause of the tenfold wholesome courses of action are included.
Với câu Satimā sampajāno (người có niệm và tỉnh giác), niệm và tỉnh giác là nguyên nhân của mười thiện nghiệp đạo đã được bao gồm.
Dukkhaṃ na sevetha anatthasaṃhitanti iminā attakilamathānuyogo paṭisiddho.
By the phrase he should not indulge in suffering that is associated with harm, the devotion to self-mortification is prohibited.
Với câu Dukkhaṃ na sevetha anatthasaṃhitaṃ (không nên theo đuổi khổ đau không lợi ích), sự chấp trước vào việc hành hạ bản thân đã bị bác bỏ.
Iti devatā ‘‘ubho ante vivajjetvā kāraṇehi satisampajaññehi saddhiṃ dasakusalakammapathadhamme tumhehi kathite ājānāmi bhagavā’’ti vadati.
Thus, the deity says, “Having avoided both extremes, I understand the tenfold wholesome courses of action taught by you, together with their causes, mindfulness and clear comprehension, O Blessed One.”
Như vậy, vị thiên nhân nói: “Bạch Thế Tôn, con đã hiểu mười pháp thiện nghiệp đạo mà Ngài đã thuyết giảng, cùng với niệm và tỉnh giác, sau khi tránh xa cả hai cực đoan”.
236
Aṭṭhaṅgikamaggavasena pana ayaṃ nayo – tasmiṃ kira ṭhāne mahatī dhammadesanā ahosi.
In terms of the Noble Eightfold Path, the method is as follows: It is said that a great Dhamma discourse took place at that time.
Tuy nhiên, theo Bát Chánh Đạo, cách giải thích như sau: Tại nơi đó, có một bài pháp rất lớn đã được thuyết giảng.
Desanāpariyosāne devatā yathāṭhāne ṭhitāva desanānusārena ñāṇaṃ pesetvā sotāpattiphale patiṭṭhāya attanā adhigataṃ aṭṭhaṅgikaṃ maggaṃ dassentī evamāha.
At the conclusion of the discourse, the deity, remaining in her place, applied her knowledge according to the discourse, became established in the fruit of stream-entry, and, revealing the Noble Eightfold Path she had attained, spoke thus.
Khi bài pháp kết thúc, vị thiên nhân vẫn đứng tại chỗ, quán chiếu bằng trí tuệ theo lời dạy, đạt được quả Tu-đà-hoàn, và sau đó đã nói bài kệ này để chỉ ra con đường tám chi phần mà mình đã chứng đắc.
Tattha vacasāti sammāvācā gahitā, mano pana aṅgaṃ na hotīti manasāti maggasampayuttakaṃ cittaṃ gahitaṃ.
There, by word includes right speech, but since mind is not a factor, by mind includes the consciousness associated with the path.
Trong đó, vacasā (bằng lời nói) bao gồm Chánh Ngữ, nhưng vì ý không phải là một chi phần, nên manasā (bằng ý) bao gồm tâm tương ưng với đạo.
Kāyena vā kiñcana sabbaloketi sammākammanto gahito, ājīvo pana vācākammantapakkhikattā gahitova hoti.
Or by body anything in the whole world includes right action, and right livelihood is also included because it belongs to the category of right speech and right action.
Kāyena vā kiñcana sabbaloke (bằng thân, bất cứ điều gì trên thế gian) bao gồm Chánh Nghiệp, và Chánh Mạng đã được bao gồm vì nó thuộc về Chánh Ngữ và Chánh Nghiệp.
Satimāti iminā vāyāmasatisamādhayo gahitā.
By the phrase mindful, right effort, right mindfulness, and right concentration are included.
Satimā (người có niệm) bao gồm Chánh Tinh Tấn, Chánh Niệm và Chánh Định.
Sampajānotipadena sammādiṭṭhisammāsaṅkappā.
By the word clearly comprehending, right view and right intention are included.
Với từ Sampajāno (tỉnh giác), Chánh Kiến và Chánh Tư Duy được bao gồm.
Kāme pahāya, dukkhaṃ na sevethātipadadvayena antadvayavajjanaṃ.
By the two phrases abandoning sensual pleasures and he should not indulge in suffering, the avoidance of the two extremes is included.
Hai cụm từ Kāme pahāya, dukkhaṃ na sevethā (đoạn trừ các dục, không nên theo đuổi khổ đau) bao gồm việc tránh xa hai cực đoan.
Iti ime dve ante anupagamma majjhimaṃ paṭipadaṃ tumhehi kathitaṃ, ājānāmi bhagavāti vatvā tathāgataṃ gandhamālādīhi pūjetvā padakkhiṇaṃ katvā pakkāmīti.
Thus, having said, “Having not approached these two extremes, I understand the Middle Path taught by you, O Blessed One,” she honored the Tathāgata with fragrances, garlands, and so forth, circumambulated him clockwise, and departed.
Như vậy, sau khi nói: “Bạch Thế Tôn, con đã hiểu Trung Đạo mà Ngài đã thuyết giảng, không theo đuổi hai cực đoan này”, vị ấy đã cúng dường Như Lai bằng hương hoa, v.v., đi nhiễu hữu và rời đi.
237
Samiddhisuttavaṇṇanā niṭṭhitā.
The commentary on the Samiddhi Sutta is finished.
Chú giải kinh Samiddhi đã hoàn tất.
238
Nandanavaggo dutiyo.
The Nandanavagga is the second.
Chương Nandanavagga thứ hai.
239

3. Sattivaggo

3. Sattivagga

3. Chương Sattivagga

240
1. Sattisuttavaṇṇanā
1. Commentary on the Satti Sutta
1. Chú giải kinh Satti
241
21. Sattivaggassa paṭhame sattiyāti desanāsīsametaṃ.
21. In the first sutta of the Sattivagga, by a spear is the heading of the discourse.
21. Trong kinh Satti đầu tiên của chương Sattivagga, sattiyā là tiêu đề của bài pháp.
Ekatokhārādinā satthenāti attho.
The meaning is by a weapon such as a one-edged knife.
Có nghĩa là bằng vũ khí có một lưỡi, v.v.
Omaṭṭhoti pahato.
Pierced means struck.
Omaṭṭho có nghĩa là bị đánh.
Cattāro hi pahārā omaṭṭho ummaṭṭho maṭṭho vimaṭṭhoti.
Indeed, there are four kinds of blows: omaṭṭha (struck down), ummaṭṭha (struck up), maṭṭha (pierced through), and vimaṭṭha (all other kinds of blows).
Có bốn loại đòn đánh: omaṭṭho, ummaṭṭho, maṭṭho, vimaṭṭho.
Tattha upari ṭhatvā adhomukhaṃ dinnapahāro omaṭṭho nāma; heṭṭhā ṭhatvā uddhaṃmukhaṃ dinno ummaṭṭho nāma; aggaḷasūci viya vinivijjhitvā gato maṭṭho nāma; seso sabbopi vimaṭṭho nāma.
Among these, a blow delivered downwards while standing above is called omaṭṭha; a blow delivered upwards while standing below is called ummaṭṭha; a blow that pierces through like a door bolt is called maṭṭha; and all other remaining blows are called vimaṭṭha.
Trong đó, đòn đánh từ trên xuống dưới được gọi là omaṭṭho; đòn đánh từ dưới lên trên được gọi là ummaṭṭho; đòn đánh xuyên qua như chốt cửa được gọi là maṭṭho; tất cả các loại còn lại được gọi là vimaṭṭho.
Imasmiṃ pana ṭhāne omaṭṭho gahito.
However, in this context, omaṭṭha is taken.
Tuy nhiên, ở đây, omaṭṭho được đề cập.
So hi sabbadāruṇo duruddharasallo duttikiccho antodoso antopubbalohitova hoti, pubbalohitaṃ anikkhamitvā vaṇamukhaṃ pariyonandhitvā tiṭṭhati.
For it is the most cruel, with a difficult-to-extract dart, hard to treat, full of internal pus and blood, where the pus and blood do not flow out but instead surround the mouth of the wound and remain.
Vì nó là loại tàn bạo nhất, có mũi tên khó rút, khó chữa trị, bên trong có mủ và máu, mủ và máu không chảy ra mà bịt kín miệng vết thương.
Pubbalohitaṃ niharitukāmehi mañcena saddhiṃ bandhitvā adhosiro kātabbo hoti, maraṇaṃ vā maraṇamattaṃ vā dukkhaṃ pāpuṇāti.
Those who wish to extract the pus and blood must be tied to a bed and held upside down; they experience either death or suffering akin to death.
Những người muốn lấy mủ và máu ra phải buộc người bệnh vào giường và để đầu chúc xuống, người đó sẽ phải chịu đau đớn đến chết hoặc gần chết.
Paribbajeti vihareyya.
He should wander means he should dwell.
Paribbaje có nghĩa là nên sống.
242
Imāya gāthāya kiṃ katheti?
What does this verse teach?
Bài kệ này nói gì?
Yathā sattiyā omaṭṭho puriso sallubbahana-vaṇatikicchanānaṃ atthāya vīriyaṃ ārabhati, payogaṃ karoti parakkamati.
Just as a man pierced by a spear exerts effort, applies himself, and strives for the sake of extracting the dart and treating the wound.
Như một người bị thương bởi mũi tên cố gắng, nỗ lực để rút mũi tên và chữa lành vết thương.
Yathā ca ḍayhamāno matthake ādittasīso tassa nibbāpanatthāya vīriyaṃ ārabhati, payogaṃ karoti parakkamati, evameva bhikkhu kāmarāgaṃ pahānāya sato appamatto hutvā vihareyya bhagavāti kathesi.
And just as one whose head is ablaze with fire exerts effort, applies himself, and strives to extinguish it, even so, O Blessed One, a bhikkhu should dwell mindfully and heedfully for the abandonment of sensual passion.
Và như một người bị cháy đầu cố gắng, nỗ lực để dập tắt lửa, cũng vậy, một Tỳ-khưu nên sống có niệm, không phóng dật để đoạn trừ dục ái, bạch Thế Tôn.
243
Atha bhagavā cintesi – imāya devatāya upamā tāva daḷhaṃ katvā ānītā, atthaṃ pana parittakaṃ gahetvā ṭhitā, punappunaṃ kathentīpi hesā kāmarāgassa vikkhambhanapahānameva katheyya.
Then the Blessed One thought: “This deity has presented a strong simile, but she has grasped only a small part of the meaning. Even if she were to speak again and again, she would only talk about suppressing and abandoning sensual passion.
Rồi Đức Thế Tôn suy nghĩ – ví dụ của vị thiên nữ này được đưa ra rất mạnh mẽ, nhưng ý nghĩa lại rất ít ỏi, dù có nói đi nói lại thì cũng chỉ nói về sự trấn áp và đoạn trừ dục ái mà thôi.
Yāva ca kāmarāgo maggena na samugghāṭiyati, tāva anubaddhova hoti.
And as long as sensual passion is not eradicated by the path, it remains persistent.”
Và chừng nào dục ái chưa được nhổ tận gốc bằng Đạo, chừng đó nó vẫn còn đeo bám.
Iti tameva opammaṃ gahetvā paṭhamamaggavasena desanaṃ vinivaṭṭetvā desento dutiyaṃ gāthamāha.
Thus, taking that same simile, and turning the teaching around according to the first path, he taught, uttering the second verse.
Như vậy, lấy chính ví dụ đó, và chuyển hướng bài thuyết pháp theo Đạo thứ nhất (Sơ Đạo), Ngài đã nói bài kệ thứ hai.
Tassattho purimānusāreneva veditabboti.
Its meaning should be understood in accordance with the preceding explanation.
Ý nghĩa của bài kệ đó cần được hiểu theo cách tương tự như bài trước.
Paṭhamaṃ.
First (sutta explanation is complete).
Thứ nhất.
244
2. Phusatisuttavaṇṇanā
2. The Commentary on the Phusati Sutta
2. Lời giải thích về Phusatisutta
245
22. Dutiye nāphusantaṃ phusatīti kammaṃ aphusantaṃ vipāko na phusati, kammameva vā aphusantaṃ kammaṃ na phusati.
22. In the second (sutta), regarding the statement "it does not befall one who does not touch," it means that the vipāka (result) does not befall one who has not touched kamma, or alternatively, kamma itself does not befall one who has not touched kamma.
22. Trong bài thứ hai, nāphusantaṃ phusatīti (điều không chạm thì không chạm tới) nghĩa là quả báo không chạm tới người không tạo nghiệp; hoặc nghiệp không chạm tới người không tạo nghiệp.
Kammañhi nākaroto kariyati.
For kamma is not done by one who does not act.
Quả thật, nghiệp không được tạo ra bởi người không hành động.
Phusantañca tato phuseti kammaṃ phusantaṃ vipāko phusati, kammameva vā phusati.
"And it befalls one who touches, from that" means that vipāka befalls one who has touched kamma, or alternatively, kamma itself befalls (them).
Phusantañca tato phuseti (điều chạm tới thì từ đó chạm tới) nghĩa là quả báo chạm tới người tạo nghiệp; hoặc chính nghiệp chạm tới (người tạo nghiệp).
Kammañhi karoto kariyati.
For kamma is done by one who acts.
Quả thật, nghiệp được tạo ra bởi người hành động.
Tasmā phusantaṃ phusati, appaduṭṭhapadosinanti yasmā na aphusantaṃ phusati, phusantañca phusati, ayaṃ kammavipākānaṃ dhammatā, tasmā yo ‘‘appaduṭṭhassa narassa dussati, suddhassa posassa anaṅgaṇassā’’ti evaṃ vutto appaduṭṭhapadosī puggalo, taṃ puggalaṃ kammaṃ phusantameva kammaṃ phusati, vipāko vā phusati.
"Therefore, it befalls one who touches, the one who offends the unoffending": Since it does not befall one who does not touch, and it befalls one who touches—this is the nature of kamma and its results—therefore, if a person, as stated, "offends a blameless person, a pure and stainless individual," it is that person (the offender) whom kamma, having touched (done by him), befalls, or whose vipāka befalls him.
Tasmā phusantaṃ phusati, appaduṭṭhapadosinanti (Vì vậy, điều chạm tới thì chạm tới, đối với người không làm hại mà lại bị hại) nghĩa là vì điều không chạm tới thì không chạm tới, còn điều chạm tới thì chạm tới—đây là bản chất của nghiệp và quả báo. Vì vậy, đối với người được gọi là appaduṭṭhapadosī (người không làm hại mà lại bị hại), như đã nói: “kẻ nào làm hại người không làm hại, người trong sạch không tì vết”, thì nghiệp chạm tới chính người đó khi người đó tạo nghiệp, hoặc quả báo chạm tới người đó.
So hi parassa upaghātaṃ kātuṃ sakkoti vā mā vā, attā panānena catūsu apāyesu ṭhapito nāma hoti.
For he may or may not be able to harm others, but he has certainly placed himself in the four miserable states (apāya).
Người đó có thể làm hại người khác hay không, nhưng chắc chắn người đó đã đặt mình vào bốn cõi khổ.
Tenāha bhagavā – ‘‘tameva bālaṃ pacceti pāpaṃ, sukhumo rajo paṭivātaṃva khitto’’ti.
Therefore, the Blessed One said: "Evil returns to that fool, like fine dust thrown against the wind."
Do đó, Đức Thế Tôn đã dạy: “Chính ác nghiệp đó quay trở lại kẻ ngu, như bụi mịn bị gió thổi ngược.”
Dutiyaṃ.
Second (sutta explanation is complete).
Thứ hai.
246
3. Jaṭāsuttavaṇṇanā
3. The Commentary on the Jaṭā Sutta
3. Lời giải thích về Jaṭāsutta
247
23. Tatiye antojaṭāti gāthāyaṃ jaṭāti taṇhāya jāliniyā adhivacanaṃ.
23. In the third (sutta), in the verse "Within is a tangle (antojaṭā)", the word jaṭā is a designation for craving, which is a network.
23. Trong bài thứ ba, trong bài kệ antojaṭāti, jaṭā là tên gọi của ái (taṇhā) như một lưới.
Sā hi rūpādīsu ārammaṇesu heṭṭhupariyavasena punappunaṃ uppajjanato saṃsibbanaṭṭhena veḷugumbādīnaṃ sākhājālasaṅkhātā jaṭā viyāti jaṭā.
For, because it arises repeatedly, upwards and downwards, in objects such as rūpa, and because it entwines, it is like the tangled branches of bamboo thickets and so on, hence it is called jaṭā (tangle).
Vì nó liên tục phát sinh trong các đối tượng như sắc (rūpa) theo cách lên xuống, nên nó được gọi là jaṭā, giống như một mạng lưới cành cây của bụi tre, v.v., do tính chất đan xen của nó.
Sā panesā sakaparikkhāraparaparikkhāresu sakaattabhāva-paraattabhāvesu ajjhattikāyatana-bāhirāyatanesu ca uppajjanato antojaṭā bahijaṭāti vuccati.
And this (craving) is called antojaṭā (internal tangle) and bahijaṭā (external tangle) because it arises in one's own requisites and others' requisites, in one's own being and others' beings, and in internal and external sense-bases.
Và vì nó phát sinh trong các vật sở hữu của mình và của người khác, trong tự thân và thân người khác, và trong các xứ nội và xứ ngoại, nên nó được gọi là antojaṭā bahijaṭā (mạng lưới bên trong, mạng lưới bên ngoài).
Tāya evaṃ uppajjamānāya jaṭāya jaṭitā pajā.
Due to that jaṭā thus arising, "the people are tangled by a tangle."
Với sự phát sinh như vậy của ái, jaṭāya jaṭitā pajā (chúng sinh bị mạng lưới ái trói buộc).
Yathā nāma veḷujaṭādīhi veḷuādayo, evaṃ tāya taṇhājaṭāya sabbāpi ayaṃ sattanikāyasaṅkhātā pajā jaṭitā vinaddhā, saṃsibbitāti attho.
Just as bamboo thickets and so on are tangled by bamboo tangles and so on, so too, all these beings, collectively known as people, are entangled and entwined by that tangle of craving. This is the meaning.
Cũng như bụi tre, v.v., bị trói buộc bởi mạng lưới tre, v.v., thì tất cả chúng sinh này, được gọi là quần chúng, đều bị trói buộc, bị đan xen bởi mạng lưới ái đó; đó là ý nghĩa.
Yasmā ca evaṃ jaṭitā, taṃ taṃ gotama pucchāmīti tasmā taṃ pucchāmi.
And because they are thus tangled, "I ask you, Gotama." Therefore, I ask you.
Và vì bị trói buộc như vậy, taṃ taṃ gotama pucchāmīti (vì vậy, này Gotama, tôi hỏi Ngài).
Gotamāti bhagavantaṃ gottena ālapati.
He addresses the Blessed One by his clan name, Gotama.
Gotamāti (Gotama) là gọi Đức Thế Tôn bằng họ.
Ko imaṃ vijaṭaye jaṭanti imaṃ evaṃ tedhātukaṃ jaṭetvā ṭhitaṃ jaṭaṃ ko vijaṭeyya, vijaṭetuṃ ko samatthoti pucchati.
"Who can untangle this tangle?" He asks, "Who can untangle this tangle that has entwined the three realms? Who is capable of untangling it?"
Ko imaṃ vijaṭaye jaṭanti (Ai có thể gỡ bỏ mạng lưới này?) là hỏi: Ai có thể gỡ bỏ mạng lưới này, thứ đã trói buộc ba cõi như vậy? Ai có khả năng gỡ bỏ nó?
248
Athassa bhagavā tamatthaṃ vissajjento sīle patiṭṭhāyātiādimāha.
Then, the Blessed One, explaining that meaning to him, uttered the statement beginning with "Established in virtue (sīle patiṭṭhāya)" and so on.
Sau đó, Đức Thế Tôn đã giải thích ý nghĩa đó, bắt đầu bằng sīle patiṭṭhāyāti (an trú trong giới).
Tattha sīle patiṭṭhāyāti catupārisuddhisīle ṭhatvā.
Therein, "Established in virtue" means standing firm in the four-fold purity of virtue.
Ở đây, sīle patiṭṭhāyāti nghĩa là an trú trong Tứ Thanh Tịnh Giới (catupārisuddhisīla).
Ettha ca bhagavā jaṭāvijaṭanaṃ pucchito sīlaṃ ārabhanto na ‘‘aññaṃ puṭṭho aññaṃ kathetī’’ti veditabbo.
Here, when the Blessed One, being asked about untangling the tangle, begins to speak of virtue, it should not be understood that "being asked one thing, he speaks of another."
Ở đây, khi được hỏi về việc gỡ bỏ mạng lưới ái, Đức Thế Tôn đã bắt đầu bằng giới, không nên hiểu rằng “Ngài được hỏi một điều lại nói một điều khác”.
Jaṭāvijaṭakassa hi patiṭṭhādassanatthamettha sīlaṃ kathitaṃ.
For here, virtue is spoken of to show the foundation for one who untangles the tangle.
Thật vậy, giới được nói ở đây để chỉ ra nền tảng cho người gỡ bỏ mạng lưới ái.
249
Naroti satto.
Naro (man) means a being.
Naroti (người) là chúng sinh.
Sapaññoti kammajatihetukapaṭisandhipaññāya paññavā.
Sapañño (wise) means possessed of wisdom, that is, the wisdom of rebirth conditioned by kamma.
Sapaññoti (có trí tuệ) là người có trí tuệ do nghiệp tái sinh có ba nhân (tihetuka-paṭisandhipaññā).
Cittaṃ paññañca bhāvayanti samādhiñceva vipassanañca bhāvayamāno.
Bhāvayaṃ cittañca paññañca (developing mind and wisdom) means cultivating both samādhi and vipassanā.
Cittaṃ paññañca bhāvayanti (tu tập tâm và tuệ) là tu tập cả định (samādhi) và tuệ quán (vipassanā).
Cittasīsena hettha aṭṭha samāpattiyo kathitā, paññānāmena vipassanā.
Here, the eight attainments are spoken of by the heading of citta, and vipassanā by the name of paññā.
Ở đây, tám thiền chứng (aṭṭha samāpattiyo) được nói đến dưới tên tâm (citta), và tuệ quán (vipassanā) dưới tên tuệ (paññā).
Ātāpīti vīriyavā.
Ātāpī (ardent) means diligent (vīriyavā).
Ātāpīti (tinh cần) là người có tinh tấn (vīriya).
Vīriyañhi kilesānaṃ ātāpanaparitāpanaṭṭhena ‘‘ātāpo’’ti vuccati, tadassa atthīti ātāpī.
For diligence is called "ātāpa" (ardor) because of its nature of burning up and consuming defilements; one who possesses that is ātāpī.
Tinh tấn (vīriya) được gọi là “ātāpo” vì nó có khả năng đốt cháy và làm phiền não các phiền não (kilesa); người có điều đó thì gọi là ātāpī.
Nipakoti nepakkaṃ vuccati paññā, tāya samannāgatoti attho.
Nipako (skillful) means paññā is called 'nepakka'; thus, it means endowed with that (wisdom).
Nipakoti (khôn ngoan) là paññā (trí tuệ) được gọi là nepakka (sự khôn ngoan); người có trí tuệ đó là ý nghĩa.
Iminā padena pārihāriyapaññaṃ dasseti.
By this word, pārihāriya-paññā (skillful wisdom for maintaining practice) is shown.
Với từ này, Ngài chỉ ra pārihāriyapaññā (trí tuệ quản lý).
Pārihāriyapaññā nāma ‘‘ayaṃ kālo uddesassa, ayaṃ kālo paripucchāyā’’tiādinā nayena sabbattha kārāpitā pariharitabbapaññā.
Pārihāriya-paññā is the wisdom that should be maintained and applied in all situations, such as, "This is the time for study, this is the time for inquiry," and so on.
Pārihāriyapaññā (trí tuệ quản lý) là trí tuệ cần được quản lý mọi lúc, theo cách như “đây là thời gian học hỏi, đây là thời gian hỏi đáp”, v.v.
Imasmiñhi pañhābyākaraṇe tikkhattuṃ paññā āgatā.
Indeed, in this explanation of the problem, wisdom (paññā) has appeared three times.
Trong lời giải đáp vấn đề này, trí tuệ (paññā) đã được đề cập ba lần.
Tattha paṭhamā jātipaññā, dutiyā vipassanāpaññā, tatiyā sabbakiccapariṇāyikā pārihāriyapaññā.
Among these, the first is innate wisdom (jāti-paññā), the second is insight wisdom (vipassanā-paññā), and the third is the skillful wisdom that guides all duties (pārihāriya-paññā).
Trong đó, trí tuệ đầu tiên là jātipaññā (trí tuệ bẩm sinh), trí tuệ thứ hai là vipassanāpaññā (trí tuệ tuệ quán), và trí tuệ thứ ba là pārihāriyapaññā (trí tuệ quản lý) hướng dẫn mọi công việc.
250
So imaṃ vijaṭaye jaṭanti so imehi sīlādīhi samannāgato bhikkhu.
So imaṃ vijaṭaye jaṭaṃ (He can untangle this tangle) means that bhikkhu, endowed with virtue and so on.
So imaṃ vijaṭaye jaṭanti (Người đó sẽ gỡ bỏ mạng lưới này) nghĩa là vị Tỳ-khưu đó, được trang bị giới, v.v.
Yathā nāma puriso pathaviyaṃ patiṭṭhāya sunisitaṃ satthaṃ ukkhipitvā mahantaṃ veḷugumbaṃ vijaṭeyya, evamevaṃ sīle patiṭṭhāya samādhisilāyaṃ sunisitaṃ vipassanāpaññāsatthaṃ vīriyabalapaggahitena pārihāriyapaññāhatthena ukkhipitvā sabbampi taṃ attano santāne patitaṃ taṇhājaṭaṃ vijaṭeyya sañchindeyya sampadāleyyāti.
Just as a man, standing on the ground, could raise a well-sharpened weapon and untangle a large bamboo thicket, even so, a bhikkhu, established in virtue, could raise the weapon of vipassanā-paññā, sharpened on the whetstone of samādhi, with the hand of pārihāriya-paññā strengthened by the power of diligence, and completely untangle, cut, and demolish that tangle of craving fallen upon his own continuum.
Cũng như một người đàn ông đứng vững trên mặt đất, vung một con dao sắc bén và gỡ bỏ một bụi tre lớn, thì cũng vậy, một vị Tỳ-khưu an trú trong giới, vung con dao trí tuệ tuệ quán (vipassanāpaññāsattha) sắc bén trên đá định (samādhisilāyaṃ), bằng bàn tay trí tuệ quản lý (pārihāriyapaññāhatthena) được nâng đỡ bởi sức mạnh tinh tấn (vīriyabalapaggahitena), sẽ gỡ bỏ, cắt đứt, và phá tan tất cả mạng lưới ái (taṇhājaṭa) đã rơi vào dòng tâm thức của mình.
251
Ettāvatā sekhabhūmiṃ kathetvā idāni jaṭaṃ vijaṭetvā ṭhitaṃ mahākhīṇāsavaṃ dassento yesantiādimāha.
Having thus explained the stage of the Sekha (trainee), the Buddha now wishing to show the great Arahant who has untangled the tangle, uttered the statement beginning with "For whom" (yesaṃ).
Sau khi nói về giai đoạn của người còn hữu học (sekhabhūmi) đến đây, bây giờ Ngài nói yesanti (những ai), v.v., để chỉ ra vị A-la-hán vĩ đại đã gỡ bỏ mạng lưới ái.
Evaṃ jaṭaṃ vijaṭetvā ṭhitaṃ khīṇāsavaṃ dassetvā puna jaṭāya vijaṭanokāsaṃ dassento yattha nāmañcātiādimāha.
Having thus shown the Arahant who has untangled the tangle, he then, wishing to show the place where the tangle is untangled, uttered the statement beginning with "Where name" (yattha nāmañca) and so on.
Sau khi chỉ ra vị A-la-hán đã gỡ bỏ mạng lưới ái như vậy, Ngài lại nói yattha nāmañcāti (nơi danh và), v.v., để chỉ ra nơi mạng lưới ái được gỡ bỏ.
Tattha nāmanti cattāro arūpino khandhā.
Therein, nāma means the four immaterial aggregates.
Ở đây, nāmanti (danh) là bốn uẩn vô sắc (arūpino khandhā).
Paṭighaṃ rūpasaññā cāti ettha paṭighasaññāvasena kāmabhavo gahito, rūpasaññāvasena rūpabhavo.
In "Paṭighaṃ rūpasaññā ca" (sense-impression and perception of form), kāma-bhava is taken by way of paṭigha-saññā (perception of impingement), and rūpa-bhava by way of rūpa-saññā (perception of form).
Trong paṭighaṃ rūpasaññā cāti (xúc chạm và tưởng sắc), cõi dục (kāmabhava) được bao gồm theo nghĩa tưởng xúc chạm (paṭighasaññā), và cõi sắc (rūpabhava) theo nghĩa tưởng sắc (rūpasaññā).
Tesu dvīsu gahitesu arūpabhavo gahitova hoti bhavasaṅkhepenāti.
When these two are taken, arūpa-bhava is also included by way of a summary of existences.
Khi hai cõi này được bao gồm, cõi vô sắc (arūpabhava) cũng được bao gồm trong sự tóm tắt các cõi.
Etthesā chijjate jaṭāti ettha tebhūmakavaṭṭassa pariyādiyanaṭṭhāne esā jaṭā chijjati, nibbānaṃ āgamma chijjati nirujjhatīti ayaṃ attho dassito hoti.
"Here this tangle is cut" (etthesā chijjate jaṭā) means that in this place where the three-fold saṃsāra comes to an end, this tangle is cut; that is, it is cut and ceases upon attaining Nibbāna. This meaning is shown.
Etthesā chijjate jaṭāti (ở đây, mạng lưới ái này bị cắt đứt) nghĩa là mạng lưới ái này bị cắt đứt tại nơi ba cõi (tebhūmakavaṭṭa) chấm dứt; ý nghĩa được chỉ ra là nó bị cắt đứt và diệt trừ khi đạt đến Nibbāna.
Tatiyaṃ.
Third (sutta explanation is complete).
Thứ ba.
252
4. Manonivāraṇasuttavaṇṇanā
4. The Commentary on the Manonivāraṇa Sutta
4. Lời giải thích về Manonivāraṇasutta
253
24. Catutthe yato yatoti pāpato vā kalyāṇato vā.
24. In the fourth (sutta), yato yato (from whatever) means from evil or from good.
24. Trong bài thứ tư, yato yatoti (từ bất cứ điều gì) là từ điều ác hoặc điều thiện.
Ayaṃ kira devatā ‘‘yaṃkiñci kusalādibhedaṃ lokiyaṃ vā lokuttaraṃ vā mano, taṃ nivāretabbameva, na uppādetabba’’nti evaṃladdhikā.
This deity, it is said, held the view that "whatever mind, whether mundane or supramundane, of good or other kinds, should be restrained; it should not be allowed to arise."
Vị thiên nhân này có tín điều rằng: “Bất kỳ tâm nào, dù là thế gian hay siêu thế, thuộc loại thiện hay bất thiện, đều phải được ngăn chặn, không được phát sinh.”
Sa sabbatoti so sabbato.
Sa sabbato (he from all) means that one from all.
Sa sabbatoti (người đó từ mọi mặt) là người đó từ mọi mặt.
Atha bhagavā – ‘‘ayaṃ devatā aniyyānikakathaṃ katheti, mano nāma nivāretabbampi atthi bhāvetabbampi, vibhajitvā namassā dassessāmī’’ti cintetvā dutiyagāthaṃ āha.
Then the Blessed One, thinking, "This deity is speaking a discourse that does not lead to release. The mind, indeed, has aspects that should be restrained and aspects that should be developed. I shall teach him by differentiating," uttered the second verse.
Sau đó, Đức Thế Tôn nghĩ: “Vị thiên nhân này đang nói một điều không dẫn đến giải thoát (aniyyānikakatha). Tâm có những điều cần được ngăn chặn và những điều cần được tu tập. Ta sẽ phân tích và chỉ ra cho vị ấy,” và Ngài đã nói bài kệ thứ hai.
Tattha na mano saṃyatattamāgatanti, yaṃ vuttaṃ ‘‘na sabbato mano nivāraye’’ti, kataraṃ taṃ mano, yaṃ taṃ sabbato na nivāretabbanti ce.
Therein, regarding "The mind that has come to be restrained" (na mano saṃyatattamāgataṃ) and the statement "One should not restrain the mind from all," if one asks, "Which mind is that which should not be restrained from all?"
Ở đây, na mano saṃyatattamāgatanti (tâm không đạt đến sự tự chế), nếu nói rằng “không nên ngăn chặn tâm từ mọi mặt”, thì tâm nào là tâm không nên ngăn chặn từ mọi mặt?
Mano saṃyatattaṃ āgataṃ, yaṃ mano yattha saṃyatabhāvaṃ āgataṃ, ‘‘dānaṃ dassāmi, sīlaṃ rakkhissāmī’’tiādinā nayena uppannaṃ, etaṃ mano na nivāretabbaṃ, aññadatthu brūhetabbaṃ vaḍḍhetabbaṃ.
The mind that has come to be restrained, the mind that has reached a state of discipline, arising with intentions such as "I will give dana, I will observe sīla," should not be restrained. On the contrary, it should be nurtured and developed.
Tâm đã đạt đến sự tự chế, tức là tâm đã đạt đến trạng thái tự chế, phát sinh theo cách như “tôi sẽ bố thí, tôi sẽ giữ giới”, v.v., tâm này không nên bị ngăn chặn, mà phải được nuôi dưỡng và phát triển.
Yato yato ca pāpakanti yato yato akusalaṃ uppajjati, tato tato ca taṃ nivāretabbanti.
"And from whatever is evil" (yato yato ca pāpakaṃ): From whatever source unwholesome states arise, from that source one should restrain it.
Yato yato ca pāpakanti (từ bất cứ điều ác nào) nghĩa là từ bất cứ nơi nào bất thiện (akusala) phát sinh, từ đó tâm đó phải được ngăn chặn.
Catutthaṃ.
Fourth (sutta explanation is complete).
Thứ tư.
254
5. Arahantasuttavaṇṇanā
5. The Commentary on the Arahanta Sutta
5. Lời giải thích về Arahantasutta
255
25. Pañcame katāvīti catūhi maggehi katakicco.
25. In the fifth (sutta), katāvī (one who has done) means one who has completed the task through the four paths.
25. Trong bài thứ năm, katāvīti (đã hoàn thành công việc) là đã hoàn thành công việc bằng bốn Đạo.
Ahaṃ vadāmīti ayaṃ devatā vanasaṇḍavāsinī, sā āraññakānaṃ bhikkhūnaṃ ‘‘ahaṃ bhuñjāmi, ahaṃ nisīdāmi, mama patto, mama cīvara’’ntiādikathāvohāraṃ sutvā cintesi – ‘‘ahaṃ ime bhikkhū ‘khīṇāsavā’ti maññāmi, khīṇāsavānañca nāma evarūpā attupaladdhinissitakathā hoti, na hoti nu kho’’ti jānanatthaṃ evaṃ pucchati.
Ahaṃ vadāmī (I say): This deity, dwelling in a forest grove, heard the forest bhikkhus speaking such words as "I eat, I sit, my bowl, my robe," and so on. She thought, "I consider these bhikkhus to be Arahants. Do Arahants truly speak such words based on self-attribution, or not?" Thus, she asked to ascertain this.
Ahaṃ vadāmīti (tôi nói) là vị thiên nhân này sống trong rừng. Nghe các Tỳ-khưu sống trong rừng nói chuyện như “tôi ăn, tôi ngồi, bát của tôi, y của tôi”, v.v., vị ấy nghĩ: “Tôi nghĩ những Tỳ-khưu này là A-la-hán. Liệu các A-la-hán có những lời nói dựa trên quan niệm về tự ngã như vậy không, hay không?” để biết, vị ấy hỏi như vậy.
256
Sāmaññanti lokaniruttiṃ lokavohāraṃ.
Sāmañña means the language of the world, the worldly convention.
Sāmaññanti (thuật ngữ thông thường) là cách nói thông thường, cách dùng từ trong thế gian.
Kusaloti khandhādīsu kusalo.
Kusalo means skilled in the aggregates (khandhas) and so forth.
Kusaloti (khéo léo) là khéo léo trong các uẩn, v.v.
Vohāramattenāti upaladdhinissitakathaṃ hitvā vohārabhedaṃ akaronto ‘‘ahaṃ, mamā’’ti vadeyya.
Vohāramattena means abandoning speech based on a conception of self (upaladdhi) and not disrupting conventional usage, one might say, "I" or "mine."
Vohāramattenā (chỉ bằng cách dùng quy ước) có nghĩa là từ bỏ lời nói dựa trên quan niệm về tự ngã (atta), không phá vỡ quy ước giao tiếp, mà nói rằng: “tôi, của tôi.”
‘‘Khandhā bhuñjanti, khandhā nisīdanti, khandhānaṃ patto, khandhānaṃ cīvara’’nti hi vutte vohārabhedo hoti, na koci jānāti.
For if one were to say, "The aggregates eat, the aggregates sit, the aggregates' bowl, the aggregates' robe," it would disrupt conventional usage, and no one would understand.
Bởi vì, nếu nói rằng: “Các uẩn thọ hưởng, các uẩn ngồi, bát của các uẩn, y của các uẩn,” thì sẽ phá vỡ quy ước giao tiếp, và không ai hiểu được.
Tasmā evaṃ avatvā lokavohārena voharatīti.
Therefore, not speaking thus, one speaks according to worldly convention.
Do đó, không nói như vậy mà nói theo quy ước của thế gian.
257
Atha devatā – ‘‘yadi diṭṭhiyā vasena na vadati, mānavasena nu kho vadatī’’ti cintetvā puna yo hotīti pucchi.
Then the deity, thinking, "If he does not speak due to wrong view (diṭṭhi), does he speak due to conceit (māna)?" asked again with "Who is?"
Rồi vị thiên nhân suy nghĩ: “Nếu vị ấy không nói theo quan điểm chấp thủ, thì có phải vị ấy nói theo sự kiêu mạn chăng?” và lại hỏi: Yo hoti (người nào có).
Tattha mānaṃ nu khoti so bhikkhu mānaṃ upagantvā mānavasena vadeyya nu khoti.
There, "Mānaṃ nu kho" means: might that bhikkhu, having approached conceit, speak due to conceit?
Ở đây, mānaṃ nu kho (có phải là kiêu mạn chăng) có nghĩa là: vị Tỳ-khưu ấy có rơi vào kiêu mạn và nói theo sự kiêu mạn chăng?
Atha bhagavā – ‘‘ayaṃ devatā khīṇāsavaṃ samānaṃ viya karotī’’ti cintetvā, ‘‘khīṇāsavassa navavidhopi māno pahīno’’ti dassento paṭigāthaṃ āha.
Then the Fortunate One, thinking, "This deity makes it seem as if the arahant (khīṇāsava) has conceit," and showing that "the nine kinds of conceit are abandoned for an arahant," spoke the counter-verse.
Rồi Thế Tôn suy nghĩ: “Vị thiên nhân này đang xem một vị A-la-hán như thể còn kiêu mạn,” và để chỉ ra rằng “chín loại kiêu mạn đều đã được đoạn trừ đối với một vị A-la-hán,” Ngài đã đáp lại bằng kệ ngôn.
Tattha vidhūpitāti vidhamitā.
There, vidhūpitā means dispelled.
Ở đây, vidhūpitā có nghĩa là đã được xua tan.
Mānaganthassāti mānā ca ganthā ca assa.
Mānaganthassa means conceit and fetters are his.
Mānaganthassā có nghĩa là có kiêu mạn và các kiết sử.
Maññatanti maññanaṃ.
Maññataṃ means the act of conceiving.
Maññataṃ có nghĩa là sự tưởng tri (maññana).
Tividhampi taṇhā-diṭṭhi-māna-maññanaṃ so vītivatto, atikkantoti attho.
He has transcended (vītivatto) the three kinds of conceiving: craving (taṇhā), wrong view (diṭṭhi), and conceit (māna); this is the meaning.
Vị ấy đã vượt qua, đã vượt lên trên ba loại tưởng tri (maññana) là tham ái, tà kiến và kiêu mạn; đó là ý nghĩa.
Sesaṃ uttānatthamevāti.
The rest is of obvious meaning.
Phần còn lại có nghĩa rõ ràng.
Pañcamaṃ.
The Fifth.
Thứ năm.
258
6. Pajjotasuttavaṇṇanā
6. Commentary on the Pajjota Sutta
6. Chú giải kinh Pajjota
259
26. Chaṭṭhe puṭṭhunti pucchituṃ.
In the sixth (sutta), puṭṭhuṃ means to ask.
Trong kinh thứ sáu, puṭṭhuṃ có nghĩa là để hỏi.
Kathaṃ jānemūti kathaṃ jāneyyāma.
Kathaṃ jānemu means: How might we know?
Kathaṃ jānemū có nghĩa là làm sao chúng ta có thể biết?
Divārattinti divā ca rattiñca.
Divārattiṃ means day and night.
Divārattiṃ có nghĩa là ngày và đêm.
Tattha tatthāti yattha yattheva pajjalito hoti, tattha tattha.
Tattha tattha means wherever it shines, there, there.
Tattha tatthā có nghĩa là bất cứ nơi nào ánh sáng bùng cháy, ở đó.
Esā ābhāti esā buddhābhā.
Esā ābhā means this is the Buddha's radiance.
Esā ābhā có nghĩa là ánh sáng của chư Phật này.
Katamā pana sāti?
But what is it?
Vậy đó là gì?
Ñāṇāloko vā hotu pītiāloko vā pasādāloko vā dhammakathāāloko vā, sabbopi buddhānaṃ pātubhāvā uppanno āloko buddhābhā nāma.
Whether it be the light of knowledge (ñāṇāloka), or the light of joy (pītiāloka), or the light of serenity (pasādāloka), or the light of Dhamma teaching (dhammakathāāloka), all light that arises from the manifestation of the Buddhas is called buddhābhā.
Dù đó là ánh sáng của trí tuệ, ánh sáng của hỷ lạc, ánh sáng của tịnh tín, hay ánh sáng của Pháp thoại, tất cả ánh sáng phát sinh từ sự xuất hiện của chư Phật đều được gọi là buddhābhā (ánh sáng của chư Phật).
Ayaṃ anuttarā sabbaseṭṭhā asadisāti.
This is unsurpassed, supreme among all, incomparable.
Đây là vô thượng, tối thắng trong tất cả, không gì sánh bằng.
Chaṭṭhaṃ.
The Sixth.
Thứ sáu.
260
7. Sarasuttavaṇṇanā
7. Commentary on the Sara Sutta
7. Chú giải kinh Sara
261
27. Sattame kuto sarā nivattantīti ime saṃsārasarā kuto nivattanti, kiṃ āgamma nappavattantīti attho.
In the seventh (sutta), kuto sarā nivattanti means: From what do these streams of saṃsāra turn back? Due to what do they not flow? This is the meaning.
Trong kinh thứ bảy, kuto sarā nivattantī (từ đâu mà các dòng sông quay trở lại) có nghĩa là: những dòng sông luân hồi này từ đâu mà quay trở lại, nương vào điều gì mà chúng không chảy nữa? Đó là ý nghĩa.
Na gādhatīti na patiṭṭhāti.
Na gādhati means it does not establish itself.
Na gādhatī có nghĩa là không đứng vững.
Atoti ato nibbānato.
Ato means from Nibbāna.
Ato có nghĩa là từ Niết Bàn này.
Sesaṃ uttānatthamevāti.
The rest is of obvious meaning.
Phần còn lại có nghĩa rõ ràng.
Sattamaṃ.
The Seventh.
Thứ bảy.
262
8. Mahaddhanasuttavaṇṇanā
8. Commentary on the Mahaddhana Sutta
8. Chú giải kinh Mahaddhana
263
28. Aṭṭhame nidhānagataṃ muttasārādi mahantaṃ dhanametesanti mahaddhanā.
In the eighth (sutta), mahaddhanā means those who possess great wealth, such as pearls and gems, stored as treasure.
Trong kinh thứ tám, những người có tài sản lớn như ngọc trai, đá quý được cất giấu, được gọi là mahaddhanā (giàu có).
Suvaṇṇarajatabhājanādi mahābhogo etesanti mahābhogā.
Mahābhogā means those who possess great enjoyments, such as gold and silver vessels.
Những người có tài sản lớn như đồ dùng bằng vàng bạc, được gọi là mahābhogā (có nhiều của cải).
Aññamaññābhigijjhantīti aññamaññaṃ abhigijjhanti patthenti pihenti.
Aññamaññābhigijjhanti means they covet, long for, and desire each other's possessions.
Aññamaññābhigijjhantī có nghĩa là họ khao khát, mong muốn, và thèm muốn tài sản của nhau.
Analaṅkatāti atittā apariyattajātā.
Analaṅkatā means unsatisfied, unfulfilled.
Analaṅkatā có nghĩa là không thỏa mãn, không bao giờ đủ.
Ussukkajātesūti nānākiccajātesu anuppannānaṃ rūpādīnaṃ uppādanatthāya uppannānaṃ anubhavanatthāya ussukkesu.
Ussukkajātesu means those who are diligent, active in various tasks for the production of unproduced forms (rūpādis) and for the experience of those already produced.
Ussukkajātesū có nghĩa là những người bận rộn với nhiều công việc khác nhau, nỗ lực để tạo ra những thứ chưa có như sắc pháp, và để trải nghiệm những thứ đã có.
Bhavasotānusārīsūti vaṭṭasotaṃ anusarantesu.
Bhavasotānusārīsu means those who follow the current of existence (vaṭṭasota).
Bhavasotānusārīsū có nghĩa là những người theo dòng luân hồi.
Anussukāti avāvaṭā.
Anussukā means not diligent, not busy.
Anussukā có nghĩa là không bận rộn.
Agāranti mātugāmena saddhiṃ gehaṃ.
Agāraṃ means a home with a woman.
Agāraṃ có nghĩa là một ngôi nhà cùng với một người phụ nữ.
Virājiyāti virājetvā.
Virājiyā means having abandoned attachment.
Virājiyā có nghĩa là đã thoát ly.
Sesaṃ uttānamevāti.
The rest is obvious.
Phần còn lại có nghĩa rõ ràng.
Aṭṭhamaṃ.
The Eighth.
Thứ tám.
264
9. Catucakkasuttavaṇṇanā
9. Commentary on the Catucakka Sutta
9. Chú giải kinh Catucakka
265
29. Navame catucakkanti catuiriyāpathaṃ.
In the ninth (sutta), catucakkaṃ means the four postures.
Trong kinh thứ chín, catucakkaṃ có nghĩa là bốn oai nghi.
Iriyāpatho hi idha cakkanti adhippeto.
For here, posture (iriyāpatha) is intended as a wheel (cakka).
Ở đây, oai nghi được hiểu là bánh xe.
Navadvāranti navahi vaṇamukhehi navadvāraṃ.
Navadvāraṃ means the body with nine doors, through the nine openings of wounds.
Navadvāraṃ có nghĩa là chín cánh cửa, qua chín lỗ hở của vết thương.
Puṇṇanti asucipūraṃ.
Puṇṇaṃ means full of impurity.
Puṇṇaṃ có nghĩa là đầy những thứ bất tịnh.
Lobhena saṃyutanti taṇhāya saṃyuttaṃ.
Lobhena saṃyuttaṃ means bound by craving (taṇhā).
Lobhena saṃyutaṃ có nghĩa là bị trói buộc bởi tham ái.
Kathaṃ yātrā bhavissatīti etassa evarūpassa sarīrassa kathaṃ niggamanaṃ bhavissati, kathaṃ mutti parimutti samatikkamo bhavissatīti pucchati.
Kathaṃ yātrā bhavissati means how will there be an escape from such a body? How will there be release, complete liberation, transcendence? This is what is asked.
Kathaṃ yātrā bhavissatī (làm sao có thể đi qua) có nghĩa là hỏi: làm sao thân thể như vậy có thể thoát ra, làm sao có thể giải thoát, giải thoát hoàn toàn, vượt qua?
Naddhinti upanāhaṃ, pubbakāle kodho, aparakāle upanāhoti evaṃ pavattaṃ balavakodhanti attho.
Naddhiṃ means resentment (upanāha); in early times it is anger (kodha), later it is resentment (upanāha); thus, it refers to strong anger that arises in this way.
Naddhiṃ có nghĩa là sự thù hận, sự phẫn nộ mạnh mẽ phát sinh như sự giận dữ ban đầu và sự thù hận sau đó; đó là ý nghĩa.
Varattanti ‘‘chetvā naddhi varattañca, sandānaṃ sahanukkama’’nti gāthāya (dha. pa. 398; su. ni. 627) taṇhā varattā, diṭṭhi sandānaṃ nāma jātaṃ.
Varattaṃ means: in the verse, "Having cut off resentment (naddhi) and the thong (varatta), and the bond (sandāna) together with the underlying tendencies (anukkama)," craving is called varattā, and wrong view (diṭṭhi) is called sandānaṃ.
Varattaṃ: Trong kệ ngôn (Dhp. 398; Sn. 627) “Chetvā naddhi varattañca, sandānaṃ sahanukkamaṃ” (Đoạn trừ thù hận, dây trói, và dây buộc cùng với sự tùy miên), tham ái được gọi là varattā, và tà kiến được gọi là sandānaṃ.
Idha pana pāḷiniddiṭṭhe kilese ṭhapetvā avasesā ‘‘varattā’’ti veditabbā, iti kilesavarattañca chetvāti attho.
Here, however, setting aside the defilements specifically mentioned in the Pāḷi, the remaining defilements (such as wrong view and doubt) are to be understood as varattā; thus, it means having cut off the thongs of defilements.
Tuy nhiên, ở đây, ngoài các phiền não được đề cập trong Pāḷi, các phiền não còn lại được hiểu là varattā; đó là ý nghĩa của việc đoạn trừ dây trói phiền não.
Icchā lobhanti ekoyeva dhammo icchanaṭṭhena icchā, lubbhanaṭṭhena lobhoti vutto.
Icchā lobhaṃ means that it is one and the same phenomenon, called icchā in the sense of desiring, and lobha in the sense of coveting.
Icchā lobhaṃ có nghĩa là cùng một pháp được gọi là icchā (mong muốn) theo nghĩa mong cầu, và lobha (tham ái) theo nghĩa ham muốn.
Paṭhamuppattikā vā dubbalā icchā, aparāparuppattiko balavā lobho.
Alternatively, weak desire (lobha) that arises first is icchā, while strong attachment (lobha) that arises repeatedly is lobha.
Hoặc, icchā là sự mong muốn yếu ớt xuất hiện lần đầu, còn lobha là sự tham ái mạnh mẽ xuất hiện lặp đi lặp lại.
Aladdhapatthanā vā icchā, paṭiladdhavatthumhi lobho.
Alternatively, wishing for what is not yet obtained is icchā, while attachment to what is already obtained is lobha.
Hoặc, icchā là sự khao khát những thứ chưa đạt được, còn lobha là sự tham ái đối với những thứ đã đạt được.
Samūlaṃ taṇhanti avijjāmūlena samūlakaṃ taṇhaṃ.
Samūlaṃ taṇhaṃ means craving (taṇhā) with its root, with ignorance (avijjā) as its root.
Samūlaṃ taṇhaṃ có nghĩa là tham ái tận gốc rễ, với vô minh làm gốc rễ.
Abbuyhāti aggamaggena uppāṭetvā.
Abbuyhā means having uprooted by the Noble Path (aggamagga).
Abbuyhā có nghĩa là nhổ tận gốc bằng đạo lộ tối thượng.
Sesaṃ uttānamevāti.
The rest is obvious.
Phần còn lại có nghĩa rõ ràng.
Navamaṃ.
The Ninth.
Thứ chín.
266
10. Eṇijaṅghasuttavaṇṇanā
10. Commentary on the Eṇijaṅgha Sutta
10. Chú giải kinh Eṇijaṅgha
267
30. Dasame eṇijaṅghanti eṇimigassa viya suvaṭṭitajaṅghaṃ.
In the tenth (sutta), eṇijaṅghaṃ means one whose calves are well-rounded like those of an eṇi deer.
Trong kinh thứ mười, eṇijaṅghaṃ có nghĩa là bắp chân tròn trịa như bắp chân của nai Eṇi.
Kisanti athūlaṃ samasarīraṃ.
Kisaṃ means a body that is not stout but well-proportioned.
Kisaṃ có nghĩa là thân thể không mập, cân đối.
Atha vā ātapena milātaṃ mālāgandhavilepanehi anupabrūhitasarīrantipi attho.
Alternatively, it means a body that is emaciated by ascetic practices, not enhanced by garlands, perfumes, and anointments.
Hoặc, đó cũng có nghĩa là thân thể héo hon vì nắng, không được nuôi dưỡng bằng vòng hoa, hương liệu và thuốc bôi.
Vīranti vīriyavantaṃ.
Vīraṃ means one who is energetic.
Vīraṃ có nghĩa là người có tinh tấn.
Appāhāranti bhojane mattaññutāya mitāhāraṃ, vikālabhojanapaṭikkhepavasena vā parittāhāraṃ.
Appāhāraṃ means one who is moderate in food due to knowing the measure in eating, or one who takes little food by rejecting untimely eating.
Appāhāraṃ có nghĩa là người có lượng thức ăn vừa phải do biết tiết độ trong ăn uống, hoặc có lượng thức ăn ít do từ bỏ việc ăn phi thời.
Alolupanti catūsu paccayesu loluppavirahitaṃ.
Alolupaṃ means one who is free from greediness (loluppa) regarding the four requisites.
Alolupaṃ có nghĩa là không tham lam đối với bốn vật dụng.
Rasataṇhāpaṭikkhepo vā esa.
Alternatively, this is the rejection of craving for tastes (rasataṇhā).
Hoặc, đây là sự từ bỏ tham ái vị giác.
Sīhaṃvekacaraṃ nāganti ekacaraṃ sīhaṃ viya, ekacaraṃ nāgaṃ viya.
Sīhaṃvekacaraṃ Nāgaṃ means like a solitary lion, like a solitary elephant.
Sīhaṃvekacaraṃ nāgaṃ có nghĩa là như sư tử độc hành, như voi chúa độc hành.
Gaṇavāsino hi pamattā honti, ekacarā appamattā, tasmā ekacarāva gahitāti.
For those who dwell in groups are heedless, while solitary ones are heedful; therefore, solitary ones are taken (as examples).
Bởi vì những người sống trong đoàn thể thường phóng dật, còn những người độc hành thì không phóng dật; do đó, chỉ những người độc hành được đề cập.
Paveditāti pakāsitā kathitā.
Paveditā means made manifest, declared.
Paveditā có nghĩa là đã được công bố, đã được thuyết giảng.
Etthāti etasmiṃ nāmarūpe.
Etthā means in this mind-and-matter (nāmarūpa).
Etthā có nghĩa là trong danh sắc này.
Pañcakāmaguṇavasena hi rūpaṃ gahitaṃ, manena nāmaṃ, ubhayehi pana avinibhuttadhamme gahetvā pañcakkhandhādivasenapettha bhummaṃ yojetabbanti.
For form (rūpa) is taken in the sense of the five sense-pleasures, and mind (nāma) by the term 'mind'; however, taking the inseparable phenomena by both, the ground (bhūma) should be connected here in the sense of the five aggregates and so forth.
Thật vậy, sắc được hiểu theo nghĩa năm dục trần, danh được hiểu theo nghĩa tâm ý; tuy nhiên, khi nắm giữ các pháp không thể tách rời bởi cả hai, thì trong đoạn này, nên kết hợp cõi giới theo nghĩa năm uẩn, v.v.
Dasamaṃ.
The Tenth.
Thứ mười.
268
Sattivaggo tatiyo.
The Sattivagga, the third, is finished.
Sattivagga thứ ba.
269

4. Satullapakāyikavaggo

4. The Satullapakāyika Vagga

4. Satullapakāyikavagga

270
1. Sabbhisuttavaṇṇanā
1. Commentary on the Sabbhi Sutta
1. Chú giải kinh Sabbhi
271
31. Satullapakāyikavaggassa paṭhame satullapakāyikāti sataṃ dhammaṃ samādānavasena ullapetvā sagge nibbattāti satullapakāyikā.
In the first (sutta) of the Satullapakāyika Vagga, satullapakāyikā means those who are reborn in heaven by upholding and practicing the good Dhamma (sataṃ Dhammaṃ samādānavasena ullapetvā).
Trong kinh đầu tiên của Satullapakāyikavagga, satullapakāyikā có nghĩa là những vị thiên nhân tái sinh ở cõi trời sau khi đã thực hành Pháp một cách đầy đủ (ullāpetvā) theo một trăm pháp.
Tatridaṃ vatthu – sambahulā kira samuddavāṇijā nāvāya samuddaṃ pakkhandiṃsu.
Here is the story: It is said that many sea merchants embarked on a voyage in a ship.
Đây là câu chuyện: Nhiều thương gia đi biển đã ra khơi bằng thuyền.
Tesaṃ khittasaravegena gacchantiyā nāvāya sattame divase samuddamajjhe mahantaṃ uppātikaṃ pātubhūtaṃ, mahāūmiyo uṭṭhahitvā nāvaṃ udakassa pūrenti.
On the seventh day, as their ship was speeding along, a great catastrophe appeared in the middle of the ocean; huge waves rose up and filled the ship with water.
Vào ngày thứ bảy, khi con thuyền đang đi với tốc độ nhanh như mũi tên bắn, một tai nạn lớn đã xảy ra giữa biển, những con sóng lớn nổi lên và nhấn chìm con thuyền.
Nāvāya nimujjamānāya mahājano attano attano devatānaṃ nāmāni gahetvā āyācanādīni karonto paridevi.
As the ship was sinking, the great multitude lamented, calling upon the names of their respective deities and making supplications.
Khi con thuyền đang chìm, mọi người kêu gọi các vị thần của mình, cầu xin và than khóc.
Tesaṃ majjhe eko puriso – ‘‘atthi nu kho me evarūpe bhaye patiṭṭhā’’ti āvajjento attano parisuddhāni saraṇāni ceva sīlāni ca disvā yogī viya pallaṅkaṃ ābhujitvā nisīdi.
Among them, one man, reflecting, "Is there any refuge for me in such danger?", and seeing his pure refuges and precepts, sat cross-legged like a yogi.
Trong số họ, có một người đàn ông suy nghĩ: “Trong nỗi sợ hãi như thế này, liệu có chỗ dựa nào cho tôi không?” và khi thấy các giới và quy y thanh tịnh của mình, ông đã ngồi kiết già như một hành giả.
Tamenaṃ itare sabhayakāraṇaṃ pucchiṃsu.
The others asked him the cause of his fearlessness.
Những người khác hỏi ông về nguyên nhân của sự sợ hãi.
So tesaṃ kathesi – ‘‘ambho ahaṃ nāvaṃ abhirūhanadivase bhikkhusaṅghassa dānaṃ datvā saraṇāni ceva sīlāni ca aggahesiṃ, tena me bhayaṃ natthī’’ti.
He told them, "Friends, on the day I boarded the ship, I gave alms to the Saṅgha of bhikkhus and took refuge and precepts; therefore, I have no fear."
Ông nói với họ: “Này các bạn, vào ngày tôi lên thuyền, tôi đã cúng dường Tăng đoàn và thọ trì quy y và các giới. Do đó, tôi không có sợ hãi.”
Kiṃ pana sāmi etāni aññesampi vattantīti?
"Venerable sir, are these available to others as well?"
“Thưa ngài, những giới này có áp dụng cho những người khác không?”
Āma vattantīti tena hi amhākampi dethāti.
"Yes, they are available," he replied. "In that case, please give them to us too."
“Vâng, có áp dụng.” “Vậy thì, xin hãy ban cho chúng tôi.”
So te manusse sataṃ sataṃ katvā satta koṭṭhāse akāsi, tato pañcasīlāni adāsi.
So he divided those people into groups of one hundred and made seven portions, then he gave them the five precepts.
Ông chia những người đó thành bảy nhóm, mỗi nhóm một trăm người, rồi ban cho họ năm giới.
Tesu paṭhamaṃ jaṅghasataṃ gopphakamatte udake ṭhitaṃ aggahesi, dutiyaṃ jāṇumatte, tatiyaṃ kaṭimatte, catutthaṃ nābhimatte, pañcamaṃ thanamatte, chaṭṭhaṃ galappamāṇe, sattamaṃ mukhena loṇodake pavisante aggahesi.
Among them, the first hundred took* standing in ankle-deep water; the second, in knee-deep water; the third, in waist-deep water; the fourth, in navel-deep water; the fifth, in breast-deep water; the sixth, in neck-deep water; the seventh, took* as the salty water entered their mouths.
Trong số đó, một trăm người đầu tiên đã thọ trì giới khi đứng trong nước ngang mắt cá chân, một trăm người thứ hai khi nước ngang đầu gối, một trăm người thứ ba khi nước ngang thắt lưng, một trăm người thứ tư khi nước ngang rốn, một trăm người thứ năm khi nước ngang ngực, một trăm người thứ sáu khi nước ngang cổ, và một trăm người thứ bảy khi nước mặn tràn vào miệng.
So tesaṃ sīlāni datvā – ‘‘aññaṃ tumhākaṃ paṭisaraṇaṃ natthi, sīlameva āvajjethā’’ti ugghosesi.
Having given the precepts to them, he exhorted, "You have no other refuge; reflect only upon the precepts."
Vị ấy đã ban giới cho họ và tuyên bố: “Các con không có nơi nương tựa nào khác, hãy quán niệm về giới luật!”
Tāni sattapi jaṅghasatāni tattha kālaṃ katvā āsannakāle gahitasīlaṃ nissāya tāvatiṃsabhavane nibbattiṃsu, tesaṃ ghaṭāvaseneva vimānāni nibbattiṃsu.
All seven hundred of them died there, and relying on the precepts they had taken at the time of their death, they were reborn in the Tāvatiṃsa realm; their celestial mansions appeared solely due to their collective presence.
Cả bảy trăm người ấy đã mệnh chung tại đó và nhờ vào giới luật đã thọ trì gần lúc lâm chung mà tái sinh vào cõi trời Ba Mươi Ba (Tāvatiṃsa), các cung điện của họ được hình thành cùng với sự hội tụ của họ.
Sabbesaṃ majjhe ācariyassa yojanasatikaṃ suvaṇṇavimānaṃ nibbatti, avasenāni tassa parivārāni hutvā sabbaheṭṭhimaṃ dvādasayojanikaṃ ahosi.
In the midst of all*, a golden mansion one hundred yojanas in size appeared for the teacher; the remaining mansions, being his retinue, were all twelve yojanas at their smallest.
Giữa tất cả, cung điện vàng rộng một trăm dojana của vị thầy đã xuất hiện, còn lại là các cung điện phụ thuộc của vị ấy, cung điện thấp nhất rộng mười hai dojana.
Te nibbattakkhaṇeyeva kammaṃ āvajjentā ācariyaṃ nissāya sampattilābhaṃ ñatvā, ‘‘gacchāma tāva, dasabalassa santike amhākaṃ ācariyassa vaṇṇaṃ katheyyāmā’’ti majjhimayāmasamanantare bhagavantaṃ upasaṅkamiṃsu, tā devatā ācariyassa vaṇṇabhaṇanatthaṃ ekekaṃ gāthaṃ abhāsiṃsu.
Upon their rebirth, reflecting on their good deeds and realizing their attainment of prosperity was due to their teacher, they thought, "Let us go and praise our teacher before the Ten-Powered One," and immediately after the middle watch of the night, they approached the Blessed One, and those devas each spoke a stanza to praise the teacher.
Ngay khi tái sinh, họ quán niệm về nghiệp của mình, nhận ra sự thành tựu của mình nhờ vị thầy, và nghĩ: “Chúng ta hãy đi, chúng ta sẽ ca ngợi công đức của vị thầy chúng ta trước Đức Thập Lực,” rồi họ đến gặp Đức Thế Tôn ngay sau giờ canh giữa đêm. Các vị thiên nữ ấy đã nói lên từng bài kệ để ca ngợi công đức của vị thầy.
272
Tattha sabbhirevāti paṇḍitehi, sappurisehi eva.
Therein, sabbhirevāti means only with the wise, with good people.
Trong đó, sabbhirevā có nghĩa là với những người trí, những bậc thiện nhân.
Ra-kāro padasandhikaro.
The letter ‘ra’ creates a sandhi between words.
Chữ ‘ra’ là yếu tố nối liền các từ.
Samāsethāti saha nisīdeyya.
Samāsethāti means one should sit together.
Samāsethā có nghĩa là nên ngồi cùng.
Desanāsīsameva cetaṃ, sabbairiyāpathe sabbhireva saha kubbeyyāti attho.
And this is merely the foremost teaching; the meaning is that one should associate only with good people in all postures.
Đây là sự ưu tiên trong lời dạy, có nghĩa là nên làm mọi tư thế cùng với những bậc thiện nhân.
Kubbethāti kareyya.
Kubbethāti means one should do.
Kubbethā có nghĩa là nên làm.
Santhavanti mittasanthavaṃ.
Santhavanti means friendly association.
Santhava có nghĩa là tình bạn.
Taṇhāsanthavo pana na kenaci saddhiṃ kātabbo, mittasanthavo buddha-paccekabuddha-buddhasāvakehi saha kātabbo.
However, association rooted in craving should not be made with anyone, but friendly association should be made with Buddhas, Paccekabuddhas, and disciples of the Buddha.
Tuy nhiên, không nên kết bạn với ái dục, mà nên kết bạn với chư Phật, chư Phật Độc Giác và các đệ tử của Phật.
Idaṃ sandhāyetaṃ vuttaṃ.
It was with this meaning in mind that this was said.
Lời này được nói ra với ý nghĩa đó.
Satanti buddhādīnaṃ sappurisānaṃ.
Satanti means of good people like the Buddhas and so forth.
Sata có nghĩa là của các bậc thiện nhân như chư Phật, v.v.
Saddhammanti pañcasīladasasīlacatusatipaṭṭhānādibhedaṃ saddhammaṃ, idha pana pañcasīlaṃ adhippetaṃ.
Saddhammanti means the good Dhamma distinguished by the Five Precepts, the Ten Precepts, the Four Foundations of Mindfulness, and so on; here, however, the Five Precepts are intended.
Saddhamma có nghĩa là Chánh pháp với các phân loại như Ngũ giới, Thập giới, Tứ Niệm Xứ, v.v., nhưng ở đây ý nói đến Ngũ giới.
Seyyo hotīti vaḍḍhi hoti.
Seyyo hotīti means there is growth.
Seyyo hotī có nghĩa là có sự tăng trưởng.
Na pāpiyoti lāmakaṃ kiñci na hoti.
Na pāpiyoti means nothing bad happens.
Na pāpiyo có nghĩa là không có điều gì xấu xa.
Nāññatoti vālikādīhi telādīni viya aññato andhabālato paññā nāma na labbhati, tilādīhi pana telādīni viya sataṃ dhammaṃ ñatvā paṇḍitameva sevanto bhajanto labhatīti.
Nāññatoti means wisdom is not obtained from another, from the ignorant and foolish, just as oil and so forth are not obtained from sand and so forth; but by knowing the Dhamma of the good and associating with and attending upon the wise, one obtains it, just as oil and so forth are obtained from sesame seeds and so forth.
Nāññato có nghĩa là trí tuệ không thể có được từ những kẻ ngu dốt, mù quáng, giống như dầu không thể có được từ cát sỏi, v.v., nhưng người ta có thể có được trí tuệ bằng cách biết Chánh pháp của các bậc thiện nhân và phụng sự, thân cận những người trí, giống như dầu có được từ hạt mè, v.v.
Sokamajjheti sokavatthūnaṃ sokānugatānaṃ vā sattānaṃ majjhagato na socati bandhulamallasenāpatissa upāsikā viya, pañcannaṃ corasatānaṃ majjhe dhammasenāpatissa saddhivihāriko saṃkiccasāmaṇero viya ca.
Sokamajjheti means one does not grieve when among things that cause sorrow or among beings afflicted by sorrow, just like the female devotee of General Bandhula the Mallian, and like the novice Saṅkicca, the co-resident of the Dhamma General (Sāriputta), when he was among five hundred robbers.
Sokamajjhe có nghĩa là dù ở giữa những đối tượng của sầu muộn hoặc giữa những chúng sinh bị sầu muộn chi phối, người ấy không sầu muộn, như vị nữ cư sĩ của tướng quân Bandhula Malla, và như Saṅkicca Sāmaṇera, đệ tử của Pháp tướng quân, ở giữa năm trăm tên cướp.
273
Ñātimajjhe virocatīti ñātigaṇamajjhe saṃkiccatherassa saddhivihāriko adhimuttakasāmaṇero viya sobhati.
Ñātimajjhe virocatīti means one shines among one's relatives, like the novice Adhimuttaka, the co-resident of Venerable Saṅkicca.
Ñātimajjhe virocatī có nghĩa là người ấy tỏa sáng giữa dòng họ, như Adhimuttaka Sāmaṇera, đệ tử của Trưởng lão Saṅkicca.
So kira therassa bhāgineyyo hoti, atha naṃ thero āha – ‘‘sāmaṇera, mahallakosi jāto, gaccha, vassāni pucchitvā ehi, upasampādessāmi ta’’nti.
It is said that he was the Venerable's nephew. Then the Venerable said to him, "Novice, you have grown old. Go, ask for your age and come back, I will ordain you."
Nghe nói, vị ấy là cháu của Trưởng lão. Bấy giờ, Trưởng lão nói với vị ấy: “Này Sāmaṇera, con đã lớn rồi, hãy đi hỏi tuổi tác rồi về đây, ta sẽ cho con thọ giới Tỳ-kheo.”
So ‘‘sādhū’’ti theraṃ vanditvā pattacīvaramādāya coraaṭaviyā orabhāge bhaginigāmaṃ gantvā piṇḍāya cari, taṃ bhaginī disvā vanditvā gehe nisīdāpetvā bhojesi.
He, saying "So be it," saluted the Venerable, took his bowl and robe, and went to his sister's village on the other side of the robbers' forest, and went for alms. His sister saw him, saluted him, seated him in the house, and fed him.
Vị ấy đáp: “Thưa vâng,” rồi đảnh lễ Trưởng lão, cầm y bát đi đến làng của người chị ở phía bên kia khu rừng cướp, và khất thực. Người chị thấy vị ấy liền đảnh lễ, mời vào nhà ngồi và cúng dường thức ăn.
So katabhattakicco vassāni pucchi.
Having finished his meal, he asked about her age.
Vị ấy sau khi dùng bữa xong, hỏi về tuổi tác.
Sā ‘‘ahaṃ na jānāmi, mātā me jānātī’’ti āha.
She said, "I do not know, my mother knows."
Người chị nói: “Con không biết, mẹ con biết ạ.”
Atha so ‘‘tiṭṭhatha tumhe, ahaṃ mātusantikaṃ gamissāmī’’ti aṭaviṃ otiṇṇo.
Then he said, "You stay here, I will go to my mother," and entered the forest.
Bấy giờ, vị ấy nói: “Các chị cứ ở lại đây, con sẽ đi đến chỗ mẹ,” rồi đi vào rừng.
Tamenaṃ dūratova corapuriso disvā corānaṃ ārocesi.
A robber's spy saw him from afar and reported it to the robbers.
Một tên cướp trinh sát nhìn thấy vị ấy từ xa và báo cho bọn cướp.
Corā ‘‘sāmaṇero kireko aṭaviṃ otiṇṇo, gacchatha naṃ ānethā’’ti āṇāpetvā ekacce ‘‘mārema na’’nti āhaṃsu, ekacce vissajjemāti.
The robbers commanded, "A novice has entered the forest, go and bring him," and some said, "Let's kill him," while others said, "Let's release him."
Bọn cướp ra lệnh: “Nghe nói có một Sāmaṇera đi vào rừng, hãy đi bắt vị ấy về!” Một số nói: “Hãy giết vị ấy đi!” Một số khác nói: “Hãy thả vị ấy ra!”
Sāmaṇero cintesi – ‘‘ahaṃ sekho sakaraṇīyo, imehi saddhiṃ mantetvā sotthimattānaṃ karissāmī’’ti corajeṭṭhakaṃ āmantetvā, ‘‘upamaṃ te, āvuso, karissāmī’’ti imā gāthā abhāsi –
The novice thought, "I am a sekha, with duties to fulfill; I will consult with these (robbers) and secure my well-being." He then addressed the chief of the robbers and said, "Friend, I will give you a simile," and then he spoke these stanzas:
Sāmaṇera nghĩ: “Ta là một bậc Hữu học, còn việc phải làm. Ta sẽ nói chuyện với bọn này để tự cứu lấy mình.” Rồi vị ấy gọi tên thủ lĩnh bọn cướp và nói: “Này hiền hữu, ta sẽ kể cho ngươi một ví dụ,” và nói lên những bài kệ này:
274
‘‘Ahu atītamaddhānaṃ, araññasmiṃ brahāvane;
“In a vast forest, in a past age,
“Đã có thời quá khứ, trong một khu rừng lớn,
275
Ceto kūṭāni oḍḍetvā, sasakaṃ avadhī tadā.
A hunter set his snares and slew a rabbit then.
Người thợ săn giăng lưới, đã giết một con thỏ.
276
‘‘Sasakañca mataṃ disvā, ubbiggā migapakkhino;
Seeing the dead rabbit, deer and birds were agitated;
“Thấy thỏ đã chết rồi, loài thú chim hoảng sợ,
277
Ekarattiṃ apakkāmuṃ, ‘akiccaṃ vattate idha’.
They fled in one night, thinking, ‘An improper deed has occurred here.’
Trong một đêm bỏ đi, ‘việc không nên làm đã xảy ra ở đây’.”
278
‘‘Tatheva samaṇaṃ hantvā, adhimuttaṃ akiñcanaṃ;
Likewise, by killing Adhimutta, a blameless ascetic,
“Cũng vậy, giết một Sa-môn, Adhimutta vô sở hữu,
279
Addhikā nāgamissanti, dhanajāni bhavissatī’’ti.
Travelers will not come, and there will be a loss of wealth.”
Khách lữ hành sẽ không đến, tài sản sẽ suy giảm.”
280
‘‘Saccaṃ kho samaṇo āha, adhimutto akiñcano;
“Indeed, the ascetic, Adhimutta, who is blameless, speaks the truth;
“Sa-môn nói lời chân thật, Adhimutta vô sở hữu;
281
Addhikā nāgamissanti, dhanajāni bhavissati.
Travelers will not come, and there will be a loss of wealth.
Khách lữ hành sẽ không đến, tài sản sẽ suy giảm.
282
‘‘Sace paṭipathe disvā, nārocessasi kassaci;
If you do not report it to anyone you meet on the path,
“Nếu trên đường đi, ngươi không báo cho ai,
283
Tava saccamanurakkhanto, gaccha bhante yathāsukha’’nti.
Then, reverend sir, upholding your truthfulness, go in peace.”
Vì giữ lời chân thật của ngươi, thưa Tôn giả, hãy đi an lành.”
284
So tehi corehi vissajjito gacchanto ñātayopi disvā tesampi na ārocesi.
Released by those robbers, he departed and, though he saw his relatives, he did not report it to them either.
Vị ấy được bọn cướp thả đi, dù thấy người thân cũng không báo cho họ.
Atha te anuppatte corā gahetvā viheṭhayiṃsu, uraṃ paharitvā paridevamānañcassa mātaraṃ corā etadavocuṃ –
Then, when those relatives arrived, the robbers seized and tormented them. The robbers then said to his mother, who was beating her chest and lamenting:
Bấy giờ, bọn cướp bắt những người thân đến sau và hành hạ họ. Bọn cướp nói với mẹ của vị ấy, người đang đấm ngực than khóc:
285
‘‘Kiṃ te hoti adhimutto, udare vasiko asi;
“What is Adhimutta to you? Were you pregnant with him?
“Adhimutta là gì của bà, người đã ở trong bụng bà?
286
Puṭṭhā me amma akkhāhi, kathaṃ jānemu taṃ maya’’nti.
Mother, tell us, as we ask you, how can we know this from you?”
Bà mẹ ơi, hãy nói cho chúng tôi biết, làm sao chúng tôi có thể biết được điều đó?”
287
‘‘Adhimuttassa ahaṃ mātā, ayañca janako pitā;
“I am Adhimutta’s mother, and this is his father.
“Ta là mẹ của Adhimutta, và đây là cha của nó;
288
Bhaginī bhātaro cāpi, sabbeva idha ñātayo.
His sisters and brothers too, all here are his relatives.
Chị em và anh em cũng vậy, tất cả đều là người thân ở đây.
289
‘‘Akiccakārī adhimutto, yaṃ disvā na nivāraye;
Adhimutta is one who does not perform improper deeds, one who, having seen, does not prevent (evil).
“Adhimutta không làm những việc không nên làm, khi thấy (người thân bị nạn) mà không ngăn cản;
290
Etaṃ kho vattaṃ samaṇānaṃ, ariyānaṃ dhammajīvinaṃ.
This is indeed the conduct of ascetics, of noble ones who live by the Dhamma.
Đó là hạnh của các Sa-môn, của các bậc Thánh sống theo Pháp.
291
‘‘Saccavādī adhimutto, yaṃ disvā na nivāraye;
Adhimutta is a speaker of truth, one who, having seen, does not prevent (evil).
“Adhimutta nói lời chân thật, khi thấy (người thân bị nạn) mà không ngăn cản;
292
Adhimuttassa suciṇṇena, saccavādissa bhikkhuno;
By the well-practiced conduct of Adhimutta, the bhikkhu who speaks the truth,
Nhờ sự thực hành tốt đẹp của Adhimutta, vị Tỳ-kheo nói lời chân thật;
293
Sabbeva abhayaṃ pattā, sotthiṃ gacchantu ñātayo’’ti.
May all my relatives attain safety and go well!”
Tất cả đều đạt được sự vô úy, nguyện cho người thân được an lành!”
294
Evaṃ te corehi vissajjitā gantvā adhimuttaṃ āhaṃsu –
Thus, released by the robbers, they went and said to Adhimutta:
Như vậy, những người thân được bọn cướp thả đi, đến gặp Adhimutta và nói:
295
‘‘Tava tāta suciṇṇena, saccavādissa bhikkhuno;
“Dear son, through the well-practiced conduct of you, the bhikkhu who speaks the truth,
“Này con, nhờ sự thực hành tốt đẹp của con, vị Tỳ-kheo nói lời chân thật,
296
Sabbeva abhayaṃ pattā, sotthiṃ paccāgamamhase’’ti.
All of us attained safety and returned well.”
Tất cả chúng con đều đạt được sự vô úy, và đã trở về an lành.”
297
Tepi pañcasatā corā pasādaṃ āpajjitvā adhimuttassa sāmaṇerassa santike pabbajiṃsu.
Those five hundred robbers, too, became filled with faith and went forth into homelessness under the novice Adhimutta.
Năm trăm tên cướp ấy cũng phát tâm tịnh tín và xuất gia theo Adhimuttaka Sāmaṇera.
So te ādāya upajjhāyassa santikaṃ gantvā paṭhamaṃ attanā upasampanno pacchā te pañcasate attano antevāsike katvā upasampādesi.
Taking them, he went to his preceptor and first received upasampadā himself, and afterward, he ordained those five hundred, making them his disciples.
Vị ấy dẫn họ đến chỗ vị Bổn sư của mình, trước hết tự mình thọ giới Tỳ-kheo, sau đó cho năm trăm người ấy, những đệ tử của mình, thọ giới Tỳ-kheo.
Te adhimuttatherassa ovāde ṭhitā sabbe aggaphalaṃ arahattaṃ pāpuṇiṃsu.
Abiding by the advice of Venerable Adhimutta, all of them attained the highest fruit, Arahantship.
Những vị ấy, sống theo lời giáo huấn của Trưởng lão Adhimutta, tất cả đều đạt được quả vị tối thượng là A-la-hán.
Imamatthaṃ gahetvā devatā ‘‘sataṃ saddhammamaññāya ñātimajjhe virocatī’’ti āha.
Taking this meaning, the deva said, "By understanding the Dhamma of the good, one shines among one's relatives."
Lấy ý nghĩa này, vị thiên nữ đã nói: “Biết Chánh pháp của bậc thiện nhân, người ấy tỏa sáng giữa dòng họ.”
298
Sātatanti satataṃ sukhaṃ vā ciraṃ tiṭṭhantīti vadati.
Sātatanti means constantly or lasts long and happily.
Sātata có nghĩa là thường xuyên, hoặc sống an lành lâu dài.
Sabbāsaṃ voti sabbāsaṃ tumhākaṃ.
Sabbāsaṃ voti means for all of you.
Sabbāsaṃ vo có nghĩa là của tất cả các ngươi.
Pariyāyenāti kāraṇena.
Pariyāyenāti means for this reason.
Pariyāyenā có nghĩa là do nguyên nhân.
Sabbadukkhā pamuccatīti, na kevalaṃ seyyova hoti, na ca kevalaṃ paññaṃ labhati, sokamajjhe na socati, ñātimajjhe virocati, sugatiyaṃ nibbattati, ciraṃ sukhaṃ tiṭṭhati, sakalasmā pana vaṭṭadukkhāpi muccatīti.
Sabbadukkhā pamuccatīti means one is not merely superior, nor merely gains wisdom, nor merely does not grieve amidst sorrow, nor merely shines among relatives, nor merely is reborn in a good destination, nor merely lasts long in happiness, but is also released from all the suffering of saṃsāra.
Sabbadukkhā pamuccatī có nghĩa là không chỉ trở nên tốt đẹp hơn, không chỉ có được trí tuệ, không sầu muộn giữa những khổ đau, tỏa sáng giữa dòng họ, tái sinh vào cõi thiện, sống an lành lâu dài, mà còn thoát khỏi tất cả khổ đau trong vòng luân hồi.
Paṭhamaṃ.
First*.
Thứ nhất.
299
2. Maccharisuttavaṇṇanā
2. Commentary on the Maccharisutta
2. Lời giải thích về Kinh Maccharī
300
32. Dutiye maccherā ca pamādā cāti attasampattinigūhanalakkhaṇena maccherena ceva sativippavāsalakkhaṇena pamādena ca.
32. In the second, maccherā ca pamādā cāti means by stinginess, characterized by concealing one's own prosperity, and by heedlessness, characterized by loss of mindfulness.
32. Trong kinh thứ hai, maccherā ca pamādā cā có nghĩa là do sự keo kiệt, đặc trưng bởi việc che giấu tài sản của mình, và do sự buông lung, đặc trưng bởi sự mất chánh niệm.
Ekacco hi ‘idaṃ me dentassa parikkhayaṃ gamissati, mayhaṃ vā gharamānusakānaṃ vā na bhavissatī’’ti macchariyena dānaṃ na deti.
For some, out of stinginess, do not give gifts, thinking, "If I give this, it will be diminished, or it will not be enough for me or my household."
Có người vì keo kiệt mà không bố thí, nghĩ rằng: “Nếu cho cái này, nó sẽ hao mòn; tôi hoặc những người trong nhà sẽ không có gì.”
Ekacco khiḍḍādipasutattā ‘dānaṃ dātabba’’nti cittampi na uppādeti.
Some, being engrossed in play and other diversions, do not even generate the thought, "A gift should be given."
Có người vì quá say mê trò vui v.v. mà tâm cũng không khởi lên ý nghĩ “cần phải bố thí”.
Evaṃ dānaṃ na dīyatīti evametaṃ yasadāyakaṃ sirīdāyakaṃ sampattidāyakaṃ sukhadāyakaṃ dānaṃ nāma na dīyatītiādinā kāraṇaṃ kathesi.
"Thus, an offering is not given": he stated the reason with phrases like, "Thus, this offering, which bestows fame, prosperity, wealth, and happiness, is not given."
Như vậy, sự bố thí không được thực hiện—nghĩa là, với cách thức như vậy, sự bố thí mang lại danh tiếng, mang lại vinh quang, mang lại tài sản, mang lại hạnh phúc này không được thực hiện—với câu nói này và các câu tương tự, Ngài đã giải thích lý do.
Puññaṃ ākaṅkhamānenāti pubbacetanādibhedaṃ puññaṃ icchamānena.
"By one desiring merit": by one desiring merit, which has categories such as prior intention.
Bởi người mong cầu phước đức—nghĩa là, bởi người mong muốn phước đức với các loại khác nhau như tư niệm trước (pubbacetanā).
Deyyaṃ hoti vijānatāti atthi dānassa phalanti jānantena dātabbamevāti vadati.
"It should be given by one who knows": he says that it should indeed be given by one who knows, "There is fruit of giving."
Vật đáng thí phải được biết—nghĩa là, người biết rằng có quả báo của sự bố thí thì phải bố thí—đó là điều được nói.
301
Tameva bālaṃ phusatīti taṃyeva bālaṃ idhalokaparalokesu jighacchā ca pipāsā ca phusati anubandhati na vijahati.
"It touches that very fool": that very fool, who is stingy and unwilling to give, is encountered by hunger and thirst in this world and the next world; they follow and bind him and do not abandon him.
Sự đó chạm đến kẻ ngu—nghĩa là, sự đó (đói và khát) chạm đến, theo sát và không rời bỏ kẻ ngu ấy ở đời này và đời sau.
Tasmāti yasmā tameva phusati, tasmā.
"Therefore": because it touches that very fool, therefore.
Do vậy—nghĩa là, bởi vì sự đó chỉ chạm đến kẻ ngu ấy, nên.
Vineyya maccheranti maccheramalaṃ vinetvā.
"Having removed stinginess": having removed the defilement of stinginess.
Sau khi loại bỏ sự xan tham—nghĩa là, sau khi loại bỏ cấu uế xan tham.
Dajjā dānaṃ malābhibhūti malābhibhū hutvā taṃ maccheramalaṃ abhibhavitvā dānaṃ dadeyya.
"Having overcome defilement, one should give an offering": having become one who overcomes defilement, having overcome that defilement of stinginess, one should give an offering.
Người chiến thắng cấu uế nên bố thí—nghĩa là, sau khi chiến thắng cấu uế xan tham ấy, người ấy nên bố thí.
302
Te matesu na mīyantīti adānasīlatāya maraṇena matesu na mīyanti.
"They do not perish among the dead": they do not perish among those dead by being called "dead" due to not giving.
Họ không chết giữa những người đã chết—nghĩa là, họ không chết giữa những người đã chết bởi cái chết do không có thói quen bố thí.
Yathā hi mato samparivāretvā ṭhapite bahumhipi annapānādimhi ‘‘idaṃ imassa hotu, idaṃ imassā’’ti uṭṭhahitvā saṃvibhāgaṃ na karoti, evaṃ adānasīlopīti matakassa ca adānasīlassa ca bhogā samasamā nāma honti.
Just as a dead person, when much food and drink are placed around him, does not rise up and share, saying, "Let this be for this one, let this be for that one," so too one who does not give does not share. Thus, the possessions of a dead person and one who does not give are truly equal.
Quả thật, một người đã chết, dù có nhiều thức ăn, đồ uống v.v. được đặt xung quanh, cũng không thể đứng dậy mà phân chia, "cái này cho người này, cái này cho người kia". Tương tự, người không có thói quen bố thí cũng vậy. Như vậy, tài sản của người đã chết và người không có thói quen bố thí là như nhau.
Tena dānasīlā evarūpesu matesu na mīyantīti attho.
Therefore, the meaning is that those who are generous do not perish among such dead ones.
Theo đó, những người có thói quen bố thí không chết giữa những người đã chết như vậy—đó là ý nghĩa.
Panthānaṃva saha vajaṃ, appasmiṃ ye pavecchantīti yathā addhānaṃ kantāramaggaṃ saha vajantā pathikā saha vajantānaṃ pathikānaṃ appasmiṃ pātheyye saṃvibhāgaṃ katvā pavecchanti dadantiyeva, evamevaṃ ye pana anamataggaṃ saṃsārakantāraṃ saha vajantā saha vajantānaṃ appasmimpi deyyadhamme saṃvibhāgaṃ katvā dadantiyeva, te matesu na mīyanti.
"Like travelers going together on a path, those who share even a little": just as travelers going together on a long, wilderness road share even a little provisions with their fellow travelers and give, so too those who, going together on the beginningless wilderness of Saṃsāra, share even a little of their transferable merit with their fellow travelers and give, they do not perish among the dead.
Như những người cùng đi trên đường, phân phát khi có ít—nghĩa là, như những người lữ hành cùng đi trên con đường hoang vắng, họ chia sẻ đồ ăn ít ỏi của mình cho những người cùng đi; tương tự, những ai cùng đi trên con đường luân hồi vô thủy vô chung, và chia sẻ những vật đáng thí dù ít ỏi của mình cho những người cùng đi, thì họ không chết giữa những người đã chết.
303
Esa dhammo sanantanoti esa porāṇako dhammo, sanantanānaṃ vā paṇḍitānaṃ esa dhammoti.
"This is the ancient Dhamma": this is the ancient Dhamma, or this is the Dhamma of wise people from ancient times.
Đây là Pháp cổ xưa—nghĩa là, đây là Pháp cổ xưa, hoặc đây là Pháp của các bậc hiền trí cổ xưa.
Appasmeketi appasmiṃ deyyadhamme eke.
"Some with little": some, when they have little offering material.
Một số người trong số ít—nghĩa là, một số người khi có ít vật đáng thí.
Pavecchantīti dadanti.
"They give": they give offerings.
Họ phân phát—nghĩa là, họ bố thí.
Bahuneke na dicchareti bahunāpi bhogena samannāgatā ekacce na dadanti.
"Many do not wish to give": some, though endowed with much wealth, do not give.
Nhiều người thì không muốn bố thí—nghĩa là, một số người, dù có nhiều tài sản, cũng không bố thí.
Sahassena samaṃ mitāti sahassena saddhiṃ mitā, sahassa dānasadisā hoti.
"Measured as equal to a thousand": measured together with a thousand, it is like a gift of a thousand.
Được so sánh với một ngàn—nghĩa là, được so sánh với một ngàn, thì tương đương với sự bố thí một ngàn.
304
Duranvayoti duranugamano, duppūroti attho.
"Hard to follow": hard to reach, meaning hard to fulfill.
Khó theo dõi—nghĩa là, khó đi theo, khó làm cho đầy đủ.
Dhammaṃ careti dasakusalakammapathadhammaṃ carati.
"Practices the Dhamma": practices the Dhamma of the ten wholesome courses of action.
Thực hành Pháp—nghĩa là, thực hành Pháp mười thiện nghiệp đạo.
Yopi samuñjakañcareti yo api khalamaṇḍalādisodhanapalālapoṭhanādivasena samuñjakañcarati.
"Even one who gathers sweepings": even one who gathers grains discarded by others by sweeping, by cleaning threshing floors and piles of straw.
Dù người đó có nhặt nhạnh—nghĩa là, dù người đó nhặt nhạnh bằng cách dọn dẹp sân đập lúa hoặc đống rơm.
Dārañca posanti dārañca posanto.
"And supports his family": and supports his wife and children.
Nuôi vợ con—nghĩa là, nuôi vợ con.
Dadaṃ appakasminti appakasmiṃ paṇṇasākamattasmimpi saṃvibhāgaṃ katvā dadantova so dhammaṃ carati.
"Giving even a little": he practices the Dhamma by sharing and giving, even if it's just a little, like a mere pot of vegetables.
Bố thí dù ít ỏi—nghĩa là, người đó thực hành Pháp bằng cách chia sẻ và bố thí dù chỉ một ít rau lá.
Sataṃ sahassānanti sahassaṃ sahassaṃ katvā gaṇitānaṃ purisānaṃ sataṃ, satasahassanti attho.
"Of a hundred thousand": a hundred men counted as a thousand, meaning a hundred thousand.
Một trăm ngàn—nghĩa là, một trăm người được tính là một ngàn, tức là một trăm ngàn.
Sahassayāginanti bhikkhusahassassa vā yāgo kahāpaṇasahassena vā nibbattito yāgopi sahassayāgo.
"Of those who make a thousand offerings": an offering to a thousand bhikkhus, or an offering made with a thousand kahāpaṇas, is also called a thousand offerings.
Người đã bố thí một ngàn—nghĩa là, một sự bố thí cho một ngàn Tỳ-kheo, hoặc một sự bố thí được thực hiện bằng một ngàn đồng kahāpaṇa, cũng là một sự bố thí một ngàn.
So etesaṃ atthīti sahassayāgino, tesaṃ sahassayāginaṃ.
They have that, thus they are called "those who make a thousand offerings"; of those who make a thousand offerings.
Những người đó có sự bố thí một ngàn này, nên họ là những người đã bố thí một ngàn.
Etena dasannaṃ vā bhikkhukoṭīnaṃ dasannaṃ vā kahāpaṇakoṭīnaṃ piṇḍapāto dassito hoti.
By this, a meal given to ten crores of bhikkhus or ten crores of kahāpaṇas is shown.
Với điều này, sự cúng dường vật thực cho mười triệu Tỳ-kheo hoặc mười triệu đồng kahāpaṇa đã được chỉ ra.
Ye ettakaṃ dadanti, te kalampi nagghanti tathāvidhassāti āha.
He said that those who give so much are not worth a kala (a fraction) of such a person.
Ngài nói rằng những người bố thí số lượng nhiều như vậy cũng không đáng giá một phần nhỏ nào so với người như vậy.
Yvāyaṃ samuñjakaṃ carantopi dhammaṃ carati, dāraṃ posentopi, appakasmiṃ dadantopi, tathāvidhassa ete sahassayāgino kalampi nagghanti.
That one who, though gathering sweepings, practices the Dhamma, and though supporting his family, and though giving a little, those who make a thousand offerings are not worth a kala of such a person.
Người dù nhặt nhạnh vẫn thực hành Pháp, dù nuôi vợ con vẫn thực hành Pháp, dù bố thí ít ỏi vẫn thực hành Pháp, thì những người bố thí một ngàn kia không đáng giá một phần nhỏ nào so với người như vậy.
Yaṃ tena daliddena ekapaṭivīsakamattampi salākabhattamattampi vā dinnaṃ, tassa dānassa sabbesampi tesaṃ dānaṃ kalaṃ nagghatīti.
The meaning is that the offering given by that poor person, even if it is just a single portion or a ticket-meal, the offerings of all those (rich donors) are not worth a kala of that offering.
Sự bố thí dù chỉ một phần ăn hoặc một phần thực phẩm theo phiếu của người nghèo đó, thì tất cả sự bố thí của những người kia cũng không đáng giá một phần nhỏ nào so với sự bố thí đó.
Kalaṃ nāma soḷasabhāgopi satabhāgopi sahassabhāgopi.
"Kala" means a sixteenth part, a hundredth part, or a thousandth part.
Kalaṃ có nghĩa là một phần mười sáu, một phần trăm, hoặc một phần ngàn.
Idha satabhāgo gahito.
Here, a hundredth part is taken.
Ở đây, một phần trăm được lấy.
Yaṃ tena dānaṃ dinnaṃ, tasmiṃ satadhā vibhatte itaresaṃ dasakoṭisahassadānaṃ tato ekakoṭṭhāsampi nagghatīti āha.
He said that if the offering given by that person is divided into a hundred parts, the ten-crore-thousand-offering of the others is not worth even one part of that.
Ngài nói rằng, khi sự bố thí mà người đó đã thực hiện được chia thành một trăm phần, thì sự bố thí mười triệu ngàn của những người khác cũng không đáng giá một phần nhỏ nào trong số đó.
305
Evaṃ tathāgate dānassa agghaṃ karonte samīpe ṭhitā devatā cintesi – ‘‘evaṃ bhagavā mahantaṃ dānaṃ pādena pavaṭṭetvā ratanasatike viya narake pakkhipanto idaṃ evaṃ parittakaṃ dānaṃ candamaṇḍale paharanto viya ukkhipati, kathaṃ nu kho etaṃ mahapphalatara’’nti jānanatthaṃ gāthāya ajjhabhāsi.
When the Tathāgata thus valued the offering, the devatā standing nearby thought, "Thus, the Blessed One, kicking aside a great offering as if throwing it into a hundred-fathom deep hell, lifts up this very small offering as if striking the moon disk. How can this be more fruitful?" She then spoke in verse to understand.
Khi Như Lai đang định giá sự bố thí như vậy, một vị thiên đứng gần đó đã suy nghĩ: "Thế Tôn đã dẫm nát một sự bố thí lớn như thể ném nó vào một hố địa ngục sâu trăm tầm, và nâng cao sự bố thí nhỏ bé này như thể đặt nó lên vòng mặt trăng. Làm sao mà sự bố thí này lại có quả báo lớn hơn?" Để biết điều đó, vị thiên đã nói lên bài kệ.
Tattha kenāti kena kāraṇena.
Therein, "by what" (kenā): by what reason.
Trong đó, bằng gì—nghĩa là, bằng lý do gì.
Mahaggatoti mahattaṃ gato, vipulassetaṃ vevacanaṃ.
"Greatly grown": reached greatness. This is a synonym for extensive.
Đã trở nên vĩ đại—nghĩa là, đã đạt đến sự vĩ đại, đó là từ đồng nghĩa của sự rộng lớn.
Samena dinnassāti samena dinnassa dānassa.
"Of that given justly": of the offering given justly.
Của sự bố thí đã được thực hiện một cách công bằng—nghĩa là, của sự bố thí đã được thực hiện một cách công bằng.
Athassā bhagavā dānaṃ vibhajitvā dassento dadanti heketiādimāha.
Then the Blessed One, desiring to show her the division of offerings, spoke the words, "Some indeed give," and so on.
Sau đó, Thế Tôn đã phân tích sự bố thí và chỉ ra, Ngài nói: Một số người bố thí, v.v.
Tattha visame niviṭṭhāti visame kāyavacīmanokamme patiṭṭhitā hutvā.
Therein, "established in inequity": established in unwholesome bodily, verbal, and mental actions.
Trong đó, an trú trong sự bất bình đẳng—nghĩa là, an trú trong những hành động thân, khẩu, ý bất thiện.
Chetvāti pothetvā.
"Having beaten": having tormented.
Sau khi đánh đập—nghĩa là, sau khi tra tấn.
Vadhitvāti māretvā.
"Having struck": having killed.
Sau khi giết hại—nghĩa là, sau khi giết chết.
Socayitvāti paraṃ sokasamappitaṃ katvā.
"Having caused to grieve": having made others overwhelmed with sorrow.
Sau khi làm cho đau khổ—nghĩa là, sau khi làm cho người khác chìm đắm trong đau khổ.
Assumukhāti assumukhasammissā.
"With tearful faces": mixed with tearful faces.
Với khuôn mặt đẫm lệ—nghĩa là, với khuôn mặt đẫm lệ.
Paraṃ rodāpetvā dinnadānañhi assumukhadānanti vuccati.
Indeed, an offering given after making others weep is called an offering with tearful faces.
Quả thật, sự bố thí được thực hiện sau khi làm cho người khác khóc được gọi là bố thí với khuôn mặt đẫm lệ.
Sadaṇḍāti daṇḍena tajjetvā paharitvā dinnadakkhiṇā sadaṇḍāti vuccati.
"With a stick": a donation given after threatening and striking with a stick is called a "donation with a stick."
Với cây gậy—nghĩa là, sự cúng dường được thực hiện sau khi đe dọa và đánh đập bằng cây gậy được gọi là sadaṇḍā.
Evanti nāhaṃ sammāsambuddhatāya mahādānaṃ gahetvā appaphalaṃ nāma kātuṃ sakkomi parittakadānaṃ vā mahapphalaṃ nāma.
"Thus": "I, being a Perfectly Self-Enlightened One, am not able to make a great offering have little fruit, nor a small offering have great fruit.
Như vậy—nghĩa là, ta, với tư cách là một Đức Phật Chánh Đẳng Giác, không thể làm cho một sự bố thí lớn trở thành có quả báo ít, hoặc một sự bố thí nhỏ trở thành có quả báo lớn.
Idaṃ pana mahādānaṃ attano uppattiyā aparisuddhatāya evaṃ appaphalaṃ nāma hoti, itaraṃ parittadānaṃ attano uppattiyā parisuddhatāya evaṃ mahapphalaṃ nāmāti imamatthaṃ dassento evantiādimāhāti.
But this great offering, due to its impure origin, thus has little fruit, and the other small offering, due to its pure origin, thus has great fruit." The Blessed One, wishing to show this meaning, spoke the words beginning with "thus."
Tuy nhiên, sự bố thí lớn này, do sự không thanh tịnh trong nguồn gốc của nó, trở thành có quả báo ít; còn sự bố thí nhỏ kia, do sự thanh tịnh trong nguồn gốc của nó, trở thành có quả báo lớn—để chỉ ra ý nghĩa này, Ngài đã nói Như vậy, v.v.
Dutiyaṃ.
Second.
Thứ hai.
306
3. Sādhusuttavaṇṇanā
3. The Commentary on the Sādhu Sutta
3. Lời giải thích Kinh Sādhu
307
33. Tatiye udānaṃ udānesīti udāhāraṃ udāhari.
33. In the third Sutta, "he uttered an udāna": he uttered an exclamation.
33. Trong Kinh thứ ba, đã nói lên lời cảm hứng—nghĩa là, đã nói lên lời tuyên bố.
Yathā hi yaṃ telaṃ mānaṃ gahetuṃ na sakkoti vissanditvā gacchati, taṃ avasesakoti vuccati.
Just as oil that cannot be contained by a measure overflows is called avasesa (residue),
Quả thật, dầu không thể chứa trong một cái đấu sẽ tràn ra ngoài, được gọi là phần còn lại (avasesa). Nước không thể chứa trong một cái ao sẽ chảy tràn, được gọi là dòng lũ (ogha).
Yañca jalaṃ taḷākaṃ gahetuṃ na sakkoti, ajjhottharitvā gacchati, taṃ oghoti vuccati, evamevaṃ yaṃ pītivacanaṃ hadayaṃ gahetuṃ na sakkoti, adhikaṃ hutvā anto asaṇṭhahitvā bahi nikkhamati, taṃ udānanti vuccati.
and water that cannot be contained by a pond overflows is called an ogha (flood), so too, a word of joy that the heart cannot contain, being excessive and not settling within but coming forth outside, is called an udāna.
Cũng vậy, lời nói hoan hỷ nào không thể chứa trong trái tim, mà tràn ra ngoài, không thể ở yên bên trong, thì được gọi là udāna.
Evarūpaṃ pītimayaṃ vacanaṃ nicchāresīti attho.
The meaning is that he uttered such a word full of joy.
Đó là ý nghĩa của việc Ngài đã phát ra lời nói đầy hoan hỷ như vậy.
Saddhāyapi sāhu dānanti kammañca kammaphalañca saddahitvāpi dinnadānaṃ sāhu laddhakaṃ bhaddakameva.
"Giving with faith is good": an offering given with faith in kamma and its fruit is indeed good, excellent.
Sự bố thí với đức tin cũng tốt—nghĩa là, sự bố thí được thực hiện với đức tin vào nghiệp và quả của nghiệp cũng tốt, là điều tốt đẹp.
Āhūti kathenti.
"They say": they declare.
Họ nói—nghĩa là, họ nói.
Kathaṃ panetaṃ ubhayaṃ samaṃ nāma hotīti?
How can both be equal?
Làm sao cả hai điều này lại có thể như nhau?
Jīvitabhīruko hi yujjhituṃ na sakkoti, khayabhīruko dātuṃ na sakkoti.
Indeed, one who fears for his life cannot fight; one who fears loss cannot give.
Quả thật, người sợ chết không thể chiến đấu; người sợ mất mát không thể bố thí.
‘‘Jīvitañca rakkhissāmi yujjhissāmi cā’’ti hi vadanto na yujjhati.
One who says, "I will protect my life and I will fight," does not fight.
Người nói: "Ta sẽ bảo vệ mạng sống và ta sẽ chiến đấu" thì không chiến đấu.
Jīvite pana ālayaṃ vissajjetvā, ‘‘chejjaṃ vā hotu maraṇaṃ vā, gaṇhissāmetaṃ issariya’’nti ussahantova yujjhati.
But one who gives up attachment to life and strives, saying, "Let there be cutting or death, I will seize this sovereignty," indeed fights.
Nhưng người từ bỏ sự gắn bó với mạng sống, và nỗ lực nói: "Dù bị cắt xẻ hay chết đi, ta sẽ giành lấy quyền lực này," thì mới chiến đấu.
‘‘Bhoge ca rakkhissāmi, dānañca dassāmī’’ti vadanto na dadāti.
One who says, "I will protect my wealth and I will give offerings," does not give.
Người nói: "Ta sẽ bảo vệ tài sản và ta sẽ bố thí" thì không bố thí.
Bhogesu pana ālayaṃ vissajjetvā mahādānaṃ dassāmīti ussahantova deti.
But one who gives up attachment to wealth and strives, saying, "I will give a great offering," indeed gives.
Nhưng người từ bỏ sự gắn bó với tài sản, và nỗ lực nói: "Ta sẽ thực hiện một sự bố thí lớn," thì mới bố thí.
Evaṃ dānañca yuddhañca samaṃ hoti.
Thus, giving and fighting are equal.
Như vậy, bố thí và chiến đấu là như nhau.
Kiñca bhiyyo?
Moreover, what else?
Hơn nữa, điều gì?
Appāpi santā bahuke jinantīti yathā ca yuddhe appakāpi vīrapurisā bahuke bhīrupurise jinanti, evaṃ saddhādisampanno appakampi dānaṃ dadanto bahumaccheraṃ maddati, bahuñca dānavipākaṃ adhigacchati.
"Even a few, being present, conquer many." Just as in battle, even a few brave men conquer many fearful men, so too, one endowed with faith, giving even a small gift, crushes much miserliness and obtains great results from the act of giving (dāna).
Dù ít ỏi nhưng vẫn chiến thắng nhiều – Cũng như trong chiến trận, dù ít người dũng cảm vẫn chiến thắng nhiều người nhút nhát, tương tự, người đầy đủ đức tin v.v. dù bố thí ít ỏi vẫn chế ngự được sự keo kiệt lớn, và đạt được quả báo bố thí lớn.
Evampi dānañca yuddhañca samānaṃ.
Thus, giving (dāna) and battle are alike.
Như vậy, bố thí và chiến trận là tương đồng.
Tenevāha –
Therefore, it is said:
Vì thế, Ngài đã nói –
308
‘‘Appampi ce saddahāno dadāti,
"If one gives, having faith, even a little,
“Nếu người có đức tin bố thí dù ít ỏi,
309
Teneva so hoti sukhī paratthā’’ti.
By that alone one becomes happy in the next world."
Chính nhờ đó người ấy được hạnh phúc ở đời sau.”
310
Imassa ca panatthassa pakāsanatthaṃ ekasāṭakabrāhmaṇavatthu ca aṅkuravatthu ca vitthāretabbaṃ.
To elucidate the meaning of this, the story of the Brahmana with one robe (Ekasāṭakabrāhmaṇavatthu) and the story of Angura (Aṅkuravatthu) should be expanded upon.
Để làm sáng tỏ ý nghĩa này, câu chuyện về Bà-la-môn Một Áo (ekasāṭakabrāhmaṇa) và câu chuyện về Aṅkura cần được kể rộng rãi.
311
Dhammaladdhassāti dhammena samena laddhassa bhogassa dhammaladdhassa ca puggalassa.
Dhammaladdhassa means wealth acquired righteously, and also a person who has attained the Dhamma.
Dhammaladdhassa (của người được Pháp) – của tài sản được thâu hoạch một cách hợp Pháp, và của người được Pháp.
Ettha puggalo laddhadhammo nāma adhigatadhammo ariyapuggalo.
Here, a person who has attained the Dhamma (laddhadhammo) is an Ariya-person who has realized the Dhamma.
Ở đây, người được Pháp (laddhadhammo) là bậc Thánh (ariyapuggala) đã chứng ngộ Pháp (adhigatadhammo).
Iti yaṃ dhammaladdhassa bhogassa dānaṃ dhammaladdhassa ariyapuggalassa dīyati, tampi sādhūti attho.
Thus, the meaning is that giving wealth acquired righteously to an Ariya-person who has attained the Dhamma is also good.
Vậy, bố thí tài sản được thâu hoạch hợp Pháp cho bậc Thánh đã chứng ngộ Pháp cũng là điều tốt đẹp, đó là ý nghĩa.
Yo dhammaladdhassāti imasmimpi gāthāpade ayameva attho.
The same meaning applies to this verse-line, " Yo dhammaladdhassā."
Trong câu kệ Yo dhammaladdhassā (Người nào của người được Pháp) này, ý nghĩa cũng tương tự.
Uṭṭhānavīriyādhigatassāti uṭṭhānena ca vīriyena ca adhigatassa bhogassa.
Uṭṭhānavīriyādhigatassā means wealth acquired through diligence and effort.
Uṭṭhānavīriyādhigatassā (của tài sản được thâu hoạch nhờ sự tinh tấn và nỗ lực) – của tài sản được thâu hoạch nhờ sự tinh tấn và nỗ lực.
Vetaraṇinti desanāsīsamattametaṃ.
Vetaraṇiṃ is merely a heading for the discourse.
Vetaraṇiṃ (sông Vaitaraṇī) – đây chỉ là tiêu đề của bài pháp.
Yamassa pana vetaraṇimpi sañjīvakāḷasuttādayopi ekatiṃsamahānirayepi sabbasova atikkamitvāti attho.
But the meaning is that one completely surpasses even Yama's Vetaraṇī river, as well as the thirty-one great hells such as Sañjīva, Kāḷasutta, and others.
Nhưng ý nghĩa là hoàn toàn vượt qua cả sông Vaitaraṇī của Diêm vương, và cả ba mươi mốt đại địa ngục như Sañjīva, Kāḷasutta v.v.
312
Viceyya dānanti vicinitvā dinnadānaṃ.
Viceyya dānaṃ means a gift given after careful selection.
Viceyya dānaṃ (bố thí có chọn lọc) – bố thí được thực hiện sau khi đã chọn lọc.
Tattha dve vicinanā dakkhiṇāvicinanaṃ dakkhiṇeyyavicinanañca.
Therein, there are two kinds of selection: selection of the donation (dakkhiṇāvicinanaṃ) and selection of the recipient (dakkhiṇeyyavicinanañca).
Ở đây có hai loại chọn lọc: chọn lọc vật cúng dường (dakkhiṇāvicinana) và chọn lọc người xứng đáng thọ nhận (dakkhiṇeyyavicinana).
Tesu lāmakalāmake paccaye apanetvā paṇītapaṇīte vicinitvā tesaṃ dānaṃ dakkhiṇāvicinanaṃ nāma.
Among these, setting aside inferior provisions and selecting the choicest ones to give is called the selection of the donation (dakkhiṇāvicinanaṃ).
Trong số đó, việc loại bỏ những vật phẩm thô kém và chọn lọc những vật phẩm tinh tế để bố thí được gọi là chọn lọc vật cúng dường.
Vipannasīle ito bahiddhā pañcanavutipāsaṇḍabhede vā dakkhiṇeyye pahāya sīlādiguṇasampannānaṃ sāsane pabbajitānaṃ dānaṃ dakkhiṇeyyavicinanaṃ nāma.
Discarding those of corrupt virtue, or those outside this Dispensation belonging to the ninety-five kinds of heretics, and giving to monastics in the Dispensation who are endowed with virtues such as sīla, is called the selection of the recipient (dakkhiṇeyyavicinanaṃ).
Việc từ bỏ những người phá giới và những người thuộc chín mươi lăm loại ngoại đạo, mà bố thí cho những vị xuất gia trong giáo pháp, những người đầy đủ các đức tính như giới v.v., được gọi là chọn lọc người xứng đáng thọ nhận.
Evaṃ dvīhākārehi viceyya dānaṃ.
Thus, a gift chosen in these two ways.
Như vậy, bố thí có chọn lọc theo hai cách này.
Sugatappasatthanti sugatena vaṇṇitaṃ.
Sugatappasatthaṃ means praised by the Sugata.
Sugatappasatthaṃ (được Thiện Thệ khen ngợi) – được Thiện Thệ tán thán.
Tattha dakkhiṇeyyavicinanaṃ dassento ye dakkhiṇeyyātiādimāha.
Therein, to show the selection of the recipient (dakkhiṇeyyavicinanaṃ), the deity uttered the verse beginning with " Ye dakkhiṇeyyā" (those worthy of offerings).
Ở đây, để chỉ ra sự chọn lọc người xứng đáng thọ nhận, Ngài nói: ye dakkhiṇeyyā (những người xứng đáng thọ nhận) v.v.
Bījāni vuttāni yathāti iminā pana dakkhiṇāvicinanaṃ āha.
By " Bījāni vuttāni yathā" (as seeds sown), however, the selection of the donation (dakkhiṇāvicinanaṃ) is indicated.
Còn với câu Bījāni vuttāni yathā (như những hạt giống được gieo), Ngài nói về sự chọn lọc vật cúng dường.
Avipannabījasadisā hi vicinitvā gahitā paṇītapaṇītā deyyadhammāti.
For indeed, choice and excellent articles of donation, selected and taken, are like uncorrupted seeds.
Quả thật, những vật phẩm cúng dường tinh tế được chọn lọc kỹ lưỡng thì giống như những hạt giống không bị hư hỏng.
313
Pāṇesupi sādhu saṃyamoti pāṇesu saṃyatabhāvopi bhaddako.
Pāṇesupi sādhu saṃyamo means restraint towards living beings is also good.
Pāṇesupi sādhu saṃyamo (sự tự chế đối với chúng sinh cũng là tốt) – sự tự chế đối với chúng sinh cũng là điều tốt đẹp.
Ayaṃ devatā itarāhi kathitaṃ dānānisaṃsaṃ atikkamitvā sīlānisaṃsaṃ kathetumāraddhā.
This deity, surpassing the benefits of giving mentioned by the others, began to speak of the benefits of virtue (sīla).
Vị thiên nhân này đã vượt qua lời khen ngợi về lợi ích của bố thí được các vị khác nói đến, và bắt đầu nói về lợi ích của giới hạnh.
Aheṭhayaṃ caranti avihiṃsanto caramāno.
Aheṭhayaṃ caraṃ means not harming, one wanders.
Aheṭhayaṃ caraṃ (không làm hại mà sống) – sống không làm hại.
Parūpavādāti parassa upavādabhayena.
Parūpavādā means for fear of others' blame.
Parūpavādā (vì lời chỉ trích của người khác) – vì sợ lời chỉ trích của người khác.
Bhayāti upavādabhayā.
Bhayā means for fear of blame.
Bhayā (vì sợ) – vì sợ lời chỉ trích.
Dānā ca kho dhammapadaṃva seyyoti dānato nibbānasaṅkhātaṃ dhammapadameva seyyo.
Dānā ca kho dhammapadaṃva seyyo means indeed the path of Dhamma, which is Nibbāna, is superior to giving (dāna).
Dānā ca kho dhammapadaṃva seyyo (Pháp đạo còn thù thắng hơn sự bố thí) – Pháp đạo, tức Niết Bàn, còn thù thắng hơn sự bố thí.
Pubbe ca hi pubbatare ca santoti pubbe ca kassapabuddhādikāle pubbatare ca koṇāgamanabuddhādikāle, sabbepi vā ete pubbe ca pubbatare ca santo nāmāti.
Pubbe ca hi pubbatare ca santo means in earlier times, such as the time of Kassapa Buddha and others, and in still earlier times, such as the time of Koṇāgamana Buddha and others; or rather, all these are called "santo" (peaceful ones) both in earlier and still earlier times.
Pubbe ca hi pubbatare ca santo (và những bậc Thánh thời xưa và thời xa xưa hơn) – vào thời các Đức Phật Kassapa v.v. và vào thời xa xưa hơn, tức thời các Đức Phật Koṇāgamana v.v., hoặc tất cả những bậc Thánh này đều được gọi là những bậc Thánh thời xưa và thời xa xưa hơn.
Tatiyaṃ.
The third (Sutta explanation) is concluded.
Kết thúc thứ ba.
314
4. Nasantisuttavaṇṇanā
4. Nasantisutta Description
4. Chú giải kinh Nasantisutta
315
34. Catutthe kamanīyānīti rūpādīni iṭṭhārammaṇāni.
In the fourth (Sutta), kamanīyāni means desirable objects such as forms and others.
34. Trong bài thứ tư, kamanīyāni (những điều đáng mong muốn) – là những đối tượng khả ái như sắc v.v.
Apunāgamanaṃ anāgantā puriso maccudheyyāti tebhūmakavaṭṭasaṅkhātā maccudheyyā apunāgamanasaṅkhātaṃ nibbānaṃ anāgantā.
Apunāgamanaṃ anāgantā puriso maccudheyyā means a person who, bound by sense-desires (kāma) and heedless, cannot reach Nibbāna, which is called "non-returning" from the realm of death (maccudheyya), i.e., the three realms of existence.
Apunāgamanaṃ anāgantā puriso maccudheyyā (người không đến được sự không trở lại từ cảnh giới của tử thần) – không đến được Niết Bàn, tức sự không trở lại, từ cảnh giới của tử thần, tức luân hồi ba cõi.
Nibbānañhi sattā na punāgacchanti, tasmā taṃ apunāgamananti vuccati.
For beings who reach Nibbāna do not return again; therefore, it is called "non-returning."
Vì chúng sinh không trở lại Niết Bàn lần nữa, nên nó được gọi là sự không trở lại.
Taṃ kāmesu baddho ca pamatto ca anāgantā nāma hoti, so taṃ pāpuṇituṃ na sakkoti, tasmā evamāha.
A person who is bound by sense-desires and heedless cannot reach it; therefore, it is said thus.
Người bị trói buộc trong dục và người phóng dật là người không đến được Niết Bàn, họ không thể đạt được nó, vì vậy Ngài nói như vậy.
Chandajanti taṇhāchandato jātaṃ.
Chandajaṃ means born from the desire of craving (taṇhāchanda).
Chandajaṃ (sinh ra từ ý muốn) – sinh ra từ ý muốn tham ái.
Aghanti pañcakkhandhadukkhaṃ.
Aghaṃ means the suffering of the five aggregates.
Aghaṃ (sự khổ) – sự khổ của năm uẩn.
Dutiyapadaṃ tasseva vevacanaṃ.
The second phrase is merely a synonym for that (first phrase).
Câu thứ hai là đồng nghĩa với câu đó.
Chandavinayā aghavinayoti taṇhāvinayena pañcakkhandhavinayo.
Chandavinayā aghavinayo means through the removal of craving, there is the removal of the five aggregates.
Chandavinayā aghavinayo (nhờ sự đoạn trừ ý muốn mà đoạn trừ sự khổ) – nhờ sự đoạn trừ tham ái mà đoạn trừ năm uẩn.
Aghavinayā dukkhavinayoti pañcakkhandhavinayena vaṭṭadukkhaṃ vinītameva hoti.
Aghavinayā dukkhavinayo means through the removal of the five aggregates, the suffering of saṃsāra is indeed removed.
Aghavinayā dukkhavinayo (nhờ sự đoạn trừ sự khổ mà đoạn trừ sự đau khổ) – nhờ sự đoạn trừ năm uẩn mà sự khổ luân hồi được đoạn trừ.
Citrānīti ārammaṇacittāni.
Citrāni means varied objects of sense.
Citrāni (những điều kỳ diệu) – những đối tượng kỳ diệu.
Saṅkapparāgoti saṅkappitarāgo.
Saṅkapparāgo means conceiving passion.
Saṅkapparāgo (tham ái do tư duy) – tham ái được tư duy.
Evamettha vatthukāmaṃ paṭikkhipitvā kilesakāmo kāmoti vutto.
Thus, here, after rejecting objective sense-desires (vatthukāma), defilement-sense-desires (kilesakāma) are called kāma.
Như vậy, ở đây, sau khi bác bỏ dục cảnh (vatthukāma), dục phiền não (kilesakāma) được nói là dục.
Ayaṃ panattho pasūrasuttena (su. ni. 830 ādayo) vibhāvetabbo.
This meaning should be explained by the Pasūra Sutta.
Ý nghĩa này cần được làm rõ bằng kinh Pasūra (Su. Ni. 830 v.v.).
Pasūraparibbājako hi therena ‘‘saṅkapparāgo purisassa kāmo’’ti vutte –
For when the Elder said to Pasūra the wanderer, "The passion of conceiving (saṅkapparāgo) is a person's kāma (sense-desire)," (Pasūra replied):
Khi Trưởng lão nói: “Tham ái do tư duy là dục của con người,” du sĩ Pasūra đã nói –
316
‘‘Na te kāmā yāni citrāni loke,
"Those things that are varied in the world are not kāma;
“Những gì kỳ diệu trên thế gian không phải là dục của ông,
317
Saṅkapparāgañca vadesi kāmaṃ;
Yet you call conceiving passion kāma;
Ông lại nói tham ái do tư duy là dục;
318
Saṅkappayaṃ akusale vitakke,
If one conceives unwholesome thoughts,
Nếu tư duy những ý nghĩ bất thiện,
319
Bhikkhūpi te hehinti kāmabhogī’’ti–
Even your bhikkhus would become enjoyers of kāma (sense-desires)."
Thì ngay cả các Tỳ-kheo của ông cũng sẽ là những người hưởng dục.”
320
Āha.
Thus he spoke.
Ông ta nói.
Atha naṃ thero avoca –
Then the Elder said to him:
Sau đó, Trưởng lão nói với ông ta –
321
‘‘Te ce kāmā yāni citrāni loke,
"If those things that are varied in the world were kāma,
“Nếu những gì kỳ diệu trên thế gian là dục,
322
Saṅkapparāgaṃ na vadesi kāmaṃ;
And you do not call conceiving passion kāma;
Mà ông không nói tham ái do tư duy là dục;
323
Passanto rūpāni manoramāni,
Then, seeing delightful forms,
Thấy những sắc đẹp ý thích,
324
Satthāpi te hehiti kāmabhogī.
Even your Teacher would become an enjoyer of kāma.
Thì ngay cả Đạo Sư của ông cũng sẽ là người hưởng dục.
325
Suṇanto saddāni, ghāyanto gandhāni;
Hearing sounds, smelling odours;
Nghe những âm thanh, ngửi những mùi hương;
326
Sāyanto rasāni, phusanto phassāni manoramāni;
Tasting flavours, touching delightful tangibles;
Nếm những vị, xúc chạm những xúc chạm ý thích;
327
Satthāpi te hehiti kāmabhogī’’ti.
Even your Teacher would become an enjoyer of kāma."
Thì ngay cả Đạo Sư của ông cũng sẽ là người hưởng dục.”
328
Athettha dhīrāti atha etesu ārammaṇesu paṇḍitā chandarāgaṃ vinayanti.
Athettha dhīrā means then, regarding these objects (of sense), the wise eliminate lustful desire (chandarāga).
Athettha dhīrā (và ở đây những bậc trí) – và ở đây những bậc trí loại bỏ tham ái đối với những đối tượng này.
Saṃyojanaṃ sabbanti dasavidhampi saṃyojanaṃ.
Saṃyojanaṃ sabbaṃ means all ten kinds of fetters.
Saṃyojanaṃ sabbaṃ (tất cả các kiết sử) – tất cả mười loại kiết sử.
Akiñcananti rāgakiñcanādivirahitaṃ.
Akiñcanaṃ means free from the impediments of passion (rāga), etc.
Akiñcanaṃ (không có gì) – không có những chướng ngại như tham ái v.v.
Nānupatanti dukkhāti vaṭṭadukkhā pana tassa upari na patanti.
Nānupatanti dukkhā means the sufferings of saṃsāra do not fall upon such a one.
Nānupatanti dukkhā (những khổ đau không rơi xuống) – những khổ đau của luân hồi không còn rơi xuống người ấy.
Iccāyasmā mogharājāti, ‘‘pahāsi saṅkha’’nti gāthaṃ sutvā tassaṃ parisati anusandhikusalo mogharājā nāma thero ‘‘imissā gāthāya attho na yathānusandhiṃ gato’’ti cintetvā yathānusandhiṃ ghaṭento evamāha.
Iccāyasmā Mogharājā means, having heard the verse "pahāsi saṅkhaṃ" (he abandoned all notions), the Elder named Mogharāja, who was skilled in connecting contexts in that assembly, thinking "the meaning of this verse has not been conveyed in accordance with the context," uttered these words to connect it properly.
Iccāyasmā Mogharājā (Thế Tôn Mogharāja đã nói như vậy) – sau khi nghe câu kệ “pahāsi saṅkhaṃ” (đã từ bỏ những khái niệm), Trưởng lão Mogharāja, bậc thiện xảo trong việc kết nối các ý nghĩa, nghĩ rằng “ý nghĩa của câu kệ này không phù hợp với sự kết nối,” và để làm cho nó phù hợp với sự kết nối, Ngài đã nói như vậy.
Tattha idha vā huraṃ vāti idhaloke vā paraloke vā.
Therein, idha vā huraṃ vā means in this world or in the other world.
Ở đây, idha vā huraṃ vā (ở đời này hay đời khác) – ở đời này hay ở đời khác.
Naruttamaṃ atthacaraṃ narānanti kiñcāpi sabbe khīṇāsavā naruttamā ceva atthacarā ca narānaṃ, thero pana dasabalaṃ sandhāyevamāha.
Naruttamaṃ atthacaraṃ narānaṃ means although all Arahants are supreme among men (naruttama) and do what is beneficial for men (atthacaraṃ narānaṃ), the Elder spoke this with reference to the Buddha (Dasabala) alone.
Naruttamaṃ atthacaraṃ narānaṃ (bậc tối thượng trong loài người, người vì lợi ích của loài người) – mặc dù tất cả các bậc A-la-hán đều là bậc tối thượng trong loài người và vì lợi ích của loài người, nhưng Trưởng lão nói như vậy là để chỉ Đức Phật.
Ye taṃ namassanti pasaṃsiyā teti yadi tathāvimuttaṃ devamanussā namassanti, atha ye taṃ bhagavantaṃ kāyena vā vācāya vā anupaṭipattiyā vā namassanti, te kiṃ pasaṃsiyā, udāhu apasaṃsiyāti.
Ye taṃ namassanti pasaṃsiyā te means if devas and humans venerate such a liberated one, then are those who venerate that Blessed One by body, speech, or practice, worthy of praise, or unworthy of praise?
Ye taṃ namassanti pasaṃsiyā te (những ai lễ bái Ngài, họ đáng được khen ngợi) – nếu chư thiên và loài người lễ bái bậc đã giải thoát như vậy, thì những ai lễ bái Đức Thế Tôn đó bằng thân, khẩu, hoặc bằng sự thực hành đúng đắn, họ có đáng được khen ngợi không, hay không đáng được khen ngợi?
Bhikkhūti mogharājattheraṃ ālapati.
Bhikkhu addresses Mogharāja Thera.
Bhikkhū (Tỳ-kheo) – gọi Trưởng lão Mogharāja.
Aññāya dhammanti catusaccadhammaṃ jānitvā.
Aññāya dhammaṃ means having known the Dhamma of the Four Noble Truths.
Aññāya dhammaṃ (sau khi hiểu Pháp) – sau khi hiểu Tứ Thánh Đế.
Saṅgātigā tepi bhavantīti ye taṃ kāyena vā vācāya vā anupaṭipattiyā vā namassanti.
Saṅgātigā tepi bhavanti means those who venerate the Blessed One by body, speech, or appropriate practice.
Saṅgātigā tepi bhavantī (họ cũng vượt qua sự ràng buộc) – những ai lễ bái Ngài bằng thân, khẩu, hoặc bằng sự thực hành đúng đắn.
Te catusaccadhammaṃ aññāya vicikicchaṃ pahāya saṅgātigāpi honti, pasaṃsiyāpi hontīti.
Those, having known the Dhamma of the Four Noble Truths and having abandoned doubt (vicikicchā), become those who transcend attachment (saṅgātigā) and are also worthy of praise.
Họ, sau khi hiểu Tứ Thánh Đế và từ bỏ nghi ngờ, cũng vượt qua sự ràng buộc và đáng được khen ngợi.
Catutthaṃ.
The fourth (Sutta explanation) is concluded.
Kết thúc thứ tư.
329
5. Ujjhānasaññisuttavaṇṇanā
5. Ujjhānasaññisutta Description
5. Chú giải kinh Ujjhānasaññisutta
330
35. Pañcame ujjhānasaññikāti ujjhānasaññī devaloko nāma pāṭiyekko natthi, imā pana devatā tathāgatassa catupaccayaparibhogaṃ nissāya ujjhāyamānā āgatā.
In the fifth (Sutta), ujjhānasaññikā means there is no particular realm of devas called Ujjhānasaññī; but these devas came complaining on account of the Tathāgata's enjoyment of the four requisites.
35. Trong bài thứ năm, ujjhānasaññikā (những vị thiên nhân hay phàn nàn) – không có một cõi trời riêng biệt nào gọi là cõi trời của những vị thiên nhân hay phàn nàn; nhưng những vị thiên nhân này đã đến, phàn nàn về việc Đức Như Lai thọ dụng bốn vật dụng.
Tāsaṃ kira evaṃ ahosi – ‘‘samaṇo gotamo bhikkhūnaṃ paṃsukūlacīvara-piṇḍiyālopa-rukkhamūlasenāsanapūtimuttabhesajjehi santosasseva pariyantakāritaṃ vaṇṇeti, sayaṃ pana pattuṇṇadukūla khomādīni paṇītacīvarāni dhāreti, rājārahaṃ uttamaṃ bhojanaṃ bhuñjati, devavimānakappāya gandhakuṭiyā varasayane sayati, sappinavanītādīni bhesajjāni paṭisevati, divasaṃ mahājanassa dhammaṃ deseti, vacanamassa aññato gacchati, kiriyā aññato’’ti ujjhāyamānā āgamiṃsu.
For it occurred to them thus: "The recluse Gotama praises contentment with rag-robes, almsfood, dwellings at the root of a tree, and fermented urine as medicine for bhikkhus; but he himself wears fine robes of wool, silk, linen, etc., eats excellent food fit for kings, sleeps on a superb couch in a Perfumed Chamber like a divine palace, partakes of medicines such as ghee and fresh butter, teaches the Dhamma to the great multitude all day long. His words go one way, his actions another." Thus, they came complaining.
Có lẽ, những vị ấy đã nghĩ như vầy: "Sa-môn Gotama ca ngợi sự bằng lòng của các Tỳ-khưu với y phấn tảo, khất thực, chỗ ở dưới gốc cây, và thuốc uống là nước tiểu thối; nhưng chính Ngài lại mặc những y thượng hạng như y vải lụa, y vải len, y vải gai, v.v., thọ dụng thức ăn tối thượng xứng đáng với vua chúa, ngủ trên giường tốt trong hương thất như cung trời, dùng các loại thuốc như bơ sữa, bơ lỏng, v.v., cả ngày thuyết pháp cho đại chúng. Lời nói của Ngài đi một nẻo, còn hành động thì một nẻo khác." Họ đến với tâm oán trách như vậy.
Tena tāsaṃ dhammasaṅgāhakattherehi ‘‘ujjhānasaññikā’’ti nāmaṃ gahitaṃ.
Therefore, the Elders who recited the Dhamma (at the Councils) took the name "Ujjhānasaññikā" (fault-finders) for them.
Do đó, các trưởng lão kết tập Pháp đã đặt tên cho các vị ấy là "Ujjhānasaññikā" (những vị có ý niệm chỉ trích).
331
Aññathā santanti aññenākārena bhūtaṃ.
Aññathā santa means existing in another way.
Aññathā santa có nghĩa là đã trở thành một cách khác.
Nikaccāti nikatiyā vañcanāya, vañcetvāti attho.
Nikaccā means by trickery, by deception; the meaning is having deceived.
Nikaccā có nghĩa là bằng sự gian trá, lừa dối; tức là đã lừa dối.
Kitavassevāti kitavo vuccati sākuṇiko.
Kitavassevā: a bird-catcher is called a kitava.
Kitavassevā có nghĩa là kẻ săn chim.
So hi agumbova samāno sākhapaṇṇādipaṭicchādanena gumbavaṇṇaṃ dassetvā upagate moratittirādayo sakuṇe māretvā dārabharaṇaṃ karoti.
Indeed, being no thicket himself, he covers himself with branches, leaves, and so on, appearing like a thicket, and having killed the birds such as peacocks and partridges that approach, he supports his family.
Thật vậy, kẻ ấy dù không phải là bụi cây nhưng lại che mình bằng cành lá, v.v., để hiện ra như bụi cây, rồi giết các loài chim như công, gà gô, v.v., đến gần để nuôi vợ con.
Iti tassa kitavassa imāya vañcanāya evaṃ vañcetvā sakuṇamaṃsabhojanaṃ viya kuhakassāpi paṃsukūlena attānaṃ paṭicchādetvā kathāchekatāya mahājanaṃ vañcetvā khādamānassa vicarato.
Just as that kitava lives by eating bird-meat by deceiving them in this way, so too does a hypocrite, covering himself with a paṃsukūla robe and deceiving the multitude with his eloquence, live by eating (their offerings).
Tương tự như vậy, kẻ lừa dối cũng che mình bằng y phấn tảo, lừa dối đại chúng bằng tài hùng biện trong thuyết pháp, rồi ăn uống và đi lại như kẻ săn chim dùng sự lừa dối này để lừa dối và ăn thịt chim.
Bhuttaṃ theyyena tassa tanti sabbopi tassa catupaccayaparibhogo theyyena paribhutto nāma hotīti devatā bhagavantaṃ sandhāya vadati.
Bhuttaṃ theyyena tassa ta means that all consumption of the four requisites by that kuhaka (hypocrite) monk is considered consumption by theft; thus, the devatā speak, referring to the Buddha.
Bhuttaṃ theyyena tassa taṃ có nghĩa là tất cả sự thọ dụng bốn vật dụng của vị ấy đều được gọi là thọ dụng bằng sự trộm cắp. Các vị thiên nhân nói điều này ám chỉ Đức Thế Tôn.
Parijānanti paṇḍitāti ayaṃ kārako vā akārako vāti paṇḍitā jānanti.
Parijānanti paṇḍitā means that the wise know whether this one is an actor (of good deeds) or not.
Parijānanti paṇḍitā có nghĩa là các bậc trí biết được: "Vị này là người hành trì hay không phải là người hành trì?"
Iti tā devatā ‘‘tathāgatāpi mayameva paṇḍitā’’ti maññamānā evamāhaṃsu.
Thus, those devatā, thinking, "We are wiser even than the Tathāgata," spoke in this way.
Vì vậy, các vị thiên nhân ấy, nghĩ rằng: "Chính chúng ta mới là bậc trí hơn cả chư Như Lai", nên đã nói như vậy.
332
Atha bhagavā nayidantiādimāha.
Then the Blessed One spoke with the verse beginning nayidaṃ.
Sau đó, Đức Thế Tôn đã nói câu bắt đầu bằng Nayidaṃ.
Tattha yāyaṃ paṭipadā daḷhāti ayaṃ dhammānudhammapaṭipadā daḷhā thirā.
In this, yāyaṃ paṭipadā daḷhā means this practice of Dhamma in accordance with Dhamma is firm, unwavering.
Ở đây, yāyaṃ paṭipadā daḷhā có nghĩa là con đường hành trì Pháp và tùy Pháp này là kiên cố, vững chắc.
Yāya paṭipadāya dhīrā paṇḍitā ārammaṇūpanijjhānena lakkhaṇūpanijjhānena cāti dvīhi jhānehi jhāyino mārabandhanā pamuccanti, taṃ paṭipadaṃ bhāsitamattena vā savanamattena vā okkamituṃ paṭipajjituṃ na sakkāti attho.
It means that the path by which the steadfast and wise, meditating with the two meditations—object-focused meditation and characteristic-focused meditation—are liberated from the bonds of Māra, that path cannot be entered or practiced merely by speaking of it or hearing about it.
Con đường hành trì mà nhờ đó các bậc trí, các bậc hiền minh, là những vị thiền giả, nhờ hai loại thiền là Ārammaṇūpanijjhāna (thiền quán sát đối tượng) và Lakkhaṇūpanijjhāna (thiền quán sát đặc tướng), được giải thoát khỏi sự trói buộc của Māra, thì con đường hành trì ấy không thể được thực hành chỉ bằng lời nói hay chỉ bằng sự lắng nghe.
Na ve dhīrā pakubbantīti dhīrā paṇḍitā viditvā lokapariyāyaṃ saṅkhāralokassa udayabbayaṃ ñatvā catusaccadhammañca aññāya kilesanibbānena nibbutā loke visattikaṃ tiṇṇā evaṃ na kubbanti, mayaṃ evarūpāni na kathemāti attho.
Na ve dhīrā pakubbanti means that the steadfast and wise, having known the world's ways, having understood the arising and passing away of the conditioned world, and having realized the Four Noble Truths, are extinguished through the extinguishment of defilements, having overcome the entanglement (craving) in the world; such ones do not act in this way, nor do we speak such things.
Na ve dhīrā pakubbanti có nghĩa là các bậc trí, các bậc hiền minh, sau khi đã biết sự biến đổi của thế gian, đã hiểu sự sinh diệt của thế giới các hành, đã thấu hiểu Tứ Thánh Đế, đã đạt Niết Bàn của phiền não, đã vượt qua sự chấp trước trong thế gian, không làm điều như vậy; tức là chúng ta không nói những điều như thế.
333
Pathaviyaṃ patiṭṭhahitvāti ‘‘ayuttaṃ amhehi kataṃ, akārakameva mayaṃ kārakavādena samudācarimhā’’ti lajjamānā mahābrahmani viya bhagavati gāravaṃ paccupaṭṭhapetvā aggikkhandhaṃ viya bhagavantaṃ durāsadaṃ katvā passamānā ākāsato otaritvā bhūmiyaṃ ṭhatvāti attho.
Pathaviyaṃ patiṭṭhahitvā means that, being ashamed, thinking, "What we have done is improper; we have addressed one who does no evil with words implying he does evil," and having established reverence for the Blessed One as if for Mahābrahmā, and regarding the Blessed One as unapproachable like a mass of fire, they descended from the sky and stood on the ground.
Pathaviyaṃ patiṭṭhahitvā có nghĩa là các vị thiên nhân ấy, xấu hổ mà nói: "Chúng tôi đã làm điều không đúng, chúng tôi đã nói về một người không làm điều xấu như thể người ấy đã làm điều xấu", rồi đặt lòng tôn kính Đức Thế Tôn như Đại Phạm Thiên, khiến Đức Thế Tôn trở nên khó tiếp cận như một khối lửa, và sau khi nhìn thấy Ngài, họ từ trên trời hạ xuống và đứng trên mặt đất.
Accayoti aparādho.
Accayo means an offense.
Accayo có nghĩa là sự phạm lỗi.
No, bhante, accāgamāti amhe atikkamma abhibhavitvā pavatto.
No, bhante, accāgamā means that which has gone beyond us, having overpowered us.
No, bhante, accāgamā có nghĩa là đã vượt qua chúng con, đã lấn át chúng con.
Āsādetabbanti ghaṭṭayitabbaṃ.
Āsādetabbaṃ means to be affronted.
Āsādetabbaṃ có nghĩa là đáng bị xúc phạm.
Tā kira devatā bhagavantaṃ kāyena vācāyāti dvīhipi ghaṭṭayiṃsu.
Those devatā, it is said, affronted the Blessed One in two ways: by body and by speech.
Các vị thiên nhân ấy đã xúc phạm Đức Thế Tôn bằng cả thân và lời nói.
Tathāgataṃ avanditvā ākāse patiṭṭhamānā kāyena ghaṭṭayiṃsu, kitavopamaṃ āharitvā nānappakārakaṃ asabbhivādaṃ vadamānā vācāya ghaṭṭayiṃsu.
They affronted him by body by standing in the sky without paying homage to the Tathāgata, and they affronted him by speech by uttering various kinds of unseemly remarks, bringing up the analogy of a fowler.
Họ đã xúc phạm bằng thân khi đứng trên không trung mà không đảnh lễ Đức Như Lai; họ đã xúc phạm bằng lời nói khi đưa ra ví dụ về kẻ săn chim và nói những lời không đúng đắn khác nhau.
Tasmā āsādetabbaṃ amaññimhāti āhaṃsu.
Therefore, they said, "We thought it was to be affronted."
Do đó, họ nói: "Chúng con đã nghĩ rằng điều đó đáng bị xúc phạm".
Paṭiggaṇhātūti khamatu.
Paṭiggaṇhātū means "please forgive."
Paṭiggaṇhātu có nghĩa là xin hãy tha thứ.
Āyatiṃ saṃvarāyāti anāgate saṃvaraṇatthāya, puna evarūpassa aparādhassa dosassa akaraṇatthāya.
Āyatiṃ saṃvarāyā means for restraint in the future, so as not to commit such an offense or fault again.
Āyatiṃ saṃvarāyā có nghĩa là để giữ gìn trong tương lai, để không tái phạm lỗi lầm như vậy nữa.
334
Sitaṃ pātvākāsīti aggadante dassento pahaṭṭhākāraṃ dassesi.
Sitaṃ pātvākāsī means he revealed a joyful expression, showing his front teeth.
Sitaṃ pātvākāsī có nghĩa là Đức Thế Tôn đã mỉm cười, để lộ hai răng cửa, biểu lộ thái độ hoan hỷ.
Kasmā?
Why?
Tại sao?
Tā kira devatā na sabhāvena khamāpenti, lokiyamahājanañca sadevake loke aggapuggalaṃ tathāgatañca ekasadisaṃ karonti.
Those devatā, it seems, did not seek forgiveness genuinely, and they equated the ordinary people of the world with the Tathāgata, the foremost being in the world with its devas.
Các vị thiên nhân ấy không xin lỗi một cách chân thành, và họ đã đặt đại chúng thế gian cùng với chư thiên và Đức Như Lai, bậc tối thượng trong thế gian, ngang hàng nhau.
Atha bhagavā ‘‘parato kathāya uppannāya buddhabalaṃ dīpetvā pacchā khamissāmī’’ti sitaṃ pātvākāsi.
Then the Blessed One, thinking, "When the discourse arises later, I will demonstrate the power of a Buddha and then forgive," revealed a smile.
Do đó, Đức Thế Tôn đã mỉm cười, nghĩ rằng: "Khi câu chuyện tiếp theo được nói ra, ta sẽ thể hiện Phật lực rồi sau đó sẽ tha thứ".
Bhiyyoso mattāyāti atirekappamāṇena.
Bhiyyoso mattāyā means to an excessive degree.
Bhiyyoso mattāyā có nghĩa là với mức độ vượt trội.
Imaṃ gāthaṃ abhāsīti kupito esa amhākanti maññamānā abhāsi.
Imaṃ gāthaṃ abhāsī means they recited this verse, thinking, "This ascetic is angry with us."
Imaṃ gāthaṃ abhāsī có nghĩa là các vị thiên nhân ấy đã nói bài kệ này, nghĩ rằng: "Vị này đang giận chúng ta".
335
Na paṭigaṇhatīti na khamati nādhivāseti.
Na paṭigaṇhatī means he does not approve, does not tolerate.
Na paṭigaṇhatī có nghĩa là không chấp nhận, không cam chịu.
Kopantaroti abbhantare uppannakopo.
Kopantaro means one in whom anger has arisen inwardly.
Kopantaro có nghĩa là có sự giận dữ phát sinh bên trong.
Dosagarūti dosaṃ garuṃ katvā ādāya viharanto.
Dosagarū means one who dwells carrying a heavy fault.
Dosagarū có nghĩa là người sống với sự thù hận nặng nề.
Sa veraṃ paṭimuñcatīti so evarūpo gaṇṭhikaṃ paṭimuñcanto viya taṃ veraṃ attani paṭimuñcati ṭhapeti, na paṭinissajjatīti attho.
Sa veraṃ paṭimuñcatī means such a person, like one tying a knot, binds that enmity to himself, holds onto it, does not cast it away; this is the meaning.
Sa veraṃ paṭimuñcatī có nghĩa là người như vậy tự mình đeo cái thù hận đó vào, như thể đeo một nút thắt, tức là không từ bỏ nó.
Accayo ce na vijjethāti sace accāyikakammaṃ na bhaveyya.
Accayo ce na vijjethā means if there were no offense.
Accayo ce na vijjethā có nghĩa là nếu không có hành động sai lầm.
No cidhāpagataṃ siyāti yadi aparādho nāma na bhāveyya.
No cidhāpagataṃ siyā means if there were no such thing as a fault.
No cidhāpagataṃ siyā có nghĩa là nếu không có lỗi lầm nào.
Kenīdha kusalo siyāti yadi verāni na sammeyyuṃ, kena kāraṇena kusalo bhaveyya.
Kenīdha kusalo siyā means if enmities were not appeased, by what means would one be skilled (in forgiveness)?
Kenīdha kusalo siyā có nghĩa là nếu các mối thù không được giải quyết, thì do nguyên nhân nào mà người ta có thể trở thành thiện xảo?
336
Kassaccayāti gāthāya kassa atikkamo natthi?
Kassaccayā: in the verse, whose transgression is there not?
Kassaccayā trong bài kệ có nghĩa là ai không có sự vượt quá giới hạn?
Kassa aparādho natthi?
Whose fault is there not?
Ai không có lỗi lầm?
Ko sammohaṃ nāpajjati?
Who does not fall into delusion?
Ai không bị mê mờ?
Ko niccameva paṇḍito nāmāti attho?
Who is always wise? This is the meaning.
Ai luôn được gọi là bậc trí?
Imaṃ kira gāthaṃ bhaṇāpanatthaṃ bhagavato sitapātukammaṃ.
It was, so to speak, to cause this verse to be recited that the Blessed One revealed a smile.
Sự mỉm cười của Đức Thế Tôn là để các vị thiên nhân nói ra bài kệ này.
Tasmā idāni devatānaṃ buddhabalaṃ dīpetvā khamissāmīti tathāgatassa buddhassātiādimāha.
Therefore, now, thinking, "I will reveal the power of a Buddha to the devatā and then forgive," he spoke with the words beginning tathāgatassa buddhassā.
Do đó, bây giờ Đức Thế Tôn đã nói câu bắt đầu bằng Tathāgatassa Buddhassā để thể hiện Phật lực cho các vị thiên nhân rồi sau đó sẽ tha thứ.
Tattha tathāgatassāti tathā āgatoti evamādīhi kāraṇehi tathāgatassa.
In this, tathāgatassā refers to the Tathāgata due to reasons such as "thus gone" (tathā āgato).
Ở đây, Tathāgatassa có nghĩa là Đức Như Lai do các nguyên nhân như "đã đến như vậy" (tathā āgato).
Buddhassāti catunnaṃ saccānaṃ buddhattādīhi kāraṇehi vimokkhantikapaṇṇattivasena evaṃ laddhanāmassa.
Buddhassā refers to the Buddha, who obtained this name by way of ultimate proclamation of liberation, due to reasons such as having awakened to the Four Noble Truths.
Buddhassā có nghĩa là Đức Phật, người đã đạt được danh hiệu này theo cách quy ước của sự giải thoát tối hậu, do các nguyên nhân như đã giác ngộ Tứ Thánh Đế.
Accayaṃ desayantīnanti yaṃ vuttaṃ tumhehi ‘‘accayaṃ desayantīnaṃ…pe… sa veraṃ paṭimuñcatī’’ti, taṃ sādhu vuttaṃ, ahaṃ pana taṃ veraṃ nābhinandāmi na patthayāmīti attho.
Accayaṃ desayantīnaṃ means, "What you have said, 'accayaṃ desayantīnaṃ...pe... sa veraṃ paṭimuñcatī,' that is well said, but I do not approve of that enmity, nor do I desire it"; this is the meaning.
Accayaṃ desayantīnaṃ có nghĩa là điều mà các vị đã nói: "Accayaṃ desayantīnaṃ... (v.v.)... sa veraṃ paṭimuñcatī", điều đó đã được nói ra một cách tốt đẹp, nhưng ta không hoan hỷ hay mong muốn mối thù hận đó.
Paṭiggaṇhāmi voccayanti tumhākaṃ aparādhaṃ khamāmīti.
Paṭiggaṇhāmi voccaya means, "I forgive your offense."
Paṭiggaṇhāmi voccayaṃ có nghĩa là ta tha thứ lỗi lầm của các vị.
Pañcamaṃ.
The Fifth.
Thứ năm.
337
6. Saddhāsuttavaṇṇanā
6. Commentary on the Saddhā Sutta
6. Lời giải thích kinh Saddhā
338
36. Chaṭṭhe saddhā dutiyā purisassa hotīti purisassa devaloke manussaloke ceva nibbānañca gacchantassa saddhā dutiyā hoti, sahāyakiccaṃ sādheti.
36. In the sixth (sutta), saddhā dutiyā purisassa hotī means faith is a companion to a person going to the deva-world, the human world, and Nibbāna; it fulfills the function of a friend.
36. Trong kinh thứ sáu, saddhā dutiyā purisassa hotī có nghĩa là đức tin là người bạn đồng hành của một người khi người ấy đi đến cõi trời, cõi người và Niết Bàn; nó hoàn thành vai trò của một người bạn.
No ce assaddhiyaṃ avatiṭṭhatīti yadi assaddhiyaṃ na tiṭṭhati.
No ce assaddhiyaṃ avatiṭṭhatī means if lack of faith does not abide.
No ce assaddhiyaṃ avatiṭṭhatī có nghĩa là nếu sự vô tín không tồn tại.
Yasoti parivāro.
Yaso means retinue.
Yaso có nghĩa là tùy tùng.
Kittīti vaṇṇabhaṇanaṃ.
Kittī means praise.
Kittī có nghĩa là sự ca ngợi đức hạnh.
Tatvassa hotīti tato assa hoti.
Tatvassa hotī means it becomes his from that (faith).
Tatvassa hotī có nghĩa là từ đó mà người ấy có được.
Nānupatanti saṅgāti rāgasaṅgādayo pañca saṅgā na anupatanti.
Nānupatanti saṅgā means the five bonds, such as the bond of craving, do not fall upon one.
Nānupatanti saṅgā có nghĩa là năm sự trói buộc như sự trói buộc của tham ái không bám theo.
Pamādamanuyuñjantīti ye pamādaṃ karonti nibbattenti, te taṃ anuyuñjanti nāma.
Pamādamanuyuñjantī means those who commit or give rise to heedlessness are said to be devoted to it.
Pamādamanuyuñjantī có nghĩa là những ai thực hành sự phóng dật, tạo ra sự phóng dật, thì họ được gọi là người chuyên tâm vào điều đó.
Dhanaṃ seṭṭhaṃva rakkhatīti muttāmaṇisārādiuttamadhanaṃ viya rakkhati.
Dhanaṃ seṭṭhaṃva rakkhatī means it protects like excellent wealth, such as pearls, gems, and essences.
Dhanaṃ seṭṭhaṃva rakkhatī có nghĩa là bảo vệ như tài sản tối thượng quý giá như ngọc trai, ngọc báu, v.v.
Jhāyantoti lakkhaṇūpanijjhānena ca ārammaṇūpanijjhānena ca jhāyanto.
Jhāyanto means one who meditates with characteristic-focused meditation and object-focused meditation.
Jhāyanto có nghĩa là người thiền định bằng Lakkhaṇūpanijjhāna và Ārammaṇūpanijjhāna.
Tattha lakkhaṇūpanijjhānaṃ nāma vipassanāmaggaphalāni.
In this, lakkhaṇūpanijjhānaṃ refers to Vipassanā, Magga, and Phala.
Ở đây, Lakkhaṇūpanijjhāna là tuệ quán, đạo và quả.
Vipassanā hi tīṇi lakkhaṇāni upanijjhāyatīti lakkhaṇūpanijjhānaṃ.
For Vipassanā observes the three characteristics (of impermanence, suffering, and non-self), thus it is lakkhaṇūpanijjhāna.
Tuệ quán được gọi là Lakkhaṇūpanijjhāna vì nó quán sát ba đặc tướng.
Maggo vipassanāya āgatakiccaṃ sādhetīti lakkhaṇūpanijjhānaṃ.
Magga fulfills the task undertaken by Vipassanā, thus it is lakkhaṇūpanijjhāna.
Đạo được gọi là Lakkhaṇūpanijjhāna vì nó hoàn thành nhiệm vụ đã đạt được nhờ tuệ quán.
Phalaṃ tathalakkhaṇaṃ nirodhasaccaṃ upanijjhāyatīti lakkhaṇūpanijjhānaṃ.
Phala observes Nibbāna, which has the characteristic of cessation, thus it is lakkhaṇūpanijjhāna.
Quả được gọi là Lakkhaṇūpanijjhāna vì nó quán sát Niết Bàn, tức là Chân Đế Đoạn Diệt, với đặc tướng như vậy.
Aṭṭha samāpattiyo pana kasiṇārammaṇassa upanijjhāyanato ārammaṇūpanijjhānanti veditabbā.
However, the eight attainments (samāpattiyo) are to be understood as ārammaṇūpanijjhāna because they observe a kasiṇa-object.
Tuy nhiên, tám loại thiền định (samāpatti) cần được hiểu là Ārammaṇūpanijjhāna vì chúng quán sát đối tượng biến xứ (kasiṇa).
Paramaṃ nāma arahattasukhaṃ adhippetanti.
Paramaṃ means the bliss of Arahantship is intended.
Paramaṃ có nghĩa là sự an lạc của A-la-hán quả.
Chaṭṭhaṃ.
The Sixth.
Thứ sáu.
339
7. Samayasuttavaṇṇanā
7. Commentary on the Samaya Sutta
7. Lời giải thích kinh Samaya
340
37. Sattame sakkesūti ‘‘sakyā vata, bho kumārā’’ti (dī. ni. 1.267) udānaṃ paṭicca sakkāti laddhanāmānaṃ rājakumārānaṃ nivāso ekopi janapado rūḷhīsaddena sakkāti vuccati.
37. In the seventh (sutta), sakkesū means a country, even a single one, where the royal princes called "Sakyas" (due to the exclamation "Sakyā vata, bho kumārā") resided, is called Sakya by common usage.
37. Trong kinh thứ bảy, sakkesū có nghĩa là đất nước của các hoàng tử được gọi là Sakkā (Thích Ca) theo cách gọi thông thường, dựa trên lời cảm thán: "Thật vậy, này các hoàng tử Thích Ca!" (Dī. Ni. 1.267).
Tasmiṃ sakkesu janapade.
In that Sakya country.
Trong đất nước Thích Ca ấy.
Mahāvaneti sayaṃjāte aropime himavantena saddhiṃ ekābaddhe mahati vane.
Mahāvane means in the great forest that grew naturally, unplanted, and was connected to the Himalayas.
Mahāvane có nghĩa là trong khu rừng lớn tự nhiên, không do con người trồng, nối liền với dãy Hy Mã Lạp Sơn.
Sabbeheva arahantehīti imaṃ suttaṃ kathitadivaseyeva pattaarahantehi.
By all Arahants means by the Arahants who attained Arahantship on the very day this Sutta was taught.
Với tất cả các bậc A-la-hán – bài kinh này được thuyết vào chính ngày các vị A-la-hán đạt quả.
341
Tatrāyaṃ anupubbikathā – sākiyakoliyā hi kira kapilavatthunagarassa ca koliyanagarassa ca antare rohiṇiṃ nāma nadiṃ ekeneva āvaraṇena bandhāpetvā sassāni kārenti.
Regarding this, the following introductory story should be known: It is said that the Sakyas and Koliyas, between the cities of Kapilavatthu and Koliya, had a dam built on the Rohini River with a single barrier and grew crops.
Đây là câu chuyện tuần tự: Người Sākiya và Koliyā đã xây một đập nước duy nhất trên sông Rohiṇī, nằm giữa thành Kapilavatthu và thành Koliyā, để trồng trọt.
Atha jeṭṭhamūlamāse sassesu milāyantesu ubhayanagaravāsīnampi kammakārā sannipatiṃsu.
Then, in the month of Jeṭṭhamūla, as the crops were withering, the laborers of both cities gathered.
Đến tháng Jeṭṭhamūla, khi cây trồng héo úa, những người làm công của cả hai thành phố đều tập trung lại.
Tattha koliyanagaravāsino āhaṃsu – ‘‘idaṃ udakaṃ ubhayato āhariyamānaṃ na tumhākaṃ, na amhākaṃ pahossati, amhākaṃ pana sassaṃ ekena udakeneva nipphajjissati, idaṃ udakaṃ amhākaṃ dethā’’ti.
There, the residents of Koliya city said, “If this water is drawn by both sides, it will not be enough for you, nor for us. But our crops will ripen with just one watering. Give this water to us.”
Tại đó, cư dân thành Koliyā nói: “Nếu nước này được lấy từ cả hai phía, thì sẽ không đủ cho các ông cũng không đủ cho chúng tôi. Nhưng cây trồng của chúng tôi sẽ chín chỉ với một lần tưới nước này. Hãy nhường nước này cho chúng tôi.”
Kapilavatthuvāsino āhaṃsu – ‘‘tumhesu koṭṭhe pūretvā ṭhitesu mayaṃ rattasuvaṇṇanīlamaṇikāḷakahāpaṇe ca gahetvā pacchipasibbakādihatthā na sakkhissāma tumhākaṃ gharadvāre vicarituṃ, amhākampi sassaṃ ekeneva udakena nipphajjissati, idaṃ udakaṃ amhākaṃ dethā’’ti.
The residents of Kapilavatthu city said, “While you stand with your granaries filled, we, carrying golden, sapphire, dark blue, and silver coins, and baskets and bags in our hands, will not be able to wander at your house doors. Our crops will also ripen with just one watering. Give this water to us.”
Cư dân Kapilavatthu nói: “Khi các ông đã đầy kho lúa, chúng tôi sẽ không thể đi lại trước cửa nhà các ông với vàng ròng, ngọc xanh, tiền đồng và các loại giỏ, túi xách trên tay. Cây trồng của chúng tôi cũng sẽ chín chỉ với một lần tưới nước này. Hãy nhường nước này cho chúng tôi.”
‘‘Na mayaṃ dassāmā’’ti.
“We will not give it,” they said.
“Chúng tôi sẽ không nhường.”
‘‘Mayampi na dassāmā’’ti.
“We also will not give it,” they said.
“Chúng tôi cũng sẽ không nhường.”
Evaṃ kathaṃ vaḍḍhetvā eko uṭṭhāya ekassa pahāraṃ adāsi, sopi aññassāti evaṃ aññamaññaṃ paharitvā rājakulānaṃ jātiṃ ghaṭṭetvā kalahaṃ vaḍḍhayiṃsu.
Thus, the argument grew, and one person stood up and struck another, and that one also struck another, and so they struck each other, provoking the royal families, and escalated the dispute.
Cứ thế, cuộc tranh cãi leo thang, một người đứng dậy đánh người kia, rồi người kia cũng đánh người khác. Cứ thế họ đánh nhau, xúc phạm dòng dõi hoàng tộc và làm cho cuộc tranh chấp thêm lớn.
342
Koliyakammakārā vadanti – ‘‘tumhe kapilavatthuvāsike gahetvā gajjatha, ye soṇasiṅgālādayo viya attano bhaginīhi saddhiṃ saṃvasiṃsu, etesaṃ hatthino ca assā ca phalakāvudhāni ca amhākaṃ kiṃ karissantī’’ti?
The Koliya laborers said, “You, Kapilavatthu residents, boast, relying on those who cohabited with their own sisters like dogs and jackals. What can their elephants, horses, shields, and weapons do to us?”
Những người làm công của Koliyā nói: “Các ông, cư dân Kapilavatthu, hãy cứ gầm thét đi, những kẻ đã sống chung với chị em ruột của mình như chó sói, chó rừng! Voi, ngựa, khiên và vũ khí của chúng sẽ làm gì được chúng tôi?”
Sākiyakammakārā vadanti – ‘‘tumhe dāni kuṭṭhino dārake gahetvā gajjatha, ye anāthā niggatikā tiracchānā viya kolarukkhe vasiṃsu, etesaṃ hatthino ca assā ca phalakāvudhāni ca amhākaṃ kiṃ karissantī’’ti?
The Sakya laborers said, “Now you boast, relying on those leprous children who lived in a kolarukkha like helpless, outcast animals. What can their elephants, horses, shields, and weapons do to us?”
Những người làm công của Sākiya nói: “Các ông, hãy cứ gầm thét đi với những đứa trẻ hủi, những kẻ khốn khổ, vô gia cư, đã sống trong thân cây kola như loài súc vật! Voi, ngựa, khiên và vũ khí của chúng sẽ làm gì được chúng tôi?”
Te gantvā tasmiṃ kamme niyuttaamaccānaṃ kathesuṃ, amaccā rājakulānaṃ kathesuṃ.
They went and reported this to the ministers in charge of that work, and the ministers reported it to the royal families.
Họ đi kể lại cho các vị quan được giao nhiệm vụ đó, và các vị quan kể lại cho các hoàng tộc.
Tato sākiyā – ‘‘bhaginīhi saddhiṃ saṃvasitakānaṃ thāmañca balañca dassessāmā’’ti yuddhasajjā nikkhamiṃsu.
Thereupon, the Sakyas, preparing for battle, set out, saying, “We will show the strength and might of those who cohabited with their sisters!”
Sau đó, người Sākiya nói: “Chúng ta sẽ cho những kẻ đã sống chung với chị em ruột thấy sức mạnh và quyền lực của chúng ta!” Rồi họ xuất quân sẵn sàng chiến đấu.
Koliyāpi – ‘‘kolarukkhavāsīnaṃ thāmañca balañca dassessāmā’’ti yuddhasajjā nikkhamiṃsu.
The Koliyas also, preparing for battle, set out, saying, “We will show the strength and might of those who lived in a kolarukkha!”
Người Koliyā cũng nói: “Chúng ta sẽ cho những kẻ sống trong thân cây kola thấy sức mạnh và quyền lực của chúng ta!” Rồi họ xuất quân sẵn sàng chiến đấu.
343
Bhagavāpi rattiyā paccūsasamayeva mahākaruṇāsamāpattito uṭṭhāya lokaṃ volokento ime evaṃ yuddhasajje nikkhamante addasa.
The Blessed One, in the early dawn hours, arose from his attainment of great compassion and, surveying the world, saw these two royal armies setting out for battle.
Vào lúc rạng đông, Đức Thế Tôn cũng từ định Đại Bi xuất khởi, quán sát thế gian và thấy những người này đang xuất quân sẵn sàng chiến đấu như vậy.
Disvā – ‘‘mayi gate ayaṃ kalaho vūpasammissati nu kho udāhu no’’ti upadhārento – ‘‘ahamettha gantvā kalahavūpasamanatthaṃ tīṇi jātakāni kathessāmi, tato kalaho vūpasammissati.
Seeing them, he reflected, “If I go, will this quarrel cease or not?” He concluded, “I will go there and, for the cessation of the quarrel, teach three Jātakas; then the quarrel will cease.
Sau khi thấy, Ngài suy xét: “Khi ta đến đó, liệu cuộc tranh chấp này có được dập tắt không, hay là không?” Rồi Ngài quyết định: “Ta sẽ đến đó và thuyết ba câu chuyện Jātaka để dập tắt cuộc tranh chấp, và sau đó cuộc tranh chấp sẽ được dập tắt.
Atha sāmaggidīpanatthāya dve jātakāni kathetvā attadaṇḍasuttaṃ desessāmi.
Then, to demonstrate unity, I will teach two Jātakas and then the Attadaṇḍa Sutta.
Sau đó, để làm nổi bật sự hòa hợp, ta sẽ thuyết hai câu chuyện Jātaka, rồi thuyết kinh Attadaṇḍa Sutta.
Desanaṃ sutvā ubhayanagaravāsinopi aḍḍhatiyāni aḍḍhatiyāni kumārasatāni dassanti, ahaṃ te pabbājessāmi, tadā mahāsamāgamo bhavissatī’’ti sanniṭṭhānaṃ akāsi.
Having heard the discourse, the residents of both cities will each offer two and a half hundred princes. I will ordain them, and then there will be a great assembly.”
Sau khi nghe bài giảng, cư dân của cả hai thành phố sẽ cúng dường hai trăm rưỡi hoàng tử mỗi bên, ta sẽ cho họ xuất gia, và khi đó sẽ có một đại hội lớn.”
Tasmā imesu yuddhasajjesu nikkhamantesu kassaci anārocetvā sayameva pattacīvaramādāya gantvā dvinnaṃ senānaṃ antare ākāse pallaṅkaṃ ābhujitvā chabbaṇṇarasmiyo vissajjetvā nisīdi.
Therefore, as these armies were setting out for battle, without informing anyone, he himself took his bowl and robes, went, and sat down in the sky between the two armies, cross-legged, radiating six-colored rays.
Vì vậy, khi những người này đang xuất quân sẵn sàng chiến đấu, Ngài không báo cho ai cả, mà tự mình mang y bát đi, đến giữa hai đạo quân, Ngài ngồi kiết già trên không trung, phóng ra sáu tia sáng rực rỡ.
344
Kapilavatthuvāsino bhagavantaṃ disvāva, ‘‘amhākaṃ ñātiseṭṭho satthā āgato.
As soon as the residents of Kapilavatthu saw the Blessed One, they thought, “Our noblest relative, the Teacher, has arrived.
Cư dân Kapilavatthu vừa thấy Đức Thế Tôn liền nghĩ: “Bậc Thầy, người thân cao quý nhất của chúng ta, đã đến.
Diṭṭho nu kho tena amhākaṃ kalahakaraṇabhāvo’’ti cintetvā, ‘‘na kho pana sakkā bhagavati āgate amhehi parassa sarīre satthaṃ pātetuṃ.
Has he seen our quarreling?” They reflected, “Indeed, with the Blessed One present, we cannot throw a weapon at another’s body.
Liệu Ngài có thấy việc chúng ta gây tranh chấp không?” Rồi họ nghĩ: “Khi Đức Thế Tôn đã đến, chúng ta không thể nào giáng vũ khí vào thân thể người khác được.
Koliyanagaravāsino amhe hanantu vā bajjhantu vā’’ti.
Let the residents of Koliya city kill us or bind us.”
Dù cư dân Koliyā có giết chúng ta hay bắt chúng ta đi nữa.”
Āvudhāni chaḍḍetvā, bhagavantaṃ vanditvā, nisīdiṃsu.
They cast aside their weapons, paid homage to the Blessed One, and sat down.
Họ bỏ vũ khí xuống, đảnh lễ Đức Thế Tôn, rồi ngồi xuống.
Koliyanagaravāsinopi tatheva cintetvā āvudhāni chaḍḍetvā, bhagavantaṃ vanditvā, nisīdiṃsu.
The residents of Koliya city also thought the same, cast aside their weapons, paid homage to the Blessed One, and sat down.
Cư dân Koliyā cũng nghĩ như vậy, bỏ vũ khí xuống, đảnh lễ Đức Thế Tôn, rồi ngồi xuống.
345
Bhagavā jānantova, ‘‘kasmā āgatattha, mahārājā’’ti pucchi?
The Blessed One, knowing full well, asked, “Why have you come, great kings?”
Đức Thế Tôn, dù đã biết, vẫn hỏi: “Các đại vương, vì sao các ông đến đây?”
‘‘Na, bhagavā, titthakīḷāya na pabbatakīḷāya, na nadīkīḷāya, na giridassanatthaṃ, imasmiṃ pana ṭhāne saṅgāmaṃ paccupaṭṭhapetvā āgatamhā’’ti.
“Not, Blessed One, for river-festival or mountain-festival, not for river-play, nor to see mountains; but we have come to stage a battle here.”
“Bạch Đức Thế Tôn, không phải để chơi ở bến sông, không phải để chơi trên núi, không phải để chơi ở sông, không phải để ngắm cảnh núi non, mà chúng con đến đây để chuẩn bị chiến tranh tại nơi này.”
‘‘Kiṃ nissāya vo kalaho, mahārājāti?
“On what account is your quarrel, great kings?”
“Các đại vương, vì lý do gì mà các ông tranh chấp?”
Udakaṃ, bhanteti.
“Water, venerable sir.”
“Bạch Đức Thế Tôn, vì nước.”
Udakaṃ kiṃ agghati, mahārājāti?
“What is water worth, great kings?”
“Các đại vương, nước đáng giá bao nhiêu?”
Appaṃ, bhanteti.
“Little, venerable sir.”
“Bạch Đức Thế Tôn, ít thôi.”
Pathavī nāma kiṃ agghati, mahārājāti?
“What is the earth worth, great kings?”
“Các đại vương, đất đáng giá bao nhiêu?”
Anagghā, bhanteti.
“Invaluable, venerable sir.”
“Bạch Đức Thế Tôn, vô giá.”
Khattiyā kiṃ agghantīti?
“What are khattiyas worth?”
“Các chiến sĩ đáng giá bao nhiêu?”
Khattiyā nāma anagghā, bhanteti.
“Khattiyas are invaluable, venerable sir.”
“Bạch Đức Thế Tôn, các chiến sĩ là vô giá.”
Appamūlaṃ udakaṃ nissāya kimatthaṃ anagghe khattiye nāsetha, mahārāja, kalahe assādo nāma natthi, kalahavasena, mahārāja, aṭṭhāne veraṃ katvā ekāya rukkhadevatāya kāḷasīhena saddhiṃ baddhāghāto sakalampi imaṃ kappaṃ anuppattoyevāti vatvā phandanajātakaṃ (jā. 1.13.14 ādayo) kathesi’’.
“Why destroy invaluable khattiyas on account of water of little worth, great kings? There is no delight in strife. Due to a quarrel, great kings, holding a grudge unnecessarily, a certain tree deity and a black bear maintained their enmity for this entire eon.” Having said this, he taught the Phandana Jātaka.
“Các đại vương, vì sao các ông lại hủy hoại những chiến sĩ vô giá vì nước có giá trị thấp? Hỡi các đại vương, không có niềm vui nào trong tranh chấp. Hỡi các đại vương, vì tranh chấp, một vị thần cây đã gây thù oán vô cớ với một con sư tử đen, và mối thù đó đã kéo dài suốt cả kiếp này.” Nói vậy, Ngài thuyết Phandanajātaka.
Tato ‘‘parapattiyena nāma, mahārāja, na bhavitabbaṃ.
Then he said, “One should not, great kings, be influenced by others.
Sau đó, Ngài nói: “Các đại vương, không nên nghe lời kẻ khác.
Parapattiyā hutvā hi ekassa sasakassa kathāya tiyojanasahassavitthate himavante catuppadagaṇā mahāsamuddaṃ pakkhandino ahesuṃ.
Indeed, by being influenced by others’ words, through the story of a rabbit, the herds of quadrupeds in the Himavanta, three thousand yojanas wide, plunged into the great ocean.
Vì nghe lời kẻ khác, theo lời kể của một con thỏ, các loài động vật bốn chân trong dãy Hy Mã Lạp Sơn rộng ba ngàn dojana đã lao xuống đại dương.
Tasmā parapattiyena na bhavitabba’’nti vatvā, pathavīundriyajātakaṃ kathesi.
Therefore, one should not be influenced by others.” Having said this, he taught the Paṭhaviundriya Jātaka.
Vì vậy, không nên nghe lời kẻ khác.” Nói vậy, Ngài thuyết Pathavīundriyajātaka.
Tato ‘‘kadāci, mahārāja, dubbalopi mahābalassa randhaṃ vivaraṃ passati, kadāci mahābalo dubbalassa.
Then he said, “Sometimes, great kings, even the weak see a weak point or an opening in the strong; and sometimes the strong see it in the weak.
Sau đó, Ngài nói: “Các đại vương, đôi khi kẻ yếu cũng thấy được sơ hở của kẻ mạnh, đôi khi kẻ mạnh cũng thấy được sơ hở của kẻ yếu.
Laṭukikāpi hi sakuṇikā hatthināgaṃ ghātesī’’ti laṭukikajātakaṃ (jā. 1.5.39 ādayo) kathesi.
Indeed, even a small quail killed a royal elephant.” Having said this, he taught the Laṭukika Jātaka.
Ngay cả một con chim cút nhỏ cũng đã giết chết một con voi chúa.” Nói vậy, Ngài thuyết Laṭukikajātaka.
Evaṃ kalahavūpasamanatthāya tīṇi jātakāni kathetvā sāmaggiparidīpanatthāya dve jātakāni kathesi.
Thus, having taught three Jātakas for the cessation of the quarrel, he taught two Jātakas for the demonstration of unity.
Như vậy, để dập tắt cuộc tranh chấp, Ngài đã thuyết ba câu chuyện Jātaka, và để làm nổi bật sự hòa hợp, Ngài đã thuyết hai câu chuyện Jātaka.
Kathaṃ?
How?
Thế nào?
‘‘Samaggānañhi, mahārāja, koci otāraṃ nāma passituṃ na sakkotīti vatvā, rukkhadhammajātakaṃ (jā. 1.1.74) kathesi.
“Indeed, no one, great kings, can find a vulnerability among those who are united.” Having said this, he taught the Rukkhadhamma Jātaka.
“Các đại vương, không ai có thể tìm thấy sơ hở của những người hòa hợp.” Nói vậy, Ngài thuyết Rukkhadhammajātaka.
Tato ‘‘samaggānaṃ, mahārāja, koci vivaraṃ dassituṃ na sakkhi.
Then he said, “No one, great kings, could find a weak point among the united.
Sau đó, Ngài nói: “Các đại vương, không ai có thể tìm thấy sơ hở của những người hòa hợp.
Yadā pana aññamaññaṃ vivādamakaṃsu, atha te nesādaputto jīvitā voropetvā ādāya gatoti vivāde assādo nāma natthī’’ti vatvā, vaṭṭakajātakaṃ (jā. 1.1.118) kathesi.
But when they quarreled among themselves, the fowler’s son deprived them of life and took them away. Therefore, there is no delight in quarrels.” Having said this, he taught the Vaṭṭaka Jātaka.
Nhưng khi họ tranh cãi lẫn nhau, thì con trai của người thợ săn đã giết chết và mang họ đi. Vì vậy, không có niềm vui nào trong tranh chấp.” Nói vậy, Ngài thuyết Vaṭṭakajātaka.
Evaṃ imāni pañca jātakāni kathetvā avasāne attadaṇḍasuttaṃ (su. ni. 941 ādayo) kathesi.
Thus, having taught these five Jātakas, at the end he taught the Attadaṇḍa Sutta.
Như vậy, sau khi thuyết năm câu chuyện Jātaka này, cuối cùng Ngài đã thuyết Attadaṇḍa Sutta.
346
Rājāno pasannā – ‘‘sace satthā nāgamissa, mayaṃ sahatthā aññamaññaṃ vadhitvā lohitanadiṃ pavattayissāma.
The kings, delighted, said, “If the Teacher had not come, we would have struck each other with our own hands, causing a river of blood to flow.
Các vị vua hoan hỷ nói: “Nếu Đức Thế Tôn không đến, chúng ta đã tự tay giết hại lẫn nhau và làm máu chảy thành sông.
Amhākaṃ puttabhātaro ca gehadvāre na passeyyāma, sāsanapaṭisāsanampi no āharaṇako nābhavissa.
We would not have seen our sons and brothers at our house doors, and there would have been no one to bring messages to and from us.
Chúng ta sẽ không còn thấy con trai và anh em của mình trước cửa nhà, và cũng sẽ không có ai mang tin tức qua lại cho chúng ta.
Satthāraṃ nissāya no jīvitaṃ laddhaṃ.
Our lives were gained through the Teacher.
Nhờ Đức Thế Tôn mà mạng sống của chúng ta được cứu.
Sace pana satthā āgāraṃ ajjhāvasissa dīpasahassadvayaparivāraṃ catumahādīparajjamassa hatthagataṃ abhavissa, atirekasahassaṃ kho panassa puttā abhavissaṃsu, tato khattiyaparivāro avicarissa.
If, however, the Teacher had led a household life, the kingship of the four great continents, surrounded by two thousand islands, would have been in his hands. Moreover, he would have had more than a thousand sons, and he would have been surrounded by khattiyas.
Nếu Đức Thế Tôn sống đời tại gia, vương quốc bốn đại châu với hai ngàn hòn đảo đã nằm trong tay Ngài, và Ngài đã có hơn một ngàn người con, khi đó Ngài sẽ không phải đi lại với tùy tùng hoàng gia.
Taṃ kho panesa sampattiṃ pahāya nikkhamitvā sambodhiṃ patto.
But he abandoned that prosperity and went forth, and attained Perfect Enlightenment.
Thế nhưng, Ngài đã từ bỏ sự thịnh vượng đó để xuất gia và đạt được Giác ngộ.”
Idānipi khattiyaparivāroyeva vicaratū’’ti ubhayanagaravāsino aḍḍhatiyāni aḍḍhatiyāni kumārasatāni adaṃsu.
Even now, let him wander with a retinue of khattiyas, thinking this, the residents of both cities gave two hundred and fifty prince-sons each.
Cư dân của hai thành phố đã dâng cúng hai trăm rưỡi hoàng tử mỗi bên,*: “Ngay cả bây giờ, Ngài cũng hãy du hành với đoàn tùy tùng hoàng gia.”
Bhagavāpi te pabbājetvā mahāvanaṃ agamāsi.
The Blessed One also, having ordained those princes, went to the Great Forest.
Đức Thế Tôn cũng đã cho họ xuất gia và đi đến khu rừng lớn (Mahāvana).
Tesaṃ garugāravena na attano ruciyā pabbajitānaṃ anabhirati uppajji.
For those who had gone forth not out of their own desire but out of reverence for the Blessed One, discontent arose.
Đối với những người xuất gia vì lòng tôn kính chứ không phải do ý muốn của mình, sự bất mãn đã nảy sinh.
Purāṇadutiyikāyopi tesaṃ – ‘‘ayyaputtā ukkaṇṭhantu, gharāvāso na saṇṭhātī’’tiādīni vatvā sāsanaṃ pesenti.
Even their former wives sent messages to them, saying such things as, "May the noble sirs become discontented; household life is not stable."
Những người vợ cũ của họ cũng gửi tin nhắn, nói những điều như: “Các ngài hãy cảm thấy chán nản, đời sống gia đình không thể ổn định được.”
Te ca atirekataraṃ ukkaṇṭhiṃsu.
And those monk-princes became exceedingly discontented.
Và họ càng trở nên bất mãn hơn.
347
Bhagavā āvajjento tesaṃ anabhiratibhāvaṃ ñatvā – ‘‘ime bhikkhū mādisena buddhena saddhiṃ ekato vasantā ukkaṇṭhanti, handa nesaṃ kuṇāladahassa vaṇṇaṃ kathetvā tattha netvā anabhiratiṃ vinodemī’’ti kuṇāladahassa vaṇṇaṃ kathesi.
The Blessed One, reflecting, knowing their state of discontent, thought, "These bhikkhus, living together with a Buddha like me, are discontented. Let me describe the excellence of the Kuṇāla lake, lead them there, and dispel their discontent." So he described the excellence of the Kuṇāla lake.
Đức Thế Tôn quán xét và biết được trạng thái bất mãn của họ,*: “Những Tỳ-khưu này sống cùng với một vị Phật như Ta mà vẫn cảm thấy bất mãn. Hãy để Ta kể về vẻ đẹp của hồ Kuṇāla và đưa họ đến đó để xua tan sự bất mãn của họ.” Ngài đã kể về vẻ đẹp của hồ Kuṇāla.
Te taṃ daṭṭhukāmā ahesuṃ.
They wished to see it.
Họ muốn nhìn thấy hồ đó.
Daṭṭhukāmattha, bhikkhave, kuṇāladahanti?
"Monks, do you wish to see the Kuṇāla lake?"
“Này các Tỳ-khưu, các ông có muốn nhìn thấy hồ Kuṇāla không?”
Āma bhagavāti.
"Yes, Blessed One."
“Thưa Thế Tôn, có ạ.”
Yadi evaṃ etha gacchāmāti.
"If so, come, let us go."
“Nếu vậy, hãy đến, chúng ta sẽ đi.”
Iddhimantānaṃ bhagavā gamanaṭṭhānaṃ mayaṃ kathaṃ gamissāmāti.
"Blessed One, that is a place for those with psychic powers to go. How shall we go?"
“Thưa Thế Tôn, đó là nơi những bậc có thần thông đi đến. Làm sao chúng con có thể đi đến đó được?”
Tumhe gantukāmā hotha, ahaṃ mamānubhāvena gahetvā gamissāmīti.
"You just desire to go, and I will take you by my power."
“Các ông hãy muốn đi, Ta sẽ đưa các ông đi bằng năng lực của Ta.”
Sādhu, bhanteti.
"Very well, venerable sir."
“Thưa Ngài, tốt lành thay!”
Bhagavā pañca bhikkhusatāni gahetvā ākāse uppatitvā kuṇāladahe patiṭṭhāya te bhikkhū āha – ‘‘bhikkhave, imasmiṃ kuṇāladahe yesaṃ macchānaṃ nāmaṃ na jānātha mamaṃ pucchathā’’ti.
The Blessed One, taking five hundred bhikkhus, rose into the air, descended onto the Kuṇāla lake, and addressed the bhikkhus, "Bhikkhus, in this Kuṇāla lake, if there are any fish whose names you do not know, ask me."
Đức Thế Tôn mang theo năm trăm Tỳ-khưu, bay lên không trung, rồi hạ xuống hồ Kuṇāla và nói với các Tỳ-khưu đó: “Này các Tỳ-khưu, trong hồ Kuṇāla này, những loài cá nào mà các ông không biết tên, hãy hỏi Ta.”
348
Te pucchiṃsu.
They asked.
Họ đã hỏi.
Bhagavā pucchitaṃ pucchitaṃ kathesi.
The Blessed One answered every question asked.
Đức Thế Tôn đã trả lời từng câu hỏi.
Na kevalañca, macchānaṃyeva, tasmiṃ vanasaṇḍe rukkhānampi pabbatapāde dvipadacatuppadasakuṇānampi nāmāni pucchāpetvā kathesi.
Not only of fish, but he also had them ask the names of the trees in that forest, and of the two-legged, four-legged animals, and birds at the foot of the mountains, and he told them.
Không chỉ vậy, Ngài còn cho họ hỏi tên của các loài cây trong khu rừng đó, tên của các loài chim và thú hai chân, bốn chân ở chân núi, và Ngài đã trả lời.
Atha dvīhi sakuṇehi mukhatuṇḍakena ḍaṃsitvā gahitadaṇḍake nisinno kuṇālasakuṇarājā purato pacchato ubhosu ca passesu sakuṇasaṅghaparivuto āgacchati.
Then, Kuṇāla, the king of birds, holding a stick in his beak, bitten by two female birds, came, surrounded by a flock of birds, in front and behind, and on both sides.
Rồi vua chim Kuṇāla, ngồi trên một cành cây được hai con chim ngậm bằng mỏ, đi đến, được một đàn chim vây quanh ở phía trước, phía sau và hai bên.
Bhikkhū taṃ disvā – ‘‘esa, bhante, imesaṃ sakuṇānaṃ rājā bhavissati, parivārā ete etassā’’ti maññāmāti.
Seeing him, the bhikkhus thought, "Venerable sir, that must be the king of these birds, and these must be his retinue."
Các Tỳ-khưu nhìn thấy chim đó và nói: “Thưa Thế Tôn, chúng con nghĩ rằng đó chắc chắn là vua của những con chim này, và những con chim kia là tùy tùng của nó.”
Evametaṃ, bhikkhave, ayampi mameva vaṃso mama paveṇīti.
"It is so, bhikkhus. This also is my lineage, my tradition."
“Này các Tỳ-khưu, đúng như vậy. Con chim này cũng là dòng dõi của Ta, là truyền thống của Ta.”
Idāni tāva mayaṃ, bhante, ete sakuṇe passāma.
"Venerable sir, for now we see these birds.
“Thưa Thế Tôn, bây giờ chúng con đã thấy những con chim này rồi.
Yaṃ pana bhagavā ‘‘ayampi mameva vaṃso mama paveṇī’’ti āha, taṃ sotukāmamhāti.
But as for what the Blessed One said, 'This also is my lineage, my tradition,' we wish to hear that."
Nhưng điều mà Đức Thế Tôn đã nói: ‘Con chim này cũng là dòng dõi của Ta, là truyền thống của Ta,’ chúng con muốn nghe điều đó.”
Sotukāmattha, bhikkhaveti?
"Do you wish to hear, bhikkhus?"
“Này các Tỳ-khưu, các ông có muốn nghe không?”
Āma bhagavāti.
"Yes, Blessed One."
“Thưa Thế Tôn, có ạ.”
Tena hi suṇāthāti tīhi gāthāsatehi maṇḍetvā kuṇālajātakaṃ (jā. 2.21.kuṇālajātaka) kathento anabhiratiṃ vinodesi.
"Then listen," and adorning it with three hundred verses, he recounted the Kuṇāla Jātaka (Jā. 2.21.Kuṇālajātaka), thereby dispelling their discontent.
“Vậy thì hãy lắng nghe,” Ngài đã xua tan sự bất mãn của họ bằng cách kể chuyện tiền thân Kuṇāla (Jā. 2.21.Kuṇālajātaka), được trang trí bằng ba trăm bài kệ.
Desanāpariyosāne sabbepi sotāpattiphale patiṭṭhahiṃsu, maggeneva ca nesaṃ iddhipi āgatā.
At the end of the discourse, all of them attained the fruit of stream-entry, and by the path itself, their psychic powers also arose.
Khi bài thuyết pháp kết thúc, tất cả đều an trú vào quả vị Nhập Lưu, và thần thông cũng đã đến với họ ngay trên đạo lộ.
Bhagavā ‘‘hotu tāva ettakaṃ tesaṃ bhikkhūna’’nti ākāse uppatitvā mahāvanameva agamāsi.
The Blessed One, thinking, "Let that be enough for these bhikkhus for now," rose into the air and returned to the Great Forest.
Đức Thế Tôn*: “Chừng đó là đủ cho những Tỳ-khưu này,” rồi bay lên không trung và đi đến khu rừng lớn.
Tepi bhikkhū gamanakāle dasabalassa ānubhāvena gantvā āgamanakāle attano ānubhāvena bhagavantaṃ parivāretvā mahāvane otariṃsu.
Those bhikkhus also, going by the power of the Ten-Powered One during their journey, and by their own power on their return, surrounded the Blessed One and descended in the Great Forest.
Khi đi, những Tỳ-khưu đó đã đi bằng năng lực của Đức Thế Tôn, và khi trở về, họ đã vây quanh Đức Thế Tôn bằng năng lực của chính mình và hạ xuống khu rừng lớn.
349
Bhagavā paññattāsane nisīditvā te bhikkhū āmantetvā – ‘‘etha, bhikkhave, nisīdatha.
The Blessed One sat on the prepared seat and, addressing those bhikkhus, said, "Come, bhikkhus, sit down.
Đức Thế Tôn ngồi trên chỗ ngồi đã được sắp đặt, gọi các Tỳ-khưu đó và nói: “Này các Tỳ-khưu, hãy đến và ngồi xuống.
Uparimaggattayavajjhānaṃ vo kilesānaṃ kammaṭṭhānaṃ kathessāmī’’ti kammaṭṭhānaṃ kathesi.
I will teach you the meditation subject for the defilements that are to be eradicated by the three higher paths." And he taught them the meditation subject.
Ta sẽ giảng cho các ông đề mục thiền định để diệt trừ các phiền não, ngoại trừ ba đạo quả cao hơn.” Ngài đã giảng đề mục thiền định.
Bhikkhū cintayiṃsu – ‘‘bhagavā amhākaṃ anabhiratabhāvaṃ ñatvā kuṇāladahaṃ netvā anabhiratiṃ vinodesi, tattha sotāpattiphalaṃ pattānaṃ no idāni idha tiṇṇaṃ maggānaṃ kammaṭṭhānaṃ adāsi, na kho pana amhehi ‘sotāpannā maya’nti vītināmetuṃ vaṭṭati, purisapurisehi no bhavituṃ vaṭṭatī’’ti te dasabalassa pāde vanditvā uṭṭhāya nisīdanaṃ papphoṭetvā visuṃ visuṃ pabbhārarukkhamūlesu nisīdiṃsu.
The bhikkhus thought, "The Blessed One, knowing our discontent, led us to the Kuṇāla lake and dispelled our discontent; there we attained the fruit of stream-entry, and now here he has given us the meditation subject for the three higher paths. Indeed, it is not fitting for us to pass our time thinking 'we are stream-enterers,' but it is fitting for us to be resolute men." So, those five hundred bhikkhus paid homage at the feet of the Ten-Powered One, rose up, shook out their sitting cloths, and sat down separately at the foot of various trees in the ravines.
Các Tỳ-khưu đã suy nghĩ: “Đức Thế Tôn biết được sự bất mãn của chúng ta nên đã đưa chúng ta đến hồ Kuṇāla để xua tan sự bất mãn, ở đó chúng ta đã đạt được quả vị Nhập Lưu. Bây giờ ở đây, Ngài đã ban cho chúng ta đề mục thiền định cho ba đạo quả*. Chúng ta không nên tự mãn rằng ‘chúng ta đã là bậc Nhập Lưu’; chúng ta phải trở thành những người đàn ông đích thực.” Rồi họ đảnh lễ dưới chân Đức Thế Tôn, đứng dậy, phủi chỗ ngồi và ngồi riêng rẽ dưới gốc cây hoặc trong hang đá.
350
Bhagavā cintesi – ‘‘ime bhikkhū pakatiyāpi avissaṭṭhakammaṭṭhānā, laddhupāyassa pana bhikkhuno kilamanakāraṇaṃ nāma natthi.
The Blessed One thought, "These bhikkhus are naturally diligent in their meditation, and there is no cause for weariness for a bhikkhu who has found the way.
Đức Thế Tôn suy nghĩ: “Những Tỳ-khưu này vốn dĩ đã không bỏ cuộc trong việc hành thiền, và đối với một Tỳ-khưu đã tìm được phương pháp, không có lý do gì để mệt mỏi.
Gacchantā gacchantā ca vipassanaṃ vaḍḍhetvā arahattaṃ patvā ‘attanā paṭividdhaguṇaṃ ārocessāmā’ti mama santikaṃ āgamissanti.
As they go, they will develop insight and attain arahantship, and then they will come to me, thinking, 'We will declare the qualities we have realized.'
Khi đi, họ sẽ phát triển thiền quán (vipassanā), đạt được A-la-hán và sẽ đến chỗ Ta để báo cáo về phẩm hạnh mà họ đã chứng đắc.
Etesu āgatesu dasasahassacakkavāḷadevatā ekacakkavāḷe sannipatissanti, mahāsamayo bhavissati, vivitte okāse mayā nisīdituṃ vaṭṭatī’’ti tato vivitte okāse buddhāsanaṃ paññāpetvā nisīdi.
When they come, the devas of ten thousand world-systems will assemble in one world-system, and there will be a great gathering. It is fitting for me to sit in a secluded place." So, he had a Buddha-seat prepared in a secluded place and sat down.
Khi họ đến, các vị thiên nhân từ mười ngàn thế giới sẽ tụ họp tại một thế giới, sẽ có một đại hội lớn. Ta nên ngồi ở một nơi vắng vẻ.” Rồi Ngài đã sắp đặt một chỗ ngồi của Phật ở một nơi vắng vẻ và an tọa.
351
Sabbapaṭhamaṃ kammaṭṭhānaṃ gahetvā gatatthero saha paṭisambhidāhi arahattaṃ pāpuṇi.
The elder who had first taken the meditation subject attained arahantship together with the four analytical knowledges (paṭisambhidā).
Vị Trưởng lão đầu tiên nhận đề mục thiền định và ra đi đã đạt được A-la-hán cùng với Tứ Vô Ngại Giải (paṭisambhidā).
Tato aparo tato aparoti pañcasatāpi paduminiyaṃ padumāni viya vikasiṃsu.
Then another, and then another, until all five hundred bloomed like lotuses in a lotus pond.
“Rồi người khác, rồi người khác” – tất cả năm trăm vị đều nở rộ như những bông sen trong đầm sen.
Sabbapaṭhamaṃ arahattaṃ pattabhikkhu ‘‘bhagavato ārocessāmī’’ti pallaṅkaṃ vinibbhujitvā nisīdanaṃ papphoṭetvā uṭṭhāya dasabalābhimukho ahosi.
The bhikkhu who first attained arahantship, wishing to declare it to the Blessed One, rose from his cross-legged posture, shook out his sitting cloth, stood up, and faced the Ten-Powered One.
Vị Tỳ-khưu đầu tiên đạt được A-la-hán*: “Ta sẽ báo cáo cho Đức Thế Tôn,” rồi xả tư thế kiết già, phủi chỗ ngồi, đứng dậy và hướng mặt về Đức Thế Tôn.
Evaṃ aparopi aparopīti pañcasatā bhattasālaṃ pavisantā viya paṭipāṭiyāva āgamiṃsu.
Similarly, another and another, all five hundred came in succession, like entering a refectory.
“Cứ như vậy, người khác cũng vậy, người khác cũng vậy” – năm trăm vị đã đến theo thứ tự như những người vào nhà ăn.
Paṭhamaṃ āgato vanditvā nisīdanaṃ paññāpetvā, ekamantaṃ nisīditvā, paṭividdhaguṇaṃ ārocetukāmo ‘‘atthi nu kho añño koci?
The first one who arrived, having paid homage, arranged his sitting cloth, and sat down to one side. Wishing to declare the realized qualities, he wondered, "Is there anyone else?
Vị đến đầu tiên đảnh lễ, sắp đặt chỗ ngồi, ngồi sang một bên, và muốn báo cáo về phẩm hạnh đã chứng đắc,*: “Có ai khác không? Không có ai à?” Rồi quay lại nhìn con đường đã đi, ông thấy một người khác, rồi lại thấy một người khác, cứ thế tất cả họ đều đến và ngồi sang một bên. Vị này vì e ngại vị kia mà không nói, vị kia vì e ngại vị này mà không nói.
Natthī’’ti nivattitvā āgatamaggaṃ olokento aparampi addasa aparampi addasayevāti sabbepi te āgantvā ekamantaṃ nisīditvā, ayaṃ imassa harāyamāno na kathesi, ayaṃ imassa harāyamāno na kathesi.
No." He turned back and looked along the path he had come, and he saw another, and he saw yet another. Thus, all of them came and sat down to one side. This one, out of shyness before the next, did not speak; that one, out of shyness before the next, did not speak.
không có." Sau khi quay lại và nhìn con đường đã đi, Ngài lại thấy một người khác, rồi lại thấy một người khác nữa. Tất cả những người ấy đều đến và ngồi sang một bên, (rồi nghĩ:) "Người này vì xấu hổ nên không nói, người này vì xấu hổ nên không nói."
Khīṇāsavānaṃ kira dve ākārā honti – ‘‘aho vata mayā paṭividdhaguṇaṃ sadevako loko khippameva paṭivijjheyyā’’ti cittaṃ uppajjati.
It is said that arahants have two characteristics: the thought arises, "Oh, may the world, with its devas, quickly realize the qualities I have realized!"
Quả thật, các bậc đã đoạn tận lậu hoặc (khīṇāsava) có hai trạng thái: một là tâm ý muốn rằng “ước gì thế gian này cùng với chư thiên nhanh chóng chứng đắc phẩm hạnh mà ta đã chứng đắc.”
Paṭividdhabhāvaṃ pana nidhiladdhapuriso viya na aññassa ārocetukāmā honti.
But as for the state of realization, like a person who has found a treasure, they do not wish to declare it to others.
Nhưng về việc đã chứng đắc, họ không muốn báo cáo cho người khác, giống như một người đã tìm thấy kho báu.
352
Evaṃ osaṭamatte pana tasmiṃ ariyamaṇḍale pācīnayugandharaparikkhepato abbhā mahikā dhūmo rajo rāhūti, imehi upakkilesehi vippamuttaṃ buddhuppādapaṭimaṇḍitassa lokassa rāmaṇeyyakadassanatthaṃ pācīnadisāya ukkhittarajatamayamahāādāsamaṇḍalaṃ viya, nemivaṭṭiyaṃ gahetvā, parivattiyamānarajatacakkasassirikaṃ puṇṇacandamaṇḍalaṃ ullaṅghitvā, anilapathaṃ paṭipajjittha.
As soon as that assembly of noble ones had thus gathered, the full moon disc, like a great silver mirror lifted from the eastern quarter for the world adorned by the appearance of the Buddha, free from the defilements of clouds, mist, smoke, dust, and Rāhu from the eastern Yugandhara mountain range, and splendid like a revolving silver wheel held at its rim, ascended and proceeded through the sky.
Vào lúc hội chúng chư Thánh đó đã tụ họp như vậy, mặt trăng tròn, sáng rực như bánh xe bạc quay tròn, được giữ bởi vành xe, đã vượt qua các đám mây, sương mù, khói bụi, và Rahu (la-hầu) từ vòng cung của núi Yugandhara phía đông, thoát khỏi những ô nhiễm này, giống như một tấm gương lớn bằng bạc được nâng lên từ phía đông, để cho thấy vẻ đẹp của thế gian được tô điểm bởi sự xuất hiện của chư Phật, và đã đi vào con đường gió (không trung).
Iti evarūpe khaṇe laye muhutte bhagavā sakkesu viharati kapilavatthusmiṃ mahāvane mahatā bhikkhusaṅghena saddhiṃ pañcamattehi bhikkhusatehi sabbeheva arahantehi.
Thus, at that auspicious moment, in that instant, at that short time, the Blessed One was dwelling among the Sakyans, at Kapilavatthu, in the Great Forest, together with a great Sangha of bhikkhus, about five hundred bhikkhus, all of them arahants.
Vào khoảnh khắc, thời điểm, giây phút như vậy, Đức Thế Tôn đang trú ngụ tại Kapilavatthu, trong khu rừng lớn (Mahāvana) ở xứ Sakya, cùng với một đại Tăng đoàn gồm khoảng năm trăm Tỳ-khưu, tất cả đều là các bậc A-la-hán.
353
Tattha bhagavāpi mahāsammatassa vaṃse uppanno, tepi pañcasatā bhikkhū mahāsammatassa kule uppannā.
There, the Blessed One was born in the lineage of Mahāsammata, and those five hundred bhikkhus were also born in the family of Mahāsammata.
Trong đó, Đức Thế Tôn cũng sinh ra trong dòng dõi của Mahāsammata, và năm trăm Tỳ-khưu đó cũng sinh ra trong gia đình của Mahāsammata.
Bhagavāpi khattiyagabbhe jāto, tepi khattiyagabbhe jātā.
The Blessed One was born in a khattiya womb, and they too were born in khattiya wombs.
Đức Thế Tôn cũng sinh ra trong dòng dõi Sát-đế-lợi, và họ cũng sinh ra trong dòng dõi Sát-đế-lợi.
Bhagavāpi rājapabbajito, tepi rājapabbajitā.
The Blessed One was a renunciant from royalty, and they too were renunciants from royalty.
Đức Thế Tôn cũng là vị vua xuất gia, và họ cũng là những vị vua xuất gia.
Bhagavāpi setacchattaṃ pahāya hatthagataṃ cakkavattirajjaṃ nissajjitvā pabbajito, tepi setacchattaṃ pahāya hatthagatāni rajjāni vissajjitvā pabbajitā.
The Blessed One renounced the white parasol and gave up the universal sovereignty that was in his hand to go forth; they too renounced the white parasol and gave up the kingships that were in their hands to go forth.
Đức Thế Tôn cũng đã từ bỏ lọng trắng, từ bỏ vương quốc của một Chuyển Luân Vương trong tay để xuất gia, và họ cũng đã từ bỏ lọng trắng, từ bỏ các vương quốc trong tay để xuất gia.
Iti bhagavā parisuddhe okāse, parisuddhe rattibhāge, sayaṃ parisuddho parisuddhaparivāro, vītarāgo vītarāgaparivāro, vītadoso vītadosaparivāro, vītamoho vītamohaparivāro, nittaṇho nittaṇhaparivāro, nikkileso nikkilesaparivāro, santo santaparivāro, danto dantaparivāro, mutto muttaparivāro, ativiya virocatīti.
Thus, the Blessed One, in a pure place, in a pure part of the night, being Himself pure with a pure retinue, free from passion with a retinue free from passion, free from hatred with a retinue free from hatred, free from delusion with a retinue free from delusion, free from craving with a retinue free from craving, free from defilements with a retinue free from defilements, calm with a calm retinue, disciplined with a disciplined retinue, liberated with a liberated retinue, shone forth exceedingly.
Như vậy, Thế Tôn ngự trong một nơi thanh tịnh, vào một đêm thanh tịnh, chính Ngài thanh tịnh với đoàn tùy tùng thanh tịnh; Ngài đã ly tham với đoàn tùy tùng đã ly tham; Ngài đã ly sân với đoàn tùy tùng đã ly sân; Ngài đã ly si với đoàn tùy tùng đã ly si; Ngài đã không khát ái với đoàn tùy tùng không khát ái; Ngài đã không phiền não với đoàn tùy tùng không phiền não; Ngài đã tịch tịnh với đoàn tùy tùng tịch tịnh; Ngài đã điều phục với đoàn tùy tùng điều phục; Ngài đã giải thoát với đoàn tùy tùng giải thoát, Ngài vô cùng rực rỡ.
Vaṇṇabhūmi nāmesā, yattakaṃ sakkoti, tattakaṃ vattabbaṃ.
This is called the ground for praise. Whatever can be stated, that much should be stated.
Đây là một phần diễn tả, nên nói đến mức nào có thể.
Iti ime bhikkhū sandhāya vuttaṃ, ‘‘pañcamattehi bhikkhusatehi sabbeheva arahantehī’’ti.
Thus, concerning these bhikkhus, it was said, "with five hundred bhikkhus, all of them Arahants."
Như vậy, lời nói “với khoảng năm trăm Tỳ-kheo, tất cả đều là các vị A-la-hán” là nhắm đến các Tỳ-kheo này.
354
Yebhuyyenāti bahutarā sannipatitā, mandā na sannipatitā asaññī arūpāvacaradevatā samāpannadevatāyo ca.
Yebhuyyenāti means that the majority gathered, while only a few, such as the non-percipient and formless realm deities, and those deities absorbed in attainment, did not gather.
Phần lớn (Yebhuyyena) nghĩa là phần đông đã tụ họp, số ít không tụ họp là các vị trời vô tưởng (asaññī), các vị trời thuộc cõi vô sắc (arūpāvacaradevatā) và các vị trời nhập định (samāpannadevatāyo).
Tatrāyaṃ sannipātakkamo – mahāvanassa kira sāmantā devatā caliṃsu, ‘‘āyāma bho!
Here is the sequence of the gathering: The deities from the vicinity of the Great Forest stirred, saying, "Come, sirs!
Trình tự tụ họp ở đây là: các vị trời quanh Mahāvana (Đại Lâm) đã chuyển động, “Này chư vị! Đến đi!
Buddhadassanaṃ nāma bahūpakāraṃ, dhammassavanaṃ bahūpakāraṃ, bhikkhusaṅghadassanaṃ bahūpakāraṃ.
Seeing the Buddha is of great benefit, listening to the Dhamma is of great benefit, seeing the Saṅgha of bhikkhus is of great benefit.
Việc thấy Phật là có nhiều lợi ích, việc nghe pháp là có nhiều lợi ích, việc thấy Tăng đoàn là có nhiều lợi ích.
Āyāma āyāmā’’ti!
Come! Let us come!"
Đến đi, đến đi!”
Mahāsaddaṃ kurumānā āgantvā bhagavantañca taṃmuhuttaṃ arahattappattakhīṇāsave ca vanditvā ekamantaṃ aṭṭhaṃsu.
Making a loud noise, they came, paid homage to the Blessed One and to those Arahants who had attained arahatta at that very moment, and stood to one side.
Họ đến, tạo ra tiếng động lớn, đảnh lễ Thế Tôn và các vị A-la-hán đã chứng quả A-la-hán ngay lúc đó, rồi đứng sang một bên.
Eteneva upāyena tāsaṃ tāsaṃ saddaṃ sutvā saddantaraaḍḍhagāvutagāvutaaḍḍhayojanayojanādivasena tiyojanasahassavitthate himavante, tikkhattuṃ tesaṭṭhiyā nagarasahassesu, navanavutiyā doṇamukhasatasahassesu, chanavutiyā paṭṭanakoṭisatasahassesu, chapaṇṇāsāya ratanākaresūti sakalajambudīpe, pubbavidehe, aparagoyāne, uttarakurumhi, dvīsu parittadīpasahassesūti sakalacakkavāḷe, tato dutiyatatiyacakkavāḷeti evaṃ dasasahassacakkavāḷesu devatā sannipatitāti veditabbā.
By this very means, having heard the voices of those various deities—at intervals of half a gāvuta, a gāvuta, half a yojana, a yojana, and so on—deities from the Himavanta mountain, three thousand yojanas wide, from sixty-three thousand cities thrice, from ninety-nine hundred thousand doṇamukha towns, from ninety-six hundred thousand port cities, from fifty-six jewel mines—thus from the entire Jambudīpa, Pubbavideha, Aparagoyāna, Uttarakuru, and the two thousand small islands—thus from the entire cakkavāḷa, and from the second and third cakkavāḷas, it should be understood that deities gathered from ten thousand cakkavāḷas.
Theo cách này, sau khi nghe tiếng của các vị trời đó, các vị trời từ khoảng cách nửa gāvuta, một gāvuta, nửa yojana, một yojana, v.v., đã tụ họp trong dãy núi Himavanta rộng ba ngàn yojana, trong sáu mươi ba ngàn thành phố ba lần, trong chín mươi chín vạn làng doṇamukha, trong chín mươi sáu vạn thị trấn lớn, trong năm mươi sáu kho báu đá quý—tức là trên toàn bộ Jambudīpa, Pubbavideha, Aparagoyāna, Uttarakuru, trong hai ngàn tiểu đảo—tức là trong toàn bộ cakkavāḷa (vũ trụ), và từ đó đến cakkavāḷa thứ hai và thứ ba; như vậy, cần hiểu rằng các vị trời đã tụ họp trong mười ngàn cakkavāḷa.
Dasasahassacakkavāḷañhi idha dasalokadhātuyoti adhippetaṃ.
For here, ten thousand cakkavāḷas are intended as the ten world-systems.
Vì ở đây, mười ngàn cakkavāḷa được hiểu là mười cõi giới (lokadhātu).
Tena vuttaṃ – ‘‘dasahi ca lokadhātūhi devatā yebhuyyena sannipatitā hontī’’ti.
Therefore, it was said, "deities from ten world-systems mostly gathered."
Do đó, đã nói: “Các vị trời từ mười cõi giới phần lớn đã tụ họp.”
355
Evaṃ sannipatitāhi devatāhi sakalacakkavāḷagabbhaṃ yāva brahmalokā sūcighare nirantaraṃ pakkhittasūcīhi viya paripuṇṇaṃ hoti.
Thus, with the deities gathered, the entire cakkavāḷa, up to the Brahmaloka, became completely filled as if with needles continuously inserted into a needle-case.
Như vậy, với sự tụ họp của các vị trời, toàn bộ không gian cakkavāḷa, cho đến cõi Phạm thiên, trở nên đầy ắp như một hộp kim đầy kim không còn kẽ hở.
Tattha brahmalokassa evaṃ uccattanaṃ veditabbaṃ – lohapāsāde kira sattakūṭāgārasamo pāsāṇo brahmaloke ṭhatvā adho khitto catūhi māsehi pathaviṃ pāpuṇāti.
Here, the height of the Brahmaloka should be understood thus: a stone equal to a seven-storied palace, when dropped from the Brahmaloka to the ground, reaches the earth in four months.
Ở đây, độ cao của cõi Phạm thiên cần được biết như sau: một tảng đá tương đương bảy tòa nhà có mái nhọn trên Loha Pāsāda, khi được đặt ở cõi Phạm thiên và ném xuống dưới, sẽ mất bốn tháng để chạm đến mặt đất.
Evaṃ mahante okāse yathā heṭṭhā ṭhatvā khittāni pupphāni vā dhūmo vā upari gantuṃ, upari vā ṭhatvā khittasāsapā heṭṭhā otarituṃ antaraṃ na labhanti, evaṃ nirantarā devatā ahesuṃ.
In such a vast space, just as flowers or smoke thrown up from below cannot find space to go upwards, and mustard seeds thrown down from above cannot find space to descend, so too were the deities without any gaps.
Trong một không gian rộng lớn như vậy, giống như những bông hoa hoặc khói được ném từ dưới lên không thể bay lên trên, hoặc hạt cải được ném từ trên xuống không thể rơi xuống dưới mà không có khoảng trống, các vị trời đã tụ họp dày đặc như vậy.
Yathā kho pana cakkavattirañño nisinnaṭṭhānaṃ asambādhaṃ hoti, āgatāgatā mahesakkhā khattiyā okāsaṃ labhantiyeva, parato parato pana atisambādhaṃ hoti.
Just as the seat of a Cakkavatti king is not restricted, and the great and powerful khattiyas who come can always find a place, but beyond that, it becomes exceedingly crowded.
Tuy nhiên, chỗ ngồi của vị Chuyển Luân Vương thì không chật chội; các vị vua có uy lực lớn đến đều có chỗ, nhưng càng xa thì càng chật chội.
Evameva bhagavato nisinnaṭṭhānaṃ asambādhaṃ, āgatāgatā mahesakkhā devā ca brahmāno ca okāsaṃ labhantiyeva.
Even so, the seat of the Blessed One was not restricted; the great and powerful devas and Brahmās who came could always find a place.
Cũng vậy, chỗ ngồi của Thế Tôn thì không chật chội; các vị trời và Phạm thiên có uy lực lớn đến đều có chỗ.
Api sudaṃ bhagavato āsannāsannaṭṭhāne vālagganittudanamatte padese dasapi vīsatipi devā sukhume attabhāve māpetvā aṭṭhaṃsu.
Indeed, in the places very close to the Blessed One, in an area as small as the tip of a hair, ten or even twenty deities created subtle forms and stood there.
Thậm chí, trong một khu vực nhỏ bằng đầu lông đuôi ngựa gần Thế Tôn, mười hoặc hai mươi vị trời đã hóa hiện thân vi tế và đứng đó.
Sabbaparato saṭṭhi saṭṭhi devatā aṭṭhaṃsu.
At the outermost edge, sixty, sixty deities stood.
Ở xa nhất, sáu mươi sáu mươi vị trời đã đứng.
356
Suddhāvāsakāyikānanti suddhāvāsavāsīnaṃ.
Suddhāvāsakāyikānanti means those residing in the Suddhāvāsa realms.
Suddhāvāsakāyikānaṃ nghĩa là của những vị cư ngụ ở Suddhāvāsa.
Suddhāvāsā nāma suddhānaṃ anāgāmikhīṇāsavānaṃ āvāsā pañca brahmalokā.
The Suddhāvāsas are the five Brahma-worlds, the abodes of the pure Anāgāmīs and Arahants.
Suddhāvāsa là tên của năm cõi Phạm thiên, là nơi cư ngụ của các vị thanh tịnh, các vị Anāgāmī và A-la-hán đã đoạn tận lậu hoặc.
Etadahosīti kasmā ahosi?
Etadahosīti: Why did this thought arise?
Etadahosi (ý nghĩ này đã khởi lên) – tại sao lại khởi lên?
Te kira brahmāno samāpattiṃ samāpajjitvā yathā paricchedena vuṭṭhitā brahmabhavanaṃ olokentā pacchābhatte bhattagehaṃ viya suññataṃ addasaṃsu.
Those Brahmās, having entered into absorption and emerged after a certain period, looked at their Brahma-abode and saw it deserted like a refectory after a meal.
Các vị Phạm thiên ấy, sau khi nhập định và xuất định theo thời gian quy định, khi nhìn cõi Phạm thiên của mình, thấy nó trống rỗng như một phòng ăn sau bữa ăn.
Tato ‘‘kuhiṃ brahmāno gatā’’ti āvajjantā mahāsamāgamaṃ ñatvā – ‘‘ayaṃ samāgamo mahā, mayaṃ ohīnā, ohīnakānaṃ pana okāso dullabho hoti, tasmā gacchantā atucchahatthā hutvā ekekaṃ gāthaṃ abhisaṅkharitvā gacchāma.
Then, reflecting, "Where have the Brahmās gone?", they understood that there was a great gathering and thought: "This gathering is great; we are left behind. For those who are left behind, a place is hard to obtain. Therefore, let us go not empty-handed, but compose a stanza each and go.
Từ đó, khi quán xét “Các vị Phạm thiên đã đi đâu?”, họ biết được có một đại hội lớn và nghĩ: “Đại hội này rất lớn, chúng ta đã bị bỏ lại phía sau, và những người bị bỏ lại thì khó có được chỗ. Do đó, khi đi, chúng ta không nên đi tay không, mà mỗi người hãy sáng tác một bài kệ rồi đi.
Tāya mahāsamāgame ca attano āgatabhāvaṃ jānāpessāma, dasabalassa ca vaṇṇaṃ bhāsissāmā’’ti.
With these, we will make known our presence at the great gathering and proclaim the praise of the Ten-Powered One."
Nhờ đó, chúng ta sẽ cho biết sự hiện diện của mình tại đại hội lớn ấy, và cũng sẽ ca ngợi Đức Thập Lực.”
Iti tesaṃ samāpattito uṭṭhāya āvajjitattā etadahosi.
Thus, this thought arose in them because they emerged from absorption and reflected.
Như vậy, ý nghĩ này đã khởi lên do họ xuất định và quán xét.
357
Bhagavato purato pāturahesunti pāḷiyaṃ bhagavato santike abhimukhaṭṭhāneyeva otiṇṇā viya katvā vuttā, na kho panettha evaṃ attho veditabbo.
Bhagavato purato pāturahesunti (They appeared before the Blessed One) in the Pāḷi implies that they descended right in front of the Blessed One, face-to-face, but the meaning should not be understood this way here.
Bhagavato purato pāturahesuṃ (hiện ra trước Thế Tôn) trong Pāḷi được nói như thể họ đã xuất hiện ngay trước mặt Thế Tôn, nhưng không nên hiểu theo nghĩa đen như vậy.
Te pana brahmaloke ṭhitāyeva gāthā abhisaṅkharitvā eko puratthimacakkavāḷamukhavaṭṭiyaṃ otari, eko dakkhiṇacakkavāḷamukhavaṭṭiyaṃ, eko pacchimacakkavāḷamukhavaṭṭiyaṃ, eko uttaracakkavāḷamukhavaṭṭiyaṃ otari.
Rather, those Brahmās, while remaining in the Brahmaloka, composed stanzas. One descended at the eastern rim of the cakkavāḷa, one at the southern rim of the cakkavāḷa, one at the western rim of the cakkavāḷa, and one at the northern rim of the cakkavāḷa.
Các vị Phạm thiên ấy, trong khi vẫn ở cõi Phạm thiên, đã sáng tác các bài kệ, rồi một vị đi xuống ở rìa cakkavāḷa phía Đông, một vị ở rìa cakkavāḷa phía Nam, một vị ở rìa cakkavāḷa phía Tây, và một vị ở rìa cakkavāḷa phía Bắc.
Tato puratthimacakkavāḷamukhavaṭṭiyaṃ otiṇṇabrahmā nīlakasiṇaṃ samāpajjitvā nīlarasmiyo vissajjetvā dasasahassacakkavāḷadevatānaṃ maṇivammaṃ paṭimuñcanto viya attano āgatabhāvaṃ jānāpetvā buddhavīthi nāma kenaci uttarituṃ na sakkā, tasmā mahatiyā buddhavīthiyāva āgantvā bhagavantaṃ abhivādetvā ekamantaṃ aṭṭhāsi.
Then, the Brahmā who had descended at the eastern rim of the cakkavāḷa, having entered the blue kasiṇa, emitted blue rays, making his presence known as if adorning the deities of the ten thousand cakkavāḷas with a sapphire shield. It is not possible for anyone to obstruct the path of the Buddhas; therefore, he came along the great Buddha-path, saluted the Blessed One, and stood to one side.
Sau đó, vị Phạm thiên đi xuống ở rìa cakkavāḷa phía Đông, sau khi nhập nīlakasiṇa (biến xứ xanh), phóng ra các tia sáng xanh, như thể đang khoác một chiếc áo giáp ngọc bích cho các vị trời trong mười ngàn cakkavāḷa, cho biết sự hiện diện của mình, rồi đi theo con đường của chư Phật (buddhavīthi) – vì không ai có thể vượt qua con đường này – đến đảnh lễ Thế Tôn và đứng sang một bên.
Ekamantaṃ ṭhito kho attanā abhisaṅkhataṃ gāthaṃ abhāsi.
Standing to one side, he then recited the stanza he had composed.
Đứng sang một bên, vị ấy đã đọc bài kệ do mình sáng tác.
358
Dakkhiṇacakkavāḷamukhavaṭṭiyaṃ otiṇṇabrahmā pītakasiṇaṃ samāpajjitvā suvaṇṇapabhaṃ muñcitvā dasasahassacakkavāḷadevatānaṃ suvaṇṇapaṭaṃ pārupanto viya attano āgatabhāvaṃ jānāpetvā tatheva akāsi.
The Brahmā who had descended at the southern rim of the cakkavāḷa, having entered the yellow kasiṇa, emitted golden light, making his presence known as if draping the deities of the ten thousand cakkavāḷas with a golden cloth, and did likewise.
Vị Phạm thiên đi xuống ở rìa cakkavāḷa phía Nam, sau khi nhập pītakasiṇa (biến xứ vàng), phóng ra ánh sáng vàng, như thể đang khoác một tấm vải vàng cho các vị trời trong mười ngàn cakkavāḷa, cho biết sự hiện diện của mình, rồi cũng làm như vậy.
Pacchimacakkavāḷamukhavaṭṭiyaṃ otiṇṇabrahmā lohitakasiṇaṃ samāpajjitvā lohitakarasmiyo muñcitvā dasasahassacakkavāḷadevatānaṃ rattavarakambalena parikkhipanto viya attano āgatabhāvaṃ jānāpetvā tatheva akāsi.
The Brahmā who had descended at the western rim of the cakkavāḷa, having entered the red kasiṇa, emitted red rays, making his presence known as if encircling the deities of the ten thousand cakkavāḷas with a splendid red blanket, and did likewise.
Vị Phạm thiên đi xuống ở rìa cakkavāḷa phía Tây, sau khi nhập lohitakasiṇa (biến xứ đỏ), phóng ra các tia sáng đỏ, như thể đang quấn một tấm chăn len đỏ tuyệt hảo cho các vị trời trong mười ngàn cakkavāḷa, cho biết sự hiện diện của mình, rồi cũng làm như vậy.
Uttaracakkavāḷamukhavaṭṭiyaṃ otiṇṇabrahmā odātakasiṇaṃ samāpajjitvā odātarasmiyo vissajjetvā dasasahassacakkavāḷadevatānaṃ sumanakusumapaṭaṃ pārupanto viya attano āgatabhāvaṃ jānāpetvā tatheva akāsi.
The Brahmā who had descended at the northern rim of the cakkavāḷa, having entered the white kasiṇa, emitted white rays, making his presence known as if draping the deities of the ten thousand cakkavāḷas with a jasmin flower cloth, and did likewise.
Vị Phạm thiên đi xuống ở rìa cakkavāḷa phía Bắc, sau khi nhập odātakasiṇa (biến xứ trắng), phóng ra các tia sáng trắng, như thể đang khoác một tấm vải hoa lài cho các vị trời trong mười ngàn cakkavāḷa, cho biết sự hiện diện của mình, rồi cũng làm như vậy.
359
Pāḷiyaṃ pana bhagavato purato pāturahesuṃ.
In the Pāḷi, however, it is stated: "They appeared before the Blessed One.
Trong Pāḷi, đã nói: Các vị ấy hiện ra trước Thế Tôn.
Atha kho tā devatā bhagavantaṃ abhivādetvā ekamantaṃ aṭṭhaṃsūti evaṃ ekakkhaṇe viya purato pātubhāvo ca abhivādetvā ekamantaṃ ṭhitabhāvo ca vutto, so iminā anukkamena ahosi, ekato katvā pana dassito.
Then those deities saluted the Blessed One and stood to one side." Thus, their appearance before Him and their standing to one side after saluting Him are described as if occurring at one moment. This happened in the sequence described, but it is presented together.
Sau đó, các vị trời ấy đảnh lễ Thế Tôn và đứng sang một bên, như thể sự xuất hiện và việc đứng sang một bên diễn ra cùng một lúc, nhưng thực ra là theo trình tự này, chỉ là được trình bày gộp lại.
Gāthābhāsanaṃ pana pāḷiyampi visuṃ visuṃyeva vuttaṃ.
The recitation of the stanzas, however, is mentioned separately in the Pāḷi as well.
Còn việc đọc kệ thì trong Pāḷi cũng đã được nói riêng từng vị.
360
Tattha mahāsamayoti mahāsamūho.
Here, mahāsamayo means a great assembly.
Ở đây, mahāsamayo nghĩa là một đại hội lớn.
Pavanaṃ vuccati vanasaṇḍo.
Pavanaṃ is called a grove.
Pavanaṃ được gọi là một khu rừng.
Ubhayenapi bhagavā ‘‘imasmiṃ pana vanasaṇḍe ajja mahāsamūho sannipāto’’ti āha.
By both, the Blessed One said, "Today there is a great assembly, a gathering, in this grove."
Thế Tôn đã nói cả hai điều: “Hôm nay, có một đại hội lớn tụ họp trong khu rừng này.”
Tato yesaṃ so sannipāto, te dassetuṃ devakāyā samāgatāti āha.
Therefore, to indicate those for whom the gathering was, it says, "devakāyā samāgatā" (hosts of deities gathered).
Sau đó, để chỉ rõ những ai đã tụ họp, Ngài nói devakāyā samāgatā (các nhóm chư thiên đã đến).
Tattha devakāyāti devaghaṭā.
Here, devakāyā means hosts of deities.
Ở đây, devakāyā nghĩa là các nhóm chư thiên.
Āgatamha imaṃ dhammasamayanti evaṃ samāgate devakāye disvā mayampi imaṃ dhammasamūhaṃ āgatā.
Āgatamha imaṃ dhammasamayanti (We have come to this Dhamma assembly): Seeing the gathered hosts of deities, we too have come to this Dhamma assembly.
Āgatamha imaṃ dhammasamayaṃ (Chúng tôi đã đến đại hội Pháp này): Khi thấy các nhóm chư thiên đã tụ họp như vậy, chúng tôi cũng đã đến đại hội Pháp này.
Kiṃ kāraṇā?
For what reason?
Vì lý do gì?
Dakkhitāye aparājitasaṅghanti kenaci aparājitaṃ ajjeva tayo māre madditvā vijitasaṅgāmaṃ imaṃ aparājitasaṅghaṃ dassanatthāya āgatamhāti attho.
The meaning is: "Dakkhitāye aparājitasaṅgha" means that we have come to see this unconquered Saṅgha, who, unconquered by anyone, today alone crushed the three Māras and won the battle.
Dakkhitāye aparājitasaṅgha (để thấy Tăng đoàn bất bại) có nghĩa là: Chúng tôi đến đây để được thấy Tăng đoàn bất bại này, những người mà hôm nay đã chế ngự ba ma vương, chiến thắng trận chiến, và không ai có thể đánh bại được.
So pana, brahmā, imaṃ gāthaṃ bhāsitvā, bhagavantaṃ abhivādetvā, puratthimacakkavāḷamukhavaṭṭiyaṃyeva aṭṭhāsi.
And that brahmā, having recited this verse, bowed to the Blessed One, and stood right at the eastern edge of the cakkavāḷa.
Vị Phạm thiên ấy, sau khi nói bài kệ này, đã đảnh lễ Thế Tôn và đứng ở vành đai phía đông của thế giới.
361
Atha dutiyo vuttanayeneva āgantvā abhāsi.
Then the second*, having come in the manner described, spoke.
Rồi vị Phạm thiên thứ hai, cũng theo cách đã nói, đến và thưa.
Tattha tatra bhikkhavoti tasmiṃ sannipātaṭṭhāne bhikkhū.
There, "tatra bhikkhavo" refers to the bhikkhus at that assembly place.
Ở đây, tatra bhikkhavo (các Tỳ-kheo ở đó) có nghĩa là các Tỳ-kheo tại nơi hội họp ấy.
Samādahaṃsūti samādhinā yojesuṃ.
"Samādahaṃsū" means they united* with samādhi.
Samādahaṃsū (họ đã an định) có nghĩa là họ đã hợp nhất với định.
Cittamattano ujukaṃ akaṃsūti attano citte sabbe vaṅkakuṭilajimhabhāve haritvā ujukaṃ akariṃsu.
"Cittamattano ujukaṃ akaṃsū" means they made their minds straight, removing all crookedness, deviousness, and deceit.
Cittamattano ujukaṃ akaṃsū (họ đã làm cho tâm mình ngay thẳng) có nghĩa là họ đã loại bỏ mọi sự cong vẹo, quanh co, gian xảo trong tâm mình và làm cho nó ngay thẳng.
Sārathīva nettāni gahetvāti yathā samappavattesu sindhavesu odhastapatodo sārathī sabbayottāni gahetvā acodento avārento tiṭṭhati, evaṃ chaḷaṅgupekkhāya samannāgatā guttadvārā sabbepete pañcasatā bhikkhū indriyāni rakkhanti paṇḍitā, ete daṭṭhuṃ idhāgatamhā bhagavāti, sopi gantvā yathāṭhāneyeva aṭṭhāsi.
"Sārathīva nettāni gahetvā" means: just as a charioteer, having released the goad for well-trained Sindh horses, grasps all the reins and stands without urging or restraining, so too, O Blessed One, all these five hundred bhikkhus, endowed with six-limbed equanimity and guarded senses, protect their faculties, being wise ones; we have come here to see them. He also went and stood in his usual place.
Sārathīva nettāni gahetvā (như người đánh xe nắm giữ dây cương): Như người đánh xe, với chiếc roi đã đặt xuống, nắm giữ tất cả dây cương trên những con ngựa Sindhu thuần thục, đứng yên mà không thúc giục hay ngăn cản, thì cũng vậy, các Tỳ-kheo năm trăm vị này, đầy đủ sáu chi xả (chaḷaṅgupekkhā), giữ gìn các căn, là những bậc hiền trí, họ bảo vệ các căn. Bạch Thế Tôn, chúng con đến đây để được thấy những vị ấy. Sau đó, vị Phạm thiên ấy cũng đi và đứng ở vị trí cũ.
362
Atha tatiyo vuttanayeneva āgantvā abhāsi.
Then the third*, having come in the manner described, spoke.
Rồi vị Phạm thiên thứ ba, cũng theo cách đã nói, đến và thưa.
Tattha chetvā khīlanti rāgadosamohakhīlaṃ chinditvā.
There, "chetvā khīlaṃ" means having cut the peg of greed, hatred, and delusion.
Ở đây, chetvā khīla (đã chặt cọc) có nghĩa là đã chặt cọc ái dục, sân hận, si mê.
Palighanti rāgadosamohapalighameva.
"Palighaṃ" refers to the bar of greed, hatred, and delusion.
Paligha (chốt cửa) có nghĩa là chốt cửa ái dục, sân hận, si mê.
Indakhīlanti rāgadosamohaindakhīlameva.
"Indakhīlaṃ" refers to the post of greed, hatred, and delusion.
Indakhīla (cột trụ) có nghĩa là cột trụ ái dục, sân hận, si mê.
Ūhacca manejāti ete taṇhāejāya anejā bhikkhū indakhīlaṃ ūhacca samūhanitvā catūsu disāsu appaṭihatacārikaṃ caranti.
"Ūhacca manejā" means these bhikkhus, free from the tremor (ejā) of craving, having uprooted the indakhīla, wander unimpeded in the four directions.
Ūhacca manejā (đã nhổ bỏ sự rung động): Những Tỳ-kheo này, không còn sự rung động của khát ái, đã nhổ bỏ cột trụ và đi lại tự do không bị chướng ngại ở bốn phương.
Suddhāti nirupakkilesā.
"Suddhā" means undefiled.
Suddhā (thanh tịnh) có nghĩa là không còn phiền não.
Vimalāti nimmalā.
"Vimalā" means Stainless.
Vimalā (không cấu uế) có nghĩa là không còn cấu uế.
Idaṃ tasseva vevacanaṃ.
This is a synonym of the same*.
Đây là từ đồng nghĩa của từ ấy.
Cakkhumatāti pañcahi cakkhūhi cakkhumantena.
"Cakkhumatā" means having vision through the five kinds of eyes.
Cakkhumatā (bậc có mắt) có nghĩa là bậc có năm loại mắt.
Sudantāti cakkhutopi dantā sotatopi ghānatopi jivhātopi kāyatopi manatopi dantā.
"Sudantā" means tamed in terms of eye, ear, nose, tongue, body, and mind.
Sudantā (đã được điều phục tốt) có nghĩa là đã được điều phục tốt về mắt, về tai, về mũi, về lưỡi, về thân và về ý.
Susunāgāti taruṇanāgā.
"Susunāgā" means young Nāgas (arahants).
Susunāgā (những Nāga trẻ) có nghĩa là những Nāga trẻ.
Tatrāyaṃ vacanattho – chandādīhi na gacchantīti nāgā, tena tena maggena pahīne kilese na āgacchantīti nāgā, nānappakāraṃ āguṃ na karontīti nāgā.
In this word, the meaning is: they do not go (na gacchanti) by way of desire (chanda) and so forth, thus they are nāgā; they do not return (na āgacchanti) to the defilements abandoned by this path or that path, thus they are nāgā; they do not commit (na karonti) various kinds of offenses (āguṃ), thus they are nāgā.
Ý nghĩa của từ này ở đây là: không đi theo dục vọng v.v... nên gọi là Nāga; không để những phiền não đã được đoạn trừ bằng con đường ấy quay trở lại nên gọi là Nāga; không gây ra các loại lỗi lầm khác nhau nên gọi là Nāga.
Ayamettha saṅkhepo, vitthāro pana mahāniddese (mahāni. 80) vuttanayeneva veditabbo.
This is a brief explanation here; the detailed explanation should be understood in the manner stated in the Mahāniddesa.
Đây là tóm tắt ở đây, còn chi tiết thì nên hiểu theo cách đã nói trong Mahāniddesa.
363
Apica –
Furthermore:
Hơn nữa –
364
‘‘Āguṃ na karoti kiñci loke,
"He commits no offense in the world,
“Không làm điều lỗi lầm nào trên đời,
365
Sabbasaṃyoga visajja bandhanāni;
Having abandoned all fetters and bonds;
Đã xả bỏ mọi trói buộc, mọi ràng buộc;
366
Sabbattha na sajjatī vimutto,
Unattached everywhere, fully liberated,
Đã giải thoát, không còn vướng mắc ở đâu,
367
Nāgo tādi pavuccate tathattā’’ti–
Such a Nāga is called thus due to his nature."
Bậc Nāga như vậy được gọi như thế vì bản chất của mình.”
368
Evamettha attho veditabbo.
This is how the meaning should be understood here.
Ý nghĩa ở đây nên được hiểu như vậy.
Susunāgāti susū nāgā, susunāgabhāvasampattiṃ pattāti attho.
"Susunāgā" means susū Nāgas, meaning they have attained the perfection of being young Nāgas (arahants).
Susunāgā (những Nāga trẻ) có nghĩa là những Nāga còn trẻ, tức là đã đạt được sự thành tựu của Nāga trẻ.
Te evarūpe anuttarena yoggācariyena damite taruṇanāge dassanāya āgatamha bhagavāti.
We have come, O Blessed One, to see such young Nāgas, trained by the supreme master of discipline.
Bạch Thế Tôn, chúng con đến đây để được thấy những Nāga trẻ như vậy, đã được điều phục bởi một bậc đạo sư huấn luyện vô thượng.
Sopi gantvā yathāṭhāneyeva aṭṭhāsi.
He also went and stood in his usual place.
Vị Phạm thiên ấy cũng đi và đứng ở vị trí cũ.
369
Atha catuttho vuttanayeneva āgantvā abhāsi.
Then the fourth*, having come in the manner described, spoke.
Rồi vị Phạm thiên thứ tư, cũng theo cách đã nói, đến và thưa.
Tattha gatāseti nibbematikasaraṇagamanena gatā.
There, "gatāse" means having gone by way of taking refuge free from doubt.
Ở đây, gatāse (họ đã đi) có nghĩa là họ đã đi bằng cách quy y không còn nghi ngờ.
Sopi gantvā yathāṭhāneyeva aṭṭhāsīti.
He also went and stood in his usual place.
Vị Phạm thiên ấy cũng đi và đứng ở vị trí cũ.
Sattamaṃ.
The Seventh.
Thứ bảy.
370
8. Sakalikasuttavaṇṇanā
8. Sakalikasutta Commentary
8. Lời Bình về Kinh Sakalika
371
38. Aṭṭhame maddakucchisminti evaṃnāmake uyyāne.
In the eighth*, "maddakucchismiṃ" refers to a park of that name.
38. Trong kinh thứ tám, maddakucchismi (trong Maddakucchi) có nghĩa là trong khu vườn mang tên ấy.
Tañhi ajātasattumhi kucchigate tassa mātarā – ‘‘ayaṃ mayhaṃ kucchigato gabbho rañño sattu bhavissati.
Indeed, when Ajātasattu was in the womb, his mother thought, "This embryo in my womb will be an enemy to the king.
Khi Ajātasattu còn trong bụng mẹ, mẹ của ông đã nghĩ: “Thai nhi này trong bụng ta sẽ là kẻ thù của nhà vua.
Kiṃ me iminā’’ti?
What good is he to me?"
Ta có cần nó làm gì?”
Gabbhapātanatthaṃ kucchi maddāpitā.
So, to induce an abortion, she had her belly massaged.
Bà đã cho người xoa bóp bụng để phá thai.
Tasmā ‘‘maddakucchī’’ti saṅkhaṃ gataṃ.
Therefore, it came to be known as "Maddakucchi."
Vì vậy, nơi đó được gọi là “Maddakucchi”.
Migānaṃ pana abhayavāsatthāya dinnattā migadāyoti vuccati.
But it is called "Migadāya" (Deer Park) because it was given for animals to live there without fear.
Vì được hiến tặng để các loài thú sống không sợ hãi, nên nó được gọi là Migadāya (Vườn Lộc Uyển).
372
Tena kho pana samayenāti ettha ayaṃ anupubbikathā – devadatto hi ajātasattuṃ nissāya dhanuggahe ca dhanapālakañca payojetvāpi tathāgatassa jīvitantarāyaṃ kātuṃ asakkonto ‘‘sahattheneva māressāmī’’ti gijjhakūṭapabbataṃ abhiruhitvā mahantaṃ kūṭāgārappamāṇaṃ silaṃ ukkhipitvā, ‘‘samaṇo gotamo cuṇṇavicuṇṇo hotū’’ti pavijjhi.
Here, "tena kho pana samayenā" has this sequential story: Devadatta, relying on Ajātasattu and employing archers and the elephant Dhanapāla, was unable to bring about the Tathāgata's demise. He then thought, "I will kill him myself," and climbed Mount Gijjhakūṭa. He lifted a large rock, the size of a peaked-house, and hurled it down, wishing, "May the ascetic Gotama be crushed to powder!"
Tena kho pana samayenā (Vào lúc bấy giờ), câu chuyện tuần tự như sau: Devadatta, dựa vào Ajātasattu, đã sai những cung thủ và con voi Dhanapāla để cố gắng giết hại Như Lai, nhưng không thành công. Hắn nghĩ: “Ta sẽ tự tay giết Ngài”, rồi leo lên núi Gijjhakūṭa, nhấc một tảng đá lớn bằng một ngôi nhà mái nhọn, và ném xuống với ý nghĩ: “Mong Sa-môn Gotama bị nghiền nát thành bụi”.
Mahāthāmavā kiresa pañcannaṃ hatthīnaṃ balaṃ dhāreti.
It is said that he possessed great strength, equal to that of five elephants.
Người ta nói rằng hắn có sức mạnh lớn lao, mang sức mạnh của năm con voi.
Aṭṭhānaṃ kho panetaṃ, yaṃ buddhānaṃ parūpakkamena jīvitantarāyo bhaveyyāti taṃ tathāgatassa sarīrābhimukhaṃ āgacchantaṃ ākāse aññā silā uṭṭhahitvā sampaṭicchi.
However, it is impossible for Buddhas to suffer an untimely death by the aggression of others. Therefore, as that rock approached the Tathāgata's body, another rock rose in the sky and intercepted it.
Tuy nhiên, điều đó là không thể xảy ra, rằng các vị Phật có thể bị hại đến tính mạng bởi sự tấn công của người khác. Vì vậy, khi tảng đá ấy bay về phía thân Như Lai, một tảng đá khác từ trên không trung bay lên và chặn lại.
Dvinnaṃ silānaṃ sampahārena mahanto pāsāṇassa sakalikā uṭṭhahitvā bhagavato piṭṭhipādapariyantaṃ abhihani, pādo mahāpharasunā pahato viya samuggatalohitena lākhārasamakkhito viya ahosi.
Due to the collision of the two rocks, a large splinter of stone flew up and struck the Blessed One's heel. His foot became like it had been struck by a great axe, smeared with a crimson liquid, as if with lac-dye, due to the profusely gushing blood.
Do sự va chạm của hai tảng đá, một mảnh đá lớn văng ra và trúng vào gót chân của Thế Tôn, khiến bàn chân Ngài trông như bị chém bằng một chiếc rìu lớn, máu chảy ra như được nhuộm bằng nước sơn.
Bhagavā uddhaṃ ulloketvā devadattaṃ etadavoca – ‘‘bahu tayā moghapurisa, apuññaṃ pasutaṃ, yo tvaṃ paduṭṭhacitto vadhakacitto tathāgatassa lohitaṃ uppādesī’’ti.
The Blessed One looked up and addressed Devadatta, "Much demerit, foolish man, have you accumulated, in that you, with a corrupted mind, with a murderous mind, caused blood to flow from the Tathāgata's body."
Thế Tôn ngước nhìn lên và nói với Devadatta: “Này kẻ ngu muội, ngươi đã tạo ra nhiều nghiệp bất thiện, khi với tâm ác độc, tâm muốn giết hại, ngươi đã làm chảy máu Như Lai.”
Tato paṭṭhāya bhagavato aphāsu jātaṃ.
From that time onwards, the Blessed One experienced discomfort.
Từ đó trở đi, Thế Tôn bị đau yếu.
Bhikkhū cintayiṃsu – ‘‘ayaṃ vihāro ujjaṅgalo visamo, bahūnaṃ khattiyādīnañceva pabbajitānañca anokāso’’ti.
The bhikkhus thought, "This monastery is desolate and uneven; it is unsuitable for many khattiyas and others, as well as for monastics."
Các Tỳ-kheo suy nghĩ: “Tịnh xá này gồ ghề, không bằng phẳng, không thích hợp cho nhiều người thuộc dòng Sát-đế-lỵ và các vị xuất gia.”
Te tathāgataṃ mañcasivikāya ādāya maddakucchiṃ nayiṃsu.
So, they carried the Tathāgata on a hammock-stretcher to Maddakucchi.
Họ đã đưa Như Lai trên một chiếc cáng đến Maddakucchi.
Tena vuttaṃ – ‘‘tena kho pana samayena bhagavato pādo sakalikāya khato hotī’’ti.
Therefore, it is said, "At that time, the Blessed One's foot was injured by a splinter."
Vì vậy, đã nói: “Vào lúc bấy giờ, chân của Thế Tôn bị thương bởi một mảnh đá.”
373
Bhusāti balavatiyo.
"Bhusā" means strong.
Bhusā (mạnh mẽ) có nghĩa là dữ dội.
Sudanti nipātamattaṃ.
"Sudaṃ" is merely a particle.
Sudaṃ (quả thật) chỉ là một từ đệm (nipāta).
Dukkhanti sukhapaṭikkhepo.
"Dukkhaṃ" is the negation of pleasure.
Dukkha (khổ) là sự phủ nhận của lạc.
Tibbāti bahalā.
"Tibbā" means intense.
Tibbā (gay gắt) có nghĩa là mãnh liệt.
Kharāti pharusā.
"Kharā" means harsh.
Kharā (thô ráp) có nghĩa là khắc nghiệt.
Kaṭukāti tikhiṇā.
"Kaṭukā" means sharp.
Kaṭukā (cay đắng) có nghĩa là sắc bén.
Asātāti amadhurā.
"Asātā" means unpleasant.
Asātā (không dễ chịu) có nghĩa là không ngọt ngào.
Na tāsu mano appeti, na tā manaṃ appāyanti vaḍḍhentīti amanāpā.
The mind does not settle in them, nor do they gladden or increase the mind, hence "amanāpā" (disagreeable).
Tâm không an trú vào chúng, chúng không làm cho tâm an trú và phát triển, nên gọi là amanāpā (không vừa ý).
Sato sampajānoti vedanādhivāsanasatisampajaññena samannāgato hutvā.
"Sato sampajāno" means being endowed with mindfulness and clear comprehension for enduring feeling.
Sato sampajāno (tỉnh giác và chánh niệm) có nghĩa là đầy đủ chánh niệm và tỉnh giác trong việc chịu đựng cảm thọ.
Avihaññamānoti apīḷiyamāno, samparivattasāyitāya vedanānaṃ vasaṃ agacchanto.
"Avihaññamāno" means not being tormented, not falling under the sway of feelings by constantly shifting positions.
Avihaññamāno (không bị phiền nhiễu) có nghĩa là không bị đau đớn, không bị các cảm thọ chi phối đến mức phải lăn qua lăn lại.
374
Sīhaseyyanti ettha kāmabhogiseyyā, petaseyyā, sīhaseyyā, tathāgataseyyāti catasso seyyā.
Here, regarding "sīhaseyyaṃ," there are four kinds of lying down: the lying down of sense-enjoyers, the lying down of pretas, the lion's lying down, and the Tathāgata's lying down.
Sīhaseyya (tư thế nằm của sư tử): Ở đây có bốn tư thế nằm: tư thế nằm của người hưởng thụ dục lạc, tư thế nằm của ngạ quỷ, tư thế nằm của sư tử, và tư thế nằm của Như Lai.
Tattha ‘‘yebhuyyena, bhikkhave, kāmabhogī sattā vāmena passena sentī’’ti ayaṃ kāmabhogiseyyā.
Of these, "For the most part, bhikkhus, beings who indulge in sensual pleasures lie on their left side"—this is the lying down of sense-enjoyers.
Trong đó, “Này các Tỳ-kheo, đa số chúng sinh hưởng thụ dục lạc thường nằm nghiêng bên trái”, đây là tư thế nằm của người hưởng thụ dục lạc.
Tesu hi yebhuyyena dakkhiṇapassena sayāno nāma natthi.
Among them, hardly anyone lies on their right side.
Trong số đó, hầu như không có ai nằm nghiêng bên phải.
‘‘Yebhuyyena, bhikkhave, petā uttānā sentī’’ti ayaṃ petaseyyā.
"For the most part, bhikkhus, pretas lie on their backs"—this is the lying down of pretas.
“Này các Tỳ-kheo, đa số ngạ quỷ thường nằm ngửa”, đây là tư thế nằm của ngạ quỷ.
Appamaṃsalohitattā hi aṭṭhisaṅghāṭajaṭitā ekena passena sayituṃ na sakkonti, uttānāva senti.
Because they have little flesh and blood, being merely skeletons, they cannot lie on one side; they lie on their backs.
Vì ít thịt và máu, chỉ còn bộ xương, nên chúng không thể nằm nghiêng một bên, mà chỉ nằm ngửa.
‘‘Yebhuyyena, bhikkhave, sīho migarājā naṅguṭṭhaṃ antarasatthimhi anupakkhipitvā dakkhiṇena passena setī’’ti ayaṃ sīhaseyyā.
"For the most part, bhikkhus, the lion, king of beasts, lies on its right side, tucking its tail between its thighs"—this is the lion's lying down.
“Này các Tỳ-kheo, đa số sư tử, vua của các loài thú, thường nằm nghiêng bên phải, đuôi đặt giữa hai đùi sau”, đây là tư thế nằm của sư tử.
Tejussadattā hi sīho migarājā dve purimapāde ekasmiṃ, ‘pacchimapāde ekasmiṃ ṭhāne ṭhapetvā naṅguṭṭhaṃ antarasatthimhi pakkhipitvā purimapādapacchimapādanaṅguṭṭhānaṃ ṭhitokāsaṃ sallakkhetvā dvinnaṃ purimapādānaṃ matthake sīsaṃ ṭhapetvā sayati, divasampi sayitvā pabujjhamāno na utrasanto pabujjhati, sīsaṃ pana ukkhipitvā purimapādādīnaṃ ṭhitokāsaṃ sallakkheti’.
Indeed, being full of vigor, the lion, king of beasts, places its two front paws in one spot, its hind paws in another, tucks its tail between its thighs, marks the place where its front paws, hind paws, and tail are placed, and lies down with its head resting on its two front paws. Even after lying down for a day and awakening, it does not wake up startled; it lifts its head and surveys the places where its front paws and other limbs were placed.
Sư tử, vua của các loài thú, vì có sức mạnh và uy dũng, đặt hai chân trước ở một chỗ, hai chân sau ở một chỗ, đuôi đặt giữa hai đùi sau, và đặt đầu lên hai chân trước, chú ý đến vị trí của chân trước, chân sau và đuôi, rồi nằm ngủ. Dù ngủ cả ngày, khi thức dậy, nó không giật mình hoảng sợ, mà chỉ ngẩng đầu lên và chú ý đến vị trí của chân trước v.v... đã đặt.
Sace kiñci ṭhānaṃ vijahitvā ṭhitaṃ hoti, ‘‘nayidaṃ tuyhaṃ jātiyā, na sūrabhāvassa anurūpa’’nti anattamano hutvā tattheva sayati, na gocarāya pakkamati.
If any spot has been abandoned, it becomes displeased, thinking, "This is not befitting your birth, nor your bravery," and lies down there, not going out to hunt.
Nếu có bất kỳ chỗ nào bị lệch khỏi vị trí, nó sẽ không hài lòng, nghĩ rằng: “Điều này không phù hợp với dòng dõi và sự dũng mãnh của ta”, và nằm yên tại chỗ, không đi kiếm ăn.
Avijahitvā ṭhite pana ‘‘tuyhaṃ jātiyā ca sūrabhāvassa ca anurūpamida’’nti haṭṭhatuṭṭho uṭṭhāya sīhavijambhitaṃ vijambhitvā kesarabhāraṃ vidhunitvā tikkhattuṃ sīhanādaṃ naditvā gocarāya pakkamati.
If it remains, not having abandoned it, then, thinking, "This is suitable for your birth and for your bravery," delighted and joyful, it rises, stretches with the stretching of a lion, shakes its mane, roars a lion's roar three times, and departs for its hunting ground.
Nhưng khi không từ bỏ chỗ nằm, nó (sư tử) hoan hỷ, phấn khởi đứng dậy, vươn vai như sư tử, rũ bờm, rống tiếng sư tử ba lần rồi đi kiếm ăn.
Catutthajjhānaseyyā pana ‘‘tathāgataseyyā’’ti vuccati.
The fourth jhāna posture, however, is called "the Tathāgata's posture."
Còn sự nằm nhập Tứ thiền thì được gọi là “tư thế nằm của Như Lai”.
Tāsu idha sīhaseyyā āgatā.
Among these, the lion's posture is mentioned here.
Trong số đó, ở đây (trong kinh này) đề cập đến tư thế nằm sư tử.
Ayañhi tejussadairiyāpathattā uttamaseyyā nāma.
This, indeed, is called the supreme posture due to its majestic deportment.
Vì đây là một oai nghi đầy uy lực, nên nó được gọi là tư thế nằm tối thượng.
375
Pāde pādanti dakkhiṇapāde vāmapādaṃ.
Foot on foot means the left foot on the right foot.
Pāde pāda (chân trên chân): là đặt chân trái lên chân phải.
Accādhāyāti atiādhāya, īsakaṃ atikkamma ṭhapetvā.
Placing one over the other means placing it slightly overlapping, having set it down a little past.
Accādhāyā (đặt chồng lên): là đặt hơi quá, đặt vượt lên một chút.
Gopphakena hi gopphake jāṇunā vā jāṇumhi saṅghaṭṭiyamāne abhiṇhaṃ vedanā uppajjati, cittaṃ ekaggaṃ na hoti, seyyā aphāsukā hoti.
For when ankle chafes ankle or knee chafes knee, pain constantly arises, the mind is not one-pointed, and the posture is uncomfortable.
Vì khi mắt cá chạm mắt cá, hoặc đầu gối chạm đầu gối, thì cảm thọ thường xuyên phát sinh, tâm không định được nhất điểm, và tư thế nằm không thoải mái.
Yathā na saṅghaṭṭeti, evaṃ atikkamma ṭhapite vedanā nuppajjati, cittaṃ ekaggaṃ hoti, seyyā phāsu hoti.
When placed in such a way that it does not chafe, pain does not arise, the mind becomes one-pointed, and the posture is comfortable.
Khi đặt vượt lên như vậy để không chạm vào nhau, thì cảm thọ không phát sinh, tâm định được nhất điểm, và tư thế nằm thoải mái.
Tasmā evaṃ nipajji.
Therefore, he lay down in this manner.
Vì vậy, Ngài đã nằm như thế.
Sato sampajānoti sayanapariggāhakasatisampajaññena samannāgato.
Mindful and clearly comprehending means endowed with mindfulness and clear comprehension that comprehend the lying-down posture.
Sato sampajāno (tỉnh giác): là đầy đủ chánh niệm và tỉnh giác để quán xét tư thế nằm.
‘‘Uṭṭhānasañña’’nti panettha na vuttaṃ, gilānaseyyā hesā tathāgatassa.
Here, the term "perception of rising" is not mentioned, for this was the Tathāgata's posture in sickness.
Ở đây, không nói “tưởng thức tỉnh”, vì đây là tư thế nằm của Như Lai khi bệnh.
376
Sattasatāti imasmiṃ sutte sabbāpi tā devatā gilānaseyyaṭṭhānaṃ āgatā.
Seven hundred devas, all of them in this Sutta, came to the place of the sick-posture.
Sattasatā (bảy trăm): trong kinh này, tất cả chư thiên ấy đều đến nơi Đức Phật nằm khi bệnh.
Udānaṃ udānesīti gilānaseyyaṃ āgatānaṃ domanassena bhavitabbaṃ siyā.
Uttered a paean indicates that those who came to the sick-posture might have felt sorrow.
Udānaṃ udānesī (thốt lời cảm hứng): những vị đã đến nơi Đức Phật nằm khi bệnh lẽ ra phải có tâm ưu phiền.
Imāsaṃ pana tathāgatassa vedanādhivāsanaṃ disvā, ‘‘aho buddhānaṃ mahānubhāvatā!
But these devas, seeing the Tathāgata's endurance of pain, thought: "Alas, what great majesty the Buddhas possess!
Nhưng khi thấy Đức Như Lai chịu đựng cảm thọ, các vị ấy đã thốt lời cảm hứng rằng: “Ôi! Oai lực vĩ đại của chư Phật!
Evarūpāsu nāma vedanāsu vattamānāsu vikāramattampi natthi, sirīsayane alaṅkaritvā ṭhapitasuvaṇṇarūpakaṃ viya aniñjamānena kāyena nipanno, idānissa adhikataraṃ mukhavaṇṇo virocati, ābhāsampanno puṇṇacando viya sampati vikasitaṃ viya ca aravindaṃ assa mukhaṃ sobhati, kāyepi vaṇṇāyatanaṃ idāni susammaṭṭhakañcanaṃ viya vippasīdatī’’ti udānaṃ udapādi.
Even when such pains arise, there is not even a trace of change; he lies motionless with his body like a golden statue placed adorned on a magnificent couch. Now his facial complexion shines even more, like a full moon radiant with light, and his face now blossoms like a freshly opened lotus; even his body's complexion now appears exceedingly bright like well-burnished gold." Thus a paean arose in them.
Dù đang trải qua những cảm thọ như vậy, Ngài không hề có chút biến đổi nào, nằm yên với thân không lay động như pho tượng vàng được trang trí trên giường quý, bây giờ sắc diện của Ngài càng thêm rạng rỡ, khuôn mặt Ngài tỏa sáng như trăng tròn đầy ánh sáng, và như hoa sen vừa nở, sắc thân Ngài giờ đây trong trẻo như vàng ròng mới được đánh bóng.”
377
Nāgo vata bhoti, ettha bhoti dhammālapanaṃ.
Indeed, a Nāga! Here, bho is an address of exhortation.
Nāgo vata bho (Thật là một bậc Nāga!): ở đây, từ bho là lời xưng hô thân mật.
Balavantaṭṭhena nāgo.
Nāga signifies strength.
Nāgo (Voi chúa) theo nghĩa là bậc có sức mạnh.
Nāgavatāti nāgabhāvena.
Like a Nāga refers to the state of being a Nāga (great elephant).
Nāgavatā (như voi chúa) theo nghĩa là trạng thái của voi chúa.
Sīho vatātiādīsu asantāsanaṭṭhena sīho.
In phrases like Indeed, a lion!, lion signifies fearlessness.
Trong các từ như Sīho vatā (Thật là một bậc Sư tử!), sīho (sư tử) theo nghĩa là không sợ hãi.
Byattaparicayaṭṭhena kāraṇākāraṇajānanena vā ājānīyo.
A thoroughbred means one skilled in training or one who knows what is proper and improper.
Ājānīyo (bậc thiện mã) theo nghĩa là thuần thục trong sự rèn luyện, hoặc là người biết rõ nguyên nhân và phi nguyên nhân.
Appaṭisamaṭṭhena nisabho.
A bull signifies unequalled.
Nisabho (bậc vương ngưu) theo nghĩa là vô song.
Gavasatajeṭṭhako hi usabho, gavasahassajeṭṭhako vasabho, gavasatasahassajeṭṭhako nisabhoti vuccati.
An ox that is chief of a hundred oxen is called an usabha (bull); one that is chief of a thousand oxen is called a vasabha; one that is chief of a hundred thousand oxen is called a nisabha (great bull).
Thật vậy, con bò đầu đàn của một trăm con bò được gọi là usabha, của một ngàn con bò được gọi là vasabha, và của một trăm ngàn con bò được gọi là nisabha.
Bhagavā pana appaṭisamaṭṭhena āsabhaṃ ṭhānaṃ paṭijānāti.
But the Blessed One proclaims his auspicious state as unequalled.
Đức Thế Tôn tuyên bố vị trí asabha (vô song) theo nghĩa là vô song.
Tenevatthena idha ‘‘nisabho’’ti vutto.
It is for this same reason that he is here called "nisabha."
Cũng theo ý nghĩa đó, ở đây Ngài được gọi là “nisabha”.
Dhuravāhaṭṭhena dhorayho.
A draught-animal means one who bears the burden.
Dhorayho (bậc gánh vác) theo nghĩa là người gánh vác trách nhiệm.
Nibbisevanaṭṭhena danto.
Tamed means free from defilements like passion.
Danto (bậc đã được thuần hóa) theo nghĩa là đã được thuần hóa khỏi các phiền não.
378
Passāti aniyamitāṇatti.
Look! is an unrestricted exhortation.
Passā (hãy nhìn): là một mệnh lệnh không giới hạn.
Samādhinti arahattaphalasamādhiṃ.
Concentration means the concentration of the fruit of arahantship.
Samādhiṃ (định): là A-la-hán quả định.
Suvimuttanti phalavimuttiyā suvimuttaṃ.
Well-released means well-released by the liberation of fruit (of arahantship).
Suvimutta (giải thoát hoàn toàn): là giải thoát hoàn toàn nhờ quả giải thoát.
Rāgānugataṃ pana cittaṃ abhinataṃ nāma hoti, dosānugataṃ apanataṃ.
A mind inclined towards passion is called abhinataṃ (bent towards), and one inclined towards hatred is called apanataṃ (bent away).
Tâm bị tham dục chi phối thì được gọi là thiên về (abhinataṃ), tâm bị sân hận chi phối thì được gọi là nghiêng về (apanataṃ).
Tadubhayapaṭikkhepena na cābhinataṃ na cāpanatanti āha.
By rejecting both, it is said: neither bent towards nor bent away.
Ngài nói na cābhinataṃ na cāpanataṃ (không thiên về cũng không nghiêng về) để bác bỏ cả hai điều đó.
Na ca sasaṅkhāraniggayhavāritagatanti na sasaṅkhārena sappayogena kilese niggahetvā vāritavataṃ, kilesānaṃ pana chinnattā vataṃ phalasamādhinā samāhitanti attho.
Nor forcefully restrained by exertion means not restrained or controlled by exertion with effort to suppress defilements, but rather, because defilements are cut off, one's practice is concentrated by the fruit-concentration. This is the meaning.
Na ca sasaṅkhāraniggayhavāritagata (không bị ngăn chặn hay chế ngự bằng nỗ lực): không phải bị ngăn chặn hay chế ngự phiền não bằng nỗ lực và sự cố gắng, mà là do phiền não đã bị đoạn trừ, nên sự tu tập được định tĩnh bằng quả định, đó là ý nghĩa.
Atikkamitabbanti viheṭhetabbaṃ ghaṭṭetabbaṃ.
To be transgressed means to be tormented, to be assailed.
Atikkamitabba (vượt qua): là quấy nhiễu, làm tổn hại.
Adassanāti aññāṇā.
From not seeing means from ignorance.
Adassanā (không thấy): là vô minh.
Aññāṇī hi andhabālova evarūpe satthari aparajjheyyāti devadattaṃ ghaṭṭayamānā vadanti.
For it is the ignorant, like the blind and foolish, who would offend such a Teacher, so they speak, provoking Devadatta.
Các vị ấy nói, ám chỉ Devadatta, rằng chỉ có kẻ vô minh, như một đứa trẻ mù quáng, mới có thể phạm lỗi với một Bậc Đạo Sư như vậy.
379
Pañcavedāti itihāsapañcamānaṃ vedānaṃ dhārakā.
Having the five Vedas means those who have memorized the Vedas, with the Itihāsa as the fifth.
Pañcavedā (năm Veda): là những người đã thuộc lòng năm bộ Veda, với Itihāsa là bộ thứ năm.
Sataṃ samanti vassasataṃ.
For a hundred years means for a hundred years.
Sataṃ samaṃ (một trăm năm): là một trăm năm.
Tapassīti tapanissitakā hutvā.
Ascetics means having become devoted to ascetic practices.
Tapassī (người tu khổ hạnh): là những người đã nương tựa vào sự tu khổ hạnh.
Caranti carantā.
Live means practicing.
Cara (hành): là những người đang hành trì.
Na sammāvimuttanti sacepi evarūpā brāhmaṇā vassasataṃ caranti, cittañca nesaṃ sammā vimuttaṃ na hoti.
Are not rightly liberated means even if such Brahmins practice for a hundred years, their minds are not rightly liberated.
Na sammāvimutta (không giải thoát hoàn toàn): nếu những Bà-la-môn như vậy có tu hành một trăm năm, thì tâm của họ cũng không được giải thoát hoàn toàn.
Hīnattarūpā na pāraṃ gamā teti hīnattasabhāvā te nibbānaṅgamā na honti.
Being of a low nature, they do not reach the far shore means being of a mean nature, they do not attain Nibbāna.
Hīnattarūpā na pāraṃ gamā te (họ là những người có bản chất thấp kém, không thể đạt đến bờ bên kia): những người có bản chất thấp kém ấy không thể đạt đến Niết Bàn.
‘‘Hīnattharūpā’’tipi pāṭho, hīnatthajātikā parihīnatthāti attho.
"Hīnattharūpā" is also a reading, meaning having a mean purpose, or having a deteriorated purpose.
Cũng có bản đọc là “Hīnattharūpā”, có nghĩa là những người có bản chất thấp kém, những người bị suy đồi.
Taṇhādhipannāti taṇhāya ajjhotthaṭā.
Overwhelmed by craving means enveloped by craving.
Taṇhādhipannā (bị ái dục chi phối): là bị ái dục bao trùm.
Vatasīlabaddhāti ajavatakukkuravatādīhi ca vatehi tādiseheva ca sīlehi baddhā.
Bound by vows and moral practices means bound by vows such as the goat-vow and dog-vow, and by similar moral practices.
Vatasīlabaddhā (bị ràng buộc bởi giới hạnh và cấm giới): là bị ràng buộc bởi các cấm giới như cấm giới dê, cấm giới chó, và các giới hạnh tương tự.
Lūkhaṃ tapanti pañcātapatāpanaṃ kaṇṭakaseyyādikaṃ tapaṃ.
Harsh asceticism refers to ascetic practices such as self-mortification under five fires or sleeping on thorns.
Lūkhaṃ tapa (khổ hạnh khắc nghiệt): là khổ hạnh như phơi mình dưới năm ngọn lửa, nằm trên gai nhọn, v.v.
Idāni sā devatā sāsanassa niyyānikabhāvaṃ kathentī na mānakāmassātiādimāha.
Now that deva, explaining the salvific nature of the teaching, says not desiring honor, and so on.
Bây giờ, vị thiên nhân ấy, khi nói về tính chất đưa đến giải thoát của giáo pháp, đã nói những lời bắt đầu bằng na mānakāmassā (không phải của kẻ kiêu mạn), v.v.
Taṃ vuttatthamevāti.
That has already been explained.
Những lời đó đã được giải thích rồi.
Aṭṭhamaṃ.
The Eighth.
Thứ Tám.
380
9. Paṭhamapajjunnadhītusuttavaṇṇanā
9. Discourse on the First Daughter of Pajjunna
9. Chú giải kinh Pajjunnadhītusutta thứ nhất
381
39. Navame pajjunnassa dhītāti pajjunnassa nāma vassavalāhakadevarañño cātumahārājikassa dhītā.
39. In the ninth (discourse), daughter of Pajjunna means the daughter of the god-king Pajjunna, who is a cloud deva of the Cātumahārājika realm.
39. Trong (kinh) thứ chín, pajjunnassa dhītā (con gái của Pajjunna) là con gái của vị thiên vương Pajjunna, vị thần mây mưa thuộc chư thiên Tứ Đại Thiên Vương.
Abhivandeti bhagavā tumhākaṃ pāde vandāmi.
I pay homage means "O Blessed One, I worship your feet."
Abhivande (con đảnh lễ): “Bạch Thế Tôn, con đảnh lễ chân của Ngài.”
Cakkhumatāti pañcahi cakkhūhi cakkhumantena tathāgatena.
By the One with eyes means by the Tathāgata, who has the five eyes.
Cakkhumatā (bậc có mắt): là Đức Như Lai, bậc có mắt với năm loại mắt.
Dhammo anubuddhoti, ‘‘idaṃ mayā pubbe paresaṃ santike kevalaṃ sutaṃyeva āsī’’ti vadati.
The Dhamma has been comprehended means, "This I had only heard from others before," she says.
Dhammo anubuddho (Pháp đã được chứng ngộ): vị ấy nói: “Điều này trước đây con chỉ nghe từ người khác mà thôi.”
Sāhaṃ dānīti, sā ahaṃ idāni.
Therefore I now means, "Therefore I now."
Sāhaṃ dānī (bây giờ con): là “bây giờ con đây”.
Sakkhi jānāmīti, paṭivedhavasena paccakkhameva jānāmi.
I know firsthand means, "I know it directly by way of penetration (paṭivedha)."
Sakkhi jānāmī (con đích thân biết): là “con đích thân biết rõ nhờ sự thể nhập.”
Vigarahantāti, ‘‘hīnakkharapadabyañjano’’ti vā ‘‘aniyyāniko’’ti vā evaṃ garahantā.
Slandering means slandering thus: "having inferior letters, words, and phrases," or "not leading to liberation."
Vigarahantā (chê bai): là chê bai như “chữ nghĩa thấp kém” hoặc “không đưa đến giải thoát” như vậy.
Roruvanti, dve roruvā – dhūmaroruvo ca jālaroruvo ca.
Roruva There are two Roruvas: Dhūmaroruva and Jālaroruva.
Roruvaṃ (Roruva): có hai loại Roruva – Dhūmaroruva và Jālaroruva.
Tattha dhūmaroruvo visuṃ hoti, jālaroruvoti pana avīcimahānirayassevetaṃ nāmaṃ.
Among them, Dhūmaroruva is a separate hell, but Jālaroruva is the name for the Avīci great hell itself.
Trong đó, Dhūmaroruva là một địa ngục riêng biệt, còn Jālaroruva là tên của đại địa ngục Avīci.
Tattha hi sattā aggimhi jalante jalante punappunaṃ ravaṃ ravanti, tasmā so ‘‘roruvo’’ti vuccati.
For there, beings repeatedly wail as the fire blazes and blazes, so it is called "Roruva."
Ở đó, khi lửa cháy rực, các chúng sinh liên tục kêu la, vì vậy nó được gọi là “Roruva”.
Ghoranti dāruṇaṃ.
Terrible means cruel.
Ghoraṃ (khủng khiếp): là tàn bạo.
Khantiyā upasamena upetāti ruccitvā khamāpetvā gahaṇakhantiyā ca rāgādiupasamena ca upetāti.
Endowed with patience and tranquility means delighted, having made one endure, and endowed with the patience of comprehension and the complete pacification of passion and so on.
Khantiyā upasamena upetā (đầy đủ sự nhẫn nại và an tịnh): là hoan hỷ, chịu đựng, đầy đủ sự nhẫn nại của trí tuệ thâu nhận và sự an tịnh các phiền não như tham dục, v.v.
Navamaṃ.
The Ninth.
Thứ Chín.
382
10. Dutiyapajjunnadhītusuttavaṇṇanā
10. Discourse on the Second Daughter of Pajjunna
10. Chú giải kinh Pajjunnadhītusutta thứ hai
383
40. Dasame dhammañcāti ca saddena saṅghañca, iti tīṇi ratanāni namassamānā idhāgatāti vadati.
40. In the tenth (discourse), and the Dhamma means, by the word ca (and), "and the Sangha." Thus, she says that she came here honoring the three Jewels.
40. Trong (kinh) thứ mười, dhammañcā (và Pháp): với từ “ca” (và) là và Tăng, vị ấy nói rằng đã đến đây để đảnh lễ ba ngôi báu.
Atthavatīti, atthavatiyo.
Meaningful means full of meaning.
Atthavatī (có ý nghĩa): là có nhiều ý nghĩa.
Bahunāpi kho tanti yaṃ dhammaṃ sā abhāsi, taṃ dhammaṃ bahunāpi pariyāyena ahaṃ vibhajeyyaṃ.
And indeed, that extensively means, "I will expound the Dhamma that she spoke in many ways."
Bahunāpi kho taṃ (dù nhiều): Pháp mà vị ấy đã nói, Pháp đó tôi cũng sẽ phân tích bằng nhiều cách.
Tādiso dhammoti, tādiso hi ayaṃ bhagavā dhammo, taṃsaṇṭhito tappaṭibhāgo bahūhi pariyāyehi vibhajitabbayuttakoti dasseti.
Such is the Dhamma means, "Indeed, this Dhamma of the Blessed One is such, established in that manner, having that counterpart, worthy of being expounded in many ways." Thus it shows.
Tādiso dhammo (Pháp như vậy): Ngài chỉ ra rằng Đức Thế Tôn là Pháp như vậy, Pháp đó được thiết lập như vậy, tương đương như vậy, nên cần phải được phân tích bằng nhiều cách.
Lapayissāmīti, kathayissāmi.
I will speak means, "I will say."
Lapayissāmī (tôi sẽ nói): tôi sẽ nói.
Yāvatā me manasā pariyattanti yattakaṃ mayā manasā pariyāpuṭaṃ, tassatthaṃ divasaṃ avatvā madhupaṭalaṃ pīḷentī viya muhutteneva saṃkhittena kathessāmi.
As much as I have learned by mind means, "I will speak briefly in a moment, without taking a whole day, about the meaning of whatever I have learned by mind, as if squeezing a honeycomb."
Yāvatā me manasā pariyattaṃ (những gì tôi đã học thuộc lòng bằng tâm): tôi sẽ nói tóm tắt ý nghĩa của những gì tôi đã học thuộc lòng bằng tâm, chỉ trong một khoảnh khắc, như vắt một tổ ong, chứ không nói cả ngày.
Sesaṃ uttānamevāti.
The rest is straightforward.
Phần còn lại là rõ ràng.
Dasamaṃ.
The Tenth.
Thứ Mười.
384
Satullapakāyikavaggo catuttho.
The Satullapakāyika Chapter, the Fourth.
Satullapakāyikavagga thứ tư kết thúc.
385

5. Ādittavaggo

5. The Chapter on the Blazing

5. Ādittavagga (Phẩm Bốc Cháy)

386
1. Ādittasuttavaṇṇanā
1. Discourse on the Blazing
1. Chú giải kinh Ādittasutta
387
41. Ādittavaggassa paṭhame jarāya maraṇena cāti desanāsīsametaṃ, rāgādīhi pana ekādasahi aggīhi loko ādittova.
41. In the first (discourse) of the Āditta Chapter, by aging and death is the head of the teaching; however, the world is indeed ablaze with the eleven fires such as passion.
41. Trong (kinh) Ādittavagga thứ nhất, jarāya maraṇena cā (bởi già và chết): đây là tiêu đề của bài thuyết pháp, nhưng thế gian thực sự đang bốc cháy bởi mười một ngọn lửa như tham dục, v.v.
Dānenāti dānacetanāya.
By giving means by the volition of giving.
Dānenā (bằng sự bố thí): bằng tâm bố thí.
Dinnaṃ hoti sunīhatanti dānapuññacetanāhi dāyakasseva hoti gharasāmikassa viya nīhatabhaṇḍakaṃ, tenetaṃ vuttaṃ.
What is given is well-secured means that the meritorious volition of giving belongs to the giver, like household goods that are well-secured. Thus it is said.
Dinnaṃ hoti sunīhataṃ (đã được cho, đã được cất giữ kỹ): công đức bố thí thuộc về người cho, giống như tài sản được cất giữ kỹ của chủ nhà, vì vậy điều này đã được nói.
Corā harantīti adinne bhoge corāpi haranti rājānopi, aggipi ḍahati, ṭhapitaṭṭhānepi nassanti.
Thieves take away means that thieves take away unsaved possessions, kings also take them away, fire burns them, and they are lost even in the place where they are kept.
Corā harantī (kẻ trộm cướp): tài sản không được cho thì kẻ trộm cướp cũng cướp, vua chúa cũng cướp, lửa cũng thiêu đốt, và chúng cũng bị mất mát ngay cả ở nơi cất giữ.
Antenāti maraṇena.
Antenā means by death.
Antenāti (bởi sự kết thúc) nghĩa là bởi cái chết.
Sarīraṃ sapariggahanti sarīrañceva corādīnaṃ vasena avinaṭṭhabhoge ca.
Sarīraṃ sapariggaha means the body, and wealth undisturbed by thieves and so forth.
Sarīraṃ sapariggahanti (thân và tài sản) nghĩa là thân thể và tài sản chưa bị hủy hoại bởi trộm cướp, v.v.
Saggamupetīti vessantaramahārājādayo viya sagge nibbattatīti.
Saggamupetī means that, like King Vessantara and others, one is reborn in a heavenly realm.
Saggamupetīti (đi đến cõi trời) nghĩa là được tái sinh ở cõi trời, như các đại vương Vessantara, v.v.
Paṭhamaṃ.
The first.
Thứ nhất.
388
2. Kiṃdadasuttavaṇṇanā
2. Explanation of the Kiṃdadasutta
2. Giải thích Kinh Kiṃdada
389
42. Dutiye annadoti yasmā atibalavāpi dve tīṇi bhattāni abhutvā uṭṭhātuṃ na sakkoti, bhutvā pana dubbalopi hutvā balasampanno hoti, tasmā ‘‘annado balado’’ti āha.
42. In the second, annado (food-giver) means that since even a very strong person cannot get up without eating two or three meals, but after eating, even a weak person becomes strong; therefore, it is said, “annado balado” (food-giver is strength-giver).
42. Trong kinh thứ hai, annadoti (người cho thức ăn) được nói là "người cho thức ăn là người cho sức mạnh" vì một người dù rất khỏe mạnh cũng không thể đứng dậy nếu không ăn hai ba bữa, nhưng sau khi ăn, dù yếu đuối cũng trở nên tràn đầy sức mạnh.
Vatthadoti yasmā surūpopi duccoḷo vā acoḷo vā virūpo hoti ohīḷito duddasiko, vatthacchanno devaputto viya sobhati, tasmā ‘‘vatthado hoti vaṇṇado’’ti āha.
Vatthado (garment-giver) means that since even a beautiful person, if ill-clad or unclothed, looks unsightly, shameful, and unpleasant, but when clad in garments, shines like a devaputta; therefore, it is said, “vatthado hoti vaṇṇado” (garment-giver is beauty-giver).
Vatthadoti (người cho y phục) được nói là "người cho y phục là người cho sắc đẹp" vì một người dù có hình dáng đẹp nhưng nếu y phục dơ bẩn hoặc không có y phục thì sẽ trông xấu xí, đáng xấu hổ, khó nhìn; còn nếu được che đậy bằng y phục thì sẽ rạng rỡ như một vị trời.
Yānadoti hatthiyānādīnaṃ dāyako.
Yānado (vehicle-giver) refers to one who gives elephant-carriages and so forth.
Yānadoti (người cho phương tiện đi lại) là người dâng cúng các phương tiện đi lại như xe voi, v.v.
Tesu pana –
Among these, however—
Trong số đó –
390
‘‘Na hatthiyānaṃ samaṇassa kappati,
“An elephant-carriage is not allowable for a recluse,
"Xe voi không phù hợp cho Sa-môn,
391
Na assayānaṃ, na rathena yātuṃ;
Nor a horse-carriage, nor to travel by chariot;
Xe ngựa không phù hợp, cũng không phải đi bằng xe;
392
Idañca yānaṃ samaṇassa kappati,
This conveyance, however, is allowable for a recluse,
Nhưng phương tiện này phù hợp cho Sa-môn,
393
Upāhanā rakkhato sīlakhandha’’nti.
Sandals for one who guards the aggregate of sīla.”
Giày dép dành cho người giữ gìn giới hạnh."
394
Tasmā chattupāhanakattarayaṭṭhimañcapīṭhānaṃ dāyako, yo ca maggaṃ sodheti, nisseṇiṃ karoti, setuṃ karoti, nāvaṃ paṭiyādeti, sabbopi yānadova hoti.
Therefore, one who gives umbrellas, sandals, staffs, walking sticks, couches, and chairs, and one who clears a path, builds a ladder, constructs a bridge, or prepares a boat, all are indeed vehicle-givers.
Vì vậy, người dâng cúng dù, dép, gậy, giường, ghế; và người dọn đường, làm cầu thang, xây cầu, chuẩn bị thuyền, tất cả đều là người cho phương tiện đi lại.
Sukhado hotīti yānassa sukhāvahanato sukhado nāma hoti.
Sukhado hoti (becomes a happiness-giver) means that due to providing the comfort of a vehicle, one is called a happiness-giver.
Sukhado hotīti (là người cho sự an lạc) được gọi là người cho sự an lạc vì phương tiện đi lại mang lại sự an lạc.
Cakkhudoti andhakāre cakkhumantānampi rūpadassanābhāvato dīpado cakkhudo nāma hoti, anuruddhatthero viya dibbacakkhu sampadampi labhati.
Cakkhudo (eye-giver) means that because even those with sight cannot see forms in darkness, one who gives lamps is called an eye-giver; one also obtains the attainment of divine sight, like the Elder Anuruddha.
Cakkhudoti (người cho con mắt) được gọi là người cho con mắt vì trong bóng tối, ngay cả người có mắt cũng không thể thấy hình sắc; người cho đèn là người cho con mắt, và cũng có thể đạt được thiên nhãn như Trưởng lão Anuruddha.
395
Sabbadado hotīti sabbesaṃyeva balādīnaṃ dāyako hoti.
Sabbadado hoti (becomes a giver of all) means one becomes a giver of all strength and so forth.
Sabbadado hotīti (là người cho tất cả) nghĩa là người cho tất cả các loại sức mạnh, v.v.
Dve tayo gāme piṇḍāya caritvā kiñci aladdhā āgatassāpi sītalāya pokkharaṇiyā nhāyitvā patissayaṃ pavisitvā muhuttaṃ mañce nipajjitvā uṭṭhāya nisinnassa hi kāye balaṃ āharitvā pakkhittaṃ viya hoti.
Indeed, for a monk who has gone for alms through two or three villages and returned without obtaining anything, after bathing in a cool pond, entering the monastery, lying down on a couch for a moment, getting up, and sitting down, it is as if strength has been brought and placed in his body.
Ngay cả một vị Tỳ-khưu đã đi khất thực hai ba ngôi làng mà không nhận được gì, khi trở về, tắm rửa trong ao sen mát mẻ, vào tịnh xá, nằm trên giường một lát rồi đứng dậy ngồi xuống, cảm giác như sức mạnh đã được mang đến và đặt vào thân thể.
Bahi vicarantassa ca kāye vaṇṇāyatanaṃ vātātapehi jhāyati, patissayaṃ pavisitvā dvāraṃ pidhāya muhuttaṃ nipannassa ca visabhāgasantati vūpasammati, sabhāgasantati okkamati, vaṇṇāyatanaṃ āharitvā pakkhittaṃ viya hoti.
And for one walking outside, the organ of vision in the body is scorched by wind and sun; but for one who enters the monastery, closes the door, and lies down for a moment, the dissimilar continuity ceases, the similar continuity arises, and it is as if the organ of vision has been brought and placed in his body.
Khi đi bên ngoài, sắc diện trên thân bị gió và nắng làm cháy sém; nhưng khi vào tịnh xá, đóng cửa lại và nằm xuống một lát, sự tiếp nối không tương ứng sẽ lắng dịu, sự tiếp nối tương ứng sẽ phát sinh, cảm giác như sắc diện đã được mang đến và đặt vào thân thể.
Bahi vicarantassa pāde kaṇṭako vijjhati, khāṇu paharati, sarīsapādiparissayo ceva corabhayañca uppajjati, patissayaṃ pavisitvā dvāraṃ pidhāya nipannassa sabbete parissayā na honti, dhammaṃ sajjhāyantassa dhammapītisukhaṃ, kammaṭṭhānaṃ manasikarontassa upasamasukhaṃ uppajjati.
For one walking outside, a thorn pierces the foot, a stump strikes it, dangers from snakes and so forth, and fear of robbers arise; but for one who enters the monastery, closes the door, and lies down, all these dangers do not occur. For one reciting Dhamma, the happiness of Dhamma-pīti arises; for one attending to kammaṭṭhāna, the happiness of peace arises.
Khi đi bên ngoài, gai đâm vào chân, cọc đâm vào, các mối nguy hiểm từ bò sát và nỗi sợ trộm cướp phát sinh; nhưng khi vào tịnh xá, đóng cửa lại và nằm xuống, tất cả những mối nguy hiểm đó không còn. Khi tụng đọc Pháp, niềm hỷ lạc Pháp phát sinh; khi quán niệm đề mục thiền, niềm an lạc tịch tịnh phát sinh.
Tathā bahi vicarantassa ca sedā muccanti, akkhīni phandanti, senāsanaṃ pavisanakkhaṇe kūpe otiṇṇo viya hoti, mañcapīṭhādīni na paññāyanti.
Similarly, for one walking outside, sweat is released, and eyes flutter. At the moment of entering the senāsana, it is as if one has descended into a well, and couches, chairs, etc., are not discernible.
Tương tự, khi đi bên ngoài, mồ hôi chảy ra, mắt giật giật; khi bước vào chỗ ở, cảm giác như rơi xuống giếng, giường ghế, v.v. không rõ ràng.
Muhuttaṃ nisinnassa pana akkhipasādo āharitvā pakkhitto viya hoti, dvārakavāṭavātapānamañcapīṭhādīni paññāyanti.
But for one who has sat for a moment, it is as if clarity of vision has been brought and placed, and doors, windows, couches, chairs, etc., become discernible.
Nhưng sau khi ngồi một lát, cảm giác như sự trong sáng của mắt đã được mang đến và đặt vào, cửa ra vào, cửa sổ, giường ghế, v.v. trở nên rõ ràng.
Tena vuttaṃ – ‘‘so ca sabbadado hoti, yo dadāti upassaya’’nti.
Therefore it is said: “He is a giver of all who gives shelter.”
Vì vậy, đã nói: "Người cho chỗ ở là người cho tất cả."
396
Amataṃdado ca so hotīti paṇītabhojanassa pattaṃ pūrento viya amaraṇadānaṃ nāma deti.
Amataṃdado ca so hoti (and he is a giver of the Deathless) means one gives the gift of deathlessness, as if filling a bowl with excellent food.
Amataṃdado ca so hotīti (và người ấy là người cho sự bất tử) nghĩa là người ấy ban tặng sự bất tử, giống như người đổ đầy bát với thức ăn ngon.
Yo dhammamanusāsatīti yo dhammaṃ anusāsati, aṭṭhakathaṃ katheti, pāḷiṃ vāceti, pucchitapañhaṃ vissajjeti, kammaṭṭhānaṃ ācikkhati, dhammassavanaṃ karoti, sabbopesa dhammaṃ anusāsati nāma.
Yo dhammamanusāsatī (one who instructs in the Dhamma) means one who instructs in the Dhamma, explains the Aṭṭhakathā, recites the Pāli, answers questions asked, teaches kammaṭṭhāna, and listens to the Dhamma; all such a one instructs in the Dhamma.
Yo dhammamanusāsatīti (người nào giáo huấn Pháp) nghĩa là người nào giáo huấn Pháp, thuyết giảng chú giải, đọc tụng kinh điển, giải đáp các câu hỏi, chỉ dạy đề mục thiền, lắng nghe Pháp, tất cả những người đó đều được gọi là giáo huấn Pháp.
Sabbadānānañca idaṃ dhammadānameva agganti veditabbaṃ.
And it should be understood that among all gifts, this gift of Dhamma is supreme.
Và cần phải biết rằng trong tất cả các sự bố thí, bố thí Pháp này là tối thượng.
Vuttampi cetaṃ –
It has also been said:
Điều này cũng đã được nói:
397
‘‘Sabbadānaṃ dhammadānaṃ jināti,
“The gift of Dhamma surpasses all gifts,
"Bố thí Pháp thắng mọi bố thí,
398
Sabbarasaṃ dhammaraso jināti;
The taste of Dhamma surpasses all tastes;
Vị Pháp thắng mọi vị ngon;
399
Sabbaratiṃ dhammarati jināti,
Delight in Dhamma surpasses all delights,
Niềm vui Pháp thắng mọi niềm vui,
400
Taṇhakkhayo sabbadukkhaṃ jinātī’’ti.(dha. pa. 354); Dutiyaṃ;
The destruction of craving conquers all suffering.” The second.
Diệt ái thắng mọi khổ đau." (Dhammapada 354); Thứ hai;
401
3. Annasuttavaṇṇanā
3. Explanation of the Annasutta
3. Giải thích Kinh Anna
402
43. Tatiye abhinandantīti patthenti.
43. In the third, abhinandantī means they desire.
43. Trong kinh thứ ba, abhinandantīti (hoan hỷ) nghĩa là mong muốn.
Bhajatīti upagacchati, cittagahapatisīvalittherādike viya pacchato anubandhati.
Bhajatī means approaches, follows behind, like Citta the householder, Elder Sīvali, and others.
Bhajatīti (phụng sự) nghĩa là đến gần, theo sau như trường hợp của gia chủ Citta, Trưởng lão Sīvali, v.v.
Tasmāti yasmā idhaloke paraloke ca annadāyakameva anugacchati, tasmā.
Tasmā means because one follows the food-giver in this world and the next, therefore.
Tasmāti (vì vậy) nghĩa là vì người ấy theo sát người cho thức ăn cả ở đời này và đời sau.
Sesaṃ uttānamevāti.
The rest is clear.
Phần còn lại là rõ ràng.
Tatiyaṃ.
The third.
Thứ ba.
403
4. Ekamūlasuttavaṇṇanā
4. Explanation of the Ekamūlasutta
4. Giải thích Kinh Ekamūla
404
44. Catutthe ekamūlanti avijjā taṇhāya mūlaṃ, taṇhā avijjāya.
44. In the fourth, ekamūlaṃ (one root) means avijjā is the root of taṇhā, and taṇhā is the root of avijjā.
44. Trong kinh thứ tư, ekamūlanti (một gốc rễ) là vô minh là gốc rễ của ái, ái là gốc rễ của vô minh.
Idha pana taṇhā adhippetā.
Here, however, taṇhā is intended.
Tuy nhiên, ở đây ý muốn nói đến ái.
Dvīhi sassatucchedadiṭṭhīhi āvaṭṭatīti dvirāvaṭṭā.
It revolves by means of the two views of eternalism and annihilationism, hence dvirāvaṭṭā (twofold revolving).
Nó xoay vần bởi hai tà kiến thường kiến và đoạn kiến, nên là dvirāvaṭṭā (hai vòng xoay).
Sā ca rāgādīhi tīhi malehi timalā.
And that* is timalā (threefold defiled) by the three defilements of rāga and so forth.
Và nó có timalā (ba cấu uế) bởi ba cấu uế tham, sân, si.
Tatrāssā moho sahajātakoṭiyā malaṃ hoti, rāgadosā upanissayakoṭiyā.
There, delusion (moha) is its defilement in the sense of being co-arisen; greed (rāga) and hatred (dosa) are in the sense of being a decisive support.
Trong đó, si là cấu uế của nó theo phương diện đồng sinh, tham và sân là theo phương diện cận y duyên.
Pañca pana kāmaguṇā assā pattharaṇaṭṭhānā, tesu sā pattharatīti pañcapattharā.
But the five strands of sensual pleasure are its spreading-places; it spreads itself among them, hence pañcapattharā (fivefold spread).
Năm dục lạc là nơi nó lan rộng, nó lan rộng trong những điều đó, nên là pañcapattharā (năm sự lan rộng).
Sā ca apūraṇīyaṭṭhena samuddo.
And that* is samuddo (an ocean) in the sense of being insatiable.
Và nó là samuddo (biển) theo nghĩa không thể lấp đầy.
Ajjhattikabāhiresu panesā dvādasāyatanesu āvaṭṭati parivaṭṭatīti dvādasāvaṭṭā.
Moreover, it revolves and turns around in the twelve āyatanas, both internal and external, hence dvādasāvaṭṭā (twelvefold revolving).
Và nó xoay vần, quay lại trong mười hai xứ nội và ngoại, nên là dvādasāvaṭṭā (mười hai vòng xoay).
Apatiṭṭhaṭṭhena pana pātāloti vuccatīti.
And it is called pātālaṃ (the abyss) in the sense of having no footing.
Và nó được gọi là pātālo (vực sâu) theo nghĩa không có chỗ đứng.
Ekamūlaṃ…pe… pātālaṃ, atari isi, uttari samatikkamīti attho.
Ekamūlaṃ…pe… pātālaṃ, the seer crossed, emerged from, and transcended, that is the meaning.
Một gốc rễ... v.v... vực sâu, vị ẩn sĩ đã vượt qua, đã thoát khỏi, đã vượt qua hoàn toàn, đó là ý nghĩa.
Catutthaṃ.
The fourth.
Thứ tư.
405
5. Anomasuttavaṇṇanā
5. Explanation of the Anomasutta
5. Giải thích Kinh Anoma
406
45. Pañcame anomanāmanti sabbaguṇasamannāgatattā avekallanāmaṃ, paripūranāmanti attho.
45. In the fifth, anomanāmaṃ (of unsurpassed name) means a faultless name, a perfect name, due to being endowed with all good qualities.
45. Trong kinh thứ năm, anomanāmanti (tên vô thượng) nghĩa là tên không khiếm khuyết, tên đầy đủ, vì Ngài đầy đủ mọi phẩm chất.
Nipuṇatthadassinti bhagavā saṇhasukhume khandhantarādayo atthe passatīti nipuṇatthadassī.
Nipuṇatthadassiṃ (perceiving subtle meanings) means the Blessed One perceives subtle and profound meanings, such as the distinctions between aggregates, hence he is called Nipuṇatthadassī.
Nipuṇatthadassinti (người thấy các ý nghĩa vi tế) là Đức Thế Tôn thấy các ý nghĩa vi tế, như các uẩn khác, v.v., nên Ngài là người thấy các ý nghĩa vi tế.
Paññādadanti anvayapaññādhigamāya paṭipadaṃ kathanavasena paññāya dāyakaṃ.
Paññādadaṃ (giver of wisdom) refers to one who gives wisdom by teaching the path to the attainment of inferential wisdom.
Paññādadanti (người ban trí tuệ) là người ban trí tuệ bằng cách chỉ dạy con đường để đạt được trí tuệ hợp lý.
Kāmālaye asattanti pañcakāmaguṇālaye alaggaṃ.
Kāmālaye asattaṃ (unattached to the abode of sensual pleasures) means unattached to the abode of the five strands of sensual pleasure.
Kāmālaye asattanti (không dính mắc vào nơi ở của dục) nghĩa là không dính mắc vào nơi ở của năm dục lạc.
Kamamānanti bhagavā mahābodhimaṇḍeyeva ariyamaggena gato, na idāni gacchati, atītaṃ pana upādāya idaṃ vuttaṃ.
Kamamānaṃ (proceeding) means the Blessed One attained the Arahant path right at the Mahābodhimaṇḍa; he is not proceeding now. This is said with reference to the past.
Kamamānanti (đang đi) là Đức Thế Tôn đã đi bằng Thánh đạo ngay tại Bồ-đề đạo tràng, không phải bây giờ đang đi; điều này được nói dựa trên quá khứ.
Mahesinti mahantānaṃ sīlakkhandhādīnaṃ esitāraṃ pariyesitāranti.
Mahesiṃ (great seer) refers to one who seeks and searches for great things such as the aggregates of sīla and so forth.
Mahesinti (Đại ẩn sĩ) là người tìm kiếm, người truy cầu các giới hạnh lớn, v.v.
Pañcamaṃ.
The fifth.
Thứ năm.
407
6. Accharāsuttavaṇṇanā
6. Explanation of the Accharāsutta
6. Giải thích Kinh Accharā
408
46. Chaṭṭhe accharāgaṇasaṅghuṭṭhanti ayaṃ kira devaputto satthusāsane pabbajitvā vattapaṭipattiṃ pūrayamāno pañcavassakāle pavāretvā dvemātikaṃ paguṇaṃ katvā kammākammaṃ uggahetvā cittarucitaṃ kammaṭṭhānaṃ uggaṇhitvā sallahukavuttiko araññaṃ pavisitvā yo bhagavatā majjhimayāmo sayanassa koṭṭhāsoti anuññāto.
46. In the sixth, accharāgaṇasaṅghuṭṭhaṃ (resounded by a multitude of nymphs). It is heard that this devaputta, having gone forth in the Teacher’s Dispensation and fulfilled his duties and practices, after five years, having performed the Pavāraṇā, mastered the two Mātikas, learned the right and wrong actions, and taken up a kammaṭṭhāna pleasing to his mind, lived with few wants and entered the forest where the middle watch of the night was permitted by the Blessed One as a time for sleeping.
46. Trong kinh thứ sáu, accharāgaṇasaṅghuṭṭhanti (được ca ngợi bởi các nhóm tiên nữ) là vị trời này, sau khi xuất gia trong giáo pháp của Đức Đạo Sư, đã hoàn thành các thực hành bổn phận, sau năm năm đã mãn hạ, thuần thục hai bộ giới luật, học hỏi về thiện và bất thiện, học một đề mục thiền ưa thích, sống một cuộc sống thanh đạm, vào rừng và được Đức Thế Tôn cho phép ngủ trong phần giữa đêm.
Tasmimpi sampatte ‘‘pamādassa bhāyāmī’’ti mañcakaṃ ukkhipitvā rattiñca divā ca nirāhāro kammaṭṭhānameva manasākāsi.
When that time arrived, thinking, “I fear heedlessness,” he lifted his couch and, without food, meditated on kammaṭṭhāna day and night.
Khi thời gian đó đến, vị ấy nghĩ: “Ta sợ sự xao lãng”, rồi nhấc giường lên, không ăn uống cả ngày lẫn đêm, chỉ chú tâm vào đề mục thiền định (kammaṭṭhāna).
409
Athassa abbhantare satthakavātā uppajjitvā jīvitaṃ pariyādiyiṃsu.
Then, internal winds, sharp as a knife, arose and ended his life.
Sau đó, bệnh gió dao cắt (satthakavātā) phát sinh bên trong vị ấy, chấm dứt mạng sống.
So dhurasmiṃyeva kālamakāsi.
He passed away while still engaged in his duty.
Vị ấy đã qua đời trong khi đang hành trì (dhura).
Yo hi koci bhikkhu caṅkame caṅkamamāno vā ālambanatthambhaṃ nissāya ṭhito vā caṅkamakoṭiyaṃ cīvaraṃ sīse ṭhapetvā nisinno vā nipanno vā parisamajjhe alaṅkatadhammāsane dhammaṃ desento vā kālaṃ karoti, sabbo so dhurasmiṃ kālaṃ karoti nāma.
Any bhikkhu who passes away while walking on a walking path, or standing leaning against a pillar, or sitting or lying at the end of a walking path with robes placed on his head, or teaching Dhamma on an adorned Dhamma seat in the midst of an assembly—all such are said to pass away while engaged in their duty.
Bất kỳ tỳ khưu nào đang đi kinh hành, hoặc đứng tựa vào một cột trụ, hoặc ngồi hay nằm ở cuối đường kinh hành với y đặt trên đầu, hoặc đang thuyết pháp trên pháp tòa trang nghiêm giữa đại chúng mà qua đời, tất cả những vị ấy đều được gọi là qua đời trong khi đang hành trì (dhura).
Iti ayaṃ caṅkamane kālaṃ katvā upanissayamandatāya āsavakkhayaṃ appatto tāvatiṃsabhavane mahāvimānadvāre niddāyitvā pabujjhanto viya paṭisandhiṃ aggahesi.
Thus, this one passed away while walking, and due to a weakness in his decisive support, not having attained the destruction of the asavas, he took rebirth in the Tāvatiṃsa heaven, at the great palace gate, as if waking up from sleep.
Vì vậy, vị ấy đã qua đời trong khi đi kinh hành, nhưng do sự yếu kém của duyên cận y (upanissaya), không đạt được sự diệt trừ lậu hoặc (āsavakkhaya), vị ấy tái sinh ở cõi trời Ba Mươi Ba (Tāvatiṃsa), thọ sanh như thể vừa tỉnh giấc sau khi ngủ tại cổng một cung điện lớn.
Tāvadevassa suvaṇṇatoraṇaṃ viya tigāvuto attabhāvo nibbatti.
Immediately, his body, three gāvutas tall, arose like a golden arch.
Ngay lập tức, thân tướng ba gāvuta của vị ấy xuất hiện như một cổng vòm vàng.
410
Antovimāne sahassamattā accharā taṃ disvā, ‘‘vimānasāmiko devaputto āgato, ramayissāma na’’nti tūriyāni gahetvā parivārayiṃsu.
Inside the celestial mansion, a thousand celestial nymphs, seeing him, (thought): "The deva son, master of the mansion, has arrived; we shall delight him!" And taking musical instruments, they surrounded him.
Trong thiên cung, một ngàn tiên nữ thấy vị thiên tử ấy, liền cầm nhạc cụ vây quanh mà nói: “Vị thiên tử chủ thiên cung đã đến, chúng ta sẽ vui chơi cùng ngài.”
Devaputto na tāva cutabhāvaṃ jānāti, pabbajitasaññīyeva accharā oloketvā vihāracārikaṃ āgataṃ mātugāmaṃ disvā lajjī.
The deva son did not yet know that he had passed away; still perceiving himself as a monk, he looked at the celestial nymphs and, seeing them as women who had come on a tour of the monastery, felt ashamed.
Vị thiên tử chưa biết mình đã chết, vẫn còn tưởng mình là một vị tỳ khưu. Ngài nhìn các tiên nữ, thấy họ như những người phụ nữ đến viếng tịnh xá, liền cảm thấy xấu hổ.
Paṃsukūliko viya upari ṭhitaṃ ghanadukūlaṃ ekaṃsaṃ karonto aṃsakūṭaṃ paṭicchādetvā indriyāni okkhipitvā adhomukho aṭṭhāsi.
Like a rag-robe wearer, he adjusted the thick fine cloth (dukūla) that was on his upper body over one shoulder, covering his shoulder blade, lowered his senses, and stood with downcast face.
Như một vị tỳ khưu mặc y phấn tảo, ngài kéo tấm lụa dày đang phủ trên người sang một bên vai, che khuất vai, rồi hạ các căn xuống, đứng cúi mặt.
Tassa kāyavikāreneva tā devatā ‘‘samaṇadevaputto aya’’nti ñatvā evamāhaṃsu – ‘‘ayya, devaputta, devaloko nāmāyaṃ, na samaṇadhammassa karaṇokāso, sampattiṃ anubhavanokāso’’ti.
By his bodily demeanor alone, those devas, realizing "This is a samaṇa deva son," said thus: "Noble deva son, this is the deva realm; it is not a place for practicing the samaṇa-dhamma, but a place for experiencing enjoyments."
Chỉ bằng cử chỉ thân thể của ngài, các vị thiên nữ ấy biết: “Đây là vị thiên tử Sa-môn,” và liền nói: “Thưa Tôn giả thiên tử, đây là cõi trời, không phải là nơi để thực hành pháp Sa-môn, mà là nơi để hưởng thụ tài sản.”
So tatheva aṭṭhāsi.
He remained as before.
Ngài vẫn đứng yên như vậy.
Devatā ‘‘na tāvāyaṃ sallakkhetī’’ti tūriyāni paggaṇhiṃsu.
The devas, thinking, "He does not yet understand," raised their musical instruments.
Các thiên nữ nghĩ: “Ngài ấy vẫn chưa nhận ra,” liền nâng nhạc cụ lên.
So tathāpi anolokentova aṭṭhāsi.
Yet, he still remained without looking at them.
Ngài vẫn đứng yên mà không nhìn.
411
Athassa sabbakāyikaṃ ādāsaṃ purato ṭhapayiṃsu.
Then, they placed a full-body mirror in front of him.
Rồi họ đặt một tấm gương toàn thân trước mặt ngài.
So chāyaṃ disvā cutabhāvaṃ ñatvā, ‘‘na mayā imaṃ ṭhānaṃ patthetvā samaṇadhammo kato, uttamatthaṃ arahattaṃ patthetvā kato’’ti sampattiyā vippaṭisārī ahosi, ‘‘suvaṇṇapaṭaṃ paṭilabhissāmī’’ti takkayitvā yuddhaṭṭhānaṃ otiṇṇamallo mūlakamuṭṭhiṃ labhitvā viya.
Seeing his reflection, he understood that he had passed away, and thinking, "I did not practice the samaṇa-dhamma desiring this realm, but desiring the highest goal, Arahantship," he regretted the celestial enjoyments, like a wrestler who, having thought of obtaining a golden prize and entered the wrestling arena, receives only a handful of rice gruel.
Ngài thấy hình ảnh của mình, biết mình đã chết, liền nghĩ: “Ta không phải đã thực hành pháp Sa-môn để mong cầu nơi này, mà là để mong cầu mục đích tối thượng là A-la-hán.” Ngài cảm thấy hối tiếc về những tài sản (thiên giới) này, như một đấu sĩ đã nghĩ sẽ giành được tấm huy chương vàng mà lại chỉ nhận được một nắm gạo lứt khi bước vào đấu trường.
So – ‘‘ayaṃ saggasampatti nāma sulabhā, buddhānaṃ pātubhāvo dullabho’’ti cintetvā vimānaṃ apavisitvāva asambhinneneva sīlena accharāsaṅghaparivuto dasabalassa santikaṃ āgamma abhivādetvā ekamantaṃ ṭhito imaṃ gāthaṃ abhāsi.
So, thinking, "These heavenly enjoyments are easily attained, but the appearance of Buddhas is rare," he did not enter the mansion, but with his unbroken sīla, surrounded by the assembly of celestial nymphs, approached the Dasabala, paid homage, stood to one side, and uttered this verse.
Ngài nghĩ: “Tài sản cõi trời này dễ có, nhưng sự xuất hiện của chư Phật thì khó gặp,” rồi không vào thiên cung, mà với giới hạnh không bị phá vỡ, được các đoàn tiên nữ vây quanh, đến gần Đức Thập Lực, đảnh lễ và đứng sang một bên, rồi đọc bài kệ này.
412
Tattha accharāgaṇasaṅghuṭṭhanti accharāgaṇena gītavāditasaddehi saṅghositaṃ.
Therein, accharāgaṇasaṅghuṭṭha means "resounded by the host of celestial nymphs with songs and musical sounds."
Trong đó, accharāgaṇasaṅghuṭṭha có nghĩa là được đoàn tiên nữ ca hát, tấu nhạc vang lừng.
Pisācagaṇasevitanti tameva accharāgaṇaṃ pisācagaṇaṃ katvā vadati.
Pisācagaṇasevita refers to that very host of celestial nymphs as a host of fiends.
Pisācagaṇasevita có nghĩa là gọi chính đoàn tiên nữ ấy là đoàn quỷ dạ xoa.
Vananti nandanavanaṃ sandhāya vadati.
Vana refers to the Nandanavana.
Vana có nghĩa là rừng Nandana.
Ayañhi niyāmacittatāya attano garubhāvena devagaṇaṃ ‘‘devagaṇo’’ti vattuṃ na roceti.
Indeed, due to his fixed resolve, and out of reverence for himself, he does not wish to call the host of devas "host of devas."
Vị thiên tử này, vì tâm hướng đến sự giải thoát và vì sự tôn kính của mình, không muốn gọi đoàn thiên nữ là “đoàn thiên nữ.”
‘‘Pisācagaṇo’’ti vadati.
He calls them "host of fiends."
Ngài gọi họ là “đoàn quỷ dạ xoa.”
Nandanavanañca ‘‘nandana’’nti avatvā ‘‘mohana’’nti vadati.
And he does not say "Nandana" but says "Mohana" for Nandanavana.
Và khu rừng Nandana, ngài không gọi là “Nandana” mà gọi là “Mohana” (mê hoặc).
Kathaṃ yātrā bhavissatīti kathaṃ niggamanaṃ bhavissati, kathaṃ atikkamo bhavissati, arahattassa me padaṭṭhānabhūtaṃ vipassanaṃ ācikkhatha bhagavāti vadati.
Kathaṃ yātrā bhavissatī means "How will there be deliverance? How will there be escape? O Blessed One, please teach me the Vipassanā that is the proximate cause for Arahantship."
Kathaṃ yātrā bhavissatī có nghĩa là: Làm thế nào để thoát ra? Làm thế nào để vượt qua? Bạch Thế Tôn, xin hãy chỉ dạy cho con pháp quán Vipassanā, nền tảng cho quả vị A-la-hán.
413
Atha bhagavā ‘‘atisallikhateva ayaṃ devaputto, kiṃ nu kho ida’’nti?
Then the Blessed One, (thinking,) "This deva son is indeed very austere, what could this be?"
Bấy giờ, Đức Thế Tôn nghĩ: “Vị thiên tử này quá khắc khổ, điều gì đã xảy ra vậy?”
Āvajjento attano sāsane pabbajitabhāvaṃ ñatvā – ‘‘ayaṃ accāraddhavīriyatāya kālaṃ katvā devaloke nibbatto, ajjāpissa caṅkamanasmiṃyeva attabhāvo asambhinnena sīlena āgato’’ti cintesi.
Reflecting, He understood that the deva son had gone forth in His Dispensation, and thought, "This one, having passed away due to exceedingly strenuous effort, was reborn in the deva realm, and even today his existence is on the walking path; he has come with unbroken sīla."
Khi quán xét, Ngài biết rằng vị ấy đã xuất gia trong giáo pháp của mình, và nghĩ: “Vị ấy đã chết do quá tinh tấn và tái sinh vào cõi trời. Ngay cả bây giờ, thân thể của vị ấy vẫn còn trên đường kinh hành với giới hạnh không bị phá vỡ.”
Buddhā ca akatābhinivesassa ādikammikassa akataparikammassa antevāsino cittakāro bhittiparikammaṃ viya – ‘‘sīlaṃ tāva sodhehi, samādhiṃ bhāvehi, kammassakatapaññaṃ ujuṃ karohī’’ti paṭhamaṃ pubbabhāgappaṭipadaṃ ācikkhanti, kārakassa pana yuttapayuttassa arahattamaggapadaṭṭhānabhūtaṃ saṇhasukhumaṃ suññatāvipassanaṃyeva ācikkhanti, ayañca devaputto kārako abhinnasīlo, eko maggo assa anāgatoti suññatāvipassanaṃ ācikkhanto ujuko nāmātiādimāha.
Buddhas, for a beginner who has not yet cultivated insight (abhinivesa), who has not yet done preparatory work, first teach the preliminary practices, like a painter preparing a wall, saying, "First purify your sīla, cultivate samādhi, and straighten your kammassakata-paññā (wisdom concerning karma ownership)"; but for one who is actively practicing and diligently striving, they teach only the subtle and refined suññatā-vipassanā, which is the proximate cause for the path of Arahantship. This deva son is a practitioner with unbroken sīla, and only one path remains for him. Thus, desiring to teach suññatā-vipassanā, He spoke the stanza beginning ujuko nāmā.
Và chư Phật, đối với những đệ tử mới bắt đầu, chưa có sự chuẩn bị, chưa có sự thực hành Vipassanā, giống như người họa sĩ chỉ dạy việc chuẩn bị bức tường, trước tiên chỉ dạy về giới, thiền định và làm cho trí tuệ về nghiệp quả được ngay thẳng. Nhưng đối với những người đã thực hành và tinh tấn, Ngài chỉ dạy Vipassanā về Tánh Không vi tế, là nền tảng cho con đường A-la-hán. Và vị thiên tử này là người đã thực hành với giới hạnh không bị phá vỡ, chỉ còn một con đường nữa là đến nơi, nên khi chỉ dạy Vipassanā về Tánh Không, Ngài đã nói bài kệ bắt đầu bằng ujuko nāmā (thẳng thắn là).
414
Tattha ujukoti kāyavaṅkādīnaṃ abhāvato aṭṭhaṅgiko maggo ujuko nāma.
Therein, ujuko (straight) is a name for the Noble Eightfold Path because of the absence of bodily crookedness and the like.
Trong đó, ujuko có nghĩa là Bát Chánh Đạo là con đường ngay thẳng vì không có sự cong vẹo của thân thể, v.v.
Abhayā nāma sā disāti nibbānaṃ sandhāyāha.
Abhayā nāma sā disā (that direction called fearless) refers to Nibbāna.
Abhayā nāma sā disā có nghĩa là Niết Bàn.
Tasmiṃ hi kiñci bhayaṃ natthi, taṃ vā pattassa bhayaṃ natthīti ‘‘abhayā nāma sā disā’’ti vuttaṃ.
For in that (Nibbāna) there is no fear whatsoever, or for one who has attained it, there is no fear, therefore it is said, "that direction called fearless."
Trong Niết Bàn không có bất kỳ sự sợ hãi nào, hoặc người đạt đến Niết Bàn không có sự sợ hãi, nên được gọi là “phương không sợ hãi.”
Ratho akūjanoti aṭṭhaṅgiko maggova adhippeto.
Ratho akūjano (the noiseless chariot) refers to the Noble Eightfold Path itself.
Ratho akūjano có nghĩa là Bát Chánh Đạo.
Yathā hi pākatikaratho akkhe vā anabbhañjite atirekesu vā manussesu abhiruḷhesu kūjati viravati, na evaṃ ariyamaggo.
For just as an ordinary chariot squeaks and rattles if its axles are not oiled or if too many people ride on it, the Noble Path is not like that.
Thật vậy, giống như một cỗ xe thông thường sẽ kêu cót két hoặc ồn ào khi trục xe không được bôi trơn hoặc khi có quá nhiều người ngồi trên, con đường Thánh đạo thì không như vậy.
So hi ekappahārena caturāsītiyāpi pāṇasahassesu abhiruhantesu na kūjati na viravati.
Indeed, even if eighty-four thousand beings ascend it at once, it does not squeak or rattle.
Thật vậy, dù có tám mươi bốn ngàn chúng sinh cùng lên một lúc, nó cũng không kêu cót két hay ồn ào.
Tasmā ‘‘akūjano’’ti vutto.
Therefore, it is called "noiseless."
Vì vậy, nó được gọi là “không ồn ào.”
Dhammacakkehi saṃyutoti kāyikacetasikavīriyasaṅkhātehi dhammacakkehi saṃyutto.
Dhammacakkehi saṃyuto means "equipped with the Dhamma-wheels, which are physical and mental effort."
Dhammacakkehi saṃyuto có nghĩa là được trang bị những bánh xe Pháp, tức là sự tinh tấn về thân và tâm.
415
Hirīti ettha hiriggahaṇena ottappampi gahitameva hoti.
In Hirī (conscience), by the inclusion of hirī, ottappa (shame and dread) is also implicitly included.
Ở đây, với việc đề cập đến hirī, sự hổ thẹn (ottappa) cũng được bao gồm.
Tassa apālamboti yathā bāhirakarathassa rathe ṭhitānaṃ yodhānaṃ apatanatthāya dārumayaṃ apālambanaṃ hoti, evaṃ imassa maggarathassa ajjhattabahiddhāsamuṭṭhānaṃ hirottappaṃ apālambanaṃ.
Tassa apālambo (its support) is like the wooden support for an external chariot, which prevents the warriors standing on it from falling. Similarly, for this chariot of the path, hirī-ottappa, which arises from internal and external causes, is the support.
Tassa apālambo có nghĩa là, giống như một cỗ xe bên ngoài có một thanh chắn bằng gỗ để ngăn các chiến binh ngồi trên xe không bị ngã, thì đối với cỗ xe Thánh đạo này, sự hổ thẹn và xấu hổ (hirī-ottappa) phát sinh từ bên trong và bên ngoài là thanh chắn.
Satyassa parivāraṇanti rathassa sīhacammādiparivāro viya imassāpi maggarathassa sampayuttā sati parivāraṇaṃ.
Satyassa parivāraṇa (mindfulness its covering) is like the covering of a chariot with lion skins and the like; similarly, for this chariot of the path, concomitant mindfulness is its covering.
Satyassa parivāraṇa có nghĩa là, giống như một cỗ xe được bao bọc bởi da sư tử, v.v., thì cỗ xe Thánh đạo này cũng được bao bọc bởi niệm (sati) tương ưng.
Dhammanti lokuttaramaggaṃ.
Dhamma refers to the supramundane path.
Dhamma có nghĩa là Thánh đạo siêu thế.
Sammādiṭṭhipurejavanti vipassanāsammādiṭṭhipurejavā assa pubbayāyikāti sammādiṭṭhipurejavo, taṃ sammādiṭṭhipurejavaṃ.
Sammādiṭṭhipurejava (with Right View as its forerunner) means that Vipassanā-sammādiṭṭhi (insight right view) is its forerunner, meaning it goes first; therefore, it has Right View as its forerunner. That is, Right View as its forerunner.
Sammādiṭṭhipurejava có nghĩa là Chánh kiến Vipassanā đi trước, nghĩa là Chánh kiến Vipassanā là người dẫn đường của nó, đó là Chánh kiến đi trước.
Yathā hi paṭhamataraṃ rājapurisehi kāṇakuṇiādīnaṃ nīharaṇena magge sodhite pacchā rājā nikkhamati, evamevaṃ vipassanā sammādiṭṭhiyā aniccādivasena khandhādīsu sodhitesu pacchā bhūmiladdhavaṭṭaṃ parijānamānā maggasammādiṭṭhi uppajjati.
For just as a king exits after his royal attendants have first cleared the path by removing the blind, the crippled, and so on, in the same way, after Vipassanā-sammādiṭṭhi has purified the aggregates and so on in terms of impermanence and so on, the Path-sammādiṭṭhi arises, comprehending the round of existence (vaṭṭa) that has been attained at the level of insight.
Thật vậy, giống như khi các quan lại của nhà vua dọn đường bằng cách loại bỏ những người mù, què, v.v., trước tiên, rồi sau đó nhà vua mới xuất hành; cũng vậy, sau khi các uẩn, v.v., được Chánh kiến Vipassanā thanh lọc theo cách vô thường, v.v., thì Chánh kiến của Thánh đạo phát sinh, nhận biết sự luân hồi đã đạt được cảnh giới.
Tena vuttaṃ ‘‘dhammāhaṃ sārathiṃ brūmi, sammādiṭṭhipurejava’’nti.
Therefore, it is said, "I declare Dhamma to be the charioteer, with Right View as its forerunner."
Vì vậy, đã nói: “Ta gọi Pháp là người đánh xe, với Chánh kiến đi trước.”
416
Iti bhagavā desanaṃ niṭṭhāpetvā avasāne cattāri saccāni dīpesi.
Thus, the Blessed One concluded the discourse and, at the end, elucidated the Four Noble Truths.
Như vậy, Đức Thế Tôn sau khi kết thúc bài thuyết pháp, cuối cùng đã trình bày Tứ Diệu Đế.
Desanāpariyosāne devaputto sotāpattiphale patiṭṭhāsi.
At the conclusion of the discourse, the deva son was established in the fruit of Stream-entry (sotāpatti).
Khi bài thuyết pháp kết thúc, vị thiên tử đã an trú vào quả vị Nhập Lưu (Sotāpatti).
Yathā hi rañño bhojanakāle attano mukhappamāṇe kabaḷe ukkhitte aṅke nisinno putto attano mukhappamāṇeneva tato kabaḷaṃ karoti, evamevaṃ bhagavati arahattanikūṭena desanaṃ desentepi sattā attano upanissayānurūpena sotāpattiphalādīni pāpuṇanti.
For just as when a king is eating, his son sitting on his lap, when a morsel of food proportionate to his own mouth is offered, takes a morsel of food proportionate to his own mouth from it, in the same way, even when the Blessed One teaches the Dhamma culminating in Arahantship, beings attain the fruits of Stream-entry and so on, according to their dispositions.
Thật vậy, giống như khi nhà vua dùng bữa, người con trai ngồi trong lòng, khi nhà vua đưa một miếng cơm vừa miệng mình, người con trai cũng lấy một miếng cơm vừa miệng mình từ đó; cũng vậy, dù Đức Thế Tôn thuyết pháp với mục đích tối thượng là A-la-hán, chúng sinh vẫn đạt được quả vị Nhập Lưu, v.v., tùy theo căn lành của mình.
Ayampi devaputto sotāpattiphalaṃ patvā bhagavantaṃ gandhādīhi pūjetvā pakkāmīti.
This deva son, too, having attained the fruit of Stream-entry, honored the Blessed One with perfumes and so on, and then departed.
Vị thiên tử này cũng vậy, sau khi đạt được quả vị Nhập Lưu, đã cúng dường Đức Thế Tôn bằng hương thơm, v.v., rồi ra đi.
Chaṭṭhaṃ.
The Sixth.
Thứ sáu.
417
7. Vanaropasuttavaṇṇanā
7. Commentary on the Vanaropa Sutta
7. Giải thích kinh Vanaropa
418
47. Sattame dhammaṭṭhā sīlasampannāti ke dhammaṭṭhā, ke sīlasampannāti pucchati.
In the seventh (sutta), Dhammaṭṭhā sīlasampannā asks: Who are righteous (dhammaṭṭhā), and who are endowed with sīla (sīlasampannā)?
47. Trong kinh thứ bảy, hỏi: dhammaṭṭhā sīlasampannā (người sống đúng Pháp, người đầy đủ giới hạnh) là ai? Ai là người sống đúng Pháp? Ai là người đầy đủ giới hạnh?
Bhagavā imaṃ pañhaṃ thāvaravatthunā dīpento ārāmaropātiādimāha.
The Blessed One, intending to explain this question with reference to permanent things, uttered the stanza beginning ārāmaropā and so on.
Đức Thế Tôn, khi giải thích câu hỏi này bằng một ví dụ về vật cố định, đã nói bài kệ bắt đầu bằng ārāmaropā (người trồng vườn).
Tattha ārāmaropāti pupphārāmaphalārāmaropakā.
Therein, ārāmaropā means "those who plant flower gardens and fruit gardens."
Trong đó, ārāmaropā là người trồng vườn hoa, vườn cây ăn trái.
Vanaropāti sayaṃjāte aropimavane sīmaṃ parikkhipitvā cetiyabodhicaṅkamanamaṇḍapakuṭileṇarattiṭṭhānadivāṭṭhānānaṃ kārakā chāyūpage rukkhe ropetvā dadamānāpi vanaropāyeva nāma.
Vanaropā means those who, having fenced off unplanted forests that have grown by themselves, and having made shrines, Bodhi trees, walking paths, pavilions, huts, caves, night resorts, and day resorts, also plant shade-giving trees and donate them, are indeed called "forest planters."
Vanaropā là những người trồng cây che bóng mát, xây dựng bảo tháp, cây Bồ đề, đường kinh hành, chánh điện, tịnh xá, hang động, nơi nghỉ đêm, nơi nghỉ ngày, bằng cách khoanh vùng một khu rừng tự nhiên, không phải do con người trồng, rồi hiến cúng.
Setukārakāti visame setuṃ karonti, udake nāvaṃ paṭiyādenti.
Setukārakā means "those who build bridges over uneven ground and prepare boats in water."
Setukārakā là những người xây cầu ở những nơi hiểm trở, chuẩn bị thuyền trên sông nước.
Papanti pānīyadānasālaṃ.
Papa means "a drinking water hall."
Papa là nhà cấp nước uống.
Udapānanti yaṃkiñci pokkharaṇītaḷākādiṃ.
Udapāna means "any pond, tank, etc."
Udapāna là bất kỳ ao hồ, hồ chứa, v.v.
Upassayanti vāsāgāraṃ.
Upassaya means "a dwelling place."
Upassaya là nơi trú ngụ.
‘‘Upāsaya’’ntipi pāṭho.
The reading is also "upāsaya."
Cũng có bản đọc là “Upāsaya.”
419
Sadā puññaṃ pavaḍḍhatīti na akusalavitakkaṃ vā vitakkentassa niddāyantassa vā pavaḍḍhati.
Sadā puññaṃ pavaḍḍhatī means it does not grow for one who is thinking unwholesome thoughts or sleeping.
Sadā puññaṃ pavaḍḍhatī (phước đức luôn tăng trưởng) không phải là tăng trưởng khi suy nghĩ những ý nghĩ bất thiện hay khi ngủ.
Yadā yadā pana anussarati, tadā tadā tassa vaḍḍhati.
But whenever one recollects it, at that time it grows for them.
Mà mỗi khi nhớ lại, phước đức của người ấy liền tăng trưởng.
Imamatthaṃ sandhāya ‘‘sadā puññaṃ pavaḍḍhatī’’ti vuttaṃ.
Referring to this meaning, it was said: “‘Merit always grows.’”
Điều này được nói đến để chỉ ý nghĩa "phước thiện luôn tăng trưởng".
Dhammaṭṭhā sīlasampannāti tasmiṃ dhamme ṭhitattā tenapi sīlena sampannattā dhammaṭṭhā sīlasampannā.
Dhammaṭṭhā sīlasampannā (Righteous and endowed with sīla)—because they are established in that Dhamma and endowed with that sīla, they are dhammaṭṭhā sīlasampannā.
Dhammaṭṭhā sīlasampannā (người an trú trong Pháp và đầy đủ giới) là do an trú trong Pháp ấy, và do đầy đủ giới ấy, nên được gọi là dhammaṭṭhā sīlasampannā.
Atha vā evarūpāni puññāni karontānaṃ dasa kusalā dhammā pūrenti, tesu ṭhitattā dhammaṭṭhā.
Alternatively, for those performing such meritorious deeds, the ten wholesome dhammas are fulfilled, and being established in these, they are dhammaṭṭhā.
Hoặc, đối với những người làm các việc phước thiện như vậy, mười pháp thiện (dasa kusalā dhammā) được viên mãn, do an trú trong những pháp ấy nên được gọi là dhammaṭṭhā.
Teneva ca sīlena sampannattā sīlasampannāti.
And because they are endowed with that sīla, they are sīlasampannā (endowed with sīla).
Và do đầy đủ giới ấy nên được gọi là sīlasampannā.
Sattamaṃ.
The Seventh.
Thứ bảy.
420
8. Jetavanasuttavaṇṇanā
8. Commentary on the Jetavana Sutta
8. Chú giải kinh Jetavana
421
48. Aṭṭhame idaṃ hi taṃ jetavananti anāthapiṇḍiko devaputto jetavanassa ceva buddhādīnañca vaṇṇabhaṇanatthaṃ āgato evamāha.
48. In the eighth, idaṃ hi taṃ jetavanaṃ (this indeed is that Jetavana)—Anāthapiṇḍika, the devaputta, having come to praise Jetavana and the Buddha and others, spoke thus.
Trong kinh thứ tám, idaṃ hi taṃ jetavana (đây chính là Jetavana) là lời của thiên tử Anāthapiṇḍika khi đến để ca ngợi Jetavana và chư Phật, v.v.
Isisaṅghanisevitanti bhikkhusaṅghanisevitaṃ.
Isisaṅghanisevitaṃ (resorted to by the community of sages)—resorted to by the community of bhikkhus.
Isisaṅghanisevitaṃ (được hàng ẩn sĩ phục vụ) nghĩa là được Tăng đoàn Tỳ-kheo phục vụ.
422
Evaṃ paṭhamagāthāya jetavanassa vaṇṇaṃ kathetvā idāni ariyamaggassa kathento kammaṃ vijjātiādimāha.
Having thus praised Jetavana in the first stanza, now, in praising the Noble Path, he spoke of kammaṃ vijjā and so on.
Sau khi ca ngợi Jetavana bằng kệ ngôn đầu tiên, nay để ca ngợi con đường Thánh, Ngài nói kammaṃ vijjā (hành vi là minh) và những điều tương tự.
Tattha kammanti maggacetanā.
Therein, kammaṃ (action) refers to the volition of the path (maggacetanā).
Trong đó, kammaṃ (hành vi) là tư tâm sở (cetanā) của đạo.
Vijjāti maggapaññā.
Vijjā (wisdom) refers to the wisdom of the path (maggapaññā).
Vijjā (minh) là tuệ của đạo.
Dhammoti samādhipakkhikā dhammā.
Dhammo (Dhamma) refers to the dhammas belonging to concentration (samādhipakkhikā dhammā).
Dhammo (Pháp) là các pháp thuộc về định.
Sīlaṃ jīvitamuttamanti sīle patiṭṭhitassa jīvitaṃ uttamanti dasseti.
Sīlaṃ jīvitamuttamaṃ (Sīla is the highest life) indicates that the life of one established in sīla is supreme.
Sīlaṃ jīvitamuttamaṃ (giới là đời sống tối thượng) chỉ ra rằng đời sống của người an trú trong giới là tối thượng.
Atha vā vijjāti diṭṭhisaṅkappā.
Alternatively, vijjā (wisdom) refers to right view and right thought (diṭṭhisaṅkappā).
Hoặc, vijjā (minh) là chánh kiến và chánh tư duy.
Dhammoti vāyāmasatisamādhayo.
Dhammo (Dhamma) refers to right effort, right mindfulness, and right concentration (vāyāmasatisamādhayo).
Dhammo (Pháp) là chánh tinh tấn, chánh niệm và chánh định.
Sīlanti vācākammantājīvā.
Sīla (morality) refers to right speech, right action, and right livelihood (vācākammantājīvā).
Sīlaṃ (giới) là chánh ngữ, chánh nghiệp và chánh mạng.
Jīvitamuttamanti etasmiṃ sīle ṭhitassa jīvitaṃ nāma uttamaṃ.
Jīvitamuttamaṃ (the highest life) means that the life of one established in this sīla is supreme.
Jīvitamuttamaṃ (đời sống tối thượng) nghĩa là đời sống của người an trú trong giới này là tối thượng.
Etena maccā sujjhantīti etena aṭṭhaṅgikamaggena sattā visujjhanti.
Etena maccā sujjhantī (By this, mortals are purified) means that by this Noble Eightfold Path, beings are purified.
Etena maccā sujjhantī (nhờ điều này mà chúng sinh được thanh tịnh) nghĩa là nhờ Bát Chánh Đạo này mà chúng sinh được thanh tịnh.
423
Tasmāti yasmā maggena sujjhanti, na gottadhanehi, tasmā.
Tasmā (Therefore)—because they are purified by the path, not by lineage or wealth, therefore.
Tasmā (do đó) nghĩa là vì chúng sinh được thanh tịnh nhờ đạo, chứ không phải nhờ dòng dõi hay tài sản, nên.
Yoniso vicine dhammanti upāyena samādhipakkhiyadhammaṃ vicineyya.
Yoniso vicine dhammaṃ (Wisely investigate the Dhamma) means one should wisely investigate the dhammas pertaining to concentration.
Yoniso vicine dhammaṃ (hãy quán sát Pháp một cách như lý) nghĩa là nên quán sát các pháp thuộc về định một cách như lý.
Evaṃ tattha visujjhatīti evaṃ tasmiṃ ariyamagge visujjhati.
Evaṃ tattha visujjhatī (Thus he is purified therein) means that thus one is purified in that Noble Path.
Evaṃ tattha visujjhatī (như vậy sẽ được thanh tịnh trong đó) nghĩa là như vậy sẽ được thanh tịnh trong Bát Chánh Đạo ấy.
Atha vā yoniso vicine dhammanti upāyena pañcakkhandhadhammaṃ vicineyya.
Alternatively, yoniso vicine dhammaṃ (wisely investigate the Dhamma) means one should wisely investigate the dhammas of the five aggregates.
Hoặc, yoniso vicine dhammaṃ (hãy quán sát Pháp một cách như lý) nghĩa là nên quán sát các pháp năm uẩn một cách như lý.
Evaṃ tattha visujjhatīti evaṃ tesu catūsu saccesu visujjhati.
Evaṃ tattha visujjhatī (Thus he is purified therein) means that thus one is purified in those four Noble Truths.
Evaṃ tattha visujjhatī (như vậy sẽ được thanh tịnh trong đó) nghĩa là như vậy sẽ được thanh tịnh trong Tứ Thánh Đế ấy.
424
Idāni sāriputtattherassa vaṇṇaṃ kathento sāriputtovātiādimāha.
Now, praising Venerable Sāriputta, he spoke of sāriputtovā and so on.
Nay để ca ngợi Trưởng lão Sāriputta, Ngài nói sāriputtovā (chỉ có Sāriputta) và những điều tương tự.
Tattha sāriputtovāti avadhāraṇavacanaṃ, etehi paññādīhi sāriputtova seyyoti vadati.
Therein, sāriputtovā is a word of affirmation, indicating that Sāriputta alone is supreme by these qualities such as wisdom.
Trong đó, sāriputtovā là một từ khẳng định, nói rằng chỉ có Sāriputta là tối thượng nhờ trí tuệ và các đức hạnh khác.
Upasamenāti kilesaupasamena.
Upasamenā (by tranquility) refers to the calming of defilements (kilesaupasamena).
Upasamenā (nhờ sự an tịnh) nghĩa là nhờ sự an tịnh các phiền não.
Pāraṃ gatoti nibbānaṃ gato.
Pāraṃ gato (gone to the other shore) means gone to Nibbāna.
Pāraṃ gato (đã đến bờ bên kia) nghĩa là đã đến Nibbāna.
Yo koci nibbānaṃ patto bhikkhu, so etāvaparamo siyā, na therena uttaritaro nāma atthīti vadati.
Any bhikkhu who has attained Nibbāna etāvaparamo siyā (would be of this much extent); it means there is no one more excellent than the Elder.
Bất kỳ Tỳ-kheo nào đã đạt đến Nibbāna, người ấy etāvaparamo siyā (chỉ có thể đạt đến mức độ này), không có ai cao hơn vị Trưởng lão này, đó là điều được nói đến.
Sesaṃ uttānamevāti.
The rest is self-evident.
Phần còn lại là rõ ràng.
Aṭṭhamaṃ.
The Eighth.
Thứ tám.
425
9. Maccharisuttavaṇṇanā
9. Commentary on the Maccharī Sutta
9. Chú giải kinh Macchari
426
49. Navame maccharinoti maccherena samannāgatā.
49. In the ninth, maccharino (miserly) refers to those endowed with stinginess (macchera).
Trong kinh thứ chín, maccharino (những người keo kiệt) nghĩa là những người bị chi phối bởi sự keo kiệt (macchariya).
Ekacco hi attano vasanaṭṭhāne bhikkhuṃ hatthaṃ pasāretvāpi na vandati, aññattha gato vihāraṃ pavisitvā sakkaccaṃ vanditvā madhurapaṭisanthāraṃ karoti – ‘‘bhante, amhākaṃ vasanaṭṭhānaṃ nāgacchatha, sampanno padeso, paṭibalā mayaṃ ayyānaṃ yāgubhattādīhi upaṭṭhānaṃ kātu’’nti.
Indeed, some individuals do not even pay homage to a bhikkhu by extending their hand in their own dwelling, but having gone elsewhere, they enter a monastery, respectfully pay homage, and offer sweet greetings, saying: “Venerable Sir, why do you not come to our dwelling place? The area is prosperous, and we are capable of attending to the noble ones with gruel, meals, and so on.”
Thật vậy, có người ở nơi mình sống không cúi chào Tỳ-kheo dù chỉ bằng cách chắp tay, nhưng khi đến nơi khác, lại vào tinh xá, cung kính cúi chào và nói những lời ngọt ngào: "Bạch Đại đức, xin Ngài đừng đến nơi chúng con ở, vùng đó đầy đủ tiện nghi, chúng con có khả năng cúng dường cháo, cơm và các vật dụng khác cho Ngài."
Bhikkhū ‘‘saddho ayaṃ upāsako’’ti yāgubhattādīhi saṅgaṇhanti.
The bhikkhus think, “This lay follower is endowed with faith,” and welcome them with gruel, meals, and so on.
Các Tỳ-kheo nghĩ: "Vị cận sự nam này có đức tin," và chấp nhận cháo, cơm, v.v.
Atheko thero tassa gāmaṃ gantvā piṇḍāya carati.
Then, an elder goes to that person’s village and wanders for alms.
Sau đó, một vị Trưởng lão đến làng của người ấy để khất thực.
So taṃ disvā aññena vā gacchati, gharaṃ vā pavisati.
Upon seeing him, that person either goes another way or enters their house.
Người ấy thấy vị Trưởng lão thì đi đường khác hoặc vào nhà.
Sacepi sammukhībhāvaṃ āgacchati, hatthena vanditvā – ‘‘ayyassa bhikkhaṃ detha, ahaṃ ekena kammena gacchāmī’’ti pakkamati.
Even if they come face to face, they merely pay homage with their hand and say, “Give alms to the noble one; I am going for some work,” and then depart.
Dù có gặp mặt, người ấy chỉ chắp tay chào và nói: "Xin hãy cúng dường cơm cho Đại đức, tôi có việc phải đi," rồi bỏ đi.
Thero sakalagāmaṃ caritvā tucchapattova nikkhamati.
The elder wanders through the entire village and leaves with an empty bowl.
Vị Trưởng lão đi khắp làng rồi ra đi với bát không.
Idaṃ tāva mudumacchariyaṃ nāma, yena samannāgato adāyakopi dāyako viya paññāyati.
This indeed is soft stinginess (mudumacchariyaṃ), by which one, though not a giver, appears as a giver.
Đây là sự keo kiệt mềm yếu (mudumacchariya), khiến người không bố thí cũng được xem như người bố thí.
Idha pana thaddhamacchariyaṃ adhippetaṃ, yena samannāgato bhikkhūsu piṇḍāya paviṭṭhesu, ‘‘therā ṭhitā’’ti vutte, ‘‘kiṃ mayhaṃ pādā rujjantī’’tiādīni vatvā silāthambho viya khāṇuko viya ca thaddho hutvā tiṭṭhati, sāmīcimpi na karoti.
Here, however, severe stinginess (thaddhamacchariyaṃ) is intended, by which one, when bhikkhus enter for alms and it is said, “The elders are standing,” responds by saying, “Do my feet ache?” and so forth, remaining stiff like a stone pillar or a tree stump, and does not even perform proper courtesies.
Tuy nhiên, ở đây ý nói đến sự keo kiệt cứng rắn (thaddhamacchariya), khiến người bị chi phối bởi nó, khi thấy các Tỳ-kheo vào khất thực, và khi được nói: "Các vị Trưởng lão đang đứng đó," thì nói: "Chân tôi có đau đâu?" và những lời tương tự, rồi đứng cứng nhắc như cột đá hoặc gốc cây khô, không làm bất kỳ cử chỉ cung kính nào.
Kadariyāti idaṃ maccharinoti padasseva vevacanaṃ.
Kadariyā (miserly) is simply a synonym for the word maccharino.
Kadariyā (những người bủn xỉn) là một từ đồng nghĩa với từ maccharino (những người keo kiệt).
Mudukampi hi macchariyaṃ ‘‘macchariya’’nteva vuccati, thaddhaṃ pana kadariyaṃ nāma.
Even soft stinginess is called macchariya, but severe stinginess is called kadariya.
Thật vậy, ngay cả sự keo kiệt mềm yếu cũng được gọi là macchariya, nhưng sự keo kiệt cứng rắn thì được gọi là kadariya.
Paribhāsakāti bhikkhū gharadvāre ṭhite disvā, ‘‘kiṃ tumhe kasitvā āgatā, vapitvā, lāyitvā?
Paribhāsakā (revilers) are those who, seeing bhikkhus standing at the house door, threaten them with words like: “Did you come after plowing, sowing, or reaping?
Paribhāsakā (những người phỉ báng) là những người khi thấy các Tỳ-kheo đứng trước cửa nhà thì nói: "Các ông có cày cấy, gieo trồng hay gặt hái mà đến đây sao?
Mayaṃ attanopi na labhāma, kuto tumhākaṃ, sīghaṃ nikkhamathā’’tiādīhi saṃtajjakā.
We don't even get enough for ourselves, how could we give to you? Get out quickly!”
Chúng tôi còn không có đủ cho mình, lấy đâu ra cho các ông? Hãy đi nhanh đi!" và những lời đe dọa tương tự.
Antarāyakarāti dāyakassa saggantarāyo, paṭiggāhakānaṃ lābhantarāyo, attano upaghātoti imesaṃ antarāyānaṃ kārakā.
Antarāyakarā (hindrances) refers to those who cause these hindrances: a hindrance to heaven for the giver, a hindrance to gains for the recipients, and a self-inflicted harm for themselves.
Antarāyakarā (những người gây chướng ngại) là những người gây ra các chướng ngại sau: chướng ngại đến thiên giới cho người bố thí, chướng ngại đến lợi lộc cho người nhận, và sự hủy hoại cho chính mình.
427
Samparāyoti paraloko.
Samparāyo (the other world) refers to the next world.
Samparāyo (đời sau) là thế giới bên kia.
Ratīti pañcakāmaguṇarati.
Ratī (delight) refers to the delight associated with the five sense pleasures.
Ratī (sự hoan hỷ) là sự hoan hỷ trong năm dục lạc.
Khiḍḍāti kāyikakhiḍḍādikā tividhā khiḍḍā.
Khiḍḍā (play) refers to the three kinds of play, such as bodily play.
Khiḍḍā (sự vui chơi) là ba loại vui chơi, bắt đầu từ sự vui chơi thân thể.
Diṭṭhe dhammesa vipākoti tasmiṃ nibbattabhavane diṭṭhe dhamme esa vipāko.
Diṭṭhe dhammesa vipāko (the result in this very life) means this is the result in this present existence, which is the rebirth-state.
Diṭṭhe dhammesa vipāko (quả báo trong đời này) là quả báo này trong đời hiện tại, trong cõi tái sinh đó.
Samparāye ca duggatīti ‘‘yamalokaṃ upapajjare’’ti vutte samparāye ca duggati.
Samparāye ca duggatī (and a bad destination in the next world) means a bad destination in the next world as spoken of by “they go to the world of Yama.”
Samparāye ca duggatī (và ác thú trong đời sau) nghĩa là ác thú trong đời sau, khi được nói rằng "họ sẽ tái sinh vào cõi Diêm La".
428
Vadaññūti bhikkhū gharadvāre ṭhitā kiñcāpi tuṇhīva honti, atthato pana – ‘‘bhikkhaṃ dethā’’ti vadanti nāma.
Vadaññū (benevolent) means that even though bhikkhus standing at the house door remain silent, they are in essence asking for alms.
Vadaññū (người hiểu ý) nghĩa là các Tỳ-kheo đứng trước cửa nhà, dù im lặng, nhưng thực chất là đang nói "xin hãy cúng dường cơm".
Tatra ye ‘‘mayaṃ pacāma, ime pana na pacanti, pacamāne patvā alabhantā kuhiṃ labhissantī’’ti?
Among them, those who consider, “We cook, but these do not cook; if they arrive at places where food is cooked but do not receive it, where will they obtain it?”
Trong số đó, những người tự nhủ: "Chúng ta nấu ăn, còn những vị này thì không nấu. Nếu họ đến nơi nấu ăn mà không nhận được thì họ sẽ nhận được ở đâu?"
Deyyadhammaṃ saṃvibhajanti, te vadaññū nāma.
—and distribute the offering are called vadaññū.
và chia sẻ vật cúng dường, những người đó được gọi là vadaññū.
Pakāsantīti vimānappabhāya jotanti.
Pakāsantī (they shine) means they shine with the radiance of their celestial mansions.
Pakāsantī (họ chiếu sáng) nghĩa là họ tỏa sáng với ánh hào quang của cung điện thiên giới.
Parasambhatesūti parehi sampiṇḍitesu.
Parasambhatesū (in what is gathered by others) refers to what has been gathered and collected by others.
Parasambhatesu (được người khác thu thập) nghĩa là được người khác thu thập.
Samparāye ca suggatīti, ‘‘ete saggā’’ti evaṃ vuttasamparāye sugati.
Samparāye ca suggatī (and a good destination in the next world) means a good destination in the next world as spoken of by “these are heavenly.”
Samparāye ca suggatī (và thiện thú trong đời sau) nghĩa là thiện thú trong đời sau, như đã nói "đây là các cõi trời".
Ubhinnampi vā etesaṃ tato cavitvā puna samparāyepi duggatisugatiyeva hotīti.
Alternatively, for both of these, having passed away from that state, there is again a bad or good destination in the next world.
Hoặc, đối với cả hai loại người này, sau khi chết từ đó, trong đời sau cũng chỉ có ác thú và thiện thú.
Navamaṃ.
The Ninth.
Thứ chín.
429
10. Ghaṭīkārasuttavaṇṇanā
10. Commentary on the Ghaṭīkāra Sutta
10. Chú giải kinh Ghaṭīkāra
430
50. Dasame upapannāseti nibbattivasena upagatā.
50. In the tenth, upapannāse (have attained) means they have arrived by way of being reborn.
Trong kinh thứ mười, upapannāse (đã tái sinh) nghĩa là đã đến bằng cách tái sinh.
Vimuttāti avihābrahmalokasmiṃ upapattisamanantarameva arahattaphalavimuttiyā vimuttā.
Vimuttā (liberated) means they were liberated by the fruit of Arahantship immediately upon rebirth in the Avihā Brahmā realm.
Vimuttā (đã giải thoát) nghĩa là đã giải thoát khỏi các phiền não bằng sự giải thoát quả A-la-hán ngay sau khi tái sinh vào cõi Phạm thiên Avihā.
Mānusaṃ dehanti idha pañcorambhāgiyasaṃyojanāni eva vuttāni.
Mānusaṃ dehaṃ (human body) here refers only to the five lower fetters (pañcorambhāgiyasaṃyojanāni).
Mānusaṃ dehaṃ (thân người) ở đây chỉ năm hạ phần kiết sử.
Dibbayoganti pañca uddhambhāgiyasaṃyojanāni.
Dibbayogaṃ (divine bondage) refers to the five upper fetters (pañca uddhambhāgiyasaṃyojanāni).
Dibbayogaṃ (sự ràng buộc của cõi trời) là năm thượng phần kiết sử.
Upaccagunti atikkamiṃsu.
Upaccaguṃ (they surpassed) means they transcended.
Upaccaguṃ (đã vượt qua) nghĩa là đã vượt qua.
Upakotiādīni tesaṃ therānaṃ nāmāni.
Upako and so on are the names of those elders.
Upako và những cái tên tương tự là tên của các vị Trưởng lão ấy.
Kusalī bhāsasī tesanti, ‘‘kusala’’nti idaṃ vacanaṃ imassa atthīti kusalī, tesaṃ therānaṃ tvaṃ kusalaṃ anavajjaṃ bhāsasi, thomesi pasaṃsasi, paṇḍitosi devaputtāti vadati.
Kusalī bhāsasī tesaṃ (you speak skillfully of them)—the word kusalaṃ (skillful) indicates that this meaning is present, hence kusalī (skillful one); it means, “Devaputta, you speak skillfully and irreproachably of those elders, you praise and commend them, you are wise.”
Kusalī bhāsasī tesaṃ (ngươi nói lời thiện lành về họ) nghĩa là từ kusala (thiện lành) này có nghĩa là kusalī (người có thiện lành), này thiên tử, ngươi nói lời thiện lành, không đáng trách, ca ngợi, tán thán về các vị Trưởng lão ấy, ngươi là người trí tuệ.
Taṃ te dhammaṃ idhaññāyāti te therā taṃ dhammaṃ idha tumhākaṃ sāsane jānitvā.
Taṃ te dhammaṃ idhaññāyā (having understood that Dhamma here) means those elders, having understood that Dhamma in your dispensation here.
Taṃ te dhammaṃ idhaññāyā (các vị Trưởng lão ấy đã hiểu Pháp đó ở đây) nghĩa là các vị Trưởng lão ấy đã hiểu Pháp đó trong giáo pháp của các Ngài ở đây.
Gambhīranti gambhīratthaṃ.
Gambhīraṃ (profound) refers to a profound meaning.
Gambhīraṃ (sâu xa) nghĩa là ý nghĩa sâu xa.
Brahmacārī nirāmisoti nirāmisabrahmacārī nāma anāgāmī, anāgāmī ahosinti attho.
Brahmacārī nirāmiso (one who lives the holy life without sensual pleasures) refers to an Anāgāmī, meaning they became Anāgāmis.
Brahmacārī nirāmiso (phạm hạnh không ô nhiễm) nghĩa là người phạm hạnh không ô nhiễm là bậc Bất Lai, nghĩa là họ đã trở thành bậc Bất Lai.
Ahuvāti ahosi.
Ahuvā (was) means was.
Ahuvā (đã là) nghĩa là đã là.
Sagāmeyyoti ekagāmavāsī.
Sagāmeyyo (of the same village) means dwelling in the same village.
Sagāmeyyo (người cùng làng) nghĩa là người sống cùng một làng.
Pariyosānagāthā saṅgītikārehi ṭhapitāti.
The concluding stanza was placed by the reciters (saṅgītikārehi ṭhapitāti).
Kệ ngôn kết thúc đã được các vị kết tập kinh điển đưa vào.
Dasamaṃ.
The Tenth.
Thứ mười.
431
Ādittavaggo pañcamo.
The fifth, the Āditta Vagga, is concluded.
Phẩm Āditta, thứ năm.
432

6. Jarāvaggo

6. Jarā Vagga

6. Phẩm Jarā

433
1. Jarāsuttavaṇṇanā
1. Commentary on the Jarā Sutta
1. Chú giải kinh Jarā
434
51. Jarāvaggassa paṭhame sādhūti laddhakaṃ bhaddakaṃ.
51. In the first sutta of the Jarā Vagga, sādhu (good) means beneficial and excellent.
Trong kinh đầu tiên của phẩm Jarā, sādhu (tốt lành) nghĩa là được lợi ích, tốt đẹp.
Sīlaṃ yāva jarāti iminā idaṃ dasseti – yathā muttāmaṇirattavatthādīni ābharaṇāni taruṇakāleyeva sobhanti, jarājiṇṇakāle tāni dhārento ‘‘ayaṃ ajjāpi bālabhāvaṃ pattheti, ummattako maññe’’ti vattabbataṃ āpajjati, na evaṃ sīlaṃ.
By "Sīlaṃ yāva jarā" (virtue until old age), this is shown – just as ornaments such as pearls, gems, and fine clothes are beautiful only in youth, wearing them in old age leads one to be called, "This one still desires youth, perhaps he is mad," but sīla is not like that.
Giới hạnh cho đến khi già – với câu này, điều này được chỉ ra: giống như trang sức như ngọc trai, đá quý, y phục đỏ, v.v., chỉ đẹp khi còn trẻ; khi già yếu mà đeo chúng, người ta sẽ bị nói là "ông ta vẫn còn khao khát tuổi trẻ, chắc là điên rồi", nhưng giới hạnh thì không như vậy.
Sīlañhi niccakālaṃ sobhati.
Indeed, sīla is beautiful at all times.
Giới hạnh luôn luôn rực rỡ.
Bālakālepi hi sīlaṃ rakkhantaṃ ‘‘kiṃ imassa sīlenā’’ti?
Even in childhood, concerning one who observes sīla,* "What is this one's sīla for?"
Ngay cả khi còn thơ ấu, ai giữ giới hạnh thì không ai nói rằng "giới hạnh của người này có ích gì?"
Vattāro natthi.
There are no critics.
Không có người chê bai.
Majjhimakālepi mahallakakālepīti.
The same applies to middle age and old age.
Cũng vậy, khi ở tuổi trung niên và khi ở tuổi già.
435
Saddhā sādhu patiṭṭhitāti hatthāḷavakacittagahapatiādīnaṃ viya maggena āgatā patiṭṭhitasaddhā nāma sādhu.
"Saddhā sādhu patiṭṭhitā" (faith, well-established, is good) refers to well-established faith, which has come through the path, like that of Hatthāḷavaka, Cittagahapati, and others, which is good.
Đức tin được thiết lập vững chắc (Saddhā sādhu patiṭṭhitā) là đức tin vững chắc, đến từ con đường (đạo lộ), giống như của gia chủ Hatthāḷavaka và Citta.
Paññā narānaṃ ratananti ettha cittīkataṭṭhādīhi ratanaṃ veditabbaṃ.
In "Paññā narānaṃ ratanaṃ" (wisdom is the jewel of humans), a jewel should be understood by its quality of being esteemed and so forth.
Trí tuệ là châu báu của con người (Paññā narānaṃ ratanaṃ) – ở đây, châu báu cần được hiểu theo nghĩa được tôn kính, v.v.
Vuttañhetaṃ –
For it has been said:
Điều này đã được nói:
436
‘‘Yadi cittīkatanti ratanaṃ, nanu bhagavā cittīkato purisasīho, ye ca loke cittīkatā, tesaṃ cittīkato bhagavā.
"If a jewel is what is esteemed, is not the Bhagavā, the Lion among men, esteemed? And of those who are esteemed in the world, the Bhagavā is esteemed by them.
"Nếu điều được tôn kính là châu báu, thì Đức Phật há chẳng phải là Sư tử giữa loài người được tôn kính sao? Và những ai được tôn kính trên thế gian này, Đức Phật được tôn kính hơn họ.
Yadi ratikaranti ratanaṃ, nanu bhagavā ratikaro purisasīho, tassa vacanena carantā jhānaratisukhena abhiramanti.
If a jewel is what creates delight, is not the Bhagavā, the Lion among men, one who creates delight? For those who live by his word delight in the bliss of jhāna-delight.
Nếu điều mang lại niềm vui là châu báu, thì Đức Phật há chẳng phải là Sư tử giữa loài người mang lại niềm vui sao? Những ai thực hành theo lời Ngài đều hoan hỷ với niềm vui thiền định.
Yadi atulyanti ratanaṃ, nanu bhagavā atulo purisasīho.
If a jewel is what is incomparable, is not the Bhagavā, the Lion among men, incomparable?
Nếu điều vô song là châu báu, thì Đức Phật há chẳng phải là Sư tử giữa loài người vô song sao?
Na hi sakkā tuletuṃ guṇehi guṇapāramiṃ gato.
Indeed, it is impossible to compare him by his qualities, as he has reached the perfection of qualities.
Thật không thể so sánh Ngài với các đức tính, vì Ngài đã đạt đến sự hoàn hảo của các đức tính.
Yadi dullabhanti ratanaṃ, nanu bhagavā dullabho purisasīho.
If a jewel is what is rare, is not the Bhagavā, the Lion among men, rare?
Nếu điều khó tìm là châu báu, thì Đức Phật há chẳng phải là Sư tử giữa loài người khó tìm sao?
Yadi anomasattaparibhoganti ratanaṃ, nanu bhagavā anomo sīlena samādhinā paññāya vimuttiyā vimuttiñāṇadassanenā’’ti.
If a jewel is what is enjoyed by worthy beings, is not the Bhagavā worthy by sīla, samādhi, paññā, vimutti, and vimuttiñāṇadassana?"
Nếu điều được hưởng bởi những chúng sinh cao quý là châu báu, thì Đức Phật há chẳng phải là bậc vô song về giới, định, tuệ, giải thoát và tri kiến giải thoát sao?"
437
Idha pana dullabhapātubhāvaṭṭhena paññā ‘‘ratana’’nti vuttaṃ.
Here, however, paññā is called a "ratana" (jewel) due to its rarity of appearance.
Tuy nhiên, ở đây, trí tuệ được gọi là "châu báu" theo nghĩa khó xuất hiện.
Puññanti puññacetanā, sā hi arūpattā pariharituṃ na sakkāti.
"Puññaṃ" (merit) is wholesome volitional action (puññacetanā). Since it is formless, it cannot be carried around.
Phước đức (Puññaṃ) là thiện tâm (puññacetanā); vì nó là vô sắc nên không thể mang theo được.
Paṭhamaṃ.
End of the First Sutta.
Thứ nhất.
438
2. Ajarasāsuttavaṇṇanā
2. Explanation of the Ajarasā Sutta
2. Lời chú giải kinh Ajarasā
439
52. Dutiye ajarasāti ajīraṇena, avipattiyāti attho.
52. In the second (sutta), "ajarasā" means without aging, without corruption, is the meaning.
Trong kinh thứ hai, không già (ajarasā) có nghĩa là không hư hoại, không suy thoái.
Sīlañhi avipannameva sādhu hoti, vipannasīlaṃ ācariyupajjhāyādayopi na saṅgaṇhanti, gatagataṭṭhāne niddhamitabbova hotīti.
For sīla is good only when uncorrupted. One with corrupted sīla is not welcomed even by teachers and preceptors, but rather is to be driven away from wherever they go.
Giới hạnh chỉ tốt đẹp khi không bị suy thoái; giới hạnh bị suy thoái thì ngay cả các bậc thầy và bổn sư cũng không chấp nhận, và người đó sẽ bị trục xuất khỏi bất cứ nơi nào mình đến.
Dutiyaṃ.
End of the Second Sutta.
Thứ hai.
440
3. Mittasuttavaṇṇanā
3. Explanation of the Mitta Sutta
3. Lời chú giải kinh Mitta
441
53. Tatiye satthoti saddhiṃcaro, jaṅghasattho vā sakaṭasattho vā.
53. In the third (sutta), "sattho" (caravan) means one who travels together, either a walking caravan or a cart caravan.
Trong kinh thứ ba, đoàn lữ hành (sattho) là những người đi cùng nhau, hoặc đoàn lữ hành đi bộ hoặc đoàn lữ hành xe bò.
Mittanti roge uppanne pāṭaṅkiyā vā aññena vā yānena haritvā khemantasampāpanena mittaṃ.
"Mittaṃ" (friend) refers to a friend who, when a disease arises, carries one by stretcher or other conveyance and brings them to a safe place.
Bạn bè (Mittaṃ) là người bạn giúp đỡ khi bệnh tật xảy ra, bằng cách đưa đến nơi an toàn bằng cáng hoặc phương tiện khác.
Sake ghareti attano gehe.
"Sake ghare" (in one's own home) means in one's own house.
Trong nhà mình (Sake ghare) là trong nhà của chính mình.
Tathārūpe roge jāte puttabhariyādayo jigucchanti, mātā pana asucimpi candanaṃ viya maññati.
When such a disease occurs, children and wives despise one, but a mother regards even impurity as sandalwood.
Khi mắc phải căn bệnh như vậy, con cái và vợ có thể ghê tởm, nhưng mẹ thì coi ngay cả chất bẩn như gỗ đàn hương.
Tasmā sā sake ghare mittaṃ.
Therefore, she is a friend in one's own home.
Vì vậy, mẹ là người bạn trong nhà mình.
Sahāyo atthajātassāti uppannakiccassa yo taṃ kiccaṃ vahati nittharati, so kiccesu saha ayanabhāvena sahāyo mittaṃ, surāpānādisahāyā pana na mittā.
"Sahāyo atthajātassa" (a companion to one in need) refers to one who takes up and accomplishes a task for a person in need; such a companion is a true friend through going together in tasks, whereas companions for drinking and the like are not friends.
Bạn đồng hành khi cần thiết (Sahāyo atthajātassā) là người gánh vác và hoàn thành công việc đã phát sinh; người bạn đồng hành như vậy là bạn bè theo nghĩa cùng đi trong công việc, nhưng những người bạn nhậu nhẹt, v.v., thì không phải là bạn bè.
Samparāyikanti samparāyahitaṃ.
"Samparāyikaṃ" (for the future) means beneficial for the future (next world).
Vì đời sau (Samparāyikaṃ) là lợi ích cho đời sau.
Tatiyaṃ.
End of the Third Sutta.
Thứ ba.
442
4. Vatthusuttavaṇṇanā
4. Explanation of the Vatthu Sutta
4. Lời chú giải kinh Vatthu
443
54. Catutthe puttā vatthūti mahallakakāle paṭijagganaṭṭhena puttā patiṭṭhā.
54. In the fourth (sutta), "puttā vatthū" (children are a support) means children are a support through caring for one in old age.
Trong kinh thứ tư, con cái là chỗ dựa (puttā vatthū) có nghĩa là con cái là chỗ dựa theo nghĩa chăm sóc khi về già.
Paramoti aññesaṃ akathetabbassapi guyhassa kathetabbayuttatāya bhariyā paramo sakhā nāma.
"Paramo" (supreme) means a wife is called a supreme friend because it is appropriate to tell her even a secret that should not be told to others.
Tối thượng (Paramo) có nghĩa là người vợ là người bạn tối thượng theo nghĩa có thể nói ra những điều bí mật không thể nói với người khác.
Catutthaṃ.
End of the Fourth Sutta.
Thứ tư.
444
5-7. Paṭhamajanasuttādivaṇṇanā
5-7. Explanation of the Paṭhamajana Sutta and others
5-7. Lời chú giải kinh Paṭhamajana, v.v.
445
55. Pañcame vidhāvatīti parasamuddādigamanavasena ito cito ca vidhāvati.
55. In the fifth (sutta), "vidhāvati" (wanders) means one wanders hither and thither by going to other oceans and so forth.
Trong kinh thứ năm, lang thang (vidhāvatī) có nghĩa là đi từ đây đến đó, chẳng hạn như đi đến các đại dương khác.
Pañcamaṃ.
End of the Fifth Sutta.
Thứ năm.
446
56. Chaṭṭhe dukkhāti vaṭṭadukkhato.
56. In the sixth (sutta), "dukkhā" (from suffering) means from the suffering of saṃsāra.
Trong kinh thứ sáu, khổ đau (dukkhā) là từ khổ đau của luân hồi.
Chaṭṭhaṃ.
End of the Sixth Sutta.
Thứ sáu.
447
57. Sattame parāyaṇanti nipphatti avassayo.
57. In the seventh (sutta), "parāyaṇaṃ" (refuge) means accomplishment, dependence.
Trong kinh thứ bảy, nơi nương tựa (parāyaṇaṃ) là sự thành tựu, chỗ dựa.
Sattamaṃ.
End of the Seventh Sutta.
Thứ bảy.
448
8. Uppathasuttavaṇṇanā
8. Explanation of the Uppatha Sutta
8. Lời chú giải kinh Uppatha
449
58. Aṭṭhame rāgo uppathoti sugatiñca nibbānañca gacchantassa amaggo.
58. In the eighth (sutta), "rāgo uppatho" (lust is a wrong path) means greed is not the path for one going to a good destination and Nibbāna.
Trong kinh thứ tám, tham ái là con đường sai lạc (rāgo uppatho) là con đường không dẫn đến thiện thú và Nibbāna.
Rattindivakkhayoti rattidivehi, rattidivesu vā khīyati.
"Rattindivakkhayo" (wasting away of nights and days) means it wastes away by or in nights and days.
Sự tiêu hao của ngày đêm (Rattindivakkhayo) là sự tiêu hao bởi ngày đêm, hoặc trong ngày đêm.
Itthī malanti sesaṃ bāhiramalaṃ bhasmakhārādīhi dhovitvā sakkā sodhetuṃ, mātugāmamalena duṭṭho pana na sakkā suddho nāma kātunti itthī ‘‘mala’’nti vuttā.
"Itthī malaṃ" (woman is a stain) means that other external stains can be cleaned by washing with ash, lye, etc., but one defiled by the impurity of a woman cannot be made pure; therefore, a woman is called a "stain".
Phụ nữ là cấu uế (Itthī malaṃ) có nghĩa là những cấu uế bên ngoài khác có thể được làm sạch bằng cách rửa với tro, xà phòng, v.v., nhưng một người bị ô nhiễm bởi cấu uế của phụ nữ thì không thể được làm cho trong sạch; vì lý do này, phụ nữ được gọi là "cấu uế".
Etthāti ettha itthiyaṃ pajā sajjati.
"Ettha" (here) means beings are attached to women here.
Ở đây (Etthā) có nghĩa là chúng sinh bị mắc kẹt vào phụ nữ.
Tapoti indriyasaṃvaradhutaṅgaguṇavīriyadukkarakārikānaṃ nāmaṃ, idha pana ṭhapetvā dukkarakārikaṃ sabbāpi kilesasantāpikā paṭipadā vaṭṭati.
"Tapo" (asceticism) is a name for sense-restraint, dhutaṅga qualities, energy, and difficult practices. Here, however, excluding difficult practices, any practice that torments defilements is appropriate.
Khổ hạnh (Tapo) là tên gọi của sự phòng hộ các căn, các pháp đầu đà, tinh tấn, và những hành động khó khăn; tuy nhiên, ở đây, ngoại trừ những hành động khó khăn, tất cả các con đường thực hành làm thiêu đốt phiền não đều phù hợp.
Brahmacariyanti methunavirati.
"Brahmacariyaṃ" (holy life) means abstinence from sexual intercourse.
Phạm hạnh (Brahmacariyaṃ) là sự kiêng cữ tà dâm.
Aṭṭhamaṃ.
End of the Eighth Sutta.
Thứ tám.
450
9. Dutiyasuttavaṇṇanā
9. Explanation of the Dutiya Sutta
9. Lời chú giải kinh Dutiya
451
59. Navame kissa cābhiratoti kismiṃ abhirato.
59. In the ninth (sutta), "kissa cābhirato" (delighting in what) means in what does one delight?
Trong kinh thứ chín, hoan hỷ trong điều gì (kissa cābhirato) có nghĩa là hoan hỷ trong điều gì?
Dutiyāti sugatiñceva nibbānañca gacchantassa dutiyikā.
"Dutiyā" (companion) means a companion for one going to a good destination and Nibbāna.
Người bạn đồng hành (Dutiyā) là người bạn đồng hành thứ hai của người đi đến thiện thú và Nibbāna.
Paññā cenaṃ pasāsatīti paññā etaṃ purisaṃ ‘‘idaṃ karohi, idaṃ mākarī’’ti anusāsati.
"Paññā cenaṃ pasāsatī" (wisdom guides him) means wisdom instructs this person, "Do this, do not do that."
Trí tuệ hướng dẫn người ấy (Paññā cenaṃ pasāsatī) có nghĩa là trí tuệ hướng dẫn người ấy rằng "hãy làm điều này, đừng làm điều kia".
Navamaṃ.
End of the Ninth Sutta.
Thứ chín.
452
10. Kavisuttavaṇṇanā
10. Explanation of the Kavi Sutta
10. Lời chú giải kinh Kavi
453
60. Dasame chando nidānanti gāyattiādiko chando gāthānaṃ nidānaṃ.
60. In the tenth (sutta), "chando nidānaṃ" (meter is the source) means meter, such as Gāyatī, is the source of verses.
Trong kinh thứ mười, nhịp điệu là căn nguyên (chando nidānaṃ) có nghĩa là nhịp điệu, chẳng hạn như gāyattī, là căn nguyên của các câu kệ.
Pubbapaṭṭhāpanagāthā ārabhanto hi ‘‘kataracchandena hotū’’ti ārabhati.
Indeed, when commencing with a foundational verse, one begins by pondering, "What meter should it be?"
Thật vậy, khi bắt đầu một câu kệ mở đầu, người ta bắt đầu bằng cách hỏi "nên dùng nhịp điệu nào?"
Viyañjananti jananaṃ.
"Viyañjanaṃ" (manifestation) means generating.
Sự biểu hiện (Viyañjanaṃ) là sự sinh ra.
Akkharaṃ hi padaṃ janeti, padaṃ gāthaṃ janeti, gāthā atthaṃ pakāsetīti.
For a letter generates a word, a word generates a verse, and a verse expresses a meaning.
Thật vậy, chữ cái sinh ra từ, từ sinh ra câu kệ, câu kệ làm sáng tỏ ý nghĩa.
Nāmasannissitāti samuddādipaṇṇattinissitā.
"Nāmasannissitā" (supported by names) means supported by designations such as "ocean" and so forth.
Dựa vào danh xưng (Nāmasannissitā) có nghĩa là dựa vào sự quy ước về danh xưng như đại dương, v.v.
Gāthā ārabhanto hi samuddaṃ vā pathaviṃ vā yaṃ kiñci nāmaṃ nissayitvāva ārabhati.
Indeed, when commencing a verse, one begins by depending on some name, be it an ocean or the earth.
Thật vậy, khi bắt đầu một câu kệ, người ta luôn bắt đầu bằng cách dựa vào một danh xưng nào đó, dù là đại dương hay trái đất.
Āsayoti patiṭṭhā.
"Āsayo" (abode) means a foundation.
Chỗ dựa (Āsayo) là nền tảng.
Kavito hi gāthā pavattanti.
For verses arise from a poet.
Thật vậy, các câu kệ phát sinh từ nhà thơ.
So tāsaṃ patiṭṭhā hotīti.
He becomes their foundation.
Ông ấy là nền tảng của chúng.
Dasamaṃ.
End of the Tenth Sutta.
Thứ mười.
454
Jarāvaggo chaṭṭho.
The Sixth Chapter, Jarā Vagga, is finished.
Chương Già Yếu, thứ sáu.
455

7. Addhavaggo

7. Addha Vagga

7. Chương Addhava

456
1. Nāmasuttavaṇṇanā
1. Explanation of the Nāma Sutta
1. Lời chú giải kinh Nāma
457
61. Addhavaggassa paṭhame nāmaṃ sabbaṃ addhabhavīti nāmaṃ sabbaṃ abhibhavati anupatati.
61. In the first (sutta) of the Addha Vagga, "nāmaṃ sabbaṃ addhabhavī" (name overwhelms everything) means name overpowers and pervades everything.
Trong kinh đầu tiên của chương Addhava, danh xưng bao trùm tất cả (nāmaṃ sabbaṃ addhabhavī) có nghĩa là danh xưng bao trùm và chi phối tất cả.
Opapātikena vā hi kittimena vā nāmena mutto satto vā saṅkhāro vā natthi.
Indeed, there is no being or conditioned phenomenon free from a name, whether it be naturally arisen or conventionally made.
Thật vậy, không có chúng sinh hay pháp hữu vi nào thoát khỏi danh xưng, dù là danh xưng tự nhiên hay danh xưng do con người đặt ra.
Yassapi hi rukkhassa vā pāsāṇassa vā ‘‘idaṃ nāma nāma’’nti na jānanti, anāmakotveva tassa nāmaṃ hoti.
For even for a tree or a stone whose name is not known as "such and such a name," its name is simply "unnamed."
Ngay cả một cái cây hay một tảng đá mà người ta không biết tên là gì, thì "không tên" chính là tên của nó.
Paṭhamaṃ.
End of the First Sutta.
Thứ nhất.
458
2-3. Cittasuttādivaṇṇanā
2-3. Explanation of the Citta Sutta and others
2-3. Lời chú giải kinh Citta, v.v.
459
62. Dutiye sabbeva vasamanvagūti ye cittassa vasaṃ gacchanti, tesaṃyeva anavasesapariyādānametaṃ.
62. In the second (sutta), "sabbeva vasamanvagū" (all came under control) refers to the complete and exhaustive inclusion of only those who come under the control of the mind.
Trong kinh thứ hai, tất cả đều đi theo sự kiểm soát (sabbeva vasamanvagū) là sự bao trùm toàn bộ những gì đi theo sự kiểm soát của tâm.
Dutiyaṃ.
End of the Second Sutta.
Thứ hai.
460
63. Tatiyepi eseva nayo.
63. The same method applies to the third (sutta).
Trong kinh thứ ba cũng vậy.
Tatiyaṃ.
End of the Third Sutta.
Thứ ba.
461
4-5. Saṃyojanasuttādivaṇṇanā
4-5. Explanation of the Saṃyojana Sutta and others
4-5. Lời chú giải kinh Saṃyojana, v.v.
462
64. Catutthe kiṃ su saṃyojanoti kiṃ saṃyojano kiṃ bandhano?
64. In the fourth (sutta), "kiṃ su saṃyojano" (what is the fetter) means what is the fetter? What is the bond?
Trong kinh thứ tư, điều gì là kiết sử (kiṃ su saṃyojano) có nghĩa là kiết sử gì, trói buộc gì?
Vicāraṇanti vicaraṇā pādāni.
"Vicāraṇaṃ" (exploring) means the feet that wander.
Sự suy xét (Vicāraṇaṃ) là các bước chân của sự đi lại.
Bahuvacane ekavacanaṃ kataṃ.
The singular has been used for the plural.
Số ít được dùng thay cho số nhiều.
Vitakkassa vicāraṇanti vitakko tassa pādā.
"Vitakkassa vicāraṇaṃ" (exploration of thought) means thought is its feet.
Sự suy xét của tầm (Vitakkassa vicāraṇaṃ) có nghĩa là tầm là các bước chân của nó.
Catutthaṃ.
End of the Fourth Sutta.
Thứ tư.
463
65. Pañcamepi eseva nayo.
65. The same method applies to the fifth (sutta).
Trong kinh thứ năm cũng vậy.
Pañcamaṃ.
End of the Fifth Sutta.
Thứ năm.
464
6. Attahatasuttavaṇṇanā
6. Explanation of the Attahata Sutta
6. Lời chú giải kinh Attahata
465
66. Chaṭṭhe kenassubbhāhatoti kena abbhāhato.
66. In the sixth (sutta), "kenassubbhāhato" (by what is he struck down) means by what is he afflicted?
Trong kinh thứ sáu, bị đánh bại bởi điều gì (kenassubbhāhato) có nghĩa là bị đánh bại bởi điều gì?
Su-kāro nipātamattaṃ.
The particle "su" is merely an emphatic particle.
Chữ "su" chỉ là một tiểu từ.
Icchādhūpāyitoti icchāya āditto.
"Icchādhūpāyito" (smoked by craving) means burning with craving.
Bị hun khói bởi tham ái (Icchādhūpāyito) có nghĩa là bị thiêu đốt bởi tham ái.
Chaṭṭhaṃ.
End of the Sixth Sutta.
Thứ sáu.
466
7-9. Uḍḍitasuttādivaṇṇanā
7-9. Explanation of the Uḍḍita Sutta and others
7-9. Lời chú giải kinh Uḍḍita, v.v.
467
67. Sattame taṇhāya uḍḍitoti taṇhāya ullaṅghito.
67. In the seventh (sutta), "taṇhāya uḍḍito" (enmeshed by craving) means entangled by craving.
Trong kinh thứ bảy, bị trói buộc bởi tham ái (taṇhāya uḍḍito) có nghĩa là bị tham ái trói buộc.
Cakkhuñhi taṇhārajjunā āvunitvā rūpanāgadante uḍḍitaṃ, sotādīni saddādīsūti taṇhāya uḍḍito loko.
Indeed, the eye, enmeshed by the rope of craving, is snagged on the elephant tusk of form, and the ear and so forth on sounds and so forth; thus, the world is enmeshed by craving.
Thật vậy, con mắt bị tham ái trói buộc vào cái răng nanh của con voi hình sắc, tai, v.v., bị trói buộc vào cái răng nanh của con voi âm thanh, v.v.; do đó, thế gian bị tham ái trói buộc.
Maccunā pihitoti anantare attabhāve kataṃ kammaṃ na dūraṃ ekacittantaraṃ, balavatiyā pana māraṇantikavedanāya pabbatena viya otthaṭattā sattā taṃ na bujjhantīti ‘‘maccunā pihito loko’’ti vuttaṃ.
"Maccunā pihito" (covered by death) means that the kamma done in the immediately preceding existence is not far, only one thought-moment away; yet, because beings are covered as if by a mountain due to strong death-agony (māraṇantikavedanā), they do not perceive it. Thus, it is said, "The world is covered by death."
Bị che lấp bởi cái chết (Maccunā pihito) có nghĩa là nghiệp đã tạo trong kiếp sống liền kề không xa, chỉ cách một sát na tâm, nhưng vì chúng sinh bị che lấp bởi cảm thọ đau đớn tột cùng như bị núi đè, nên họ không biết đến nghiệp đó; do đó, kinh nói "thế gian bị che lấp bởi cái chết".
Sattamaṃ.
End of the Seventh Sutta.
Thứ bảy.
468
68. Aṭṭhame sveva pañho devatāya heṭṭhupariyāyavasena pucchito.
68. In the eighth (sutta), the same question was asked by the deity with an upward and downward sequence.
Trong kinh thứ tám, cùng một câu hỏi được vị thiên nhân hỏi theo cách khác.
Aṭṭhamaṃ.
End of the Eighth Sutta.
Thứ tám.
469
69. Navame sabbaṃ uttānameva.
69. In the ninth (discourse), everything is quite clear.
69. Trong kinh thứ chín, tất cả đều rõ ràng.
Navamaṃ.
The ninth.
Kinh thứ chín.
470
10. Lokasuttavaṇṇanā
10. Exegesis on the Lokasutta
10. Chú giải kinh Lokasutta
471
70. Dasame kismiṃ loko samuppannoti kismiṃ uppanne loko uppannoti pucchati.
70. In the tenth (discourse), In what is the world arisen? — this question asks: When what arises, does the world arise?
70. Trong kinh thứ mười, câu hỏi Thế giới sinh khởi từ đâu? (kismiṃ loko samuppanno) có nghĩa là: Khi cái gì sinh khởi thì thế giới sinh khởi?
Chasūti chasu ajjhattikesu āyatanesu uppannesu uppannoti vuccati.
In six — it is said that when the six internal sense bases arise, (the world) arises.
Trong sáu (Chasū) có nghĩa là: Khi sáu nội xứ (ajjhattika-āyatana) sinh khởi thì (thế giới) được gọi là sinh khởi.
Chasu kubbatīti tesuyeva chasu santhavaṃ karoti.
In six one performs — one develops intimacy only with those six (internal sense bases).
Trong sáu (nơi) tạo tác (Chasu kubbatī) có nghĩa là: (Thế giới) tạo sự thân mật trong chính sáu (nội xứ) ấy.
Upādāyāti tāniyeva ca upādāya āgamma paṭicca pavattati.
Dependent on — dependent only on those (six internal sense bases), it occurs by way of cause and condition.
Nương vào (Upādāyā) có nghĩa là: (Thế giới) vận hành do nương tựa, dựa vào chính những (nội xứ) ấy.
Vihaññatīti tesuyeva chasu vihaññati pīḷiyati.
It is afflicted — it is afflicted and tormented by those same six.
Bị hủy hoại (Vihaññatī) có nghĩa là: (Thế giới) bị hủy hoại, bị bức bách trong chính sáu (nội xứ) ấy.
Iti ajjhattikāyatanavasena ayaṃ pañho āgato, ajjhattikabāhirānaṃ pana vasena āharituṃ vaṭṭati.
Thus, this question has come by way of the internal sense bases; however, it is fitting to interpret it by way of both internal and external (sense bases).
Vấn đề này được nêu ra theo cách của nội xứ, nhưng cũng có thể được giải thích theo cách của nội xứ và ngoại xứ.
Chasu hi ajjhattikāyatanesu uppannesu ayaṃ uppanno nāma hoti, chasu bāhiresu santhavaṃ karoti, channaṃ ajjhattikānaṃ upādāya chasu bāhiresu vihaññatīti.
Indeed, when the six internal sense bases arise, this (world of beings) is said to arise; it develops intimacy with the six external (sense objects); dependent on the six internal (sense bases), it is afflicted by the six external (sense objects).
Khi sáu nội xứ sinh khởi, thế giới này được gọi là sinh khởi; nó tạo sự thân mật trong sáu ngoại xứ; nó bị hủy hoại trong sáu ngoại xứ do nương tựa vào sáu nội xứ.
Dasamaṃ.
The tenth.
Kinh thứ mười.
472
Addhavaggo sattamo.
The Chapter of Traversing is the seventh.
Phẩm Addha là phẩm thứ bảy.
473

8. Chetvāvaggo

8. The Chapter of Cutting Off

8. Phẩm Chetvā

474
1. Chetvāsuttavaṇṇanā
1. Exegesis on the Chetvāsutta
1. Chú giải kinh Chetvāsutta
475
71. Chetvāvaggassa paṭhame chetvāti vadhitvā.
71. In the first (discourse) of the Chetvāvagga, having cut off means having killed and destroyed.
71. Trong kinh đầu tiên của phẩm Chetvā, đã đoạn trừ (chetvā) có nghĩa là: đã giết chết, hủy diệt.
Sukhaṃ setīti kodhapariḷāhena aparidayhamānattā sukhaṃ sayati.
He sleeps happily means he sleeps happily, not being tormented by the fever of anger.
Ngủ an lành (sukhaṃ setī) có nghĩa là: ngủ an lành vì không bị thiêu đốt bởi sự bức bách của sân hận.
Na socatīti kodhavināsena vinaṭṭhadomanassattā na socati.
He does not grieve means he does not grieve, having destroyed mental pain through the destruction of anger.
Không sầu muộn (na socatī) có nghĩa là: không sầu muộn vì sự ưu phiền đã bị diệt trừ do sự hủy diệt của sân hận.
Visamūlassāti dukkhavipākassa.
Of the poisonous root means of that which has painful results.
Có gốc độc (visamūlassā) có nghĩa là: có quả khổ.
Madhuraggassāti kuddhassa paṭikujjhitvā, akkuṭṭhassa paccakkositvā, pahaṭassa ca paṭipaharitvā sukhaṃ uppajjati, taṃ sandhāya madhuraggoti vutto.
Of the sweet tip means that happiness arises from retaliating against an angry person, reviling one who reviles, and striking back at one who strikes; referring to this, it is called the "sweet tip."
Có ngọn ngọt (madhuraggassā) có nghĩa là: khi một người nổi giận, trả đũa lại; khi bị mắng chửi, mắng chửi lại; khi bị đánh đập, đánh đập lại, thì sự vui sướng sinh khởi. Do đó, nó được gọi là có ngọn ngọt.
Imasmiṃ hi ṭhāne pariyosānaṃ agganti vuttaṃ.
In this context, the cessation (of enmity) is called the tip.
Trong trường hợp này, sự kết thúc được gọi là ngọn (agga).
Ariyāti buddhādayo.
The Noble Ones refers to the Buddhas and others.
Các bậc Thánh (Ariyā) có nghĩa là: chư Phật và những vị khác.
Paṭhamaṃ.
The first.
Kinh thứ nhất.
476
2. Rathasuttavaṇṇanā
2. Exegesis on the Rathasutta
2. Chú giải kinh Rathasutta
477
72. Dutiye paññāyati etenāti paññāṇaṃ.
72. In the second (discourse), an identifying mark (paññāṇaṃ) is that by which something is known.
72. Trong kinh thứ hai, sự nhận biết (paññāṇaṃ) là cái mà nhờ đó có thể nhận biết.
Dhajo rathassāti mahantasmiṃ hi saṅgāmasīse dūratova dhajaṃ disvā ‘‘asukarañño nāma ayaṃ ratho’’ti ratho pākaṭo hoti.
The banner of a chariot — for in the midst of a great battlefield, upon seeing a banner from afar, one knows, "This chariot belongs to such and such a king," and the chariot becomes evident.
Cờ hiệu của xe (dhajo rathassā) có nghĩa là: trong một trận chiến lớn, chỉ cần nhìn thấy cờ hiệu từ xa, người ta đã biết "Đây là xe của vị vua tên là A-su-ka". Do đó, chiếc xe được nhận biết.
Tena vuttaṃ ‘‘dhajo rathassa paññāṇa’’nti.
Therefore, it is said, "The banner is the identifying mark of a chariot."
Vì vậy, đã nói rằng "Cờ hiệu là sự nhận biết của xe".
Aggipi dūratova dhūmena paññāyati.
Fire too is known from afar by its smoke.
Lửa (Aggi) cũng được nhận biết từ xa qua khói.
Coḷaraṭṭhaṃ paṇḍuraṭṭhanti evaṃ raṭṭhampi raññā paññāyati.
A country too, such as Cola country or Paṇḍu country, is known by its king.
Quốc độ (raṭṭha) cũng được nhận biết qua vị vua, chẳng hạn như quốc độ Coḷa và quốc độ Paṇḍu.
Cakkavattirañño dhītāpi pana itthī ‘‘asukassa nāma bhariyā’’ti bhattāraṃ patvāva paññāyati.
And a woman, even a daughter of a Wheel-turning Monarch, becomes known as "the wife of so-and-so" only when she has obtained a husband.
Con gái của một vị Chuyển Luân Vương, một người phụ nữ (itthī), chỉ được nhận biết là "vợ của người tên là A-su-ka" khi cô ấy đến với chồng.
Tasmā dhūmo paññāṇamagginotiādi vuttaṃ.
Therefore, smoke is the identifying mark of fire and so on is said.
Vì vậy, đã nói rằng Khói là sự nhận biết của lửa (dhūmo paññāṇamaggino), v.v.
Dutiyaṃ.
The second.
Kinh thứ hai.
478
3. Vittasuttavaṇṇanā
3. Exegesis on the Vittasutta
3. Chú giải kinh Vittasutta
479
73. Tatiye saddhīdha vittanti yasmā saddho saddhāya muttamaṇiādīnipi vittāni labhati, tissopi kulasampadā, cha kāmasaggāni, nava brahmaloke patvā pariyosāne amatamahānibbānadassanampi labhati, tasmā maṇimuttādīhi vittehi saddhāvittameva seṭṭhaṃ.
73. In the third (discourse), faith is wealth here — because a faithful person, through faith, obtains even treasures like pearls and gems, and also the three accomplishments of noble families, the six heavens of the sense-sphere, and reaching the nine brahmalokas, ultimately attains the vision of the great Nibbāna, the deathless. Therefore, among treasures like gems and pearls, the treasure of faith is supreme.
73. Trong kinh thứ ba, Đức tin là tài sản ở đây (saddhīdha vittaṃ) có nghĩa là: vì người có đức tin nhờ đức tin mà đạt được những tài sản quý giá như ngọc trai, đá quý, đạt được ba sự sung túc về gia đình, sáu cõi trời dục giới, chín cõi Phạm thiên, và cuối cùng còn đạt được sự chứng kiến Niết Bàn vĩ đại bất tử. Do đó, tài sản đức tin (saddhāvitta) là tối thượng hơn các tài sản như ngọc trai, đá quý.
Dhammoti dasakusalakammapatho.
Dhamma means the ten wholesome courses of action.
Pháp (Dhammo) có nghĩa là: mười nghiệp đạo thiện.
Sukhamāvahatīti sabbampi sāsavānāsavaṃ asaṃkiliṭṭhasukhaṃ āvahati.
It brings happiness means it brings all happiness, defiled and undefiled, which is pure.
Mang lại hạnh phúc (sukhamāvahatī) có nghĩa là: mang lại tất cả hạnh phúc không ô nhiễm, dù hữu lậu hay vô lậu.
Sādutaranti lokasmiṃ loṇambilādīnaṃ sabbarasānaṃ saccameva madhurataraṃ.
More delicious — in the world, among all tastes like saltiness and sourness, truth is truly the most delicious.
Ngọt ngào hơn (Sādutaraṃ) có nghĩa là: trong thế gian, giữa tất cả các vị như mặn, chua, v.v., sự thật (sacca) là ngọt ngào nhất.
Saccasmiṃ hi ṭhitā sīghavegaṃ nadimpi nivattenti, visampi nimmaddenti, aggimpi paṭibāhanti, devampi vassāpenti, tasmā taṃ sabbarasānaṃ madhurataranti vuttaṃ.
For those who stand firm in truth can turn back a swift-flowing river, crush poison, repel fire, and make devas rain. Therefore, it is said that it is the most delicious of all tastes.
Thật vậy, những người kiên định trong sự thật có thể làm cho dòng sông chảy xiết quay ngược, có thể tiêu diệt chất độc, có thể đẩy lùi lửa, và có thể khiến trời mưa. Do đó, nó được nói là ngọt ngào nhất trong tất cả các vị.
Paññājīviṃ jīvitamāhu seṭṭhanti yo paññājīvī gahaṭṭho samāno pañcasu sīlesu patiṭṭhāya salākabhattādīni paṭṭhapetvā paññāya jīvati, pabbajito vā pana dhammena uppanne paccaye ‘‘idamattha’’nti paccavekkhitvā paribhuñjanto kammaṭṭhānaṃ ādāya vipassanaṃ paṭṭhapetvā ariyaphalādhigamavasena paññāya jīvati, taṃ paññājīviṃ puggalaṃ seṭṭhaṃ jīvitaṃ jīvatīti āhu.
They say that a life lived by wisdom is supreme — a layperson who lives by wisdom, established in the five precepts, having offered meals by ticket and so forth, lives by wisdom; or an ordained person who, reflecting upon requisites obtained righteously, "This is for such a purpose," consumes them, takes up a meditation subject, establishes insight, and lives by wisdom through the attainment of the noble fruits — they say such a person living by wisdom leads a supreme life.
Đời sống của người sống bằng trí tuệ được gọi là tối thượng (Paññājīviṃ jīvitamāhu seṭṭhaṃ) có nghĩa là: một người cư sĩ sống bằng trí tuệ, kiên định trong năm giới, thiết lập các bữa ăn theo phiếu (salākabhatta) và sống bằng trí tuệ; hoặc một người xuất gia, sau khi quán xét các vật dụng cúng dường được sinh ra một cách hợp pháp là "có mục đích này", sử dụng chúng, rồi lấy đề mục thiền định, thiết lập thiền quán (vipassanā), và sống bằng trí tuệ thông qua việc chứng đắc các Thánh quả (ariyaphala), thì những bậc Thánh (chư Phật, v.v.) nói rằng người sống bằng trí tuệ đó đang sống một cuộc đời tối thượng.
Tatiyaṃ.
The third.
Kinh thứ ba.
480
4. Vuṭṭhisuttavaṇṇanā
4. Exegesis on the Vuṭṭhisutta
4. Chú giải kinh Vuṭṭhisutta
481
74. Catutthe bījanti uppatantānaṃ sattavidhaṃ dhaññabījaṃ seṭṭhaṃ.
74. In the fourth (discourse), seed — among things that sprout, the seven kinds of grain seeds are supreme.
74. Trong kinh thứ tư, hạt giống (bījaṃ) có nghĩa là: trong số những thứ nảy mầm, bảy loại hạt ngũ cốc là tối thượng.
Tasmiñhi uggate janapado khemo hoti subhikkho.
For when these sprout, the country is safe and prosperous.
Khi chúng nảy mầm, đất nước trở nên an toàn và thịnh vượng.
Nipatatanti nipatantānaṃ meghavuṭṭhi seṭṭhā.
Of things that fall — among things that fall, rain from clouds is supreme.
Rơi xuống (Nipatataṃ) có nghĩa là: trong số những thứ rơi xuống, mưa là tối thượng.
Meghavuṭṭhiyañhi sati vividhāni sassāni uppajjanti, janapadā phītā honti khemā subhikkhā.
For when there is rain, various crops arise, and countries become flourishing, safe, and prosperous.
Khi có mưa, nhiều loại cây trồng sinh sôi, đất nước trở nên phồn thịnh, an toàn và thịnh vượng.
Pavajamānānanti jaṅgamānaṃ padasā caramānānaṃ gāvo seṭṭhā.
Of those who move — among moving beings, those who walk on foot, cows are supreme.
Đi lại (Pavajamānānaṃ) có nghĩa là: trong số những loài di chuyển, đi bộ, bò cái là tối thượng.
Tā nissāya hi sattā pañca gorase paribhuñjamānā sukhaṃ viharanti.
For dependent on them, beings enjoy the five products of milk and dwell happily.
Nương tựa vào chúng, chúng sinh hưởng thụ năm loại sản phẩm từ bò và sống an lạc.
Pavadatanti rājakulamajjhādīsu vadantānaṃ putto varo.
Of those who speak — among those who speak in royal courts and other places, a son is supreme.
Nói năng (Pavadataṃ) có nghĩa là: trong số những người nói năng ở giữa hoàng tộc, v.v., con cái là tối thượng.
So hi mātāpitūnaṃ anatthāvahaṃ na vadati.
For he does not speak what is harmful to his parents.
Vì con cái không nói những điều gây hại cho cha mẹ.
482
Vijjā uppatataṃ seṭṭhāti purimapañhe kira sutvā samīpe ṭhitā ekā devatā ‘‘devate, kasmā tvaṃ etaṃ pañhaṃ dasabalaṃ pucchasi?
Knowledge is supreme among things that arise — it is said that in the previous question, a certain deva who was nearby, hearing (the question), said, "Deva, why do you ask the Buddha this question? I will tell you." And so, according to her own conviction and doctrine, she answered the question.
Trí tuệ là tối thượng trong số những thứ nảy mầm (Vijjā uppatataṃ seṭṭhā) có nghĩa là: nghe vấn đề trong câu hỏi trước, một vị thiên đứng gần đó nói: "Này thiên nhân, tại sao ngài lại hỏi vấn đề này với Đức Thế Tôn (Dasabala)? Ta sẽ trả lời ngài." Và vị thiên ấy đã trả lời vấn đề theo quan điểm và niềm tin của mình.
Ahaṃ te kathessāmī’’ti attano khantiyā laddhiyā pañhaṃ kathesi.
Then the other deva said to her, "Deva, how impertinently you speak, how presumptuous and garrulous you are! I am asking the Blessed One, the Buddha.
Sau đó, vị thiên kia nói với vị thiên này: "Này thiên nhân, ngài nói năng quá xúc phạm, quá táo bạo và lắm lời. Ta đang hỏi Đức Phật, Thế Tôn.
Atha naṃ itarā devatā āha – ‘‘yāva padhaṃsī vadesi devate yāva pagabbhā mukharā, ahaṃ buddhaṃ bhagavantaṃ pucchāmi.
Why do you answer me?"
Tại sao ngài lại trả lời ta?"
Tvaṃ mayhaṃ kasmā kathesī’’ti?
"Why do you speak to me?"
Tại sao ngươi lại nói với ta?”
Nivattetvā tadeva pañhaṃ dasabalaṃ pucchi.
Having ceased (that conversation), she again asked the Buddha the same question.
Sau khi khiển trách, vị thiên kia lại hỏi Đức Thế Tôn cùng vấn đề đó.
Athassā satthā vissajjento vijjā uppatatantiādimāha.
Then the Teacher, intending to answer her, spoke the verse beginning with Knowledge is supreme among things that arise.
Khi đó, Bậc Đạo Sư đã trả lời bằng cách nói Trí tuệ là tối thượng trong số những thứ nảy mầm (vijjā uppatataṃ) v.v.
Tattha vijjāti catumaggavijjā.
Therein, knowledge means the knowledge of the four paths (catumaggavijjā).
Trong đó, trí tuệ (vijjā) có nghĩa là: trí tuệ của bốn Thánh đạo (catumaggavijjā).
Sā hi uppatamānā sabbākusaladhamme samugghāteti.
For when that arises, it utterly uproots all unwholesome states.
Thật vậy, khi trí tuệ ấy sinh khởi, nó diệt trừ tất cả các pháp bất thiện.
Tasmā ‘‘uppatataṃ seṭṭhā’’ti vuttā.
Therefore, it is said to be "supreme among things that arise."
Do đó, nó được nói là "tối thượng trong số những thứ nảy mầm".
Avijjāti vaṭṭamūlakamahāavijjā.
Ignorance means the great ignorance that is the root of saṃsāra.
Vô minh (Avijjā) có nghĩa là: vô minh lớn, gốc rễ của luân hồi (vaṭṭamūlakamahāavijjā).
Sā hi nipatantānaṃ osīdantānaṃ varā.
Indeed, it is supreme among those who fall and sink (into saṃsāra).
Thật vậy, vô minh ấy là tối thượng đối với những ai rơi xuống, chìm đắm.
Pavajamānānanti padasā caramānānaṃ jaṅgamānaṃ anomapuññakkhettabhūto saṅgho varo.
Of those who move — among moving beings who walk on foot, the Saṅgha, which is an incomparable field of merit, is supreme.
Đi lại (Pavajamānānaṃ) có nghĩa là: trong số những loài di chuyển, đi bộ, Tăng đoàn (Saṅgha) là tối thượng, vì là ruộng phước vô thượng.
Tañhi tattha tattha disvā pasannacittā sattā sotthiṃ pāpuṇanti.
For seeing the Noble Saṅgha here and there, beings with minds full of faith attain well-being.
Thật vậy, chúng sinh khi thấy Tăng đoàn ở khắp nơi, với tâm hoan hỷ, sẽ đạt được sự an lành.
Buddhoti yādiso putto vā hotu añño vā, yesaṃ kesañci vadamānānaṃ buddho varo.
The Buddha — whatever kind of son or other person may speak, the Buddha is supreme among all speakers.
Đức Phật (Buddho) có nghĩa là: dù là con cái hay bất kỳ ai khác, trong số tất cả những người nói năng, Đức Phật là tối thượng.
Tassa hi dhammadesanaṃ āgamma anekasatasahassānaṃ pāṇānaṃ bandhanamokkho hotīti.
For through His teaching of the Dhamma, hundreds of thousands of beings are released from bondage.
Thật vậy, nhờ giáo pháp của Ngài, hàng trăm ngàn chúng sinh đã được giải thoát khỏi mọi ràng buộc.
Catutthaṃ.
The fourth.
Kinh thứ tư.
483
5. Bhītāsuttavaṇṇanā
5. Exegesis on the Bhītāsutta
5. Chú giải kinh Bhītāsutta
484
75. Pañcame kiṃsūdha bhītāti kiṃ bhītā?
75. In the fifth (discourse), What is feared here? — What is feared?
75. Trong kinh thứ năm, Điều gì đáng sợ ở đây? (kiṃsūdha bhītā) có nghĩa là: điều gì đáng sợ?
Maggo canekāyatanappavuttoti aṭṭhatiṃsārammaṇavasena anekehi kāraṇehi kathito.
The path, which leads to many spheres, is declared to be such by many reasons, by way of thirty-eight objects (of meditation).
Con đường được thuyết giảng với nhiều xứ (Maggo canekāyatanappavutto) có nghĩa là: được thuyết giảng với nhiều lý do dựa trên ba mươi tám đối tượng (ārammaṇa).
Evaṃ sante kissa bhītā hutvā ayaṃ janatā dvāsaṭṭhi diṭṭhiyo aggahesīti vadati.
Given this, (the question implies) why, being fearful, did this populace adopt the sixty-two wrong views?
Như vậy, tại sao chúng sinh này lại sợ hãi mà chấp thủ sáu mươi hai tà kiến?
Bhūripaññāti bahupañña ussannapañña.
One of great wisdom means one with much wisdom, abundant wisdom.
Trí tuệ rộng lớn (Bhūripaññā) có nghĩa là: người có nhiều trí tuệ, trí tuệ dồi dào.
Paralokaṃ na bhāyeti imasmā lokā paraṃ lokaṃ gacchanto na bhāyeyya.
He should not fear the other world — one who goes from this world to the next world should not fear.
Không sợ hãi thế giới bên kia (Paralokaṃ na bhāye) có nghĩa là: người đi từ thế giới này sang thế giới bên kia sẽ không sợ hãi.
Paṇidhāyāti ṭhapetvā.
Having established means having placed.
Thiết lập (Paṇidhāyā) có nghĩa là: đặt để.
Bahvannapānaṃ gharamāvasantoti anāthapiṇḍikādayo viya bahvannapāne ghare vasanto.
Dwelling in a house with abundant food and drink means dwelling in a house with abundant food and drink, like Anāthapiṇḍika and others.
Người cư sĩ có nhiều thức ăn và đồ uống (Bahvannapānaṃ gharamāvasanto) có nghĩa là: sống trong một ngôi nhà có nhiều thức ăn và đồ uống, giống như Trưởng giả Anāthapiṇḍika và những người khác.
Saṃvibhāgīti accharāya gahitampi nakhena phāletvā parassa datvāva bhuñjanasīlo.
Sharing means one whose habit is to break off even a morsel of food with a fingernail and give it to another before eating.
Người chia sẻ (Saṃvibhāgī) có nghĩa là: người có thói quen chia sẻ thức ăn, dù chỉ là một miếng nhỏ bằng đầu ngón tay, cho người khác trước khi tự mình ăn.
Vadaññūti vuttatthameva.
Generous is the same meaning as stated before.
Người biết nói lời hay (Vadaññū) có nghĩa là: ý nghĩa đã được nói ở trên.
485
Idāni gāthāya aṅgāni uddharitvā dassetabbāni – ‘‘vāca’’nti hi iminā cattāri vacīsucaritāni gahitāni, ‘‘manenā’’tipadena tīṇi manosucaritāni, ‘‘kāyenā’’ti padena tīṇi kāyasucaritāni.
Now, the factors in the verse should be pointed out: by "speech," the four wholesome actions of speech are taken; by the word "mind," the three wholesome mental actions; and by the word "body," the three wholesome bodily actions.
Bây giờ, các yếu tố của bài kệ sẽ được trình bày: "Lời nói" (vāca) bao gồm bốn thiện nghiệp về lời nói; "ý" (manenā) bao gồm ba thiện nghiệp về ý; "thân" (kāyenā) bao gồm ba thiện nghiệp về thân.
Iti ime dasa kusalakammapathā pubbasuddhiaṅgaṃ nāma.
Thus, these ten wholesome courses of action are called the factors of initial purity.
Như vậy, mười nghiệp đạo thiện này được gọi là yếu tố thanh tịnh ban đầu (pubbasuddhiaṅga).
Bahvannapānaṃ gharamāvasantoti iminā yaññaupakkharo gahito.
By the phrase dwelling in a house with abundant food and drink, the requisites for offerings are taken.
Câu Người cư sĩ có nhiều thức ăn và đồ uống (Bahvannapānaṃ gharamāvasanto) bao gồm các vật phẩm cúng dường.
Saddhoti ekamaṅgaṃ, mudūti ekaṃ, saṃvibhāgīti ekaṃ, vadaññūti ekaṃ.
Faithful is one factor; gentle is one; sharing is one; generous is one.
Có đức tin (Saddho) là một yếu tố, nhu hòa (mudū) là một yếu tố, chia sẻ (saṃvibhāgī) là một yếu tố, biết nói lời hay (vadaññū) là một yếu tố.
Iti imāni cattāri aṅgāni sandhāya ‘‘etesu dhammesu ṭhito catūsū’’ti āha.
Thus, with reference to these four factors, it was said: "standing in these four qualities."
Như vậy, Đức Phật đã dạy rằng: ‘Người an trú trong bốn pháp này’ là để chỉ bốn chi phần này.
486
Aparopi pariyāyo – vācantiādīni tīṇi aṅgāni, bahvannapānanti iminā yaññaupakkharova gahito, saddho mudū saṃvibhāgī vadaññūti ekaṃ aṅgaṃ.
Another approach is: "speech" and so on are three factors; by "having much food and drink" the completion of the sacrificial offering is understood; "faithful, gentle, generous, and kindly" is one factor.
Một cách giải thích khác là: ba chi phần là lời nói, v.v.; với từ ‘nhiều thức ăn và đồ uống’ thì chỉ sự hoàn thành của vật cúng dường bố thí; tin tưởng, nhu hòa, chia sẻ, biết nói lời hay là một chi phần.
Aparo dukanayo nāma hoti.
There is another method called the "duka-method" (method of pairs).
Một phương pháp phân loại theo cặp khác được gọi là.
‘‘Vācaṃ manañcā’’ti idamekaṃ aṅgaṃ, ‘‘kāyena pāpāni akubbamāno, bahvannapānaṃ gharamāvasanto’’ti ekaṃ, ‘‘saddho mudū’’ti ekaṃ, ‘‘saṃvibhāgī vadaññū’’ti ekaṃ.
"Speech and mind" is one factor; "not committing evil deeds with the body, dwelling in a house with much food and drink" is one; "faithful, gentle" is one; "generous, kindly" is one.
“Lời nói và ý nghĩ” là một chi phần; “không làm điều ác bằng thân, sống trong nhà có nhiều thức ăn và đồ uống” là một chi phần; “tin tưởng, nhu hòa” là một chi phần; “chia sẻ, biết nói lời hay” là một chi phần.
Etesu catūsu dhammesu ṭhito dhamme ṭhito nāma hoti.
One who stands in these four qualities is called one who stands in the Dhamma.
Người an trú trong bốn pháp này được gọi là người an trú trong Pháp.
So ito paralokaṃ gacchanto na bhāyati.
Such a person, when passing from this world to the next, does not fear.
Người ấy khi đi từ thế giới này sang thế giới khác thì không sợ hãi.
Pañcamaṃ.
Fifth (Sutta).
Thứ năm.
487
6. Najīratisuttavaṇṇanā
6. Commentary on the Najīratisutta
6. Chú giải kinh Najīrati
488
76. Chaṭṭhe nāmagottaṃ na jīratīti atītabuddhānaṃ yāvajjadivasā nāmagottaṃ kathiyati, tasmā na jīratīti vuccati.
76. In the sixth (Sutta), Nāmagottaṃ na jīratī means that the names and clans of past Buddhas are recounted even today; therefore, it is said, "it does not decay."
76. Trong kinh thứ sáu, tên và dòng dõi không bị hủy hoại (nāmagottaṃ na jīratīti) có nghĩa là tên và dòng dõi của các vị Phật quá khứ vẫn được nhắc đến cho đến ngày nay, vì vậy nó được gọi là không bị hủy hoại.
Porāṇā pana ‘‘addhāne gacchante na paññāyissati, jīraṇasabhāvo pana na hotiyevā’’ti vadanti.
However, the ancients say, "Though with the passing of time it may not be recognized, its nature of decaying does not exist."
Tuy nhiên, các bậc cổ đức nói rằng: “Khi thời gian trôi qua, nó sẽ không còn được biết đến, nhưng bản chất của sự hủy hoại thì không tồn tại.”
Ālasyanti ālasiyaṃ, yena ṭhitaṭṭhāne ṭhitova, nisinnaṭṭhāne nisinnova hoti, telepi uttarante ṭhitiṃ na karoti.
Ālasya means laziness, by which one remains standing where one stands, remains seated where one is seated, and even when oil overflows, one makes no effort.
Biếng nhác (ālasyaṃ) là sự lười biếng, do đó người ấy vẫn đứng yên tại chỗ đã đứng, vẫn ngồi yên tại chỗ đã ngồi, và ngay cả khi dầu tràn ra cũng không làm gì.
Pamādoti niddāya vā kilesavasena vā pamādo.
Pamādo means heedlessness due to sleep or due to defilements.
Phóng dật (pamādo) là sự lơ là do ngủ hoặc do phiền não.
Anuṭṭhānanti kammasamaye kammakaraṇavīriyābhāvo.
Anuṭṭhāna means lack of energy to perform work at the time of work.
Không nỗ lực (anuṭṭhānaṃ) là không có tinh tấn để làm việc vào thời điểm cần làm việc.
Asaṃyamoti sīlasaññamābhāvo vissaṭṭhācāratā.
Asaṃyamo means absence of moral restraint, or unrestrained conduct.
Không chế ngự (asaṃyamo) là không có sự chế ngự về giới, là hành vi phóng túng.
Niddāti soppabahulatā.
Niddā means excessive sleepiness.
Ngủ (niddā) là sự ngủ quá nhiều.
Tāya gacchantopi ṭhitopi nisinnopi niddāyati, pageva nipanno.
By this, even when walking, standing, or sitting, one dozes, let alone when lying down.
Do đó, người ấy ngủ gật ngay cả khi đang đi, đang đứng, đang ngồi, huống chi là khi nằm.
Tandīti aticchātādivasena āgantukālasiyaṃ.
Tandī means incidental sluggishness, for example, due to excessive hunger.
Uể oải (tandī) là sự lười biếng tạm thời do quá đói, v.v.
Te chiddeti tāni cha chiddāni vivarāni.
Te chidde means those six holes or openings.
Sáu lỗ hổng đó (te chidde) là sáu lỗ hổng, sáu khe hở đó.
Sabbasoti sabbākārena.
Sabbaso means in every way.
Hoàn toàn (sabbaso) là bằng mọi cách.
Tanti nipātamattaṃ.
Ta is merely a particle.
Đó (taṃ) chỉ là một trạng từ.
Vivajjayeti vajjeyya jaheyya.
Vivajjaye means one should avoid or abandon.
Nên tránh (vivajjaye) là nên tránh, nên từ bỏ.
Chaṭṭhaṃ.
Sixth (Sutta).
Thứ sáu.
489
7. Issariyasuttavaṇṇanā
7. Commentary on the Issariyasutta
7. Chú giải kinh Issariya
490
77. Sattame satthamalanti malaggahitasatthaṃ.
77. In the seventh (Sutta), satthamala means a weapon covered with rust.
77. Trong kinh thứ bảy, gỉ sét của vũ khí (satthamalaṃ) là vũ khí bị gỉ sét.
Kiṃ su harantaṃ vārentīti kaṃ harantaṃ nisedhenti.
Kiṃ su harantaṃ vārentī means whom do they restrain when he takes?
Ai đang mang đi mà họ ngăn cản? (kiṃ su harantaṃ vārentīti) là họ ngăn cản ai đang mang đi?
Vasoti āṇāpavattanaṃ.
Vaso means the exercise of authority.
Quyền lực (vaso) là sự thi hành mệnh lệnh.
Itthīti avissajjanīyabhaṇḍattā ‘‘itthī bhaṇḍānamuttamaṃ, varabhaṇḍa’’nti āha.
Itthī means, because she is an item not to be given away, it is said: "Woman is the best of items, a supreme item."
Phụ nữ (itthī) được nói là “phụ nữ là tối thượng trong các tài sản, là tài sản quý giá” vì họ là tài sản không thể từ bỏ.
Atha vā sabbepi bodhisattā ca cakkavattino ca mātukucchiyaṃyeva nibbattantīti ‘‘itthī bhaṇḍānamuttama’’nti āha.
Alternatively, it is said "Woman is the best of items" because all Bodhisattas and Cakkavattis are born in a mother's womb.
Hoặc, tất cả các vị Bồ tát và Chuyển luân vương đều sinh ra trong bụng mẹ, nên nói rằng “phụ nữ là tối thượng trong các tài sản.”
Kodho satthamalanti kodho malaggahitasatthasadiso, paññāsatthassa vā malanti satthamalaṃ.
Kodho satthamala means anger is like a weapon covered with rust, or it is the rust of the weapon of wisdom.
Sân hận là gỉ sét của vũ khí (kodho satthamalaṃ) có nghĩa là sân hận giống như vũ khí bị gỉ sét, hoặc là gỉ sét của vũ khí trí tuệ.
Abbudanti vināsakāraṇaṃ, corā lokasmiṃ vināsakāti attho.
Abbuda means a cause of destruction; the meaning is that thieves are destroyers in the world.
Kẻ cướp (abbudaṃ) là nguyên nhân của sự hủy diệt, ý nói kẻ cướp là những kẻ hủy diệt trong thế gian.
Harantoti salākabhattādīni gahetvā gacchanto.
Haranto means taking and going with ticket-meals and so on.
Người mang đi (haranto) là người nhận và mang đi các món ăn theo phiếu, v.v.
Salākabhattādīni hi paṭṭhapitakāleyeva manussehi pariccattāni.
Indeed, ticket-meals and so on are offered by people at the very time they are prepared.
Thật vậy, các món ăn theo phiếu, v.v., đã được con người từ bỏ ngay khi chúng được thiết lập.
Tesaṃ tāni haranto samaṇo piyo hoti, anāharante puññahāniṃ nissāya vippaṭisārino honti.
A monastic who receives them is dear, but if they do not receive them, people feel remorse due to the loss of merit.
Vị Sa-môn nhận những thứ đó thì được yêu mến, nếu không nhận thì họ sẽ hối tiếc vì sự mất mát công đức.
Sattamaṃ.
Seventh (Sutta).
Thứ bảy.
491
8. Kāmasuttavaṇṇanā
8. Commentary on the Kāmasutta
8. Chú giải kinh Kāma
492
78. Aṭṭhame attānaṃ na dadeti parassa dāsaṃ katvā attānaṃ na dadeyya ṭhapetvā sabbabodhisatteti vuttaṃ.
78. In the eighth (Sutta), attānaṃ na dade means one should not give oneself away by making oneself a slave to another, except for all Bodhisattas, it is said.
78. Trong kinh thứ tám, không hiến dâng bản thân (attānaṃ na dade) có nghĩa là không biến mình thành nô lệ cho người khác, ngoại trừ tất cả các vị Bồ tát.
Na pariccajeti sīhabyagghādīnaṃ na pariccajeyya sabbabodhisatte ṭhapetvāyevāti vuttaṃ.
Na pariccaje means one should not abandon oneself to lions, tigers, and so on; except for all Bodhisattas, it is said.
Không từ bỏ (na pariccaje) có nghĩa là không từ bỏ cho sư tử, hổ, v.v., cũng ngoại trừ tất cả các vị Bồ tát.
Kalyāṇanti saṇhaṃ mudukaṃ.
Kalyāṇa means gentle, soft.
Tốt đẹp (kalyāṇaṃ) là lời nói dịu dàng, mềm mại.
Pāpikanti pharusaṃ vācaṃ.
Pāpika means harsh speech.
Xấu xa (pāpikaṃ) là lời nói thô tục.
Aṭṭhamaṃ.
Eighth (Sutta).
Thứ tám.
493
9. Pātheyyasuttavaṇṇanā
9. Commentary on the Pātheyyasutta
9. Chú giải kinh Pātheyya
494
79. Navame saddhā bandhati pātheyyanti saddhaṃ uppādetvā dānaṃ deti, sīlaṃ rakkhati, uposathakammaṃ karoti, tenetaṃ vuttaṃ.
79. In the ninth (Sutta), saddhā bandhati pātheyya means one generates faith, then gives dana, observes sīla, and performs Uposatha practice; therefore, this was said.
79. Trong kinh thứ chín, đức tin tạo ra lương thực (saddhā bandhati pātheyyaṃ) có nghĩa là người ta phát khởi đức tin rồi bố thí, giữ giới, thực hành Uposatha, nên lời này đã được nói.
Sirīti issariyaṃ.
Sirī means sovereignty.
Sự giàu có (sirī) là quyền lực.
Āsayoti vasanaṭṭhānaṃ.
Āsayo means dwelling place.
Nơi trú ngụ (āsayo) là nơi ở.
Issariye hi abhimukhībhūte thalatopi jalatopi bhogā āgacchantiyeva.
Indeed, when sovereignty is present, riches come from both land and water.
Thật vậy, khi quyền lực hiển hiện, tài sản sẽ đến từ đất liền và từ biển.
Tenetaṃ vuttaṃ.
Therefore, this was said.
Vì vậy, lời này đã được nói.
Parikassatīti parikaḍḍhati.
Parikassatī means it draws near.
Kéo về (parikassatīti) là kéo lại.
Navamaṃ.
Ninth (Sutta).
Thứ chín.
495
10. Pajjotasuttavaṇṇanā
10. Commentary on the Pajjotasutta
10. Chú giải kinh Pajjota
496
80. Dasame pajjototi padīpo viya hoti.
80. In the tenth (Sutta), pajjoto means it is like a lamp.
80. Trong kinh thứ mười, ánh sáng (pajjoto) giống như ngọn đèn.
Jāgaroti jāgarabrāhmaṇo viya hoti.
Jāgaro means it is like the ever-vigilant Arahant.
Người tỉnh thức (jāgaro) giống như vị Bà-la-môn tỉnh thức.
Gāvo kamme sajīvānanti kammena saha jīvantānaṃ gāvova kamme kammasahāyā kammadutiyakā nāma honti.
Gāvo kamme sajīvāna means for those who live by their work, cows are indeed their companions in work, their secondary companions in work.
Bò là bạn đồng hành trong công việc (gāvo kamme sajīvānaṃ) có nghĩa là đối với những người sống bằng công việc, bò là bạn đồng hành, là người thứ hai trong công việc.
Gomaṇḍalehi saddhiṃ kasikammādīni nipphajjanti.
Farming and other works are accomplished with herds of cattle.
Các công việc đồng áng, v.v., được hoàn thành cùng với đàn bò.
Sītassa iriyāpathoti sītaṃ assa sattakāyassa iriyāpatho jīvitavutti.
Sītassa iriyāpatho means the plough is the means of livelihood for living beings.
Cái cày là phương tiện sinh sống (sītassa iriyāpatho) có nghĩa là cái cày là phương tiện sinh sống của chúng sinh.
Sītanti naṅgalaṃ.
Sīta means a plough.
Cái cày (sītaṃ) là cái cày.
Yassa hi naṅgalehi khettaṃ appamattakampi kaṭṭhaṃ na hoti, so kathaṃ jīvissatīti vadati.
He says, "How will one live if even a small field is not ploughed with ploughs?"
Lời này nói rằng: Nếu cánh đồng của một người không được cày dù chỉ một chút bằng cái cày, thì làm sao người ấy có thể sống được?
Dasamaṃ.
Tenth (Sutta).
Thứ mười.
497
11. Araṇasuttavaṇṇanā
11. Commentary on the Araṇasutta
11. Chú giải kinh Araṇa
498
81. Ekādasame araṇāti nikkilesā.
81. In the eleventh (Sutta), araṇā means without defilements.
81. Trong kinh thứ mười một, không phiền não (araṇā) là không có phiền não.
Vusitanti vusitavāso.
Vusita means the accomplished dwelling.
Đã sống (vusitaṃ) là đã sống Phạm hạnh.
Bhojissiyanti adāsabhāvo.
Bhojissiya means the state of not being a slave.
Tự do (bhojissiyaṃ) là không làm nô lệ.
Samaṇāti khīṇāsavasamaṇā.
Samaṇā means monks who have destroyed the asavas.
Các Sa-môn (samaṇā) là các Sa-môn đã diệt trừ lậu hoặc.
Te hi ekantena araṇā nāma.
For they are indeed entirely without defilements.
Thật vậy, họ là những người hoàn toàn không có phiền não.
Vusitaṃ na nassatīti tesaṃ ariyamaggavāso na nassati.
Vusitaṃ na nassatī means their dwelling in the Noble Path does not perish.
Phạm hạnh đã sống không mất đi (vusitaṃ na nassati) có nghĩa là đời sống Phạm hạnh theo Thánh đạo của họ không mất đi.
Parijānantīti puthujjanakalyāṇakato paṭṭhāya sekhā lokiyalokuttarāya pariññāya parijānanti.
Parijānantī means from the time one is an ordinary virtuous person, the Sekha (trainee) individuals fully comprehend with mundane and supramundane full understanding (pariññā).
Hiểu rõ (parijānanti) có nghĩa là từ khi là phàm nhân thiện hạnh, các bậc hữu học hiểu rõ bằng sự liễu tri thế gian và siêu thế.
Bhojissiyanti khīṇāsavasamaṇānaṃyeva niccaṃ bhujissabhāvo nāma.
Bhojissiya means the constant state of freedom belongs only to monks who have destroyed the asavas.
Tự do (bhojissiyaṃ) là trạng thái tự do vĩnh viễn của các Sa-môn đã diệt trừ lậu hoặc.
Vandantīti pabbajitadivasato paṭṭhāya vandanti.
Vandantī means they pay homage from the day of their ordination.
Đảnh lễ (vandanti) có nghĩa là họ đảnh lễ từ ngày xuất gia.
Patiṭṭhitanti sīle patiṭṭhitaṃ.
Patiṭṭhita means established in sīla.
An trú (patiṭṭhitaṃ) là an trú trong giới.
Samaṇīdhāti samaṇaṃ idha.
Samaṇīdhā means a monk here.
Sa-môn ở đây (samaṇīdhā) là Sa-môn ở đây.
Jātihīnanti api caṇḍālakulā pabbajitaṃ.
Jātihīna means even one who has gone forth from a candāla family.
Dòng dõi thấp kém (jātihīnaṃ) là ngay cả người xuất gia từ gia đình candāla.
Khattiyāti na kevalaṃ khattiyāva, devāpi sīlasampannaṃ samaṇaṃ vandantiyevāti.
Khattiyā means not only khattiyas, but also devas pay homage to a monk endowed with sīla.
Các Sát-đế-lợi (khattiyā) không chỉ các Sát-đế-lợi, mà cả các vị chư thiên cũng đảnh lễ vị Sa-môn đầy đủ giới hạnh.
Ekādasamaṃ.
Eleventh (Sutta).
Thứ mười một.
499
Chetvāvaggo aṭṭhamo.
The Chetva Vagga, the Eighth, is concluded.
Chương Chetvā kết thúc.
500
Iti sāratthappakāsiniyā
Thus, in the Sāratthappakāsinī,
Như vậy, trong Sāratthappakāsinī
501
Saṃyuttanikāya-aṭṭhakathāya
The Commentary on the Saṃyutta Nikāya
Chú giải Tương Ưng Bộ Kinh
Next Page →