185. Evaṃ me sutanti mahāsuññatasuttaṃ.
185. "Thus have I heard": This is the Mahāsuññata Sutta.
185. Tôi nghe như vầy là Đại Không Kinh.
Tattha kāḷakhemakassāti chavivaṇṇena so kāḷo, khemakoti panassa nāmaṃ.
There, Kāḷakhemakassa means that he was dark in complexion, and Khemaka was his name.
Trong đó, Kāḷakhemaka có nghĩa là vị ấy đen về màu da, còn Khemaka là tên của vị ấy.
Vihāroti tasmiṃyeva nigrodhārāme ekasmiṃ padese pākārena parikkhipitvā dvārakoṭṭhakaṃ māpetvā haṃsavaṭṭakādisenāsanāni ceva maṇḍalamāḷabhojanasālādīni ca patiṭṭhapetvā kato vihāro.
Vihāra means a monastery built by enclosing a specific area within that very Nigrodhārāma with a fence, erecting a gatehouse, and establishing sleeping and sitting places such as swan-like structures, as well as circular halls and refectories.
Vihāra (tinh xá) là một tinh xá được xây dựng trong chính khu vườn Nigrodha đó, trong một khu vực, được bao quanh bởi một bức tường, có cổng chính, và được bố trí các chỗ ở như Hamsavaṭṭaka v.v., cùng các sảnh đường hình tròn, phòng ăn v.v.
Sambahulāni senāsanānīti mañco pīṭhaṃ bhisibimbohanaṃ taṭṭikā cammakhaṇḍo tiṇasanthāro paṇṇasanthāro palālasanthārotiādīni paññattāni honti, mañcena mañcaṃ…pe… palālasanthāreneva palālasanthāraṃ āhacca ṭhapitāni, gaṇabhikkhūnaṃ vasanaṭṭhānasadisaṃ ahosi.
Sambahulāni senāsanāni means that numerous sleeping and sitting places such as couches, chairs, cushions, bolsters, mats, hide-coverings, grass beds, leaf beds, and straw beds were arranged, with one couch against another... (pe) ...and one straw bed against another, resembling a dwelling place for a community of bhikkhus.
Nhiều chỗ ở có nghĩa là giường, ghế, đệm, gối, chiếu, mảnh da, thảm cỏ, thảm lá cây, thảm rơm v.v. được sắp đặt, giường này dựa vào giường kia… (v.v.)… thảm rơm này dựa vào thảm rơm kia, giống như nơi ở của các tỳ-khưu sống theo nhóm.
Sambahulā nu khoti bhagavato bodhipallaṅkeyeva sabbakilesānaṃ samugghāṭitattā saṃsayo nāma natthi, vitakkapubbabhāgā pucchā, vitakkapubbabhāge cāyaṃ nukāro nipātamatto.
Regarding Sambahulā nu kho*: There is no doubt for the Blessed One, as all defilements were eradicated at the Bodhi-seat itself. This is a question preceded by deliberation, and here, the particle nu merely indicates a preceding deliberation.
Chữ Sambahulā nu kho là, do Đức Thế Tôn đã nhổ tận gốc mọi phiền não ngay tại Bồ-đề tòa, nên không có sự nghi ngờ nào cả. Đây là câu hỏi có sự suy tư đi trước, và chữ "nu" trong câu hỏi này chỉ là một tiểu từ biểu thị sự suy tư đi trước.
Pāṭimatthakaṃ gacchante avinicchito nāma na hoti.
As he reaches the pinnacle of the discourse, for the Blessed One, there is nothing undetermined.
Khi đi đến đỉnh cao của giáo pháp, Đức Thế Tôn không có điều gì chưa được quyết định.
Ito kira pubbe bhagavatā dasa dvādasa bhikkhū ekaṭṭhāne vasantā na diṭṭhapubbā.
It is said that before this, the Blessed One had never seen ten or twelve bhikkhus dwelling in one place.
Nghe nói, trước thời điểm này, Đức Thế Tôn chưa từng thấy mười hay mười hai Tỳ-kheo cùng sống chung một chỗ.
Athassa etadahosi – gaṇavāso nāmāyaṃ vaṭṭe āciṇṇasamāciṇṇo nadīotiṇṇaudakasadiso, nirayatiracchānayonipettivisayāsurakāyesupi, manussaloka-devalokabrahmalokesupi gaṇavāsova āciṇṇo.
Then it occurred to him: "This dwelling in groups is a practice repeatedly done in saṃsāra, like water flowing into a river. It is practiced in the realms of hell, animals, hungry ghosts, and asuras, as well as in the human, deva, and brahmā realms."
Khi ấy, Ngài có ý nghĩ này – sự sống chung theo nhóm này trong vòng luân hồi đã trở thành một thói quen, một tập quán, giống như nước chảy vào sông, và sự sống chung theo nhóm này cũng là một thói quen trong các cõi địa ngục, súc sanh, ngạ quỷ, A-tu-la, cũng như trong cõi người, cõi trời và cõi Phạm thiên.
Dasayojanasahasso hi nirayo tipucuṇṇabharitā nāḷi viya sattehi nirantaro, pañcavidhabandhanakammakāraṇakaraṇaṭṭhāne sattānaṃ pamāṇaṃ vā paricchedo vā natthi, tathā vāsīhi tacchanādiṭhānesu, iti gaṇabhūtāva paccanti.
For indeed, hell, ten thousand yojanas wide, is packed with beings like a tube filled with powdered tin. In the places of the fivefold binding and torture, there is no measure or limit to the beings, nor in places where they are cut by axes and so on. Thus, they suffer as a group.
Địa ngục rộng mười ngàn do-tuần, chật kín chúng sanh như một ống đựng đầy bột thiếc; không có giới hạn hay số lượng chúng sanh tại nơi hành hình với năm loại trói buộc, cũng như tại những nơi bị đẽo gọt bằng rìu, v.v., như vậy, chúng sanh phải chịu quả báo theo từng nhóm.
Tiracchānayoniyaṃ ekasmiṃ vammike upasikānaṃ pamāṇaṃ vā paricchedo vā natthi, tathā ekekabilādīsupi kipillikādīnaṃ.
In the animal realm, there is no measure or limit to the termites in a single anthill, nor to ants and so on in each hole.
Trong cõi súc sanh, không có giới hạn hay số lượng kiến trong một tổ mối, cũng như các loài côn trùng như kiến trong mỗi hang, v.v.
Tiracchānayoniyampi gaṇavāsova.
Thus, even in the animal realm, dwelling in groups is the practice.
Trong cõi súc sanh cũng là sự sống chung theo nhóm.
Petanagarāni ca gāvutikāni aḍḍhayojanikānipi petabharitāni honti.
And the cities of hungry ghosts, one gavuta or even half a yojana in size, are filled with hungry ghosts.
Các thành phố của ngạ quỷ rộng một gāvuta hoặc nửa do-tuần cũng chật kín ngạ quỷ.
Evaṃ pettivisayepi gaṇavāsova.
Thus, even in the realm of hungry ghosts, dwelling in groups is the practice.
Như vậy, trong cõi ngạ quỷ cũng là sự sống chung theo nhóm.
Asurabhavanaṃ dasayojanasahassaṃ kaṇṇe pakkhittasūciyā kaṇṇabilaṃ viya hoti.
The asura realm, ten thousand yojanas wide, is like an ear-hole filled with a needle thrust into it.
Cung điện của A-tu-la rộng mười ngàn do-tuần, giống như lỗ tai bị đâm bằng kim.
Iti asurakāyepi gaṇavāsova.
Thus, even in the asura realm, dwelling in groups is the practice.
Như vậy, trong cõi A-tu-la cũng là sự sống chung theo nhóm.
Manussaloke sāvatthiyaṃ sattapaṇṇāsa kulasatasahassāni, rājagahe anto ca bahi ca aṭṭhārasa manussakoṭiyo vasiṃsu.
In the human realm, in Sāvatthī, there were fifty-seven hundred thousand families; in Rājagaha, eighteen crores of people lived both inside and outside the city.
Trong cõi người, tại Sāvatthī có năm mươi bảy vạn gia đình, tại Rājagaha có mười tám triệu người sống trong và ngoài thành.
Evaṃ aññesupi ṭhānesūti manussalokepi gaṇavāsova.
Thus, dwelling in groups is the practice even in the human realm, and in other places as well.
Như vậy, ở những nơi khác cũng vậy, trong cõi người cũng là sự sống chung theo nhóm.
Bhummadevatā ādiṃ katvā devalokabrahmalokesupi gaṇavāsova.
Starting with the earth deities, even in the deva and brahmā realms, dwelling in groups is the practice.
Bắt đầu từ chư thiên ở cõi đất, cho đến các cõi trời và cõi Phạm thiên cũng là sự sống chung theo nhóm.
Ekekassa hi devaputtassa aḍḍhatiyā nāṭakakoṭiyo honti, navapi koṭiyo honti, ekaṭṭhāne dasasahassāpi brahmāno vasanti.
Indeed, each deva-son has two and a half crores of dancing girls, or even nine crores. In one place, ten thousand brahmās also dwell.
Mỗi vị thiên tử có hai triệu rưỡi vũ nữ, hoặc chín triệu vũ nữ; mười ngàn vị Phạm thiên cũng sống chung một chỗ.
Tato cintesi – ‘‘mayā satasahassakappādhikāni cattāri asaṅkhyeyyāni gaṇavāsaviddhaṃsanatthaṃ dasa pāramiyo pūritā, ime ca bhikkhū ito paṭṭhāyeva gaṇaṃ bandhitvā gaṇābhiratā jātā ananucchavikaṃ karontī’’ti.
Then he thought: "I have perfected the ten pāramīs over four incalculable aeons and a hundred thousand aeons for the destruction of dwelling in groups, but these bhikkhus, from this very time, are forming groups and delighting in groups, doing what is unseemly."
Khi ấy, Ngài suy nghĩ: “Ta đã viên mãn mười Ba-la-mật trong bốn A-tăng-kỳ và một trăm ngàn đại kiếp để phá tan sự sống chung theo nhóm, nhưng những Tỳ-kheo này lại bắt đầu kết nhóm và ưa thích nhóm, đang làm điều không phù hợp.”
So dhammasaṃvegaṃ uppādetvā puna cintesi – ‘‘sace ‘ekaṭṭhāne dvīhi bhikkhūhi na vasitabba’nti sakkā bhaveyya sikkhāpadaṃ paññapetuṃ, sikkhāpadaṃ paññāpeyyaṃ, na kho panetaṃ sakkā.
Having aroused a sense of urgency regarding the Dhamma, he thought again: "If it were possible to lay down a training rule saying, 'Two bhikkhus should not dwell in one place,' I would lay it down, but that is not possible.
Ngài khởi lên sự xúc động về Pháp, rồi lại suy nghĩ: “Nếu có thể chế định một giới luật rằng ‘hai Tỳ-kheo không được sống chung một chỗ’, thì ta sẽ chế định giới luật đó, nhưng điều này không thể làm được.
Handāhaṃ mahāsuññatāpaṭipattiṃ nāma suttantaṃ desemi, yaṃ sikkhākāmānaṃ kulaputtānaṃ sikkhāpadapaññatti viya nagaradvāre nikkhittasabbakāyikaādāso viya ca bhavissati.
Let me then teach a Sutta called Mahāsuññatāpaṭipatti, which will be like the promulgation of a training rule for sons of good families who desire to train, and like a full-length mirror placed at the city gate.
Vậy ta hãy thuyết một bài kinh tên là Mahāsuññatāpaṭipatti (Đại Không Hạnh), bài kinh này sẽ giống như một giới luật được chế định cho các thiện nam tử muốn học giới, và giống như một tấm gương toàn thân được đặt ở cổng thành.
Tato yathā nāmekasmiṃ ādāse khattiyādayo attano vajjaṃ disvā taṃ pahāya anavajjā honti, evamevaṃ mayi parinibbutepi pañcavassasahassāni imaṃ suttaṃ āvajjitvā gaṇaṃ vinodetvā ekībhāvābhiratā kulaputtā vaṭṭadukkhassa antaṃ karissantī’’ti.
Just as kings and others, seeing their faults in a mirror, abandon them and become faultless, so too, even after I have passed into Nibbāna, for five thousand years, sons of good families, reflecting on this Sutta, giving up grouping, and delighting in solitude, will put an end to the suffering of saṃsāra."
Khi ấy, như các vị Sát-đế-lợi, v.v., nhìn thấy lỗi lầm của mình trong gương và từ bỏ chúng để trở nên không lỗi lầm, thì cũng vậy, sau khi ta nhập Niết-bàn, trong năm ngàn năm, các thiện nam tử quán xét bài kinh này, giải tán nhóm và ưa thích sự độc cư, sẽ chấm dứt khổ đau của vòng luân hồi.”
Bhagavato ca manorathaṃ pūrentā viya imaṃ suttaṃ āvajjitvā gaṇaṃ vinodetvā vaṭṭadukkhaṃ khepetvā parinibbutā kulaputtā gaṇanapathaṃ vītivattā.
And as if fulfilling the Blessed One's aspiration, sons of good families, reflecting on this Sutta, giving up grouping, and ending the suffering of saṃsāra, passed into Nibbāna, beyond reckoning.
Như để hoàn thành ước nguyện của Đức Thế Tôn, các thiện nam tử đã quán xét bài kinh này, giải tán nhóm, chấm dứt khổ đau của vòng luân hồi và nhập Niết-bàn, số lượng họ vượt quá mọi sự tính toán.
Vālikapiṭṭhivihārepi hi ābhidhammikaabhayatthero nāma vassūpanāyikasamaye sambahulehi bhikkhūhi saddhiṃ imaṃ suttaṃ sañjhāyitvā ‘‘sammāsambuddho evaṃ kāreti, mayaṃ kiṃ karomā’’ti āha.
Indeed, even at Vālikapiṭṭhivihāra, the Abhidhammika Elder Abhaya, during the rains-retreat, recited this Sutta with many bhikkhus and said, "The Perfectly Enlightened One does this, so why should we not do it?"
Quả thật, tại tu viện Vālikapiṭṭhi, Trưởng lão Abhaya, vị thông hiểu Abhidhamma, vào mùa an cư kiết hạ, cùng với nhiều Tỳ-kheo khác, đã tụng đọc bài kinh này và nói: “Đức Chánh Đẳng Giác đã làm như vậy, chúng ta sẽ làm gì đây?”
Te sabbepi antovasse gaṇaṃ vinodetvā ekībhāvābhiratā arahattaṃ pāpuṇiṃsu.
All of them, having given up grouping within the rains-retreat, delighted in solitude and attained Arahantship.
Tất cả các vị ấy, trong mùa an cư, đã giải tán nhóm và ưa thích sự độc cư, rồi chứng đắc A-la-hán quả.
Gaṇabhedanaṃ nāma idaṃ suttanti.
This Sutta is called the Breaking of Groups.
Bài kinh này được gọi là sự phá hoại nhóm.
186. Ghaṭāyāti evaṃnāmakassa sakkassa.
Ghaṭāyā means of the Sakyan by that name.
Ghaṭāyā là của vị Sakka (Thích Ca) tên như vậy.
Vihāreti ayampi vihāro nigrodhārāmasseva ekadese kāḷakhemakassa vihāro viya katoti veditabbo.
Regarding vihāre (monastery): This monastery should be understood as having been built in a part of the Nigrodhārāma itself, like the monastery of Kāḷakhemaka.
Vihāre (tu viện): Tu viện này cũng được hiểu là được xây dựng ở một phần của tu viện Nigrodhārāma, giống như tu viện của Kāḷakhemaka.
Cīvarakammanti jiṇṇamalinānaṃ aggaḷaṭṭhānuppādanadhovanādīhi kataparibhaṇḍampi, cīvaratthāya uppannavatthānaṃ vicāraṇasibbanādīhi akataṃ saṃvidhānampi vaṭṭati, idha pana akataṃ saṃvidhānaṃ adhippetaṃ.
Cīvarakammaṃ (robe-work) means both the preparation done by repairing worn-out, soiled robes, washing them, etc., and also the arrangement of unmade robes, such as examining and sewing cloths intended for robes. Here, however, the intention is for unmade arrangements.
Cīvarakammaṃ (việc y phục): Có thể là việc chuẩn bị y phục đã hoàn tất bằng cách vá lại, giặt giũ, v.v., những y phục cũ nát, hoặc việc chưa chuẩn bị những vật liệu đã có để làm y phục bằng cách cắt may, v.v. Ở đây, ý muốn nói đến việc chưa chuẩn bị.
Manussā hi ānandattherassa cīvarasāṭake adaṃsu.
For indeed, people had given robe-cloths to Venerable Ānanda.
Quả thật, mọi người đã dâng y phục cho Trưởng lão Ānanda.
Tasmā thero sambahule bhikkhū gahetvā tattha cīvarakammaṃ akāsi.
Therefore, the Elder took many bhikkhus and performed robe-work there.
Vì vậy, Trưởng lão Ānanda đã dẫn nhiều Tỳ-kheo đến đó để làm việc y phục.
Tepi bhikkhū pātova sūcipāsakassa paññāyanakālato paṭṭhāya nisinnā apaññāyanakāle uṭṭhahanti.
Those bhikkhus, too, would sit from the time the eye of the needle became visible in the early morning and would rise when it was no longer visible.
Những Tỳ-kheo ấy, từ lúc kim chỉ còn nhìn thấy rõ vào buổi sáng sớm, đã ngồi và chỉ đứng dậy khi kim chỉ không còn nhìn thấy rõ.
Sūcikamme niṭṭhiteyeva senāsanāni saṃvidahissāmāti na saṃvidahiṃsu.
They did not arrange their lodgings, thinking, "We will arrange the lodgings only after the sewing work is finished."
Họ không sắp xếp chỗ ở, nghĩ rằng: “Chúng ta sẽ sắp xếp chỗ ở sau khi việc may vá hoàn tất.”
Cīvarakārasamayo noti thero kira cintesi – ‘‘addhā etehi bhikkhūhi na paṭisāmitāni senāsanāni, bhagavatā ca diṭṭhāni bhavissanti.
Regarding Cīvarakārasamayo no (It is our time for robe-making): The Elder thought, "Surely these bhikkhus have not put their lodgings in order, and the Blessed One will see them.
Cīvarakārasamayo no (Đây là thời điểm làm y phục của chúng tôi): Trưởng lão Ānanda đã suy nghĩ: “Chắc chắn những Tỳ-kheo này chưa sắp xếp chỗ ở, và Đức Thế Tôn cũng đã thấy điều đó.
Iti anattamano satthā suṭṭhu niggahetukāmo, imesaṃ bhikkhūnaṃ upatthambho bhavissāmī’’ti; tasmā evamāha.
Thus, the Teacher, being displeased and wishing to reprimand them severely, I will be a support for these bhikkhus"; hence he spoke thus.
Vì vậy, Đức Đạo Sư không hài lòng và muốn khiển trách họ một cách nghiêm khắc, ta sẽ là người bênh vực cho những Tỳ-kheo này.” Đó là lý do Ngài nói như vậy.
Ayaṃ panettha adhippāyo – ‘‘na, bhante, ime bhikkhū kammārāmā eva, cīvarakiccavasena pana evaṃ vasantī’’ti.
The intention here is: "Bhante, these bhikkhus are not habitually engaged in work; rather, they are dwelling thus on account of the robe-making task."
Ý nghĩa ở đây là: “Bạch Đức Thế Tôn, những Tỳ-kheo này không phải là những người ưa thích công việc, nhưng họ đang sống như vậy vì việc y phục.”
Na kho, ānandāti, ānanda, kammasamayo vā hotu akammasamayo vā, cīvarakārasamayo vā hotu acīvarakārasamayo vā, atha kho saṅgaṇikārāmo bhikkhu na sobhatiyeva.
Na kho, Ānandā (No, Ānanda), means, Ānanda, whether it is a time for work or not a time for work, whether it is a time for robe-making or not a time for robe-making, a bhikkhu who delights in company is simply not radiant.
Na kho, Ānandā (Không phải, Ānanda): Này Ānanda, dù là thời gian làm việc hay không làm việc, dù là thời gian làm y phục hay không làm y phục, một Tỳ-kheo ưa thích tụ tập vẫn không đẹp đẽ chút nào.
Mā tvaṃ anupatthambhaṭṭhāne upatthambho ahosīti.
Do not become a support in a situation where support is unseemly.
Con đừng trở thành người bênh vực ở nơi không nên bênh vực.
Tattha saṅgaṇikāti sakaparisasamodhānaṃ.
Therein, saṅgaṇikā means associating with one's own assembly.
Ở đây, saṅgaṇikā (tụ tập) là sự tụ họp của nhóm mình.
Gaṇoti nānājanasamodhānaṃ.
Gaṇo means associating with various people.
Gaṇa (nhóm) là sự tụ họp của nhiều người khác nhau.
Iti saṅgaṇikārāmo vā hotu gaṇārāmo vā, sabbathāpi gaṇabāhullābhirato gaṇabandhanabaddho bhikkhu na sobhati.
Thus, whether one delights in one's own assembly or in a group of various people, in any way, a bhikkhu who delights in excessive grouping and is bound by group ties is not radiant.
Như vậy, dù là ưa thích tụ tập với nhóm mình hay ưa thích tụ tập với nhiều nhóm, một Tỳ-kheo bị ràng buộc bởi sự tụ tập, ưa thích sự đông đúc của nhóm, vẫn không đẹp đẽ chút nào.
Pacchābhatte pana divāṭṭhānaṃ sammajjitvā sudhotahatthapādo mūlakammaṭṭhānaṃ gahetvā ekārāmatamanuyutto bhikkhu buddhasāsane sobhati.
However, a bhikkhu who, after the meal, sweeps the day-residence, washes his hands and feet thoroughly, takes up his fundamental meditation subject, and is devoted to dwelling alone, is radiant in the Buddha's dispensation.
Tuy nhiên, một Tỳ-kheo sau bữa ăn, quét dọn chỗ nghỉ ban ngày, rửa tay chân sạch sẽ, lấy đề mục thiền định cơ bản và chuyên tâm vào sự độc cư, thì đẹp đẽ trong giáo pháp của Đức Phật.
Nekkhammasukhanti kāmato nikkhantassa sukhaṃ.
Nekkhammasukhaṃ means the happiness of one who has gone forth from sensuality.
Nekkhammasukhaṃ (hạnh phúc xuất ly) là hạnh phúc của người đã xuất ly khỏi dục lạc.
Pavivekasukhampi kāmapavivekasukhameva.
Pavivekasukhaṃ also means the happiness of seclusion from sensuality.
Pavivekasukhaṃ (hạnh phúc viễn ly) cũng chính là hạnh phúc viễn ly khỏi dục lạc.
Rāgādīnaṃ pana vūpasamatthāya saṃvattatīti upasamasukhaṃ.
It contributes to the calming of lust and other defilements, hence it is upasamasukhaṃ (happiness of tranquility).
Vì nó dẫn đến sự lắng dịu của tham ái, v.v., nên gọi là upasamasukhaṃ (hạnh phúc an tịnh).
Maggasambodhatthāya saṃvattatīti sambodhisukhaṃ.
It contributes to the complete enlightenment of the path, hence it is sambodhisukhaṃ (happiness of full enlightenment).
Vì nó dẫn đến sự giác ngộ Đạo, nên gọi là sambodhisukhaṃ (hạnh phúc giác ngộ).
Nikāmalābhīti kāmalābhī icchitalābhī.
Nikāmalābhī means one who obtains as desired, one who obtains what is wished for.
Nikāmalābhī (người được lợi ích theo ý muốn) là người được lợi ích theo ý muốn, được điều mong muốn.
Akicchalābhīti adukkhalābhī.
Akicchalābhī means one who obtains without difficulty.
Akicchalābhī (người được lợi ích không khó khăn) là người được lợi ích không đau khổ.
Akasiralābhīti vipulalābhī.
Akasiralābhī means one who obtains abundantly.
Akasiralābhī (người được lợi ích dễ dàng) là người được lợi ích dồi dào.
Sāmāyikanti appitappitasamaye kilesehi vimuttaṃ.
Sāmāyikaṃ means liberation from defilements at the specific time of attainment.
Sāmāyikaṃ (thời giải thoát) là giải thoát khỏi phiền não vào những thời điểm nhập định.
Kantanti manāpaṃ.
Kantaṃ means pleasing.
Kantaṃ (đáng yêu) là điều đáng yêu.
Cetovimuttinti rūpārūpāvacaracittavimuttiṃ.
Cetovimuttiṃ means liberation of mind in the rūpāvacara and arūpāvacara jhāna states.
Cetovimuttiṃ (tâm giải thoát) là tâm giải thoát trong các cõi sắc giới và vô sắc giới.
Vuttañhetaṃ – ‘‘cattāri ca jhānāni catasso ca arūpasamāpattiyo, ayaṃ sāmāyiko vimokkho’’ti (paṭi. ma. 1.213).
For it has been said: "The four jhāna attainments and the four arūpasamāpatti, this is the temporary liberation (sāmāyiko vimokkho)."
Điều này đã được nói: “Bốn thiền và bốn thiền vô sắc, đây là sự giải thoát hữu thời (sāmāyika vimokkha)” (Paṭi. Ma. 1.213).
Asāmāyikanti na samayavasena kilesehi vimuttaṃ, atha kho accantavimuttaṃ lokuttaraṃ vuttaṃ.
Asāmāyikaṃ means not liberation from defilements based on a specific time, but rather permanent liberation, which is supramundane (lokuttara).
Asāmāyikaṃ (bất thời giải thoát) là không phải giải thoát khỏi phiền não theo thời điểm, mà là giải thoát tuyệt đối, tức là pháp xuất thế.
Vuttañhetaṃ – ‘‘cattāro ca ariyamaggā cattāri ca sāmaññaphalāni, ayaṃ asāmāyiko vimokkho’’ti.
For it has been said: "The four Noble Paths and the four Fruits of recluseship, this is the non-temporary liberation (asāmāyiko vimokkho)."
Điều này đã được nói: “Bốn Thánh đạo và bốn Sa-môn quả, đây là sự giải thoát bất thời (asāmāyika vimokkha).”
Akuppanti kilesehi akopetabbaṃ.
Akuppaṃ means that which cannot be disturbed by defilements.
Akuppaṃ (bất động) là không bị phiền não làm lay chuyển.
Ettāvatā kiṃ kathitaṃ hoti?
What is taught by this much?
Đến đây, điều gì đã được nói?
Saṅgaṇikārāmo bhikkhu gaṇabandhanabaddho neva lokiyaguṇaṃ, na ca lokuttaraguṇaṃ nibbattetuṃ sakkoti, gaṇaṃ vinodetvā pana ekābhirato sakkoti.
A bhikkhu who delights in company, bound by the fetter of a group, is not able to produce either worldly qualities or transcendent qualities. But having dispelled the group, one who delights in solitude is able.
Một tỳ-khưu ưa thích hội chúng, bị ràng buộc bởi sự kết nhóm, không thể tạo ra các phẩm chất thế gian cũng như các phẩm chất siêu thế. Nhưng khi đã giải tán hội chúng, sống một mình, vị ấy có thể làm được.
Tathā hi vipassī bodhisatto caturāsītiyā pabbajitasahassehi parivuto satta vassāni vicaranto sabbaññuguṇaṃ nibbattetuṃ nāsakkhi, gaṇaṃ vinodetvā sattadivase ekībhāvābhirato bodhimaṇḍaṃ āruyha sabbaññuguṇaṃ nibbattesi.
Indeed, Vipassī Bodhisatta, while wandering for seven years surrounded by eighty-four thousand renunciants, was not able to produce the quality of omniscience. Having dismissed the group, delighting in solitude on the seventh day, he ascended the Bodhi-maṇḍala and produced the quality of omniscience.
Quả thật, Bồ-tát Vipassī, được vây quanh bởi tám vạn bốn ngàn vị xuất gia, đã không thể tạo ra phẩm chất Toàn Giác khi đi lại trong bảy năm. Sau khi giải tán hội chúng, Ngài sống một mình, hoan hỷ trong bảy ngày, rồi Ngài lên Bồ-đề đạo tràng và tạo ra phẩm chất Toàn Giác.
Amhākaṃ bodhisatto pañcavaggiyehi saddhiṃ chabbassāni vicaranto sabbaññuguṇaṃ nibbattetuṃ nāsakkhi, tesu pakkantesu ekībhāvābhirato bodhimaṇḍaṃ āruyha sabbaññuguṇaṃ nibbattesi.
Our Bodhisatta, while wandering for six years with the Pañcavaggī monks, was not able to produce the quality of omniscience. When they had departed, delighting in solitude, he ascended the Bodhi-maṇḍala and produced the quality of omniscience.
Bồ-tát của chúng ta, khi đi lại sáu năm cùng với nhóm năm vị tỳ-khưu, đã không thể tạo ra phẩm chất Toàn Giác. Khi họ rời đi, Ngài hoan hỷ trong sự cô độc, lên Bồ-đề đạo tràng và tạo ra phẩm chất Toàn Giác.
Evaṃ saṅgaṇikārāmassa guṇādhigamābhāvaṃ dassetvā idāni dosuppattiṃ dassento nāhaṃ ānandātiādimāha.
Having thus shown the absence of achieving special qualities for one who delights in company, the Blessed One now states, "I, Ānanda," and so forth, intending to show the arising of faults.
Sau khi trình bày sự thiếu thốn thành tựu phẩm chất của người ưa thích hội chúng như vậy, bây giờ để trình bày sự phát sinh các lỗi lầm, Ngài nói: “Này Ānanda, Ta không thấy…” và tiếp theo.
Tattha rūpanti sarīraṃ.
Therein, "rūpaṃ" means the body.
Trong đó, ‘sắc’ (rūpa) là thân thể.
Yattha rattassāti yasmiṃ rūpe rāgavasena rattassa.
"Yattha rattassa" means for one who is attached due to lust in that form.
‘Nơi người bị tham ái trói buộc’ (yattha rattassā) là nơi người bị tham ái trói buộc vào sắc đó.
Na uppajjeyyunti yasmiṃ rūpe rattassa na uppajjeyyuṃ, taṃ rūpaṃ na samanupassāmi, atha kho sāriputtamoggallānānaṃ dasabalasāvakattupagamanasaṅkhātena aññathābhāvena sañcayassa viya, upāligahapatino aññathābhāvena nāṭaputtassa viya, piyajātikasutte seṭṭhiādīnaṃ viya ca uppajjantiyeva.
"Na uppajjeyyuṃ" means: "I do not see any form for one attached to which sorrows and so forth would not arise. For such a one, they indeed arise," just as for Sañcaya due to the transformation of Sāriputta and Moggallāna becoming disciples of the Ten-Powered One, and just as for Nāṭaputta due to the transformation of Upāli the householder, and just as for the wealthy and others in the Piyajātika Sutta, sorrows and so forth arise.
‘Không phát sinh’ (na uppajjeyyu) có nghĩa là: Ta không thấy sắc nào mà người bị tham ái trói buộc vào đó lại không phát sinh (sầu, bi, khổ, ưu, não). Trái lại, chúng phát sinh, như đối với Sañcaya khi Sāriputta và Moggallāna trở thành đệ tử của Bậc Thập Lực, như đối với Nāṭaputta khi gia chủ Upāli trở thành đệ tử của Bậc Thập Lực, và như đối với các vị trưởng giả và những người khác trong kinh Piyajātika.
187. Ayaṃ kho panānandāti ko anusandhi?
187. "Now, Ānanda, this"—what is the connection?
187. “Này Ānanda, đây là…” – sự liên kết là gì?
Sace hi koci dubbuddhī navapabbajito vadeyya – ‘‘sammāsambuddho khettaṃ paviṭṭhā gāviyo viya amheyeva gaṇato nīharati, ekībhāve niyojeti, sayaṃ pana rājarājamahāmattādīhi parivuto viharatī’’ti, tassa vacanokāsupacchedanatthaṃ – ‘‘cakkavāḷapariyantāya parisāya majjhe nisinnopi tathāgato ekakovā’’ti dassetuṃ imaṃ desanaṃ ārabhi.
If some foolish newly-ordained monk were to say: "The Perfectly Enlightened One drives us out of the group, like cows entering a field, and enjoins us to solitude, but he himself dwells surrounded by kings, great ministers, and so forth," then to cut off the occasion for such talk, the Blessed One began this discourse to show that "even when seated amidst an assembly extending to the edge of the Cakkavāḷa, the Tathāgata is indeed alone."
Nếu có một tân tỳ-khưu ngu dốt nào đó nói: “Đức Chánh Đẳng Giác đuổi chúng ta ra khỏi hội chúng như những con bò bị đuổi khỏi cánh đồng, Ngài khuyến khích chúng ta sống cô độc, nhưng chính Ngài lại sống được vây quanh bởi các vua chúa, đại thần, v.v.”, để cắt đứt cơ hội cho lời nói như vậy, Ngài đã bắt đầu bài thuyết pháp này để chỉ ra rằng: “Dù ngồi giữa hội chúng rộng lớn như toàn cõi thế giới, Như Lai vẫn là một mình.”
Tattha sabbanimittānanti rūpādīnaṃ saṅkhanimittānaṃ.
Therein, "sabbanimittānaṃ" means the signs of conditioned things such as rūpa and so forth.
Trong đó, ‘tất cả các tướng’ (sabbanimittānaṃ) là các tướng hữu vi như sắc, v.v.
Ajjhattanti visayajjhattaṃ.
"Ajjhattaṃ" means internal (subjective) as a sphere.
‘Nội’ (ajjhatta) là nội thuộc đối tượng (ý nói quả vị thiền định).
Suññatanti suññataphalasamāpattiṃ.
"Suññataṃ" means the attainment of fruition of emptiness.
‘Không’ (suññatā) là Không Quả Định (suññataphalasamāpatti).
Tatra ceti upayogatthe bhummaṃ, taṃ ceti vuttaṃ hoti.
"Tatra ce" is the locative case used in the sense of the accusative; it means "and if those*."
‘Nếu ở đó’ (tatra ce) là cách dùng địa cách cho ý nghĩa đối tượng, và có nghĩa là ‘nếu họ đến với Ngài’.
Puna tatrāti tasmiṃ parisamajjhe ṭhito.
Again, "Tatra" means standing in the midst of that assembly.
Lại nữa, ‘ở đó’ (tatrā) là đứng giữa hội chúng đó.
Vivekaninnenāti nibbānaninnena.
"Vivekaninnenā" means with a mind inclined towards Nibbāna.
‘Nghiêng về viễn ly’ (vivekaninnena) là nghiêng về Nibbāna.
Byantībhūtenāti āsavaṭṭhānīyadhammehi vigatantena nissaṭena visaṃyuttena.
"Byantībhūtenā" means with a mind free, detached, and disjoined from those qualities that are the causes of the Āsavas.
‘Đã dứt sạch’ (byantībhūtena) là đã thoát ly, đã lìa khỏi, đã không còn liên hệ với các pháp là nguyên nhân của lậu hoặc.
Uyyojanikapaṭisaṃyuttanti gacchatha tumheti evaṃ uyyojanikena vacanena paṭisaṃyuttaṃ.
"Uyyojanikapaṭisaṃyuttaṃ" means associated with a dismissal-type statement such as "Go, all of you."
‘Liên quan đến việc ra đi’ (uyyojanikapaṭisaṃyutta) là liên quan đến lời nói khuyến khích: “Các ông hãy đi đi!”
Kāya pana velāya bhagavā evaṃ katheti?
But at what time does the Blessed One speak thus?
Đức Thế Tôn nói như vậy vào lúc nào?
Pacchābhattakiccavelāya, vā purimayāmakiccavelāya vā.
At the time after the meal or at the time of the first watch.
Vào lúc sau bữa ăn, hoặc vào lúc canh đầu.
Bhagavā hi pacchābhatte gandhakuṭiyaṃ sīhaseyyaṃ kappetvā vuṭṭhāya phalasamāpattiṃ appetvā nisīdati.
For after the meal, the Blessed One lies down in the Fragrant Hut in the manner of a lion, rises, enters the fruition attainment, and sits down.
Thật vậy, sau bữa ăn, Đức Thế Tôn nằm nghỉ theo thế sư tử trong hương thất, rồi đứng dậy, nhập quả định và ngồi xuống.
Tasmiṃ samaye dhammassavanatthāya parisā sannipatanti.
At that time, the assembly gathers to listen to the Dhamma.
Vào lúc đó, hội chúng tập hợp để nghe Pháp.
Atha bhagavā kālaṃ viditvā gandhakuṭito nikkhamitvā buddhāsanavaragato dhammaṃ desetvā bhesajjatelapākaṃ gaṇhanto viya kālaṃ anatikkamitvā vivekaninnena cittena parisaṃ uyyojeti.
Then, the Blessed One, knowing the time, emerges from the Fragrant Hut, goes to the excellent Buddha-seat, teaches the Dhamma, and then, without exceeding the proper time, just as one takes medicinal oil, he dismisses the assembly with a mind inclined towards seclusion.
Sau đó, Đức Thế Tôn biết thời gian, ra khỏi hương thất, đến ngồi trên Phật tọa cao quý, thuyết Pháp, rồi như người uống dầu thuốc, không để lỡ thời gian, Ngài khuyến khích hội chúng ra về với tâm hướng về viễn ly.
Purimayāmepi ‘‘abhikkantā kho vāseṭṭhā ratti, yassa dāni kālaṃ maññathā’’ti (dī. ni. 3.299) evaṃ uyyojeti.
Even in the first watch, he dismisses them saying, "The night, Vāseṭṭhas, is far spent; do now what you think is fitting."
Vào canh đầu cũng vậy, Ngài khuyến khích họ ra về bằng cách nói: “Này Vāseṭṭha, đêm đã khuya rồi. Bây giờ các ông hãy làm những gì các ông cho là thích hợp.”
Buddhānañhi bodhipattito paṭṭhāya dve pañcaviññāṇānipi nibbānaninnāneva.
For the Buddhas, from the moment of their enlightenment, even the ten sense-consciousnesses are indeed inclined towards Nibbāna.
Thật vậy, đối với các vị Phật, từ khi đạt được giác ngộ, mười thức (dve pañcaviññāṇāni) đều hướng về Nibbāna.
Tasmātihānandāti yasmā suññatāvihāro santo paṇīto, tasmā.
"Tasmātihānandā" means: "Therefore, Ānanda," because dwelling in emptiness is peaceful and sublime.
‘Do đó, này Ānanda’ (tasmātihānandā) có nghĩa là: bởi vì sự an trú trong Không (suññatāvihāra) là an tịnh và cao quý, nên như vậy.
188. Ajjhattamevāti gocarajjhattameva.
188. "Ajjhattameva" means only in the internal sphere of meditation.
188. ‘Chỉ nội’ (ajjhattamevā) là chỉ nội thuộc đối tượng (gocara).
Ajjhattaṃ suññatanti idha niyakajjhattaṃ, attano pañcasu khandhesu nissitanti attho.
"Ajjhattaṃ suññataṃ" here means the emptiness inherent in one's own five aggregates, that is, dependent on one's own five aggregates.
‘Nội không’ (ajjhattaṃ suññata) ở đây là không thuộc về chính mình, có nghĩa là nương tựa vào năm uẩn của chính mình.
Sampajāno hotīti kammaṭṭhānassa asampajjanabhāvajānanena sampajāno.
"Sampajāno hoti" means one is possessed of wisdom and discernment by knowing the incompleteness of the meditation subject.
‘Tỉnh giác’ (sampajāno hoti) là tỉnh giác do biết được trạng thái bất toàn của đề mục thiền.
Bahiddhāti parassa pañcasu khandhesu.
"Bahiddhā" means in the five aggregates of another.
‘Ngoại’ (bahiddhā) là thuộc về năm uẩn của người khác.
Ajjhattabahiddhāti kālena ajjhattaṃ kālena bahiddhā.
"Ajjhattabahiddhā" means sometimes in one's own aggregates, sometimes in another's aggregates.
‘Nội ngoại’ (ajjhattabahiddhā) là lúc thì nội, lúc thì ngoại.
Āneñjanti ubhatobhāgavimutto bhavissāmāti āneñjaṃ arūpasamāpattiṃ manasi karoti.
"Āneñjaṃ" means, having considered "I will be liberated in both ways," one contemplates the imperturbable (arūpa-samāpatti).
‘Bất động’ (āneñja) là tác ý đến vô sắc định (arūpasamāpatti) với ý nghĩ: “Ta sẽ trở thành người giải thoát cả hai phương diện (ubhatobhāgavimutta).”
Tasmiṃyeva purimasminti pādakajjhānaṃ sandhāya vuttaṃ.
"Tasmiṃyeva purimasmiṃ" is said with reference to the foundational jhāna.
‘Chính trong cái trước đó’ (tasmiṃyeva purimasmiṃ) là nói đến thiền nền tảng (pādakajjhāna).
Apaguṇapādakajjhānato vuṭṭhitassa hi ajjhattaṃ suññataṃ manasikaroto tattha cittaṃ na pakkhandati.
For the mind of one who has risen from a poorly practiced foundational jhāna does not incline towards the contemplation of internal emptiness.
Thật vậy, đối với người đã xuất khỏi thiền nền tảng chưa thuần thục, khi tác ý đến nội không, tâm của vị ấy không đi vào đó.
Tato ‘‘parassa santāne nu kho katha’’nti bahiddhā manasi karoti, tatthapi na pakkhandati.
Therefore, one contemplates external emptiness, thinking, "How is it in the continuity of another?" But even there, the mind does not incline.
Từ đó, vị ấy tác ý đến ngoại: “Liệu ở dòng tâm thức của người khác thì sao?”, nhưng tâm cũng không đi vào đó.
Tato – ‘‘kālena attano santāne, kālena parassa santāne nu kho katha’’nti ajjhattabahiddhā manasi karoti, tatthapi na pakkhandati.
Therefore, one contemplates internal and external emptiness, thinking, "How is it sometimes in one's own continuity, sometimes in another's continuity?" But even there, the mind does not incline.
Từ đó, vị ấy tác ý đến nội ngoại: “Liệu lúc thì ở dòng tâm thức của mình, lúc thì ở dòng tâm thức của người khác thì sao?”, nhưng tâm cũng không đi vào đó.
Tato ubhatobhāgavimutto hotukāmo ‘‘arūpasamāpattiyaṃ nu kho katha’’nti āneñjaṃ manasi karoti, tatthapi na pakkhandati.
Therefore, desiring to be liberated in both ways, one contemplates the imperturbable (arūpa-samāpatti), thinking, "How is it in the arūpa-samāpatti?" But even there, the mind does not incline.
Từ đó, muốn trở thành người giải thoát cả hai phương diện, vị ấy tác ý đến bất động (āneñja): “Liệu ở vô sắc định thì sao?”, nhưng tâm cũng không đi vào đó.
Idāni – ‘‘na me cittaṃ pakkhandatīti vissaṭṭhavīriyena upaṭṭhākādīnaṃ pacchato na caritabbaṃ, pādakajjhānameva pana sādhukaṃ punappunaṃ manasikātabbaṃ.
Now, to show that "one should not wander behind attendants and so forth with slackened effort just because one's mind does not incline, but rather one should repeatedly and properly contemplate the foundational jhāna itself.
Bây giờ, để chỉ ra rằng: “Không nên đi theo sau các thị giả, v.v., với sự tinh tấn buông lỏng vì tâm ta không đi vào (đề mục). Trái lại, thiền nền tảng cần phải được tác ý kỹ lưỡng lặp đi lặp lại.
Evamassa rukkhe chindato pharasumhi avahante puna nisitaṃ kāretvā chindantassa chijjesu pharasu viya kammaṭṭhāne manasikāro vahatī’’ti dassetuṃ tasmiṃyevātiādimāha.
Thus, for such a person, just as an axe that does not cut for a woodcutter is sharpened again and then cuts, so too does the mental engagement in the meditation subject become effective," the phrase "tasmiṃyevā" and so forth is stated.
Như vậy, sự tác ý vào đề mục của vị ấy sẽ hoạt động như một chiếc rìu của người đang chặt cây, khi rìu không ăn, người ấy mài sắc lại rồi chặt, thì rìu sẽ ăn vào việc chặt cây”, Ngài nói “Chính trong cái đó…” và tiếp theo.
Idānissa evaṃ paṭipannassa yaṃ yaṃ manasi karoti, tattha tattha manasikāro sampajjatīti dassento pakkhandatīti āha.
Now, to show that for one who practices thus, whatever one contemplates, the mental engagement becomes successful there, the phrase "pakkhandati" is stated.
Bây giờ, để chỉ ra rằng đối với người thực hành như vậy, bất cứ điều gì vị ấy tác ý, sự tác ý đó đều thành tựu ở đó, Ngài nói “đi vào” (pakkhandati).
189. Iminā vihārenāti iminā samathavipassanāvihārena.
189. "Iminā vihārenā" means with this dwelling of serenity and insight.
189. ‘Với sự an trú này’ (iminā vihārena) là với sự an trú samatha-vipassanā này.
Itiha tattha sampajānoti iti caṅkamantopi tasmiṃ kammaṭṭhāne sampajjamāne ‘‘sampajjati me kammaṭṭhāna’’nti jānanena sampajāno hoti.
"Itiha tattha sampajāno" means thus, even when walking, one is comprehending in that meditation subject, knowing "my meditation subject is successful."
‘Như vậy, ở đó vị ấy tỉnh giác’ (itiha tattha sampajāno) có nghĩa là: như vậy, ngay cả khi đi kinh hành, vị ấy vẫn tỉnh giác do biết rằng: “Đề mục thiền của ta đang thành tựu.”
Sayatīti nipajjati.
"Sayatī" means one lies down.
‘Nằm’ (sayatī) là ngủ.
Ettha kañci kālaṃ caṅkamitvā – ‘‘idāni ettakaṃ kālaṃ caṅkamituṃ sakkhissāmī’’ti ñatvā iriyāpathaṃ ahāpetvā ṭhātabbaṃ.
Here, after walking for some time, one should know, "Now I can walk for this much longer," and without losing the posture, one should stand.
Ở đây, sau khi đi kinh hành một thời gian, biết rằng: “Bây giờ ta có thể đi kinh hành được chừng này thời gian”, vị ấy nên đứng mà không làm mất oai nghi.
Esa nayo sabbavāresu.
This method applies to all instances.
Nguyên tắc này áp dụng cho tất cả các oai nghi.
Na kathessāmīti, itiha tatthāti evaṃ na kathessāmīti jānanena tattha sampajānakārī hoti.
"Na kathessāmīti, itiha tatthā" means thus, by knowing "I will not speak thus," one acts with comprehension in that situation.
‘Ta sẽ không nói chuyện như vậy, như vậy ở đó’ (na kathessāmīti, itiha tatthā) có nghĩa là: vị ấy tỉnh giác ở đó do biết rằng: “Ta sẽ không nói chuyện phiếm như vậy.”
190. Iti vitakkapahānena dve magge kathetvā idāni tatiyamaggassa vipassanaṃ ācikkhanto pañca kho ime, ānanda, kāmaguṇātiādimāha.
190. Thus, having taught the two paths through the abandoning of vitakka, the Blessed One now describes the insight of the third path, saying, "These five strands of sensuality, Ānanda," and so forth.
190. Như vậy, sau khi nói về hai đạo (magga) thông qua việc đoạn trừ tầm, bây giờ để giảng về vipassanā của đạo thứ ba, Ngài nói: “Này Ānanda, có năm dục lạc này…” và tiếp theo.
Āyataneti tesuyeva kāmaguṇesu kismiñcideva kilesuppattikāraṇe.
"Āyatane" means in those very strands of sensuality, in some cause for the arising of defilements.
‘Trong xứ’ (āyatane) là trong chính các dục lạc đó, trong bất kỳ nguyên nhân nào phát sinh phiền não.
Samudācāroti samudācaraṇato appahīnakileso.
"Samudācāro" means an unabandoned defilement arises from constant indulgence.
‘Sự hiện hành’ (samudācāro) là phiền não chưa được đoạn trừ do sự hiện hành.
Evaṃ santanti evaṃ vijjamānameva.
"Evaṃ santaṃ" means that which exists thus clearly.
‘Khi điều đó hiện hữu’ (evaṃ santa) là khi điều đó hiện hữu rõ ràng.
Sampajānoti kammaṭṭhānassa asampattijānanena sampajāno.
"Sampajāno" means one is possessed of wisdom and discernment by knowing the non-achievement of the meditation subject.
‘Tỉnh giác’ (sampajāno) là tỉnh giác do biết được sự chưa thành tựu của đề mục thiền.
Dutiyavāre evaṃ santametanti evaṃ sante etaṃ.
In the second instance, " evaṃ santametaṃ" means: this* when it is thus.
Trong lần thứ hai, evaṃ santametaṃ có nghĩa là "khi điều này là như vậy".
Sampajānoti kammaṭṭhānasampattijānanena sampajāno.
" Sampajāno" means one who is clearly comprehending through knowing the attainment of the meditation subject.
Sampajāno (chánh niệm) có nghĩa là vị ấy có chánh niệm do biết được sự thành tựu của đề mục thiền định (kammaṭṭhāna).
Ayañhi ‘‘pahīno nu kho me pañcasu kāmaguṇesu chandarāgo no’’ti paccavekkhamāno apahīnabhāvaṃ ñatvā vīriyaṃ paggahetvā taṃ anāgāmimaggena samugghāṭeti, tato maggānantaraṃ phalaṃ, phalato vuṭṭhāya paccavekkhamāno pahīnabhāvaṃ jānāti, tassa jānanena ‘‘sampajāno hotī’’ti vuttaṃ.
For this monk, reflecting, "Has attachment and desire for the five sense-pleasures been abandoned in me or not?", he knows the state of not having abandoned it, and having aroused energy, he uproots it completely with the Anāgāmi-magga. Then, immediately after the path, is the fruition. Rising from the fruition, and reflecting, he knows the state of having abandoned it. It is because of this knowing that it is said, "He is clearly comprehending (sampajāno)."
Vị ấy, khi quán xét: “Tham ái (chandarāga) của ta đối với năm dục trần đã được đoạn trừ chưa?”, nếu biết rằng nó chưa được đoạn trừ, bèn nỗ lực tinh tấn (vīriya) để đoạn trừ hoàn toàn tham ái đó bằng đạo Anāgāmimagga (Bất Lai Đạo). Sau đó, liền sau đạo là quả (phala). Vị ấy xuất khỏi quả và quán xét, biết được sự đoạn trừ của tham ái. Do sự biết đó, được gọi là “có chánh niệm (sampajāno)”.
191. Idāni arahattamaggassa vipassanaṃ ācikkhanto pañca kho ime, ānanda, upādānakkhandhātiādimāha.
191. Now, intending to explain the insight of the Arahant-magga, he said, " Ananda, there are these five clinging-aggregates," and so forth.
191. Bây giờ, khi giảng về thiền quán (vipassanā) của đạo A-la-hán (Arahattamaggassa), Đức Phật đã nói câu: “Này Ānanda, đây là năm uẩn chấp thủ (upādānakkhandhā) này” và tiếp theo.
Tattha so pahīyatīti rūpe asmīti māno asmīti chando asmīti anusayo pahīyati.
There, " it is abandoned" means the conceit "I am" in form, the desire "I am," the underlying tendency "I am" are abandoned.
Ở đây, “nó được đoạn trừ” có nghĩa là kiêu mạn (māna) “ta là sắc”, tham ái (chanda) “ta là sắc”, và tùy miên (anusaya) “ta là sắc” trong sắc được đoạn trừ.
Tathā vedanādīsu sampajānatā vuttanāyeneva veditabbā.
Similarly, clear comprehension (sampajānatā) in feeling and so forth should be understood in the manner already explained.
Tương tự, chánh niệm (sampajānatā) trong thọ (vedanā) và các uẩn khác cũng phải được hiểu theo cách đã nói.
Ime kho te, ānanda, dhammāti heṭṭhā kathite samathavipassanāmaggaphaladhamme sandhāyāha.
" Ananda, these are those states" refers to the states of Samatha-Vipassanā, Magga, and Phala mentioned previously.
“Này Ānanda, đây là những pháp (dhammā) đó” được nói đến để chỉ các pháp chỉ và quán (samatha-vipassanā), đạo và quả (magga-phala) đã được đề cập ở trên.
Kusalāyatikāti kusalato āgatā.
" Kusalāyatikā" means arisen from wholesome (kusala) states.
Kusalāyatikā (có căn nguyên từ thiện) có nghĩa là đến từ thiện pháp (kusala).
Kusalā hi kusalāpi honti kusalāyatikāpi, seyyathidaṃ, paṭhamajjhānaṃ kusalaṃ, dutiyajjhānaṃ kusalañceva kusalāyatikañca…pe… ākiñcaññāyatanaṃ kusalaṃ, nevasaññānāsaññāyatanaṃ kusalañceva kusalāyatikañca, nevasaññānāsaññāyatanaṃ kusalaṃ, sotāpattimaggo kusalo ceva kusalāyatiko ca…pe… anāgāmimaggo kusalo, arahattamaggo kusalo ceva kusalāyatiko ca.
Indeed, wholesome states can be merely wholesome or also arisen from wholesome states. For example, the first jhāna is wholesome; the second jhāna is both wholesome and arisen from wholesome states... (and so on)... the base of nothingness is wholesome; the base of neither perception nor non-perception is both wholesome and arisen from wholesome states. The base of neither perception nor non-perception is wholesome; the Stream-entry Path is both wholesome and arisen from wholesome states... (and so on)... the Non-return Path is wholesome; the Arahant Path is both wholesome and arisen from wholesome states.
Thiện pháp (kusala) có thể là thiện pháp thuần túy (kusala) hoặc có căn nguyên từ thiện pháp (kusalāyatika). Ví dụ, sơ thiền là thiện pháp; nhị thiền vừa là thiện pháp vừa có căn nguyên từ thiện pháp... (tương tự cho các thiền còn lại)... Không vô sở hữu xứ thiền là thiện pháp; Phi tưởng phi phi tưởng xứ thiền vừa là thiện pháp vừa có căn nguyên từ thiện pháp. Không vô sở hữu xứ thiền là thiện pháp; Sơ quả đạo (Sotāpattimagga) vừa là thiện pháp vừa có căn nguyên từ thiện pháp... (tương tự cho các đạo còn lại)... Đạo Bất lai (Anāgāmimagga) là thiện pháp; Đạo A-la-hán (Arahattamaggo) vừa là thiện pháp vừa có căn nguyên từ thiện pháp.
Tathā paṭhamajjhānaṃ kusalaṃ, taṃsampayuttakā dhammā kusalā ceva kusalāyatikā ca…pe… arahattamaggo kusalo, taṃsampayuttakā dhammā kusalā ceva kusalāyatikā ca.
Similarly, the first jhāna is wholesome; the states associated with it are both wholesome and arisen from wholesome states... (and so on)... the Arahant Path is wholesome; the states associated with it are both wholesome and arisen from wholesome states.
Tương tự, sơ thiền là thiện pháp; các pháp tương ưng với nó vừa là thiện pháp vừa có căn nguyên từ thiện pháp... (tương tự cho các đạo và quả còn lại)... Đạo A-la-hán là thiện pháp; các pháp tương ưng với nó vừa là thiện pháp vừa có căn nguyên từ thiện pháp.
Ariyāti nikkilesā visuddhā.
" Noble" (Ariyā) means stainless, pure.
Ariyā (Thánh) có nghĩa là không có phiền não (nikkilesā), thanh tịnh (visuddhā).
Lokuttarāti loke uttarā visiṭṭhā.
" Supramundane" (Lokuttarā) means superior, excellent in the world.
Lokuttarā (Siêu thế) có nghĩa là vượt trội (uttarā visiṭṭhā) trong thế gian (loke).
Anavakkantā pāpimatāti pāpimantena mārena anokkantā.
" Not encroached upon by Māra" (anavakkantā pāpimatā) means not overcome by the evil one, Māra.
Anavakkantā pāpimatā (không bị kẻ ác xâm phạm) có nghĩa là không bị Māra, kẻ ác, xâm phạm (anokkantā).
Vipassanāpādakā aṭṭha samāpattiyo appetvā nisinnassa hi bhikkhuno cittaṃ māro na passati, ‘‘idaṃ nāma ārammaṇaṃ nissāya saṃvattatī’’ti jātituṃ na sakkoti.
Indeed, Māra cannot see the mind of a bhikkhu who has entered and is abiding in the eight attainments based on Vipassanā; he cannot ascertain, "This mind arises dependent on such and such an object."
Thật vậy, Māra không thể nhìn thấy tâm của vị tỳ khưu đang an trú trong tám thiền định (samāpatti) làm nền tảng cho thiền quán (vipassanā). Māra không thể biết được: "Tâm này phát sinh dựa vào đối tượng (ārammaṇa) nào".
Tasmā ‘‘anavakkantā’’ti vuttaṃ.
Therefore, it is said, "not encroached upon."
Vì vậy, được nói là “anavakkantā”.
Na kho, ānandāti ettha kiñcāpi bhagavatā – ‘‘sutāvudho, bhikkhave, ariyasāvako akusalaṃ pajahati, kusalaṃ bhāveti, sāvajjaṃ pajahati, anavajjaṃ bhāveti, suddhaṃ attānaṃ pariharatī’’ti (a. ni. 7.67) bahussuto pañcāvudhasampanno yodho viya kato.
In "Na kho, Ananda," although the Blessed One said, "Monks, a well-taught noble disciple abandons the unwholesome, cultivates the wholesome; abandons what is blamable, cultivates what is blameless; he protects himself purely," comparing him to a warrior endowed with five weapons, being learned in many scriptures.
“Không, này Ānanda” – Mặc dù Đức Thế Tôn đã nói: “Này các tỳ khưu, một đệ tử cao quý (ariyasāvaka) có học thức (sutāvudho) từ bỏ bất thiện, tu tập thiện, từ bỏ điều đáng trách, tu tập điều không đáng trách, giữ gìn bản thân thanh tịnh” (A.N. 7.67), ví như một chiến binh có học thức và đầy đủ năm loại vũ khí.
Yasmā pana so sutapariyattiṃ uggahetvāpi tadanucchavikaṃ anulomapaṭipadaṃ na paṭipajjati, na tassa taṃ āvudhaṃ hoti.
However, if he, having learned the taught Pariyatti, does not practice the corresponding, appropriate path, that* is not a weapon for him.
Tuy nhiên, vì người đã học được kinh điển (sutapariyatti) nhưng không thực hành theo con đường thuận lợi (anulomapaṭipadā) tương ứng với nó, thì kinh điển đó không phải là vũ khí của người ấy.
Yo paṭipajjati, tasseva hoti.
It is only for him who practices.
Chỉ đối với người thực hành thì nó mới là vũ khí.
Tasmā etadatthaṃ anubandhituṃ nārahatīti dassento na kho, ānandāti āha.
Therefore, to show that one should not follow for that purpose, he said, " Indeed, Ananda, not so."
Vì vậy, để chỉ ra rằng không nên đi theo ý nghĩa đó, Đức Phật nói: “Không, này Ānanda”.
Idāni yadatthaṃ anubandhitabbo, taṃ dassetuṃ yā ca khotiādimāha.
Now, to show for what purpose one should follow, he said, " And indeed," and so forth.
Bây giờ, để chỉ ra mục đích cần phải theo, Đức Phật nói: “Và này Ānanda” và tiếp theo.
Iti imasmiṃ sutte tīsu ṭhānesu dasa kathāvatthūni āgatāni.
Thus, in this Sutta, ten topics of discourse (kathāvatthūni) appear in three places.
Như vậy, trong bài kinh này, mười đề tài đàm luận (kathāvatthūni) đã được đề cập ở ba chỗ.
‘‘Iti evarūpaṃ kathaṃ kathessāmī’’ti sappāyāsappāyavasena āgatāni, ‘‘yadidaṃ suttaṃ geyya’’nti ettha sutapariyattivasena āgatāni, imasmiṃ ṭhāne paripūraṇavasena āgatāni.
They appear in terms of suitability and unsuitability in "I will speak such a discourse"; they appear in terms of learned Pariyatti in "This discourse is to be recited"; and they appear in terms of fulfillment in this passage.
Ở chỗ “Tôi sẽ nói một câu chuyện như thế này”, chúng được đề cập theo cách thích hợp và không thích hợp (sappāya-asappāya). Ở chỗ “Kinh này là một bài kệ”, chúng được đề cập theo cách học kinh điển (sutapariyatti). Ở chỗ này, chúng được đề cập theo cách bổ sung (paripūraṇa).
Tasmā imasmiṃ sutte dasa kathāvatthūni kathentena imasmiṃ ṭhāne ṭhatvā kathetabbāni.
Therefore, when discoursing on the ten topics of discourse in this Sutta, one should do so by standing in this passage.
Vì vậy, khi giảng mười đề tài đàm luận trong bài kinh này, cần phải dựa vào chỗ này mà giảng.
Idāni yasmā ekaccassa ekakassa viharatopi attho na sampajjati, tasmā taṃ sandhāya ekībhāve ādīnavaṃ dassento evaṃ sante kho, ānandātiādimāha.
Now, since for some, even dwelling alone does not bring benefit, therefore, referring to that, to show the danger in solitude, he said, " When it is so, Ananda," and so forth.
Bây giờ, vì đôi khi ngay cả khi sống một mình (ekakassa viharato), mục đích (attha) cũng không thành tựu cho một số người (ekaccassa), cho nên, để chỉ ra sự nguy hiểm (ādīnava) của việc sống một mình (ekībhāve), Đức Phật đã nói: “Này Ānanda, khi điều này là như vậy” và tiếp theo.
Tattha evaṃ santeti evaṃ ekībhāve sante.
There, " when it is so" means when one is alone in this way.
Ở đây, evaṃ sante (khi điều này là như vậy) có nghĩa là khi sống một mình (ekībhāve sante).
193. Satthāti bāhirako titthakarasatthā.
193. " Teacher" (Satthā) refers to an external teacher of another sect.
193. Satthā (Vị Đạo Sư) có nghĩa là vị đạo sư ngoại đạo (bāhirako titthakarasatthā).
Anvāvattantīti anuāvattanti upasaṅkamanti.
" Anvāvattantī" means they follow, they approach.
Anvāvattantī (họ đi theo) có nghĩa là họ đi theo (anuāvattanti), họ đến gần (upasaṅkamanti).
Mucchaṃ kāmayatīti mucchanataṇhaṃ pattheti, pavattetīti attho.
" Desires confusion" (mucchaṃ kāmayatī) means he longs for the craving for requisites, he generates it, is the meaning.
Mucchaṃ kāmayatī (mong muốn sự mê muội) có nghĩa là mong cầu (pattheti) sự tham ái (taṇhā) về sự mê muội (mucchanataṇhaṃ), tức là làm cho nó phát sinh (pavatteti).
Ācariyūpaddavenāti abbhantare uppannena kilesūpaddavena ācariyassupaddavo.
" Teacher's affliction" means the affliction of the teacher by the defilement (kilesa) that has arisen internally.
Ācariyūpaddavenā (do tai họa của đạo sư) có nghĩa là tai họa của đạo sư do phiền não (kilesūpaddava) phát sinh bên trong (abbhantare).
Sesupaddavesupi eseva nayo.
The same applies to the other afflictions.
Đối với các tai họa khác cũng theo cách này.
Avadhiṃsu nanti mārayiṃsu naṃ.
" They did not kill him" (avadhiṃsu naṃ).
Avadhiṃsu naṃ (họ đã giết ông ta) có nghĩa là họ đã giết ông ta (mārayiṃsu naṃ).
Etena hi guṇamaraṇaṃ kathitaṃ.
By this, the death of virtues is stated.
Điều này đã nói về sự mất phẩm hạnh (guṇamaraṇaṃ).
Vinipātāyāti suṭṭhu nipatanāya.
" For ruin" (vinipātāya) means for utter falling.
Vinipātāya (đến sự đọa lạc) có nghĩa là đến sự đọa lạc sâu sắc (suṭṭhu nipatanāya).
Kasmā pana brahmacārupaddavova – ‘‘dukkhavipākataro ca kaṭukavipākataro ca vinipātāya ca saṃvattatī’’ti vuttoti.
Why is it said that only the affliction concerning the holy life (brahmacārupaddavo) "has a more painful result, a more bitter result, and leads to ruin"?
Tại sao tai họa của đời sống phạm hạnh (brahmacārupaddavo) lại được nói là “có quả báo đau khổ hơn, có quả báo cay đắng hơn, và dẫn đến sự đọa lạc”?
Bāhirapabbajjā hi appalābhā, tattha mahanto nibbattetabbaguṇo natthi, aṭṭhasamāpattipañcābhiññāmattakameva hoti.
Indeed, external renunciations (bāhirapabbajjā) yield little gain; there are no great virtues to be produced there, only the eight attainments (samāpattiyo) and five supernormal powers (abhiññā) at most.
Thật vậy, sự xuất gia ngoài giáo pháp (bāhirapabbajjā) có lợi ích ít ỏi (appalābhā), không có phẩm hạnh lớn lao nào cần phải thành tựu ở đó, chỉ có tám thiền định (aṭṭhasamāpatti) và năm thần thông (pañcābhiññā) mà thôi.
Iti yathā gadrabhapiṭṭhito patitassa mahantaṃ dukkhaṃ na hoti, sarīrassa paṃsumakkhanamattameva hoti, evaṃ bāhirasamaye lokiyaguṇamattatova parihāyati, tena purimaṃ upaddavadvayaṃ na evaṃ vuttaṃ.
Thus, just as a person who falls from the back of a donkey does not experience great suffering, but only the smearing of dust on the body, so too, in external systems, one loses only mundane qualities, which is why the two former afflictions (of teacher and pupil) are not described in this way.
Như vậy, giống như người ngã từ lưng lừa không chịu đau khổ lớn lao, chỉ bị dính đầy bụi bẩn trên thân thể, thì cũng vậy, trong các giáo phái bên ngoài, người ta chỉ mất đi những phẩm hạnh thế gian (lokiyaguṇa) mà thôi. Vì vậy, hai tai họa trước đó (tai họa của đạo sư và tai họa của đệ tử) không được nói theo cách này.
Sāsane pana pabbajjā mahālābhā, tattha cattāro maggā cattāri phalāni nibbānanti mahantā adhigantabbaguṇā.
But in the Dispensation, renunciation yields great gain; there are great virtues to be attained: the four Paths, the four Fruitions, and Nibbāna.
Tuy nhiên, sự xuất gia trong giáo pháp (sāsane pabbajjā) có lợi ích lớn lao (mahālābhā), ở đó có bốn đạo (cattāro maggā), bốn quả (cattāri phalāni) và Niết Bàn (Nibbāna) là những phẩm hạnh vĩ đại cần phải thành tựu.
Iti yathā ubhato sujāto khattiyakumāro hatthikkhandhavaragato nagaraṃ anusañcaranto hatthikkhandhato patito mahādukkhaṃ nigacchati, evaṃ sāsanato parihāyamāno navahi lokuttaraguṇehi parihāyati.
Thus, just as a Khattiya prince, well-born on both sides, riding on the back of a noble elephant, traversing the city, experiences great suffering when he falls from the elephant's back, so too, one who declines from the Dispensation loses the nine supramundane qualities.
Như vậy, giống như một hoàng tử Sát-đế-lợi (khattiyakumāro) xuất thân cao quý từ hai phía, khi cưỡi voi đi khắp thành phố mà bị ngã từ lưng voi thì chịu đau khổ lớn lao, thì cũng vậy, người suy đồi khỏi giáo pháp sẽ mất đi chín phẩm hạnh siêu thế (lokuttaraguṇa).
Tenāyaṃ brahmacārupaddavo evaṃ vutto.
Therefore, this affliction concerning the holy life is described in this way.
Vì vậy, tai họa của đời sống phạm hạnh này được nói theo cách đó.
196. Tasmāti yasmā sesupaddavehi brahmacārupaddavo dukkhavipākataro, yasmā vā sapattapaṭipattiṃ vītikkamanto dīgharattaṃ ahitāya dukkhāya saṃvattati, mittapaṭipatti hitāya, tasmā.
196. " Therefore" (tasmā) means: because the affliction concerning the holy life is more painful in its result than other afflictions, or because transgressing the practice of an enemy leads to harm and suffering for a long time, while the practice of a friend leads to benefit; therefore,*.
196. Tasmā (Do đó) có nghĩa là vì tai họa của đời sống phạm hạnh (brahmacārupaddavo) có quả báo đau khổ hơn so với các tai họa khác, hoặc vì người vượt qua sự thực hành của kẻ thù (sapattapaṭipattiṃ vītikkamanto) sẽ phải chịu bất lợi và đau khổ trong thời gian dài, còn sự thực hành của bạn bè (mittapaṭipatti) thì có lợi ích. Do đó.
Evaṃ uparimenapi heṭṭhimenapi atthena yojetabbaṃ.
Thus, it should be connected with both the preceding and the following meanings.
Như vậy, cần phải kết hợp ý nghĩa với cả phần trên và phần dưới.
Mittavatāyāti mittapaṭipattiyā.
" For friendship" (mittavatāyā) means by the practice of a friend.
Mittavatāyā (như bạn bè) có nghĩa là với sự thực hành của bạn bè (mittapaṭipattiyā).
Sapattavatāyāti verapaṭipattiyā.
" For enmity" (sapattavatāyā) means by the practice of an enemy.
Sapattavatāyā (như kẻ thù) có nghĩa là với sự thực hành của kẻ thù (verapaṭipattiyā).
Na vo ahaṃ, ānanda, tathā parakkamissāmīti ahaṃ tumhesu tathā na paṭipajjissāmi.
" Ananda, I will not treat you in that way" means: I will not behave towards you in that manner.
“Này Ānanda, ta sẽ không hành xử với các ông như vậy” có nghĩa là ta sẽ không hành xử với các ông theo cách đó.
Āmaketi apakke.
" Unbaked" (āmake) means unfired.
Āmake (chưa nung) có nghĩa là chưa nung (apakke).
Āmakamatteti āmake nātisukkhe bhājane.
" Just unbaked" (āmakamatte) refers to an unfired, not overly dry pot.
Āmakamatte (trong đồ gốm chưa nung) có nghĩa là trong đồ gốm chưa nung (āmake), chưa khô hoàn toàn (nātisukkhe).
Kumbhakāro hi āmakaṃ nātisukkhaṃ apakkaṃ ubhohi hatthehi saṇhikaṃ gaṇhāti ‘‘mā bhijjatū’’ti.
For a potter holds a raw, not overly dry, unfired pot gently with both hands, thinking, "May it not break."
Thật vậy, người thợ gốm cầm đồ gốm chưa nung, chưa khô hoàn toàn, bằng cả hai tay một cách cẩn thận để “đừng để nó vỡ”.
Iti yathā kumbhakāro tattha paṭipajjati, nāhaṃ tumhesu tathā paṭipajjissāmi.
Thus, just as a potter acts in that way towards them, I will not act towards you in that way.
Như vậy, giống như người thợ gốm hành xử với đồ gốm đó, ta sẽ không hành xử với các ông như vậy.
Niggayha niggayhāti sakiṃ ovaditvā tuṇhī na bhavissāmi, niggaṇhitvā niggaṇhitvā punappunaṃ ovadissāmi anusāsissāmi.
" Again and again reprimanding" (niggayha niggayhā) means I will not admonish you once and then remain silent; I will repeatedly admonish and instruct you, again and again finding fault.
Niggayha niggayhā (trừng phạt hết lần này đến lần khác) có nghĩa là ta sẽ không im lặng sau khi khuyên bảo một lần, mà sẽ trừng phạt và khuyên bảo hết lần này đến lần khác (punappunaṃ ovadissāmi anusāsissāmi).
Pavayha pavayhāti dose pavāhetvā pavāhetvā.
" Again and again pushing away" (pavayha pavayhā) means again and again driving out faults.
Pavayha pavayhā (loại bỏ hết lần này đến lần khác) có nghĩa là loại bỏ (pavāhetvā pavāhetvā) những lỗi lầm.
Yathā pakkabhājanesu kumbhakāro bhinnachinnajajjarāni pavāhetvā ekato katvā supakkāneva ākoṭetvā ākoṭetvā gaṇhāti, evameva ahampi pavāhetvā pavāhetvā punappunaṃ ovadissāmi anusāsissāmi.
Just as a potter, with fired pots, casts aside broken, cracked, and shattered ones, collects the well-fired ones, and taps them again and again to take them, so too will I, again and again driving out faults, admonish and instruct you repeatedly.
Giống như người thợ gốm, trong số những đồ gốm đã nung, loại bỏ những cái vỡ, nứt, hỏng, rồi gom những cái đã nung kỹ lại và gõ từng cái một để chọn, thì cũng vậy, ta sẽ loại bỏ những lỗi lầm và khuyên bảo, giáo huấn các ông hết lần này đến lần khác.
Yo sāro so ṭhassatīti evaṃ vo mayā ovadiyamānānaṃ yo maggaphalasāro, so ṭhassati.
"Whatever is the essence, that will endure"—thus, to you who are being exhorted by me, whatever is the essence of the path and fruit, that will endure.
"Cái tinh túy là cái sẽ còn lại" (Yo sāro so ṭhassatīti) có nghĩa là, khi Ta (Phật) giáo huấn các con như vậy, thì tinh túy là Đạo quả (maggaphalasāro) sẽ còn lại.
Apica lokiyaguṇāpi idha sārotveva adhippetā.
Moreover, worldly qualities are also intended here as the essence.
Hơn nữa, những phẩm chất thế gian (lokiyaguṇā) cũng được xem là tinh túy ở đây.
Sesaṃ sabbattha uttānamevāti.
The rest is clear everywhere.
Phần còn lại đều rõ ràng ở khắp mọi nơi.
197. Evaṃ me sutanti acchariyaabbhutasuttaṃ.
197. Thus have I heard refers to the Acchariyaabbhuta Sutta.
197. Như vầy tôi nghe (Evaṃ me sutaṃ) là Kinh Hy Hữu và Vi Diệu (Acchariyaabbhutasuttaṃ).
Tattha yatra hi nāmāti acchariyatthe nipāto.
Therein, yatra hi nāmā is a particle indicating wonder.
Ở đây, yatra hi nāmā là một từ bất biến (nipāta) mang ý nghĩa kinh ngạc, hy hữu.
Yo nāma tathāgatoti attho.
The meaning here is "who indeed is the Tathāgata."
Có nghĩa là: "Đức Như Lai nào".
Chinnapapañceti ettha papañcā nāma taṇhā māno diṭṭhīti ime tayo kilesā.
In chinnapapañce, the papañcas are these three defilements: craving, conceit, and wrong views.
Trong chinnapapañce, papañca (hý luận) là ba phiền não này: tham ái (taṇhā), kiêu mạn (māna), và tà kiến (diṭṭhī).
Chinnavaṭumeti ettha vaṭumanti kusalākusalakammavaṭṭaṃ vuccati.
In chinnavaṭume, vaṭuma refers to the cycle of wholesome and unwholesome kamma.
Trong chinnavaṭume, vaṭumaṃ được gọi là luân hồi nghiệp (kammavaṭṭa) thiện và bất thiện.
Pariyādinnavaṭṭeti tasseva vevacanaṃ.
Pariyādinnavaṭṭe is a synonym for that very term.
Pariyādinnavaṭṭe là từ đồng nghĩa với từ đó.
Sabbadukkhavītivatteti sabbaṃ vipākavaṭṭasaṅkhātaṃ dukkhaṃ vītivatte.
Sabbadukkhavītivatte means having transcended all suffering, which is the cycle of results.
Sabbadukkhavītivatte là vượt qua tất cả khổ đau, tức là vòng luân hồi quả báo (vipākavaṭṭa).
Anussarissatīti idaṃ yatrāti nipātavasena anāgatavacanaṃ, attho panettha atītavasena veditabbo.
Anussarissatī is a future tense word due to the particle "yatra," but its meaning here should be understood in the past tense.
Anussarissati là một từ ở thì vị lai do từ bất biến yatra mà ra, nhưng ý nghĩa ở đây phải được hiểu theo thì quá khứ.
Bhagavā hi te buddhe anussari, na idāni anussarissati.
For the Blessed One remembered those Buddhas; he will not remember them now.
Vì Đức Thế Tôn đã hồi tưởng về các vị Phật đó, chứ không phải bây giờ mới hồi tưởng.
Evaṃjaccāti vipassīādayo khattiyajaccā, kakusandhādayo brāhmaṇajaccāti.
Evaṃjaccā means that Buddhas like Vipassī were of the warrior caste, and Buddhas like Kakusandha were of the Brahmin caste.
Evaṃjaccā: Các vị Phật như Vipassī thuộc dòng Sát-đế-lợi (khattiyajaccā), các vị Phật như Kakusandha thuộc dòng Bà-la-môn (brāhmaṇajaccā).
Evaṃgottāti vipassīādayo koṇḍaññagottā, kakusandhādayo kassapagottāti.
Evaṃgottā means that Buddhas like Vipassī were of the Koṇḍañña clan, and Buddhas like Kakusandha were of the Kassapa clan.
Evaṃgottā: Các vị Phật như Vipassī thuộc dòng Koṇḍañña, các vị Phật như Kakusandha thuộc dòng Kassapa.
Evaṃsīlāti lokiyalokuttarasīlena evaṃsīlā.
Evaṃsīlā means having such morality, consisting of worldly and supramundane morality.
Evaṃsīlā: Có giới hạnh như vậy bằng giới hạnh thế gian và siêu thế.
Evaṃdhammāti ettha samādhipakkhā dhammā adhippetā.
In evaṃdhammā, the qualities associated with samādhi are intended.
Ở đây, trong evaṃdhammā, các pháp thuộc về định (samādhipakkha) được đề cập.
Lokiyalokuttarena samādhinā evaṃsamādhinoti attho.
The meaning here is "having such samādhi, consisting of worldly and supramundane samādhi."
Có nghĩa là: có định như vậy bằng định thế gian và siêu thế.
Evaṃpaññāti lokiyalokuttarapaññāya evaṃpaññā.
Evaṃpaññā means having such wisdom, consisting of worldly and supramundane wisdom.
Evaṃpaññā: Có trí tuệ như vậy bằng trí tuệ thế gian và siêu thế.
Evaṃvihārīti ettha pana heṭṭhā samādhipakkhānaṃ dhammānaṃ gahitattā vihāro gahitova, puna kasmā gahitameva gaṇhātīti ce, na idaṃ gahitameva.
Now, in evaṃvihārī, since the qualities associated with samādhi were already included below, the abiding (vihāra) is already included. If it is asked why something already included is included again, it is not simply a repetition.
Còn trong evaṃvihārī, nếu hỏi rằng: "Ở dưới đã đề cập đến các pháp thuộc về định, nên sự an trú (vihāra) đã được bao gồm rồi, tại sao lại đề cập đến cái đã được bao gồm nữa?", thì đây không phải là cái đã được bao gồm.
Idañhi nirodhasamāpattidīpanatthaṃ, tasmā evaṃnirodhasamāpattivihārīti ayamettha attho.
For this term is used to explain the attainment of cessation (nirodhasamāpatti). Therefore, the meaning here is "abiding in such attainment of cessation."
Điều này nhằm làm sáng tỏ sự chứng nhập diệt thọ tưởng định (nirodhasamāpatti), vì vậy ý nghĩa ở đây là: "có sự an trú chứng nhập diệt thọ tưởng định như vậy".
Evaṃvimuttāti ettha vikkhambhanavimutti tadaṅgavimutti samucchedavimutti paṭippassaddhivimutti nissaraṇavimuttīti pañcavidhā vimuttiyo.
In evaṃvimuttā, there are five kinds of liberation: suppression-liberation (vikkhambhanavimutti), liberation by substitution of opposites (tadaṅgavimutti), eradication-liberation (samucchedavimutti), tranquilisation-liberation (paṭippassaddhivimutti), and escape-liberation (nissaraṇavimutti).
Trong evaṃvimuttā, có năm loại giải thoát (vimutti): giải thoát ly chướng (vikkhambhanavimutti), giải thoát từng phần (tadaṅgavimutti), giải thoát đoạn diệt (samucchedavimutti), giải thoát an tịnh (paṭippassaddhivimutti), và giải thoát xuất ly (nissaraṇavimutti).
Tattha aṭṭha samāpattiyo sayaṃ vikkhambhitehi nīvaraṇādīhi vimuttattā vikkhambhanavimuttīti saṅkhaṃ gacchanti.
Among these, the eight attainments are called suppression-liberation because they are liberated from hindrances and the like, which are suppressed by oneself.
Trong đó, tám loại thiền chứng (samāpatti) được gọi là giải thoát ly chướng (vikkhambhanavimutti) vì chúng tự giải thoát khỏi các triền cái (nīvaraṇa) và những chướng ngại khác đã bị đẩy lùi.
Aniccānupassanādikā satta anupassanā sayaṃ tassa tassa paccanīkaṅgavasena paricattāhi niccasaññādīhi vimuttattā tadaṅgavimuttīti saṅkhaṃ gacchanti.
The seven kinds of contemplation, such as the contemplation of impermanence, are called liberation by substitution of opposites because they are liberated from perceptions of permanence and the like, which are abandoned by oneself by way of being the opponent factor to each respective hindrance.
Bảy loại quán chiếu (anupassanā) như quán chiếu vô thường (aniccānupassanā) được gọi là giải thoát từng phần (tadaṅgavimutti) vì chúng tự giải thoát khỏi các tưởng thường (niccasaññā) và những tưởng khác đã bị từ bỏ theo cách đối trị từng phần.
Cattāro ariyamaggā sayaṃ samucchinnehi kilesehi vimuttattā samucchedavimuttīti saṅkhaṃ gacchanti.
The four Noble Paths are called eradication-liberation because they are liberated from defilements completely cut off by oneself.
Bốn Thánh Đạo (ariyamagga) được gọi là giải thoát đoạn diệt (samucchedavimutti) vì chúng tự giải thoát khỏi các phiền não đã bị đoạn diệt hoàn toàn.
Cattāri sāmaññaphalāni maggānubhāvena kilesānaṃ paṭippassaddhante uppannattā paṭippassaddhivimuttīti saṅkhaṃ gacchanti.
The four fruits of recluseship are called tranquilisation-liberation because they arise when defilements are tranquillised through the power of the path.
Bốn Sa-môn quả (sāmaññaphala) được gọi là giải thoát an tịnh (paṭippassaddhivimutti) vì chúng sinh khởi khi các phiền não lắng dịu (paṭippassaddhante) nhờ uy lực của Đạo.
Nibbānaṃ sabbakilesehi nissaṭattā apagatattā dūre ṭhitattā nissaraṇavimuttīti saṅkhaṃ gataṃ.
Nibbāna is called escape-liberation because it is completely free from, removed from, and far from all defilements.
Niết-bàn (Nibbāna) được gọi là giải thoát xuất ly (nissaraṇavimutti) vì nó đã thoát ly (nissaṭattā), đã rời bỏ (apagatattā), và ở xa (dūre ṭhitattā) tất cả các phiền não.
Iti imāsaṃ pañcannaṃ vimuttīnaṃ vasena evaṃvimuttāti evamettha attho veditabbo.
Thus, the meaning here, evaṃvimuttā, should be understood in terms of these five kinds of liberation.
Vì vậy, ý nghĩa ở đây là: "được giải thoát như vậy" theo năm loại giải thoát này.
199. Tasmātihāti yasmā tvaṃ ‘‘tathāgatā acchariyā’’ti vadasi, tasmā taṃ bhiyyoso mattāya paṭibhantu tathāgatassa acchariyā abbhutadhammāti.
199. Tasmātihā means, "Since you say, 'Tathāgatas are wonderful,' therefore may the wonderful and astonishing qualities of the Tathāgata manifest themselves to you even more abundantly."
199. Tasmātihā có nghĩa là: "Vì ông nói rằng các Đức Như Lai là những điều hy hữu, nên những pháp hy hữu và vi diệu của Đức Như Lai hãy hiện rõ hơn nữa trong trí tuệ của ông."
Sato sampajānoti ettha dvesampajaññāni manussaloke devaloke ca.
In sato sampajāno, there are two kinds of clear comprehension: in the human world and in the deva world.
Trong sato sampajāno (có niệm và tỉnh giác), có hai loại tỉnh giác (sampajañña) ở cõi người và cõi trời.
Tattha vessantarajātake brāhmaṇassa dve putte datvā punadivase sakkassa deviṃ datvā sakkena pasīditvā dinne aṭṭha vare gaṇhanto –
In the Vessantara Jātaka, King Vessantara, after giving his two children to the Brahmin and on the next day giving Queen Maddī to Sakka, and when Sakka was pleased and offered him eight boons, took a boon saying:
Trong đó, trong câu chuyện Jātaka về Vessantara, sau khi bố thí hai người con cho vị Bà-la-môn và ngày hôm sau lại bố thí hoàng hậu Maddī cho Sakka, khi Sakka hoan hỷ ban cho tám điều ước, Đức Vessantara đã nhận một điều ước rằng:
Kiṃ pana sesadevatā na jānantīti?
Do other devas not know?
Vậy các vị chư thiên khác có biết không?
No na jānanti.
No, they do not know in the same way.
Không, họ không biết.
Tā pana uyyānavimānakapparukkhe oloketvā devanāṭakehi tūriyasaddena pabodhitā ‘‘mārisa ayaṃ devaloko tumhe idha nibbattā’’ti sāritā jānanti.
But they, upon seeing their pleasure gardens, mansions, and wish-granting trees, and being awakened by the sound of divine music from the celestial dancers, and being reminded, "Noble ones, this is the deva world; you have been reborn here," they come to know.
Họ chỉ biết khi nhìn thấy các khu vườn, cung điện, cây như ý (kapparukkha), và được đánh thức bởi tiếng nhạc của các tiên nữ, được nhắc nhở rằng: "Thưa quý vị, đây là cõi trời, quý vị đã tái sinh ở đây."
Bodhisatto paṭhamajavanavāre na jānāti, dutiyajavanato paṭṭhāya jānāti.
The Bodhisatta does not know in the first impulsion (javana) moment, but he knows from the second impulsion moment onwards.
Bồ-tát không biết trong khoảnh khắc tốc hành tâm đầu tiên, nhưng biết từ khoảnh khắc tốc hành tâm thứ hai trở đi.
Iccassa aññehi asādhāraṇajānanaṃ hoti.
Thus, his knowing is extraordinary compared to others.
Vì vậy, sự hiểu biết này của Ngài là không chung với những người khác.
Aṭṭhāsīti ettha kiñcāpi aññepi devā tattha ṭhitā ṭhitamhāti jānanti, te pana chasu dvāresu balavatā iṭṭhārammaṇena abhibhuyyamānā satiṃ vissajjetvā attano bhuttapītabhāvampi ajānantā āhārūpacchedena kālaṃ karonti.
In aṭṭhāsī, although other devas also know, "We are abiding here," they are overwhelmed by powerful and desirable sense objects at the six doors, lose their mindfulness, and pass away without even knowing their own eating and drinking, by the cessation of food.
Trong aṭṭhāsī, mặc dù các vị chư thiên khác cũng biết rằng họ đang ở đó, nhưng họ bị áp đảo bởi các đối tượng khả ái mạnh mẽ ở sáu căn môn, mất đi sự tỉnh giác, không biết cả việc mình đã ăn uống gì, và chết đi do thức ăn bị cắt đứt.
Bodhisattassa kiṃ tathārūpaṃ ārammaṇaṃ natthīti?
Does the Bodhisatta not have such sense objects?
Vậy Bồ-tát không có đối tượng như vậy sao?
No natthi.
No, it is not that he does not have them.
Không, không phải không có.
So hi sesadeve dasahi ṭhānehi adhiggaṇhāti, ārammaṇena pana attānaṃ maddituṃ na deti, taṃ ārammaṇaṃ abhibhavitvā tiṭṭhati.
For he surpasses other devas in ten ways, but he does not allow sense objects to crush him; he overcomes those sense objects and abides.
Ngài vượt trội các vị chư thiên khác ở mười phương diện, và không để đối tượng áp đảo mình; Ngài vượt qua đối tượng đó và an trú.
Tena vuttaṃ – ‘‘sato sampajāno, ānanda, bodhisatto tusite kāye aṭṭhāsī’’ti.
Therefore, it was said: "Mindful and clearly comprehending, Ānanda, the Bodhisatta abode in the Tusita realm."
Vì vậy, đã nói rằng: "Này Ānanda, Bồ-tát an trú trong thân ở cõi Tusita với niệm và tỉnh giác."
200. Yāvatāyukanti sesattabhāvesu kiṃ yāvatāyukaṃ na tiṭṭhattīti?
200. Yāvatāyukaṃ – in other existences, does he not abide for the full lifespan?
200. Yāvatāyukaṃ: Vậy trong các kiếp sống khác, Ngài không an trú trọn tuổi thọ sao?
Āma na tiṭṭhati.
Indeed, he does not.
Vâng, không an trú trọn tuổi thọ.
Aññadā hi dīghāyukadevaloke nibbatto tattha pāramiyo na sakkā pūretunti akkhīni nimīletvā adhimuttikālaṃkiriyaṃ nāma katvā manussaloke nibbattati.
For at other times, being reborn in a deva world with a long lifespan, if the perfections (pāramī) cannot be fulfilled there, he closes his eyes and performs what is called "death by decision" (adhimuttikālaṃkiriyaṃ), and is reborn in the human world.
Vì trong những kiếp khác, khi tái sinh vào cõi trời có tuổi thọ dài, Ngài nhận thấy không thể hoàn thành các Ba-la-mật ở đó, nên Ngài nhắm mắt lại, thực hiện một cái chết có ý định (adhimuttikālaṃkiriyaṃ) và tái sinh vào cõi người.
Ayaṃ kālaṅkiriyā aññesaṃ na hoti.
This kind of passing away does not occur to others.
Cái chết như vậy không xảy ra với những người khác.
Tadā pana adinnadānaṃ nāma natthi, arakkhitasīlaṃ nāma natthi, sabbapāramīnaṃ pūritattā yāvatāyukaṃ aṭṭhāsi.
However, at that time, there was no giving undone, no morality unguarded; because all perfections were fulfilled, he abode for the full lifespan.
Tuy nhiên, lúc đó, không có bố thí nào chưa được thực hiện, không có giới nào chưa được giữ, vì tất cả các Ba-la-mật đã được hoàn thành, nên Ngài đã an trú trọn tuổi thọ.
Sato sampajāno tusitā kāyā cavitvā mātukucchiṃ okkamatīti evaṃ tāva sabbapāramiyo pūretvā tadā bodhisatto yāvatāyukaṃ aṭṭhāsi.
Mindful and clearly comprehending, having passed away from the Tusita realm, he entered his mother's womb. Thus, having fulfilled all perfections, the Bodhisatta abode for the full lifespan at that time.
Sato sampajāno tusitā kāyā cavitvā mātukucchiṃ okkamatī (Với niệm và tỉnh giác, Bồ-tát từ thân ở cõi Tusita chuyển sinh vào bụng mẹ): Như vậy, sau khi hoàn thành tất cả các Ba-la-mật, Bồ-tát đã an trú trọn tuổi thọ ở cõi Tusita.
Devatānaṃ pana – ‘‘manussagaṇanāvasena idāni sattahi divasehi cuti bhavissatī’’ti pañca pubbanimittāni uppajjanti – mālā milāyanti, vatthāni kilissanti, kacchehi sedā muccanti, kāye dubbaṇṇiyaṃ okkamati, devo devāsane na saṇṭhāti.
However, to devas, five prior signs appear when it is time to say, "Now, according to human reckoning, in seven days, the passing away will occur": their garlands wilt, their garments become soiled, sweat issues from their armpits, their body becomes discolored, and the deva is restless on his divine couch.
Tuy nhiên, đối với các vị chư thiên, năm dấu hiệu báo trước (pubbanimitta) cái chết sẽ xảy ra trong bảy ngày theo cách tính của loài người xuất hiện: vòng hoa héo tàn, y phục dơ bẩn, mồ hôi chảy ra từ nách, thân thể trở nên xấu xí, và vị chư thiên không còn an trú trên thiên cung của mình.
Tattha mālāti paṭisandhiggahaṇadivase piḷandhanamālā.
Therein, mālā refers to the garlands worn on the day of conception.
Trong đó, mālā là vòng hoa được đeo vào ngày tái sinh.
Tā kira saṭṭhisatasahassādhikā sattapaṇṇāsa-vassakoṭiyo amilāyitvā tadā milāyanti.
Those garlands, which had not withered for fifty-seven crores plus sixty lakhs of years, then wilt.
Những vòng hoa đó, sau sáu mươi vạn năm và năm mươi bảy triệu năm không héo tàn, thì lúc đó chúng héo tàn.
Vatthesupi eseva nayo.
The same principle applies to garments.
Điều tương tự cũng áp dụng cho y phục.
Ettakaṃ pana kālaṃ devānaṃ neva sītaṃ na uṇhaṃ hoti, tasmiṃ kāle sarīrato bindubinduvasena sedā muccanti.
For this long period, devas experience neither cold nor heat, but at that time, sweat issues from their bodies in drops.
Trong suốt thời gian dài đó, các vị chư thiên không cảm thấy lạnh hay nóng, nhưng vào lúc đó, mồ hôi chảy ra từng giọt từ thân thể họ.
Ettakañca kālaṃ tesaṃ sarīre khaṇḍiccapāliccādivasena vivaṇṇatā na paññāyati, devadhītā soḷasavassuddesikā viya, devaputtā vīsativassuddesikā viya khāyanti.
And for this long period, no discoloration appears on their bodies, such as broken teeth or wrinkled skin; devis appear like sixteen-year-olds, and devas appear like twenty-year-olds.
Trong suốt thời gian dài đó, thân thể của họ không biểu hiện sự xấu xí (vivaṇṇatā) như răng sứt hay tóc bạc; các nữ thần trông như thiếu nữ mười sáu tuổi, và các nam thần trông như thanh niên hai mươi tuổi.
Maraṇakāle pana nesaṃ kilantarūpo attabhāvo hoti.
But at the time of death, their bodies appear exhausted.
Nhưng vào lúc chết, thân thể của họ trở nên mệt mỏi.
Ettakañca nesaṃ kālaṃ devaloke ukkaṇṭhitā nāma natthi, maraṇakāle pana nissasanti vijambhanti, sake āsane nābhiramanti.
For such a long time, there is no such thing as being "discontented" in the deva world for them; but at the time of death, they sigh, they stretch, and they do not delight in their own seats.
Trong suốt thời gian đó, chư thiên không hề cảm thấy chán nản ở cõi trời; nhưng đến lúc lâm chung, họ thở dài, ngáp dài, và không còn hoan hỷ trên chỗ ngồi của mình nữa.
Imāni pana pubbanimittāni, yathā loke mahāpuññānaṃ rājarājamahāmattādīnaṃyeva ukkāpātabhūmicālacandaggāhādīni nimittāni paññāyanti, na sabbesaṃ, evameva mahesakkhānaṃ devatānaṃyeva paññāyanti, na sabbesaṃ.
Just as these five premonitory signs, such as meteors falling, earthquakes, and lunar eclipses, appear only to those in the world who are greatly meritorious, like kings, royal ministers, and so forth, and not to all; even so, they appear only to powerful deities, not to all.
Những điềm báo trước này, cũng như ở đời, các điềm báo như sao băng, động đất, nhật thực, nguyệt thực... chỉ xuất hiện đối với những người có đại phước như vua chúa, đại thần, v.v., chứ không phải đối với tất cả mọi người; cũng vậy, chúng chỉ xuất hiện đối với các vị thiên nhân có đại uy đức, chứ không phải đối với tất cả mọi vị.
Yathā ca manussesu pubbanimittāni nakkhattapāṭhakādayova jānanti, na sabbe, evameva tānipi sabbe devā na jānanti, paṇḍitā eva pana jānanti.
And just as among humans, only astrologers and the like know these premonitory signs, not everyone; even so, not all deities know them, but only the wise ones.
Và cũng như trong loài người, chỉ có các nhà chiêm tinh, v.v., mới biết các điềm báo trước, chứ không phải tất cả mọi người; cũng vậy, không phải tất cả chư thiên đều biết những điềm báo đó, mà chỉ có những vị trí giả mới biết.
Tattha ye ca mandena kusalakammena nibbattā devaputtā, te tesu uppannesu – ‘‘idāni ko jānāti, kuhiṃ nibbattissāmā’’ti bhāyanti.
Among those deities, those devaputtas who were born due to weak wholesome kamma, when those signs arise, are afraid, thinking: "Now, who knows where we will be reborn?"
Trong số đó, những vị thiên tử được tái sinh do nghiệp thiện yếu kém, khi những điềm báo đó xuất hiện, họ sợ hãi mà rằng: “Bây giờ ai biết được chúng ta sẽ tái sinh ở đâu?”
Ye mahāpuññā, te – ‘‘amhehi dinnaṃ dānaṃ rakkhitaṃ sīlaṃ bhāvitaṃ bhāvanaṃ āgamma uparidevalokesu sampattiṃ anubhavissāmā’’ti na bhāyanti.
But those who are greatly meritorious are not afraid, thinking: "Having relied on the generosity we have given, the virtue we have observed, and the mental development we have practiced, we shall experience happiness in the higher deva realms."
Những vị có đại phước thì không sợ hãi mà rằng: “Nhờ vào bố thí, trì giới và tu tập mà chúng ta đã thực hành, chúng ta sẽ hưởng thụ sự an lạc ở các cõi trời cao hơn.”
Bodhisattopi tāni pubbanimittāni disvā ‘‘idāni anantare attabhāve buddho bhavissāmī’’ti na bhāyi.
The Bodhisatta, too, seeing those premonitory signs, was not afraid, thinking: "Now, in my next existence, I shall become a Buddha."
Bồ Tát cũng không sợ hãi khi thấy những điềm báo trước đó, mà nghĩ: “Bây giờ, trong kiếp sống kế tiếp, ta sẽ thành Phật.”
Athassa tesu nimittesu pātubhūtesu dasasahassacakkavāḷadevatā sannipatitvā – ‘‘mārisa tumhehi dasa pāramiyo pūrentehi na sakkasampattiṃ na mārabrahmacakkavattisampattiṃ patthentehi pūritā, lokanittharaṇatthāya pana buddhattaṃ patthayamānehi pūritā.
Then, when those signs appeared, the deities of the ten-thousand world-systems assembled and entreated him, saying: "Venerable sir, you fulfilled the ten Pāramīs, not aspiring to the sovereignty of Sakka, nor the sovereignty of Māra, Brahma, or a Universal Monarch; rather, you fulfilled them aspiring to Buddhahood for the liberation of the world.
Sau đó, khi những điềm báo đó xuất hiện, chư thiên từ mười ngàn thế giới đã tập hợp lại và thỉnh cầu: “Bạch Đại đức, Đại đức đã viên mãn mười ba-la-mật không phải vì mong cầu sự an lạc của Sakka hay sự an lạc của Chuyển Luân Thánh Vương, mà Đại đức đã viên mãn chúng vì mong cầu Phật quả để giải thoát chúng sinh khỏi thế gian.
So vo idāni kālo mārisa buddhattāya, samayo mārisa buddhattāyā’’ti yācanti.
Now is the time, Venerable sir, for your Buddhahood; it is the proper season, Venerable sir, for your Buddhahood."
Bạch Đại đức, đây là thời điểm thích hợp để Đại đức thành Phật, đây là cơ hội thích hợp để Đại đức thành Phật.”
Atha mahāsatto devatānaṃ paṭiññaṃ adatvāva kāladīpadesakulajanettiāyuparicchedavasena pañcamahāvilokanaṃ nāma vilokesi.
Then the Great Being, without giving a promise to the deities, made the Five Great Observations (pañcamahāvilokanaṃ), which are: observing the time, the continent, the region, the family, and the lifespan of the mother.
Sau đó, Đại Bồ Tát, không chấp nhận lời thỉnh cầu của chư thiên ngay lập tức, đã quán xét Ngũ Đại Quán Sát (Pañcamahāvilokanaṃ) liên quan đến thời gian, châu lục, xứ sở, dòng tộc và tuổi thọ của mẹ.
Tattha ‘‘kālo nu kho, na kālo’’ti paṭhamaṃ kālaṃ vilokesi.
First, he observed the time, thinking: "Is this the right time, or is it not the right time?"
Trong đó, trước tiên Ngài quán xét thời gian: “Bây giờ là lúc thích hợp hay không thích hợp?”
Tattha vassasatasahassato uddhaṃ vaḍḍhitaāyukālo kālo nāma na hoti.
In this regard, a time when the lifespan is greater than one hundred thousand years is not the right time.
Trong đó, thời gian mà tuổi thọ của chúng sinh kéo dài hơn một trăm ngàn năm thì không phải là thời điểm thích hợp.
Tadā hi sattānaṃ jātijarāmaraṇāni na paññāyanti, buddhānañca dhammadesanā nāma tilakkhaṇamuttā natthi, tesaṃ aniccaṃ dukkhaṃ anattāti kathentānaṃ ‘‘kiṃ nāmetaṃ kathentī’’ti neva sotuṃ na saddhātuṃ maññanti, tato abhisamayo na hoti, tasmiṃ asati aniyyānikaṃ sāsanaṃ hoti.
Because at that time, beings do not perceive birth, aging, and death, and the Buddhas' teaching is never without the three characteristics. When they teach impermanence, suffering, and non-self, beings neither think of listening nor believing, and thus there is no realization. Without that, the Dispensation is not liberating.
Bởi vì vào thời điểm đó, sự sinh, già, chết của chúng sinh không rõ ràng. Và giáo pháp của chư Phật không vượt ngoài tam tướng (anicca, dukkha, anattā). Khi chư Phật thuyết giảng về vô thường, khổ, vô ngã, chúng sinh không nghĩ đến việc lắng nghe hay tin tưởng, do đó không có sự chứng ngộ. Nếu không có sự chứng ngộ, giáo pháp sẽ không đưa đến giải thoát.
Tasmā so akālo.
Therefore, that is not the right time.
Vì vậy, đó là thời điểm không thích hợp.
Vassasatato ūnaāyukālopi kālo nāma na hoti.
A time when the lifespan is less than one hundred years is also not the right time.
Thời gian mà tuổi thọ của chúng sinh dưới một trăm năm cũng không phải là thời điểm thích hợp.
Tadā hi sattā ussannakilesā honti, ussannakilesānañca dinnovādo ovādaṭṭhāne na tiṭṭhati.
Because at that time, beings are overwhelmed with defilements, and advice given to those overwhelmed with defilements does not remain in the place of instruction.
Bởi vì vào thời điểm đó, chúng sinh có nhiều phiền não. Và lời giáo huấn được ban cho những người có nhiều phiền não sẽ không lưu lại trong tâm trí.
Udake daṇḍarāji viya khippaṃ vigacchati.
It quickly vanishes, like a line drawn on water.
Nó nhanh chóng biến mất như vết gạch trên mặt nước.
Tasmā sopi akālo.
Therefore, that too is not the right time.
Vì vậy, đó cũng là thời điểm không thích hợp.
Satasahassato pana paṭṭhāya heṭṭhā vassasatato paṭṭhāya uddhaṃ āyukālo kālo nāma.
However, a lifespan starting from one hundred thousand years downwards, and upwards from one hundred years, is considered the right time.
Tuy nhiên, thời gian mà tuổi thọ của chúng sinh từ một trăm ngàn năm trở xuống và từ một trăm năm trở lên thì là thời điểm thích hợp.
Tadā ca vassasatakālo hoti.
And at that time, the lifespan was one hundred years.
Và vào thời điểm đó, tuổi thọ của chúng sinh là một trăm năm.
Atha mahāsatto ‘‘nibbattitabbakālo’’ti kālaṃ passi.
Then the Great Being perceived the time as "the time for birth."
Sau đó, Đại Bồ Tát thấy rằng: “Đây là thời điểm thích hợp để tái sinh.”
Tato – ‘‘jambudīpo nāma mahā, dasayojanasahassaparimāṇo, katarasmiṃ nu kho padese buddhā nibbattantī’’ti desaṃ vilokento majjhimadesaṃ passi.
Then, thinking: "Jambudīpa is vast, ten thousand yojanas in extent. In which particular region are Buddhas born?" and observing the region, he saw the Middle Country.
Sau đó, Ngài quán xét xứ sở mà rằng: “Châu Jambudīpa rộng lớn, có chu vi mười ngàn dojana, vậy chư Phật tái sinh ở vùng nào?” Ngài thấy xứ Trung Ấn (Majjhimadesa).
Majjhimadeso nāma ‘‘puratthimāya disāya gajaṅgalaṃ nāma nigamo’’tiādinā nayena vinaye (mahāva. 259) vuttova.
The Middle Country is as described in the Vinaya, beginning with "to the east is the market town called Gajaṅgala."
Xứ Trung Ấn là vùng đã được Đức Phật đề cập trong Luật tạng theo cách nói: “Về phía đông là thị trấn tên Gajaṅgala,” v.v.
So pana āyāmato tīṇi yojanasatāni.
Its length is three hundred yojanas.
Vùng đó có chiều dài ba trăm dojana.
Vitthārato aḍḍhatiyāni, parikkhepato navayojanasatānīti.
Its width is two hundred and fifty, and its circumference is nine hundred yojanas.
Chiều rộng hai trăm rưỡi dojana, và chu vi chín trăm dojana.
Etasmiñhi padese cattāri aṭṭha soḷasa vā asaṅkhyeyyāni, kappasatasahassañca pāramiyo pūretvā sammāsambuddhā uppajjanti.
In this region, Sammāsambuddhas, having fulfilled the Pāramīs for four or eight or sixteen Asaṅkheyyas and one hundred thousand kappas, arise.
Ở xứ sở này, các vị Chánh Đẳng Giác xuất hiện sau khi viên mãn ba-la-mật trong bốn, tám hoặc mười sáu a-tăng-kỳ và một trăm ngàn đại kiếp.
Dve asaṅkhyeyyāni, kappasatasahassañca pāramiyo pūretvā paccekabuddhā uppajjanti, ekaṃ asaṅkhyeyyaṃ, kappasatasahassañca pāramiyo pūretvā sāriputtamoggallānādayo mahāsāvakā uppajjanti, catunnaṃ mahādīpānaṃ dvisahassānaṃ parittadīpānañca issariyādhipaccakārakacakkavattirājāno uppajjanti, aññe ca mahesakkhā khattiyabrāhmaṇagahapatimahāsālā uppajjanti.
Paccekabuddhas, having fulfilled the Pāramīs for two Asaṅkheyyas and one hundred thousand kappas, arise; great disciples like Sāriputta and Moggallāna, having fulfilled the Pāramīs for one Asaṅkheyya and one hundred thousand kappas, arise; Universal Monarchs, who are masters and rulers of the four great continents and two thousand small islands, arise; and other powerful Khattiyas, Brāhmaṇas, and wealthy householders arise.
Các vị Độc Giác Phật xuất hiện sau khi viên mãn ba-la-mật trong hai a-tăng-kỳ và một trăm ngàn đại kiếp; các vị Đại Thanh Văn như Sāriputta và Moggallāna, v.v., xuất hiện sau khi viên mãn ba-la-mật trong một a-tăng-kỳ và một trăm ngàn đại kiếp; các vị Chuyển Luân Thánh Vương cai trị bốn đại châu và hai ngàn tiểu châu xuất hiện; và các vị đại phú gia thuộc dòng Sát-đế-lợi, Bà-la-môn, Gia chủ có đại uy đức khác cũng xuất hiện.
Idañcettha kapilavatthu nāma nagaraṃ, tattha mayā nibbattitabbanti niṭṭhamagamāsi.
And here, the city named Kapilavatthu exists; it was decided that "I shall be born there."
Và ở đây, có một thành phố tên là Kapilavatthu, nơi mà ta sẽ tái sinh – điều đó đã được quyết định.
Iti imaṃ pañcamahāvilokanaṃ viloketvā – ‘‘kālo me mārisā buddhabhāvāyā’’ti devatānaṃ saṅgahaṃ karonto paṭiññaṃ datvā ‘‘gacchatha tumhe’’ti tā devatā uyyojetvā tusitadevatāhi parivuto tusitapure nandanavanaṃ pāvisi.
Thus, having made these Five Great Observations, and extending his compassion to the deities, he gave his promise, saying: "It is my time for Buddhahood, Venerable sirs!" Then, dismissing those deities, he entered the Nandanavana garden in Tusita city, surrounded by the Tusita deities.
Như vậy, sau khi quán xét Ngũ Đại Quán Sát này, Ngài nói với chư thiên: “Bạch Đại đức, đã đến lúc ta thành Phật.” Ngài chấp nhận lời thỉnh cầu của chư thiên, từ biệt họ và cùng với chư thiên cõi Tusita, Ngài đi vào khu vườn Nandanavana trong thành Tusita.
Sabbadevalokesu hi nandanavanaṃ atthiyeva.
Indeed, Nandanavana gardens exist in all deva realms.
Thật vậy, ở tất cả các cõi trời đều có khu vườn Nandanavana.
Tattha naṃ devatā – ‘‘ito cuto sugatiṃ gaccha, ito cuto sugatiṃ gacchā’’ti pubbekatakusalakammokāsaṃ sārayamānā vicaranti.
There, the deities, reminding him of the opportunities for wholesome kamma he had accumulated in the past, moved about saying: "Having departed from here, go to a good destination! Having departed from here, go to a good destination!"
Ở đó, chư thiên đi lại và nhắc nhở Ngài về nghiệp thiện đã tạo trong quá khứ: “Từ đây, sau khi chết, hãy đi đến thiện thú! Từ đây, sau khi chết, hãy đi đến thiện thú!”
So evaṃ devatāhi kusalaṃ sārayamānāhi parivuto tattha vicarantova cavi.
Thus, surrounded by deities who were reminding him of his wholesome kamma, he passed away while still moving about there.
Được chư thiên nhắc nhở về nghiệp thiện như vậy, Ngài đã chết ngay khi đang đi lại ở đó.
Evaṃ cuto cavāmīti pajānāti, cuticittaṃ na jānāti.
He knows, "I am passing away," but he does not know the passing consciousness. Even after taking rebirth, he does not know the rebirth consciousness, but he knows, "I have taken rebirth in this place."
Khi chết như vậy, Ngài biết rằng mình đang chết, nhưng không biết tâm tử.
Paṭisandhiṃ gahetvāpi paṭisandhicittaṃ na jānāti, imasmiṃ me ṭhāne paṭisandhi gahitāti evaṃ pana jānāti.
Even after taking rebirth, he does not know the rebirth consciousness, but he knows: "I have taken rebirth in this place."
Ngay cả sau khi tái tục, Ngài cũng không biết tâm tái tục, nhưng Ngài biết rằng mình đã tái tục ở nơi này.
Keci pana therā ‘‘āvajjanapariyāyo nāma laddhuṃ vaṭṭati, dutiyatatiyacittavāreyeva jānissatī’’ti vadanti.
However, some elders say: "It is appropriate for the turn of adverting consciousness to occur; he will know it in the second or third moment of consciousness."
Một số vị trưởng lão nói: “Có một giai đoạn quán xét, Ngài sẽ biết trong lần tâm thứ hai hoặc thứ ba.”
Tipiṭakamahāsīvatthero panāha – ‘‘mahāsattānaṃ paṭisandhi na aññesaṃ paṭisandhisadisā, koṭippattaṃ tesaṃ satisampajaññaṃ.
But Tipiṭakamahāsīvatthero said: "The rebirth of Great Beings is not like the rebirth of others; their mindfulness and clear comprehension are supreme.
Tuy nhiên, Đại Trưởng lão Tipiṭaka Mahāsīva đã nói: “Sự tái tục của các Đại Bồ Tát không giống như sự tái tục của những người khác, chánh niệm và tỉnh giác của các Ngài đã đạt đến đỉnh cao.
Yasmā pana teneva cittena taṃ cittaṃ ñātuṃ na sakkā, tasmā cuticittaṃ na jānāti.
However, since it is not possible to know that consciousness with the same consciousness, he does not know the passing consciousness.
Tuy nhiên, vì không thể biết tâm đó bằng chính tâm đó, nên Ngài không biết tâm tử.
Cutikkhaṇepi cavāmīti pajānāti, paṭisandhiṃ gahetvāpi paṭisandhicittaṃ na jānāti, asukasmiṃ ṭhāne paṭisandhi gahitāti pajānāti, tasmiṃ kāle dasasahassī kampatī’’ti.
Even at the moment of passing away, he knows 'I am passing away'; and even after taking rebirth, he does not know the rebirth consciousness, but he knows 'I have taken rebirth in such and such a place.' At that time, the ten-thousand world-system shakes."
Ngay cả vào khoảnh khắc chết, Ngài biết mình đang chết, và sau khi tái tục, Ngài không biết tâm tái tục, nhưng Ngài biết rằng mình đã tái tục ở nơi nào đó. Vào thời điểm đó, mười ngàn thế giới rung chuyển.”
Evaṃ sato sampajāno mātukucchiṃ okkamanto pana ekūnavīsatiyā paṭisandhicittesu mettāpubbabhāgassa somanassa-sahagata-ñāṇasampayutta-asaṅkhārika-kusalacittassa sadisamahāvipākacittena paṭisandhiṃ gaṇhi.
Thus, mindful and clearly comprehending, the Bodhisatta entered his mother's womb, taking rebirth with a great resultant consciousness similar to a wholesome consciousness accompanied by joy, associated with knowledge, and unprompted, which had loving-kindness as its forerunner, among the nineteen rebirth consciousnesses.
Khi nhập vào thai mẹ với chánh niệm và tỉnh giác như vậy, Ngài đã tái tục bằng một tâm đại quả tương tự như tâm thiện vô hành tương ưng với trí tuệ và hỷ lạc, có từ bi làm tiền phần, trong số mười chín tâm tái tục.
Mahāsīvatthero pana ‘‘upekkhāsahagatenā’’ti āha.
However, Mahāsīvatthero said: "with equanimity-accompanied (consciousness)."
Tuy nhiên, Đại Trưởng lão Mahāsīva nói: “Bằng tâm xả thọ tương ưng.”
Paṭisandhiṃ gaṇhanto pana āsāḷhīpuṇṇamāyaṃ uttarāsāḷhanakkhattena aggahesi.
He took rebirth on the full moon day of Āsāḷhī, under the Uttarāsāḷha constellation.
Ngài đã tái tục vào ngày trăng tròn tháng Āsāḷha, dưới chòm sao Uttarāsāḷha.
Tadā kira mahāmāyā pure puṇṇamāya sattamadivasato paṭṭhāya vigatasurāpānaṃ mālāgandhavibhūsanasampannaṃ nakkhattakīḷaṃ anubhavamānā sattame divase pāto vuṭṭhāya gandhodakena nhāyitvā sabbālaṅkāravibhūsitā varabhojanaṃ bhuñjitvā uposathaṅgāni adhiṭṭhāya sirīgabbhaṃ pavisitvā sirīsayane nipannā niddaṃ okkamamānā idaṃ supinaṃ addasa – ‘‘cattāro kira naṃ mahārājāno sayaneneva saddhiṃ ukkhipitvā anotattadahaṃ netvā ekamantaṃ aṭṭhaṃsu.
Then, Queen Mahāmāyā, having abstained from intoxicating drinks since the seventh day before the full moon and having enjoyed the festival adorned with garlands, perfumes, and ornaments, on the full moon day of Āsāḷha, early in the morning, rose, bathed with scented water, adorned herself with all ornaments, ate excellent food, undertook the Uposatha vows, entered her splendid chamber, lay down on a magnificent couch, and as she was falling asleep, she had this dream: "It seems that four Great Kings lifted her together with her couch, carried her to Lake Anotatta, and stood aside.
Bấy giờ, nghe nói, Đại Ma-da (Mahāmāyā) từ bảy ngày trước ngày trăng tròn, đã không uống rượu, vui hưởng lễ hội với vòng hoa, hương thơm và đồ trang sức. Đến ngày thứ bảy, bà dậy sớm, tắm nước thơm, trang sức đầy đủ, dùng bữa ăn thịnh soạn, thọ trì các giới Bát quan trai, rồi vào cung điện, nằm trên giường quý, khi chìm vào giấc ngủ, bà thấy giấc mơ này – “Nghe nói, bốn vị Đại Thiên vương đã nhấc bà cùng với chiếc giường, đưa đến hồ Anotatta và đứng sang một bên.
Atha nesaṃ deviyo āgantvā manussamalaharaṇatthaṃ nhāpetvā dibbavatthaṃ nivāsetvā gandhehi vilimpetvā dibbapupphāni piḷandhitvā tato avidūre rajatapabbato, tassa anto kanakavimānaṃ atthi, tasmiṃ pācīnato sīsaṃ katvā nipajjāpesuṃ.
Then their goddesses came, bathed her to remove human impurities, dressed her in divine garments, anointed her with perfumes, adorned her with divine flowers, and then, not far from there, there was a silver mountain, and within it, a golden palace. They laid her down in it with her head towards the east.
Sau đó, các vị thiên nữ của họ đến, tắm rửa cho bà để tẩy trừ uế tạp của loài người, mặc cho bà y phục trời, xoa dầu thơm và đeo hoa trời. Cách đó không xa có một núi bạc, bên trong có một cung điện vàng; họ đặt bà nằm trong đó, đầu hướng về phía đông.
Atha bodhisatto setavaravāraṇo hutvā tato avidūre eko suvaṇṇapabbato, tattha caritvā tato oruyha rajatapabbataṃ abhiruhitvā uttaradisato āgamma kanakavimānaṃ pavisitvā mātaraṃ padakkhiṇaṃ katvā dakkhiṇapassaṃ phāletvā kucchiṃ paviṭṭhasadiso ahosi.
Then the Bodhisatta, having become a white, excellent elephant, there was a golden mountain not far from that silver mountain; having roamed there, he descended from it, ascended the silver mountain, came from the north, entered the golden palace, circumambulated his mother, and appeared as if he had pierced her right side and entered her womb.
Sau đó, Bồ-tát hóa thành một con voi trắng tuyệt đẹp, từ đó không xa có một núi vàng, Ngài đi lại ở đó, rồi từ đó xuống, leo lên núi bạc, từ hướng bắc đến, vào cung điện vàng, nhiễu bên phải mẹ, rồi như thể xuyên qua hông phải mà vào bụng mẹ.
Atha pabuddhā devī taṃ supinaṃ rañño ārocesi.
Then, the awakened queen reported that dream to the king.
Sau đó, vị thiên nữ thức dậy và kể giấc mơ đó cho nhà vua.
Rājā pabhātāya rattiyā catusaṭṭhimatte brāhmaṇapāmokkhe pakkosāpetvā haritūpalittāya lājādīhi katamaṅgalasakkārāya bhūmiyā mahārahāni āsanāni paññāpetvā tattha nisinnānaṃ brāhmaṇānaṃ sappimadhusakkarābhisaṅkhārassa varapāyāsassa suvaṇṇarajatapātiyo pūretvā suvaṇṇarajatapātītiheva paṭikujjitvā adāsi, aññehi ca ahatavatthakapilagāvīdānādīhi te santappesi.
At dawn, the king summoned sixty-four prominent brahmins, had excellent seats prepared for them on ground plastered with fresh cow-dung and sanctified with parched rice and other auspicious offerings, and for those brahmins seated there, he filled golden and silver bowls with excellent milk-rice prepared with ghee, honey, and sugar, and presented it to them, covered with golden and silver lids. He also satisfied them with other gifts such as new cloths and red cows.
Đức vua, khi màn đêm tan, cho triệu tập sáu mươi bốn vị Bà-la-môn đứng đầu, trải những chỗ ngồi cao quý trên nền đất đã được trét bằng phân bò tươi và trang hoàng bằng các lễ vật như cốm rang, rồi dâng cho các vị Bà-la-môn đang ngồi đó những bát vàng, bát bạc đầy món cháo sữa quý được chế biến bằng bơ, mật ong và đường, và đậy lại bằng chính những bát vàng, bát bạc đó. Ngài còn làm cho họ hài lòng bằng những lễ vật khác như y phục mới chưa cắt, bò cái Kapila, v.v.
Atha nesaṃ sabbakāmasantappitānaṃ supinaṃ ārocāpetvā – ‘‘kiṃ bhavissatī’’ti pucchi.
Then, after satisfying all their desires, he had the dream recounted to them and asked, "What will be its outcome?"
Sau đó, khi đã làm cho họ hài lòng với mọi thứ mong muốn, Ngài kể giấc mơ cho họ nghe và hỏi: “Điều gì sẽ xảy ra?”
Brāhmaṇā āhaṃsu – ‘‘mā cintayi mahārāja, deviyā te kucchimhi gabbho patiṭṭhito, so ca kho purisagabbho, na itthigabbho, putto te bhavissati.
The brahmins said, "Do not worry, Great King. A conception has occurred in your queen's womb. And this is a male conception, not a female. A son will be born to you.
Các vị Bà-la-môn nói: “Đại vương đừng lo lắng, trong bụng hoàng hậu đã có thai, đó là thai nam, không phải thai nữ, con trai của ngài sẽ ra đời.
So sace agāraṃ ajjhāvasissati, rājā bhavissati cakkavattī.
If he lives in the household, he will become a Universal Monarch.
Nếu vị ấy sống đời tại gia, sẽ trở thành Chuyển Luân Thánh Vương.
Sace agārā nikkhamma pabbajissati, buddho bhavissati loke vivaṭṭacchado’’ti.
If he leaves home and goes forth, he will become a Buddha in the world, one who has removed the covering of rebirth."
Nếu vị ấy xuất gia, sẽ trở thành Đức Phật, Đấng vén màn phiền não trong thế gian.”
Evaṃ sato sampajāno bodhisatto tusitakāyā cavitvā mātukucchiṃ okkamati.
Thus, mindful and fully aware, the Bodhisatta passed away from the Tusita realm and entered his mother's womb.
Như vậy, với đầy đủ niệm và tỉnh giác, Bồ-tát từ cõi trời Tusita giáng xuống bụng mẹ.
‘‘Catasso imā, bhante, gabbhāvakkantiyo.
"Venerable Sir, there are these four types of conception.
“Bạch Thế Tôn, có bốn cách nhập thai này.
Idha, bhante, ekacco asampajāno mātukucchiṃ okkamati, asampajāno mātukucchismiṃ ṭhāti, asampajāno mātukucchimhā nikkhamati, ayaṃ paṭhamā gabbhāvakkanti.
Here, Venerable Sir, some person enters the mother's womb without full awareness, stays in the mother's womb without full awareness, and comes forth from the mother's womb without full awareness. This is the first type of conception.
Ở đây, bạch Thế Tôn, có người nhập thai không tỉnh giác, ở trong bụng mẹ không tỉnh giác, và ra khỏi bụng mẹ không tỉnh giác. Đây là cách nhập thai thứ nhất.
Etāsu paṭhamā lokiyamanussānaṃ hoti, dutiyā asītimahāsāvakānaṃ, tatiyā dvinnaṃ aggasāvakānaṃ paccekabodhisattānañca.
Of these, the first is for ordinary human beings, the second for the eighty great disciples, and the third for the two chief disciples and Paccekabuddhas.
Trong số đó, cách thứ nhất là của những người phàm tục; cách thứ hai là của tám mươi vị Đại Thanh văn; cách thứ ba là của hai vị Thượng thủ Thanh văn và các vị Độc Giác Phật.
Te kira kammajavātehi uddhaṃpādā adhosirā anekasataporise papāte viya yonimukhe tāḷacchiggalena hatthī viya ativiya sambādhena yonimukhena nikkhamamānā anantaṃ dukkhaṃ pāpuṇanti.
For they, as it were, fall headfirst with their feet upwards due to kamma-born winds, like falling down an abyss of hundreds of human heights, and emerge through the narrow opening of the womb like an elephant through a palmyra tree's broken trunk, experiencing immense suffering.
Nghe nói, những vị này, do nghiệp lực của gió nghiệp, bị lộn đầu xuống chân lên trên, như rơi xuống vực sâu hàng trăm tầm, và ra khỏi cửa tử cung chật hẹp như voi chui qua lỗ chốt cửa, phải chịu vô vàn khổ đau.
Tena nesaṃ ‘‘mayaṃ nikkhamāmā’’ti sampajānatā na hoti.
Therefore, they do not have the full awareness, "We are coming forth."
Vì vậy, họ không có sự tỉnh giác rằng “chúng ta đang ra đời”.
Catutthā sabbaññubodhisattānaṃ.
The fourth is for the All-Knowing Bodhisattas.
Cách thứ tư là của các vị Bồ-tát Toàn Giác.
Te hi mātukucchismiṃ paṭisandhiṃ gaṇhantāpi jānanti, tattha vasantāpi jānanti.
For they know even as they conceive in their mother's womb, and they know while residing there.
Thật vậy, khi thọ sanh trong bụng mẹ, các Ngài biết; khi ở trong đó, các Ngài cũng biết.
Nikkhamanakālepi nesaṃ kammajavātā uddhaṃpāde adhosire katvā khipituṃ na sakkonti, dve hatthe pasāretvā akkhīni ummīletvā ṭhitakāva nikkhamanti.
Even at the time of coming forth, the kamma-born winds cannot throw them out headfirst with feet upwards; they emerge standing, stretching out their two hands and opening their eyes.
Vào lúc ra đời, gió nghiệp cũng không thể khiến các Ngài lộn đầu xuống chân lên trên, mà các Ngài ra đời trong tư thế đứng, duỗi hai tay và mở mắt.
201. Mātukucchiṃ okkamatīti ettha mātukucchiṃ okkanto hotīti attho.
201. In " Mātukucchiṃ okkamati" (enters the mother's womb), the meaning is "he has entered the mother's womb."
201. Mātukucchiṃ okkamati (nhập vào bụng mẹ) ở đây có nghĩa là đã nhập vào bụng mẹ.
Okkante hi tasmiṃ evaṃ hoti, na okkamamāne.
For such awareness occurs when he has entered, not while he is entering.
Khi Ngài đã nhập vào, thì mới có sự tỉnh giác như vậy, chứ không phải trong lúc đang nhập.
Appamāṇoti buddhappamāṇo, vipuloti attho.
" Appamāṇo" means "immeasurable like the Buddha," that is, vast.
Appamāṇo (vô lượng) có nghĩa là vô lượng như Phật, tức là rộng lớn.
Uḷāroti tasseva vevacanaṃ.
" Uḷāro" is a synonym for that same word.
Uḷāro (vi diệu) là từ đồng nghĩa với từ đó.
Devānubhāvanti ettha devānaṃ ayamānubhāvo – nivatthavatthassa pabhā dvādasa yojanāni pharati, tathā sarīrassa, tathā alaṅkārassa, tathā vimānassa, taṃ atikkamitvāti attho.
In " Devānubhāvaṃ" (divine power), this is the power of devas: the radiance of their clothes extends twelve yojanas, similarly for their bodies, similarly for their ornaments, similarly for their mansions; it means "surpassing that."
Devānubhāva (oai lực chư thiên) ở đây, oai lực của chư thiên là: ánh sáng của y phục đã mặc tỏa xa mười hai dojana, cũng như ánh sáng của thân thể, của trang sức, và của cung điện. Nghĩa là vượt qua điều đó.
Lokantarikāti tiṇṇaṃ tiṇṇaṃ cakkavāḷānaṃ antarā ekeko lokantarikā hoti, tiṇṇaṃ sakaṭacakkānaṃ pattānaṃ vā aññamaññaṃ āhacca ṭhapitānaṃ majjhe okāso viya.
" Lokantarikā" refers to the space between every three cakkavāḷas, like the space between three cart-wheels or alms-bowls placed touching each other.
Lokantarikā (giữa các thế giới) là khoảng không gian giữa ba cõi luân hồi, giống như khoảng trống giữa ba bánh xe bò hoặc ba cái bát được đặt kề nhau.
So pana lokantarikanirayo parimāṇato aṭṭhayojanasahasso hoti.
This Lokantarika hell has a size of eight thousand yojanas.
Địa ngục Lokantarika đó có kích thước tám ngàn dojana.
Aghāti niccavivaṭā.
" Aghā" means constantly open.
Aghā (không có cửa) có nghĩa là luôn luôn mở toang.
Asaṃvutāti heṭṭhāpi appatiṭṭhā.
" Asaṃvutā" means unobstructed even below, without support.
Asaṃvutā (không có che chắn) có nghĩa là không có nền tảng ở phía dưới.
Andhakārāti tamabhūtā.
" Andhakārā" means filled with darkness.
Andhakārā (tối tăm) có nghĩa là hoàn toàn tối tăm.
Andhakāratimisāti cakkhuviññāṇuppattinivāraṇato andhabhāvakaraṇatimisena samannāgatā.
" Andhakāratimisā" means endowed with darkness that causes blindness, preventing the arising of eye-consciousness.
Andhakāratimisā (tối tăm mù mịt) có nghĩa là bị bao phủ bởi bóng tối khiến thị giác không thể phát sinh.
Tattha kira cakkhuviññāṇaṃ na jāyati.
For it is said that eye-consciousness does not arise there.
Nghe nói, ở đó, nhãn thức không thể phát sinh.
Evaṃmahiddhikāti candimasūriyā kira ekappahāreneva tīsu dīpesu paññāyanti, evaṃmahiddhikā.
" Evaṃmahiddhikā" refers to the sun and moon, which appear simultaneously on three continents, possessing such great power.
Evaṃmahiddhikā (có đại thần lực như vậy) có nghĩa là mặt trăng và mặt trời có thần lực lớn đến mức chúng có thể xuất hiện đồng thời trên cả ba châu lục.
Ekekāya disāya navanavayojanasatasahassāni andhakāraṃ vidhamitvā ālokaṃ dassenti, evaṃ mahānubhāvā.
They dispel darkness for nine hundred thousand yojanas in each direction and bring light, possessing such great influence.
Chúng có oai lực lớn đến mức có thể xua tan bóng tối và chiếu sáng hàng chín trăm ngàn dojana về mỗi hướng.
Ābhāya nānubhontīti attano pabhāya nappahonti.
" Ābhāya nānubhontī" means they cannot extend their own light.
Ābhāya nānubhontī (không thể chiếu sáng bằng ánh sáng của mình) có nghĩa là không thể chiếu sáng bằng ánh sáng của chính mình.
Te kira cakkavāḷapabbatassa vemajjhena caranti, cakkavāḷapabbatañca atikkamma lokantarikanirayo, tasmā te tattha ābhāya nappahonti.
For the sun and moon travel in the middle of the Cakkavāḷa mountain, and beyond the Cakkavāḷa mountain is the Lokantarika hell; therefore, they cannot extend their light there.
Nghe nói, mặt trăng và mặt trời di chuyển ở giữa núi Cakkavāḷa, và địa ngục Lokantarika nằm vượt qua núi Cakkavāḷa, do đó chúng không thể chiếu sáng đến đó bằng ánh sáng của mình.
Yepi tattha sattāti yepi tasmiṃ lokantaramahāniraye sattā upapannā.
" Yepi tattha sattā" means "and those beings who are reborn in that great Lokantarika hell."
Yepi tattha sattā (những chúng sanh ở đó) có nghĩa là những chúng sanh nào đã tái sanh trong đại địa ngục Lokantara đó.
Kiṃ pana kammaṃ katvā te tattha uppajjantīti?
What kind of kamma did they perform to be reborn there?
Vậy thì, do làm nghiệp gì mà chúng sanh đó tái sanh ở đó?
Bhāriyaṃ dāruṇaṃ mātāpitūnaṃ dhammikasamaṇabrāhmaṇānañca upari aparādhaṃ aññañca divase divase pāṇavadhādisāhasikakammaṃ katvā uppajjanti tambapaṇṇidīpe abhayacoranāgacorādayo viya.
They are reborn after committing grave and cruel offenses against their parents and righteous ascetics and brahmins, and other daily violent acts such as killing living beings, like the bandits Abhayacora and Nāgacora in Tambapaṇṇidīpa (Sri Lanka).
Chúng tái sanh ở đó do đã phạm những lỗi lầm nặng nề, tàn ác đối với cha mẹ, các vị Sa-môn, Bà-la-môn chân chính, và do đã làm những hành động bạo lực khác như sát sanh mỗi ngày, giống như những tên cướp Abhayacora, Nāgacora, v.v. ở đảo Tambapaṇṇī.
Tesaṃ attabhāvo tigāvutiko hoti, vaggulīnaṃ viya dīghanakhā honti.
Their body is three gāvutas (about 7.5 miles) in size, and their nails are long like those of bats.
Thân thể của chúng dài ba gāvuta, và chúng có những móng vuốt dài như dơi.
Te rukkhe vagguliyo viya nakhehi cakkavāḷapāde lagganti.
They cling to the base of the cakkavāḷa mountain with their nails, like bats on a tree.
Chúng bám vào chân núi Cakkavāḷa bằng móng vuốt, giống như dơi bám vào cây.
Yadā pana saṃsappantā aññamaññassa hatthapāsaṃ gatā honti, atha ‘‘bhakkho no laddho’’ti maññamānā tattha vāvaṭā viparivattitvā lokasandhārakaudake patanti.
However, when they crawl and come within reach of each other, thinking "we have found prey," they become agitated there, turn over, and fall into the water that supports the world.
Tuy nhiên, khi chúng bò đến và nằm trong tầm tay của nhau, chúng nghĩ rằng “chúng ta đã tìm thấy thức ăn”, rồi chúng cố gắng bắt lấy nhau, lăn lộn và rơi xuống nước nâng đỡ thế giới.
Vāte paharante madhukaphalāni viya chijjitvā udake patanti.
When struck by the wind, they break apart like madhuka fruits and fall into the water.
Khi gió thổi mạnh, chúng bị xé ra như quả madhuka và rơi xuống nước.
Patitamattā ca accantakhāre udake piṭṭhapiṇḍi viya vilīyanti.
And having just fallen, they utterly dissolve in the exceedingly cool water, like a ball of flour.
Và khi vừa rơi xuống, họ tan rã như một cục bột trong nước cực kỳ mặn.
Aññepi kira bho santi sattāti – ‘‘yathā mayaṃ mahādukkhaṃ anubhavāma, evaṃ aññepi kira sattā idaṃ dukkhaṃ anubhavantā idhūpapannā’’ti taṃ divasaṃ passanti.
Are there, good sirs, other beings? On that day, they see, thinking: ‘‘As we experience great suffering, so too, it seems, other beings, experiencing this suffering, are reborn here in this Lokantarika hell.”
“ Thưa quý vị, hình như còn có những chúng sinh khác nữa” – “Như chúng ta đang chịu đựng khổ đau lớn lao, thì hình như cũng có những chúng sinh khác đang chịu đựng khổ đau này mà sinh vào đây” – họ thấy điều đó vào ngày hôm ấy.
Ayaṃ pana obhāso ekayāgupānamattampi na tiṭṭhati, yāvatā niddāyitvā pabuddho ārammaṇaṃ vibhāveti, tattakaṃ kālaṃ hoti.
This radiance, however, does not last even for the time it takes to drink one gulp of gruel; it lasts only for the time it takes for a person who has woken up from sleep to grasp an object.
Tuy nhiên, ánh sáng này không tồn tại lâu bằng một ngụm cháo, mà chỉ tồn tại trong khoảng thời gian một người thức dậy sau giấc ngủ và nhận biết đối tượng.
Dīghabhāṇakā pana ‘‘accharāsaṅghāṭamattameva vijjubhāso viya niccharitvā kiṃ idanti bhaṇantānaṃyeva antaradhāyatī’’ti vadanti.
But the Dīghabhāṇakas say, “It flashes forth like lightning for only the duration of a finger snap, and then vanishes even as they exclaim, ‘What is this?’”
Nhưng các Dīghabhāṇaka (người tụng đọc Trường Bộ Kinh) nói rằng: “Nó chỉ lóe lên như tia chớp trong khoảnh khắc một cái búng tay, và biến mất ngay khi họ đang nói ‘cái gì đây?’”.
Saṅkampatīti samantato kampati.
Saṅkampati means trembles all around.
Saṅkampatī (rung động) nghĩa là rung chuyển khắp nơi.
Itaradvayaṃ purimapasseva vevacanaṃ.
The other two are synonyms, as in the previous section.
Hai từ còn lại là từ đồng nghĩa của từ phía trước.
Puna appamāṇo cātiādi nigamanatthaṃ vuttaṃ.
Again, appamāṇo ca and so forth were stated for the purpose of conclusion.
Lại nữa, câu appamāṇo cātiādi (và vô lượng, v.v.) được nói ra với mục đích kết luận.
202. Cattāro devaputtā catuddisaṃ ārakkhāya upagacchantīti ettha cattāroti catunnaṃ mahārājūnaṃ vasena vuttaṃ, dasasahassacakkavāḷe pana cattāro cattāro katvā cattālīsadasasahassā honti.
In “The four devaputtas come for protection from the four directions”, the word “four” is said with reference to the four Great Kings. However, in ten thousand world-systems, there are forty thousand Great Kings, calculating four by four.
Trong câu cattāro devaputtā catuddisaṃ ārakkhāya upagacchantī (bốn vị thiên tử từ bốn phương đến để bảo vệ), từ cattāro (bốn) được nói đến theo nghĩa bốn vị Đại Thiên Vương; nhưng trong mười ngàn thế giới, mỗi thế giới có bốn vị, nên có bốn mươi ngàn vị Đại Thiên Vương.
Tattha imasmiṃ cakkavāḷe mahārājāno khaggahatthā āgantvā bodhisattassa ārakkhaṇatthāya upagantvā sirīgabbhaṃ paviṭṭhā, itare gabbhadvārato paṭṭhāya avaruddhapaṃsupisācakādiyakkhagaṇe paṭikkamāpetvā yāva cakkavāḷā ārakkhaṃ gaṇhiṃsu.
Among them, the Great Kings in this world-system came with swords in hand, entered the splendid chamber to protect the Bodhisatta. The others, from the door of the chamber, drove away the host of disagreeable dust-ghouls and pisācas, and so forth, and took up protection as far as the world-system’s boundary.
Trong đó, ở thế giới này, các vị Đại Thiên Vương cầm kiếm đến để bảo vệ Bồ Tát, rồi đi vào cung điện vinh quang; còn các vị khác thì từ cửa cung điện trở đi, xua đuổi các nhóm Dạ Xoa như Pāṃsupisāca đã bị cấm đoán, và thực hiện việc bảo vệ cho đến tận rìa thế giới.
Kimatthaṃ panāyaṃ rakkhā āgatā?
Why then did this protection come?
Vậy tại sao sự bảo vệ này lại đến?
Nanu paṭisandhikkhaṇe kalalakālato paṭṭhāya sacepi koṭisatasahassā mārā koṭisatasahassaṃ sineruṃ ukkhipitvā bodhisattassa vā bodhisattamātuyā vā antarāyakaraṇatthaṃ āgaccheyyuṃ, sabbe antarāva antaradhāyeyyuṃ.
Surely, from the moment of conception, from the kalala stage onwards, even if hundreds of thousands of Māras were to come lifting hundreds of thousands of Meru mountains to cause harm to the Bodhisatta or the Bodhisatta’s mother, they would all vanish on the way.
Chẳng phải từ lúc còn là kalala (hợp thể) vào khoảnh khắc tái sinh, dù cho hàng trăm ngàn vạn Ma vương đến, nâng hàng trăm ngàn vạn núi Sineru lên để gây trở ngại cho Bồ Tát hoặc mẹ của Bồ Tát, thì tất cả đều sẽ biến mất giữa chừng sao?
Vuttampi cetaṃ bhagavatā ruhiruppādavatthusmiṃ – ‘‘aṭṭhānametaṃ, bhikkhave, anavakāso, yaṃ parūpakkamena tathāgataṃ jīvitā voropeyya.
This was also said by the Blessed One in the matter of the causing of blood: “It is impossible, bhikkhus, there is no opportunity for a Tathāgata to be deprived of life by another’s assault.
Điều này cũng đã được Đức Thế Tôn nói trong câu chuyện về sự chảy máu: “Này các Tỳ khưu, điều đó là không thể, không có cơ hội để một vị Như Lai bị tước đoạt sự sống bởi sự tấn công của người khác.
Anupakkamena, bhikkhave, tathāgatā parinibbāyanti.
Tathāgatas, bhikkhus, attain Parinibbāna without external assault.
Này các Tỳ khưu, các vị Như Lai nhập Niết Bàn mà không bị tấn công.
Gacchatha tumhe, bhikkhave, yathāvihāraṃ, arakkhiyā, bhikkhave, tathāgatā’’ti (cūḷava. 341).
Go, bhikkhus, to your respective dwelling places, Tathāgatas are unprotectable” (cūḷava. 341).
Này các Tỳ khưu, các ông hãy đi về trú xứ của mình, này các Tỳ khưu, các vị Như Lai không cần được bảo vệ” (Cūḷava. 341).
Evametaṃ, na parūpakkamena tesaṃ jīvitantarāyo atthi.
So it is: there is no danger to their lives through the assault of others.
Đúng là như vậy, không có sự nguy hiểm đến tính mạng của họ do sự tấn công của người khác.
Santi kho pana amanussā virūpā duddasikā, bheravarupā pakkhino, yesaṃ rūpaṃ disvā saddaṃ vā sutvā bodhisattamātu bhayaṃ vā santāso vā uppajjeyya, tesaṃ nivāraṇatthāya rakkhaṃ aggahesuṃ.
But there are non-human beings of ugly and terrifying forms, and birds of dreadful appearance, by seeing whose forms or hearing whose sounds, fear or terror might arise in the Bodhisatta’s mother. It was to prevent these that they undertook protection.
Tuy nhiên, có những phi nhân hình dạng xấu xí, khó nhìn, những loài chim có hình dạng đáng sợ, mà khi thấy hình dạng hoặc nghe tiếng của chúng, mẹ của Bồ Tát có thể sinh ra sợ hãi hoặc kinh hoàng; các vị thiên tử đã bảo vệ để ngăn chặn điều đó.
Apica kho bodhisattassa puññatejena sañjātagāravā attano gāravacoditāpi te evamakaṃsu.
Moreover, impelled by the reverence that arose from the power of the Bodhisatta’s merit, they acted in this way due to their own reverence.
Hơn nữa, do oai lực phước đức của Bồ Tát, các vị ấy cũng đã làm như vậy vì lòng tôn kính đã phát sinh và được thúc đẩy bởi sự tôn kính của chính mình.
Kiṃ pana te antogabbhaṃ pavisitvā ṭhitā cattāro mahārājāno bodhisattamātuyā attānaṃ dassenti na dassentīti?
Do those four Great Kings who have entered and remained inside the chamber show themselves to the Bodhisatta’s mother or not?
Vậy bốn vị Đại Thiên Vương đã vào trong cung điện có hiển lộ thân mình cho mẹ của Bồ Tát thấy hay không?
Nahānamaṇḍanabhojanādisarīrakiccakāle na dassenti, sirīgabbhaṃ pavisitvā varasayane nipannakāle pana dassenti.
They do not show themselves during bodily functions such as bathing, adorning, and eating, but they do show themselves when she has entered the splendid chamber and is lying on the excellent couch.
Họ không hiển lộ thân mình trong lúc tắm rửa, trang điểm, ăn uống và các hoạt động thể chất khác; nhưng khi vào cung điện vinh quang và nằm trên giường quý, họ hiển lộ thân mình.
Tattha kiñcāpi amanussadassanaṃ nāma manussānaṃ sappaṭibhayaṃ hoti, bodhisattamātā pana attano ceva puttassa ca puññānubhāvena te disvā na bhāyati, pakatiantepurapālakesu viya assā tesu cittaṃ uppajjati.
Although the sight of non-human beings is frightening to humans, the Bodhisatta’s mother, by the power of her own and her son’s merits, sees them without fear; her mind becomes like it would towards ordinary palace guards.
Mặc dù việc nhìn thấy phi nhân thường gây sợ hãi cho con người, nhưng mẹ của Bồ Tát, nhờ oai lực phước đức của chính mình và của con trai, đã nhìn thấy họ mà không sợ hãi, tâm bà đối với họ giống như đối với những người bảo vệ nội cung bình thường.
203. Pakatiyā sīlavatīti sabhāveneva sīlasampannā.
203. Pakatiyā sīlavatī means naturally endowed with virtue.
203. Pakatiyā sīlavatī (tự nhiên có giới đức) nghĩa là tự bản chất đã đầy đủ giới đức.
Anuppanne kira buddhe manussā tāpasaparibbājakānaṃ santike vanditvā ukkuṭikaṃ nisīditvā sīlaṃ gaṇhanti, bodhisattamātāpi kāladevilassa isino santike gaṇhāti.
Before the Buddha appeared, people would, after saluting ascetics and wanderers, sit squatting and undertake the precepts from them; the Bodhisatta’s mother also undertook them from the sage Kāḷadevilā.
Người ta nói rằng, trước khi Đức Phật xuất hiện, con người đến chỗ các đạo sĩ, du sĩ để đảnh lễ, ngồi xổm và thọ giới; mẹ của Bồ Tát cũng thọ giới từ đạo sĩ Kāladevila.
Bodhisatte pana kucchigate aññassa pādamūle nisīdituṃ nāma na sakkā, samāsane nisīditvā gahitasīlampi avaññā kāraṇamattaṃ hoti.
But when the Bodhisatta was in her womb, it was not possible for her to sit at the feet of another, and even undertaking precepts while sitting on the same seat would be a cause for disrespect.
Nhưng khi Bồ Tát đã nhập thai, thì không thể ngồi dưới chân người khác, và việc thọ giới khi ngồi ngang hàng cũng chỉ là một sự coi thường.
Tasmā sayameva sīlaṃ aggahesīti vuttaṃ hoti.
Therefore, it is said that she herself undertook the precepts.
Vì vậy, điều đó có nghĩa là bà tự mình thọ giới.
Purisesūti bodhisattassa pitaraṃ ādiṃ katvā kesuci manussesu purisādhippāyacittaṃ nuppajjati.
In men: beginning with the Bodhisatta’s father, a mind with sensual intentions does not arise towards any men.
Purisesu (đối với nam giới) nghĩa là không có tâm ý muốn nam giới đối với bất kỳ người nào, bắt đầu từ cha của Bồ Tát.
Tañca kho bodhisatte gāravena, na pahīnakilesatāya.
And that is out of reverence for the Bodhisatta, not because defilements have been abandoned.
Điều này là do sự tôn kính đối với Bồ Tát, chứ không phải do các phiền não đã được đoạn trừ.
Bodhisattamātu rūpaṃ pana sukusalāpi sippikā potthakammādīsupi kātuṃ na sakkonti, taṃ disvā purisassa rāgo nuppajjatīti na sakkā vattuṃ.
However, even very skilled artists cannot reproduce the Bodhisatta’s mother’s form in painting or other crafts, and it cannot be said that seeing her form does not arouse passion in a man.
Tuy nhiên, hình dáng của mẹ Bồ Tát thì ngay cả những nghệ nhân khéo léo nhất cũng không thể tạo ra trong các tác phẩm điêu khắc, hội họa, v.v. Không thể nói rằng nam giới nhìn thấy bà mà không phát sinh tham ái.
Sace pana taṃ rattacitto upasaṅkamitukāmo hoti, pādā na vahanti, dibbasaṅkhalikā viya bajjhanti.
But if a man, with a passionate mind, wishes to approach her, his feet cannot carry him; they become bound as if by divine chains.
Nhưng nếu một người đàn ông có tâm tham ái muốn đến gần bà, thì chân anh ta sẽ không thể bước đi, như thể bị trói bằng xiềng xích của chư thiên.
Tasmā ‘‘anatikkamanīyā’’tiādi vuttaṃ.
Therefore, “anatikkamanīyā” (unassailable) and so forth were stated.
Vì vậy, câu “không thể vượt qua” (anatikkamanīyā) v.v. đã được nói.
Pañcannaṃ kāmaguṇānanti pubbe ‘‘kāmaguṇūpasaṃhita’’nti purisādhippāyavasena vatthupaṭikkhepo kathito, idha ārammaṇappaṭilābho dassito.
Of the five strands of sensuality: previously, the rejection of the object was spoken of as "associated with sensuality" in terms of male intention; here, the acquisition of sense objects is shown.
Pañcannaṃ kāmaguṇānaṃ (năm dục lạc): Trước đây, từ “kāmaguṇūpasaṃhita” (liên quan đến dục lạc) đã được nói để bác bỏ đối tượng theo ý muốn của nam giới; ở đây, sự thọ nhận đối tượng được chỉ ra.
Tadā kira ‘‘deviyā evarūpo putto kucchismiṃ uppanno’’ti, sutvā samantato rājāno mahagghaābharaṇatūriyādivasena pañcadvārārammaṇavatthubhūtaṃ paṇṇākāraṃ pesenti, bodhisattassa ca bodhisattamātuyā ca katakammassa ussannattā lābhasakkārassa pamāṇaparicchedo nāma natthi.
At that time, hearing, “Such a son has been conceived in the queen’s womb,” kings from all directions sent offerings consisting of exceedingly valuable ornaments, musical instruments, and so forth, which are objects of the five sense doors; and due to the abundance of the merits accumulated by the Bodhisatta and the Bodhisatta’s mother, there was no measure or limit to the gains and homage.
Vào thời điểm đó, khi nghe nói “một người con trai như vậy đã sinh ra trong bụng hoàng hậu”, các vị vua từ khắp nơi đã gửi tặng phẩm là những vật phẩm làm đối tượng cho năm giác quan, như trang sức quý giá, nhạc cụ, v.v. Do công đức dồi dào của Bồ Tát và mẹ Bồ Tát, lợi lộc và sự tôn kính là vô cùng vô tận.
204. Akilantakāyāti yathā aññā itthiyo gabbhabhārena kilamanti, hatthapādā uddhumātakādīni pāpuṇanti, na evaṃ tassā koci kilamatho ahosi.
204. Akilantakāyā means that she experienced no fatigue, unlike other women who become tired from the burden of pregnancy, and whose hands and feet swell and so forth.
204. Akilantakāyā (thân thể không mệt mỏi) nghĩa là bà không hề có sự mệt mỏi nào do thai nghén, như những phụ nữ khác thường mệt mỏi, tay chân sưng phù, v.v.
Tirokucchigatanti antokucchigataṃ.
Tirokucchigataṃ means “inside the womb”.
Tirokucchigataṃ (ở trong bụng) nghĩa là ở bên trong bụng.
Kalalādikālaṃ atikkamitvā sañjātaaṅgapaccaṅgaṃ ahīnindriyabhāvaṃ upagataṃyeva passati.
She sees him only when he has passed the kalala stage and so forth, and his limbs and minor parts have developed, and his faculties are complete.
Sau khi vượt qua giai đoạn kalala (hợp thể) v.v., bà thấy Bồ Tát đã có đủ các chi thể và các căn không bị khiếm khuyết.
Kimatthaṃ passati?
Why does she see him?
Tại sao bà thấy?
Sukhavāsatthaṃ.
For a comfortable dwelling.
Để sống an lạc.
Yatheva hi mātā puttena saddhiṃ nisinnā vā nipannā vā ‘‘hatthaṃ vā pādaṃ vā olambantaṃ ukkhipitvā saṇṭhapessāmī’’ti sukhavāsatthaṃ puttaṃ oloketi, evaṃ bodhisattamātāpi yaṃ taṃ mātu uṭṭhānagamanaparivattananisajjādīsu uṇhasītaloṇikatittakakaṭukāhāraajjhoharaṇakālesu ca gabbhassa dukkhaṃ uppajjati, atthi nu kho me taṃ puttassāti sukhavāsatthaṃ bodhisattaṃ olokayamānā pallaṅkaṃ ābhujitvā nisinnaṃ bodhisattaṃ passati.
Just as a mother, sitting or lying with her son, looks at him for comfortable dwelling, thinking, “I will lift and arrange his hanging hand or foot,” so too the Bodhisatta’s mother, while observing the Bodhisatta to ensure he is not suffering any discomfort in the womb during her standing, walking, turning, sitting, and other movements, or when she consumes hot, cold, salty, bitter, or pungent foods, sees the Bodhisatta sitting cross-legged.
Cũng như người mẹ ngồi hay nằm với con trai, nhìn con để sống an lạc, nghĩ rằng “mình sẽ nâng tay hay chân con lên và đặt lại cho ngay ngắn nếu nó buông thõng xuống”, thì mẹ Bồ Tát cũng vậy, bà nhìn Bồ Tát để sống an lạc, nghĩ rằng “có phải con trai mình đang chịu khổ đau khi mẹ đứng dậy, đi lại, xoay mình, ngồi xuống, v.v., hay khi ăn các món nóng, lạnh, mặn, đắng, cay không?”, và bà thấy Bồ Tát ngồi kiết già.
Yathā hi aññe antokucchigatā pakkāsayaṃ ajjhottharitvā āmāsayaṃ ukkhipitvā udarapaṭalaṃ piṭṭhito katvā piṭṭhikaṇṭakaṃ nissāya ukkuṭikā dvīsu muṭṭhīsu hanukaṃ ṭhapetvā deve vassante rukkhasusire makkaṭā viya nisīdanti, na evaṃ bodhisatto.
Just as other children in the womb sit squatted, covering the digested food receptacle, lifting the undigested food receptacle, with the abdominal wall behind them, leaning on the backbone, resting their chin on two fists, like monkeys in a tree hollow when it rains, the Bodhisatta was not so.
Vì những đứa trẻ khác khi ở trong bụng mẹ, chúng thường nằm đè lên ruột già, đẩy ruột non lên, lấy thành bụng mẹ làm lưng, tựa vào xương sống, ngồi xổm, đặt cằm lên hai nắm tay, như những con khỉ trong hốc cây khi trời mưa; Bồ Tát thì không như vậy.
Bodhisatto pana piṭṭhikaṇṭakaṃ piṭṭhito katvā dhammāsane dhammakathiko viya pallaṅkaṃ ābhujitvā puratthābhimukho nisīdati.
The Bodhisatta, however, sat with his backbone behind him, facing east, cross-legged, like a Dhamma preacher on a Dhamma seat.
Bồ Tát lấy xương sống làm lưng, ngồi kiết già hướng về phía đông, như một vị thuyết pháp trên pháp tòa.
Pubbe katakammaṃ panassā vatthuṃ sodheti, suddhe vatthumhi sukhumacchavilakkhaṇaṃ nibbattati.
His past deeds purify her womb, and in a purified womb, the characteristic of delicate skin is produced.
Công đức đã tạo ra từ trước của bà đã làm sạch tử cung, và trên tử cung sạch sẽ đó, một đặc điểm da thịt tinh tế đã được sinh ra.
Atha naṃ kucchigataṃ taco paṭicchādetuṃ na sakkoti, olokentiyā bahi ṭhito viya paññāyati.
Then, the skin of her abdomen cannot conceal the Bodhisatta within; to her who looks, he appears as if he were outside.
Khi đó, da bụng không thể che khuất Bồ Tát đang ở trong bụng, nên khi bà nhìn, Bồ Tát hiện ra như đang ở bên ngoài.
Tamatthaṃ upamāya vibhāvento seyyathāpītiādimāha.
Explaining this meaning with a simile, it says seyyathāpi and so forth.
Để làm rõ ý nghĩa đó bằng ví dụ, Đức Phật đã nói câu seyyathāpītiādi (ví như, v.v.).
Bodhisatto pana antokucchigato mātaraṃ na passati.
The Bodhisatta, however, does not see his mother while in her womb.
Tuy nhiên, Bồ Tát đang ở trong bụng mẹ thì không nhìn thấy mẹ.
Na hi antokucchiyaṃ cakkhuviññāṇaṃ uppajjati.
Indeed, eye-consciousness does not arise within the womb.
Vì nhãn thức không thể phát sinh trong bụng mẹ.
205. Kālaṃ karotīti na vijātabhāvapaccayā, āyuparikkhayeneva.
205. Kālaṃ karoti means she passes away not due to giving birth, but due to the exhaustion of her lifespan.
205. Kālaṃ karoti (qua đời) là do tuổi thọ đã hết, chứ không phải do việc sinh nở.
Bodhisattena vasitaṭṭhānañhi cetiyakuṭisadisaṃ hoti aññesaṃ aparibhogaṃ, na ca sakkā bodhisattamātaraṃ apanetvā aññaṃ aggamahesiṭṭhāne ṭhapetunti tattakaṃyeva bodhisattamātu āyuppamāṇaṃ hoti, tasmā tadā kālaṃ karoti.
For the place where a Bodhisatta resides is like a cetiya-shrine, not to be enjoyed by others; and it is not possible to remove the Bodhisatta's mother and enthrone another in the position of chief consort. Therefore, such is the lifespan of the Bodhisatta's mother, and thus she passes away at that time.
Nơi Đức Bồ-tát cư ngụ giống như một tháp thờ (cetiya-kuṭi), không thể được người khác sử dụng. Và không thể nào phế bỏ mẹ của Đức Bồ-tát để đặt một người khác vào vị trí Hoàng hậu chính (aggamahesiṭṭhāna). Vì vậy, tuổi thọ của mẹ Đức Bồ-tát chỉ có bấy nhiêu, do đó, vào lúc ấy bà qua đời.
Katarasmiṃ pana vaye kālaṃ karotīti?
In which age, then, does she pass away?
Vậy bà qua đời vào độ tuổi nào?
Majjhimavaye.
In middle age.
Vào độ tuổi trung niên.
Paṭhamavayasmiñhi sattānaṃ attabhāve chandarāgo balavā hoti, tena tadā sañjātagabbhā itthī taṃ gabbhaṃ anurakkhituṃ na sakkonti, gabbho bahvābādho hoti.
For in the first age, the sensual desire (chandarāga) for one's own body is strong, and thus at that time, a woman who has conceived cannot protect that embryo; the embryo suffers from many ailments.
Trong độ tuổi đầu tiên, sự tham ái (chandarāga) trong thân của chúng sanh rất mạnh mẽ, do đó, người phụ nữ mang thai vào lúc ấy không thể bảo vệ bào thai, và bào thai sẽ dễ mắc nhiều bệnh tật.
Majjhimavayassa pana dve koṭṭhāse atikkamma tatiyakoṭṭhāse vatthuṃ visadaṃ hoti, visade vatthumhi nibbattā dārakā arogā honti.
But, having passed two portions of middle age, the womb becomes pure in the third portion, and children born in a pure womb are healthy.
Còn trong độ tuổi trung niên, sau khi vượt qua hai phần, đến phần thứ ba thì tử cung (vatthu) trở nên trong sạch (visada), và những đứa trẻ được sinh ra trong tử cung trong sạch thì không bệnh tật.
Tasmā bodhisattamātāpi paṭhamavaye sampattiṃ anubhavitvā majjhimavayassa tatiyakoṭṭhāse vijāyitvā kālaṃ karoti.
Therefore, the Bodhisatta's mother, having enjoyed prosperity in the first age, gives birth in the third portion of middle age and then passes away.
Do đó, mẹ của Đức Bồ-tát cũng vậy, sau khi hưởng thụ hạnh phúc trong độ tuổi đầu tiên, bà sinh con vào phần thứ ba của độ tuổi trung niên rồi qua đời.
Nava vā dasa vāti ettha vā-saddena vikappanavasena satta vā aṭṭha vā ekādasa vā dvādasa vāti evamādīnampi saṅgaho veditabbo.
In this phrase "nine or ten," by the word "or," the inclusion of seven or eight or eleven or twelve months, and so on, should be understood as an alternative.
Ở đây, với từ “vā” (hoặc) trong cụm từ “chín hoặc mười”, cần hiểu rằng nó cũng bao gồm bảy hoặc tám, mười một hoặc mười hai (tháng), v.v. theo cách lựa chọn.
Tattha sattamāsajāto jīvati, sītuṇhakkhamo pana na hoti.
Among these, one born in the seventh month lives, but cannot endure heat and cold.
Trong số đó, đứa trẻ sinh ra đủ bảy tháng thì sống được, nhưng không chịu đựng được lạnh và nóng.
Aṭṭhamāsajāto na jīvati, sesā jīvanti.
One born in the eighth month does not live; the rest live.
Đứa trẻ sinh ra đủ tám tháng thì không sống được, những đứa còn lại thì sống được.
Ṭhitāvāti ṭhitāva hutvā.
"Standing only" means having stood still.
Đứng mà có nghĩa là đã đứng.
Mahāmāyāpi devī upavijaññā ñātikulagharaṃ gamissāmīti rañño ārocesi.
Devī Mahāmāyā also informed the king, "I will go to my kinsfolk's home for childbirth."
Đức Đại-mẫu Māyā cũng tâu với nhà vua rằng: “Con sẽ về nhà bà con để sinh nở.”
Rājā kapilavatthuto devadahanagaragāmimaggaṃ alaṅkārāpetvā deviṃ suvaṇṇasivikāya nisīdāpesi.
The king decorated the road from Kapilavatthu to Devadaha city and had the devī sit in a golden palanquin.
Đức vua cho trang hoàng con đường từ Kapilavatthu đến thành Devadaha, rồi đặt Đức Hoàng hậu ngồi trên kiệu vàng.
Sakalanagaravāsino sakyā parivāretvā gandhamālādīhi pūjayamānā deviṃ gahetvā pāyiṃsu.
The Sakyas, all residents of the city, surrounded her, offered perfumes and flowers, and carried the devī forth.
Các vị Sakya cư dân của toàn thành vây quanh, dâng hương hoa và các vật phẩm cúng dường, rước Đức Hoàng hậu đi.
Sā devadahanagarassa avidūre lumbinisālavanuyyānaṃ disvā uyyānavicaraṇatthāya cittaṃ uppādetvā rañño saññaṃ adāsi.
When she saw the Lumbinī sāla grove not far from Devadaha city, she conceived a desire to wander in the grove and gave a sign to the king.
Khi đến gần thành Devadaha, bà thấy khu vườn Lumbinī-sālavana, liền nảy ý muốn dạo chơi trong vườn và ra hiệu cho nhà vua.
Rājā uyyānaṃ paṭijaggāpetvā ārakkhaṃ saṃvidahāpesi.
The king had the grove attended to and arranged for its protection.
Đức vua cho sửa soạn khu vườn và bố trí đội bảo vệ.
Deviyā uyyānaṃ paviṭṭhamattāya kāyadubbalyaṃ ahosi, athassā maṅgalasālamūle sirīsayanaṃ paññāpetvā sāṇiyā parikkhipiṃsu.
As soon as the devī entered the grove, she felt bodily weakness; then a glorious couch was prepared for her at the foot of an auspicious sāla tree, and it was enclosed by a curtain.
Ngay khi Đức Hoàng hậu vừa bước vào vườn, bà cảm thấy yếu sức. Thế là người ta cho trải một chiếc giường quý (sirīsayana) dưới gốc cây sala cát tường và vây màn vải (sāṇi) xung quanh.
Sā antosāṇiṃ pavisitvā sālasākhaṃ hatthena gahetvā aṭṭhāsi.
She entered inside the curtain, grasped a sāla branch with her hand, and stood.
Bà bước vào trong màn, nắm một cành cây sala bằng tay và đứng đó.
Athassā tāvadeva gabbhavuṭṭhānaṃ ahosi.
Immediately thereafter, the childbirth occurred.
Ngay lúc ấy, thai nhi được sinh ra.
Devā naṃ paṭhamaṃ paṭiggaṇhantīti khīṇāsavā suddhāvāsabrahmāno paṭiggaṇhanti.
"The devas receive him first" refers to the Arahant Suddhāvāsa Brahmās receiving him.
Chư thiên đón đỡ trước tiên có nghĩa là chư Phạm thiên Suddhāvāsa đã diệt tận các lậu hoặc (khīṇāsava) đón đỡ.
Kathaṃ?
How?
Bằng cách nào?
Sūtivesaṃ gaṇhitvāti eke.
Some say, "Having assumed the guise of a midwife."
Một số người nói rằng bằng cách hóa thân thành bà đỡ.
Taṃ pana paṭikkhipitvā idaṃ vuttaṃ – tadā bodhisattamātā suvaṇṇakhacitaṃ vatthaṃ nivāsetvā macchakkhisadisaṃ dukūlapaṭaṃ yāva pādantāva pārupitvā aṭṭhāsi.
But rejecting that, it is stated thus: At that time, the Bodhisatta's mother was wearing gold-embroidered clothing and was draped in a fine white cloth (dukūlapaṭa) resembling a fish's eye, reaching down to her feet, and stood thus.
Nhưng bác bỏ điều đó, đây là điều đã được nói: Vào lúc ấy, mẹ của Đức Bồ-tát mặc y phục thêu vàng, khoác một tấm vải dukūla (tơ lụa trắng mịn) giống như mắt cá, che phủ đến tận bàn chân và đứng đó.
Athassā sallahukaṃ gabbhavuṭṭhānaṃ ahosi dhammakaraṇato udakanikkhamanasadisaṃ.
Then her childbirth occurred gently, like water flowing from a water-filter (dhammakaraṇa).
Thế là thai nhi được sinh ra một cách nhẹ nhàng, giống như nước chảy ra từ một cái gáo (dhammakaraṇa).
Atha te pakatibrahmaveseneva upasaṅkamitvā paṭhamaṃ suvaṇṇajālena paṭiggahesuṃ.
Then those Brahmās approached in their natural Brahma-form and first received him with a golden net.
Rồi chư Phạm thiên ấy, với hình tướng Phạm thiên tự nhiên của mình, đến gần và trước tiên đón đỡ bằng một tấm lưới vàng.
Tesaṃ hatthato manussā dukūlacumbaṭakena paṭiggahesuṃ.
From their hands, humans received him with a roll of fine white cloth.
Từ tay của chư thiên, loài người đón đỡ bằng một tấm vải dukūla cuộn tròn.
Tena vuttaṃ – ‘‘devā naṃ paṭhamaṃ paṭiggaṇhanti pacchā manussā’’ti.
Therefore, it is said: "Devas receive him first, then humans."
Vì vậy, đã nói: “Chư thiên đón đỡ trước tiên, sau đó là loài người.”
Visadova nikkhamatīti yathā aññe sattā yonimagge laggantā bhaggavibhaggā nikkhamanti, na evaṃ nikkhamati, alaggo hutvā nikkhamatīti attho.
"Emerged pure" means he did not emerge soiled or dishevelled like other beings who cling to the birth passage, but emerged unattached.
Thanh tịnh mà ra có nghĩa là không như những chúng sanh khác bị mắc kẹt trong đường sinh, bị vỡ nát mà ra, mà là không bị mắc kẹt mà ra.
Udenāti udakena.
"By water" means by the water in the womb.
Udaka có nghĩa là bằng nước.
Kenaci asucināti yathā aññe sattā kammajavātehi uddhaṃpādā adhosirā yonimagge pakkhittā sataporisanarakapapātaṃ patantā viya tāḷacchiddena nikkaḍḍhiyamānā hatthī viya mahādukkhaṃ anubhavantā nānāasucimakkhitāva nikkhamanti, na evaṃ bodhisatto.
"By any impurity" means that just as other beings, thrown into the birth passage by kamma-born winds, head downwards and feet upwards, experiencing great suffering as if falling down a hundred-man-deep precipice or being pulled out through a loophole like an elephant, emerge covered in various impurities—the Bodhisatta does not.
Không bị ô uế nào có nghĩa là không như những chúng sanh khác bị gió nghiệp đẩy vào đường sinh với đầu chúc xuống, chân giơ lên, như thể rơi xuống một vực thẳm sâu hàng trăm tầm, hoặc như những con voi bị kéo ra khỏi lỗ thủng bằng móc sắt, chịu đựng đau khổ lớn lao, dính đầy các thứ ô uế mà ra, Đức Bồ-tát thì không như vậy.
Bodhisattañhi kammajavātā uddhaṃpādaṃ adhosiraṃ kātuṃ na sakkonti.
For the kamma-born winds cannot turn the Bodhisatta head downwards and feet upwards.
Gió nghiệp không thể làm cho Đức Bồ-tát đầu chúc xuống, chân giơ lên.
So dhammāsanato otaranto dhammakathiko viya nisseṇito otaranto puriso viya ca dve hatthe ca pāde ca pasāretvā ṭhitakova mātukucchisambhavena kenaci asucinā amakkhitova nikkhamati.
He emerges standing, extending both hands and feet, like a Dhamma preacher descending from the Dhamma seat, or like a person descending a ladder, completely unstained by any impurity originating from the mother's womb.
Ngài ra đời trong tư thế đứng thẳng, duỗi cả hai tay và hai chân, không bị dính bất kỳ ô uế nào từ bụng mẹ, như một vị thuyết pháp bước xuống từ pháp tòa, hoặc như một người bước xuống từ cầu thang.
Udakassa dhārāti udakavaṭṭiyo.
"Streams of water" means currents of water.
Dòng nước là những cột nước.
Tāsu sītā suvaṇṇakaṭāhe patati, uṇhā rajatakaṭāhe.
Among these, the cold water falls into a golden basin, and the hot water into a silver basin.
Trong số đó, nước mát rơi vào chậu vàng, nước ấm rơi vào chậu bạc.
Idañca pathavītale kenaci asucinā asammissaṃ tesaṃ pānīyaparibhojanīyaudakañceva aññehi asādhāraṇaṃ kīḷanaudakañca dassetuṃ vuttaṃ.
This is stated to show that their drinking water and bathing water, which is not mixed with any impurity on the ground, is also exclusive to them for play.
Điều này được nói để chỉ ra rằng nước uống và nước dùng của họ, cũng như nước để vui chơi, không bị lẫn với bất kỳ thứ ô uế nào trên mặt đất và không dành cho người khác.
Aññassa pana suvaṇṇarajataghaṭehi āhariyamānaudakassa ceva haṃsavaṭṭakādipokkharaṇigatassa ca udakassa paricchedo natthi.
However, there is no limit to the water brought in golden and silver pots, or to the water found in ponds with geese, quail, and so on.
Ngoài ra, không có giới hạn cho nước được mang đến bằng các bình vàng bạc và nước trong các hồ sen có thiên nga, vịt trời, v.v.
207. Sampatijātoti muhuttajāto.
"Just born" means born just at that moment.
207. Vừa mới sinh có nghĩa là vừa sinh ra trong khoảnh khắc đó.
Pāḷiyaṃ pana mātukucchito nikkhantamatto viya dassito, na pana evaṃ daṭṭhabbaṃ.
In the Pāli, it is presented as if he emerged immediately from the mother's womb, but it should not be understood thus.
Tuy nhiên, trong Pāḷi, điều đó được trình bày như thể Ngài vừa ra khỏi bụng mẹ, nhưng không nên hiểu như vậy.
Nikkhantamattañhi taṃ paṭhamaṃ brahmāno suvaṇṇajālena paṭiggaṇhiṃsu, tesaṃ hatthato cattāro mahārājāno maṅgalasammatāya sukhasamphassāya ajinappaveṇiyā, tesaṃ hatthato manussā dukūlacumbaṭakena, manussānaṃ hatthato muccitvā pathaviyaṃ patiṭṭhito.
For immediately upon emergence, the Brahmās first received him with a golden net; from their hands, the four Great Kings received him with a soft and auspicious antelope-hide mat; from their hands, humans received him with a roll of fine white cloth; and having been released from the hands of humans, he stood on the ground.
Thật vậy, ngay khi vừa ra đời, Ngài được chư Phạm thiên đón đỡ trước tiên bằng lưới vàng; từ tay chư Phạm thiên, bốn vị Đại Thiên vương đón đỡ bằng tấm thảm da thú (ajinappaveṇī) được coi là cát tường và dễ chịu khi tiếp xúc; từ tay chư Đại Thiên vương, loài người đón đỡ bằng tấm vải dukūla cuộn tròn; và sau khi thoát khỏi tay loài người, Ngài đứng vững trên mặt đất.
Setamhi chatte anudhāriyamāneti dibbasetacchatte anudhāriyamāne.
"While the white parasol was held above" means while the divine white parasol was held above.
Khi chiếc lọng trắng được che có nghĩa là khi chiếc lọng trắng của chư thiên được che.
Ettha ca chattassa parivārāni khaggādīni pañca rājakakudhabhaṇḍānipi āgatāneva.
Here, the five royal regalia, such as the sword, which are attendants to the parasol, are also included.
Ở đây, năm vật phẩm hoàng gia (pañca rājakakudhabhaṇḍa) như kiếm, v.v., là tùy tùng của chiếc lọng, cũng đã xuất hiện.
Pāḷiyaṃ pana rājagamane rājā viya chattameva vuttaṃ.
But in the Pāli, like a king in royal procession, only the parasol is mentioned.
Tuy nhiên, trong Pāḷi, chỉ nói về chiếc lọng, giống như khi nói về sự ra đi của nhà vua, chỉ nói về nhà vua.
Tesu chattameva paññāyati, na chattaggāhakā.
Among these, only the parasol is visible, not its bearers.
Trong số đó, chỉ có chiếc lọng được thấy, chứ không thấy những người cầm lọng.
Tathā khagga-tālavaṇṭa-morahatthaka-vāḷabījani-uṇhīsamattāyeva paññāyanti, na tesaṃ gāhakā.
Similarly, only the sword, palm-leaf fan, peacock-feather fan, chowrie, and turban are visible, not their bearers.
Tương tự, chỉ thấy kiếm, quạt lá cọ, quạt lông công, phất trần lông đuôi bò, và mũ miện, chứ không thấy những người cầm chúng.
Sabbāni kira tāni adissamānarūpā devatā gaṇhiṃsu.
It is said that all of these were held by deities with invisible forms.
Quả thật, tất cả những vật phẩm ấy đều được chư thiên có hình tướng vô hình cầm giữ.
Vuttampi cetaṃ –
It is also stated:
Điều này cũng đã được nói:
Sabbā ca disāti idaṃ sattapadavītihārūpari ṭhitassa viya sabbadisānuvilokanaṃ vuttaṃ, na kho panevaṃ daṭṭhabbaṃ.
"All directions" refers to his looking in all directions as if standing above the seven steps, but it should not be understood thus.
Tất cả các phương – câu này được nói như thể Ngài nhìn khắp các phương khi đứng trên bảy bước chân, nhưng không nên hiểu như vậy.
Mahāsatto hi manussānaṃ hatthato muccitvā puratthimadisaṃ olokesi, anekacakkavāḷasahassāni ekaṅgaṇāni ahesuṃ.
For the Great Being, having been released from the hands of humans, looked towards the eastern direction, and thousands of world-systems became as one vast plain.
Thật vậy, Đức Đại-sĩ, sau khi thoát khỏi tay loài người, nhìn về phương Đông, và hàng ngàn thế giới (cakkavāḷa) trở nên phẳng lì như một sân rộng.
Tattha devamanussā gandhamālādīhi pūjayamānā – ‘‘mahāpurisa idha tumhehi sadisopi natthi, kuto uttaritaro’’ti āhaṃsu.
There, devas and humans, making offerings of perfumes and flowers, said, "O Great Man, there is no one equal to you in this world, let alone superior."
Ở đó, chư thiên và loài người, cúng dường bằng hương hoa, v.v., đã nói: “Đại nhân, ở đây không có ai giống Ngài, huống chi là vượt trội hơn Ngài.”
Evaṃ catasso disā, catasso anudisā, heṭṭhā, uparīti dasapi disā anuviloketvā attanā sadisaṃ adisvā ayaṃ uttarā disāti sattapadavītihārena agamāsīti evamettha attho daṭṭhabbo.
In this manner, having looked in the four cardinal directions, the four intermediate directions, below, and above—all ten directions—and not seeing anyone equal to himself, he considered, "This is the northern direction," and walked seven strides. This is how the meaning should be understood here.
Tương tự, Ngài nhìn khắp mười phương: bốn phương chính, bốn phương phụ, phương dưới và phương trên. Không thấy ai giống mình, Ngài nghĩ: “Đây là phương Bắc,” và đi bảy bước. Ý nghĩa ở đây nên được hiểu như vậy.
Āsabhinti uttamaṃ.
"Āsabhaṃ" means supreme.
Āsabha có nghĩa là tối thượng.
Aggoti guṇehi sabbapaṭhamo.
"Aggo" means foremost in qualities.
Aggo có nghĩa là đứng đầu về phẩm hạnh.
Itarāni dve padāni etasseva vevacanāni.
The other two terms are synonyms for this very word.
Hai từ còn lại là từ đồng nghĩa của từ này.
Ayamantimā jāti, natthi dāni punabbhavoti padadvayena imasmiṃ attabhāve pattabbaṃ arahattaṃ byākāsi.
By the two phrases, "This is the final birth; there is no rebirth now," he declared the Arahantship to be attained in this existence.
Với hai câu “Đây là kiếp cuối cùng, không còn tái sanh nữa”, Ngài đã tuyên bố quả A-la-hán sẽ đạt được trong kiếp này.
Ettha ca samehi pādehi pathaviyaṃ patiṭṭhānaṃ catuiddhipādapaṭilābhassa pubbanimittaṃ, uttarābhimukhabhāvo mahājanaṃ ajjhottharitvā abhibhavitvā gamanassa pubbanimittaṃ, sattapadagamanaṃ sattabojjhaṅgaratanapaṭilābhassa pubbanimittaṃ, dibbasetacchattadhāraṇaṃ vimutticchattapaṭilābhassa pubbanimittaṃ, pañcarājakakudhabhaṇḍāni pañcahi vimuttīhi vimuccanassa pubbanimittaṃ, disānuvilokanaṃ anāvaraṇañāṇapaṭilābhassa pubbanimittaṃ, āsabhīvācābhāsanaṃ appaṭivattiyadhammacakkappavattanassa pubbanimittaṃ.
Herein, standing on the ground with even feet is a premonitory sign of attaining the four bases of psychic power. Facing north, overwhelming and subduing the great multitude in his going, is a premonitory sign of his going. Going seven paces is a premonitory sign of attaining the seven Jewels of Enlightenment Factors. The holding of the divine white parasol is a premonitory sign of attaining the parasol of liberation. The five royal emblems are a premonitory sign of being liberated by the five liberations. Looking around in all directions is a premonitory sign of attaining unobstructed knowledge. Uttering the supreme utterance is a premonitory sign of setting in motion the irreversible Dhamma-wheel.
Ở đây, việc đứng vững trên mặt đất bằng hai bàn chân bằng nhau là điềm báo trước cho sự thành tựu bốn thần túc (iddhipāda); việc hướng về phía Bắc là điềm báo trước cho sự đi lại bao trùm và chế ngự đại chúng; việc đi bảy bước là điềm báo trước cho sự thành tựu bảy báu giác chi (bojjhaṅga); việc che lọng trắng của chư thiên là điềm báo trước cho sự thành tựu lọng giải thoát (vimutti); năm vật báu của vua chúa là điềm báo trước cho sự giải thoát khỏi năm sự giải thoát; việc nhìn khắp các phương là điềm báo trước cho sự thành tựu trí tuệ vô ngại (anāvaraṇañāṇa); việc nói lời hùng tráng (āsabhīvācā) là điềm báo trước cho sự chuyển Pháp luân không thể đảo ngược.
‘‘Ayamantimā jātī’’ti sīhanādo anupādisesāya nibbānadhātuyā parinibbānassa pubbanimittanti veditabbaṃ.
The lion’s roar, "This is my final birth," should be understood as a premonitory sign of his Parinibbāna into the Nibbāna-element with no remainder of clinging.
Lời rống sư tử “Đây là kiếp cuối cùng” là điềm báo trước cho sự nhập Niết Bàn vô dư y của vị ấy, cần phải hiểu như vậy.
Ime vārā pāḷiyaṃ āgatā, sambahulavāro pana āgato, āharitvā dīpetabbo.
These occurrences are found in the Pāḷi. However, the comprehensive occurrence is not found. It should be brought forth and explained.
Những trường hợp này được đề cập trong Pāḷi, nhưng trường hợp tổng hợp (sambahulavāra) thì không được đề cập, nên cần phải trích dẫn và trình bày.
Mahāpurisassa hi jātadivase dasasahassilokadhātu kampi.
Indeed, on the day of the Great Being’s birth, the ten-thousand-world-system trembled.
Vào ngày Đại Nhân đản sinh, mười ngàn thế giới chấn động.
Dasasahassilokadhātumhi devatā ekacakkavāḷe sannipatiṃsu.
Devas from the ten-thousand-world-system assembled in one cakkavāḷa.
Chư thiên trong mười ngàn thế giới đã tập trung tại một thế giới.
Paṭhamaṃ devā paṭiggahiṃsu, pacchā manussā.
First, devas received him, then humans.
Trước tiên là chư thiên tiếp nhận, sau đó là loài người.
Tantibaddhā vīṇā cammabaddhā bheriyo ca kenaci avāditā sayameva vajjiṃsu, manussānaṃ andubandhanādīni khaṇḍākhaṇḍaṃ bhijjiṃsu.
Stringed lutes and hide-bound drums played by themselves, without anyone striking them, and the fetters and bonds of humans broke into pieces.
Đàn vīṇā có dây và trống bherī có da tự động vang lên mà không ai đánh, những xiềng xích của loài người bị vỡ tan thành từng mảnh.
Sabbarogā ambilena dhotatambamalaṃ viya vigacchiṃsu, jaccandhā rūpāni passiṃsu.
All diseases vanished like copper stains scoured with acid, and those born blind saw forms.
Tất cả bệnh tật đều biến mất như vết đồng dơ được rửa bằng chất chua, người mù bẩm sinh nhìn thấy hình sắc.
Jaccabadhirā saddaṃ suṇiṃsu, pīṭhasappī javanasampannā ahesuṃ, jātijaḷānampi eḷamūgānaṃ sati patiṭṭhāsi, videse pakkhandanāvā supaṭṭanaṃ pāpuṇiṃsu, ākāsaṭṭhakabhūmaṭṭhakaratanāni sakatejobhāsitāni ahesuṃ, verino mettacittaṃ paṭilabhiṃsu, avīcimhi aggi nibbāyi.
Those born deaf heard sounds, the crippled became swift, memory became established even for the mentally deficient and the dumb, ships venturing abroad reached safe harbors, jewels in the sky and on the ground shone with their own brilliance, enemies attained minds of loving-kindness, and the fire in Avīci was extinguished.
Người điếc bẩm sinh nghe được âm thanh, người què trở nên nhanh nhẹn, người đần độn và câm bẩm sinh có được chánh niệm, những con thuyền vượt biển đến được bến cảng an toàn, những viên ngọc quý trên trời và dưới đất đều tự phát sáng, kẻ thù có được tâm từ, lửa trong địa ngục Avīci tắt ngấm.
Lokantare āloko udapādi, nadīsu jalaṃ na pavatti, mahāsamuddesu madhurasadisaṃ udakaṃ ahosi, vāto na vāyi, ākāsapabbatarukkhagatā sakuṇā bhassitvā pathavīgatā ahesuṃ, cando atiroci, sūriyo na uṇho na sītalo nimmalo utusampanno ahosi, devatā attano attano vimānadvāre ṭhatvā apphoṭanaseḷanacelukkhepādīhi mahākīḷaṃ kīḷiṃsu, cātuddīpikamahāmegho vassi, mahājanaṃ neva khudā na pipāsā pīḷesi, dvārakavāṭāni sayameva vivariṃsu, pupphūpagaphalūpagā rukkhā pupphaphalāni gaṇhiṃsu, dasasahassilokadhātu ekaddhajamālā ahosīti.
Light appeared in the Lokantara hells, water did not flow in the rivers, the water in the great oceans became like honey, the wind did not blow, birds in the sky, mountains, and trees fell to the ground, the moon shone with exceeding brilliance, the sun was neither hot nor cold, pure and perfect in season, devas, standing at the doors of their mansions, celebrated with great joy by clapping, whistling, throwing up their garments, and so on; a great rain cloud over the four continents poured down rain; the great multitude was afflicted neither by hunger nor by thirst; doors and door-panels opened by themselves; trees bearing flowers and fruits bore flowers and fruits; and the ten-thousand-world-system became a single wreath of banners.
Ánh sáng xuất hiện trong địa ngục Lokantara, nước sông ngừng chảy, nước biển lớn trở nên ngọt như mật, gió ngừng thổi, chim chóc trên trời, núi và cây cối rơi xuống đất, mặt trăng sáng rực, mặt trời không nóng không lạnh, trong sạch và có mùa tiết tốt lành, chư thiên đứng ở cửa cung điện của mình và vui chơi bằng cách vỗ tay, huýt sáo, tung khăn choàng, v.v., trận mưa lớn bao trùm bốn châu lục, đại chúng không bị đói khát hành hạ, cửa nẻo tự động mở ra, cây ra hoa kết trái, và mười ngàn thế giới trở thành một chuỗi cờ phướn duy nhất.
Tatrāpissa dasasahassilokadhātukampo sabbaññutañāṇapaṭilābhassa pubbanimittaṃ, devatānaṃ ekacakkavāḷe sannipāto dhammacakkappavattanakāle ekappahārena sannipatitvā dhammapaṭiggaṇhanassa pubbanimittaṃ, paṭhamaṃ devatānaṃ paṭiggahaṇaṃ catunnaṃ rūpāvacarajjhānānaṃ paṭilābhassa pubbanimittaṃ.
Therein, too, the trembling of the ten-thousand-world-system is a premonitory sign of the attainment of omniscience. The assembly of devas in one cakkavāḷa is a premonitory sign of their assembling at one stroke to receive the Dhamma at the time of the setting in motion of the Dhamma-wheel. The initial reception by devas is a premonitory sign of the attainment of the four rūpāvacara jhāna.
Trong đó, sự chấn động của mười ngàn thế giới là điềm báo trước cho sự thành tựu Nhất thiết trí (sabbaññutañāṇa), sự tập trung của chư thiên tại một thế giới là điềm báo trước cho sự tập trung và tiếp nhận Pháp ngay lập tức khi Pháp luân được chuyển, việc chư thiên tiếp nhận trước là điềm báo trước cho sự thành tựu bốn thiền sắc giới.
Pacchā manussānaṃ paṭiggahaṇaṃ catunnaṃ arūpajjhānānaṃ paṭilābhassa pubbanimittaṃ, tantibaddhavīṇānaṃ sayaṃ vajjanaṃ anupubbavihārapaṭilābhassa pubbanimittaṃ, cammabaddhabherīnaṃ vajjanaṃ mahatiyā dhammabheriyā anussāvanassa pubbanimittaṃ, andubandhanādīnaṃ chedo asmimānasamucchedassa pubbanimittaṃ, sabbarogavigamo sabbakilesavigamassa pubbanimittaṃ, jaccandhānaṃ rūpadassanaṃ dibbacakkhupaṭilābhassa pubbanimittaṃ, jaccabadhirānaṃ saddassavanaṃ dibbasotadhātupaṭilābhassa pubbanimittaṃ, pīṭhasappīnaṃ javanasampadā catuiddhipādādhigamassa pubbanimittaṃ, jaḷānaṃ satipatiṭṭhānaṃ catusatipaṭṭhānapaṭilābhassa pubbanimittaṃ, videsapakkhandanāvānaṃ supaṭṭanasampāpuṇanaṃ catupaṭisambhidādhigamassa pubbanimittaṃ, ratanānaṃ sakatejobhāsitattaṃ yaṃ lokassa dhammobhāsaṃ dassessati tassa pubbanimittaṃ.
The subsequent reception by humans is a premonitory sign of the attainment of the four arūpa jhāna. The self-playing of stringed lutes is a premonitory sign of the attainment of the anupubbavihāra. The playing of hide-bound drums is a premonitory sign of the sounding of the great Dhamma-drum. The breaking of fetters and bonds is a premonitory sign of the eradication of the conceit "I am." The disappearance of all diseases is a premonitory sign of the disappearance of all defilements. The seeing of forms by the born blind is a premonitory sign of the attainment of the divine eye. The hearing of sounds by the born deaf is a premonitory sign of the attainment of the divine ear element. The swiftness of the crippled is a premonitory sign of the attainment of the four bases of psychic power. The establishment of memory for the mentally deficient is a premonitory sign of the attainment of the four foundations of mindfulness. The arrival of ships venturing abroad at a safe harbor is a premonitory sign of the attainment of the four analytical knowledges. The shining of jewels with their own brilliance is a premonitory sign of the Dhamma-light which will be shown to the world.
Việc loài người tiếp nhận sau là điềm báo trước cho sự thành tựu bốn thiền vô sắc giới, việc đàn vīṇā có dây tự động vang lên là điềm báo trước cho sự thành tựu các thiền định tuần tự (anupubbavihāra), việc trống bherī có da tự động vang lên là điềm báo trước cho sự tuyên bố tiếng trống Pháp lớn, việc xiềng xích bị cắt đứt là điềm báo trước cho sự đoạn trừ kiêu mạn ‘ta là’, việc tất cả bệnh tật biến mất là điềm báo trước cho sự đoạn trừ tất cả phiền não, việc người mù bẩm sinh nhìn thấy hình sắc là điềm báo trước cho sự thành tựu thiên nhãn (dibbacakkhu), việc người điếc bẩm sinh nghe được âm thanh là điềm báo trước cho sự thành tựu thiên nhĩ (dibbasotadhātu), sự nhanh nhẹn của người què là điềm báo trước cho sự thành tựu bốn thần túc (iddhipāda), sự an trú chánh niệm của người đần độn là điềm báo trước cho sự thành tựu bốn niệm xứ (satipaṭṭhāna), việc thuyền vượt biển đến được bến cảng an toàn là điềm báo trước cho sự thành tựu bốn biện tài (paṭisambhidā), việc các viên ngọc quý tự phát sáng là điềm báo trước cho sự chiếu rọi ánh sáng Pháp cho thế gian.
Verīnaṃ mettacittapaṭilābho catubrahmavihārapaṭilābhassa pubbanimittaṃ, avīcimhi agginibbānaṃ ekādasaagginibbānassa pubbanimittaṃ, lokantarāloko avijjandhakāraṃ vidhamitvā ñāṇālokadassanassa pubbanimittaṃ, mahāsamuddassa madhuratā nibbānarasena ekarasabhāvassa pubbanimittaṃ, vātassa avāyanaṃ dvāsaṭṭhidiṭṭhigatabhindanassa pubbanimittaṃ, sakuṇānaṃ pathavīgamanaṃ mahājanassa ovādaṃ sutvā pāṇehi saraṇagamanassa pubbanimittaṃ, candassa ativirocanaṃ bahujanakantatāya pubbanimittaṃ, sūriyassa uṇhasītavivajjanautusukhatā kāyikacetasikasukhuppattiyā pubbanimittaṃ, devatānaṃ vimānadvāresu apphoṭanādīhi kīḷanaṃ buddhabhāvaṃ patvā udānaṃ udānassa pubbanimittaṃ, cātuddīpikamahāmeghavassanaṃ mahato dhammameghavassanassa pubbanimittaṃ, khudāpīḷanassa abhāvo kāyagatāsatiamatapaṭilābhassa pubbanimittaṃ, pipāsāpīḷanassa abhāvo vimuttisukhena sukhitabhāvassa pubbanimittaṃ, dvārakavāṭānaṃ sayameva vivaraṇaṃ aṭṭhaṅgikamaggadvāravivaraṇassa pubbanimittaṃ, rukkhānaṃ pupphaphalagahaṇaṃ vimuttipupphehi pupphitassa ca sāmaññaphalabhārabharitabhāvassa ca pubbanimittaṃ, dasasahassilokadhātuyā ekaddhajamālatā ariyaddhajamālāmālitāya pubbanimittanti veditabbaṃ.
The attainment of loving-kindness by enemies is a premonitory sign of the attainment of the four Brahmavihārās. The extinguishing of fire in Avīci is a premonitory sign of the extinguishing of the eleven fires. The light in the Lokantara hells is a premonitory sign of dispelling the darkness of ignorance and seeing the light of knowledge. The sweetness of the great ocean is a premonitory sign of the Sangha's one taste, the taste of Nibbāna. The absence of wind is a premonitory sign of the breaking of the sixty-two wrong views. The birds’ coming to the ground is a premonitory sign of the great multitude, having heard the teaching, taking refuge for their lives. The moon’s exceeding brightness is a premonitory sign of his belovedness by many. The sun’s freedom from heat and cold and its pleasant season is a premonitory sign of the arising of bodily and mental happiness. The devas’ playing at their mansion doors with clappings, etc., is a premonitory sign of his uttering the Udāna after attaining Buddhahood. The great rain cloud showering over the four continents is a premonitory sign of the great rain of Dhamma falling with the power of the knowledge of doctrine. The absence of affliction from hunger is a premonitory sign of the attainment of the Deathless of mindfulness of the body. The absence of affliction from thirst is a premonitory sign of being happy with the happiness of liberation. The self-opening of doors and door-panels is a premonitory sign of the opening of the eightfold path door. The bearing of flowers and fruits by trees is a premonitory sign of being flowered with the flowers of liberation and being laden with the burden of the fruits of recluseship. The ten-thousand-world-system becoming a single wreath of banners should be understood as a premonitory sign of being adorned with the wreath of the noble path and noble factors of enlightenment.
Việc kẻ thù có được tâm từ là điềm báo trước cho sự thành tựu bốn Phạm trú (brahmavihāra), việc lửa trong địa ngục Avīci tắt ngấm là điềm báo trước cho sự dập tắt mười một ngọn lửa, ánh sáng trong địa ngục Lokantara là điềm báo trước cho sự tiêu tan bóng tối vô minh và sự xuất hiện ánh sáng trí tuệ, vị ngọt của biển lớn là điềm báo trước cho sự đồng nhất vị giải thoát (nibbānarasena ekarasabhāva) của Giáo Pháp, việc gió ngừng thổi là điềm báo trước cho sự phá vỡ sáu mươi hai tà kiến, việc chim chóc xuống đất là điềm báo trước cho việc đại chúng nghe lời giáo huấn và quy y Tam Bảo bằng cả sinh mạng, việc mặt trăng sáng rực là điềm báo trước cho sự được đại chúng yêu mến, sự thoải mái về thời tiết của mặt trời không nóng không lạnh là điềm báo trước cho sự xuất hiện hạnh phúc thân và tâm, việc chư thiên vui chơi bằng cách vỗ tay, v.v. ở cửa cung điện của mình là điềm báo trước cho sự thốt lên lời cảm hứng (udāna) sau khi đạt được Phật quả, việc mưa lớn bao trùm bốn châu lục là điềm báo trước cho trận mưa Pháp lớn, việc không bị đói hành hạ là điềm báo trước cho sự thành tựu bất tử nhờ niệm thân (kāyagatāsati), việc không bị khát hành hạ là điềm báo trước cho sự an lạc bằng hạnh phúc giải thoát (vimuttisukha), việc cửa nẻo tự động mở ra là điềm báo trước cho sự mở cửa Bát chánh đạo (aṭṭhaṅgikamaggadvāra), việc cây ra hoa kết trái là điềm báo trước cho sự nở hoa bằng hoa giải thoát và sự trĩu nặng quả Sa-môn (sāmaññaphala), việc mười ngàn thế giới trở thành một chuỗi cờ phướn duy nhất là điềm báo trước cho sự trang hoàng bằng chuỗi cờ phướn của bậc Thánh (ariyaddhajamālā), cần phải hiểu như vậy.
Ayaṃ sambahulavāro nāma.
This is called the comprehensive occurrence.
Đây được gọi là trường hợp tổng hợp (sambahulavāra).
Ettha pañhe pucchanti – ‘‘yadā mahāpuriso pathaviyaṃ patiṭṭhahitvā uttarābhimukho gantvā āsabhiṃ vācaṃ bhāsati, tadā kiṃ pathaviyā gato, udāhu ākāsena?
Here, they ask a question: "When the Great Being stood on the ground, went facing north, and spoke the supreme utterance, did he go on the ground or through the sky?
Ở đây, họ đặt câu hỏi: “Khi Đại Nhân đứng vững trên mặt đất, hướng về phía Bắc và nói lời hùng tráng, lúc đó Ngài đi trên mặt đất hay trên không?
Dissamāno gato, udāhu adissamāno?
Did he go visible, or invisible?
Ngài đi hiện hữu hay vô hình?
Acelako gato, udāhu alaṅkatappaṭiyatto?
Did he go naked, or adorned and prepared?
Ngài đi trần truồng hay trang điểm lộng lẫy?
Daharo hutvā gato, udāhu mahallako?
Did he go as a youth, or as an old man?
Ngài đi khi còn trẻ hay đã lớn?
Pacchāpi kiṃ tādisova ahosi, udāhu puna bāladārako’’ti?
Afterwards, did he remain that way, or did he become a mere infant again?"
Sau đó Ngài vẫn như vậy hay lại trở thành một đứa bé?”
Ayaṃ pana pañho heṭṭhā lohapāsāde saṅghasannipāte tipiṭakacūḷābhayattherena vissajjitova.
This question was already answered by Tipiṭaka Cūḷābhaya Thera at the assembly of the Saṅgha beneath the Lohapāsāda.
Câu hỏi này đã được Trưởng lão Tipiṭaka Cūḷābhayatthera giải đáp trong buổi họp Tăng đoàn tại Loha Pāsāda phía dưới.
Thero kirettha niyati pubbekatakamma-issaranimmānavādavasena taṃ taṃ bahuṃ vatvā avasāne evaṃ byākāsi – ‘‘mahāpuriso pathaviyaṃ gato, mahājanassa pana ākāse gacchanto viya ahosi.
Indeed, the Elder, having spoken much here according to the doctrines of determinism (niyati), previous kamma (pubbekata kamma), and divine creation (issara nimmāna), finally answered thus: "The Great Being went on the ground, but to the great multitude, it was as if he went through the sky.
Trưởng lão đã nói nhiều điều liên quan đến thuyết định mệnh (niyati), thuyết nghiệp quá khứ (pubbekatakamma) và thuyết tạo hóa của Thượng đế (issaranimmānavāda), và cuối cùng đã giải thích như sau: “Đại Nhân đã đi trên mặt đất, nhưng đối với đại chúng thì dường như Ngài đi trên không.
Dissamāno gato, mahājanassa pana adissamāno viya ahosi.
He went visibly, but to the great multitude, it was as if he was invisible.
Ngài đã đi hiện hữu, nhưng đối với đại chúng thì dường như Ngài vô hình.
Acelako gato, mahājanassa pana alaṅkatappaṭiyattova upaṭṭhāsi.
He went naked, but to the great multitude, he appeared adorned and prepared.
Ngài đã đi trần truồng, nhưng đối với đại chúng thì Ngài xuất hiện như đã được trang điểm lộng lẫy.
Daharova gato, mahājanassa pana soḷasavassuddesiko viya ahosi.
He went as a mere youth, but to the great multitude, it was as if he was sixteen years old.
Ngài đã đi khi còn trẻ, nhưng đối với đại chúng thì dường như Ngài đã mười sáu tuổi.
Pacchā pana bāladārakova ahosi, na tādiso’’ti.
Afterwards, however, he was a mere infant again, not that way."
Sau đó Ngài lại trở thành một đứa bé, không còn như vậy nữa.”
Evaṃ vutte parisā cassa ‘‘buddhena viya hutvā bho therena pañho kathito’’ti attamanā ahosi.
When this was said, the assembly was delighted, thinking, "The Elder has answered the question as if he were the Buddha."
Khi được giải thích như vậy, hội chúng vô cùng hoan hỷ và nói: “Trưởng lão đã giải đáp câu hỏi như một vị Phật vậy!”
Lokantarikavāro vuttanayo eva.
The section on the intermundane is indeed as the method already stated.
Phần về Lokantarika (thế giới gian) cũng theo cách đã nói.
Viditāti pākaṭā hutvā.
“Viditā” means having become manifest.
Viditā có nghĩa là đã trở nên rõ ràng.
Yathā hi sāvakā nahānamukhadhovanakhādanapivanādikāle anokāsagate atītasaṅkhāre nippadese sammasituṃ na sakkonti, okāsapattayeva sammasanti, na evaṃ buddhā.
Just as disciples, when occupied with bathing, washing their faces, eating, drinking, and so on, are unable to reflect fully on past conditioned phenomena (saṅkhārā) in all their aspects, but reflect only when they have leisure, the Buddhas are not so.
Vì các đệ tử, khi không có cơ hội trong lúc tắm rửa, súc miệng, ăn uống, v.v., không thể quán xét các hành quá khứ mà không sót một phần nào, họ chỉ quán xét khi có cơ hội. Các vị Phật thì không như vậy.
Buddhā hi sattadivasabbhantare vavatthitasaṅkhāre ādito paṭṭhāya sammasitvā tilakkhaṇaṃ āropetvāva vissajjenti, tesaṃ avipassitadhammo nāma natthi, tasmā ‘‘viditā’’ti āha.
For the Buddhas, having reflected on the ascertained conditioned phenomena from the beginning within seven days, and having applied the three characteristics, declare them. There is no phenomenon unknown to them. Therefore, it is said “viditā”.
Các vị Phật, trong vòng bảy ngày, quán xét các hành đã được sắp đặt từ ban đầu, áp dụng ba đặc tướng (tilakkhaṇa) rồi mới giải đáp; không có pháp nào mà các Ngài không quán thấy. Do đó, Ngài nói: “viditā” (đã biết rõ).
Sesaṃ sabbattha uttānamevāti.
The rest is clear everywhere.
Phần còn lại ở tất cả mọi nơi đều rõ ràng.
209. Evaṃ me sutanti bākulasuttaṃ.
“Thus have I heard” refers to the Bākula Sutta.
209. Evaṃ me sutaṃ (Như vầy tôi nghe) là Kinh Bākula.
Tattha bākuloti yathā dvāvīsati dvattiṃsātiādimhi vattabbe bāvīsati bāttiṃsātiādīni vuccanti, evameva dvikuloti vattabbe bākuloti vuttaṃ.
Here, Bākula (meaning “of two families”) is said, just as people say “bāvīsati” (twenty-two) and “bāttiṃsāti” (thirty-two) instead of “dvāvīsati” and “dvattiṃsāti”.
Trong đó, Bākulo được nói như cách người đời nói “bāvīsati” (hai mươi hai) và “bāttiṃsa” (ba mươi hai) thay vì “dvāvīsati” và “dvattiṃsa”. Tương tự, thay vì nói “Dvikulo” (hai gia tộc), người ta nói “Bākulo”.
Tassa hi therassa dve kulāni ahesuṃ.
For that Elder had two families.
Vị Trưởng lão ấy có hai gia tộc.
So kira devaloko cavitvā kosambinagare nāma mahāseṭṭhikule nibbatto, tamenaṃ pañcame divase sīsaṃ nhāpetvā gaṅgākīḷaṃ akaṃsu.
It is said that he, having passed away from the deva-world, was reborn in a great wealthy family in the city named Kosambī. On the fifth day, they bathed his head and performed a Gaṅgā sport.
Ngài ấy, sau khi mệnh chung từ cõi trời, tái sinh vào gia đình một đại phú hộ tên là Kosambī. Vào ngày thứ năm, họ gội đầu cho Ngài và tổ chức trò chơi trên sông Gaṅgā.
Dhātiyā dārakaṃ udake nimujjanummujjanavasena kīḷāpentiyā eko maccho dārakaṃ disvā ‘‘bhakkho me aya’’nti maññamāno mukhaṃ vivaritvā upagato.
As the wet-nurse was playing with the child, immersing him in the water and bringing him up, a fish, seeing the child and thinking, “This is my food,” opened its mouth and approached.
Trong lúc người vú em đang chơi đùa với đứa bé bằng cách nhúng xuống nước rồi nhấc lên, một con cá thấy đứa bé, nghĩ rằng: “Đây là thức ăn của ta,” liền há miệng tiến đến.
Dhātī dārakaṃ chaḍḍetvā palātā.
The wet-nurse abandoned the child and fled.
Người vú em bỏ đứa bé lại và bỏ chạy.
Maccho taṃ gili.
The fish swallowed him.
Con cá nuốt đứa bé.
Puññavā satto dukkhaṃ na pāpuṇi, sayanagabbhaṃ pavisitvā nipanno viya ahosi.
The meritorious being did not experience suffering; it was as if he had entered a sleeping chamber and lay down.
Chúng sinh có phước báu không gặp khổ, Ngài an trú như thể đang nằm trong phòng ngủ.
Maccho dārakassa tejena tattakapallaṃ gilitvā dayhamāno viya vegena tiṃsayojanamaggaṃ gantvā bārāṇasinagaravāsino macchabandhassa jālaṃ pāvisi, mahāmacchā nāma jālabaddhā pahariyamānā maranti.
The fish, due to the child's power, felt as if it had swallowed a hot iron plate and was burning. It swiftly traveled a distance of thirty yojanas and entered the net of a fisherman living in the city of Bārāṇasī. Large fish caught in a net usually die when beaten.
Con cá, do uy lực của đứa bé, như thể nuốt phải một chảo nóng đang cháy, nhanh chóng bơi đi một quãng đường ba mươi dojana và mắc vào lưới của một ngư dân sống ở thành phố Bārāṇasī. Những con cá lớn khi bị mắc lưới và bị đánh thì chết.
Ayaṃ pana dārakassa tejena jālato nīhaṭamattova mato.
However, this fish, due to the child’s power, died as soon as it was taken out of the net.
Nhưng con cá này, do uy lực của đứa bé, vừa được kéo ra khỏi lưới thì liền chết.
Macchabandhā ca mahantaṃ macchaṃ labhitvā phāletvā vikkiṇanti.
The fishermen, having obtained a large fish, cut it open and sold it.
Các ngư dân, sau khi bắt được con cá lớn, liền mổ bụng và bán.
Taṃ pana dārakassa ānubhāvena aphāletvā sakalameva kājena haritvā sahassena demāti vadantā nagare vicariṃsu.
But, due to the child’s power, they did not cut it open. They carried it whole on a pole and went around the city, saying, “We will give it for a thousand (coins).”
Nhưng do oai lực của đứa bé, họ không mổ bụng mà mang nguyên con cá trên đòn gánh, rao khắp thành phố rằng: “Chúng tôi sẽ bán con cá này với giá một ngàn.”
Koci na gaṇhāti.
No one bought it.
Không ai mua.
Tasmiṃ pana nagare aputtakaṃ asītikoṭivibhavaṃ seṭṭhikulaṃ atthi, tassa dvāramūlaṃ patvā ‘‘kiṃ gahetvā dethā’’ti vuttā kahāpaṇanti āhaṃsu.
In that city, however, there was a wealthy family with eighty crores of wealth that had no children. When the fishermen reached their doorstep and asked, “What will you take for it?” they replied, “A kahāpaṇa.”
Trong thành phố ấy có một gia đình phú hộ không con, tài sản tám mươi crore. Khi họ đến trước cổng nhà phú hộ và hỏi: “Các ông bán gì?” thì các ngư dân trả lời: “Một đồng tiền vàng.”
Tehi kahāpaṇaṃ datvā gahito.
They paid a kahāpaṇa and bought it.
Họ liền trả một đồng tiền vàng và mua con cá.
Seṭṭhibhariyāpi aññesu divasesu macche na kelāyati, taṃ divasaṃ pana macchaṃ phalake ṭhapetvā sayameva phālesi.
The सेठṭhi’s wife, who usually did not enjoy fish on other days, that day placed the fish on a plank and cut it open herself.
Vợ của phú hộ, những ngày khác không bao giờ động đến cá, nhưng ngày hôm đó, bà đặt con cá lên một tấm ván và tự mình mổ bụng.
Macchañca nāma kucchito phālenti, sā pana piṭṭhito phālentī macchakucchiyaṃ suvaṇṇavaṇṇaṃ dārakaṃ disvā – ‘‘macchakucchiyaṃ me putto laddho’’ti nādaṃ naditvā dārakaṃ ādāya sāmikassa santikaṃ agamāsi.
Fish are typically cut from the belly, but she cut it from the back. Seeing a golden-colored child in the fish's belly, she cried out, “I have found a son in the fish's belly!” and taking the child, went to her husband.
Người ta thường mổ cá từ bụng, nhưng bà lại mổ từ lưng. Khi nhìn thấy đứa bé có màu vàng như vàng trong bụng cá, bà liền kêu lên: “Ta đã tìm thấy con trai ta trong bụng cá!” rồi ôm đứa bé đến gặp chồng.
Seṭṭhi tāvadeva bheriṃ carāpetvā dārakaṃ ādāya rañño santikaṃ gantvā – ‘‘macchakucchiyaṃ me deva dārako laddho, kiṃ karomī’’ti āha.
The seṭṭhi immediately had a drum beaten, and taking the child, went to the king, saying, “Your Majesty, I have found a child in the fish’s belly. What should I do?”
Phú hộ lập tức cho đánh trống, rồi ôm đứa bé đến gặp vua và thưa: “Thưa Đại vương, tôi đã tìm thấy một đứa bé trong bụng cá, tôi phải làm gì đây?”
Puññavā esa, yo macchakucchiyaṃ arogo vasi, posehi nanti.
The king replied, “This child is meritorious, for he lived unharmed in the fish’s belly. Raise him.”
Vua đáp: “Đứa bé này có phước báu, vì đã sống khỏe mạnh trong bụng cá. Hãy nuôi dưỡng nó!”
Assosi kho itaraṃ kulaṃ – ‘‘bārāṇasiyaṃ kira ekaṃ seṭṭhikulaṃ macchakucchiyaṃ dārakaṃ labhatī’’ti, te tattha agamaṃsu.
The other family heard, “It seems a seṭṭhi’s family in Bārāṇasī has found a child in a fish’s belly.” So they went there.
Gia đình kia (tức gia đình ở Kosambī) nghe nói: “Ở Bārāṇasī, hình như có một gia đình phú hộ tìm thấy một đứa bé trong bụng cá.” Họ liền đến đó.
Athassa mātā dārakaṃ alaṅkaritvā kīḷāpiyamānaṃ disvāva ‘‘manāpo vatāyaṃ dārako’’ti gantvā pavatiṃ ācikkhi.
Then, when his (the child’s) mother saw him adorned and being played with, she said, “This child is indeed charming!” and went to relate her story.
Khi mẹ của đứa bé (người mẹ nuôi ở Bārāṇasī) trang điểm cho đứa bé và đang chơi đùa với nó, người mẹ ruột vừa nhìn thấy đã nói: “Đứa bé này thật đáng yêu!” rồi đi đến kể lại câu chuyện.
Itarā mayhaṃ puttotiādimāha.
The other mother then said, “He is my son,” and so on.
Người kia (người mẹ nuôi) nói: “Đó là con của tôi,” v.v.
Kahaṃ te laddhoti?
“Where did you find him?”
“Bà tìm thấy nó ở đâu?”
Macchakucchiyanti.
“In the fish’s belly.”
“Trong bụng cá.”
No tuyhaṃ putto, mayhaṃ puttoti.
“He is not your son, he is my son.”
“Không phải con của bà, mà là con của tôi!”
Kahaṃ te laddhoti?
“Where did you find him?”
“Bà tìm thấy nó ở đâu?”
Mayā dasamāse kucchiyā dhārito, atha naṃ nadiyā kīḷāpiyamānaṃ maccho gilīti.
“I carried him in my womb for ten months, and then, while he was being played with in the river, a fish swallowed him.”
“Tôi đã mang thai nó mười tháng trong bụng, sau đó, khi nó đang chơi đùa trên sông, một con cá đã nuốt nó.”
Tuyhaṃ putto aññena macchena gilito bhavissati, ayaṃ pana mayā macchakucchiyaṃ laddhoti, ubhopi rājakulaṃ agamaṃsu.
“Your son must have been swallowed by another fish. But this one I found in the fish’s belly.” Both went to the royal court.
“Con của bà chắc là bị con cá khác nuốt rồi, còn đứa bé này thì tôi tìm thấy trong bụng cá.” Cả hai đều đến gặp vua.
Rājā āha – ‘‘ayaṃ dasa māse kucchiyā dhāritattā amātā kātuṃ na sakkā, macchaṃ gaṇhantāpi vakkayakanādīni bahi katvā gaṇhantā nāma natthīti macchakucchiyaṃ laddhattā ayampi amātā kātuṃ na sakkā, dārako ubhinnampi kulānaṃ dāyādo hotu, ubhopi naṃ jaggathā’’ti ubhopi jaggiṃsu.
The king said, “This woman, having carried him in her womb for ten months, cannot be denied as his mother. And those who buy fish do not take it out after removing the guts and so on. Therefore, this woman, having found him in the fish’s belly, also cannot be denied as his mother. Let the child be an heir to both families, and both of you shall raise him.” So both raised him.
Vua nói: “Vì người phụ nữ này đã mang thai đứa bé mười tháng trong bụng, không thể nói bà ấy không phải là mẹ. Và những người mua cá không bao giờ bỏ ruột gan ra ngoài khi mua, nên cũng không thể nói người phụ nữ tìm thấy đứa bé trong bụng cá không phải là mẹ. Đứa bé này hãy là người thừa kế của cả hai gia đình, và cả hai hãy cùng nuôi dưỡng nó.” Thế là cả hai cùng nuôi dưỡng đứa bé.
Viññutaṃ pattassa dvīsupi nagaresu pāsādaṃ kāretvā nāṭakāni paccupaṭṭhāpesuṃ.
When he came of age, palaces were built for him in both cities, and theatrical performances were arranged.
Khi đứa bé trưởng thành, họ xây cung điện ở cả hai thành phố và sắp đặt các vũ nữ cho Ngài.
Ekekasmiṃ nagare cattāro cattāro māse vasati, ekasmiṃ nagare cattāro māse vuṭṭhassa saṅghāṭanāvāya maṇḍapaṃ kāretvā tattha naṃ saddhiṃ nāṭakāhi āropenti.
He lived four months in each city. For him, having lived four months in one city, a pavilion was built on a raft, and he was brought there together with the dancers.
Ngài sống bốn tháng ở mỗi thành phố. Khi Ngài đã sống bốn tháng ở một thành phố, họ dựng một gian lều trên một chiếc thuyền lớn, rồi đưa Ngài cùng các vũ nữ lên đó.
So sampattiṃ anubhavamāno itaraṃ nagaraṃ gacchati.
Enjoying such prosperity, he went to the other city.
Ngài hưởng thụ tài sản và đi đến thành phố kia.
Taṃnagaravāsino nāṭakāni upaḍḍhamaggaṃ agamaṃsu.
The dancers from that city came halfway to meet him.
Các vũ nữ của thành phố đó đi ra nửa đường để đón Ngài.
Te paccuggantvā taṃ parivāretvā attano pāsādaṃ nayanti.
They met him, surrounded him, and took him to their palace.
Họ đón Ngài, bao quanh Ngài và đưa Ngài về cung điện của họ.
Itarāni nāṭakāni nivattitvā attano nagarameva gacchanti.
The other dancers returned to their own city.
Các vũ nữ kia quay về thành phố của mình.
Tattha cattāro māse vasitvā teneva niyāmena puna itaraṃ nagaraṃ gacchati.
Having stayed there for four months, he then went to the other city again in the same manner.
Sau khi sống bốn tháng ở đó, Ngài lại theo cách đó đi đến thành phố kia.
Evamassa sampattiṃ anubhavantassa asīti vassāni paripuṇṇāni.
Thus, while he was enjoying such prosperity, eighty years passed for him.
Cứ như vậy, Ngài hưởng thụ tài sản cho đến khi tám mươi năm trôi qua.
Atha bhagavā cārikaṃ caramāno bārāṇasiṃ patto.
Then the Blessed One, wandering on tour, arrived in Bārāṇasī.
Sau đó, Đức Thế Tôn du hành và đến Bārāṇasī.
So bhagavato santike dhammaṃ sutvā paṭiladdhasaddho pabbajito.
Having heard the Dhamma from the Blessed One, he gained faith and was ordained.
Ngài Bākula, sau khi nghe Pháp từ Đức Thế Tôn, phát sinh niềm tin và xuất gia.
Pabbajitvā sattāhameva puthujjano ahosi, aṭṭhame pana so saha paṭisambhidāhi arahattaṃ pāpuṇīti evamassa dve kulāni ahesuṃ.
After ordination, he remained a puthujjana for only seven days. On the eighth day, he attained arahatta together with the paṭisambhidās. Thus, he had two families.
Sau khi xuất gia, Ngài chỉ là phàm nhân trong bảy ngày, nhưng vào ngày thứ tám, Ngài chứng đắc A-la-hán cùng với các phân tích tuệ (paṭisambhidā). Như vậy, Ngài có hai gia tộc.
Tasmā bākuloti saṅkhaṃ agamāsīti.
Therefore, he came to be known as Bākula.
Do đó, Ngài được gọi là Bākula.
Purāṇagihisahāyoti pubbe gihikāle sahāyo.
“ Purāṇagihisahāyo” means a companion from his former household life.
Purāṇagihisahāyo nghĩa là bạn bè từ thời còn là gia chủ.
Ayampi dīghāyukova theraṃ pabbajitaṃ passituṃ gacchanto asītime vasse gato.
This ascetic Kassapa also, being long-lived, went to see the Elder who had been ordained, when he was eighty years old.
Vị Acelakassapa này cũng là người sống lâu. Khi đi thăm vị Trưởng lão đã xuất gia, ông đã ở tuổi tám mươi.
Methuno dhammoti bālo naggasamaṇako bālapucchaṃ pucchati, na sāsanavacanaṃ, idāni therena dinnanaye ṭhito imehi pana teti pucchi.
By the word “ methuno dhammo,” the ignorant naked ascetic (Acelaka Kassapa) asks a foolish question, not a monastic question. Now, standing in the manner given by the Elder, he asked, “And with these (vows)?”
Methuno dhammo có nghĩa là vị sa môn trần truồng ngu dốt hỏi câu hỏi ngu dốt, không phải là lời dạy của giáo pháp. Bây giờ, Acelakassapa, sau khi được Trưởng lão chỉ dạy, đã hỏi: “ imehi pana te” (những điều này đối với Ngài).
210. Yaṃpāyasmātiādīni padāni sabbavāresu dhammasaṅgāhakattherehi niyametvā ṭhapitāni.
The words beginning with “ Yaṃpāyasmā” (whatever, venerable sir) were fixed and established by the Dhamma-reciting elders in all recitations.
210. Các từ như yaṃpāyasmā, v.v., đã được các vị Trưởng lão kết tập giáo pháp quy định trong tất cả các phần.
Tattha saññā uppannamattāva, vitakko kammapathabhedakoti.
There, saññā (perception) is merely arising, vitakka (thought) breaks the path of kamma.
Trong đó, saññā (tưởng) chỉ mới phát sinh, còn vitakka (tầm) là sự phân biệt nghiệp đạo.
Thero panāha – ‘‘kasmā visuṃ karotha, ubhayampetaṃ kammapathabhedakamevā’’ti.
But the Elder said, “Why do you separate them? Both of these indeed break the path of kamma.”
Tuy nhiên, vị Trưởng lão (Mahādhammarakkhita) nói: “Tại sao lại chia riêng ra? Cả hai đều là sự phân biệt nghiệp đạo.”
211. Gahapaticīvaranti vassāvāsikaṃ cīvaraṃ.
“ Gahapaticīvaraṃ” means a robe offered by householders for the rains retreat.
211. Gahapaticīvaraṃ là y phục được cúng dường trong mùa an cư.
Satthenāti pipphalakena.
“ Satthenā” means with a razor.
Satthenā có nghĩa là bằng dao cạo.
Sūciyāti sūciṃ gahetvā sibbitabhāvaṃ na sarāmīti attho.
“ Sūciyā” means, “I do not remember having taken a needle and sewn.” This is the meaning.
Sūciyā có nghĩa là tôi không nhớ đã từng cầm kim may vá. Đó là ý nghĩa.
Kathine cīvaranti kathinacīvaraṃ, kathinacīvarampi hi vassāvāsikagatikameva.
“ Kathine cīvaraṃ” means the kathina robe, for the kathina robe also follows the same category as the rains-residence robe.
Kathine cīvaraṃ là y Kathina. Y Kathina cũng thuộc loại y an cư.
Tasmā tattha ‘‘sibbitā nābhijānāmī’’ti āha.
Therefore, it is said there, “I do not recall having sewn.”
Do đó, ở đó Ngài nói: “Tôi không biết đã may vá.”
Ettakaṃ panassa kālaṃ gahapaticīvaraṃ asādiyantassa chindanasibbanādīni akarontassa kuto cīvaraṃ uppajjatīti.
But during such a long time, not accepting a householder’s robe, not cutting or sewing, from where did robes arise for him?
Trong suốt thời gian ấy, khi Ngài không chấp nhận y phục của gia chủ, không cắt may, v.v., thì y phục từ đâu mà có?
Dvīhi nagarehi.
From the two cities.
Từ hai thành phố.
Thero hi mahāyasassī, tassa puttadhītaro nattapanattakā sukhumasāṭakehi cīvarāni kāretvā rajāpetvā samugge pakkhipitvā pahiṇanti.
For the Elder was greatly renowned; his sons, daughters, grandsons, and great-grandsons had robes made of fine cloth, dyed them, placed them in baskets, and sent them.
Vị Trưởng lão có uy tín lớn, con trai, con gái, cháu nội, cháu ngoại của Ngài làm y phục bằng vải lụa mịn, nhuộm màu, rồi bỏ vào hộp và gửi đến.
Therassa nhānakāle nhānakoṭṭhake ṭhapenti.
They would place them in the bathing chamber when the Elder was to bathe.
Khi Ngài tắm, họ đặt y phục trong phòng tắm.
Thero tāni nivāseti ceva pārupati ca, purāṇacīvarāni sampattapabbajitānaṃ deti.
The Elder would both wear and drape them, and give his old robes to visiting monastics.
Vị Trưởng lão mặc và đắp những y phục đó, còn những y phục cũ thì Ngài cho các tỳ khưu mới đến.
Thero tāni nivāsetvā ca pārupitvā ca navakammaṃ na karoti, kiñci āyūhanakammaṃ natthi.
Having put on and worn those robes, the elder does no new work; there is no accumulating kamma.
Vị Trưởng lão ấy, sau khi mặc và đắp những y phục đó, không làm công việc mới nào, không có bất kỳ công việc tự mình nỗ lực nào.
Phalasamāpattiṃ appetvā appetvā nisīdati.
He sits, repeatedly entering Fruition Attainment.
Vị ấy nhập và nhập quả định rồi ngồi.
Catūsu māsesu pattesu lomakiliṭṭhāni honti, athassa puna teneva niyāmena pahiṇitvā denti.
When four months had passed, the robes became soiled with hair, and then they would present him with robes again in the same manner.
Khi bốn tháng trôi qua, chúng trở nên cũ kỹ, rồi họ lại gửi y phục đến cho vị ấy theo cùng cách đó.
Aḍḍhamāse aḍḍhamāse parivattatītipi vadantiyeva.
And some say that he would change robes every half month.
Một số vị nói rằng cứ nửa tháng là thay y phục.
Anacchariyañcetaṃ therassa mahāpuññassa mahābhiññassa satasahassakappe pūritapāramissa, asokadhammarañño kulūpako nigrodhatthero divasassa nikkhattuṃ cīvaraṃ parivattesi.
And this was no wonder for the Elder, whose great merit, great supernormal powers, and Perfections had been fulfilled for one hundred thousand aeons; for Elder Nigrodha, who was a close attendant to King Asoka, would change his robes three times a day.
Và điều này không có gì lạ đối với vị Trưởng lão có đại phước, đại thắng trí, đã viên mãn các ba-la-mật trong một trăm ngàn kiếp. Vị Trưởng lão Nigrodha, người thân cận của vua Asokadhamma, đã thay y phục ba lần mỗi ngày.
Tassa hi ticīvaraṃ hatthikkhandhe ṭhapetvā pañcahi ca gandhasamuggasatehi pañcahi ca mālāsamuggasatehi saddhiṃ pātova āhariyittha, tathā divā ceva sāyañca.
Indeed, his three robes would be brought early in the morning, placed on an elephant's back, along with five hundred fragrant perfume caskets and five hundred flower caskets, and similarly at noon and in the evening.
Thật vậy, ba y của vị ấy được đặt trên lưng voi, cùng với năm trăm hộp hương và năm trăm hộp hoa, được mang đến vào buổi sáng, cũng như vào buổi trưa và buổi tối.
Rājā kira divasassa nikkhattuṃ sāṭake parivattento ‘‘therassa cīvaraṃ nīta’’nti pucchitvā ‘‘āma nīta’’nti sutvāva parivattesi.
It is said that the king, when changing his own clothes three times a day, would only change them after asking if the Elder's robes had been brought, and hearing "Yes, they have been brought".
Người ta nói rằng nhà vua, khi thay xiêm y ba lần mỗi ngày, đã hỏi: “Y phục của Trưởng lão đã được mang đến chưa?” và chỉ khi nghe “Vâng, đã mang đến rồi” thì ngài mới thay y phục.
Theropi na bhaṇḍikaṃ bandhitvā ṭhapesi, sampattasabrahmacārīnaṃ adāsi.
The Elder himself did not bundle them up and keep them, but gave them to the brahmacārīs who arrived.
Vị Trưởng lão cũng không buộc thành gói mà giữ lại, mà đã cho các đồng phạm hạnh đến thăm.
Tadā kira jambudīpe bhikkhusaṅghassa yebhuyyena nigrodhasseva santakaṃ cīvaraṃ ahosi.
It is said that at that time, most of the robes for the Bhikkhu Saṅgha in Jambudīpa belonged to Elder Nigrodha.
Người ta nói rằng vào thời đó, phần lớn y phục của Tăng đoàn ở Jambudīpa là của riêng Trưởng lão Nigrodha.
Aho vata maṃ koci nimanteyyāti kiṃ pana cittassa anuppādanaṃ bhāriyaṃ, uppannassa pahānanti.
"Oh, if only someone would invite me!" — Is it difficult for such a thought not to arise, or is it difficult to abandon it once it has arisen?
Ôi, ước gì có ai đó mời tôi! Việc không khởi lên ý nghĩ có khó khăn không, hay việc đoạn trừ ý nghĩ đã khởi lên mới khó khăn?
Cittaṃ nāma lahukaparivattaṃ, tasmā anuppādanaṃ bhāriyaṃ, uppannassa pahānampi bhāriyameva.
The mind is swift in change; therefore, preventing its arising is difficult, and abandoning it once it has arisen is also difficult.
Tâm là thứ biến đổi nhanh chóng, vì vậy việc không khởi lên là khó khăn, và việc đoạn trừ ý nghĩ đã khởi lên cũng khó khăn không kém.
Antaraghareti mahāsakuludāyisutte (ma. ni. 2.237) indakhīlato paṭṭhāya antaragharaṃ nāma idha nimbodakapatanaṭṭhānaṃ adhippetaṃ.
"Within the village": In the Mahāsakuludāyī Sutta, "within the village" refers to the area from the city gate pillar onwards, but here it is intended as the place where the drip-water falls from the eaves.
Antaraghare (trong nhà): Trong kinh Mahāsakuludāyī (Trung Bộ 2.237), từ cột trụ cửa trở đi được gọi là antaraghara. Ở đây, nó được hiểu là nơi nước nhỏ giọt từ mái hiên.
Kuto panassa bhikkhā uppajjitthāti.
How, then, did the Elder obtain alms?
Vậy thì vị ấy nhận được vật thực khất thực từ đâu?
Thero dvīsu nagaresu abhiññāto, gehadvāraṃ āgatassevassa pattaṃ gahetvā nānārasabhojanassa pūretvā denti.
The Elder was well-known in two cities; as soon as he arrived at a house door, they would take his bowl, fill it with various delicious foods, and give it to him.
Vị Trưởng lão nổi tiếng ở hai thành phố, khi vị ấy đến cửa nhà, họ liền lấy bát, đổ đầy các loại thức ăn ngon và dâng cúng.
So laddhaṭṭhānato nivattati, bhattakiccakaraṇaṭṭhānaṃ panassa nibaddhameva ahosi.
He would return from the place where he received alms, but the place for his meal remained fixed.
Vị ấy trở về từ nơi đã nhận được, và nơi để dùng bữa của vị ấy thì luôn cố định.
Anubyañjanasoti therena kira rūpe nimittaṃ gahetvā mātugāmo na olokitapubbo.
"By minor characteristics": It is said that the Elder had never previously looked at a woman by taking a sign in her form.
Anubyañjanaso (theo từng chi tiết): Người ta nói rằng vị Trưởng lão chưa bao giờ nhìn phụ nữ với ý niệm về hình sắc.
Mātugāmassa dhammanti mātugāmassa chappañcavācāhi dhammaṃ desetuṃ vaṭṭati, pañhaṃ puṭṭhena gāthāsahassampi vattuṃ vaṭṭatiyeva.
"The Dhamma for women": It is permissible to teach the Dhamma to women with five or six words, and when asked a question, it is even permissible to speak a thousand verses.
Mātugāmassa dhamma (pháp cho phụ nữ): Được phép thuyết pháp cho phụ nữ bằng năm sáu lời, và khi được hỏi một câu hỏi, cũng được phép nói cả ngàn bài kệ.
Thero pana kappiyameva na akāsi.
But the Elder did not do what was allowable.
Nhưng vị Trưởng lão không làm điều đó, dù là hợp pháp.
Yebhuyyena hi kulūpakatherānametaṃ kammaṃ hoti.
Indeed, this work usually falls to the elders who frequent households.
Thật vậy, đây thường là công việc của các vị Trưởng lão thân cận gia đình.
Bhikkhunupassayanti bhikkhuniupassayaṃ.
"Nunnery": A dwelling for bhikkhunīs.
Bhikkhunupassaya (chỗ ở của Tỳ-khưu-ni): Chỗ ở của Tỳ-khưu-ni.
Taṃ pana gilānapucchakena gantuṃ vaṭṭati, thero pana kappiyameva na akāsi.
It is permissible for one who visits the sick to go there, but the Elder did not do what was allowable.
Tuy nhiên, được phép đến đó để hỏi thăm người bệnh, nhưng vị Trưởng lão không làm điều đó, dù là hợp pháp.
Esa nayo sabbattha.
This method applies everywhere.
Nguyên tắc này áp dụng cho tất cả các trường hợp.
Cuṇṇenāti kosambacuṇṇādinā.
"With powder": With kosamba powder and so forth.
Cuṇṇenā (bằng bột): Bằng bột Kosamba, v.v.
Gattaparikammeti sarīrasambāhanakamme.
"Body care": In the work of massaging the body.
Gattaparikamme (trong việc chăm sóc thân thể): Trong việc xoa bóp thân thể.
Vicāritāti payojayitā.
"Vicāritā": Employed.
Vicāritā (được sử dụng): Được áp dụng.
Gaddūhanamattanti gāviṃ thane gahetvā ekaṃ khīrabinduṃ dūhanakālamattampi.
"Length of milking a cow": Even for the time it takes to grasp a cow's teat and milk one drop of milk.
Gaddūhanamatta (chỉ bằng thời gian vắt sữa): Chỉ bằng thời gian vắt một giọt sữa bằng cách nắm vú bò.
Kena pana kāraṇena thero nirābādho ahosi.
For what reason, then, was the Elder free from illness?
Vậy vì lý do gì mà vị Trưởng lão không có bệnh tật?
Padumuttare kira bhagavati satasahassabhikkhuparivāre cārikaṃ caramāne himavati visarukkhā pupphiṃsu.
It is said that when the Blessed One Padumuttara was touring with a retinue of one hundred thousand bhikkhus, poisonous trees bloomed in the Himālaya.
Người ta nói rằng khi Đức Thế Tôn Padumuttara, với một trăm ngàn Tỳ-khưu tùy tùng, đang du hành, những cây độc ở Himavanta đã nở hoa.
Bhikkhusatasahassānampi tiṇapupphakarogo uppajjati.
One hundred thousand bhikkhus also developed a disease from grass and flowers.
Cả trăm ngàn Tỳ-khưu đều mắc bệnh hoa cỏ.
Thero tasmiṃ samaye iddhimā tāpaso hoti, so ākāsena gacchanto bhikkhusaṅghaṃ disvā otaritvā rogaṃ pucchitvā himavantato osadhaṃ āharitvā adāsi.
At that time, the Elder was an ascetic with psychic powers; seeing the Saṅgha of bhikkhus as he traveled through the air, he descended, inquired about the illness, brought medicine from the Himālaya, and gave it to them.
Vị Trưởng lão vào thời điểm đó là một đạo sĩ có thần thông, khi bay trên không nhìn thấy Tăng đoàn, vị ấy đã hạ xuống, hỏi về bệnh tật, rồi mang thuốc từ Himavanta đến và dâng cúng.
Upasiṅghanamatteneva rogo vūpasami.
The illness subsided merely by smelling it.
Chỉ bằng cách ngửi, bệnh tật đã thuyên giảm.
Kassapasammāsambuddhakālepi paṭhamavappadivase vappaṃ ṭhapetvā bhikkhusaṅghassa paribhogaṃ aggisālañceva vaccakuṭiñca kāretvā bhikkhusaṅghassa bhesajjavattaṃ nibandhi, iminā kammena nirābādho ahosi.
Even during the time of Kassapa Sammāsambuddha, on the first day of cultivation, he set aside the plowing, had a fire-hut and a latrine built for the use of the Bhikkhu Saṅgha, and established a regular offering of medicine for the Bhikkhu Saṅgha; by this action, he became free from illness.
Vào thời Đức Chánh Đẳng Giác Kassapa, vào ngày gieo trồng đầu tiên, sau khi gieo trồng, vị ấy đã xây dựng một nhà lửa và một nhà vệ sinh để Tăng đoàn sử dụng, và đã thiết lập việc cúng dường thuốc men thường xuyên cho Tăng đoàn. Nhờ nghiệp này mà vị ấy không có bệnh tật.
Ukkaṭṭhanesajjiko panesa ukkaṭṭhāraññako ca tasmā ‘‘nābhijānāmi apassenakaṃ apassayitā’’tiādimāha.
But this Elder was an accomplished nesajjika and an accomplished araññaka, hence he said, "I do not remember having leaned upon a reclining board," and so on.
Vị ấy là người thực hành dhutaṅga nằm thường xuyên và dhutaṅga sống trong rừng thường xuyên, vì vậy ngài đã nói: “Tôi không biết người đã dùng chỗ nằm dựa.”
Saraṇoti sakileso.
"Saraṇo": Possessing defilements.
Saraṇo (có nương tựa): Có phiền não.
Aññā udapādīti anupasampannassa aññaṃ byākātuṃ na vaṭṭati.
"Aññā udapādī": It is not permissible for an unordained person to declare arahantship.
Aññā udapādī (tri kiến đã khởi lên): Không được phép tuyên bố A-la-hán quả cho người chưa thọ giới.
Thero kasmā byākāsi?
Why did the Elder declare it?
Tại sao vị Trưởng lão lại tuyên bố?
Na thero ahaṃ arahāti āha, aññā udapādīti panāha.
The Elder did not say, "I am an Arahant," but rather, "Aññā udapādī."
Vị Trưởng lão không nói: “Tôi là A-la-hán”, mà nói: “Tri kiến đã khởi lên”.
Apica thero arahāti pākaṭo, tasmā evamāha.
Moreover, the Elder was clearly an Arahant, which is why he spoke in this way.
Hơn nữa, vị Trưởng lão được biết đến là A-la-hán, vì vậy ngài đã nói như vậy.
Nisinnakova parinibbāyīti ahaṃ dharamānopi na aññassa bhikkhussa bhāro ahosiṃ, parinibbutassāpi me sarīraṃ bhikkhusaṅghassa palibodho mā ahosīti tejodhātuṃ samāpajjitvā parinibbāyi.
"He attained Parinibbāna while sitting": "May my body not be a burden to the Bhikkhu Saṅgha even while I am alive, nor after I have attained Parinibbāna," having thus resolved, he entered the fire element (tejodhātu) and attained Parinibbāna.
Nisinnakova parinibbāyī (ngồi mà nhập Niết-bàn): Tôi khi còn sống cũng không là gánh nặng cho bất kỳ Tỳ-khưu nào khác, và khi nhập Niết-bàn, thân thể của tôi cũng không nên trở thành chướng ngại cho Tăng đoàn. Với ý nghĩ đó, vị ấy đã nhập tejodhātu (hỏa giới) và nhập Niết-bàn.
Sarīrato jālā uṭṭhahi, chavimaṃsalohitaṃ sappi viya jhāyamānaṃ parikkhayaṃ gataṃ, sumanamakulasadisā dhātuyova avasesiṃsu.
Flames arose from his body; his skin, flesh, and blood were consumed like ghee, and only relics resembling jasmine buds remained.
Ngọn lửa bốc lên từ thân thể, da thịt máu mủ tiêu tan như bơ tan chảy, chỉ còn lại các di cốt giống như nụ hoa lài.
Sesaṃ sabbattha pākaṭameva.
The rest is clear everywhere.
Phần còn lại đều rõ ràng ở khắp mọi nơi.
Idaṃ pana suttaṃ dutiyasaṅgahe saṅgītanti.
This Sutta was recited in the Second Saṅgaha.
Kinh này đã được kết tập trong kỳ Kết tập thứ hai.
Phuseyyāti labheyya.
"Phuseyyā": May obtain.
Phuseyyā (có thể đạt được): Có thể đạt được.
Ekaggatanti evaṃ paṭipanno samāpattiṃ nāma labhati, jhānaṃ nāma labhatīti idaṃ mayā sutanti vadati.
"One-pointedness": Thus, a practitioner obtains concentration (samāpatti), obtains jhāna; this is what I have heard, thus he says.
Ekaggata (nhất tâm): Tôi nghe rằng người thực hành như vậy sẽ đạt được samāpatti (thiền định), đạt được jhāna (thiền na) – đó là điều tôi nghe.
Kilamathoti kāyakilamatho.
"Fatigue": Physical fatigue.
Kilamatho (sự mệt mỏi): Sự mệt mỏi của thân thể.
Vihesāti sveva kilamatho vutto.
"Hardship": That very same fatigue is stated.
Vihesā (sự phiền nhiễu): Chính là sự mệt mỏi đó.
Yathāsake tiṭṭheyyāsīti attano ajānanakoṭṭhāseyeva tiṭṭheyyāsīti.
"May you remain in your own position": May you remain in that part which you do not know.
Yathāsake tiṭṭheyyāsī (hãy giữ nguyên vị trí của bạn): Hãy giữ nguyên vị trí của bạn trong phần mà bạn không biết.
215. Hatthidammā vā assadammā vā godammā vāti ettha adantahatthidammādayo viya cittekaggarahitā puggalā daṭṭhabbā.
215. "Tamed elephants, or tamed horses, or tamed cows": Here, those individuals who are without one-pointedness of mind should be seen as untamed elephants, etc.
215. Hatthidammā vā assadammā vā godammā vā (voi đã được thuần hóa, ngựa đã được thuần hóa, bò đã được thuần hóa): Ở đây, những người không có sự nhất tâm nên được xem như những con voi, v.v., chưa được thuần hóa.
Dantahatthiādayo viya cittekaggasampannā.
Those endowed with one-pointedness of mind are like tamed elephants, etc.
Những người có sự nhất tâm nên được xem như những con voi, v.v., đã được thuần hóa.
Yathā adantahatthidammādayo kūṭākāraṃ akatvā dhuraṃ achaḍḍetvā dantagamanaṃ vā gantuṃ, dantehi vā pattabbaṃ bhūmiṃ pāpuṇituṃ na sakkonti, evameva cittekaggarahitā sampannacittekaggehi nibbattitaguṇaṃ vā nibbattetuṃ pattabhūmiṃ vā pāpuṇituṃ na sakkonti.
Just as untamed elephants, etc., cannot go on a tamed path or reach the ground to be reached by the tamed, without acting with deceit and without abandoning the yoke, so too, those without one-pointedness of mind cannot bring forth the qualities produced by those with complete one-pointedness of mind, nor can they reach the stage to be reached.
Cũng như những con voi, v.v., chưa được thuần hóa không thể đi theo con đường đã được thuần hóa hoặc đạt đến vùng đất đã được thuần hóa mà không làm những hành động gian xảo hoặc không bỏ gánh nặng, thì những người không có sự nhất tâm cũng không thể làm phát sinh những phẩm chất được phát sinh bởi những người có sự nhất tâm hoàn hảo, hoặc đạt đến vùng đất đã được đạt đến.
217. Nāgavanikanti hatthipadopame (ma. ni. 1.288 ādayo) nāgavanacarako puriso ‘‘nāgavaniko’’ti vutto, idha hatthisikkhāya kusalo hatthiṃ gahetuṃ samattho.
217. Nāgavanika (elephant-forest dweller) refers to a man who roams in an elephant forest, as mentioned in the Hatthipadopama Sutta and similar texts. Here, in the Dantabhūmi Sutta, it refers to a man skilled in elephant training, capable of capturing an elephant.
217. Nāgavanika (người ở rừng voi): Trong (Ma. Ni. 1.288 và các kinh khác) Hatthisadopama Sutta, người đi lại trong rừng voi được gọi là “Nāgavanika”. Ở đây, nó chỉ người thiện xảo trong việc huấn luyện voi, có khả năng bắt voi.
Atipassitvāti disvā.
Atipassitvā means having seen (good elephants and bad elephants).
Atipassitvā (sau khi quan sát kỹ): là sau khi thấy.
Etthagedhāti etasmiṃ pavattagedhā.
Etthagedhā means having attachment arising in that assembly of elephants in the elephant forest.
Etthagedhā (tham đắm ở đây): là sự tham đắm khởi lên trong khu rừng voi đó.
Sarasaṅkappānanti dhāvanasaṅkappānaṃ.
Sarasaṅkappāna refers to intentions of tormenting.
Sarasaṅkappāna (những tư niệm làm tổn hại): là những tư niệm muốn làm tổn hại.
Manussakantesu sīlesu samādapanāyāti ettha yadā nāgo itthipurisehi kumārakumārikāhi soṇḍādīsu gahetvā upakeḷayamāno vikāraṃ na karoti sukhāyati, tadānena manussakantāni sīlāni samādinnāni nāma honti.
Regarding manussakantesu sīlesu samādapanāyā, when an elephant, being taken by men, women, young boys, and young girls by its trunk and so forth, is sporting and does not act wildly, but rather feels at ease, then it is said that agreeable human behaviors have been undertaken by that elephant.
Manussakantesu sīlesu samādapanāyā (để thọ trì những giới hạnh được loài người ưa thích): Ở đây, khi con voi không có phản ứng bất thường khi được nam nữ, trẻ em trai và trẻ em gái nắm vòi hay chơi đùa, và nó cảm thấy dễ chịu, thì lúc đó con voi này được gọi là đã thọ trì những giới hạnh được loài người ưa thích.
Pemanīyāti tāta rājā te pasanno maṅgalahatthiṭṭhāneva ṭhapessati, rājārahāni bhojanādīni labhissasīti evarūpī nāgehi piyāpitabbā kathā.
Pemanīyā refers to agreeable speech such as, "My dear elephant, the king is pleased with you; he will place you in the position of a royal elephant, and you will receive food and other provisions fit for a king."
Pemanīyā (lời nói dễ thương): là lời nói như thế này: “Này con voi, đức vua đã hoan hỷ với con, ngài sẽ đặt con vào vị trí voi chúa, con sẽ nhận được thức ăn xứng đáng với vua chúa, v.v.”, là lời nói mà các người huấn luyện voi cần nói để làm cho voi yêu mến.
Sussūsatīti taṃ pemanīyakathaṃ sotukāmo hoti.
Sussūsatī means he wishes to hear that agreeable speech.
Sussūsatī (muốn nghe): là muốn nghe lời nói dễ thương đó.
Tiṇaghāsodakanti tiṇaghāsañceva udakañca, tiṇaghāsanti ghāsitabbaṃ tiṇaṃ, khāditabbanti attho.
Tiṇaghāsodaka means both grass (food) and water. Tiṇaghāsa means grass to be eaten, that is, to be consumed.
Tiṇaghāsodaka (cỏ, thức ăn và nước): là cỏ và nước. Tiṇaghāsa (thức ăn cỏ): có nghĩa là cỏ để ăn, để nhai.
223. Evaṃ me sutanti bhūmijasuttaṃ.
223. Evaṃ me sutaṃ is the Bhūmija Sutta.
223. Evaṃ me suta (Như vầy tôi nghe): là kinh Bhūmija.
Tattha bhūmijoti ayaṃ thero jayasenarājakumārassa mātulo.
There, Bhūmija is the elder who was the maternal uncle of Prince Jayasena.
Ở đây, Bhūmijo (Bhūmija): vị Trưởng lão này là cậu của hoàng tử Jayasena.
Āsañca anāsañcāti kālena āsaṃ kālena anāsaṃ.
Āsañca anāsañcā means sometimes hoping (for human or divine rebirth, or Nibbāna), sometimes not hoping.
Āsañca anāsañcā (lúc có ước muốn, lúc không có ước muốn): lúc có ước muốn, lúc không có ước muốn.
Sakena thālipākenāti pakatipavattāya bhikkhāya attano niṭṭhitabhattatopi bhattena parivisi.
Sakena thālipākenā means he served food from his own cooked meal, even from that which was prepared for himself (Prince Jayasena), in addition to the regularly offered alms food.
Sakena thālipākenā (bằng phần cơm của mình): vị ấy đã dâng cơm từ phần cơm đã chuẩn bị cho chính mình, ngoài phần khất thực thông thường.
Sesaṃ sabbattha uttānamevāti.
The rest is clear everywhere.
Phần còn lại là rõ ràng ở mọi nơi.
230. Evaṃ me sutanti anuruddhasuttaṃ.
230. Evaṃ me sutaṃ is the Anuruddha Sutta.
230. Evaṃ me suta (Như vầy tôi nghe): là kinh Anuruddha.
Tattha evamāhaṃsūti tassa upāsakassa aphāsukakālo ahosi, tadā upasaṅkamitvā evamāhaṃsu.
There, evamāhaṃsū means when that lay follower (Pañcakaṅga) was unwell, they approached him and spoke thus.
Ở đây, evamāhaṃsū (họ đã nói như vầy): khi vị cư sĩ đó lâm bệnh, các vị tỳ khưu đã đến và nói như vầy.
Apaṇṇakanti avirādhitaṃ.
Apaṇṇaka means unerring.
Apaṇṇaka (không sai lạc): là không sai lạc.
Ekatthāti appamāṇāti vā mahaggatāti vā jhānameva cittekaggatāyeva evaṃ vuccatīti imaṃ sandhāya evamāha.
Ekatthā means the same in meaning (either as immeasurable or exalted); it means that jhāna itself, or indeed one-pointedness of mind, is spoken of in this way. Pañcakaṅga, the lay follower, said this intending this meaning, "These dhammas are one in meaning, only various in expression."
Ekatthā (một ý nghĩa): là nói đến thiền định, sự nhất tâm, hoặc là vô lượng, hoặc là quảng đại.
231. Yāvatā ekaṃ rukkhamūlaṃ mahaggatanti pharitvā adhimuccitvā viharatīti ekarukkhamūlapamāṇaṭṭhānaṃ kasiṇanimittena ottharitvā tasmiṃ kasiṇanimitte mahaggatajjhānaṃ pharitvā adhimuccitvā viharati.
231. Yāvatā ekaṃ rukkhamūlaṃ mahaggatanti pharitvā adhimuccitvā viharatī means having pervaded a place the size of a single tree root with the kasiṇa sign, he dwells, having pervaded and applied his mind to the exalted jhāna in that kasiṇa sign.
Yāvatā ekaṃ rukkhamūlaṃ mahaggatanti pharitvā adhimuccitvā viharatī (trú an lạc, biến mãn và an trú một gốc cây với tâm quảng đại): là biến mãn một nơi có kích thước bằng một gốc cây bằng kasiṇa-nimitta (tướng biến xứ), và an trú trong kasiṇa-nimitta đó với thiền quảng đại (mahaggata-jhāna), sau khi đã an trú.
Mahaggatanti panassa ābhogo natthi, kevalaṃ mahaggatajjhānapavattivasena panetaṃ vuttaṃ.
However, for the one who enters jhāna, there is no advertence to "exalted"; it is merely said thus by the Venerable Anuruddha with reference to the arising of the exalted jhāna.
Tuy nhiên, đối với thiền quảng đại (mahaggata), không có sự quán tưởng (ābhoga), mà chỉ được nói như vậy theo cách thức của sự vận hành của thiền quảng đại.
Esa nayo sabbattha.
The same method applies everywhere.
Tương tự ở mọi nơi.
Iminā kho etaṃ gahapati pariyāyenāti iminā kāraṇena.
Iminā kho etaṃ gahapati pariyāyenā means by this reason.
Iminā kho etaṃ gahapati pariyāyenā (Này gia chủ, chính bằng phương tiện này): là bằng nguyên nhân này.
Ettha hi appamāṇāti vuttānaṃ brahmavihārānaṃ nimittaṃ na vaḍḍhati, ugghāṭanaṃ na jāyati, tāni jhānāni abhiññānaṃ vā nirodhassa vā pādakāni na honti, vipassanāpādakāni pana vaṭṭapādakāni bhavokkamanāni ca honti.
Here, the kasiṇa sign of the Brahmavihāras, which are called "immeasurable," does not expand, no removing of the sign occurs, and those jhānas do not become bases for supernormal powers or for cessation. However, they become bases for insight, bases for the round of existence, and lead to rebirth.
Ở đây, tướng của các phạm trú được gọi là appamāṇā (vô lượng) không phát triển, sự khai mở không sinh khởi, những thiền định đó không phải là nền tảng cho các thắng trí (abhiññā) hoặc diệt tận (nirodha), nhưng chúng là nền tảng cho tuệ quán (vipassanā), là nền tảng cho luân hồi (vaṭṭa) và là phương tiện tái sinh (bhavokkamanā).
‘‘Mahaggatā’’ti vuttānaṃ pana kasiṇajjhānānaṃ nimittaṃ vaḍḍhati, ugghāṭanaṃ jāyati, samatikkamā honti, abhiññāpādakāni nirodhapādakāni vaṭṭapādakāni bhavokkamanāni ca honti.
But the kasiṇa jhānas, which are called "exalted," their kasiṇa sign expands, removing of the sign occurs, they are transcended (by higher jhānas), and they become bases for supernormal powers, bases for cessation, bases for the round of existence, and lead to rebirth.
Tuy nhiên, tướng của các thiền kasiṇa được gọi là mahaggatā (quảng đại) thì phát triển, sự khai mở sinh khởi, có sự vượt qua, và chúng là nền tảng cho các thắng trí, là nền tảng cho diệt tận, là nền tảng cho luân hồi và là phương tiện tái sinh.
Evamime dhammā nānatthā, appamāṇā mahaggatāti evaṃ nānābyañjanā ca.
Thus, these dhammas differ in meaning and also differ in expression as "immeasurable" and "exalted."
Vì vậy, những pháp này có ý nghĩa khác nhau, và cũng có các từ ngữ khác nhau như appamāṇā và mahaggatā.
232. Idāni mahaggatasamāpattito nīharitvā bhavūpapattikāraṇaṃ dassento catasso kho imātiādimāha.
232. Now, indicating the cause of rebirth by drawing the mind out from the exalted attainment, the Blessed One spoke the passage beginning catasso kho imā.
232. Bây giờ, để chỉ ra nguyên nhân của sự tái sinh sau khi xuất khỏi thiền quảng đại, Ngài đã nói Catasso kho imā (có bốn điều này), v.v.
Parittābhāti pharitvā jānantassa ayamābhogo atthi, parittābhesu pana devesu nibbattikāraṇaṃ jhānaṃ bhāvento evaṃ vutto.
Parittābhā means for one who knows, there is this advertence: "There is the realm of limited radiance." However, a person who cultivates jhāna, which is the cause of rebirth among the devas of limited radiance, is spoken of in this way.
Parittābhā (ánh sáng giới hạn): đối với người biết biến mãn, có sự quán tưởng này. Nhưng khi một người tu tập thiền định là nguyên nhân tái sinh vào cõi chư thiên Parittābha, người đó được gọi như vậy.
Esa nayo sabbattha.
The same method applies everywhere.
Tương tự ở mọi nơi.
Parittābhā siyā saṃkiliṭṭhābhā honti siyā parisuddhābhā, appamāṇābhā siyā saṃkiliṭṭhābhā honti siyā parisuddhābhā.
The devas of limited radiance may be of defiled radiance or they may be of purified radiance; the devas of immeasurable radiance may be of defiled radiance or they may be of purified radiance.
Các cõi Parittābha có thể là cõi có ánh sáng ô nhiễm hoặc có ánh sáng thanh tịnh; các cõi Appamāṇābhā có thể là cõi có ánh sáng ô nhiễm hoặc có ánh sáng thanh tịnh.
Suppamatte vā sarāvamatte vā kasiṇaparikammaṃ katvā samāpattiṃ nibbattetvā pañcahākārehi āciṇṇavasibhāvo paccanīkadhammānaṃ suṭṭhu aparisodhitattā dubbalameva samāpattiṃ vaḷañjitvā appaguṇajjhāne ṭhito kālaṃ katvā parittābhesu nibbattati, vaṇṇo panassa paritto ceva hoti saṃkiliṭṭho ca.
A person who has performed kasiṇa preparation of a size of a winnowing basket or a bowl, and having generated attainment, and whose mastery has been cultivated in five ways, but because the opposing defilements (nīvaraṇa) have not been thoroughly purified, practices a weak attainment and, dwelling in jhāna that has not been cultivated, passes away and is reborn among the devas of limited radiance. His radiance is then both limited and defiled.
Một người đã thực hiện kasiṇa-parikamma (chuẩn bị biến xứ) với kích thước bằng một cái sàng hoặc một cái bát, sau đó phát sinh samāpatti (nhập định), và có sự thuần thục (vasībhāva) được thực hành theo năm cách. Do không thanh lọc kỹ các pháp đối nghịch, người đó chỉ sử dụng samāpatti yếu kém và an trú trong thiền định kém phẩm chất, rồi chết và tái sinh vào cõi Parittābha. Ánh sáng của vị ấy vừa giới hạn vừa ô nhiễm.
Pañcahi panākārehi āciṇṇavasibhāvo paccanīkadhammānaṃ suṭṭhu parisodhitattā suvisuddhaṃ samāpattiṃ vaḷañjitvā paguṇajjhāne ṭhito kālaṃ katvā parittābhesu nibbattati, vaṇṇo panassa paritto ceva hoti parisuddho ca.
But a person whose mastery has been cultivated in five ways, and because the opposing defilements have been thoroughly purified, practices a very pure attainment and, dwelling in jhāna that has been cultivated, passes away and is reborn among the devas of limited radiance. His radiance is then both limited and purified.
Tuy nhiên, một người đã có sự thuần thục được thực hành theo năm cách, do thanh lọc kỹ các pháp đối nghịch, người đó sử dụng samāpatti rất thanh tịnh và an trú trong thiền định thuần thục, rồi chết và tái sinh vào cõi Parittābha. Ánh sáng của vị ấy vừa giới hạn vừa thanh tịnh.
Evaṃ parittābhā siyā saṃkiliṭṭhābhā honti siyā parisuddhābhā.
Thus, the devas of limited radiance may be of defiled radiance or they may be of purified radiance.
Như vậy, các cõi Parittābha có thể có ánh sáng ô nhiễm hoặc có ánh sáng thanh tịnh.
Kasiṇe pana vipulaparikammaṃ katvā samāpattiṃ nibbattetvā pañcahākārehi āciṇṇavasibhāvoti sabbaṃ purimasadisameva veditabbaṃ.
But, having performed extensive kasiṇa preparation, having generated attainment, and whose mastery has been cultivated in five ways—all this should be understood as similar to the preceding explanation.
Tuy nhiên, việc thực hiện kasiṇa-parikamma rộng lớn, phát sinh samāpatti, và có sự thuần thục được thực hành theo năm cách, v.v., tất cả đều phải được hiểu tương tự như trước.
Evaṃ appamāṇābhā siyā saṃkiliṭṭhābhā honti siyā parisuddhābhāti.
Thus, the devas of immeasurable radiance may be of defiled radiance or they may be of purified radiance.
Như vậy, các cõi Appamāṇābhā có thể có ánh sáng ô nhiễm hoặc có ánh sáng thanh tịnh.
Yattha yatthāti uyyānavimānakapparukkhanadītīrapokkharaṇītīresu yattha yattha.
Yattha yatthā means wherever, in gardens, mansions, wish-fulfilling trees, riverbanks, or pond banks.
Yattha yatthā (ở bất cứ nơi nào): ở bất cứ nơi nào như vườn, cung điện, cây như ý, bờ sông, bờ ao sen.
Abhinivisantīti vasanti.
Abhinivisantī means they reside.
Abhinivisantī (an trú): là sống.
Abhiramantīti ramanti na ukkaṇṭhanti.
Abhiramantī means they delight and do not become weary.
Abhiramantī (hoan hỷ): là hoan hỷ, không chán ghét.
Kājenāti yāgubhattatelaphāṇitamacchamaṃsakājesu yena kenaci kājena.
Kājenā means by any kind of load, such as loads of gruel, cooked rice, oil, molasses, fish, or meat.
Kājenā (bằng gánh): là bằng bất cứ gánh nào trong các gánh cháo, cơm, dầu, mật, cá, thịt.
‘‘Kācenāti’’pi pāṭho, ayameva attho.
There is also the reading “Kācenāti,” with the same meaning.
Cũng có bản đọc là Kācenāti, ý nghĩa vẫn như vậy.
Piṭakenāti pacchiyā.
Piṭakenā means with a basket.
Piṭakenā (bằng giỏ): là bằng giỏ.
Tattha tatthevāti sappimadhuphāṇitādīnaṃ sulabhaṭṭhānato loṇapūtimacchādīnaṃ ussannaṭṭhānaṃ nītā ‘‘pubbe amhākaṃ vasanaṭṭhānaṃ phāsukaṃ, tattha sukhaṃ vasimhā, idha loṇaṃ vā no bādhati pūtimacchagandho vā sīsarogaṃ uppādetī’’ti evaṃ cittaṃ anuppādetvā tattha tattheva ramanti.
Tattha tatthevā means even if they are taken from a place where ghee, honey, molasses, etc., are easily available to a place where salt, rotten fish, etc., are abundant, they do not generate thoughts like, "Our former dwelling place was pleasant; we lived happily there. Here, salt afflicts us, or the smell of rotten fish causes headaches." Instead, they delight in those very places.
Tattha tatthevā (chính ở nơi đó): những con ruồi bị đưa từ nơi dễ kiếm bơ, mật, mật đường, v.v., đến nơi có nhiều muối, cá ươn, v.v., không khởi tâm nghĩ rằng “Nơi ở trước đây của chúng ta thật thoải mái, chúng ta đã sống hạnh phúc ở đó. Ở đây, muối làm chúng ta khó chịu, hoặc mùi cá ươn gây đau đầu”, mà chúng hoan hỷ chính ở nơi đó.
234. Ābhāti ābhāsampannā.
234. Ābhā means endowed with radiance.
234. Ābhā (ánh sáng): là đầy đủ ánh sáng.
Tadaṅgenāti tassā bhavūpapattiyā aṅgena, bhavūpapattikāraṇenāti attho.
Tadaṅgenā means by that factor of rebirth (in that Brahma realm); that is, by the cause of rebirth.
Tadaṅgenā (bằng yếu tố đó): là bằng yếu tố của sự tái sinh đó, có nghĩa là bằng nguyên nhân tái sinh.
Idāni taṃ kāraṇaṃ pucchanto ko nu kho, bhantetiādimāha.
Now, desiring to ask about that cause, he spoke beginning with ko nu kho, bhante.
Bây giờ, để hỏi về nguyên nhân đó, Ngài đã nói Ko nu kho, bhante (Thưa Tôn giả, điều gì), v.v.
236. Evaṃ me sutanti upakkilesasuttaṃ.
236. Thus have I heard—this is the Upakkilesa Sutta. Regarding this, he said this was not with the intention of causing division, nor out of affection. Rather, it occurred to him: "These bhikkhus, having taken my words, will not desist. Buddhas, indeed, are compassionate and concerned for welfare. Certainly, the Blessed One will explain a matter to them, and hearing it, they will desist. Then there will be comfortable dwelling for them." Therefore, he spoke this statement beginning with "Here, Venerable Sir." In phrases like mā bhaṇḍana, the remaining part of the text, "did not do," should be supplied, so the meaning should be understood as "do not quarrel." The phrase aññataro means that bhikkhu was devoted to the Blessed One's welfare. This was his thought: "These bhikkhus, overcome by anger, do not accept the Teacher's words. May the Blessed One not grow weary in admonishing them." Therefore, he spoke thus.
236. Evaṃ me sutaṃ (Như vầy tôi nghe) là kinh Upakkilesa.
Tattha etadavocāti neva bhedādhippāyena na piyakamyatāya, atha khvāssa etadahosi – ‘‘ime bhikkhū mama vacanaṃ gahetvā na oramissanti, buddhā ca nāma hitānukampakā, addhā nesaṃ bhagavā ekaṃ kāraṇaṃ kathessati, taṃ sutvā ete oramissanti, tato tesaṃ phāsuvihāro bhavissatī’’ti.
Thus have I heard—this is the Upakkilesa Sutta. Regarding this, he said this was not with the intention of causing division, nor out of affection. Rather, it occurred to him: "These bhikkhus, having taken my words, will not desist. Buddhas, indeed, are compassionate and concerned for welfare. Certainly, the Blessed One will explain a matter to them, and hearing it, they will desist. Then there will be comfortable dwelling for them." Therefore, he spoke this statement beginning with "Here, Venerable Sir." In phrases like mā bhaṇḍana, the remaining part of the text, "did not do," should be supplied, so the meaning should be understood as "do not quarrel." The phrase aññataro means that bhikkhu was devoted to the Blessed One's welfare. This was his thought: "These bhikkhus, overcome by anger, do not accept the Teacher's words. May the Blessed One not grow weary in admonishing them." Therefore, he spoke thus.
Trong đó, etadavocā (đã nói điều này) không phải với ý định gây chia rẽ hay vì muốn được yêu mến, mà là vì vị Tỳ-khưu ấy nghĩ: “Những Tỳ-khưu này sẽ không từ bỏ (sự tranh cãi) khi nghe lời ta. Các Đức Phật là những bậc từ bi, chắc chắn Thế Tôn sẽ giảng một điều gì đó cho họ, khi nghe điều đó họ sẽ từ bỏ, và sau đó họ sẽ được an trú trong an lạc.”
Tasmā etaṃ ‘‘idha, bhante’’tiādivacanamavoca.
Thus have I heard—this is the Upakkilesa Sutta. Regarding this, he said this was not with the intention of causing division, nor out of affection. Rather, it occurred to him: "These bhikkhus, having taken my words, will not desist. Buddhas, indeed, are compassionate and concerned for welfare. Certainly, the Blessed One will explain a matter to them, and hearing it, they will desist. Then there will be comfortable dwelling for them." Therefore, he spoke this statement beginning with "Here, Venerable Sir." In phrases like mā bhaṇḍana, the remaining part of the text, "did not do," should be supplied, so the meaning should be understood as "do not quarrel." The phrase aññataro means that bhikkhu was devoted to the Blessed One's welfare. This was his thought: "These bhikkhus, overcome by anger, do not accept the Teacher's words. May the Blessed One not grow weary in admonishing them." Therefore, he spoke thus.
Vì vậy, vị ấy đã nói lời “Bạch Thế Tôn, ở đây...”
Mā bhaṇḍanantiādīsu ‘‘akatthā’’ti pāṭhasesaṃ gahetvā ‘‘mā bhaṇḍanaṃ akatthā’’ti evaṃ attho daṭṭhabbo.
Thus have I heard—this is the Upakkilesa Sutta. Regarding this, he said this was not with the intention of causing division, nor out of affection. Rather, it occurred to him: "These bhikkhus, having taken my words, will not desist. Buddhas, indeed, are compassionate and concerned for welfare. Certainly, the Blessed One will explain a matter to them, and hearing it, they will desist. Then there will be comfortable dwelling for them." Therefore, he spoke this statement beginning with "Here, Venerable Sir." In phrases like mā bhaṇḍana, the remaining part of the text, "did not do," should be supplied, so the meaning should be understood as "do not quarrel." The phrase aññataro means that bhikkhu was devoted to the Blessed One's welfare. This was his thought: "These bhikkhus, overcome by anger, do not accept the Teacher's words. May the Blessed One not grow weary in admonishing them." Therefore, he spoke thus.
Trong các từ như mā bhaṇḍanaṃ (chớ tranh cãi), cần hiểu nghĩa bằng cách thêm phần còn lại của câu là “akatthā” (chớ làm), tức là “mā bhaṇḍanaṃ akatthā” (chớ gây tranh cãi).
Aññataroti so kira bhikkhu bhagavato atthakāmo, ayaṃ kirassa adhippāyo – ‘‘ime bhikkhū kodhābhibhūtā satthu vacanaṃ na gaṇhanti, mā bhagavā ete ovadanto kilamī’’ti, tasmā evamāha.
Thus have I heard—this is the Upakkilesa Sutta. Regarding this, he said this was not with the intention of causing division, nor out of affection. Rather, it occurred to him: "These bhikkhus, having taken my words, will not desist. Buddhas, indeed, are compassionate and concerned for welfare. Certainly, the Blessed One will explain a matter to them, and hearing it, they will desist. Then there will be comfortable dwelling for them." Therefore, he spoke this statement beginning with "Here, Venerable Sir." In phrases like mā bhaṇḍana, the remaining part of the text, "did not do," should be supplied, so the meaning should be understood as "do not quarrel." The phrase aññataro means that bhikkhu was devoted to the Blessed One's welfare. This was his thought: "These bhikkhus, overcome by anger, do not accept the Teacher's words. May the Blessed One not grow weary in admonishing them." Therefore, he spoke thus.
Aññataro (một vị khác): Vị Tỳ-khưu ấy có ý muốn lợi ích cho Thế Tôn. Ý của vị ấy là: “Những Tỳ-khưu này bị sân hận chế ngự nên không tiếp thu lời dạy của bậc Đạo sư. Chớ để Thế Tôn phải mệt mỏi khi giáo huấn họ.” Vì vậy, vị ấy đã nói như vậy.
Piṇḍāya pāvisīti na kevalaṃ pāvisi, yenapi janena na diṭṭho, so maṃ passatūtipi adhiṭṭhāsi.
He entered for alms means he not only entered, but he also resolved, "May those people who have not seen me, see me."
Piṇḍāya pāvisī (đi vào khất thực): Không chỉ đơn thuần là đi vào, mà Ngài còn quyết định rằng “người nào chưa thấy ta, người đó hãy thấy ta”.
Kimatthaṃ adhiṭṭhāsīti?
Why did he make that resolution?
Vì mục đích gì mà Ngài đã quyết định như vậy?
Tesaṃ bhikkhūnaṃ damanatthaṃ.
For the taming of those bhikkhus.
Để chế ngự những Tỳ-khưu ấy.
Bhagavā hi tadā piṇḍapātappaṭikkanto ‘‘puthusaddo samajano’’tiādigāthā bhāsitvā kosambito bālakaloṇakāragāmaṃ gato.
For at that time, having returned from his alms-round, the Blessed One had spoken the verses beginning with "A great clamour, a multitude of people," and had gone from Kosambī to the village of Bālakaloṇakāra.
Thật vậy, lúc bấy giờ, sau khi khất thực xong, Thế Tôn đã đọc bài kệ “puthusaddo samajano” (tiếng ồn ào của đám đông) và rời Kosambī đến làng Bālakaloṇakāra.
Tato pācīnavaṃsadāyaṃ, tato pālileyyakavanasaṇḍaṃ gantvā pālileyyahatthināgena upaṭṭhahiyamāno temāsaṃ vasi.
From there, he went to Pācīnavaṃsadāya, and from there to Pālileyyakavanasaṇḍa, where he dwelt for three months, attended by the Pālileyyaka elephant king.
Từ đó, Ngài đến Pācīnavaṃsadāya, rồi đến rừng Pālileyyaka và an cư ba tháng được voi chúa Pālileyyaka hầu hạ.
Nagaravāsinopi – ‘‘satthā vihāraṃ gato, gacchāma dhammassavanāyā’’ti gandhapupphahatthā vihāraṃ gantvā ‘‘kahaṃ, bhante, satthā’’ti pucchiṃsu.
The townspeople also, thinking, "The Teacher has gone to the monastery; let us go to hear the Dhamma," went to the monastery with perfumes and flowers in hand and asked, "Venerable sirs, where is the Teacher?"
Cư dân thành phố cũng nghĩ: “Bậc Đạo sư đã đến tịnh xá, chúng ta hãy đi nghe Pháp.” Họ cầm hương hoa đến tịnh xá và hỏi: “Bạch các Tỳ-khưu, Bậc Đạo sư đang ở đâu?”
‘‘Kahaṃ tumhe satthāraṃ dakkhatha, satthā ‘ime bhikkhū samagge karissāmī’ti āgato, samagge kātuṃ asakkonto nikkhamitvā gato’’ti.
"Where will you see the Teacher? The Teacher came, thinking, 'I will unite these bhikkhus.' Unable to unite them, he left and went away."
Các Tỳ-khưu trả lời: “Các vị sẽ thấy Bậc Đạo sư ở đâu? Bậc Đạo sư đã đến với ý định ‘ta sẽ làm cho những Tỳ-khưu này hòa hợp’, nhưng vì không thể làm cho họ hòa hợp nên Ngài đã rời đi.”
‘‘Mayaṃ satampi sahassampi datvā satthāraṃ ānetuṃ na sakkoma, so no ayācito sayameva āgato, mayaṃ ime bhikkhū nissāya satthu sammukhā dhammakathaṃ sotuṃ na labhimhā.
"We cannot bring the Teacher even by giving a hundred or a thousand (treasures). He came to us uninvited of his own accord. Because of these bhikkhus, we could not hear a Dhamma talk from the Teacher's presence.
Các cư sĩ nói: “Chúng ta không thể thỉnh Bậc Đạo sư đến dù có cúng dường một trăm hay một ngàn (vật phẩm). Ngài đã tự mình đến mà không được chúng ta thỉnh mời, vậy mà chúng ta không được nghe Pháp từ Bậc Đạo sư vì những Tỳ-khưu này.
Ime satthāraṃ uddissa pabbajitā, tasmimpi sāmaggiṃ karonte samaggā na jātā, kassāññassa vacanaṃ karissanti.
These, having gone forth on account of the Teacher, did not become united even when he was trying to unite them. Whose words will they obey?
Những vị này đã xuất gia vì Bậc Đạo sư, vậy mà khi Ngài cố gắng làm cho họ hòa hợp, họ vẫn không hòa hợp. Họ sẽ nghe lời ai khác nữa đây?
Alaṃ na imesaṃ bhikkhā dātabbā’’ti sakalanagare daṇḍaṃ ṭhapayiṃsu.
Enough! Alms should not be given to these." Thus, they imposed a penalty throughout the entire city.
Đủ rồi, không nên cúng dường vật thực cho những Tỳ-khưu này nữa.” Họ đã ban hành lệnh cấm cúng dường trong khắp thành phố.
Te punadivase sakalanagaraṃ piṇḍāya caritvā kaṭacchumattampi bhikkhaṃ alabhitvā vihāraṃ āgamaṃsu.
The next day, having wandered for alms throughout the entire city, they could not obtain even a spoonful of alms and returned to the monastery.
Ngày hôm sau, những Tỳ-khưu ấy đi khất thực khắp thành phố nhưng không nhận được dù chỉ một muỗng vật thực, nên họ trở về tịnh xá.
Upāsakāpi te puna āhaṃsu – ‘‘yāva satthāraṃ na khamāpetha, tāva vo tameva daṇḍakamma’’nti.
The lay followers also said to them again, "Until you appease the Teacher, that same penalty remains for you."
Các cư sĩ lại nói với họ: “Cho đến khi nào các vị sám hối với Bậc Đạo sư, thì hình phạt đó vẫn dành cho các vị.”
Te ‘‘satthāraṃ khamāpessāmā’’ti bhagavati sāvatthiyaṃ anuppatte tattha agamaṃsu.
Thinking, "We will appease the Teacher," they went to Sāvatthī when the Blessed One had arrived there.
Họ nghĩ: “Chúng ta sẽ sám hối với Bậc Đạo sư.” Khi Thế Tôn đến Sāvatthī, họ đã đến đó.
Satthā tesaṃ aṭṭhārasa bhedakaravatthūni desesīti ayamettha pāḷimuttakakathā.
The Teacher taught them the eighteen divisive topics. This is the extra-canonical story here.
Bậc Đạo sư đã giảng cho họ mười tám nguyên nhân gây chia rẽ. Đây là câu chuyện ngoài kinh điển (pāḷimuttakakathā) ở đây.
237. Idāni puthusaddotiādigāthāsu puthu mahāsaddo assāti puthusaddo.
237. Now, in the verses beginning puthusaddo, puthusaddo means there is a great clamour from that assembly of people. samajano means a uniform assembly, a multitude of people who are the same. It is said that all these quarrelsome people are alike, with a great clamour of words issuing from all sides.
237. Bây giờ, trong các bài kệ như puthusaddo (tiếng ồn ào của đám đông), puthusaddo có nghĩa là có nhiều tiếng ồn lớn.
Samajanoti samāno ekasadiso jano, sabbovāyaṃ bhaṇḍanakārakajano samantato saddaniccharaṇena puthusaddo ceva sadiso cāti vuttaṃ hoti.
Now, in the verses beginning puthusaddo, puthusaddo means there is a great clamour from that assembly of people. samajano means a uniform assembly, a multitude of people who are the same. It is said that all these quarrelsome people are alike, with a great clamour of words issuing from all sides.
Samajano (đám đông): là những người đồng nhất, cùng một loại người, tất cả những người gây tranh cãi này đều ồn ào và giống nhau trong việc phát ra tiếng ồn từ mọi phía, đó là ý nghĩa được nói đến.
Na bālo koci maññathāti tatra koci ekopi ahaṃ bāloti na maññati, sabbepi paṇḍitamāninoyeva.
No one thinks he is a fool. Among that assembly of quarrelsome people, not a single bhikkhu thinks, "I am a fool"; all of them consider themselves wise.
Na bālo koci maññathā (Không một kẻ ngu nào tự cho mình là ngu): Trong số đó, không một ai nghĩ rằng mình là kẻ ngu, tất cả đều tự cho mình là người trí tuệ.
Nāññaṃ bhiyyo amaññarunti koci ekopi ahaṃ bāloti na ca maññi, bhiyyo ca saṅghasmiṃ bhijjamāne aññampi ekaṃ ‘‘mayhaṃ kāraṇā saṅgho bhijjatī’’ti idaṃ kāraṇaṃ na maññīti attho.
They did not think any further: Not a single bhikkhu thought, "I am a fool," nor did any bhikkhu, when the Saṅgha was splitting, think, "Because of me, the Saṅgha is splitting." This is the meaning.
Nāññaṃ bhiyyo amaññaruṃ (và không một ai nghĩ thêm điều gì khác): Không một ai nghĩ rằng mình là kẻ ngu, và hơn nữa, khi Tăng đoàn bị chia rẽ, không một ai nghĩ rằng “Tăng đoàn bị chia rẽ là do ta”, đó là ý nghĩa.
Parimuṭṭhāti muṭṭhassatino.
Parimuṭṭhā means of lost mindfulness.
Parimuṭṭhā (mất trí): là những người mất niệm.
Vācāgocarabhāṇinoti rākārassa rassādeso kato; vācāgocarāva, na satipaṭṭhānagocarā, bhāṇino ca, kathaṃ bhāṇino?
Vācāgocarabhāṇino: The rā syllable's r was made short. They have only speech as their domain, not the foundations of mindfulness (satipaṭṭhāna) as their domain, and they are speakers. How are they speakers?
Vācāgocarabhāṇino (những người nói theo ý muốn của lời nói): Chữ ‘rā’ được rút ngắn thành ‘ra’; họ chỉ nói theo lời nói, không phải theo niệm xứ, và họ nói như thế nào?
Yāvicchanti mukhāyāmaṃ, yāva mukhaṃ pasāretuṃ icchanti, tāva pasāretvā bhāṇino, ekopi saṅghagāravena mukhasaṅkocanaṃ na karotīti attho.
As far as they wish to stretch their mouths, they stretch them and speak. No one restrains their mouth out of respect for the Saṅgha. This is the meaning.
Yāvicchanti mukhāyāmaṃ (Họ nói cho đến khi nào muốn mở miệng), tức là họ nói cho đến khi nào muốn mở miệng, không ai vì kính trọng Tăng đoàn mà khép miệng lại, đó là ý nghĩa.
Yena nītāti yena kalahena imaṃ nillajjabhāvaṃ nītā.
By what they were led: By what quarrel they were led to this shameless state.
Yena nītā (do điều gì dẫn đến): do sự tranh cãi nào mà họ bị dẫn đến sự vô liêm sỉ này.
Na taṃ vidū na taṃ jānanti ‘‘evaṃ sādīnavo aya’’nti.
They do not know that: They do not know that "this* is so disadvantageous."
Na taṃ vidū (họ không biết điều đó): họ không biết điều đó “sự tranh cãi này có nhiều hiểm họa như vậy”.
Pareti paṇḍite ṭhapetvā tato aññe bhaṇḍanakārakā pare nāma.
Others (pare) means quarrelsome people other than the wise.
Pare (những người khác): là những người gây tranh cãi khác, không phải là người trí tuệ.
Te ettha saṅghamajjhe kalahaṃ karontā ‘‘mayaṃ yamāmase upayamāma nassāma satataṃ samitaṃ maccusantikaṃ gacchāmā’’ti na jānanti.
Those who quarrel in the midst of the Saṅgha do not know, "We are dying, we are going to ruin, we are constantly and perpetually going to the presence of death."
Những người này, khi gây tranh cãi giữa Tăng đoàn, không biết rằng “chúng ta đang đi đến cái chết, luôn luôn, không ngừng nghỉ, chúng ta đang đi đến gần tử thần”.
Ye ca tattha vijānantīti ye ca tattha paṇḍitā ‘‘mayaṃ maccuno samīpaṃ gacchāmā’’ti vijānanti.
And those who know there means those wise ones among them who know, "We are going to the presence of death."
Ye ca tattha vijānantī (và những ai biết điều đó): những người trí tuệ trong số đó biết rằng “chúng ta đang đi đến gần tử thần”.
Tato sammanti medhagāti evañhi te jānantā yonisomanasikāraṃ uppādetvā medhagānaṃ kalahānaṃ vūpasamāya paṭipajjanti.
From that, quarrels cease means that those who know thus develop wise attention and practice for the cessation of quarrels.
Tato sammanti medhagā (từ đó mà các cuộc tranh cãi lắng xuống): Vì khi biết như vậy, họ phát khởi tác ý đúng đắn và thực hành để làm lắng xuống các cuộc tranh cãi.
Aṭṭhicchinnāti ayaṃ gāthā jātake (jā. 1.9.16) āgatā, brahmadattañca dīghāvukumārañca sandhāya vuttā.
Aṭṭhicchinnā: This verse appears in the Jātaka and was spoken with reference to Brahmadatta and Dīghāvukumāra.
Aṭṭhicchinnā (xương cốt bị chặt): Bài kệ này được tìm thấy trong Jātaka, được nói đến liên quan đến Brahmadatta và hoàng tử Dīghāvu.
Ayañhettha attho – tesampi tathā pavattaverānaṃ hoti saṅgati, kasmā tumhākaṃ na hoti, yesaṃ vo neva mātāpitūnaṃ aṭṭhīni chinnāni, na pāṇā haṭā na gavāssadhanāni haṭānīti.
The meaning here is this: "Even for those whose enmity was so deeply rooted, there was concord. Why should it not be for you, whose parents' bones were not cut, whose lives were not taken, whose cattle, horses, and wealth were not seized?"
Ý nghĩa ở đây là: ngay cả những người có mối thù hận sâu sắc như vậy cũng có thể hòa hợp, tại sao các vị lại không thể hòa hợp, khi mà xương cốt của cha mẹ các vị không bị chặt, sinh mạng không bị cướp đoạt, trâu bò, ngựa và tài sản không bị cướp đoạt?
Rājāva raṭṭhaṃ vijitanti yathā attano vijitaraṭṭhaṃ mahājanakarājā ca arindamamahārājā ca pahāya ekakā vicariṃsu, evaṃ vicareyyāti attho.
As a king his conquered realm means as the great king Mahājanaka and the great king Arindama wandered alone, having abandoned their conquered kingdoms; one should wander in the same way. This is the meaning.
Rājāva raṭṭhaṃ vijitaṃ (như vua đã chinh phục vương quốc): Ý nghĩa là, như vua Mahājanaka và vua Arindama đã từ bỏ vương quốc đã chinh phục của mình và sống một mình, thì vị ấy cũng nên sống như vậy.
Mātaṅgaraññeva nāgoti mātaṅgo araññe nāgova.
Like an elephant in the Mātanga forest means like a great elephant in the forest.
Mātaṅgaraññeva nāgo (như voi chúa trong rừng Mātaṅga): voi chúa trong rừng.
Mātaṅgoti hatthi vuccati.
Mātanga refers to an elephant.
Mātaṅgo được gọi là voi.
Nāgoti mahantādhivacanametaṃ.
Nāga is a term for a great one.
Nāgo là từ chỉ sự vĩ đại.
Yathā hi mātuposako mātaṅganāgo araññe eko cari, na ca pāpāni akāsi, yathā ca pālileyyako, evaṃ eko care, na ca pāpāni kayirāti vuttaṃ hoti.
It is said that just as the great elephant Mātanga, who supported his mother, wandered alone in the forest and did no evil, and just as the Pālileyyaka elephant did, so too one should wander alone and commit no evil.
Ý nghĩa là, như voi chúa Mātaṅga nuôi mẹ đã sống một mình trong rừng và không làm điều ác, và như voi Pālileyyaka, thì vị ấy cũng nên sống một mình và không làm điều ác.
238. Bālakaloṇakāragāmoti upāligahapatissa bhogagāmo.
238. Bālakaloṇakāragāmo is the village of Upāli the householder.
238. Bālakaloṇakāragāmo là làng làm muối của gia chủ Upāli.
Tenupasaṅkamīti kasmā upasaṅkami?
He approached it: Why did he approach it?
Tenupasaṅkamī (Ngài đã đến đó): Tại sao Ngài lại đến đó?
Gaṇe kirassa ādīnavaṃ disvā ekavihāriṃ bhikkhuṃ passitukāmatā udapādi, tasmā sītādīhi pīḷito uṇhādīni patthayamāno viya upasaṅkami.
It is said that seeing the danger in a group, a desire arose in him to see a bhikkhu dwelling alone. Therefore, he approached it as one afflicted by cold and so on might long for warmth and so on.
Vì khi thấy sự hiểm nguy trong việc sống chung với nhóm, Ngài đã phát sinh ý muốn gặp một Tỳ-khưu sống một mình. Vì vậy, Ngài đã đến đó như một người bị lạnh hành hạ mà mong muốn được ấm áp.
Dhammiyā kathāyāti ekībhāve ānisaṃsappaṭisaṃyuttāya.
With a Dhamma talk means one connected with the advantage of solitude.
Dhammiyā kathāyā (bằng lời nói về Pháp): là lời nói liên quan đến lợi ích của việc sống một mình.
Yena pācīnavaṃsadāyo, tattha kasmā upasaṅkami?
To the Pacīnavamsadāya, why did he approach there?
Nơi có rừng Pācīnavaṃsadāya, tại sao Ngài lại đến đó?
Kalahakārake kirassa diṭṭhādīnavattā samaggavāsino bhikkhū passitukāmatā udapādi, tasmā sītādīhi pīḷito uṇhādīni patthayamāno viya tattha upasaṅkami.
Indeed, since he had seen the danger in quarrels, the desire arose in him to see bhikkhus dwelling in harmony. Therefore, just as one afflicted by cold desires warmth, he approached there.
Nghe nói, vì thấy sự nguy hại trong việc gây tranh cãi, Ngài mong muốn được thấy các Tỳ-kheo sống hòa hợp, do đó, Ngài đã đến đó như một người bị lạnh hành hạ mà mong muốn hơi ấm.
Āyasmā ca anuruddhotiādi vuttanayameva.
And Venerable Anuruddha, etc., is to be understood in the manner already stated.
"Và Tôn giả Anuruddha," v.v., chỉ là theo cách đã nói.
241. Atthi pana voti pacchimapucchāya lokuttaradhammaṃ puccheyya.
241. With the final question, “Do you have…?”, one might ask about a supramundane Dhamma.
241. Atthi pana vo (Các vị có) là câu hỏi cuối cùng để hỏi về pháp siêu thế (lokuttaradhamma).
So pana therānaṃ natthi, tasmā taṃ pucchituṃ na yuttanti parikammobhāsaṃ pucchati.
But that (supramundane Dhamma) does not exist for the Elders; therefore, it is not fitting to ask them about it. So, he asks about the preparatory light.
Nhưng các Trưởng lão không có điều đó, vì vậy không thích hợp để hỏi về nó, nên Ngài hỏi về hào quang sơ khởi (parikammobhāsa).
Obhāsañceva sañjānāmāti parikammobhāsaṃ sañjānāma.
“We perceive the light” means we perceive the preparatory light.
Obhāsañceva sañjānāmā (Chúng tôi nhận biết hào quang) nghĩa là chúng tôi nhận biết hào quang sơ khởi.
Dassanañca rūpānanti dibbacakkhunā rūpadassanañca sañjānāma.
“And the sight of forms” means we also perceive the sight of forms with the divine eye.
Dassanañca rūpāna (Và sự thấy sắc) nghĩa là chúng tôi nhận biết sự thấy sắc bằng thiên nhãn (dibbacakkhu).
Tañca nimittaṃ nappaṭivijjhāmāti tañca kāraṇaṃ na jānāma, yena no obhāso ca rūpadassanañca antaradhāyati.
“But we do not penetrate that sign” means we do not know the reason why our light and the sight of forms disappear.
Tañca nimittaṃ nappaṭivijjhāmā (Và chúng tôi không thấu hiểu dấu hiệu đó) nghĩa là chúng tôi không biết lý do tại sao hào quang và sự thấy sắc của chúng tôi lại biến mất.
Taṃ kho pana vo anuruddhā nimittaṃ paṭivijjhitabbanti taṃ vo kāraṇaṃ jānitabbaṃ.
“That sign, Anuruddhas, must be penetrated by you” means that reason must be known by you.
Taṃ kho pana vo anuruddhā nimittaṃ paṭivijjhitabba (Này Anuruddha, các vị cần phải thấu hiểu dấu hiệu đó) nghĩa là các vị cần phải biết lý do đó.
Ahampi sudanti anuruddhā tumhe kiṃ na āḷulessanti, ahampi imehi ekādasahi upakkilesehi āḷulitapubboti dassetuṃ imaṃ desanaṃ ārabhi.
“I too formerly…”: To show that, “Anuruddhas, why should these (defilements) not trouble you? I too was formerly troubled by these eleven defilements,” he began this teaching.
Ahampi suda (Ngay cả ta cũng vậy) là lời dạy được bắt đầu để chỉ ra rằng: "Này Anuruddha, tại sao các vị lại không bị khuấy động? Ngay cả ta cũng đã từng bị khuấy động bởi mười một ô nhiễm này."
Vicikicchā kho metiādīsu mahāsattassa ālokaṃ vaḍḍhetvā dibbacakkhunā nānāvidhāni rūpāni disvā ‘‘idaṃ kho ki’’nti vicikicchā udapādi.
In “Doubt arose in me,” etc., the Great Being, having developed the light and seen various forms with the divine eye, wondered, “What is this?” and doubt arose.
Trong các đoạn như Vicikicchā kho me (Ta có sự hoài nghi), sau khi Đức Đại sĩ tăng cường ánh sáng và thấy các sắc khác nhau bằng thiên nhãn, sự hoài nghi đã khởi lên: "Đây là gì?"
Samādhi cavīti parikammasamādhi cavi.
“The samādhi wavered” means the preparatory samādhi wavered.
Samādhi cavī (Định bị dao động) nghĩa là định sơ khởi (parikammasamādhi) bị dao động.
Obhāsoti parikammobhāsopi antaradhāyi, dibbacakkhunāpi rūpaṃ na passi.
“The light” means the preparatory light also disappeared, and he could not see forms with the divine eye.
Obhāso (Hào quang) nghĩa là hào quang sơ khởi cũng biến mất, và Ngài không thấy sắc bằng thiên nhãn.
Amanasikāroti rūpāni passato vicikicchā uppajjati, idāni kiñci na manasikarissāmīti amanasikāro udapādi.
“Lack of attention”: When seeing forms, doubt arises, (thinking) “Now I will not attend to anything.” Thus, lack of attention arose.
Amanasikāro (Không tác ý) nghĩa là khi đang thấy các sắc, sự hoài nghi khởi lên, rồi Ngài nghĩ: "Bây giờ ta sẽ không tác ý bất cứ điều gì," và sự không tác ý đã khởi lên.
Parittañceva obhāsanti parittakaṭṭhāne obhāsaṃ.
“A limited light” means light in a limited area.
Parittañceva obhāsa (Hào quang nhỏ hẹp) nghĩa là hào quang trong một phạm vi nhỏ.
Parittāni ca rūpānīti parittakaṭṭhāne rūpāni.
“And limited forms” means forms in a limited area.
Parittāni ca rūpānī (Và các sắc nhỏ hẹp) nghĩa là các sắc trong một phạm vi nhỏ.
Vipariyāyena dutiyavāro veditabbo.
The second instance (of the reciprocal statement) should be understood in the opposite way.
Cách thứ hai phải được hiểu theo nghĩa ngược lại.
Paritto samādhīti parittako parikammobhāso, obhāsaparittatañhi sandhāya idha parikammasamādhi ‘‘paritto’’ti vutto.
“The samādhi is limited” refers to the preparatory light being limited; indeed, it is with reference to the limited nature of the light that the preparatory samādhi is called “limited” here.
Paritto samādhī (Định nhỏ hẹp) nghĩa là hào quang sơ khởi nhỏ hẹp; bởi vì, định sơ khởi ở đây được gọi là "nhỏ hẹp" để chỉ sự nhỏ hẹp của hào quang.
Parittaṃ me tasmiṃ samayeti tasmiṃ samaye dibbacakkhupi parittakaṃ hoti.
“My (divine eye) was limited at that time” means at that time, the divine eye was also limited.
Parittaṃ me tasmiṃ samaye (Vào lúc đó, thiên nhãn của ta nhỏ hẹp) nghĩa là vào lúc đó, thiên nhãn cũng nhỏ hẹp.
Appamāṇavārepi eseva nayo.
The same method applies to the immeasurable instance.
Trong trường hợp vô lượng (appamāṇa) cũng theo cách tương tự.
245. Avitakkampi vicāramattanti pañcakanaye dutiyajjhānasamādhiṃ.
245. “Without initial application, only sustained application” refers to the second jhāna samādhi in the fivefold system.
245. Avitakkampi vicāramatta (Không tầm, chỉ có tứ) nghĩa là định của thiền thứ hai trong cách năm chi (pañcakanaya).
Avitakkampi avicāranti catukkanayepi pañcakanayepi jhānattayasamādhiṃ.
“Without initial application, without sustained application” refers to the samādhi of the third jhāna (in the fourfold system) and the third and fourth jhānas (in the fivefold system).
Avitakkampi avicāra (Không tầm, không tứ) nghĩa là định của ba thiền (thiền thứ hai, thứ ba, thứ tư) trong cả cách bốn chi (catukkanaya) và cách năm chi.
Sappītikanti dukatikajjhānasamādhiṃ.
“Accompanied by rapture” refers to the samādhi of the first two jhānas.
Sappītika (Có hỷ) nghĩa là định của hai thiền (thiền thứ nhất, thứ hai) trong cách ba chi (dukatika).
Nippītikanti dukajjhānasamādhiṃ.
“Without rapture” refers to the samādhi of the third jhāna (in the fourfold system) and the fourth jhāna (in the fivefold system).
Nippītika (Không hỷ) nghĩa là định của hai thiền (thiền thứ ba, thứ tư) trong cách hai chi (duka).
Sātasahagatanti tikacatukkajjhānasamādhiṃ.
“Accompanied by pleasure” refers to the samādhi of the first three jhānas (in the fourfold system) and the first four jhānas (in the fivefold system).
Sātasahagata (Đồng hành với lạc) nghĩa là định của thiền thứ ba và thứ tư trong cách ba chi và cách bốn chi.
Upekkhāsahagatanti catukkanaye catutthajjhānasamādhiṃ pañcakanaye pañcamajjhānasamādhiṃ.
“Accompanied by equanimity” refers to the samādhi of the fourth jhāna in the fourfold system and the fifth jhāna in the fivefold system.
Upekkhāsahagata (Đồng hành với xả) nghĩa là định của thiền thứ tư trong cách bốn chi và định của thiền thứ năm trong cách năm chi.
Kadā pana bhagavā imaṃ tividhaṃ samādhiṃ bhāveti?
When did the Blessed One cultivate these three types of samādhi?
Vậy khi nào Đức Thế Tôn tu tập ba loại định này?
Mahābodhimūle nisinno pacchimayāme.
Seated at the foot of the Mahābodhi tree, during the last watch of the night.
Khi Ngài ngồi dưới cội Đại Bồ-đề vào canh cuối đêm.
Bhagavato hi paṭhamamaggo paṭhamajjhāniko ahosi, dutiyādayo dutiyatatiyacatutthajjhānikā.
Indeed, the first path of the Blessed One was associated with the first jhāna, and the second, etc., with the second, third, and fourth jhānas.
Đối với Đức Thế Tôn, đạo lộ thứ nhất là thiền thứ nhất, các đạo lộ thứ hai, v.v., là thiền thứ hai, thứ ba, thứ tư.
Pañcakanaye pañcamajjhānassa maggo natthīti so lokiyo ahosīti lokiyalokuttaramissakaṃ sandhāyetaṃ vuttaṃ.
In the fivefold system, there is no path for the fifth jhāna, so it was worldly. This statement refers to a mixture of worldly and supramundane.
Trong cách năm chi, không có đạo lộ cho thiền thứ năm, vì vậy thiền đó là thế gian (lokiya). Lời này được nói để chỉ sự pha trộn giữa thế gian và siêu thế (lokiya-lokuttara).
Sesaṃ sabbattha uttānamevāti.
All the rest is clear.
Phần còn lại đều rõ ràng ở khắp mọi nơi.
246. Evaṃ me sutanti bālapaṇḍitasuttaṃ.
246. “Thus have I heard”: This is the Bālapaṇḍita Sutta.
246. Evaṃ me suta (Tôi đã nghe như vầy) là kinh Bālapaṇḍita.
Tattha bālalakkhaṇānīti bālo ayanti etehi lakkhiyati ñāyatīti bālalakkhaṇāni.
Therein, “Characteristics of a fool” (bālalakkhaṇāni) means, “By these (characteristics) one is recognized, known, as a fool.” Hence, they are bālalakkhaṇāni.
Ở đây, bālalakkhaṇāni (các đặc điểm của kẻ ngu) là những điều mà nhờ đó người ta nhận biết: "Kẻ này là ngu."
Tāneva tassa sañjānanakāraṇānīti bālanimittāni.
Since these very characteristics are the causes for recognizing him, they are “signs of a fool” (bālanimittāni).
Chính những điều đó là nguyên nhân để nhận biết kẻ ngu, nên gọi là bālanimittāni (các dấu hiệu của kẻ ngu).
Bālassa apadānānīti bālāpadānāni.
They are the fool’s deeds, hence “foolish deeds” (bālāpadānāni).
Những hành vi của kẻ ngu nên gọi là bālāpadānāni (những hành vi của kẻ ngu).
Duccintitacintīti cintayanto abhijjhābyāpādamicchādassanavasena duccintitameva cinteti.
“Thinking ill thoughts” means when thinking, one thinks only ill thoughts in the way of covetousness, ill-will, and wrong view.
Duccintitacintī (Suy nghĩ những điều xấu) nghĩa là khi suy nghĩ, người đó chỉ suy nghĩ những điều xấu ác dưới hình thức tham lam, sân hận, và tà kiến.
Dubbhāsitabhāsīti bhāsamānopi musāvādādibhedaṃ dubbhāsitameva bhāsati.
“Speaking ill speech” means when speaking, one speaks only ill speech, such as lying, etc.
Dubbhāsitabhāsī (Nói những lời xấu) nghĩa là khi nói, người đó chỉ nói những lời xấu ác thuộc loại nói dối, v.v.
Dukkaṭakammakārīti karontopi pāṇātipātādivasena dukkaṭakammameva karoti.
“Doing ill deeds” means when acting, one does only ill deeds in the way of killing living beings, etc.
Dukkaṭakammakārī (Làm những việc ác) nghĩa là khi làm, người đó chỉ làm những việc ác dưới hình thức sát sinh, v.v.
Tatra ceti yattha nisinno, tassaṃ parisati.
“If there” (tatra ce) refers to the assembly where one is seated.
Tatra ce (Nếu ở đó) nghĩa là trong hội chúng mà người đó đang ngồi.
Tajjaṃ tassāruppanti tajjātikaṃ tadanucchavikaṃ, pañcannaṃ verānaṃ diṭṭhadhammakasamparāyikaādīnavappaṭisaṃyuttanti adhippāyo.
“That which is appropriate for him” (tajjaṃ tassāruppaṃ) means that which is similar to his nature, suitable for him; the intention is that it is connected with the danger of the five enmities, both in this life and the next.
Tajjaṃ tassāruppa (Điều phù hợp với người đó) nghĩa là điều tương ứng với người đó, điều thích hợp với người đó; ý muốn nói là những điều liên quan đến sự nguy hại trong hiện tại và tương lai của năm điều ác.
Tatrāti tāya kathāya kacchamānāya.
“There” (tatrā) means when that talk is being given.
Tatrā (Ở đó) nghĩa là khi câu chuyện đó đang được nói.
Bālantiādīni sāmiatthe upayogavacanaṃ.
“Fool,” etc., are words used in the sense of possession (genitive case).
Bāla (Kẻ ngu), v.v., là từ được dùng theo nghĩa sở hữu.
248. Olambantīti upaṭṭhahanti.
248. “Hang down” (olambantī) means they appear.
248. Olambantī (Treo lơ lửng) nghĩa là xuất hiện.
Sesapadadvayaṃ tasseva vevacanaṃ, olambanādiākārena hi tāni upaṭṭhahanti, tasmā evaṃ vuttaṃ.
The remaining two words (ajjholambanti, atilambanti) are synonyms for the same; indeed, they appear in the manner of hanging down, etc., hence it is said thus.
Hai từ còn lại là đồng nghĩa với từ đó, bởi vì chúng xuất hiện dưới hình thức treo lơ lửng, v.v., nên được nói như vậy.
Pathaviyā olambantīti pathavitale pattharanti.
“Hang down to the earth” (pathaviyā olambantī) means they spread out on the ground.
Pathaviyā olambantī (Treo lơ lửng trên mặt đất) nghĩa là trải rộng trên mặt đất.
Sesapadadvayaṃ tasseva vevacanaṃ.
The remaining two words (ajjhoplambanti, abhippalambanti) are synonyms for the same.
Hai từ còn lại là đồng nghĩa với từ đó.
Pattharaṇākāroyeva hesa.
Indeed, that is the manner of spreading out.
Đây chính là hình thức trải rộng.
Tatra, bhikkhave, bālassāti tasmiṃ upaṭṭhānākāre āpāthagate bālassa evaṃ hoti.
“There, O bhikkhus, for the fool” (tatra, bhikkhave, bālassā) means when that appearing form has come into sight, it occurs to the fool in this way.
Tatra, bhikkhave, bālassā (Ở đó, này các Tỳ-kheo, đối với kẻ ngu) nghĩa là khi các đối tượng nghiệp, nghiệp tướng, và cảnh giới tái sinh xuất hiện, thì kẻ ngu có suy nghĩ như vậy.
249. Etadavocāti anusandhikusalo bhikkhu ‘‘nirayassa upamā kātuṃ na sakkā’’ti na bhagavā vadati, ‘‘na sukarā’’ti pana vadati, na sukaraṃ pana sakkā hoti kātuṃ, handāhaṃ dasabalaṃ upamaṃ kārāpemīti cintetvā etaṃ ‘‘sakkā, bhante’’ti vacanaṃ avoca.
249. “Etadavocā”—the bhikkhu skilled in context, having thought, “The Blessed One does not say, ‘An analogy for hell cannot be made.’ Rather, he says, ‘It is not easy.’ But that which is not easy can be done. Now, I will make the Dasabala (Buddha) cause an analogy to be made”—spoke this statement, “It is possible, Venerable Sir.”
249. Etadavocā (vị ấy đã nói điều này) nghĩa là, vị tỳ-khưu thiện xảo về liên kết (ý nghĩa) đã nói điều này, suy nghĩ rằng: “Đức Thế Tôn không nói rằng ‘không thể làm ví dụ về địa ngục’, mà Ngài nói ‘không dễ làm’. Nhưng điều không dễ thì vẫn có thể làm được. Vậy ta hãy thỉnh Đức Thập Lực làm ví dụ.” Sau khi suy nghĩ như vậy, vị ấy đã nói lời “Bạch Ngài, có thể được.”
Haneyyunti vinivijjhitvā gamanavasena yathā ekasmiṃ ṭhāne dve pahārā nipatanti, evaṃ haneyyuṃ.
“Haneyyuṃ” means they would strike in the manner of penetrating through, just as two blows (spears) fall in one place when plunged down.
Họ sẽ đâm (Haneyyuṃ) nghĩa là, theo cách đâm xuyên qua, như thể hai mũi giáo cùng rơi vào một chỗ, thì họ sẽ đâm như vậy.
Tenassa dve vaṇamukhasatāni honti.
Due to that penetrating action, that thief has two hundred wound openings.
Do đó, người ấy có hai trăm vết thương.
Ito uttaripi eseva nayo.
Furthermore, the same method applies to the subsequent (midday and evening) watches.
Từ đây trở đi, phương pháp cũng tương tự.
250. Pāṇimattanti antomuṭṭhiyaṃ ṭhapanamattaṃ.
250. “Pāṇimattaṃ” means just enough to be held in the palm of the hand (a small stone).
250. Chỉ bằng lòng bàn tay (Pāṇimattaṃ) nghĩa là, chỉ đủ để giữ trong nắm tay.
Saṅkhampi na upetīti gaṇanamattampi na gacchati.
“Saṅkhampi na upeti” means it does not even amount to a mere calculation.
Không đạt đến con số (Saṅkhampi na upetī) nghĩa là, không đạt đến mức độ có thể đếm được.
Kalabhāgampīti satimaṃ kalaṃ sahassimaṃ kalaṃ satasahassimaṃ vā kalaṃ upagacchatītipi vattabbataṃ na upeti.
“Kalabhāgampī” means it does not attain the state of being spoken of as a hundredth part, or a thousandth part, or a hundred thousandth part.
Dù là một phần nhỏ (Kalabhāgampī) nghĩa là, không thể nói là đạt đến một phần trăm, một phần nghìn, hay một phần trăm nghìn.
Upanidhampīti upanikkhepanamattampi na upeti, olokentassa olokitamattampi natthi.
“Upanidhampī” means it does not even attain the state of being placed near; for one looking, it is not even a mere glance.
Dù là một sự so sánh (Upanidhampī) nghĩa là, không thể đạt đến mức độ chỉ là một sự so sánh, đối với người nhìn thì không có gì để nhìn.
Tattaṃ ayokhilanti tigāvutaṃ attabhāvaṃ sampajjalitāya lohapathaviyā uttānakaṃ nipajjāpetvā tassa dakkhiṇahatthe tālappamāṇaṃ ayasūlaṃ pavesenti, tathā vāmahatthādīsu.
“Tattaṃ ayokhilaṃ” means, having made a being three gavutas tall lie supine on a blazing iron ground, (the hell-wardens) insert an iron stake the size of a palm tree into its right hand, and similarly into its left hand and so on.
Cọc sắt nung đỏ (Tattaṃ ayokhilaṃ) nghĩa là, đặt thân thể dài ba gāvuta nằm ngửa trên mặt đất sắt đang cháy rực, rồi đóng một cây cọc sắt to bằng cây thốt nốt vào bàn tay phải của người ấy, và tương tự vào bàn tay trái, v.v.
Yathā ca uttānakaṃ nipajjāpetvā, evaṃ urenapi dakkhiṇapassenapi vāmapassenapi nipajjāpetvā taṃ kammakāraṇaṃ karontiyeva.
Just as they make it lie supine, so too they continue that torment, making it lie on its chest, its right side, and its left side.
Và cũng như đặt nằm ngửa, họ cũng thực hiện hình phạt đó bằng cách đặt nằm sấp, nằm nghiêng bên phải, và nằm nghiêng bên trái.
Saṃvesetvāti sampajjalitāya lohapathaviyā tigāvutaṃ attabhāvaṃ nipajjāpetvā.
“Saṃvesetvā” means, having made a being three gavutas tall lie down on the blazing iron ground.
Đặt nằm (Saṃvesetvā) nghĩa là, đặt thân thể dài ba gāvuta nằm trên mặt đất sắt đang cháy rực.
Kuṭhārīhīti mahatīhi gehassa ekapakkhachadanamattāhi kuṭhārīhi tacchanti.
“Kuṭhārīhi” means (the hell-wardens) hew with large axes, as long as the roofing of one side of a house.
Bằng rìu (Kuṭhārīhi) nghĩa là, họ đẽo bằng những chiếc rìu lớn, to bằng một mặt mái nhà.
Lohitaṃ nadī hutvā sandati, lohapathavito jālā uṭṭhahitvā tacchitaṭṭhānaṃ gaṇhanti.
Blood flows like a river, and flames rise from the iron ground, engulfing the hewn places.
Máu chảy thành sông, và lửa bốc lên từ mặt đất sắt thiêu đốt những chỗ bị đẽo.
Mahādukkhaṃ uppajjati, tacchantā pana suttāhataṃ karitvā dārū viya aṭṭhaṃsampi chaḷaṃsampi karonti.
Great suffering arises. The hewers, however, make (the bodies) eight-sided or sixteen-sided, like timber that has been marked with a string.
Đau khổ lớn lao phát sinh, nhưng những người đẽo thì làm cho (thân thể) thành tám cạnh hoặc mười sáu cạnh như những khúc gỗ đã được kẻ chỉ.
Vāsīhīti mahāsuppapamāṇāhi vāsīhi.
“Vāsīhi” means with adzes the size of large winnowing baskets.
Bằng đục (Vāsīhi) nghĩa là, bằng những chiếc đục lớn như cái sàng lớn.
Tāhi tacchantā tacato yāva aṭṭhīni saṇikaṃ tacchanti, tacchitaṃ tacchitaṃ paṭipākatikaṃ hoti.
Hewing with them, they slowly hew from the skin down to the bones, and whatever is hewn regenerates to its original state.
Khi đẽo bằng những chiếc đục đó, họ đẽo chậm rãi từ da cho đến xương, và mỗi chỗ bị đẽo lại trở lại trạng thái ban đầu.
Rathe yojetvāti saddhiṃ yugayottapañcaracakkakubbarapācanehi sabbato sampajjalite rathe yojetvā.
“Rathe yojetvā” means, having yoked (the being) to a chariot blazing on all sides, together with its yoke, reins, cage, wheels, axle, and goad.
Ghép vào xe (Rathe yojetvā) nghĩa là, ghép vào một chiếc xe đang cháy rực khắp nơi, cùng với ách, dây cương, khung xe, bánh xe, trục xe và roi.
Mahantanti mahākūṭāgārappamāṇaṃ.
“Mahantaṃ” means a mountain of burning charcoal as large as a great gabled house.
Lớn (Mahantaṃ) nghĩa là, to bằng một ngôi nhà mái nhọn lớn.
Āropentīti sampajjalitehi ayamuggarehi pothentā āropenti.
“Āropenti” means, beating with blazing iron hammers, they make it ascend.
Họ chất lên (Āropentī) nghĩa là, họ chất lên bằng cách dùng những cái búa sắt đang cháy rực để đập.
Sakimpi uddhanti supakkuthitāya ukkhaliyā pakkhittataṇḍulā viya uddhaṃ adho tiriyañca gacchati.
“Sakimpi uddhaṃ” means it goes up, down, and crosswise, like grains of rice put into a pot that is boiling furiously.
Dù chỉ một lần lên (Sakimpi uddhaṃ) nghĩa là, nó đi lên, xuống và ngang như những hạt gạo được bỏ vào nồi đang sôi sùng sục.
Dubbaṇṇoti durūpo.
“Dubbaṇṇo” means having an ugly appearance.
Xấu xí (Dubbaṇṇo) nghĩa là, có hình dạng xấu xí.
Duddasikoti dārakānaṃ bhayāpanatthaṃ katayakkho viya duddaso.
“Duddasiko” means difficult to behold, like an ogre made to frighten children.
Khó nhìn (Duddasiko) nghĩa là, khó nhìn như một con quỷ được tạo ra để dọa trẻ con.
Okoṭimakoti lakuṇḍako paviṭṭhagīvo mahodaro.
“Okoṭimako” means short, with a sunken neck and a large belly.
Còng lưng (Okoṭimako) nghĩa là, lùn tịt, cổ rụt, bụng to.
Kāṇoti ekakkhikāṇo vā ubhayakkhikāṇo vā.
“Kāṇo” means either blind in one eye or blind in both eyes.
Mù (Kāṇo) nghĩa là, mù một mắt hoặc mù cả hai mắt.
Kuṇīti ekahatthakuṇī vā ubhayahatthakuṇī vā.
“Kuṇī” means either having one crippled hand or having both crippled hands.
Cụt tay (Kuṇī) nghĩa là, cụt một tay hoặc cụt cả hai tay.
Pakkhahatoti pīṭhasappī.
“Pakkhahato” means a cripple (one who crawls on their seat).
Bị liệt nửa người (Pakkhahato) nghĩa là, người phải lê lết.
So kāyenāti idamassa dukkhānupabandhadassanatthaṃ āraddhaṃ.
“So kāyenā”—this (statement) is started to show the continuous nature of suffering for that fool.
Người ấy bằng thân thể (So kāyenā) điều này được đưa ra để chỉ ra sự liên tục của đau khổ đối với người ấy.
Kaliggahenāti parājayena.
“Kaliggahenā” means by defeat (in gambling).
Do thua cuộc (Kaliggahenā) nghĩa là, do thất bại.
Adhibandhaṃ nigaccheyyāti yasmā bahuṃ jito sabbasāpateyyampissa nappahoti, tasmā attanāpi bandhaṃ nigaccheyya.
“Adhibandhaṃ nigaccheyyā” means, because a man who has lost much gambling cannot afford all his wealth, he would also fall into bondage himself.
Sẽ rơi vào cảnh bị trói buộc (Adhibandhaṃ nigaccheyyā) nghĩa là, vì đã thua quá nhiều, đến nỗi tất cả tài sản của người ấy cũng không đủ, nên người ấy sẽ tự mình rơi vào cảnh bị trói buộc.
Kevalā paripūrā bālabhūmīti bālo tīṇi duccaritāni pūretvā niraye nibbattati, tattha pakkāvasesena manussattaṃ āgato pañcasu nīcakulesu nibbattitvā puna tīṇi duccaritāni pūretvā niraye nibbattatīti ayaṃ sakalā paripuṇṇā bālabhūmi.
“Kevalā paripūrā bālabhūmī” means that a fool, having completed three unwholesome actions, is reborn in hell. From there, having come to human existence with the remainder of his karma, he is reborn into five low castes, and then again, having completed three unwholesome actions, he is reborn in hell. This continuous occurrence is called the complete and full state of a fool.
Toàn bộ và trọn vẹn cõi của kẻ ngu (Kevalā paripūrā bālabhūmī) nghĩa là, kẻ ngu hoàn thành ba ác hạnh và tái sinh vào địa ngục; sau đó, với phần nghiệp còn lại, người ấy tái sinh làm người trong năm dòng họ thấp kém, rồi lại hoàn thành ba ác hạnh và tái sinh vào địa ngục – đây là toàn bộ và trọn vẹn cõi của kẻ ngu.
256. Sīsaṃ nhātassāti sīsena saddhiṃ gandhodakena nhātassa.
256. “Sīsaṃ nhātassā” means for the Universal Monarch who has bathed his head with perfumed water.
256. Đối với người đã gội đầu (Sīsaṃ nhātassā) nghĩa là, đối với người đã gội đầu bằng nước thơm.
Uposathikassāti samādinnauposathaṅgassa.
“Uposathikassā” means for the Universal Monarch who has undertaken the Uposatha observances.
Đối với người giữ giới Uposatha (Uposathikassā) nghĩa là, đối với người đã thọ trì các giới Uposatha.
Uparipāsādavaragatassāti pāsādavarassa upari gatassa subhojanaṃ bhuñjitvā pāsādavarassa upari mahātale sirīgabbhaṃ pavisitvā sīlāni āvajjantassa.
“Uparipāsādavaragatassā” means for the Universal Monarch who has gone to the top of the excellent palace, having eaten fine food, entered the royal chamber on the great upper floor of the excellent palace, and is reflecting on the virtues (sīlāni).
Đối với người đã lên đến đỉnh cung điện cao quý (Uparipāsādavaragatassā) nghĩa là, đối với người đã lên đến đỉnh cung điện cao quý, sau khi ăn bữa ăn ngon, đi vào phòng hoàng gia trên tầng cao nhất của cung điện cao quý và quán chiếu các giới.
Tadā kira rājā pātova satasahassaṃ vissajjetvā mahādānaṃ datvā punapi soḷasahi gandhodakaghaṭehi sīsaṃ nhāyitvā katapātarāso suddhaṃ uttarāsaṅgaṃ ekaṃsaṃ katvā uparipāsādassa sirīsayane pallaṅkaṃ ābhujitvā nisinno attano dānamayapuññasamudayaṃ āvajjetvā nisīdati, ayaṃ sabbacakkavattīnaṃ dhammatā.
At that time, it is said, the king, having given a great donation of a hundred thousand (coins) early in the morning, then bathed his head with sixteen jars of perfumed water, finished his breakfast, placed a clean upper robe over one shoulder, sat cross-legged on the auspicious couch on the upper floor of the palace, and reflected on his accumulated merits from generosity. This is the custom of all Universal Monarchs.
Vào lúc đó, nhà vua, vào buổi sáng sớm, đã bố thí một trăm nghìn (tiền), sau đó gội đầu bằng mười sáu bình nước thơm, ăn bữa sáng xong, vắt tấm y choàng sạch sẽ qua một bên vai, ngồi kiết già trên giường hoàng gia trên tầng cao nhất của cung điện, và quán chiếu công đức bố thí của mình. Đây là thông lệ của tất cả các Chuyển Luân Thánh Vương.
Tesaṃ taṃ āvajjantānaṃyeva vuttappakārapuññakammapaccayaṃ utusamuṭṭhānaṃ nīlamaṇisaṅghāṭasadisaṃ pācīnasamuddajalatalaṃ chindamānaṃ viya ākāsaṃ alaṅkurumānaṃ viya dibbaṃ cakkaratanaṃ pātubhavati.
While they are thus reflecting, a divine wheel-jewel appears, which is born of the season, having merit-karma as its cause as described, resembling a cluster of sapphire gems, as if cleaving the eastern ocean’s surface, and as if adorning the sky.
Ngay khi họ đang quán chiếu công đức đó, một bánh xe báu thần thánh xuất hiện, do nghiệp thiện đã nói trên và do thời tiết, giống như một khối ngọc bích xanh, như thể đang xẻ đôi mặt nước biển phía đông, như thể đang trang hoàng bầu trời.
Tayidaṃ dibbānubhāvayuttattā dibbanti vuttaṃ.
And this (wheel-jewel) is called “dibbaṃ” (divine) because it is endowed with divine power.
Bánh xe này được gọi là thiên (dibbaṃ) vì nó được phú cho quyền năng thần thánh.
Sahassaṃ assa arānanti sahassāraṃ.
It has a thousand spokes, hence “sahassāraṃ”.
Nó có một nghìn căm, nên được gọi là có một nghìn căm (sahassāraṃ).
Saha nemiyā saha nābhiyā cāti sanemikaṃ sanābhikaṃ.
It is with a felloe and with a nave, hence “sanemikaṃ sanābhikaṃ”.
Nó có vành và có trục, nên được gọi là có vành và có trục (sanemikaṃ sanābhikaṃ).
Sabbehi ākārehi paripūranti sabbākāraparipūraṃ.
It is perfect in all aspects, hence “sabbākāraparipūraṃ”.
Nó hoàn hảo về mọi mặt, nên được gọi là hoàn hảo về mọi mặt (sabbākāraparipūraṃ).
Tattha cakkañca taṃ ratijananaṭṭhena ratanañcāti cakkaratanaṃ.
Here, it is a wheel, and it is a jewel because of its nature to generate delight, thus “cakkaratanaṃ”.
Trong đó, nó là một bánh xe (cakkaṃ) và nó là một viên ngọc quý (ratanaṃ) vì nó tạo ra niềm vui (ratijananaṭṭhena), nên được gọi là bánh xe báu (cakkaratanaṃ).
Yāya pana taṃ nābhiyā ‘‘sanābhika’’nti vuttaṃ, sā indanīlamaṇimayā hoti.
The nave by which it is called “sanābhikaṃ” is made of sapphire.
Trục mà nó được gọi là “có trục” thì được làm bằng ngọc bích.
Majjhe panassā rajatamayā panāḷi, yāya suddhasiniddhadantapantiyā hasamānaṃ viya virocati.
In its center is an opening (panāḷi) made of silver, which shines as if smiling with a row of pure, smooth teeth.
Ở giữa nó có một ống bạc, nhờ đó nó tỏa sáng như thể đang mỉm cười với hàng răng trắng bóng và mịn màng.
Majjhe chiddena viya candamaṇḍalena ubhosupi bāhirantesu rajatapaṭṭena kataparikkhepo hoti.
Through a hole in the middle, it has a circumference made of a silver band on both its outer edges, like the orb of the moon.
Ở giữa, nó có một vòng tròn bằng bạc bao quanh cả hai mặt ngoài và trong, như thể có một lỗ hổng với một vầng trăng.
Tesu panassā nābhipanāḷi parikkhepapaṭṭesu yuttaṭṭhāne paricchedalekhā suvibhattāva hutvā paññāyanti.
On the bands encircling the nave and its opening, the demarcation lines in the appropriate places appear clearly defined.
Trên các tấm bao quanh ống trục, các đường phân chia được phân biệt rõ ràng ở những chỗ phù hợp.
Ayaṃ tāvassa nābhiyā sabbākāraparipūratā.
This, then, is the perfection of its nave in all aspects.
Đây là sự hoàn hảo về mọi mặt của trục bánh xe.
Yāya pana taṃ nemiyā saha ‘‘sanemika’’nti vuttaṃ, sā bālasūriyarasmikalāpasiriṃ avahasamānā viya surattasuddhasiniddhapavāḷamayā hoti.
The felloe, with which it is called “sanemikaṃ,” is made of very red, pure, smooth coral, as if ridiculing the beauty of the clusters of rays of the rising sun.
Vành mà nó được gọi là “có vành” thì được làm bằng san hô đỏ thẫm, tinh khiết và mịn màng, như thể đang chế nhạo vẻ đẹp của những tia nắng mặt trời buổi sớm.
Sandhīsu panassā sañjhārāgasassirikarattajambonadapaṭṭā vaṭṭaparicchedalekhā ca suvibhattā paññāyanti.
Moreover, at the joints of its felloe, plates of red Jambūnada gold, shining with the splendor of the twilight glow, and circular boundary lines are well-defined and manifest.
Và trên các mối nối của vành bánh xe ấy, những dải vàng Jambonada đỏ thắm, lấp lánh như ánh hoàng hôn, cùng những đường nét viền tròn được phân chia rõ ràng hiện ra.
Ayamassa nemiyā sabbākāraparipūratā.
This is the perfection of its felloe in all respects.
Đây là sự hoàn hảo về mọi mặt của vành bánh xe ấy.
Nemimaṇḍalapiṭṭhiyaṃ panassa dasannaṃ dasannaṃ arānamantare dhamanavaṃso viya antosusiro chiddamaṇḍalacitto vātagāhī pavāḷadaṇḍo hoti, yassa vātena paharitassa sukusalasamannāhatassa pañcaṅgikatūriyassa viya saddo vaggu ca rajanīyo ca kamanīyo ca hoti.
Furthermore, on the outer surface of its felloe-circle, in the spaces between every ten spokes, there is a coral staff, hollow inside like a wind instrument, adorned with circular holes, and taking in air. When struck by the wind, the sound of this coral staff is like the sound of a five-instrument orchestra expertly played by a very skilled musician; it is pleasant, captivating, and delightful.
Hơn nữa, trên bề mặt vành bánh xe ấy, giữa mỗi mười nan hoa, có một cây san hô rỗng ruột bên trong, có hình tròn với các lỗ hổng, hút gió, giống như một ống sáo, và khi gió thổi vào, âm thanh phát ra giống như tiếng của một nhạc cụ năm loại được người nhạc sĩ tài tình hòa tấu, vừa du dương, vừa mê hoặc, vừa đáng yêu.
Tassa kho pana pavāḷadaṇḍassa upari setacchattaṃ, ubhosu passesu samosaritakusumadāmapantiyoti evaṃ samosaritakusumadāmapantisatadvayaparivārena setacchattasatadhārinā pavāḷadaṇḍasatena samupasobhitanemiparikkhepassa dvinnampi nābhipanāḷīnaṃ anto dve sīhamukhāni honti, yehi tālakkhandhappamāṇā puṇṇacandakiraṇakalāpasassirikā taruṇaravisamānarattakambalageṇḍukapariyantā ākāsagaṅgāgatisobhaṃ abhibhavamānā viya dve muttakalāpā olambanti, yehi cakkaratanena saddhiṃ ākāse samparivattamānehi tīṇi cakkāni ekato parivattantāni viya khāyanti.
Above that coral staff is a white parasol, and on both sides of it are rows of suspended flower garlands. Thus, encircling the felloe, adorned with a hundred such coral staves, each bearing a hundred white parasols and surrounded by two hundred rows of suspended flower garlands, within the two central channels of the nave are two lion faces. From these, two pearl clusters, as large as palm trunks, shining with the radiance of a full moon’s rays, and edged with red blankets resembling the glow of a rising sun, hang down as if surpassing the beauty of the celestial river’s flow. When these turn in the air with the Cakka-ratana, they appear as if three wheels are turning together.
Trên cây san hô ấy có một chiếc lọng trắng, và ở hai bên có hai hàng vòng hoa rủ xuống; và như vậy, trong vòng chu vi vành bánh xe được trang hoàng bởi một trăm cây san hô với một trăm chiếc lọng trắng và hai trăm hàng vòng hoa rủ xuống, bên trong hai ống trục bánh xe có hai miệng sư tử, từ đó hai chuỗi ngọc trai rủ xuống, lớn bằng thân cây thốt nốt, rực rỡ như ánh sáng của trăng tròn, với các cạnh tròn như những quả cầu chăn đỏ tươi màu mặt trời non, dường như vượt qua vẻ đẹp của dòng sông thiên giới (Akasaganga). Khi những chuỗi ngọc trai này quay cùng với Cakka-ratana trên không trung, dường như có ba bánh xe đang quay cùng một lúc.
Ayamassa sabbaso sabbākāraparipūratā.
This is its perfection in all respects.
Đây là sự hoàn hảo toàn diện về mọi mặt của nó.
Taṃ panetaṃ evaṃ sabbākāraparipūraṃ pakatiyā sāyamāsabhattaṃ bhuñjitvā attano attano gharadvāre paññattāsanesu nisīditvā pavattakathāsallāpesu manussesu vīthicatukkādīsu kīḷamāne dārakajane nātiuccena nātinīcena vanasaṇḍamatthakāsannena ākāsappadesena upasobhayamānaṃ viya rukkhasākhaggāni, dvādasayojanato paṭṭhāya suyyamānena madhurassarena sattānaṃ sotāni odhāpayamānaṃ yojanato paṭṭhāya nānappabhāsamudayasamujjalena vaṇṇena nayanāni samākaḍḍhantaṃ rañño cakkavattissa puññānubhāvaṃ ugghosayantaṃ viya rājadhāniabhimukhaṃ āgacchati.
That Cakka-ratana, perfect in all these respects, appears in the sky at a height neither too high nor too low, near the tops of trees, as if adorning the branch tips of a forest grove. This occurs when people, having eaten their usual evening meal, are seated on prepared seats at their respective house doors, engaged in conversation, and children are playing in streets and at crossroads. The Cakka-ratana comes towards the royal capital, making the ears of beings listen with its sweet sound, audible from twelve yojanas away, and captivating their eyes with its radiating splendor of various hues, shining from one yojana away, as if proclaiming the power of the Wheel-turning Monarch’s merits.
Sau khi dùng bữa tối như thường lệ, khi mọi người đang ngồi trên những chỗ ngồi đã được sắp đặt trước cửa nhà mình để trò chuyện, và trẻ em đang chơi đùa trên đường phố và các ngã tư, Cakka-ratana hoàn hảo về mọi mặt ấy đến gần kinh đô, dường như đang tô điểm cho không gian gần đỉnh rừng cây, không quá cao cũng không quá thấp, với âm thanh ngọt ngào có thể nghe thấy từ khoảng cách mười hai dojana, thu hút tai của chúng sinh, và với màu sắc rực rỡ phát ra nhiều loại ánh sáng từ khoảng cách một dojana, thu hút mắt của chúng sinh, dường như đang tuyên bố phước báu của vị Chuyển Luân Thánh Vương.
Atha tassa cakkaratanassa saddassavaneneva ‘‘kuto nu kho, kassa nu kho ayaṃ saddo’’ti āvajjitahadayānaṃ puratthimadisaṃ olokayamānānaṃ tesaṃ manussānaṃ aññataro aññataraṃ evamāha – ‘‘passa bho acchariyaṃ, ayaṃ puṇṇacando pubbe eko uggacchati, ajja pana attadutiyo uggato, etañhi rājahaṃsamithunaṃ viya puṇṇacandamithunaṃ pubbāpariyena gaganatalaṃ abhilaṅghatī’’ti.
Then, at the mere sound of that Cakka-ratana, people whose hearts are stirred, wondering, “From where, and of whom, is this sound?”, look to the east. One among them says to another: “Behold, friend, a wonder! Formerly, the full moon rose alone, but today it has risen with a companion. Indeed, this pair of full moons, like a pair of royal swans, crosses the sky one after the other!”
Khi ấy, chỉ vừa nghe thấy âm thanh của Cakka-ratana ấy, những người ấy, với tâm trí đang suy nghĩ: “Âm thanh này từ đâu đến? Của ai vậy?”, và nhìn về phía đông, một người nói với người kia rằng: “Này bạn, hãy xem điều kỳ diệu! Trước đây, mặt trăng tròn mọc một mình, nhưng hôm nay nó mọc đôi, như một cặp thiên nga vương giả, một cặp trăng tròn đang bay qua bầu trời, một trước một sau!”
Tamañño āha – ‘‘kiṃ kathesi samma kahaṃ nāma tayā dve puṇṇacandā ekato uggacchantā diṭṭhapubbā, nanu esa tapanīyaraṃsidhāro piñcharakiraṇo divākaro uggato’’ti.
Another replies to him: “What are you saying, friend? Where have you ever seen two full moons rising together? Is it not the sun that has risen, bearing a scorching beam and a tawny ray?”
Người khác nói với anh ta: “Bạn đang nói gì vậy, bạn của tôi? Bạn đã bao giờ thấy hai mặt trăng tròn mọc cùng lúc ở đâu chưa? Chẳng phải đó là mặt trời, với những tia sáng rực rỡ màu vàng cam, đang mọc đó sao?”
Tamañño sitaṃ katvā evamāha – ‘‘kiṃ ummattosi, nanu kho idānimeva divākaro atthaṅgato, so kathaṃ imaṃ puṇṇacandaṃ anubandhamāno uggacchissati, addhā panetaṃ anekaratanappabhāsamujjalaṃ ekassa puññavato vimānaṃ bhavissatī’’ti.
Another, smiling, says to him: “Are you mad? Has not the sun just set? How can it rise now, following this full moon? Surely, this must be the radiant celestial palace of a meritorious being, shining with the light of many jewels.”
Người khác mỉm cười và nói: “Bạn có điên không? Chẳng phải mặt trời vừa lặn đó sao? Làm sao nó có thể mọc lại theo sau mặt trăng tròn này được? Chắc chắn đây là một cung điện của một người có phước báu, rực rỡ với ánh sáng của nhiều loại ngọc quý.”
Te sabbepi apasādayantā aññe evamāhaṃsu – ‘‘kiṃ bahuṃ vippalapatha, nevesa puṇṇacando, na sūriyo na devavimānaṃ.
All of them, disapproving of the others, said: “Why do you babble so much? That is neither the full moon, nor the sun, nor a celestial palace.
Tất cả họ đều bác bỏ những ý kiến khác và nói: “Sao các bạn lại nói nhiều lời vô ích thế? Đó không phải là mặt trăng tròn, không phải mặt trời, cũng không phải cung điện của chư thiên.
Na hetesaṃ evarūpā sirisampatti atthi, cakkaratanena panetena bhavitabba’’nti.
These do not possess such splendor. This must be the Cakka-ratana.”
Những thứ đó không có sự huy hoàng như vậy. Chắc chắn đó là Cakka-ratana.”
Evaṃ pavattasallāpasseva tassa janassa candamaṇḍalaṃ ohāya taṃ cakkaratanaṃ abhimukhaṃ hoti.
As the people were thus conversing, the Cakka-ratana, leaving the moon’s orb, came into view.
Trong khi những người ấy đang trò chuyện như vậy, Cakka-ratana ấy đã rời khỏi quỹ đạo mặt trăng và hướng về phía họ.
Tato tehi ‘‘kassa nu kho idaṃ nibbatta’’nti vutte bhavanti vattāro – ‘‘na kassaci aññassa, nanu amhākaṃ rājā pūritacakkavattivatto, tassetaṃ nibbatta’’nti.
Thereupon, when they asked, “To whom has this arisen?”, some replied: “To no one else. Is not our king one who has fulfilled the duties of a Cakkavatti? This has arisen for him.”
Khi họ hỏi: “Cái này xuất hiện vì ai?”, những người khác đáp: “Không vì ai khác cả! Chẳng phải Đức vua của chúng ta đã hoàn thành bổn phận của một Chuyển Luân Thánh Vương sao? Cái này xuất hiện vì Ngài.”
Atha so ca mahājano, yo ca añño passati, sabbo cakkaratanameva anugacchati.
Then that great multitude, and all others who saw it, followed the Cakka-ratana.
Khi ấy, cả đại chúng ấy, và bất cứ ai khác nhìn thấy, đều đi theo Cakka-ratana.
Tampi cakkaratanaṃ raññoyeva atthāya attano āgatabhāvaṃ ñāpetukāmaṃ viya sattakkhattuṃ pākāramatthakeneva nagaraṃ anusaṃyāyitvā rañño antepuraṃ padakkhiṇaṃ katvā antepurassa uttarasīhapañjaraāsanne ṭhāne yathā gandhapupphādīhi sukhena sakkā hoti pūjetuṃ, evaṃ akkhāhataṃ viya tiṭṭhati.
That Cakka-ratana, as if desiring to make known that it had come for the king’s benefit, circled the city seven times above the city wall, then circumambulated the king’s inner palace, and stopped at a spot near the northern lion-window of the inner palace, as if fixed by an axle, so that it could be easily honored with perfumes, flowers, and so forth.
Cakka-ratana ấy, dường như muốn cho vua biết rằng nó đã đến vì lợi ích của Ngài, đã bay vòng quanh thành phố bảy lần trên đỉnh tường thành, sau đó đi nhiễu quanh cung điện của vua theo chiều kim đồng hồ, và dừng lại ở một vị trí gần cửa sổ sư tử ở phía bắc của cung điện, như thể được đóng cọc, để có thể dễ dàng cúng dường bằng hương hoa và các vật phẩm khác.
Evaṃ ṭhitassa panassa vātapānacchiddādīhi pavisitvā nānāvirāgaratanappabhāsamujjalaṃ anto pāsādaṃ alaṅkurumānaṃ pabhāsamūhaṃ disvā dassanatthāya sañjātābhilāso rājā hoti.
Seeing the mass of light that penetrated through windows and openings, illuminating the interior of the palace with the radiance of various brilliantly colored jewels, the king developed a desire to see it.
Khi Cakka-ratana ấy đứng yên như vậy, ánh sáng của nó, rực rỡ với nhiều loại ngọc quý lấp lánh, xuyên qua các lỗ cửa sổ và các khe hở, chiếu sáng bên trong cung điện, khiến nhà vua nảy sinh ý muốn được chiêm ngưỡng.
Parijanopissa piyavacanapābhatena āgantvā tamatthaṃ nivedeti.
His attendants also came, bearing kind words as a gift, and reported the matter to him.
Các cận thần của Ngài cũng đến và báo cáo sự việc đó với những lời lẽ thân ái.
Atha rājā balavapītipāmojjaphuṭasarīro pallaṅkaṃ mocetvā uṭṭhāyāsanā sīhapañjarasamīpaṃ gantvā taṃ cakkaratanaṃ disvā ‘‘sutaṃ kho pana meta’’ntiādikaṃ cintanaṃ cintesi.
Then the king, his body filled with strong joy and rapture, uncrossed his legs, rose from his seat, went near the lion-window, and seeing the Cakka-ratana, reflected, “I have heard that…” and so forth.
Khi ấy, nhà vua, với thân thể tràn đầy hỷ lạc mạnh mẽ, gỡ thế kiết già, đứng dậy khỏi chỗ ngồi, đi đến gần cửa sổ sư tử, nhìn thấy Cakka-ratana ấy và suy nghĩ: “Ta đã nghe nói về điều này…”
Tena vuttaṃ – ‘‘disvāna rañño khattiyassa…pe… assaṃ nu kho ahaṃ rājā cakkavattī’’ti.
Thus it was said: “When the Khattiya king saw… and so on… Am I not a Cakkavatti king?”
Vì vậy, đã nói rằng: “Sau khi thấy vị vua Khattiya… (vân vân)… ta có phải là Chuyển Luân Thánh Vương không?”
Tattha so hoti rājā cakkavattīti kittāvatā cakkavattī hoti?
Here, “He is a Cakkavatti king”—how much does it take for one to be a Cakkavatti?
Trong đó, “ Vị ấy là Chuyển Luân Thánh Vương” có nghĩa là Chuyển Luân Thánh Vương như thế nào?
Ekaṅguladvaṅgulamattampi cakkaratane ākāsaṃ abbhuggantvā pavatte.
When the Cakka-ratana rises into the sky and turns, even by one or two finger-breadths.
Khi Cakka-ratana bay lên không trung dù chỉ một ngón tay hay hai ngón tay và bắt đầu quay.
Idāni tassa pavattāpanatthaṃ yaṃ kātabbaṃ taṃ dassento atha kho, bhikkhavetiādimāha.
Now, showing what is to be done to make it turn, he said, “Then, bhikkhus,” and so on.
Bây giờ, để chỉ ra những gì cần làm để làm cho nó quay, Đức Phật đã nói: “ Này các Tỳ-kheo,” và những lời tiếp theo.
Tattha uṭṭhāyāsanāti nisinnāsanato uṭṭhahitvā cakkaratanasamīpaṃ āgantvā.
Here, “rising from his seat” means rising from his seated position and coming near the Cakka-ratana.
Trong đó, “ Uṭṭhāyāsanā” có nghĩa là đứng dậy khỏi chỗ ngồi và đến gần Cakka-ratana.
Bhiṅkāraṃ gahetvāti hatthisoṇḍasadisapanāḷiṃ suvaṇṇabhiṅkāraṃ ukkhipitvā vāmahatthena udakaṃ gahetvā.
“Taking the water-pot” means lifting a golden water-pot with a spout resembling an elephant’s trunk with his left hand, and taking water.
“ Bhiṅkāraṃ gahetvā” có nghĩa là cầm một bình vàng có vòi giống như vòi voi, nâng nó bằng tay trái và lấy nước.
Pavattatu bhavaṃ cakkaratanaṃ, abhivijinātu bhavaṃ cakkaratananti.
“Let the venerable Cakka-ratana turn, let the venerable Cakka-ratana conquer!”
“Xin Cakka-ratana cao quý hãy quay, xin Cakka-ratana cao quý hãy chiến thắng!”
Anvadeva rājā cakkavattī saddhiṃ caturaṅginiyā senāyāti sabbacakkavattīnañhi udakena abhisiñcitvā ‘‘abhivijānātu bhavaṃ cakkaratana’’nti vacanasamanantarameva vehāsaṃ abbhuggantvā cakkaratanaṃ pavattati, yassa pavattisamakālameva so rājā cakkavattī nāma hoti.
“Then the Cakkavatti king, together with his fourfold army,” means that for all Cakkavattis, immediately after sprinkling water and saying, “Let the venerable Cakka-ratana conquer!”, the Cakka-ratana rises into the air and turns. At the very moment it begins to turn, that king becomes known as a Cakkavatti.
“ Và sau đó, Chuyển Luân Thánh Vương cùng với quân đội bốn binh chủng” – Đối với tất cả các Chuyển Luân Thánh Vương, ngay sau khi tưới nước và nói: “Xin Cakka-ratana cao quý hãy chiến thắng!”, Cakka-ratana sẽ bay lên không trung và bắt đầu quay. Ngay khi nó quay, vị vua ấy trở thành Chuyển Luân Thánh Vương.
Pavatte pana cakkaratane taṃ anubandhamānova rājā cakkavattī yānavaraṃ āruyha vehāsaṃ abbhuggacchati, athassa chattacāmarādihattho parijano ceva antepurajano ca.
When the Cakka-ratana turns, the Cakkavatti king, following it, ascends a splendid vehicle and rises into the air. Then his attendants, holding parasols and whisks, and the women of his inner palace, also follow.
Khi Cakka-ratana quay, Chuyển Luân Thánh Vương đi theo nó, lên cỗ xe quý báu và bay lên không trung. Khi ấy, các cận thần cầm lọng, chổi lông và những người trong nội cung cũng bay lên và vây quanh nhà vua.
Tato nānappakārakañcukakavacādisannāhavibhūsitena vividhāharaṇappabhāsamujjalitena samussitaddhajapaṭākapaṭimaṇḍitena attano attano balakāyena saddhiṃ uparājasenāpati pabhūtayopi vehāsaṃ abbhuggantvā rājānameva parivārenti.
Thereafter, the viceroy, the general, and other high officials, adorned with various coats of mail and armor, shining with the splendor of diverse weapons, and embellished with raised banners and flags, together with their respective divisions of troops, also rise into the air and surround the king.
Sau đó, các phó vương, tổng tư lệnh và những người khác, được trang bị áo giáp, áo choàng và các loại trang phục khác nhau, rực rỡ với ánh sáng của nhiều loại vũ khí, được trang hoàng bằng cờ phướn giương cao, cùng với quân đội của mình, cũng bay lên không trung và vây quanh nhà vua.
Rājayuttā pana janasaṅgahatthaṃ nagaravīthīsu bheriyo carāpenti ‘‘tātā amhākaṃ rañño cakkaratanaṃ nibbattaṃ, attano attano vibhavānurūpena maṇḍitappasādhitā sannipatathā’’ti.
The royal officials, for the welfare of the people, have drums beaten in the city streets, announcing: “Dear friends, a Cakka-ratana has arisen for our king! Adorn yourselves according to your wealth and assemble!”
Các quan lại của nhà vua cho đánh trống trong các con đường thành phố để tập hợp dân chúng, nói rằng: “Này các bạn, Cakka-ratana của Đức vua chúng ta đã xuất hiện. Hãy trang điểm và ăn mặc lộng lẫy theo khả năng của mình và tập hợp lại!”
Mahājano pana pakatiyā cakkaratanasaddeneva sabbakiccāni pahāya gandhapupphādīni ādāya sannipatitova, sopi sabbo vehāsaṃ abbhuggantvā rājānameva parivāreti.
The great multitude, however, naturally, at the sound of the Cakka-ratana alone, abandoning all their activities, had already assembled, bringing perfumes, flowers, and so forth. All of them also rise into the air and surround the king.
Đại chúng, vốn đã bỏ tất cả công việc của mình ngay khi nghe tiếng Cakka-ratana, đã tập hợp lại với hương hoa và các vật phẩm khác. Tất cả họ cũng bay lên không trung và vây quanh nhà vua.
Yassa yassa hi raññā saddhiṃ gantukāmatā uppajjati, so so ākāsagatova hoti.
Indeed, for whosoever arises the desire to go with the Universal Monarch, that person becomes one who moves through the air.
Quả thật, bất cứ ai có ý muốn đi cùng với vua, người ấy liền ở trên không trung.
Evaṃ dvādasayojanāyāmavitthārā parisā hoti.
Thus, the retinue is twelve yojanas in length and breadth.
Như vậy, đoàn tùy tùng có chiều dài và chiều rộng mười hai dojana.
Tattha ekapurisopi chinnabhinnasarīro vā kiliṭṭhavattho vā natthi.
Among them, not even a single man has a body that is mutilated or broken, nor a garment that is soiled.
Trong đó, không một người nào có thân thể bị thương tích hay quần áo dơ bẩn.
Suciparivāro hi rājā cakkavattī.
Indeed, the Universal Monarch has a pure retinue.
Quả thật, vị Chuyển Luân Vương có đoàn tùy tùng thanh tịnh.
Cakkavattiparisā nāma vijjādharaparisā viya ākāse gacchamānā indanīlamaṇitale vippakiṇṇaratanasadisā hoti.
The retinue of the Universal Monarch, as it proceeds through the air, is like the retinue of a vijjādhara, resembling scattered jewels on a sapphire slab.
Đoàn tùy tùng của Chuyển Luân Vương, khi đi trên không trung, giống như đoàn tùy tùng của các vị Vidyādhara, như những viên ngọc quý rải rác trên tấm ngọc Indanīla.
Tena vuttaṃ ‘‘anvadeva rājā cakkavattī saddhiṃ caturaṅginiyā senāyā’’ti.
Therefore it was said: "After him, the Universal Monarch goes with his fourfold army."
Do đó, đã được nói: “Vị Chuyển Luân Vương cùng với bốn binh chủng quân đội đi theo sau.”
Tampi cakkaratanaṃ rukkhaggānaṃ uparūpari nātiuccena gaganapadesena pavattati, yathā rukkhānaṃ pupphaphalapallavehi atthikā tāni sukhena gahetuṃ sakkonti, bhūmiyaṃ ṭhitā ‘‘esa rājā, esa uparājā, esa senāpatī’’ti sallakkhetuṃ sakkonti.
That Cakka-gem also proceeds high above the treetops, not excessively high in the sky, so that those who desire the flowers, fruits, and tender leaves of the trees can easily gather them, and those standing on the ground can identify, "This is the king, this is the crown prince, this is the general."
Bánh xe báu ấy di chuyển trên không trung, không quá cao so với ngọn cây, sao cho những ai muốn hoa, quả, lá non từ cây có thể dễ dàng hái được, và những người đứng dưới đất có thể nhận ra: “Đây là vua, đây là thái tử, đây là tổng tư lệnh.”
Ṭhānādīsupi iriyāpathesu yo yena icchati, so teneva gacchati.
As for postures such as standing, whoever wishes to go in a certain posture, goes in that one.
Trong các tư thế đi đứng, v.v., ai muốn đi theo tư thế nào thì đi theo tư thế đó.
Cittakammādisippapasutā cettha attano attano kiccaṃ karontāyeva gacchanti.
Those skilled in various crafts, such as painting, also proceed while performing their respective tasks.
Những người thợ thủ công như thợ vẽ tranh, v.v., cũng vừa đi vừa làm công việc của mình.
Yatheva hi bhūmiyaṃ, tathā nesaṃ sabbakiccāni ākāse ijjhanti.
Just as on the ground, so too all their tasks are accomplished in the air.
Quả thật, mọi công việc của họ đều thành tựu trên không trung như trên mặt đất.
Evaṃ cakkavattiparisaṃ gahetvā taṃ cakkaratanaṃ vāmapassena sineruṃ pahāya samuddassa uparibhāgena aṭṭhayojanasahassappamāṇaṃ pubbavidehaṃ gacchati.
Taking his retinue in this way, that Cakka-gem leaves Mount Sineru on its left side and proceeds over the ocean to Pubbavideha, which is eight thousand yojanas in extent.
Như vậy, mang theo đoàn tùy tùng của Chuyển Luân Vương, bánh xe báu ấy rời núi Sineru ở phía bên trái, đi qua vùng biển phía đông đến Pubbavideha, rộng tám ngàn dojana.
Tattha yo vinibbedhena dvādasayojanāya parikkhepato chattiṃsayojanaparisāya sannivesakkhamo sulabhāhārūpakaraṇo chāyūdakasampanno sucisamatalo ramaṇīyo bhūmibhāgo, tassa uparibhāge taṃ cakkaratanaṃ ākāse akkhāhataṃ viya tiṭṭhati.
There, a delightful area of land, suitable for a settlement of thirty-six yojanas in circumference (with a penetration of twelve yojanas), where food and provisions are easily obtained, abundant with shade and water, pure and level, exists; upon that, the Cakka-gem stands in the sky as if fixed by an axle.
Ở đó, có một vùng đất đẹp đẽ, bằng phẳng, sạch sẽ, đầy đủ bóng mát và nước uống, dễ dàng có lương thực và vật dụng, có thể dựng trại cho một đoàn tùy tùng rộng mười hai dojana theo chiều ngang và ba mươi sáu dojana theo chu vi; trên vùng đất ấy, bánh xe báu dừng lại trên không trung như thể bị trục giữ chặt.
Atha tena saññāṇena so mahājano otaritvā yathāruci nhānabhojanādīni sabbakiccāni karonto vāsaṃ kappeti, tena vuttaṃ ‘‘yasmiṃ kho pana, bhikkhave, padese taṃ cakkaratanaṃ patiṭṭhāti, tattha rājā cakkavattī vāsaṃ upeti saddhiṃ caturaṅginiyā senāyā’’ti.
Then, with that sign, the multitude descends and, performing all their duties such as bathing and eating as they please, they establish their residence; therefore it was said: "Wherever, bhikkhus, that Cakka-gem stands, there the Universal Monarch takes up residence with his fourfold army."
Sau đó, bằng dấu hiệu ấy, đại chúng hạ xuống và an trú, thực hiện mọi công việc như tắm rửa, ăn uống, v.v., tùy theo ý muốn. Do đó, đã được nói: “Này các Tỳ-khưu, nơi nào bánh xe báu ấy dừng lại, ở đó Chuyển Luân Vương cùng với bốn binh chủng quân đội an trú.”
Evaṃ vāsaṃ upagate cakkavattimhi ye tattha rājāno, te ‘‘paracakkaṃ āgata’’nti sutvāpi na balakāyaṃ sannipātetvā yuddhasajjā honti.
When the Universal Monarch thus takes up residence, the kings there, even upon hearing, "An enemy army has arrived," do not assemble their forces and prepare for battle.
Khi Chuyển Luân Vương an trú như vậy, các vị vua ở đó, dù nghe nói “quân địch đã đến,” cũng không tập hợp quân đội để chuẩn bị chiến tranh.
Cakkaratanassa uppattisamanantarameva natthi so satto nāma, yo paccatthikasaññāya rājānaṃ ārabbha āvudhaṃ ukkhipituṃ visaheyya.
Immediately upon the appearance of the Cakka-gem, there is no being who would dare to raise a weapon against the king with the intention of hostility.
Ngay sau khi bánh xe báu xuất hiện, không một chúng sanh nào dám cầm vũ khí chống lại vị vua với ý nghĩ là kẻ thù.
Ayamanubhāvo cakkaratanassa.
This is the power of the Cakka-gem.
Đây là uy lực của bánh xe báu.
Tasmā sabbepi te rājāno attano attano rajjasirivibhavānurūpaṃ pābhataṃ gahetvā taṃ rājānaṃ upagamma onatasirā attano moḷiyamaṇippabhābhisekenassa pādapūjaṃ karonto ‘‘ehi kho mahārājā’’tiādīhi vacanehi tassa kiṅkārappaṭissāvitaṃ āpajjanti.
Therefore, all those kings, taking gifts suitable to their royal splendor and wealth, approach that king, and bowing their heads, with the radiance of the jewels on their crowns, they pay homage to his feet, addressing him with words such as, "Come, great king," and making themselves subservient.
Vì vậy, tất cả các vị vua ấy đều mang theo lễ vật phù hợp với sự giàu sang và vinh quang vương giả của mình, đến gần vị vua ấy, cúi đầu, cúng dường chân ngài bằng ánh sáng từ ngọc báu trên vương miện của họ, và dùng những lời như “Xin mời, Đại Vương,” để bày tỏ sự phục tùng.
Tena vuttaṃ ye kho pana, bhikkhave, puratthimāya…pe… anusāsa mahārājāti.
Therefore it was said: "Those, bhikkhus, from the eastern direction… (pa) … govern, great king."
Do đó, đã được nói: “Này các Tỳ-khưu, những ai từ phương đông… (v.v.)… xin Đại Vương hãy giáo huấn.”
Tattha svāgatanti suāgamanaṃ.
There, "svāgataṃ" means a welcome arrival.
Trong đó, “svāgata” có nghĩa là sự đến tốt lành.
Ekasmiñhi āgate socanti, gate nandanti.
For indeed, at the arrival of some, people grieve; at their departure, they rejoice.
Khi một người đến, họ đau khổ; khi người ấy đi, họ vui mừng.
Ekasmiṃ āgate nandanti, gate socanti.
At the arrival of some, people rejoice; at their departure, they grieve.
Khi một người đến, họ vui mừng; khi người ấy đi, họ đau khổ.
Tādiso tvaṃ āgatanandano gamanasocano, tasmā tava āgamanaṃ suāgamananti vuttaṃ hoti.
You are such a one whose arrival brings joy and whose departure brings sorrow; therefore, your arrival is called a welcome arrival.
Ngài là người mà khi đến thì được hoan hỷ, khi đi thì gây sầu khổ. Do đó, sự đến của ngài được gọi là sự đến tốt lành.
Evaṃ vutte pana cakkavattī nāpi ‘‘ettakaṃ nāma me anuvassaṃ baliṃ upakappethā’’ti vadati, nāpi aññassa bhogaṃ acchinditvā aññassa deti.
However, when this is said, the Universal Monarch neither says, "Provide me with this much tribute annually," nor does he seize the wealth of one and give it to another.
Khi được nói như vậy, Chuyển Luân Vương không nói: “Hãy cống nạp cho ta bấy nhiêu thuế hàng năm,” cũng không cướp đoạt tài sản của người này để trao cho người khác.
Attano pana dhammarājabhāvassa anurūpāya paññāya pāṇātipātādīni upaparikkhitvā pemanīyena mañjunā sarena ‘‘passatha tātā, pāṇātipāto nāmesa āsevito bhāvito bahulīkato nirayasaṃvattaniko hotī’’tiādinā nayena dhammaṃ desetvā ‘‘pāṇo na hantabbo’’tiādikaṃ ovādaṃ deti.
But with wisdom befitting his state as a righteous king, he examines actions like taking life and, with a loving and pleasant voice, teaches the Dhamma in this manner: "See, my dears, taking life, when indulged in, developed, and practiced repeatedly, leads to rebirth in hell," and gives admonition such as, "Life should not be taken."
Ngài dùng trí tuệ phù hợp với phẩm chất của một vị vua Chánh Pháp, xem xét kỹ lưỡng các hành vi như sát sanh, v.v., rồi dùng giọng nói dịu dàng, đáng yêu để thuyết Pháp theo cách như: “Hỡi các con, hãy xem, hành vi sát sanh này, nếu được thực hành, phát triển, và làm cho sung mãn, sẽ dẫn đến cõi địa ngục,” và đưa ra lời giáo huấn như: “Không được sát sanh,” v.v.
Tena vuttaṃ rājā cakkavattī evamāha pāṇo na hantabbo…pe… yathābhuttañca bhuñjathāti.
Therefore it was said: "The Universal Monarch says thus: Life should not be taken… (pe) … and eat what you have eaten."
Do đó, đã được nói: “Chuyển Luân Vương nói như sau: Không được sát sanh… (v.v.)… và hãy hưởng thụ những gì đã được hưởng.”
Kiṃ pana sabbepi rañño imaṃ ovādaṃ gaṇhantīti.
Do all kings accept this admonition?
Vậy, có phải tất cả các vị vua đều chấp nhận lời giáo huấn này của ngài không?
Buddhassapi tāva sabbe na gaṇhanti, rañño kiṃ gaṇhissanti.
Even for the Buddha, not all accepted it; how then would they accept it for a king?
Ngay cả đối với Đức Phật, không phải tất cả đều chấp nhận, huống chi là đối với một vị vua.
Tasmā ye paṇḍitā vibhāvino, te gaṇhanti.
Therefore, those who are wise and discerning, they accept it.
Do đó, những người có trí tuệ và hiểu biết thì chấp nhận.
Sabbe pana anuyantā bhavanti.
However, all become followers.
Tuy nhiên, tất cả đều trở thành người phục tùng.
Tasmā ‘‘ye kho pana, bhikkhave’’tiādimāha.
Therefore, it says, "Those, bhikkhus," and so on.
Vì vậy, đã được nói: “Này các Tỳ-khưu, những ai…,” v.v.
Atha taṃ cakkaratanaṃ evaṃ pubbavidehavāsīnaṃ ovāde dinne katapātarāse cakkavattībalena vehāsaṃ abbhuggantvā puratthimaṃ samuddaṃ ajjhogāhati.
Then, having given such admonition to the inhabitants of Pubbavideha and having eaten breakfast, that Cakka-gem ascends into the sky by the power of the Universal Monarch's wheel and plunges into the eastern ocean.
Sau khi Chuyển Luân Vương đã dùng bữa sáng và ban lời giáo huấn cho cư dân Pubbavideha như vậy, bánh xe báu liền bay lên không trung nhờ uy lực của nó, rồi đi vào biển phía đông.
Yathā yathā ca taṃ ajjhogāhati, tathā tathā agadagandhaṃ ghāyitvā saṃkhittaphaṇo nāgarājā viya saṃkhittaūmivipphāraṃ hutvā ogacchamānaṃ mahāsamuddasalilaṃ yojanamattaṃ ogantvā antosamudde veḷuriyabhitti viya tiṭṭhati.
And as it plunges, the great ocean's water, smelling the scent of the antidote, shrinks its wave-expansions like a Nāga king retracting his hood, and descends one yojana, standing within the ocean like a sapphire wall.
Cứ mỗi khi nó đi vào sâu hơn, nước biển lớn lại rút xuống một dojana, như một vị Long vương đã ngửi mùi thuốc độc và cuộn mào lại, rồi đứng yên trong lòng biển như một bức tường ngọc bích.
Taṅkhaṇaññeva ca tassa rañño puññasiriṃ daṭṭhukāmāni viya mahāsamuddatale vippakiṇṇāni nānāratanāni tato tato āgantvā taṃ padesaṃ pūrayanti.
And at that very moment, various jewels scattered on the great ocean floor, as if desirous of seeing the glory of that king's merit, come from here and there and fill that area.
Ngay lập tức, các loại ngọc báu khác nhau, rải rác dưới đáy biển lớn, như muốn chiêm ngưỡng phước đức của vị vua ấy, từ khắp nơi đổ về lấp đầy vùng đó.
Atha sā rājaparisā taṃ nānāratanaparipūraṃ mahāsamuddatalaṃ disvā yathāruci ucchaṅgādīhi ādiyati, yathāruci ādinnaratanāya pana parisāya taṃ cakkaratanaṃ paṭinivattati.
Then that royal retinue, seeing the great ocean floor filled with various jewels, gathers them as they please into their laps and so on; and when the retinue has gathered the jewels as they please, that Cakka-gem returns.
Sau đó, đoàn tùy tùng của vua thấy đáy biển lớn đầy ắp các loại ngọc báu, liền lấy tùy thích bằng cách chứa vào vạt áo, v.v. Khi đoàn tùy tùng đã lấy ngọc báu tùy thích, bánh xe báu liền quay trở lại.
Paṭinivattamāne ca tasmiṃ parisā aggato hoti, majjhe rājā, ante cakkaratanaṃ.
As it returns, the retinue is in front, the king in the middle, and the Cakka-gem at the rear.
Khi bánh xe ấy quay trở lại, đoàn tùy tùng đi trước, vua ở giữa, và bánh xe báu ở phía sau.
Tampi jalanidhijalaṃ palobhiyamānamiva cakkaratanasiriyā, asahamānamiva ca tena viyogaṃ, nemimaṇḍalapariyantaṃ abhihanantaṃ nirantarameva upagacchati.
And that ocean water, as if enticed by the splendor of the Cakka-gem, and as if unable to bear separation from it, approaches continuously, striking against the edge of the wheel's rim.
Nước biển ấy cũng như bị vẻ đẹp của bánh xe báu mê hoặc, và như không chịu nổi sự chia lìa với nó, liền không ngừng tiến sát đến tận vành bánh xe.
257. Evaṃ rājā cakkavattī puratthimasamuddapariyantaṃ pubbavidehaṃ abhivijinitvā dakkhiṇasamuddapariyantaṃ jambudīpaṃ vijetukāmo cakkaratanadesitena maggena dakkhiṇasamuddābhimukho gacchati.
Having thus conquered Pubbavideha up to the eastern ocean, the Universal Monarch, desiring to conquer Jambudīpa up to the southern ocean, proceeds towards the southern ocean along the path indicated by the Cakka-gem.
Như vậy, Chuyển Luân Vương, sau khi đã chinh phục Pubbavideha đến tận bờ biển phía đông, muốn chinh phục Jambudīpa đến tận bờ biển phía nam, liền đi theo con đường do bánh xe báu chỉ dẫn, hướng về phía biển phía nam.
Tena vuttaṃ atha kho taṃ, bhikkhave, cakkaratanaṃ puratthimasamuddaṃ ajjhogāhetvā paccuttaritvā dakkhiṇaṃ disaṃ pavattatīti.
Therefore it was said: "Then, bhikkhus, that Cakka-gem, having plunged into the eastern ocean, ascends again and proceeds towards the southern direction."
Do đó, đã được nói: “Này các Tỳ-khưu, sau khi bánh xe báu ấy đã đi vào biển phía đông và quay trở lại, nó liền di chuyển về phía nam.”
Evaṃ pavattamānassa pana tassa pavattanavidhānaṃ senāsanniveso paṭirājagamanaṃ tesaṃ anusāsanippadānaṃ dakkhiṇasamuddaṃ ajjhogāhanaṃ samuddasalilassa ogacchanaṃ ratanādānanti sabbaṃ purimanayeneva veditabbaṃ.
And for its continuation thus proceeding, the manner of its movement, the encampment of the army, the coming of the rival kings, the giving of admonition to them, the plunging into the southern ocean, the descent of the ocean water, and the taking of jewels—all should be understood in the same way as before.
Và đối với sự di chuyển của nó như vậy, cách thức di chuyển, sự tập hợp quân đội, sự đến của các vị vua đối địch, việc ban lời giáo huấn cho họ, việc đi vào biển phía nam, việc nước biển rút xuống, việc thu thập ngọc báu, tất cả đều phải được hiểu theo cách thức đã nói ở trên.
Ettāvatā raññā cakkavattinā cāturantāya pathaviyā ādhipaccaṃ adhigataṃ hoti.
By this much, the Universal Monarch has attained dominion over the entire earth bounded by the four oceans.
Đến đây, Chuyển Luân Vương đã đạt được quyền thống trị trên toàn cõi đất bốn phương.
So evaṃ vijitavijayo attano rajjasirisampattidassanatthaṃ sapariso uddhaṃ gaganatalaṃ abhilaṅghitvā suvikasitapadumuppalapuṇḍarīkavanavicitte cattāro jātassare viya pañcasatapañcasataparittadīpaparivāre cattāro mahādīpe oloketvā cakkaratanadesiteneva maggena yathānukkamaṃ attano rājadhānimeva paccāgacchati.
Thus, that Universal Monarch, whose enemies had been conquered, having ascended to the sky above with his retinue to behold the splendor and prosperity of his kingship, looked upon the four great continents, each surrounded by five hundred small islands, as if they were four natural lakes adorned with fully bloomed lotuses, white water lilies, and red water lilies, and then returned to his own royal capital by the path indicated by the wheel-gem, in due order.
Vị Chuyển Luân Vương đã chiến thắng như vậy, để thị kiến sự viên mãn vinh quang vương quyền của mình, cùng với tùy tùng bay lên không trung, ngắm nhìn bốn đại châu, mỗi châu được vây quanh bởi năm trăm tiểu đảo, như thể đang nhìn bốn hồ tự nhiên được tô điểm bởi những rừng hoa sen, súng, và sen trắng nở rộ, rồi theo con đường do Bánh Xe Báu chỉ dẫn, tuần tự trở về kinh đô của mình.
Atha taṃ cakkaratanaṃ antepuradvāraṃ sobhayamānaṃ viya hutvā tiṭṭhati.
Then that wheel-gem stood as if adorning the palace gate.
Khi đó, Bánh Xe Báu ấy đứng yên như thể đang tô điểm cho cổng cung điện.
Evaṃ patiṭṭhite pana tasmiṃ cakkaratane rājantepure ukkāhi vā dīpikāhi vā kiñci karaṇīyaṃ na hoti, cakkaratanobhāsoyeva rattiṃ andhakāraṃ vidhamati.
When that wheel-gem was thus established, there was no need for torches or lamps in the royal inner palace; the radiance of the wheel-gem itself dispelled the darkness at night.
Khi Bánh Xe Báu ấy đã an vị như vậy, trong cung điện của vua không cần dùng đuốc hay đèn dầu gì cả, chính ánh sáng của Bánh Xe Báu xua tan bóng tối vào ban đêm.
Ye ca pana rattiṃ andhakāratthikā honti, tesaṃ andhakārameva hoti.
And for those who desired darkness at night, there was darkness.
Và những ai muốn có bóng tối vào ban đêm thì vẫn có bóng tối.
Tena vuttaṃ dakkhiṇasamuddaṃ ajjhogāhetvā…pe… evarūpaṃ cakkaratanaṃ pātubhavatīti.
Therefore, it was said: “Having plunged into the southern ocean...pe... such a wheel-gem appears.”
Vì vậy, đã nói: “ Đi vào biển phía nam… (v.v.)… Bánh Xe Báu như vậy xuất hiện.”
258. Evaṃ pātubhūtacakkaratanassa panassa cakkavattino amaccā pakatimaṅgalahatthiṭṭhānaṃ sucibhūmibhāgaṃ kāretvā haricandanādīhi surabhigandhehi upalimpāpetvā heṭṭhā vicittavaṇṇasurabhikusumasamākiṇṇaṃ upari suvaṇṇatārakānaṃ antarantarā samosaritamanuñña-kusumadāmappaṭimaṇḍitavitānaṃ devavimānaṃ viya abhisaṅkharitvā ‘‘evarūpassa nāma deva hatthiratanassa āgamanaṃ cintethā’’ti vadanti.
258. When such a wheel-gem had appeared, the ministers of that Universal Monarch prepared a clean plot of ground at the customary auspicious elephant-station, anointed it with fragrant perfumes like sandalwood, and created a canopy adorned with beautiful fragrant flowers below, and lovely flower garlands interspersed with golden stars above, like a celestial mansion, saying: “O Lord, may you contemplate the arrival of such a divine elephant-gem.”
Khi Bánh Xe Báu đã xuất hiện như vậy, các quan của vị Chuyển Luân Vương làm cho nơi đặt voi lành bình thường trở thành một khu vực đất sạch sẽ, xoa dầu thơm bằng gỗ đàn hương vàng và các loại hương liệu khác, bên dưới rải đầy hoa thơm đủ màu sắc, bên trên trang trí bằng những chuỗi hoa đẹp mắt xen lẫn những ngôi sao vàng, như một cung điện chư thiên, rồi thưa rằng: “Đại Vương, xin hãy quán tưởng sự xuất hiện của một con voi báu như vậy.”
So pubbe vuttanayeneva mahādānaṃ datvā sīlāni samādāya taṃ puññasampattiṃ āvajjanto nisīdati, athassa puññānubhāvacodito chaddantakulā vā uposathakulā vā taṃ sakkāravisesaṃ anubhavitukāmo taruṇaravimaṇḍalābhirattacaraṇa-gīvamukhappaṭimaṇḍitavisuddhasetasarīro sattappatiṭṭho susaṇṭhitaṅgapaccaṅgasanniveso vikasitaratta-padumacārupokkharo iddhimā yogī viya vehāsaṃ gamanasamattho manosilācuṇṇarañjitapariyanto viya rajatapabbato hatthiseṭṭho tasmiṃ padese patiṭṭhāti.
He, having made a great offering and undertaken the precepts in the manner previously described, sat reflecting on his meritorious achievements. Then, impelled by the power of his merit, a noble elephant, desirous of experiencing that special veneration, came from the Chaddanta lineage or the Uposatha lineage. Its body was pure white, adorned with feet, neck, and face reddish like the disc of the rising sun, standing firmly on seven points, with well-proportioned limbs and organs, possessing a trunk as beautiful as a blooming red lotus, endowed with psychic power like a yogi, capable of traversing the sky, appearing like a silver mountain with edges stained by realgar powder. This supreme elephant appeared in that place.
Vị ấy, theo cách đã nói trước đây, bố thí đại thí, thọ trì giới, và ngồi quán tưởng sự viên mãn công đức ấy. Khi đó, được thúc đẩy bởi năng lực công đức của vị ấy, một con voi chúa xuất hiện tại nơi đó, hoặc từ dòng dõi voi Chaddanta hoặc từ dòng dõi voi Uposatha, mong muốn hưởng thụ sự tôn kính đặc biệt ấy. Nó có thân thể trắng tinh khiết, được trang hoàng bằng chân và cổ họng đỏ rực như vầng mặt trời non, có bảy điểm chạm đất, các chi lớn nhỏ được sắp đặt cân đối, miệng đẹp như hoa sen đỏ tươi nở rộ, có thần thông, có khả năng đi trên không như một vị yogi, giống như một ngọn núi bạc với các cạnh được nhuộm bột đá son.
So chaddantakulā āgacchanto sabbakaniṭṭho āgacchati, uposathakulā sabbajeṭṭho.
When it comes from the Chaddanta lineage, it is the youngest of all elephants; when it comes from the Uposatha lineage, it is the oldest.
Nếu nó đến từ dòng dõi Chaddanta, nó sẽ là con voi nhỏ nhất; nếu từ dòng dõi Uposatha, nó sẽ là con voi lớn nhất.
Pāḷiyaṃ pana ‘‘uposatho nāgarājā’’ icceva āgacchati.
In the Pāli, however, it is stated as "Uposatha, the nāgarāja."
Trong Pāḷi thì chỉ nói: “Uposatha, vua voi.”
Svāyaṃ pūritacakkavattivattānaṃ cakkavattīnaṃ sutte vuttanayeneva cintayantānaṃ āgacchati, na itaresaṃ.
This elephant-king comes only to Universal Monarchs who have fulfilled the Universal Monarch's duties and contemplate it in the manner described in the sutta, not to others.
Con voi chúa này xuất hiện cho các Chuyển Luân Vương đã hoàn thành các bổn phận của Chuyển Luân Vương, những người quán tưởng theo cách đã nói trong kinh, chứ không phải cho những người khác.
Sayameva pakatimaṅgalahatthiṭṭhānaṃ āgantvā maṅgalahatthiṃ apanetvā tattha tiṭṭhati.
It comes by itself to the customary auspicious elephant-station, removes the auspicious elephant (already there) by its power, and stands in that place.
Nó tự mình đến nơi đặt voi lành bình thường, dời con voi lành đi và đứng ở đó.
Tena vuttaṃ puna caparaṃ, bhikkhave…pe… nāgarājāti.
Therefore, it was said: “Furthermore, bhikkhus...pe... the nāgarāja.”
Vì vậy, đã nói: “ Lại nữa, này các Tỳ-kheo… (v.v.)… vua voi.”
Evaṃ pātubhūtaṃ pana taṃ hatthiratanaṃ disvā hatthigopakādayo haṭṭhatuṭṭhā vegena gantvā rañño ārocenti.
Seeing that elephant-gem thus appeared, the elephant-keepers and others, joyful and delighted, quickly went and reported it to the king.
Khi thấy con Voi Báu xuất hiện như vậy, những người quản tượng và những người khác vui mừng khôn xiết, vội vã đi báo cáo với vua.
Rājā turitaturitaṃ āgantvā taṃ disvā pasannacitto ‘‘bhaddakaṃ vata bho hatthiyānaṃ, sace damathaṃ upeyyā’’ti cintayanto hatthaṃ pasāreti.
The king, arriving with great haste and seeing it, with a pleased mind, thought: "Oh, what a fine elephant mount! If only it were tamed!" and extended his hand.
Vua vội vã đến, nhìn thấy nó, tâm hoan hỷ, nghĩ: “Ôi, con voi này thật tốt! Nếu có thể thuần hóa được nó thì thật tuyệt vời!”, rồi đưa tay ra.
Atha so gharadhenuvacchako viya kaṇṇe olambetvā sūratabhāvaṃ dassento rājānaṃ upasaṅkamati, rājā taṃ abhiruhitukāmo hoti.
Then that elephant, like a calf of a domestic cow, approached the king, showing its gentleness by hanging its ears; the king desired to mount it.
Khi đó, con voi ấy, như một con nghé nhà, rủ tai xuống, biểu lộ sự dịu dàng, tiến đến gần vua. Vua muốn cưỡi nó.
Athassa parijanā adhippāyaṃ ñatvā taṃ hatthiratanaṃ sovaṇṇaddhajaṃ sovaṇṇālaṅkāraṃ hemajālapaṭicchannaṃ katvā upanenti.
Then his attendants, understanding his intention, prepared that elephant-gem with a golden banner, golden ornaments, and covered it with a golden net, and brought it to him.
Khi đó, tùy tùng của vua hiểu ý, trang hoàng con Voi Báu ấy bằng cờ vàng, trang sức vàng, và phủ bằng lưới vàng, rồi dâng lên vua.
Rājā taṃ anisīdāpetvāva sattaratanamayāya nisseṇiyā abhiruyha ākāsaṃ gamananinnacitto hoti.
The king, without causing it to sit down, ascended by a staircase made of the seven precious gems, his mind inclined to go into the sky.
Vua, không cần bảo nó ngồi xuống, liền leo lên bằng thang làm bằng bảy loại báu và tâm hướng về việc đi trên không.
Tassa saha cittuppādeneva so hatthirājā rājahaṃso viya indanīlamaṇippabhājālanīlagaganatalaṃ abhilaṅghati, tato cakkacārikāya vuttanayeneva sakalarājaparisā.
With the mere arising of his thought, that elephant-king soared into the sky, which was blue like a network of sapphire light, just as a royal swan would, and then his entire royal retinue followed in the same manner as described for the wheel-journey.
Ngay khi ý nghĩ ấy khởi lên, con voi chúa ấy, như một con thiên nga chúa, bay lên không trung xanh thẳm như ánh sáng ngọc Indra Nīla, rồi toàn thể tùy tùng của vua cũng bay theo, theo cách đã nói về chuyến đi của Bánh Xe Báu.
Iti sapariso rājā antopātarāseyeva sakalapathaviṃ anusaṃyāyitvā rājadhāniṃ paccāgacchati, evaṃ mahiddhikaṃ cakkavattino hatthiratanaṃ hoti.
Thus, the king, with his retinue, traversed the entire earth and returned to the royal capital within the morning mealtime. Such is the great psychic power of the Universal Monarch's elephant-gem.
Như vậy, vị vua cùng với tùy tùng, chỉ trong buổi sáng, đã chu du khắp toàn cõi đất và trở về kinh đô. Voi Báu của vị Chuyển Luân Vương có đại thần thông như vậy.
Tena vuttaṃ disvāna rañño cakkavattissa…pe… evarūpaṃ hatthiratanaṃ pātubhavatīti.
Therefore, it was said: "Having seen the Universal Monarch's...pe... such an elephant-gem appears."
Vì vậy, đã nói: “ Sau khi thấy voi của vị Chuyển Luân Vương… (v.v.)… Voi Báu như vậy xuất hiện.”
Evaṃ pātubhūtahatthiratanassa pana cakkavattino parisā pakatimaṅgalaassaṭṭhānaṃ sucisamatalaṃ kāretvā alaṅkaritvā ca purimanayeneva rañño tassa āgamanacintanatthaṃ ussāhaṃ janenti.
When such an elephant-gem had appeared, the retinue of that Universal Monarch prepared and adorned the customary auspicious horse-station, making it clean and level, and in the same manner as before, encouraged the king to contemplate the arrival of such a horse-gem.
Khi Voi Báu đã xuất hiện như vậy, tùy tùng của vị Chuyển Luân Vương làm cho nơi đặt ngựa lành bình thường trở thành một khu vực sạch sẽ và bằng phẳng, trang hoàng nó, rồi theo cách trước đây, khuyến khích vua quán tưởng sự xuất hiện của ngựa báu.
So purimanayeneva katadānasakkāro samādinnasīlova pāsādatale nisinno puññasampattiṃ samanussarati, athassa puññānubhāvacodito sindhavakulato vijjullatāvinaddhasaradakālasetavalāhakarāsisassiriko rattapādo rattatuṇḍo candappabhāpuñjasadisasuddhasiniddhaghanasaṅghātasarīro kākagīvā viya indanīlamaṇi viya ca kāḷavaṇṇena sīsena samannāgatattā kāḷasīso suṭṭhu kappetvā ṭhapitehi viya muñjasadisehi saṇhavaṭṭaujugatigatehi kesehi samannāgatattā muñjakeso vehāsaṅgamo valāhako nāma assarājā āgantvā tasmiṃ ṭhāne patiṭṭhāti.
He, having performed deeds of generosity and undertaken precepts as before, sat on the palace terrace, recollecting his meritorious achievements. Then, impelled by the power of his merit, from the Sindhu lineage of noble horses, there came the king of horses named Valāhaka, resembling a white cloud mass entwined with lightning flashes in the autumn season, with red feet and a red muzzle, a body pure, smooth, and densely formed like a mass of moonlight, Kāḷasīsa (Black-headed) due to its head being black like a crow's neck or a sapphire, and Muñjakesa (Muñja-haired) due to its fine, round, straight, and smooth hair resembling well-arranged muñja grass, capable of traveling through the air. This horse-king appeared in that place.
Vị ấy, theo cách trước đây, sau khi đã bố thí và cúng dường, thọ trì giới, ngồi trên sân thượng cung điện, quán tưởng sự viên mãn công đức. Khi đó, được thúc đẩy bởi năng lực công đức của vị ấy, một con ngựa chúa tên là Valāhaka xuất hiện tại nơi đó, từ dòng dõi ngựa Sindhu, với vẻ đẹp như đám mây trắng mùa thu được bao bọc bởi tia chớp, chân đỏ, miệng đỏ, thân thể trắng tinh khiết, mịn màng, rắn chắc như ánh sáng mặt trăng, đầu đen như cổ quạ hoặc như ngọc Indra Nīla, nên được gọi là Kāḷasīsa (Đầu Đen), và có bờm lông mịn, tròn, thẳng, đẹp như cỏ muñja được cắt tỉa cẩn thận, nên được gọi là Muñjakesa (Bờm Cỏ Muñja), có khả năng đi trên không (vehāsaṅgama).
Sesaṃ sabbaṃ hatthiratane vuttanayeneva veditabbaṃ.
All the rest should be understood in the same manner as described for the elephant-gem.
Tất cả những điều còn lại đều phải hiểu theo cách đã nói về Voi Báu.
Evarūpaṃ assaratanaṃ sandhāya bhagavā puna caparantiādimāha.
It is with reference to such a horse-gem that the Blessed One said: "Furthermore, bhikkhus...pe...".
Đức Phật đã nói: “ Lại nữa” và các lời tiếp theo, ám chỉ đến Ngựa Báu như vậy.
Evaṃ pātubhūtaassaratanassa pana rañño cakkavattissa catuhatthāyāmaṃ sakaṭanābhisamappamāṇaṃ ubhosu antesu kaṇṇikapariyantato viniggatasuparisuddhamuttākalāpehi dvīhi kañcanapadumehi alaṅkataṃ caturāsītimaṇisahassaparivāraṃ tārāgaṇaparivutassa puṇṇacandassa siriṃ paṭippharamānaṃ viya vepullapabbatato maṇiratanaṃ āgacchati.
When such a horse-gem had appeared for that Universal Monarch, a jewel-gem came from the Vepulla Mountain, four cubits in length, the size of a chariot hub, adorned at both ends with two golden lotuses from which exceedingly pure strings of pearls emerged from the center's periphery, surrounded by eighty-four thousand jewels, as if radiating the splendor of the full moon encircled by a host of stars.
Khi Ngựa Báu đã xuất hiện như vậy, một viên Ngọc Báu xuất hiện từ núi Vepulla cho vị Chuyển Luân Vương. Viên ngọc ấy dài bốn cubit, kích thước bằng trục bánh xe, được trang trí bằng hai hoa sen vàng với những chuỗi ngọc trai tinh khiết tuyệt đẹp nhô ra từ các rìa ở cả hai đầu, được bao quanh bởi tám vạn bốn ngàn viên ngọc, như thể đang lan tỏa vẻ đẹp của vầng trăng tròn được vây quanh bởi các chòm sao.
Tassevaṃ āgatassa muttājālake ṭhapetvā veḷuparamparāya saṭṭhihatthappamāṇaṃ ākāsaṃ āropitassa rattibhāge samantā yojanappamāṇaṃ okāsaṃ ābhā pharati, yāya sabbo so okāso aruṇuggamanavelā viya sañjātāloko hoti.
When it had thus arrived, and was placed in a net of pearls and raised into the sky by a series of bamboos to a height of sixty cubits, its light spread for a distance of a yojana all around at night, illuminating the entire area as if it were dawn.
Khi viên ngọc ấy đã đến như vậy, được đặt trong lưới ngọc trai và được nâng lên không trung cao sáu mươi cubit bằng một hàng tre, ánh sáng của nó chiếu sáng khắp một khu vực rộng một dojana vào ban đêm, khiến toàn bộ khu vực đó sáng rực như lúc bình minh.
Tato kassakā kasikammaṃ, vāṇijā āpaṇugghāṭanaṃ, te te ca sippino taṃ taṃ kammantaṃ payojenti divāti maññamānā.
Then farmers carried out their farming, merchants opened their shops, and various artisans performed their respective tasks, thinking it was daytime.
Khi đó, nông dân làm công việc cày cấy, thương nhân mở cửa hàng, và các thợ thủ công khác làm công việc của mình, nghĩ rằng đó là ban ngày.
Tena vuttaṃ puna caparaṃ, bhikkhave…pe… maṇiratanaṃ pātubhavatīti.
Therefore, it was said: "Furthermore, bhikkhus...pe... a jewel-gem appears."
Vì vậy, đã nói: “ Lại nữa, này các Tỳ-kheo… (v.v.)… Ngọc Báu xuất hiện.”
Evaṃ pātubhūtamaṇiratanassa pana cakkavattissa visayasukhavisesakāraṇaṃ itthiratanaṃ pātubhavati.
When such a jewel-gem had appeared, a woman-gem appeared for that Universal Monarch, serving as a special source of sensual pleasure.
Khi Ngọc Báu đã xuất hiện như vậy, một Nữ Báu xuất hiện cho vị Chuyển Luân Vương, là nguyên nhân của những lạc thú đặc biệt về dục lạc.
Maddarājakulato vā hissa aggamahesiṃ ānenti, uttarakuruto vā puññānubhāvena sayaṃ āgacchati.
His chief queen was brought from the royal family of Madda, or she came spontaneously from Uttarukuru by the power of his merit.
Hoặc là họ mang đến cho vua một vị chánh hậu từ dòng dõi vua Madda, hoặc nàng tự mình đến từ Uttarakuru nhờ năng lực công đức của vua.
Avasesā panassā sampatti ‘‘puna caparaṃ, bhikkhave, rañño cakkavattissa itthiratanaṃ pātubhavati abhirūpā dassanīyā’’tiādinā nayena pāḷiyaṃyeva āgatā.
Her remaining qualities of perfection are described at length in the Pāli itself, in passages such as: "Furthermore, bhikkhus, a woman-gem appears for the Universal Monarch, beautiful, pleasing to the eye," and so on.
Những phẩm chất còn lại của nàng đã được nói rõ trong kinh Pāḷi theo cách: “Lại nữa, này các Tỳ-kheo, một Nữ Báu xuất hiện cho vị Chuyển Luân Vương, xinh đẹp, khả ái,” v.v.
Tattha saṇṭhānapāripūriyā adhikaṃ rūpaṃ assāti abhirūpā.
Among these, she is called abhirūpā (beautiful) because she possesses superior beauty through the perfection of her form.
Trong đó, “ abhirūpā” (xinh đẹp) có nghĩa là nàng có hình dáng vượt trội về sự hoàn hảo của các chi thể.
Dissamānā ca cakkhūni pīṇayati, tasmā aññaṃ kiccavikkhepaṃ hitvāpi daṭṭhabbāti dassanīyā.
And being seen, she delights the eyes; therefore, setting aside other distracting activities, she is to be seen—thus dassanīyā (lovely to behold).
Và khi được nhìn thấy, nàng làm hài lòng đôi mắt, do đó, dù bỏ qua những công việc khác, nàng vẫn đáng được nhìn ngắm, nên gọi là dassanīyā (đáng chiêm ngưỡng).
Dissamānā ca somanassavasena cittaṃ pasādetīti pāsādikā.
And being seen, she gladdens the mind through joy—thus pāsādikā (charming).
Và khi được nhìn thấy, nàng làm cho tâm (của người khác) trong sáng do sự hoan hỷ, nên gọi là pāsādikā. (đáng mến).
Paramāyāti evaṃ pasādāvahattā uttamāya.
Paramāyā means 'supreme' because she brings such joy.
Paramāyā (tối thượng) là vì mang lại sự trong sáng như vậy, nên là tối thượng.
Vaṇṇapokkharatāyāti vaṇṇasundaratāya.
Vaṇṇapokkharatāyā means 'of perfect complexion' or 'of beautiful complexion'.
Vaṇṇapokkharatāyā (sắc đẹp tuyệt vời) là sắc đẹp tuyệt hảo.
Samannāgatāti upetā.
Samannāgatā means 'endowed with'.
Samannāgatā (đầy đủ) là có được.
Abhirūpā vā yasmā nātidīghā nātirassā dassanīyā yasmā nātikisā nātithūlā, pāsādikā yasmā nātikāḷikā naccodātā.
Alternatively, abhirūpā because she is neither too tall nor too short; dassanīyā because she is neither too thin nor too stout; pāsādikā because she is neither too dark nor too fair.
Hoặc, vì nàng không quá cao không quá thấp, nên abhirūpā (xinh đẹp); vì nàng không quá gầy không quá mập, nên dassanīyā (đáng chiêm ngưỡng); vì nàng không quá đen không quá trắng, nên pāsādikā (đáng mến).
Paramāya vaṇṇapokkharatāya samannāgatā yasmā atikkantā mānusaṃ vaṇṇaṃ appattā dibbavaṇṇaṃ.
Paramāya vaṇṇapokkharatāya samannāgatā because her complexion surpasses that of humans but has not yet reached that of devas.
Paramāya vaṇṇapokkharatāya samannāgatā (đầy đủ sắc đẹp tuyệt vời) là vì vượt qua sắc đẹp của loài người nhưng chưa đạt đến sắc đẹp của chư thiên.
Manussānañhi vaṇṇābhā bahi na niccharati, devānaṃ atidūraṃ niccharati, tassā pana dvādasahatthappamāṇaṃ padesaṃ sarīrābhā obhāseti.
Indeed, the radiance of humans’ complexions does not extend outwards, while that of devas extends very far. But her body's radiance illuminates a space of twelve cubits.
Thật vậy, ánh sáng sắc đẹp của loài người không tỏa ra bên ngoài, ánh sáng của chư thiên tỏa ra rất xa, còn ánh sáng thân thể của nàng chiếu sáng một vùng rộng mười hai khuỷu tay.
Nātidīghādīsu cassā paṭhamayugaḷena ārohasampatti, dutiyayugaḷena pariṇāhasampatti, tatiyayugaḷena vaṇṇasampatti vuttā.
Among the terms like 'neither too tall,' the first pair describes her perfect height; the second pair, her perfect proportions; and the third pair, her perfect complexion.
Trong các đặc điểm không quá cao, v.v., cặp đầu tiên (không quá cao, không quá thấp) nói về sự hoàn hảo về chiều cao của nàng; cặp thứ hai (không quá gầy, không quá mập) nói về sự hoàn hảo về vóc dáng; cặp thứ ba (không quá đen, không quá trắng) nói về sự hoàn hảo về sắc đẹp.
Chahi vāpi etehi kāyavipattiyā abhāvo, atikkantā mānusaṃ vaṇṇanti iminā kāyasampatti vuttā.
Or, these six terms describe the absence of physical imperfections, and 'her complexion surpasses that of humans' describes her physical perfection.
Hoặc, sáu đặc điểm này nói về sự không có khiếm khuyết về thân thể, còn câu "vượt qua sắc đẹp của loài người" nói về sự hoàn hảo về thân thể.
Tūlapicuno vā kappāsapicuno vāti sappimaṇḍe pakkhipitvā ṭhapitassa satavihatassa tūlapicuno vā satavihatassa kappāsapicuno vā kāyasamphasso hoti.
Tūlapicuno vā kappāsapicuno vā means that her body's touch is like that of a hundred-times-beaten cotton tuft or a hundred-times-beaten kapok tuft, placed in clarified butter.
Tūlapicuno vā kappāsapicuno vā (như bông gòn hay bông vải) có nghĩa là sự tiếp xúc thân thể của nàng giống như bông gòn hoặc bông vải đã được giã trăm lần, đặt trong bơ lỏng.
Sīteti rañño sītakāle.
Sīte means 'in the king's cold season'.
Sīte (trong mùa lạnh) là trong mùa lạnh của nhà vua.
Uṇheti rañño uṇhakāle.
Uṇhe means 'in the king's hot season'.
Uṇhe (trong mùa nóng) là trong mùa nóng của nhà vua.
Candanagandhoti niccakālameva supisitassa abhinavassa catujjātisamāyojitassa haricandanassa gandho kāyato vāyati.
Candanagandho means that the scent of fresh haricandana, blended with the four species of perfumes, continuously emanates from her body.
Candanagandho (hương chiên đàn) là hương thơm của chiên đàn vàng mới mài, trộn bốn loại hương, tỏa ra từ thân thể nàng mọi lúc.
Uppalagandhoti hasitakathitakālesu mukhato nikkhanto taṅkhaṇaṃ vikasitasseva nīluppalassa atisurabhigandho vāyati.
Uppalagandho means that when she smiles or speaks, a supremely fragrant scent like that of a freshly bloomed blue lotus emanates from her mouth.
Uppalagandho (hương sen xanh) là hương thơm cực kỳ thanh khiết của hoa sen xanh vừa nở, tỏa ra từ miệng nàng khi nàng cười hay nói chuyện.
Evaṃ rūpasamphassagandhasampattiyuttāya panassā sarīrasampattiyā anurūpaṃ ācāraṃ dassetuṃ taṃ kho panātiādi vuttaṃ.
To show conduct appropriate to her bodily perfection, endowed with such perfect touch, complexion, and scent, the passage starting with taṃ kho panā has been stated.
Để chỉ ra hành vi phù hợp với sự hoàn hảo về thân thể của nàng, vốn có sự hoàn hảo về xúc giác và hương thơm như vậy, nên đã nói taṃ kho panā (này các Tỳ-kheo), v.v.
Tattha rājānaṃ disvā nisinnāsanato aggidaḍḍhā viya paṭhamameva uṭṭhātīti pubbuṭṭhāyinī.
Among these, pubbuṭṭhāyinī means she rises immediately upon seeing the king from her seated position, as if burned by fire.
Trong đó, pubbuṭṭhāyinī (dậy trước) là nàng đứng dậy ngay lập tức khỏi chỗ ngồi như bị lửa đốt khi thấy nhà vua.
Tasmiṃ nisinne tassa rañño tālavaṇṭena bījanādikiccaṃ katvā pacchā nipatati nisīdatīti pacchānipātinī.
Pacchānipātinī means that after the king is seated, she performs duties such as fanning him with a palm-leaf fan and then sits down after him.
Pacchānipātinī (ngồi sau) là khi nhà vua ngồi, nàng làm các việc như quạt cho nhà vua bằng quạt lá thốt nốt, rồi sau đó mới ngồi xuống.
Kiṃ karomi devāti tassa kiṃkāraṃ paṭissāvetīti kiṃkārapaṭissāvinī.
Kiṃkārapaṭissāvinī means she responds to the king's query, "What may I do, my lord?"
Kiṃkārapaṭissāvinī (hỏi "tôi phải làm gì?") là nàng hỏi nhà vua "Thưa Đại vương, tôi phải làm gì?".
Rañño manāpameva carati karotīti manāpacārinī.
Manāpacārinī means she acts and behaves only in ways pleasing to the king.
Manāpacārinī (hành động vừa ý) là nàng chỉ làm những điều vừa ý nhà vua.
Yaṃ rañño piyaṃ, tadeva vadatīti piyavādinī.
Piyavādinī means she speaks only what is dear to the king.
Piyavādinī (nói lời dễ thương) là nàng chỉ nói những lời mà nhà vua thích.
Idāni svāssā ācāro bhāvasuddhiyā eva, na sāṭheyyenāti dassetuṃ taṃ kho panātiādimāha.
Now, to show that her conduct is purely out of sincerity and not deceit, the passage starting with taṃ kho panā is spoken.
Bây giờ, để chỉ ra rằng hành vi của nàng là do sự thanh tịnh trong tâm, chứ không phải do sự lừa dối, nên đã nói taṃ kho panā (này các Tỳ-kheo), v.v.
Tattha no aticaratīti na atikkamitvā carati, aññaṃ purisaṃ cittenapi na patthetīti vuttaṃ hoti.
Among these, no aticaratī means she does not transgress, meaning she does not desire another man even in her mind.
Trong đó, no aticaratī (không vượt quá giới hạn) có nghĩa là nàng không hành động vượt quá giới hạn, không mong muốn một người đàn ông khác ngay cả trong tâm.
Tattha ye tassā ādimhi ‘‘abhirūpā’’tiādayo ante ‘‘pubbuṭṭhāyinī’’tiādayo guṇā vuttā, te pakatiguṇā eva ‘‘atikkantā mānusaṃ vaṇṇa’’ntiādayo pana cakkavattino puññaṃ upanissāya cakkaratanapātubhāvato paṭṭhāya purimakammānubhāvena nibbattantīti veditabbā.
Among these, the qualities mentioned at the beginning, such as "abhirūpā," and at the end, such as "pubbuṭṭhāyinī," are natural qualities. However, those like "her complexion surpasses that of humans" are to be understood as arising from the king's merit, due to the appearance of the Wheel-Gem, and by the power of previous kamma.
Trong số các phẩm chất của nàng, những phẩm chất được nói ở đầu như "xinh đẹp", v.v., và những phẩm chất ở cuối như "dậy trước", v.v., là những phẩm chất tự nhiên; còn những phẩm chất như "vượt qua sắc đẹp của loài người", v.v., thì được sinh ra do quả báo của nghiệp quá khứ, nương vào phước báu của Chuyển Luân Vương kể từ khi bánh xe báu xuất hiện.
Abhirūpatādikāpi vā cakkaratanapātubhāvato paṭṭhāya sabbākārapāripūrā jātā.
Or, qualities like being abhirūpā become perfect in all respects from the appearance of the Wheel-Gem.
Hoặc, các phẩm chất như xinh đẹp, v.v., cũng trở nên hoàn hảo về mọi mặt kể từ khi bánh xe báu xuất hiện.
Tenāha evarūpaṃ itthiratanaṃ pātubhavatīti.
Therefore, it is said, such a woman-gem appears.
Vì vậy, Đức Phật đã nói: "Một phụ nữ báu như vậy xuất hiện."
Evaṃ pātubhūtaitthiratanassa pana rañño cakkavattissa dhanakaraṇīyānaṃ kiccānaṃ yathāsukhappavattanatthaṃ gahapatiratanaṃ pātubhavati.
For the smooth accomplishment of the Universal Monarch's financial affairs, with such a woman-gem having appeared, the Householder-Gem appears.
Để cho các công việc liên quan đến tài sản của Chuyển Luân Vương được tiến hành thuận lợi, sau khi Nữ Báu xuất hiện như vậy, một Gia chủ Báu xuất hiện.
So pakatiyāva mahābhogo mahābhogakule jāto rañño dhanarāsivaḍḍhako seṭṭhi gahapati hoti, cakkaratanānubhāvasahitaṃ panassa kammavipākajaṃ dibbacakkhu pātubhavati, yena antopathaviyaṃ yojanabbhantare nidhiṃ passati.
He is naturally wealthy, born into a wealthy family, a rich householder who increases the king's treasury. By the power of the Wheel-Gem, he acquires a divine eye, born of kamma-result, with which he sees treasure within a yojana of the earth's interior.
Người ấy vốn là một đại phú hộ, sinh ra trong một gia đình đại phú hộ, là một trưởng giả, một gia chủ làm tăng thêm khối tài sản của nhà vua; nhưng nhờ oai lực của bánh xe báu, một thiên nhãn do quả báo nghiệp xuất hiện nơi người ấy, nhờ đó người ấy có thể nhìn thấy kho báu trong lòng đất trong phạm vi một dojana.
So taṃ sampattiṃ disvā tuṭṭhahadayo gantvā rājānaṃ dhanena pavāretvā sabbāni dhanakaraṇīyāni sampādeti.
Seeing this attainment, he becomes joyful, goes to the king, offers wealth, and completes all financial tasks.
Khi thấy sự thành tựu đó, người ấy hoan hỷ trong tâm, đến dâng tài sản cho nhà vua và hoàn thành mọi công việc liên quan đến tài sản.
Tena vuttaṃ puna caparaṃ, bhikkhave…pe… evarūpaṃ gahapatiratanaṃ pātubhavatīti.
Therefore, it is said, "Furthermore, O Bhikkhus...pe... such a householder-gem appears."
Vì vậy, Đức Phật đã nói: "Lại nữa, này các Tỳ-kheo... một Gia chủ Báu như vậy xuất hiện."
Evaṃ pātubhūtagahapatiratanassa pana rañño cakkavattissa sabbakiccasaṃvidhānasamatthaṃ pariṇāyakaratanaṃ pātubhavati.
With such a householder-gem having appeared, the Universal Monarch's Counsellor-Gem, capable of managing all affairs, appears.
Để Chuyển Luân Vương có thể sắp xếp mọi công việc, sau khi Gia chủ Báu xuất hiện như vậy, một Đại thần Báu xuất hiện.
So rañño jeṭṭhaputtova hoti.
He is the king's eldest son.
Người ấy chính là con trai trưởng của nhà vua.
Pakatiyā eva paṇḍito byatto medhāvī, rañño puññānubhāvaṃ nissāya panassa attano kammānubhāvena paracittañāṇaṃ uppajjati.
He is naturally wise, skilled, and intelligent. By relying on the king's meritorious power and his own kamma-power, knowledge of others' minds arises in him.
Vốn dĩ người ấy là người trí tuệ, thông minh, lanh lợi; nhưng nhờ nương vào phước báu của nhà vua, và do oai lực của nghiệp của chính mình, trí tuệ biết tâm người khác xuất hiện nơi người ấy.
Yena dvādasayojanāya rājaparisāya cittācāraṃ ñatvā rañño ahite hite ca vavatthapetuṃ samattho hoti.
With this, he understands the mental dispositions of the royal assembly within twelve yojanas and is capable of discerning what is detrimental or beneficial to the king.
Nhờ đó, người ấy có khả năng biết được hành vi tâm của hội đồng hoàng gia trong phạm vi mười hai dojana, và có thể sắp xếp những điều có lợi và bất lợi cho nhà vua.
Sopi taṃ attano ānubhāvaṃ disvā tuṭṭhahadayo rājānaṃ sabbakiccānusāsanena pavāreti.
He, too, seeing his own power, becomes joyful and offers the king guidance in all affairs.
Người ấy cũng, khi thấy oai lực của chính mình, hoan hỷ trong tâm, dâng lời khuyên về mọi công việc cho nhà vua.
Tena vuttaṃ puna caparaṃ…pe… pariṇāyakaratanaṃ pātubhavatīti.
Therefore, it is said, "Furthermore...pe... a counsellor-gem appears."
Vì vậy, Đức Phật đã nói: "Lại nữa... một Đại thần Báu xuất hiện."
Tattha ṭhapetabbaṃ ṭhapetunti tasmiṃ tasmiṃ ṭhānantare ṭhapetabbaṃ ṭhapetuṃ.
Among these, ṭhapetabbaṃ ṭhapetuṃ means to appoint those who should be appointed to various positions.
Trong đó, ṭhapetabbaṃ ṭhapetuṃ (đặt người đáng đặt) có nghĩa là đặt người đáng đặt vào vị trí thích hợp.
260. Kaṭaggahenāti jayaggāhena.
260. Kaṭaggahena means by taking victory.
260. Kaṭaggahenā (bằng cách chiếm lấy) là bằng cách chiến thắng.
Mahantaṃ bhogakkhandhanti ekappahāreneva dve vā tīṇi vā satasahassāni.
Mahantaṃ bhogakkhandhaṃ means two or three hundred thousand at one stroke.
Mahantaṃ bhogakkhandhaṃ (một khối tài sản lớn) là hai hoặc ba trăm ngàn (vàng bạc) trong một lần.
Kevalā paripūrā paṇḍitabhūmīti paṇḍito tīṇi sucaritāni pūretvā sagge nibbattati, tato manussalokaṃ āgacchanto kularūpabhogasampattiyaṃ nibbattati, tattha ṭhito tīṇi ca sucaritāni pūretvā puna sagge nibbattatīti ayaṃ sakalā paripuṇṇā paṇḍitabhūmi.
Kevalā paripūrā paṇḍitabhūmī means that a wise person, having perfected the three good conducts, is reborn in the heavenly realms. From there, coming to the human world, he is reborn into a family endowed with noble form and wealth. Remaining there, he again perfects the three good conducts and is reborn in the heavenly realms. This is the complete and perfect stage of the wise.
Kevalā paripūrā paṇḍitabhūmī (cõi hiền trí hoàn toàn đầy đủ) là một người hiền trí hoàn thành ba thiện hạnh, tái sinh vào cõi trời, rồi từ đó xuống cõi người, tái sinh vào một gia đình có sự hoàn hảo về dòng dõi, sắc đẹp và tài sản; ở đó, người ấy hoàn thành ba thiện hạnh nữa, rồi lại tái sinh vào cõi trời; đây là cõi hiền trí hoàn toàn đầy đủ.
Sesaṃ sabbattha uttānamevāti.
All the rest is clear everywhere.
Phần còn lại đều rõ ràng ở khắp mọi nơi.
262. Nirayaṃ upapannāti bhagavā katthaci nirayato paṭṭhāya desanaṃ devalokena osāpeti, katthaci devalokato paṭṭhāya nirayena osāpeti.
262. Nirayaṃ upapannā means that the Buddha sometimes begins his discourse from the hells and concludes with the deva worlds, and sometimes begins with the deva worlds and concludes with the hells.
262. Nirayaṃ upapannā (tái sinh vào địa ngục): Đức Phật đôi khi bắt đầu bài giảng từ địa ngục và kết thúc bằng cõi trời, đôi khi bắt đầu từ cõi trời và kết thúc bằng địa ngục.
Sace saggasampattiṃ vitthāretvā kathetukāmo hoti, nirayadukkhaṃ ekadesato katheti, tiracchānayonidukkhaṃ pettivisayadukkhaṃ manussalokasampattiṃ ekadesato katheti, saggasampattimeva vitthāreti.
If he wishes to elaborate on the heavenly attainments, he speaks of the suffering in hell only in part, and of the suffering in the animal realm and the realm of hungry ghosts, and of human world attainments, only in part, but elaborates on the heavenly attainments.
Nếu Ngài muốn giải thích chi tiết về sự an lạc của cõi trời, Ngài sẽ nói sơ lược về khổ đau của địa ngục, khổ đau của loài súc sinh, khổ đau của cõi ngạ quỷ và sự an lạc của cõi người, rồi giải thích chi tiết về sự an lạc của cõi trời.
Sace nirayadukkhaṃ vitthāretvā kathetukāmo hoti, devalokamanussalokesu sampattiṃ tiracchānayonipettivisayesu ca dukkhaṃ ekadesato katheti, nirayadukkhameva vitthāreti.
If he wishes to elaborate on the suffering in hell, he speaks of the attainments in the deva and human worlds, and the suffering in the animal realm and the realm of hungry ghosts, only in part, but elaborates on the suffering in hell.
Nếu Ngài muốn giải thích chi tiết về khổ đau của địa ngục, Ngài sẽ nói sơ lược về sự an lạc ở cõi trời và cõi người, và khổ đau ở loài súc sinh và cõi ngạ quỷ, rồi giải thích chi tiết về khổ đau của địa ngục.
So imasmiṃ sutte nirayadukkhaṃ vitthāretukāmo, tasmā devalokato paṭṭhāya desanaṃ nirayena osāpeti.
In this Sutta, he wishes to elaborate on the suffering in hell; therefore, he begins his discourse from the deva worlds and concludes with the hells.
Trong kinh này, Ngài muốn giải thích chi tiết về khổ đau của địa ngục, do đó Ngài bắt đầu bài giảng từ cõi trời và kết thúc bằng địa ngục.
Devalokamanussalokasampattiyo tiracchānayonipettivisayadukkhāni ca ekadesato kathetvā nirayadukkhameva vitthārena kathetuṃ tamenaṃ, bhikkhave, nirayapālātiādimāha.
Having spoken of the attainments in the deva and human worlds and the sufferings in the animal realm and the realm of hungry ghosts in part, he then states "Tamenaṃ, bhikkhave, nirayapālā..." in order to elaborate on the suffering in hell.
Để nói sơ lược về sự an lạc ở cõi trời và cõi người, và khổ đau ở loài súc sinh và cõi ngạ quỷ, rồi giải thích chi tiết về khổ đau của địa ngục, Ngài đã nói tamenaṃ, bhikkhave, nirayapālā (này các Tỳ-kheo, những người canh địa ngục), v.v.
Tattha ekacce therā ‘‘nirayapālā nāma natthi, yantarūpaṃ viya kammameva kāraṇaṃ kāretī’’ti vadanti.
In this regard, some Elders say, "There are no hell-keepers; it is karma itself that brings about the actions, like a machine."
Ở đây, một số trưởng lão nói rằng: "Không có những người gọi là ngục tốt (nirayapāla); chính nghiệp (kamma) đã tạo ra sự trừng phạt (kāraṇa), giống như một cỗ máy."
Tesaṃ taṃ ‘‘atthi niraye nirayapālāti, āmantā, atthi ca kāraṇikā’’tiādinā nayena abhidhamme (kathā. 866) paṭisedhitameva.
That statement of theirs was indeed refuted in the Abhidhamma, in a manner beginning with: "Are there guardians of hell (nirayapālā) in hell? Yes, there are; and there are torturers (kāraṇikā)."
Lời nói đó của họ đã bị bác bỏ trong Abhidhamma bằng cách nói rằng: "Có ngục tốt trong địa ngục ư? Vâng, có. Và có cả những kẻ hành hình (kāraṇikā) nữa," v.v.
Yathā hi manussaloke kammakāraṇakārakā atthi, evameva niraye nirayapālā atthīti.
For just as there are executioners in the human world, so too are there guardians of hell in hell, so it was said, and this was refuted.
Thật vậy, giống như trong thế giới loài người có những kẻ thực hiện việc trừng phạt, thì trong địa ngục cũng có những ngục tốt.
Yamassa raññoti yamarājā nāma vemānikapetarājā, ekasmiṃ kāle dibbavimāne dibbakapparukkhadibbauyyānadibbanāṭakādisampattiṃ anubhavati, ekasmiṃ kāle kammavipākaṃ, dhammiko rājā.
Of King Yama means King Yama is a vemānika peta king who, at one time, enjoys the divine bliss of a celestial palace, celestial wish-fulfilling trees, celestial gardens, and celestial entertainers; at another time, he experiences the results of kamma. He is a righteous king.
Về vua Yama: Yama-rājā là một vị vua dạ-xoa (vemānika peta-rājā), vào một thời điểm thì hưởng thụ sự sung túc của cung điện thiên giới, cây như ý thiên giới, vườn thiên giới, vũ điệu thiên giới, v.v., vào một thời điểm thì chịu quả báo của nghiệp (kamma-vipāka); ngài là một vị vua công chính (dhammika rājā).
Na cesa ekova hoti, catūsu pana dvāresu cattāro janā honti.
He is not alone; there are four persons at the four gates.
Ngài không chỉ có một mình, mà có bốn vị ở bốn cánh cửa.
Nāddasanti attano santike pesitassa kassaci devadūtassa abhāvaṃ sandhāya evaṃ vadati.
I did not see — this is said referring to the absence of any divine messenger sent to him.
Không thấy (nāddasaṃ): Người đàn ông đến địa ngục nói như vậy, ám chỉ không có bất kỳ sứ giả nào được gửi đến mình.
Atha naṃ yamo ‘‘nāyaṃ bhāsitassa atthaṃ sallakkhetī’’ti ñatvā sallakkhāpetukāmo ambhotiādimāha.
Then Yama, realizing "this one does not discern the meaning of what was said," and wishing to make him discern, said, "Ambho!" and so forth.
Sau đó, Yama, khi biết rằng "người này không hiểu ý nghĩa của lời nói," muốn làm cho người đó hiểu, nên nói: "Này ông!" v.v.
263. Paṭhamaṃ devadūtaṃ samanuyuñjitvāti ettha daharakumāro atthato evaṃ vadati nāma ‘‘passatha, bho, mayhampi tumhākaṃ viya hatthapādā atthi, sake panamhi muttakarīse palipanno, attano dhammatāya uṭṭhahitvā nhāyituṃ na sakkomi, ahaṃ kiliṭṭhagattomhi, nhāpetha manti vattumpi na sakkomi, jātitomhi aparimuttatāya ediso jāto.
263. Having questioned the first divine messenger — here, the young child, in essence, says: “Look, sirs, I too have hands and feet like you, but I am covered in my own urine and excrement; by my own nature, I cannot get up and bathe myself. My body is soiled, and I cannot even ask you to bathe me. I was born like this because I am not free from birth.
263. Sau khi thẩm vấn sứ giả đầu tiên: Ở đây, một đứa bé sơ sinh, về mặt ý nghĩa, nói như thế này: "Này các ông, hãy nhìn xem, tôi cũng có tay chân như các ông, nhưng tôi đang nằm trong phân và nước tiểu của chính mình. Tôi không thể tự mình đứng dậy và tắm rửa. Tôi bị dơ bẩn. Tôi thậm chí không thể nói 'Hãy tắm cho tôi.' Tôi trở nên như thế này vì chưa thoát khỏi sự sinh.
Na kho panāhameva, tumhepi jātito aparimuttāva.
Indeed, it is not just I; you too are not free from birth.
Không chỉ mình tôi, mà các ông cũng chưa thoát khỏi sự sinh.
Yatheva hi mayhaṃ, evaṃ tumhākampi jāti āgamissati, iti tassā pure āgamanāva kalyāṇaṃ karothā’’ti.
Just as birth will come to me, so too will it come to you. Therefore, before its arrival, do what is good.”
Giống như sự sinh sẽ đến với tôi, nó cũng sẽ đến với các ông. Vì vậy, trước khi nó đến, hãy làm điều thiện lành."
Tenesa devadūto nāma jāto, vacanattho pana maghadevasutte vuttova.
Thus, this is what makes him a divine messenger; the literal meaning has already been stated in the Maghadeva Sutta.
Vì thế, đứa bé này được gọi là sứ giả (devadūta). Còn ý nghĩa của từ này đã được giải thích trong kinh Maghadeva.
Dutiyaṃ devadūtanti etthāpi jarājiṇṇasatto atthato evaṃ vadati nāma – ‘‘passatha, bho, ahampi tumhe viya taruṇo ahosiṃ ūrubalabāhubalajavanasampanno, tassa me tā balajavanasampattiyo antarahitā, vijjamānāpi me hatthapādā hatthapādakiccaṃ na karonti, jarāyamhi aparimuttatāya ediso jāto.
The second divine messenger — here too, the person worn out by old age, in essence, says: “Look, sirs, I too was once young like you, endowed with strength in my thighs, arms, and swiftness. But those endowments of strength and swiftness have disappeared from me. Though I have hands and feet, they do not perform the function of hands and feet. I became like this because I am not free from old age.
Sứ giả thứ hai: Ở đây, một chúng sinh già yếu, về mặt ý nghĩa, nói như thế này: "Này các ông, hãy nhìn xem, tôi cũng đã từng trẻ trung như các ông, với sức mạnh đùi, sức mạnh cánh tay và sự nhanh nhẹn. Nhưng những sức mạnh và sự nhanh nhẹn đó đã biến mất. Tay chân tôi dù còn đó nhưng không thực hiện được chức năng của chúng. Tôi trở nên như thế này vì chưa thoát khỏi sự già.
Na kho panāhameva, tumhepi jarāya aparimuttāva.
Indeed, it is not just I; you too are not free from old age.
Không chỉ mình tôi, mà các ông cũng chưa thoát khỏi sự già.
Yatheva hi mayhaṃ, evaṃ tumhākampi jarā āgamissati, iti tassā pure āgamanāva kalyāṇaṃ karothā’’ti.
Just as old age will come to me, so too will it come to you. Therefore, before its arrival, do what is good.”
Giống như sự già sẽ đến với tôi, nó cũng sẽ đến với các ông. Vì vậy, trước khi nó đến, hãy làm điều thiện lành."
Tenesa devadūto nāma jāto.
Thus, this is what makes him a divine messenger.
Vì thế, người này được gọi là sứ giả.
Tatiyaṃ devadūtanti etthāpi gilānasatto atthato eva vadati nāma – ‘‘passatha, bho, ahampi tumhe viya nirogo ahosiṃ, somhi etarahi byādhinā abhihato sake muttakarīse palipanno, uṭṭhātumpi na sakkomi, vijjamānāpi me hatthapādā hatthapādakiccaṃ na karonti, byādhitomhi aparimuttatāya ediso jāto.
The third divine messenger — here too, the sick person, in essence, says: “Look, sirs, I too was once healthy like you. But now I am afflicted by illness, covered in my own urine and excrement. I cannot even get up. Though I have hands and feet, they do not perform the function of hands and feet. I became like this because I am not free from illness.
Sứ giả thứ ba: Ở đây, một chúng sinh bệnh tật, về mặt ý nghĩa, nói như thế này: "Này các ông, hãy nhìn xem, tôi cũng đã từng khỏe mạnh như các ông. Nhưng bây giờ tôi bị bệnh tật hành hạ, nằm trong phân và nước tiểu của chính mình. Tôi không thể đứng dậy. Tay chân tôi dù còn đó nhưng không thực hiện được chức năng của chúng. Tôi trở nên như thế này vì chưa thoát khỏi bệnh tật.
Na kho panāhameva, tumhepi byādhito aparimuttāva.
Indeed, it is not just I; you too are not free from illness.
Không chỉ mình tôi, mà các ông cũng chưa thoát khỏi bệnh tật.
Yatheva hi mayhaṃ, evaṃ tumhākaṃ byādhi āgamissati, iti tassa pure āgamanāva kalyāṇaṃ karothā’’ti.
Just as illness will come to me, so too will it come to you. Therefore, before its arrival, do what is good.”
Giống như bệnh tật sẽ đến với tôi, nó cũng sẽ đến với các ông. Vì vậy, trước khi nó đến, hãy làm điều thiện lành."
Tenesa devadūto nāma jāto.
Thus, this is what makes him a divine messenger.
Vì thế, người này được gọi là sứ giả.
265. Catutthaṃ devadūtanti ettha pana kammakāraṇā vā devadūtāti kātabbā kammakāraṇikā vā.
265. The fourth divine messenger — here, one should consider either the instruments of torture (kammakāraṇā) as divine messengers or the torturers (kammakāraṇikā) as such.
265. Sứ giả thứ tư: Ở đây, có thể là những hình phạt (kammakāraṇā) hoặc những kẻ hành hình (kammakāraṇikā) được gọi là sứ giả.
Tattha pana kammakāraṇapakkhe bāttiṃsa tāva kammakāraṇā atthato evaṃ vadanti nāma – ‘‘mayaṃ nibbattamānā na rukkhe vā pāsāṇe vā nibbattāma, tumhādisānaṃ sarīre nibbattāma, iti amhākaṃ pure nibbattitova kalyāṇaṃ karothā’’ti.
In the case of the instruments of torture, the thirty-two instruments of torture, in essence, say: “When we arise, we do not arise in trees or rocks, but we arise in bodies like yours. Therefore, do what is good before we arise.”
Trong trường hợp những hình phạt, ba mươi hai hình phạt, về mặt ý nghĩa, nói như thế này: "Khi chúng tôi xuất hiện, chúng tôi không xuất hiện trên cây hay đá, mà chúng tôi xuất hiện trên thân thể của những người như các ông. Vì vậy, trước khi chúng tôi xuất hiện, hãy làm điều thiện lành."
Tenete devadūtā nāma jātā.
Thus, these become divine messengers.
Vì thế, những hình phạt này được gọi là sứ giả.
Kammakāraṇikāpi atthato evaṃ vadanti nāma – ‘‘mayaṃ dvattiṃsa kammakāraṇā karontā na rukkhādīsu karoma, tumhādisesu sattesuyeva karoma, iti amhākaṃ tumhesu pure kammakāraṇākaraṇatova kalyāṇaṃ karothā’’ti.
The torturers too, in essence, say: “When we inflict the thirty-two instruments of torture, we do not inflict them on trees and so forth, but on beings like yourselves. Therefore, do what is good before we inflict torture on you.”
Những kẻ hành hình cũng, về mặt ý nghĩa, nói như thế này: "Khi chúng tôi thực hiện ba mươi hai hình phạt, chúng tôi không thực hiện trên cây cối v.v., mà chúng tôi thực hiện trên những chúng sinh như các ông. Vì vậy, trước khi chúng tôi thực hiện các hình phạt trên các ông, hãy làm điều thiện lành."
Tenetepi devadūtā nāma jātā.
Thus, these also become divine messengers.
Vì thế, những kẻ hành hình này cũng được gọi là sứ giả.
266. Pañcamaṃ devadūtanti ettha matakasatto atthato evaṃ vadati nāma – ‘‘passatha bho maṃ āmakasusāne chaḍḍitaṃ uddhumātakādibhāvaṃ pattaṃ, maraṇatomhi aparimuttatāya ediso jāto.
266. The fifth divine messenger — here, the dead person, in essence, says: “Look, sirs, at me, thrown into the charnel ground, having become swollen and putrid. I became like this because I am not free from death.
266. Sứ giả thứ năm: Ở đây, một chúng sinh đã chết, về mặt ý nghĩa, nói như thế này: "Này các ông, hãy nhìn tôi bị vứt bỏ ở bãi tha ma, đã trở thành một xác chết trương phình v.v. Tôi trở nên như thế này vì chưa thoát khỏi sự chết.
Na kho panāhameva, tumhepi maraṇato aparimuttāva.
Indeed, it is not just I; you too are not free from death.
Không chỉ mình tôi, mà các ông cũng chưa thoát khỏi sự chết.
Yatheva hi mayhaṃ, evaṃ tumhākampi maraṇaṃ āgamissati, iti tassa pure āgamanāva kalyāṇaṃ karothā’’ti.
Just as death will come to me, so too will it come to you. Therefore, do what is good before its arrival.”
Giống như sự chết sẽ đến với tôi, nó cũng sẽ đến với các ông. Vì vậy, trước khi nó đến, hãy làm điều thiện lành."
Tenesa devadūto nāma jāto.
Thus, this is what makes him a divine messenger.
Vì thế, chúng sinh này được gọi là sứ giả.
Imaṃ pana devadūtānuyogaṃ ko labhati, ko na labhatīti?
But who receives this questioning by divine messengers, and who does not?
Vậy ai nhận được sự thẩm vấn của các sứ giả này, ai không?
Yena tāva bahuṃ pāpaṃ kataṃ, so gantvā niraye nibbattatiyeva.
One who has committed much evil, goes and is simply reborn in hell.
Người nào đã làm nhiều điều ác, người đó sẽ đi thẳng xuống địa ngục.
Yena pana parittaṃ pāpakammaṃ kataṃ, so labhati.
But one who has committed little evil kamma receives it.
Còn người nào đã làm ít điều ác, người đó sẽ nhận được sự thẩm vấn.
Yathā hi sabhaṇḍaṃ coraṃ gahetvā kattabbameva karonti, na vinicchinanti.
For example, if a thief with stolen goods is caught, they simply apply the necessary punishment; they do not conduct an inquiry.
Thật vậy, giống như trong thế gian, khi bắt được một tên trộm có tang vật, người ta chỉ thực hiện hình phạt cần thiết, chứ không xét xử.
Anuvijjitvā gahitaṃ pana vinicchayaṭṭhānaṃ nayanti, so vinicchayaṃ labhati.
But one who is caught after an investigation is brought to the place of inquiry, and that person receives an inquiry.
Nhưng khi bắt được một tên trộm cần điều tra, người ta đưa hắn đến nơi xét xử, và hắn sẽ được xét xử.
Evaṃsampadametaṃ.
This case is similar.
Trường hợp này cũng tương tự.
Parittapāpakammā hi attano dhammatāyapi saranti, sāriyamānāpi saranti.
Those with little evil kamma recall their good deeds by their own nature, or they recall them when reminded.
Những người đã làm ít điều ác, họ có thể tự mình nhớ lại (nghiệp thiện) hoặc được nhắc nhở để nhớ lại.
Tattha dīghajayantadamiḷo nāma attano dhammatāya sari.
Among them, the Dīghajayanta Damila recalled by his own nature.
Ở đây, một người Damiḷa tên Dīghajayanta đã tự mình nhớ lại.
So kira damiḷo sumanagirivihāre ākāsacetiyaṃ rattapaṭena pūjesi.
It is said that this Damila offered a red cloth to the Aṅkāsa Cetiya at Sumanagiri Vihāra.
Nghe nói, người Damiḷa đó đã cúng dường một tấm vải đỏ cho tháp trên không (ākāsa-cetiya) tại tu viện Sumanagiri.
Atha niraye ussadasāmante nibbatto aggijālasaddaṃ sutvāva attano pūjitapaṭaṃ anussari, so gantvā sagge nibbatto.
Then, being reborn near Ussada hell, he heard the sound of the flames and recollected the cloth he had offered. He then went and was reborn in heaven.
Sau đó, khi tái sinh gần Ussada-niraya và nghe tiếng lửa cháy xèo xèo, ông ta nhớ lại tấm vải đã cúng dường, và tái sinh lên cõi trời.
Aparopi puttassa daharabhikkhuno khalisāṭakaṃ dento pādamūle ṭhapesi, maraṇakālamhi paṭapaṭāti sadde nimittaṃ gaṇhi, sopi ussadasāmante nibbatto jālasaddena taṃ sāṭakaṃ anussaritvā sagge nibbatto.
Another person, giving a patched robe to his young bhikkhu son, placed it at his feet. At the time of death, he took the sound "paṭapaṭā" as a sign. He too, reborn near Ussada hell, recollected that robe by the sound of the flames and was reborn in heaven.
Một người khác, khi dâng một tấm y cũ cho con trai mình là một tỳ khưu trẻ, đã đặt nó dưới chân. Vào lúc lâm chung, ông ta đã lấy tiếng "patapaṭa" làm nghiệp tướng (kamma-nimitta). Ông ta cũng tái sinh gần Ussada-niraya, và khi nghe tiếng lửa cháy, ông ta nhớ lại tấm y đó và tái sinh lên cõi trời.
Evaṃ tāva attano dhammatāya kusalaṃ kammaṃ saritvā sagge nibbattatīti.
Thus, first, one recalls one's wholesome kamma by one's own nature and is reborn in heaven.
Như vậy, việc nhớ lại nghiệp thiện của mình một cách tự nhiên có thể dẫn đến tái sinh lên cõi trời.
Attano dhammatāya asarante pana pañca devadūte pucchati.
But for those who do not recall by their own nature, Yama questions them with the five divine messengers.
Còn đối với những người không tự mình nhớ lại, Yama sẽ hỏi về năm sứ giả.
Tattha koci paṭhamena devadūtena sarati, koci dutiyādīhi.
Among them, some recall by the first divine messenger, some by the second, and so on.
Ở đây, có người nhớ lại nhờ sứ giả đầu tiên, có người nhờ sứ giả thứ hai v.v.
Yo pana pañcahipi na sarati, taṃ yamo rājā sayaṃ sāreti.
But if someone does not recall even by all five, King Yama himself reminds him.
Còn người nào không nhớ lại dù qua cả năm sứ giả, thì vua Yama sẽ tự mình nhắc nhở.
Eko kira amacco sumanapupphakumbhena mahācetiyaṃ pūjetvā yamassa pattiṃ adāsi, taṃ akusalakammena niraye nibbattaṃ yamassa santikaṃ nayiṃsu.
It is said that a certain minister offered Sumanapuppha flowers in a pot to the Great Cetiya and dedicated the merit to Yama. Due to unwholesome kamma, he was reborn in hell and brought before Yama.
Nghe nói, có một vị đại thần đã cúng dường Đại Tháp (Mahā-cetiya) bằng một bình hoa lài và hồi hướng phước báu cho Yama. Vì nghiệp bất thiện, vị đó tái sinh vào địa ngục và bị dẫn đến Yama.
Tasmiṃ pañcahipi devadūtehi kusale asarante yamo sayaṃ olokento disvā – ‘‘nanu tvaṃ mahācetiyaṃ sumanapupphakumbhena pūjetvā mayhaṃ pattiṃ adāsī’’ti sāresi, so tasmiṃ kāle saritvā devalokaṃ gato.
When he did not recall his wholesome deed even with the five divine messengers, Yama himself looked, saw it, and reminded him, saying, “Did you not offer Sumanapuppha flowers in a pot to the Great Cetiya and dedicate the merit to me?” He then recollected at that time and went to the deva world.
Khi vị đó không nhớ lại nghiệp thiện của mình qua cả năm sứ giả, Yama tự mình nhìn thấy và nhắc nhở: "Chẳng phải ngươi đã cúng dường Đại Tháp bằng một bình hoa lài và hồi hướng phước báu cho ta sao?" Vào lúc đó, vị đại thần nhớ lại và được sinh lên cõi trời.
Yamo pana sayaṃ oloketvāpi apassanto – ‘‘mahādukkhaṃ nāma anubhavissati ayaṃ satto’’ti tuṇhī hoti.
But if Yama himself looks and still does not see, he becomes silent, thinking, “This being will surely experience great suffering.”
Còn Yama, nếu tự mình nhìn mà cũng không thấy, thì sẽ im lặng và nghĩ: "Chúng sinh này chắc chắn sẽ phải chịu khổ đau lớn lao."
267. Mahānirayeti avīcimahānirayamhi.
267. In the Great Hell means in Avīci Great Hell.
267. Trong đại địa ngục (mahā-niraye) nghĩa là trong đại địa ngục Avīci.
Kiṃ panassa pamāṇaṃ?
What then is its size?
Vậy kích thước của nó là bao nhiêu?
Abbhantaraṃ āyāmena ca vitthārena ca yojanasataṃ hoti.
Its interior is one hundred yojanas in both length and breadth.
Bên trong, nó dài và rộng một trăm dojunā.
Lohapathavī lohachadanaṃ ekekā ca bhitti navanavayojanikā hoti.
It has an iron floor and an iron roof, and each wall is nine yojanas thick.
Mặt đất bằng sắt, mái che bằng sắt, và mỗi bức tường cao chín dojunā.
Puratthimāya bhittiyā acci uṭṭhitā pacchimaṃ bhittiṃ gahetvā taṃ vinivijjhitvā parato yojanasataṃ gacchati.
A flame arising from the eastern wall reaches the western wall, pierces through it, and goes one hundred yojanas beyond.
Ngọn lửa bùng lên từ bức tường phía đông, bao trùm bức tường phía tây, xuyên qua nó và đi xa một trăm do tuần về phía bên kia.
Sesadisāsupi eseva nayo.
The same method applies to the other directions as well.
Đối với các hướng còn lại cũng vậy.
Iti jālapariyantavasena āyāmavitthārato aṭṭhārasayojanādhikāni tīṇi yojanasatāni, parikkhepato pana navayojanasatāni catupaṇṇāsayojanāni, samantā pana ussadehi saddhiṃ dasayojanasahassaṃ hoti.
Thus, by the extent of its flames, its length and width are three hundred yojanas and eighteen yojanas more. Its circumference is nine hundred and fifty-four yojanas. And together with the surrounding Ussada hells, it is ten thousand yojanas all around.
Như vậy, theo giới hạn của ngọn lửa, chiều dài và chiều rộng là ba trăm do tuần cộng thêm mười tám do tuần; còn chu vi là chín trăm do tuần cộng thêm năm mươi bốn do tuần; và tổng cộng với các ngục Ussada xung quanh là mười ngàn do tuần.
268. Ubbhataṃ tādisameva hotīti ettha akkantapadaṃ yāva aṭṭhito daḷhaṃ uddharitumeva na sakkā.
In "it is lifted up in the same manner," the foot that has stepped down is so burned to the bone that it cannot be lifted.
268. Trong câu Ubbhataṃ tādisameva hotī (cất lên cũng như vậy), cái chân đã đặt xuống không thể nhấc lên được cho đến tận xương.
Ayaṃ panettha attho – heṭṭhato paṭṭhāya ḍayhati, uparito paṭṭhāya jhāyati, iti akkamanakāle ḍayhamānaṃ paññāyati, uddharaṇakāle tādisameva, tasmā evaṃ vuttaṃ.
The meaning here is this: it burns from below, and it burns from above, so at the time of stepping, it appears to be burning, and at the time of lifting, it is the same. Therefore, it is said thus.
Ý nghĩa ở đây là: từ dưới chân cháy lên, từ trên đầu cũng cháy xuống, nên khi đặt chân xuống thì thấy đang cháy, khi nhấc chân lên cũng như vậy, vì thế mới nói như vậy.
Bahusampattoti bahūni vassasatavassasahassāni sampatto.
Bahusampatto means having reached many hundreds and thousands of years.
Bahusampatto (đến nhiều) nghĩa là đã trải qua nhiều trăm năm, nhiều ngàn năm.
Kasmā panesa narako avīcīti saṅkhaṃ gatoti.
Why has this hell come to be known as Avīci?
Tại sao địa ngục này được gọi là Avīci?
Vīci nāma antaraṃ vuccati, tattha ca aggijālānaṃ vā sattānaṃ vā dukkhassa vā antaraṃ natthi.
Vīci means an interval, and in that hell, there is no interval for the flames, or for the beings, or for the suffering.
Vīci có nghĩa là khoảng cách, nhưng ở đó không có khoảng cách giữa các ngọn lửa, giữa các chúng sinh hay giữa các khổ đau.
Tasmā so avīcīti saṅkhaṃ gatoti.
Therefore, it has come to be known as Avīci.
Vì thế nó được gọi là Avīci.
Tassa hi puratthimabhittito jālā uṭṭhitā saṃsibbamānā yojanasataṃ gantvā pacchimabhittiṃ vinivijjhitvā parato yojanasataṃ gacchati.
Indeed, flames arising from its eastern wall, intertwining, travel a hundred yojanas, pierce through the western wall, and proceed another hundred yojanas beyond it.
Thật vậy, ngọn lửa bùng lên từ bức tường phía đông, liên tục lan tỏa đi xa một trăm do tuần, xuyên qua bức tường phía tây và đi thêm một trăm do tuần về phía bên kia.
Sesadisāsupi eseva nayo.
The same method applies to the other directions.
Đối với các hướng còn lại cũng vậy.
Imesaṃ channaṃ jālānaṃ majjhe nibbatto devadatto, tassa yojanasatappamāṇo attabhāvo, dve pādā yāva gopphakā lohapathaviṃ paviṭṭhā, dve hatthā yāva maṇibandhā lohabhittiyo paviṭṭhā, sīsaṃ yāva bhamukaṭṭhito lohachadane paviṭṭhaṃ, adhobhāgena ekaṃ lohasūlaṃ pavisitvā kāyaṃ vinivijjhantaṃ chadane paviṭṭhaṃ, pācīnabhittito nikkhantasūlaṃ hadayaṃ vinivijjhitvā pacchimabhittiṃ paviṭṭhaṃ, uttarabhittito nikkhantasūlaṃ phāsukā vinivijjhitvā dakkhiṇabhittiṃ paviṭṭhaṃ.
In the midst of these six flames, Devadatta was born. His body is a hundred yojanas in size. His two feet, up to the ankles, are sunk into the iron ground. His two hands, up to the wrists, are sunk into the iron walls. His head, up to the eyebrows, is sunk into the iron roof. From below, an iron spike enters and pierces his body, sinking into the roof. A spike emerging from the eastern wall pierces his heart and enters the western wall. A spike emerging from the northern wall pierces his ribs and enters the southern wall.
Giữa sáu ngọn lửa này, Devadatta đã tái sinh, thân thể ông ta dài một trăm do tuần; hai bàn chân ông ta lún sâu vào nền đất sắt đến mắt cá chân; hai cánh tay ông ta lún sâu vào các bức tường sắt đến cổ tay; đầu ông ta lún vào trần sắt đến lông mày; một cây giáo sắt từ phía dưới xuyên qua thân ông ta và đâm vào trần; một cây giáo từ bức tường phía đông xuyên qua tim ông ta và đâm vào bức tường phía tây; một cây giáo từ bức tường phía bắc xuyên qua xương sườn ông ta và đâm vào bức tường phía nam.
Niccale tathāgatamhi aparaddhattā niccalova hutvā paccatīti kammasarikkhatāya ediso jāto.
Because he committed an offense against the immovable Tathāgata, he cooks immovably, thus becoming such due to the similarity of his kamma.
Vì đã phạm tội với Đức Như Lai không lay chuyển, ông ta cũng phải chịu đựng sự hành hạ không lay chuyển, điều này phù hợp với nghiệp của ông ta.
Evaṃ jālānaṃ nirantaratāya avīci nāma.
Thus, due to the uninterrupted nature of the flames, it is called Avīci.
Như vậy, do sự liên tục không ngừng của các ngọn lửa, nó được gọi là Avīci.
Abbhantare panassa yojanasatike ṭhāne nāḷiyaṃ koṭṭetvā pūritapiṭṭhaṃ viya sattā nirantarā, ‘‘imasmiṃ ṭhāne satto atthi, imasmiṃ natthī’’ti na vattabbaṃ, gacchantānaṃ ṭhitānaṃ nisinnānaṃ nipannānaṃ anto natthi, gacchante vā ṭhite vā nisinne vā nipanne vā aññamaññaṃ na bādhanti.
Within its hundred-yojana space, beings are continuous, like flour pounded and filled into a tube. It cannot be said, "There is a being in this place, there is not in that place." There is no end for those who are going, standing, sitting, or lying down. Those who are going, standing, sitting, or lying down do not obstruct one another.
Bên trong, tại nơi rộng một trăm do tuần, các chúng sinh dày đặc như bột được nghiền và đổ đầy vào ống; không thể nói rằng “có chúng sinh ở chỗ này, không có ở chỗ kia”; không có khoảng trống cho những người đi, đứng, ngồi, nằm; những người đi, đứng, ngồi, nằm không cản trở lẫn nhau.
Evaṃ sattānaṃ nirantaratāya avīci.
Thus, due to the uninterrupted nature of beings, it is Avīci.
Như vậy, do sự liên tục của các chúng sinh, nó là Avīci.
Kāyadvāre pana cha upekkhāsahagatāni cittāni uppajjanti, ekaṃ dukkhasahagataṃ.
At the bodily door, six cittas accompanied by upekkhā arise, and one citta accompanied by dukkha.
Tuy nhiên, ở cửa thân, sáu tâm đồng sinh với xả (upekkhā) phát sinh, và một tâm đồng sinh với khổ (dukkha).
Evaṃ santepi yathā jivhagge cha madhubindūni ṭhapetvā ekasmiṃ tambalohabindumhi ṭhapite anudahanabalavatāya tadeva paññāyati, itarāni abbohārikāni honti, evaṃ anudahanabalavatāya dukkhamevettha nirantaraṃ, itarāni abbohārikānīti.
Even so, just as when six drops of honey are placed on the tip of the tongue and one drop of molten copper is placed, only the latter is perceived due to its overwhelming intensity, and the others become negligible, so too, due to the overwhelming intensity, suffering here is continuous, and the others are negligible.
Mặc dù vậy, cũng như khi đặt sáu giọt mật ong lên đầu lưỡi cùng với một giọt đồng đỏ nóng chảy, do sức mạnh của sự nóng bỏng, chỉ có giọt đồng đỏ đó là rõ ràng, còn những giọt kia thì không đáng kể; tương tự như vậy, ở đây, do sức mạnh của sự nóng bỏng liên tục, chỉ có khổ đau là liên tục, còn những thứ khác thì không đáng kể.
Evaṃ dukkhassa nirantaratāya avīci.
Thus, due to the uninterrupted nature of suffering, it is Avīci.
Như vậy, do sự liên tục của khổ đau, nó là Avīci.
Khārodakā nadīti vetaraṇī nāma tambalohanadī.
The Khārodakā River is called Vetaraṇī, a river of molten copper.
Khārodakā nadī (sông nước kiềm) là sông Vetaraṇī, một con sông đồng đỏ.
Tattha ayomayāni kharavālika-pokkharapattāni, heṭṭhā khuradhārā ubhosu tīresu vettalatā ca kusatiṇāni ca.
Therein are rough, iron-like razor-leafed lotuses. Below are razor blades, and on both banks are cane creepers and Kuśa grass.
Ở đó có cát sắt sắc nhọn, lá sen bằng sắt, lưỡi dao cạo ở phía dưới, và dây mây cùng cỏ sắc nhọn ở hai bờ.
So tattha dukkhā tibbā kharāti so tattha uddhañca adho ca vuyhamāno pokkharapattesu chijjati.
So tattha dukkhā tibbā kharā means there, being swept up and down, he is cut by the razor-leafed lotuses.
So tattha dukkhā tibbā kharā (người ấy ở đó chịu khổ đau dữ dội, gay gắt) nghĩa là người ấy bị cuốn trôi lên xuống ở đó, bị cắt xẻ bởi lá sen.
Siṅghāṭakasaṇṭhānāya kharavālikāya kaṇṭakehi vijjhiyati, khuradhārāhi phāliyati, ubhosu tīresu kusatiṇehi vilekhati, vettalatāhi ākaḍḍhiyati, tikkhasattīhi phāliyati.
He is pierced by thorns in the rough sand, which is shaped like a crossroad. He is split by razor blades, scraped by Kuśa grass on both banks, dragged by cane creepers, and torn by sharp spears.
Bị đâm bởi gai trên bãi cát sắc nhọn hình ngã tư, bị xẻ bởi lưỡi dao cạo, bị cào xước bởi cỏ sắc nhọn ở hai bờ, bị kéo bởi dây mây, và bị đâm bởi những ngọn giáo sắc bén.
270. Tattena ayosaṅkunāti tena jigacchitomhīti vutte mahantaṃ lohapacchiṃ lohaguḷānaṃ pūretvā taṃ upagacchanti, so lohaguḷabhāvaṃ ñatvā dante samphuseti, athassa te tattena ayosaṅkunā mukhaṃ vivaranti, tambalohadhārehi mahantena lohakaṭāhena tambalohaṃ upanetvā evamevaṃ karonti.
Tattena ayosaṅkunā means when he says, "I am hungry," they approach him with a large iron basket filled with iron balls. Knowing them to be iron balls, he closes his teeth. Then, they open his mouth with a red-hot iron hook, bring molten copper in a large iron pot with streams of molten copper, and do the same.
270. Tattena ayosaṅkunā (bằng cây móc sắt nung đỏ) nghĩa là khi người ấy nói: “Tôi đói”, họ mang đến một cái giỏ sắt lớn đầy những viên sắt nung đỏ, người ấy biết đó là viên sắt nung đỏ nên khép răng lại, sau đó họ dùng cây móc sắt nung đỏ mở miệng người ấy ra, và dùng một cái chảo sắt lớn chứa đồng đỏ nóng chảy mang đến gần và làm như vậy.
Puna mahānirayeti evaṃ pañcavidhabandhanato paṭṭhāya yāva tambalohapānā tambalohapānato paṭṭhāya puna pañcavidhabandhanādīni kāretvā mahāniraye pakkhipanti.
Again, mahāniraye: thus, from the fivefold binding up to the drinking of molten copper, and from the drinking of molten copper, they again inflict the fivefold binding and so forth, and cast him into the great hell.
Lại nữa, mahāniraye (trong đại địa ngục) nghĩa là sau khi chịu đựng từ năm loại trói buộc cho đến uống đồng đỏ, và từ việc uống đồng đỏ lại chịu đựng năm loại trói buộc trở đi, các cai ngục sẽ ném người ấy trở lại đại địa ngục.
Tattha koci pañcavidhabandhaneneva muccati, koci dutiyena, koci tatiyena, koci tambalohapānena muccati, kamme pana aparikkhīṇe puna mahāniraye pakkhipanti.
There, some are released merely by the fivefold binding, some by the second, some by the third, and some by the drinking of molten copper. But if their kamma is not exhausted, they are again cast into the great hell.
Ở đó, một số người được giải thoát chỉ sau năm loại trói buộc, một số sau loại thứ hai, một số sau loại thứ ba, một số sau khi uống đồng đỏ; nhưng nếu nghiệp chưa hết, họ lại bị ném trở lại đại địa ngục.
Idaṃ pana suttaṃ gaṇhanto eko daharabhikkhu, – ‘‘bhante, ettakaṃ dukkhamanubhavitasattaṃ punapi mahāniraye pakkhipantī’’ti āha.
A young bhikkhu, learning this Sutta, said, "Venerable sir, do they cast a being who has endured so much suffering into the great hell again?"
Một vị tỳ khưu trẻ đang học kinh này đã hỏi: “Bạch Thế Tôn, một chúng sinh đã chịu đựng nhiều khổ đau như vậy lại bị ném trở lại đại địa ngục sao?”
Āma, āvuso, kamme aparikkhīṇe punappunaṃ evaṃ karontīti.
"Yes, friend, if the kamma is not exhausted, they do so again and again,"*.
“Phải, này hiền hữu, nếu nghiệp chưa hết, họ sẽ bị làm như vậy lặp đi lặp lại,” (vị thầy) nói.
Tiṭṭhatu, bhante, uddeso, kammaṭṭhānameva kathethāti kammaṭṭhānaṃ kathāpetvā sotāpanno hutvā āgamma uddesaṃ aggahesi.
"Let the recitation wait, Venerable sir, please teach me meditation," he said, and having had meditation taught, he returned after becoming a Sotāpanna and resumed his recitation.
“Bạch Thế Tôn, xin hãy dừng việc giảng kinh, chỉ xin giảng về thiền quán (kammaṭṭhāna) thôi,” vị tỳ khưu đó nói, và sau khi được giảng thiền quán, ông đã trở thành bậc Dự Lưu (Sotāpanna), rồi quay lại học kinh.
Aññesampi imasmiṃ padese uddesaṃ ṭhapetvā arahattaṃ pattānaṃ gaṇanā natthi.
The number of others who, in this section, set aside recitation and attained Arahantship is countless.
Ở nơi này, số lượng những vị đã đạt A-la-hán quả sau khi tạm dừng việc học kinh là vô số.
Sabbabuddhānañcetaṃ suttaṃ avijahitameva hoti.
And this Sutta is never abandoned by any Buddha.
Và kinh này luôn được tất cả chư Phật giảng dạy.
271. Hīnakāyūpagāti hīnakāyaṃ upagatā hutvā.
Hīnakāyūpagā means having associated with an inferior group.
271. Hīnakāyūpagā (đi đến thân thấp kém) nghĩa là trở thành bạn bè với những người thấp kém.
Upādāneti taṇhādiṭṭhigahaṇe.
Upādāne means in the clinging of craving and views.
Upādāne (trong chấp thủ) nghĩa là trong sự chấp thủ tham ái và tà kiến.
Jātimaraṇasambhaveti jātiyā ca maraṇassa ca kāraṇabhūte.
Jātimaraṇasambhave means being the cause of birth and death.
Jātimaraṇasambhave (trong sự sinh khởi của sinh và tử) nghĩa là bốn pháp chấp thủ là nguyên nhân của sinh và tử.
Anupādāti catūhi upādānehi anupādiyitvā.
Anupādā means not clinging with the four clingings.
Anupādā (không chấp thủ) nghĩa là không chấp thủ bốn loại chấp thủ.
Jātimaraṇasaṅkhayeti jātimaraṇasaṅkhayasaṅkhāte nibbāne vimuccanti.
Jātimaraṇasaṅkhaye means they are liberated in Nibbāna, which is called the destruction of birth and death.
Jātimaraṇasaṅkhaye (trong sự đoạn diệt của sinh và tử) nghĩa là được giải thoát trong Nibbāna, tức là sự đoạn diệt của sinh và tử.