Atthato pana evaṃsaddo tāva upamūpadesasampahaṃsanagarahaṇavacanasampaṭiggahākāra- nidassanāvadhāraṇapucchāidamatthaparimāṇādi anekatthappabhedo.
In terms of meaning, the word evaṃ first has many distinctions of meaning, such as simile, instruction, commendation, censure, acceptance of a statement, manner, indication, ascertainment, inquiry, meaning of 'this', and measure.
Về nghĩa, từ “evaṃ” có nhiều nghĩa khác nhau như so sánh, chỉ dẫn, tán thán, quở trách, chấp nhận lời nói, cách thức, minh họa, xác định, câu hỏi, ý nghĩa này, số lượng, v.v.
Tathā hesa ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti evamādīsu (dha. pa. 53) upamāyaṃ āgato.
Thus, it appears in the sense of simile in passages like "One born thus, a mortal, should do much good," and so forth.
Chẳng hạn, từ này xuất hiện với nghĩa so sánh trong các câu như “Con người đã sinh ra như thế này, nên làm nhiều điều thiện.”
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In instruction, in passages like "Thus should you go forward, thus should you retreat," and so forth.
Với nghĩa chỉ dẫn trong các câu như “Ngươi phải tiến lên như thế này, ngươi phải lùi lại như thế này.”
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In commendation, in passages like "So it is, Blessed One, so it is, Sugata," and so forth.
Với nghĩa tán thán trong các câu như “Bạch Thế Tôn, đúng là như vậy! Bạch Thiện Thệ, đúng là như vậy!”
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In censure, in passages like "Just so, this low-caste woman praises that shaven-headed ascetic in whatever way," and so forth.
Với nghĩa quở trách trong các câu như “Thật vậy, người phụ nữ thấp kém này cứ nói tốt về vị sa-môn đầu trọc đó bất kể là ai.”
‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (dī. ni. 2.3; ma. ni. 1.1) vacanasampaṭiggahe.
In acceptance of a statement, in passages like "‘Yes, venerable sir,’ those bhikkhus replied to the Blessed One," and so forth.
Với nghĩa chấp nhận lời nói trong các câu như “Bạch Thế Tôn, các Tỳ-khưu đó đã đáp lời Thế Tôn rằng ‘Vâng, bạch Thế Tôn’.”
‘‘Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In manner, in passages like "Thus, venerable sir, do I understand the Dhamma taught by the Blessed One," and so forth.
Với nghĩa cách thức trong các câu như “Bạch Thế Tôn, tôi hiểu Pháp do Thế Tôn thuyết giảng theo cách này.”
‘‘Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama, upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha ‘subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’ti, evañca vadehi ‘sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’ti’’ādīsu (dī. ni. 1.445) nidassane.
In indication, in passages like "Come, young man, approach the ascetic Ānanda, and having approached, inquire in my name about the ascetic Ānanda’s health, freedom from affliction, lightness of bodily functions, strength, and comfortable abiding, saying, ‘The young man Subha, son of Todeyya, inquires about Venerable Ānanda’s health, freedom from affliction, lightness of bodily functions, strength, and comfortable abiding.’ And also say this: ‘May Venerable Ānanda kindly approach the dwelling of the young man Subha, son of Todeyya, out of compassion’," and so forth.
Với nghĩa minh họa trong các câu như “Này thanh niên, ngươi hãy đi đến chỗ Sa-môn Ānanda, sau khi đến, hãy hỏi Sa-môn Ānanda thay lời ta rằng ‘Thanh niên Subha, con của Todeyya, hỏi thăm Tôn giả Ānanda có được khỏe mạnh không, có bệnh tật gì không, có dễ chịu không, có đủ sức khỏe không, có an ổn không’, và hãy nói như vầy: ‘Kính mong Tôn giả Ānanda vì lòng từ bi, hãy đến nhà của thanh niên Subha, con của Todeyya’.”
‘‘‘Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vā’ti?
"‘What do you think, Kālāmā, are these qualities wholesome or unwholesome?’
“Các ông nghĩ sao, hỡi Kālāmā, những pháp này là thiện hay bất thiện?”
‘Akusalā, bhante’.
‘Unwholesome, venerable sir.’
“Bất thiện, bạch Thế Tôn.”
‘Sāvajjā vā anavajjā vā’ti?
‘Blamable or blameless?’
“Có lỗi hay không có lỗi?”
‘Sāvajjā, bhante’.
‘Blamable, venerable sir.’
“Có lỗi, bạch Thế Tôn.”
‘Viññūgarahitā vā viññuppasatthā vā’ti?
‘Censured by the wise or praised by the wise?’
“Bị người trí quở trách hay được người trí tán thán?”
‘Viññūgarahitā, bhante’.
‘Censured by the wise, venerable sir.’
“Bị người trí quở trách, bạch Thế Tôn.”
‘Samattā samādinnā ahitāya dukkhāya saṃvattanti, no’vā?
‘When undertaken and practiced, do they lead to harm and suffering, or not?’
“Khi được thực hành và chấp nhận, chúng dẫn đến bất lợi, đau khổ, hay không?”
‘Kathaṃ vo ettha hotī’ti?
‘How does it seem to you in this matter?’
“Các ông nghĩ thế nào về điều này?”
‘Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotīti’’’ādīsu (a. ni. 3.66) avadhāraṇe.
‘When undertaken and practiced, venerable sir, they lead to harm and suffering; so it seems to us in this matter,’" and so forth, in ascertainment.
“Bạch Thế Tôn, khi được thực hành và chấp nhận, chúng dẫn đến bất lợi, đau khổ. Chúng tôi nghĩ như vậy về điều này.” – Với nghĩa xác định trong các câu như thế.
‘‘Evamete sunhātā suvilittā kappitakesamassū āmuttamālābharaṇā’’tiādīsu (dī. ni. 1.286) pucchāyaṃ.
In inquiry, in passages like "Are these well-bathed, well-anointed, with hair and beard trimmed, adorned with garlands and ornaments, thus?" and so forth.
Với nghĩa câu hỏi trong các câu như “Những người này đã tắm rửa sạch sẽ, thoa dầu thơm, tóc và râu được cắt tỉa, đeo vòng hoa và trang sức như thế này sao?”
‘‘Evaṃgatāni puthusippāyatanāni (dī. ni. 1.182), evaṃvidho evamākāro’’tiādīsu idaṃsaddassa atthe.
In the sense of the word idaṃ (this), in passages like "such various professions," "such a kind, such a manner," and so forth.
Với nghĩa của từ “idaṃ” (này) trong các câu như “Nhiều nghề nghiệp như thế này, loại này, cách thức này.”
Gatasaddo hi pakārapariyāyo, tathā vidhākārasaddā.
Indeed, the word gata is a synonym for pakāra (kind, manner), as are the words vidha and ākāra.
Thật vậy, từ “gata” là một từ đồng nghĩa với “pakāra” (cách thức), cũng như các từ “vidha” và “ākāra”.
Tathā hi vidhayuttagatasadde lokiyā pakāratthe vadanti.
Thus, in common usage, the words vidha, yutta, and gata are used in the sense of pakāra.
Thật vậy, trong đời thường, người ta dùng các từ “vidha”, “yutta”, “gata” với nghĩa “cách thức”.
‘‘Evaṃ lahuparivattaṃ evamāyupariyanto’’tiādīsu (a. ni. 1.48) parimāṇe.
In measure, in passages like "such a swift change," "such a limit of life," and so forth.
Với nghĩa số lượng trong các câu như “Sự thay đổi nhanh chóng như thế này, tuổi thọ kết thúc như thế này.”
Ettha puppharāsiṭṭhānīyato manussuppatti sappurisūpanissayasaddhammassavanayonisomanasikārabhogasampattiādito dānādipuññakiriyāhetusamudāyato sobhāsugandhatādiguṇavisesayogato mālāguṇasadisiyo bahukā puññakiriyā maritabbasabhāvatāya maccena kattabbāti abhedatāya puppharāsi mālāguṇā ca upamā, tesaṃ upamānākāro yathāsaddena aniyamato vutto.
Here, from the position of a heap of flowers—namely, from the attainment of human birth, association with good people, hearing the Dhamma, proper attention (yonisomanasikāra), and material prosperity, etc., as the collection of causes for meritorious deeds (dānādipuññakiriyāhetusamudāya), and due to the possession of special qualities like beauty and fragrance—many meritorious deeds, similar to garlands, are to be done by a mortal, due to the nature of being subject to death. Thus, the heap of flowers and the garlands are similes due to their non-distinction, and the manner of their comparison is expressed indeterminately by the word yathā.
Ở đây, việc sinh ra làm người, nương tựa vào bậc thiện trí, nghe chánh pháp, tác ý đúng đắn, tài sản đầy đủ, v.v., là nơi chốn của đống hoa. Từ tổng hợp các nguyên nhân của các hành động thiện như bố thí, v.v., và nhờ vào các đặc tính tốt đẹp như vẻ đẹp, hương thơm, v.v., nhiều hành động thiện giống như vòng hoa cần được con người thực hiện vì bản chất phải chết. Do sự không khác biệt, đống hoa và vòng hoa là ví dụ so sánh. Cách thức so sánh của chúng đã được nói một cách không xác định bằng từ “yathā”.
Puna evaṃsaddena niyamanavasena vutto.
Again, it is expressed determinately by the word evaṃ.
Sau đó, nó được nói một cách xác định bằng từ “evaṃ”.
So pana upamākāro niyamiyamāno atthato upamā eva hotīti vuttaṃ ‘‘upamāyaṃ āgato’’ti.
And that manner of comparison, being determined, is indeed a simile in meaning, hence it is said, "It has come in the form of a simile."
Và cách thức so sánh đó, khi được xác định, về nghĩa, chính là sự so sánh. Vì vậy, đã nói “xuất hiện với nghĩa so sánh”.
Evamākāravisesavācīnampi etesaṃ evaṃsaddānaṃ upamādivisesatthavuttitāya upamādiatthatā vuttā.
Thus, the meaning of simile and other specific meanings are stated for these words evaṃ, which indicate specific modes, due to their being uttered with the meaning of simile and other distinctions.
Đối với những từ ‘evaṃ’ này, vốn là từ chỉ các cách thức đặc biệt, ý nghĩa của chúng được nói là ý nghĩa của sự so sánh, v.v., do chúng mang ý nghĩa đặc biệt của sự so sánh, v.v.
‘‘Evaṃ, bhante’’ti pana dhammassa sādhukaṃ savanamanasikāre niyojitehi bhikkhūhi tattha patiṭṭhitabhāvassa paṭijānanavasena vuttattā tattha evaṃsaddo vacanasampaṭiggahattho.
However, in "evaṃ, bhante," since it is spoken by bhikkhus who have been enjoined to listen and pay attention to the Dhamma properly, in acknowledgment of their firm establishment therein, the word evaṃ there has the meaning of accepting a statement.
Tuy nhiên, trong câu ‘‘Evaṃ, bhante’’ (Vâng, bạch Thế Tôn), từ ‘evaṃ’ có nghĩa là sự chấp nhận lời nói, vì các Tỳ-khưu đã được khuyến khích lắng nghe và chú tâm vào Pháp một cách cẩn thận đã tuyên bố sự kiên định của mình trong đó.
Tena evaṃ, bhanteti sādhu, bhante, suṭṭhu, bhanteti vuttaṃ hoti.
Therefore, "evaṃ, bhante" means "Sādhu, bhante" (It is good, venerable sir) and "Suṭṭhu, bhante" (It is very good, venerable sir).
Do đó, ‘‘Evaṃ, bhante’’ có nghĩa là “Tốt lắm, bạch Thế Tôn,” hoặc “Rất tốt, bạch Thế Tôn.”
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
And this (meaning of evaṃ) should be seen here in the sense of mode, indication, and affirmation.
Ở đây, từ này được hiểu theo nghĩa cách thức, chỉ thị và quyết định.
Ettha ca ekattanānattaabyāpāraevaṃdhammatāsaṅkhātā nandiyāvattatipukkhalasīhavikkīḷitadisālocanaaṅkusasaṅkhātā ca assādādivisayādibhedena nānāvidhā nayā nānānayā.
And here, the various approaches are of diverse kinds, such as the modes of unity, diversity, non-activity, and inherent nature (evaṃdhammatā), and the modes of nandiyāvaṭṭa, tipukkala, sīhavikkīḷita, disālocana, and aṅkusa, distinguished by subjects like gratification and so forth.
Trong ngữ cảnh này, nānānayā (nhiều phương pháp) là các phương pháp đa dạng như nhất thể, dị thể, bất tác ý, và như vậy là pháp tính (evam-dhammatā), cũng như các phương pháp được gọi là nandiyāvaṭṭa (xoay tròn hoan hỷ), tipukkala (ba loại người), sīhavikkīḷita (sư tử vờn), disālocana (nhìn quanh), và aṅkusa (cái móc), với sự phân biệt theo các đối tượng như sự hoan hỷ, v.v.
Nayā vā pāḷigatiyo, tā ca paññattianupaññattādivasena saṃkilesabhāgiyādilokiyāditadubhayavomissakādivasena kusalādivasena khandhādivasena, saṅgahādivasena, samayavimuttādivasena, ṭhapanādivasena, kusalamūlādivasena, tikapaṭṭhānādivasena ca nānappakārāti nānānayā, tehi nipuṇaṃ saṇhaṃ sukhumanti nānānayanipuṇaṃ.
Alternatively, the approaches are the ways of the Pāḷi texts, and these are of various kinds, such as by way of designations (paññatti) and secondary designations (anupaññatti), by way of corrupting factors (saṃkilesabhāgiyā) and mundane (lokiya) states, or mixtures of both, by way of wholesome (kusala) states, by way of aggregates (khandhā), by way of comprehensions (saṅgahā), by way of temporary or permanent liberation (samayavimuttā), by way of placements (ṭhapanā), by way of roots of wholesome actions (kusalamūlā), and by way of the Triplet-Paṭṭhāna (tikapaṭṭhānā). Therefore, they are nānānayā (various approaches). And by these, it is subtle, refined, and profound; thus, it is nānānayanipuṇa (subtle in various approaches).
Hoặc nānānayā là những cách thức diễn đạt (Pāḷi gatiyo) đa dạng, và những cách thức ấy rất đa dạng theo sự phân biệt thành paññatti (khái niệm) và anupaññatti (khái niệm phụ), theo sự phân biệt thành saṃkilesabhāgiya (thuộc về ô nhiễm), lokiya (thế gian) và sự pha trộn của cả hai, theo sự phân biệt thành kusala (thiện), v.v., theo sự phân biệt thành khandha (uẩn), v.v., theo sự phân biệt thành saṅgaha (tập hợp), v.v., theo sự phân biệt thành samayavimutta (giải thoát theo thời) và asamayavimutta (giải thoát phi thời), theo sự phân biệt thành ṭhapanā (thiết lập), v.v., theo sự phân biệt thành kusalamūla (gốc thiện), v.v., và theo sự phân biệt thành Tikapaṭṭhāna (Tam đề tương duyên), v.v. Và tinh vi (nipuṇaṃ) có nghĩa là khéo léo, vi tế.
Iddhiādesanānusāsanībhedena tesu ca ekekassa visayādibhedena vividhaṃ bahuvidhaṃ vā pāṭihāriyaṃ etassāti vividhapāṭihāriyaṃ.
It is vividhapāṭihāriyaṃ (endowed with diverse psychic powers) because it possesses diverse or many kinds of psychic power, distinguished by the three types: psychic power (iddhi), power of manifestation (ādesanā), and power of instruction (anusāsanī), and in each of these, by distinctions of their respective domains.
Vividhapāṭihāriyaṃ (nhiều phép thần thông) là vì nó có nhiều loại hay đa dạng các phép thần thông theo sự phân biệt thành thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī), và trong mỗi loại đó, theo sự phân biệt về đối tượng, v.v.
Tattha paṭipakkhaharaṇato rāgādikilesāpanayanato pāṭihāriyanti atthe sati bhagavato na paṭipakkhā rāgādayo santi ye haritabbā, puthujjanānampi vigatūpakkilese aṭṭhaguṇasamannāgate citte hatapaṭipakkhe iddhividhaṃ pavattati, tasmā tattha pavattavohārena ca na sakkā idha pāṭihāriyanti vattuṃ.
If pāṭihāriya means the removal of opponents (defilements) or the dispelling of defilements like lust, then the Bhagavā has no opponents or defilements like lust to be removed. Even for ordinary individuals, psychic power operates in a mind free from defilements and endowed with eight qualities, when opponents have been overcome. Therefore, it is not possible to call it pāṭihāriya here in the sense of the conventional usage in that context.
Trong đó, nếu nói rằng pāṭihāriya là do loại bỏ đối thủ, do loại bỏ các phiền não như tham ái, thì Thế Tôn không có các đối thủ là tham ái, v.v., để phải loại bỏ; ngay cả đối với phàm phu, phép thần thông cũng phát sinh trong tâm đã loại bỏ các phiền não phụ, đầy đủ tám phẩm chất, đã tiêu diệt đối thủ. Do đó, không thể nói ở đây là pāṭihāriya theo cách dùng từ phổ biến trong trường hợp đó.
Sace pana mahākāruṇikassa bhagavato veneyyagatā ca kilesā paṭipakkhā, tesaṃ haraṇato pāṭihāriyanti vuttaṃ, evaṃ sati yuttametaṃ.
However, if it is said that the defilements of the trainable individuals are the opponents of the Greatly Compassionate Bhagavā, and pāṭihāriya refers to the removal of these, then this is indeed fitting.
Tuy nhiên, nếu nói rằng các phiền não trong tâm của những người có thể được giáo hóa là đối thủ của Thế Tôn đại bi, và pāṭihāriya là do loại bỏ chúng, thì điều này là hợp lý.
Atha vā bhagavato ceva sāsanassa ca paṭipakkhā titthiyā, tesaṃ haraṇato pāṭihāriyaṃ.
Alternatively, the Tīrthikas (sectarians) are the opponents of the Bhagavā and the Sāsana. Pāṭihāriya refers to the removal of them.
Hoặc, các tirthika (ngoại đạo) là đối thủ của Thế Tôn và của giáo pháp. Pāṭihāriya là do loại bỏ họ.
Te hi diṭṭhiharaṇavasena diṭṭhippakāsane asamatthabhāvena ca iddhiādesanānusāsanīhi haritā apanītā honti.
Indeed, they are removed or dispelled by the psychic power, the power of manifestation, and the power of instruction, by way of removing their wrong views and by their inability to express their wrong views.
Thật vậy, họ bị loại bỏ, bị loại trừ bởi thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī) theo cách loại bỏ tà kiến và do không có khả năng hiển thị tà kiến.
Paṭīti vā ayaṃ saddo pacchāti etassa atthaṃ bodheti ‘‘tasmiṃ paṭipaviṭṭhamhi, añño āgañchi brāhmaṇo’’tiādīsu (cūḷani. pārāyanavagga, vatthugāthā 4) viya.
Or this word paṭi conveys the meaning of paccha (after, behind), as in "When he entered, another brahmin came after" and so forth.
Hoặc từ ‘paṭi’ này biểu thị ý nghĩa “sau”, như trong các câu như ‘‘tasmiṃ paṭipaviṭṭhamhi, añño āgañchi brāhmaṇo’’ (khi người đó đã vào, một Bà-la-môn khác đến).
Tasmā samāhite citte vigatūpakkilese katakiccena pacchā haritabbaṃ pavattetabbanti paṭihāriyaṃ.
Therefore, paṭihāriya means that which should be carried out afterwards, that which should be made to occur after the mind is concentrated, after defilements are removed, and after the task is accomplished.
Do đó, pāṭihāriya là điều cần được thực hiện sau khi tâm đã định tĩnh, các phiền não đã được loại bỏ, và công việc đã hoàn thành.
Attano vā upakkilesesu catutthajjhānamaggehi haritesu pacchā haraṇaṃ paṭihāriyaṃ.
Alternatively, the removal of one's own defilements by the paths of the fourth jhāna, and the subsequent carrying out (of benefits for others) is paṭihāriya.
Hoặc, sau khi các phiền não phụ của mình đã được loại bỏ bằng Tứ thiền và các đạo lộ, sự loại bỏ sau đó là pāṭihāriya.
Iddhiādesanānusāsaniyo vigatūpakkilesena katakiccena sattahitatthaṃ puna pavattetabbā, haritesu ca attano upakkilesesu parasattānaṃ upakkilesaharaṇāni hontīti paṭihāriyāni bhavanti.
The psychic power, the power of manifestation, and the power of instruction should be cultivated again for the welfare of beings by one who is free from defilements and has accomplished the task. And when one's own defilements have been removed, the removal of the defilements of other beings occurs. Therefore, they become paṭihāriyā.
Thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī) cần được thực hiện lại vì lợi ích của chúng sinh, sau khi các phiền não phụ đã được loại bỏ và công việc đã hoàn thành; và khi các phiền não phụ của mình đã được loại bỏ, thì việc loại bỏ các phiền não phụ của chúng sinh khác cũng xảy ra. Do đó, chúng trở thành pāṭihāriya.
Paṭihāriyameva pāṭihāriyaṃ, paṭihāriye vā iddhiādesanānusāsanīsamudāye bhavaṃ ekekaṃ pāṭihāriyanti vuccati.
Paṭihāriya itself is pāṭihāriya, or each individual psychic power, power of manifestation, and power of instruction, being part of the paṭihāriya (collection), is called pāṭihāriya.
Pāṭihāriya chính là paṭihāriya; hoặc, mỗi một điều xảy ra trong tập hợp thần thông (iddhi), tiên tri (ādesanā) và giáo hóa (anusāsanī) được gọi là pāṭihāriya.
Paṭihāriyaṃ vā catutthajjhānaṃ maggo ca paṭipakkhaharaṇato.
Alternatively, the fourth jhāna and the path are paṭihāriya because they remove opponents.
Hoặc, Tứ thiền và đạo lộ là pāṭihāriya, do chúng loại bỏ đối thủ.
Tattha jātaṃ nimittabhūtato tato vā āgatanti pāṭihāriyanti attho veditabbo.
Thus, the meaning to be understood is that pāṭihāriya refers to that which arises there, or that which originates from there as a sign (nimitta).
Trong đó, ý nghĩa pāṭihāriya là điều phát sinh ở đó, hoặc đến từ đó như một dấu hiệu, cần được hiểu.
Avadhāraṇatthena ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.219-223) evaṃ bhagavatā, ‘‘āyasmā ānando atthakusalo, dhammakusalo, byañjanakusalo, niruttikusalo, pubbāparakusalo’’ti (a. ni. 5.169) evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti.
By way of ascertainment, the Blessed One praised him thus: “Bhikkhus, among my bhikkhu disciples who are widely learned, Ananda is the foremost; among those who are capable, mindful, resolute, and attendants, Ananda is the foremost.” And the Dhamma Senāpati praised him thus: “Venerable Ananda is skilled in purpose, skilled in Dhamma, skilled in expression, skilled in language, skilled in sequence.” In accordance with this praised status, he demonstrates his power of retention, thus generating the desire to listen among beings.
Với nghĩa quyết định, Ngài Ānanda đã thể hiện sức mạnh ghi nhớ của mình phù hợp với lời tán thán của Thế Tôn: ‘‘Này các Tỳ-khưu, trong số các đệ tử Tỳ-khưu của Ta, những người đa văn, Ānanda là bậc tối thượng; trong số những người có trí tuệ, có niệm, có dũng lực, có người hầu hạ, Ānanda là bậc tối thượng’’ và của Pháp tướng quân (Sāriputta): ‘‘Tôn giả Ānanda thiện xảo về ý nghĩa, thiện xảo về giáo pháp, thiện xảo về văn tự, thiện xảo về ngữ nguyên, thiện xảo về quá khứ và tương lai’’, qua đó khơi dậy ý muốn lắng nghe của chúng sinh.
‘‘Evaṃ me sutaṃ, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
“Thus have I heard, and that, whether in meaning or in expression, is neither deficient nor excessive; it should be seen as exactly so and not otherwise.”
‘‘Evaṃ me sutaṃ (Tôi đã nghe như vậy), và điều đó không thiếu cũng không thừa về ý nghĩa hay văn tự; nó phải được xem xét đúng như vậy, không khác.’’
Aññathāti bhagavato sammukhā sutākārato aññathā na pana bhagavatā desitākārato.
Otherwise refers to an alteration from the manner of having heard it directly from the Blessed One, but not from the manner in which it was taught by the Blessed One.
Aññathā (khác) có nghĩa là không khác với cách đã nghe trực tiếp từ Thế Tôn, chứ không phải khác với cách Thế Tôn đã thuyết giảng.
Acinteyyānubhāvā hi bhagavato desanā, sā neva sabbākārena sakkā viññātunti vuttovāyamattho.
For the Blessed One’s teachings possess inconceivable power, and it has been stated that they cannot be fully understood in every respect.
Thật vậy, giáo pháp của Thế Tôn có năng lực không thể nghĩ bàn, không thể hiểu được theo mọi khía cạnh. Ý nghĩa này đã được nói đến.
Sutākārāvirujjhanameva hi dhāraṇabalaṃ.
Indeed, non-deviation from the heard form is the power of retention.
Thật vậy, không mâu thuẫn với cách đã nghe chính là sức mạnh ghi nhớ.
Mesaddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me xuất hiện với ba ý nghĩa.
Tathā hissa ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (saṃ. ni. 1.194; su. ni. 81) mayāti attho.
For example, in phrases like “What is obtained by chanting verse is not for me to eat,” its meaning is by me.
Thật vậy, trong các câu như ‘‘gāthābhigītaṃ me abhojaneyya’’ (món ăn được ca tụng bằng kệ không phải là của tôi), nó có nghĩa là ‘mayā’ (bởi tôi).
‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88; 5.382; a. ni. 4.257) mayhanti attho.
In phrases like “Good, Venerable Sir, may the Blessed One teach me the Dhamma in brief,” its meaning is for me.
Trong các câu như ‘‘Sādhu me, bhante, bhagavā saṃkhittena dhammaṃ desetū’’ (Bạch Thế Tôn, xin Thế Tôn hãy thuyết pháp tóm tắt cho con), nó có nghĩa là ‘mayhaṃ’ (cho tôi).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases like “Bhikkhus, be heirs of the Dhamma for me,” its meaning is my.
Trong các câu như ‘‘Dhammadāyādā me, bhikkhave, bhavathā’’ (Này các Tỳ-khưu, hãy là những người thừa kế Pháp của Ta), nó có nghĩa là ‘mama’ (của tôi).
Idha pana ‘‘mayā sutaṃ, mama suta’’nti ca atthadvaye yujjati.
Here, however, it is applicable in both meanings: “heard by me” and “my hearing.”
Ở đây, nó được dùng với hai ý nghĩa: ‘‘mayā sutaṃ’’ (tôi đã nghe) và ‘‘mama sutaṃ’’ (điều tôi đã nghe).
Tattha ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
There, in phrases like “went with the army,” the meaning is going.
Trong các trường hợp như "senāya pasuto" (đi cùng quân đội), nghĩa là "đang đi".
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases like “to one of renowned Dhamma who sees,” the meaning is of renowned Dhamma.
Trong các trường hợp như "sutadhammassa passato" (người đã nghe Pháp và đã thấy), nghĩa là "người có Pháp nổi tiếng".
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilesena kilinnā kilinnassāti attho.
In phrases like “the defiled to the undefiled,” the meaning is defiled by defilement to the undefiled.
Trong các trường hợp như "avassutā avassutassā" (người nữ tỳ kheo bị ô nhiễm đối với người nam tỳ kheo không bị ô nhiễm), nghĩa là "bị dơ bẩn bởi phiền não, đối với người không bị dơ bẩn".
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In phrases like “You have accumulated much merit,” the meaning is accumulated.
Trong các trường hợp như "tumhehi puññaṃ pasutaṃ anappaka" (các ông đã tích lũy công đức không ít), nghĩa là "đã tích lũy".
‘‘Ye jhānappasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases like “those wise ones who are diligent in jhāna,” the meaning is engaged in jhāna.
Trong các trường hợp như "ye jhānappasutā dhīrā" (những bậc trí giả chuyên tâm vào thiền định), nghĩa là "những người chuyên tâm vào thiền định".
‘‘Diṭṭhaṃ sutaṃ muta’’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases like “seen, heard, sensed,” the meaning is cognizable by ear-consciousness.
Trong các trường hợp như "diṭṭhaṃ sutaṃ mutaṃ" (cái đã thấy, đã nghe, đã biết), nghĩa là "có thể nhận biết bằng thính giác".
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases like “one who retains what he has heard, one who accumulates what he has heard,” the meaning is one who retains what is known through following the ear-door.
Trong các trường hợp như "sutadharo sutasannicayo" (người ghi nhớ những gì đã nghe, người tích lũy những gì đã nghe), nghĩa là "người ghi nhớ những gì đã biết theo dòng thính giác".
Idha panassa ‘‘sotadvārānusārena upadhārita’’nti vā ‘‘upadhāraṇa’’nti vā attho.
Here, however, its meaning is either “retained through following the ear-door” or “retention.”
Tuy nhiên, ở đây, nghĩa của nó là "đã ghi nhớ theo dòng thính giác" hoặc "sự ghi nhớ".
Me-saddassa hi mayāti atthe sati ‘‘evaṃ mayā sutaṃ sotadvārānusārena upadhārita’’nti yujjati.
For when the word me has the meaning by me, then it is appropriate to say, “Thus was heard by me, retained through following the ear-door.”
Thật vậy, nếu từ me có nghĩa là "mayā" (bởi tôi), thì "evaṃ mayā sutaṃ sotadvārānusārena upadhāritaṃ" (như vậy tôi đã nghe, đã ghi nhớ theo dòng thính giác) là hợp lý.
Mamāti atthe sati ‘‘evaṃ mama sutaṃ sotadvārānusārena upadhāraṇa’’nti yujjati.
When it has the meaning my, then it is appropriate to say, “Thus is my hearing, retention through following the ear-door.”
Nếu từ me có nghĩa là "mama" (của tôi), thì "evaṃ mama sutaṃ sotadvārānusārena upadhāraṇaṃ" (như vậy sự nghe của tôi là sự ghi nhớ theo dòng thính giác) là hợp lý.
Evametesu tīsu padesu yasmā sutasaddasannidhāne payuttena evaṃsaddena savanakiriyājotakena bhavitabbaṃ, tasmā evanti sotaviññāṇasampaṭicchanādisotadvārikaviññāṇānantaraṃ uppannamanodvārikaviññāṇakiccanidassanaṃ.
In these three positions, since the word evaṃ, used in proximity to the word suta and indicating the act of hearing, must be present, therefore evaṃ indicates the function of mind-door consciousness that arises immediately after ear-door consciousness, such as receiving ear-consciousness.
Trong ba từ này, vì từ evaṃ được sử dụng gần với từ suta phải làm sáng tỏ hành động nghe, nên evaṃ là sự trình bày hành động của thức ý môn (manodvārikaviññāṇa) phát sinh ngay sau thức nhĩ môn (sotaviññāṇa) tiếp nhận, v.v.
Meti vuttaviññāṇasamaṅgīpuggalanidassanaṃ.
Me indicates the person endowed with the aforesaid consciousness.
Me là sự trình bày về cá nhân có đầy đủ thức đã nói.
Sabbāni hi vākyāni evakāratthasahitāniyeva avadhāraṇaphalattā tesaṃ.
For all sentences are indeed accompanied by the meaning of evaṃ because it is their fruit of ascertainment.
Tất cả các câu đều đi kèm với nghĩa của từ "eva" (chính là), vì chúng có kết quả là sự xác định.
Sutanti assavanabhāvappaṭikkhepato anūnānadhikāviparītaggahaṇanidassanaṃ.
Suta indicates a non-deficient, non-excessive, and non-distorted apprehension, by negating the state of not having heard.
Sutaṃ là sự trình bày về việc nắm bắt không thiếu, không thừa, không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Yathā hi sutaṃ sutamevāti vattabbataṃ arahati tathā taṃ sammā sutaṃ anūnaggahaṇaṃ anadhikaggahaṇaṃ aviparītaggahaṇañca hotīti.
For just as what is heard is worthy of being called "just heard," so too is it correctly heard, without deficiency, without excess, and without distortion.
Thật vậy, những gì đã nghe đáng được nói là "chính là đã nghe", và như vậy, sự nghe đúng đắn đó là sự nắm bắt không thiếu, không thừa và không sai lệch.
Atha vā saddantaratthāpohanavasena saddo atthaṃ vadatīti etasmiṃ pakkhe yasmā sutanti etassa asutaṃ na hotīti ayamattho vutto, tasmā sutanti assavanabhāvappaṭikkhepato anūnānadhikāviparītaggahaṇanidassanaṃ.
Alternatively, if it is held that a word expresses its meaning by excluding the meaning of another word, then since the meaning of sutaṃ is "it is not unheard," therefore sutaṃ indicates a non-deficient, non-excessive, and non-distorted apprehension by negating the state of not having heard.
Hoặc, theo quan điểm rằng một từ nói lên nghĩa bằng cách loại bỏ nghĩa của các từ khác, vì nghĩa của "sutaṃ" đã được nói là "không phải là chưa nghe", nên "sutaṃ" là sự trình bày về việc nắm bắt không thiếu, không thừa, không sai lệch, bằng cách phủ nhận trạng thái không nghe.
Idaṃ vuttaṃ hoti – evaṃ me sutaṃ, na mayā idaṃ diṭṭhaṃ, na sayambhūñāṇena sacchikataṃ, na aññathā vā upaladdhaṃ.
This is what is meant: "Thus have I heard, this was not seen by me, not directly realized by self-existent knowledge, nor obtained in any other way.
Điều này có nghĩa là: "Như vậy tôi đã nghe, điều này tôi không tự mình thấy, không tự mình chứng ngộ bằng Tuệ tự sinh, cũng không đạt được bằng cách nào khác.
Api ca sutaṃva, tañca kho sammadevāti.
Moreover, it was indeed heard, and that too, correctly."
Hơn nữa, nó chỉ là điều đã nghe, và điều đó đã được nghe một cách đúng đắn."
Avadhāraṇatthe vā evaṃsadde ayamatthayojanā, tadapekkhassa sutasaddassa niyamattho sambhavatīti tadapekkhassa sutasaddassa assavanabhāvappaṭikkhepo anūnānadhikāviparītaggahaṇanidassanatā ca veditabbā.
Or, if the word evaṃ is in the sense of ascertainment, this construction of meaning applies, and thus the specific meaning of the word suta is possible, so the negation of the state of not having heard, and the indication of non-deficient, non-excessive, and non-distorted apprehension of the word suta dependent on that, should be understood.
Hoặc, nếu từ "evaṃ" có nghĩa là xác định, thì sự giải thích nghĩa này là hợp lý, và khi đó, nghĩa xác định của từ "suta" liên quan đến nó có thể xảy ra, và do đó, sự phủ nhận trạng thái không nghe, sự trình bày về việc nắm bắt không thiếu, không thừa, không sai lệch của từ "suta" liên quan đến nó cần được hiểu.
Iti savanahetusavanavisesavasenapi sutasaddassa atthayojanā katāti daṭṭhabbaṃ.
Thus, it should be understood that the meaning of the word suta is explained by way of the cause of hearing and the distinction of hearing.
Như vậy, cần hiểu rằng sự giải thích nghĩa của từ "suta" đã được thực hiện theo cách là nguyên nhân của sự nghe và sự đặc biệt của sự nghe.
Tathā evanti nidassitabbappakāsanaṃ nidassanattho evaṃsaddoti katvā nidassetabbassa niddisitabbabhāvato.
Likewise, evaṃ expresses what is to be demonstrated, taking the word evaṃ as having the meaning of exemplification, because what is to be demonstrated is indeed to be indicated.
Tương tự, evaṃ là sự trình bày về điều cần được chỉ ra, giả định rằng từ evaṃ có nghĩa là sự chỉ ra, vì điều cần được chỉ ra là điều cần được trình bày.
Tasmā evaṃsaddena sakalampi suttaṃ paccāmaṭṭhanti veditabbaṃ.
Therefore, it should be understood that the entire Sutta is referred to by the word evaṃ.
Do đó, cần hiểu rằng toàn bộ bài kinh đã được hồi tưởng bằng từ evaṃ.
Meti puggalappakāsanaṃ.
Me is the expression of the person.
Me là sự trình bày về cá nhân.
Sutanti puggalakiccappakāsanaṃ.
Suta is the expression of the person's function.
Sutaṃ là sự trình bày về hành động của cá nhân.
Sutasaddena hi labbhamānā savanakiriyā savanaviññāṇappabandhappaṭibaddhā, tattha ca puggalavohāro, na ca puggalavohārarahite dhammappabandhe savanakiriyā labbhati.
For the act of hearing obtained through the word suta is connected with the continuity of hearing-consciousness, and there is the convention of "person" in that context, and the act of hearing is not found in a continuity of Dhamma devoid of the convention of "person."
Thật vậy, hành động nghe được hiểu từ từ "suta" gắn liền với chuỗi thức nghe, và ở đó có sự quy ước về cá nhân, và hành động nghe không thể được tìm thấy trong chuỗi Pháp không có quy ước về cá nhân.
Tassāyaṃ saṅkhepattho – yaṃ suttaṃ niddisissāmi, taṃ mayā evaṃ sutanti.
Its brief meaning is: "The Sutta which I will indicate, was thus heard by me."
Nghĩa tóm tắt của điều này là: "Bài kinh tôi sẽ trình bày, tôi đã nghe như vậy."
Atha vā evanti puggalakiccaniddeso, sutānañhi dhammānaṃ gahitākārassa nidassanassa avadhāraṇassa vā pakāsanasabhāvena evaṃsaddena tadākārādidhāraṇassa puggalavohārupādānadhammabyāpārabhāvato puggalakiccaṃnāma niddiṭṭhaṃ hotīti.
Alternatively, Evaṃ is a designation of the individual's function, for by the word 'evaṃ' as manifesting the nature of indicating or ascertaining the understood mode of the heard Dhammas, the function of the individual is designated through the activity of referring to the individual's conventional usage of retaining that mode and so forth.
Hoặc, evaṃ là sự trình bày về hành động của cá nhân, vì bằng từ evaṃ với tính chất làm sáng tỏ sự chỉ ra hoặc sự xác định về cách thức đã được nắm bắt của các Pháp đã được nghe, hành động của cá nhân được chỉ ra là do sự diễn ra của Pháp, là sự quy ước về cá nhân dựa trên sự ghi nhớ cách thức đó, v.v.
Sutanti viññāṇakiccaniddeso, puggalavādinopi hi savanakiriyā viññāṇanirapekkhā na hotīti.
Sutaṃ is a designation of the function of consciousness, for even for those who assert an individual, the act of hearing is not independent of consciousness.
Sutaṃ là sự trình bày về hành động của thức, vì ngay cả đối với người nói về cá nhân, hành động nghe cũng không thể không có thức.
Meti ubhayakiccayuttapuggalaniddeso.
Me is a designation of the individual endowed with both functions.
Me là sự trình bày về cá nhân có cả hai hành động.
Meti hi saddappavatti ekanteneva sattavisesavisayā viññāṇakiccañca tattheva samodahitabbanti.
Indeed, the occurrence of the word 'me' refers exclusively to a specific living being, and the function of consciousness must also be included therein.
Thật vậy, sự xuất hiện của từ me hoàn toàn liên quan đến một loại hữu tình, và hành động của thức cũng phải được bao gồm trong đó.
Ayaṃ panettha saṅkhepo – mayā savanakiccaviññāṇasamaṅginā puggalena viññāṇavasena laddhasavanakiccavohārena sutanti.
Here is the summary: "It was heard by me, the individual endowed with the consciousness of the act of hearing, by way of consciousness, by whom the conventional usage of the act of hearing was obtained."
Đây là tóm tắt ở đây: "Tôi, cá nhân có đầy đủ hành động nghe và thức, với quy ước về hành động nghe đạt được nhờ thức, đã nghe."
Tathā evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
Likewise, both Evaṃ and Me are designations of what is non-existent according to the absolute ultimate reality.
Tương tự, evaṃ và me là những quy ước không tồn tại theo nghĩa chân đế tuyệt đối.
Sabbassa hi saddādhigamanīyassa atthassa paññattimukheneva paṭipajjitabbattā sabbapaññattīnañca vijjamānādīsu chasu paññattīsu avarodho, tasmā yo māyāmarīciādayo viya abhūtattho anussavādīhi gahetabbo viya anuttamatthopi na hoti.
For every meaning that is to be understood through words must be approached through designations, and all designations are subsumed under the six types of designations, such as existent and so forth. Therefore, that meaning which is not real, like illusions and mirages, and which is not an ultimate truth to be grasped by tradition and so forth, is not ultimately real.
Vì tất cả các nghĩa có thể đạt được bằng lời nói đều phải được thực hành thông qua quy ước, và tất cả các quy ước đều được bao gồm trong sáu loại quy ước như tồn tại, v.v., do đó, cái gì không phải là nghĩa không tồn tại như ảo ảnh, ảo giác, v.v., cũng không phải là nghĩa tối thượng cần được nắm bắt bằng sự truyền khẩu, v.v.
So rūpasaddādiko ruppanānubhavanādiko ca paramatthasabhāvo saccikaṭṭhaparamatthavasena vijjati.
That ultimate reality, such as material sound, suffering, experience, and so forth, exists in terms of absolute ultimate reality.
Cái đó, tức là bản chất tối thượng của sắc, thanh, v.v., của sự bị phá hoại, sự trải nghiệm, v.v., tồn tại theo nghĩa chân đế tuyệt đối.
Yo pana evanti ca meti ca vuccamāno ākārattho, so aparamatthasabhāvo saccikaṭṭhaparamatthavasena anupalabbhamāno avijjamānapaññatti nāma.
But the meaning of the mode, which is spoken of as Evaṃ and Me, is not an ultimate reality; being unperceivable in terms of absolute ultimate reality, it is called a designation of what is non-existent.
Còn cái nghĩa cách thức được gọi là "evaṃ" và "me", bản chất không phải tối thượng, không thể tìm thấy theo nghĩa chân đế tuyệt đối, được gọi là quy ước không tồn tại.
Tasmā kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha?
Therefore, what in this (designation) truly exists in ultimate reality, that it might obtain the designation of Evaṃ or Me?
Do đó, ở đây, cái gì tồn tại theo nghĩa tối thượng mà có thể được gọi là "evaṃ" hoặc "me"?
Sutanti vijjamānapaññatti, yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
Sutaṃ is an existent designation, for what is apprehended by the ear here truly exists in ultimate reality.
Sutaṃ là quy ước tồn tại, vì cái đã được nhận biết bằng tai ở đây là cái tồn tại theo nghĩa tối thượng.
Tathā evanti sotapathamāgate dhamme upādāya tesaṃ upadhāritākārādīnaṃ paccāmasanavasena.
Similarly, Evaṃ is a designation by referring to the ascertained modes and so forth of the Dhammas that have come to the path of hearing.
Tương tự, evaṃ là theo cách hồi tưởng lại các cách thức đã được ghi nhớ, v.v., của các Pháp đã đến đường tai.
Meti sasantatipariyāpanne khandhe karaṇādivisesavisiṭṭhe upādāya vattabbato upādāpaññatti.
Me is a designation by referring to the aggregates included within one's own continuum, distinguished by characteristics such as instrumentality, hence it is a designation by way of clinging (upādāya paññatti).
Me là quy ước dựa trên (upādāya paññatti), vì nó được nói dựa trên các uẩn thuộc dòng tâm thức của chính mình, được đặc trưng bởi các trường hợp đặc biệt như công cụ, v.v.
Sutanti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a designation by comparison (upanidhāpaññatti), as it is to be spoken of by comparing it with what has been seen and so forth.
Sutaṃ là quy ước so sánh (upanidhāpaññatti), vì nó được nói dựa trên các điều đã thấy, v.v.
Diṭṭhādisabhāvarahite saddāyatane pavattamānopi sutavohāro dutiyaṃ tatiyantiādiko viya paṭhamādīni, diṭṭhamutaviññāte apekkhitvā sutanti viññeyyattā diṭṭhādīni upanidhāya vattabbo hoti.
Even though the designation of "heard" occurs with respect to the sound-ayatana, which is devoid of the nature of "seen" and so forth, just as "second" and "third" depend on "first" and so forth, similarly, the word "heard" must be spoken of by comparison to "seen," "perceived," and "discerned," because it is to be understood as "heard" in relation to them.
Mặc dù thuật ngữ "suta" (đã nghe) được sử dụng trong lĩnh vực âm thanh, vốn không có bản chất của "diṭṭha" (đã thấy) và các giác quan khác, nhưng nó phải được nói bằng cách dựa vào "diṭṭha" và các giác quan khác, vì nó được hiểu là "suta" khi so sánh với "diṭṭha", "muta" (đã cảm thọ) và "viññāta" (đã nhận biết), như cách các thuật ngữ "thứ hai", "thứ ba" và các thuật ngữ tương tự dựa vào "thứ nhất" và các thuật ngữ tương tự.
Asutaṃ na hotīti hi sutanti pakāsitoyamatthoti.
For this meaning is declared as "heard" because it is not unheard.
Vì đây là ý nghĩa được tuyên bố là "suta" (đã nghe) bởi vì "asuta" (chưa nghe) không tồn tại.
Ettha ca evantivacanena asammohaṃ dīpeti.
Here, by the word Evaṃ, non-confusion is indicated.
Ở đây, với từ evaṃ, Ngài A-nanda biểu thị sự không lầm lẫn.
Paṭividdhā hi attanā sutassa pakāravisesā evanti idha āyasmatā ānandena paccāmaṭṭhā, tenassa asammoho dīpito hoti.
For the venerable Ānanda here recollected the specific modes of what he himself had penetrated and heard as 'thus' (evaṃ); by this, his non-confusion is indicated.
Thật vậy, ở đây, Tôn giả A-nanda đã suy xét lại những đặc điểm chi tiết của những gì mình đã nghe, do đó, sự không lầm lẫn của Ngài được biểu thị.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti, paccayākāravasena nānappakārā duppaṭividdhā ca suttantāti dīpitanti.
Indeed, one who is confused is not capable of penetrating various modes; thus, it is shown that the Suttantas, with their various modes by way of conditions and aspects, are difficult to penetrate.
Thật vậy, một người lầm lẫn không thể thấu hiểu nhiều loại, và được biểu thị rằng các ý nghĩa của kinh điển là đa dạng về mặt nhân duyên và khó thấu hiểu.
Sutantivacanena sutassa asammosaṃ dīpeti, sutākārassa yāthāvato dassiyamānattā.
By the word Sutaṃ, non-forgetfulness of what was heard is indicated, due to the faithful showing of the mode of what was heard.
Với từ sutaṃ, Ngài biểu thị sự không quên những gì đã nghe, vì cách thức đã nghe được trình bày một cách chân thực.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantare mayā sutanti paṭijānāti.
For if one's hearing is forgotten, one does not acknowledge in a later time that "I heard this."
Thật vậy, một người đã quên những gì mình đã nghe sẽ không thừa nhận rằng "tôi đã nghe điều này" vào một thời điểm sau đó.
Iccassa asammohena paññāsiddhi, sammohābhāvena paññāya eva vā savanakālasambhūtāya taduttarikālapaññāsiddhi, tathā asammosena satisiddhi.
Thus, by his non-confusion, the attainment of wisdom is perfected, or by the absence of confusion, the attainment of wisdom in the subsequent period, based on the wisdom arisen at the time of hearing; similarly, by non-forgetfulness, the attainment of mindfulness is perfected.
Vì thế, sự thành tựu trí tuệ của Ngài là do không lầm lẫn, hoặc sự thành tựu trí tuệ sau này là do trí tuệ phát sinh vào lúc nghe, do không lầm lẫn; và sự thành tựu chánh niệm là do không quên.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā.
Among these, mindfulness preceded by wisdom is capable of comprehending the mere words.
Trong đó, khả năng ghi nhớ các từ ngữ là nhờ chánh niệm đi trước trí tuệ.
Byañjanānañhi paṭivijjhitabbo ākāro nātigambhīro, yathāsutaṃ dhāraṇameva tattha karaṇīyanti satiyā byāpāro adhiko, paññā tattha guṇībhūtā hoti paññāya pubbaṅgamāti katvā.
For the mode of the words to be penetrated is not overly profound; merely retaining what was heard is to be done there. Thus, the activity of mindfulness is primary, and wisdom is secondary there, because it is preceded by wisdom.
Thật vậy, khía cạnh cần được thấu hiểu của các từ ngữ không quá sâu sắc; ở đây, việc ghi nhớ đúng như đã nghe là điều cần làm. Vì vậy, vai trò của chánh niệm là lớn hơn, trí tuệ ở đây trở thành phụ thuộc, vì chánh niệm đi trước trí tuệ.
Satipubbaṅgamāya paññāya atthappaṭivedhasamatthatā.
Wisdom preceded by mindfulness is capable of penetrating the meaning.
Khả năng thấu hiểu ý nghĩa là nhờ trí tuệ đi trước chánh niệm.
Atthassa hi paṭivijjhitabbo ākāro gambhīroti paññāya byāpāro adhiko, sati tattha guṇībhūtāyevāti satiyā pubbaṅgamāyāti katvā.
For the mode of the meaning to be penetrated is profound. Thus, the activity of wisdom is primary, and mindfulness is secondary there, because it is preceded by mindfulness.
Thật vậy, khía cạnh cần được thấu hiểu của ý nghĩa là sâu sắc, vì vậy vai trò của trí tuệ là lớn hơn, chánh niệm ở đây chỉ là phụ thuộc, vì trí tuệ đi trước chánh niệm.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthatāya dhammabhaṇḍāgārikattasiddhi.
By virtue of being endowed with the ability of both, the attainment of being the Keeper of the Dhamma Treasury is perfected, through the ability to preserve the Dhamma-treasury complete with both meaning and words.
Do khả năng kép này, sự thành tựu của Ngài là người giữ kho Pháp (Dhammabhaṇḍāgārika) là nhờ khả năng bảo vệ kho tàng Pháp đầy đủ cả ý nghĩa và từ ngữ.
Aparo nayo – evantivacanena yonisomanasikāraṃ dīpeti, tena ca vuccamānānaṃ ākāranidassanāvadhāraṇatthānaṃ upari vakkhamānānaṃ nānappakārappaṭivedhajotakānaṃ aviparītasiddhi dhammavisayattā.
Another method: By the word Evaṃ, appropriate attention (yonisomanasikāra) is indicated, and by that, the unerring perfection of the meanings of mode, indication, and ascertainment, which will be explained later and which illuminate various kinds of penetration, is indicated, because they pertain to Dhamma.
Một cách giải thích khác – với từ evaṃ, Ngài biểu thị sự tác ý đúng đắn (yonisomanasikāra), và nhờ đó, sự thành tựu không sai lệch của các ý nghĩa về khía cạnh, ví dụ và sự xác định, sẽ được nói đến ở trên, vốn biểu thị sự thấu hiểu đa dạng, là do chúng thuộc về Pháp.
Na hi ayoniso manasikaroto nānappakārappaṭivedho sambhavati.
Indeed, for one who attends inappropriately, various kinds of penetration do not arise.
Thật vậy, sự thấu hiểu đa dạng không thể xảy ra đối với người tác ý không đúng đắn.
Sutantivacanena avikkhepaṃ dīpeti, ‘‘paṭhamabodhisuttaṃ kattha bhāsita’’ntiādipucchāvasena pakaraṇapattassa vakkhamānassa suttassa savanaṃ samādhānamantarena na sambhavati vikkhittacittassa savanābhāvato.
By the word Sutaṃ, non-distraction is indicated, for the hearing of the Sutta, which will be explained later and which pertains to the context, as in questions like "Where was the first Bodhi Sutta delivered?", cannot occur without mental concentration, due to the absence of hearing for one with a distracted mind.
Với từ sutaṃ, Ngài biểu thị sự không tán loạn, vì việc nghe bài kinh sẽ được nói đến, vốn thuộc về phần chính của kinh điển thông qua các câu hỏi như "Bài kinh Bồ-đề đầu tiên được thuyết ở đâu?", không thể xảy ra nếu không có sự tập trung, bởi vì người có tâm tán loạn không thể nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Thus, a distracted person, even when spoken to with a complete exposition, says, "I did not hear; please say it again."
Thật vậy, một người có tâm tán loạn, dù được nói tất cả những điều tốt đẹp, vẫn nói: "Tôi chưa nghe, xin hãy nói lại."
Yonisomanasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Here, by appropriate attention, one accomplishes self-resolution and past meritorious deeds, for these are absent for one whose self is not rightly resolved or who has not performed meritorious deeds in the past.
Ở đây, với sự tác ý đúng đắn (yonisomanasikāra), Ngài chứng minh sự tự định hướng đúng đắn và công đức đã tạo trong quá khứ, vì những điều đó không tồn tại đối với người không tự định hướng đúng đắn hoặc người chưa tạo công đức trong quá khứ.
Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti assutavato sappurisūpanissayavirahitassa ca tadabhāvato.
By non-distraction, one accomplishes hearing the True Dhamma and associating with good people, for these are absent for one who has not heard or who is devoid of association with good people.
Với sự không tán loạn, Ngài chứng minh việc nghe Chánh Pháp và nương tựa vào bậc thiện trí (sappurisūpanissaya), vì những điều đó không tồn tại đối với người chưa từng nghe hoặc người không có sự nương tựa vào bậc thiện trí.
Na hi vikkhitto sotuṃ sakkoti, na ca sappurise anupanissayamānassa savanaṃ atthīti.
Indeed, a distracted person cannot hear, nor is there hearing for one who does not associate with good people.
Thật vậy, người tán loạn không thể nghe, và người không nương tựa vào bậc thiện trí thì không có sự nghe.
Aparo nayo – ‘‘yassa cittasantānassa nānappakārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddeso’’ti vuttaṃ.
Another method: "The indication of various modes belongs to the mind-continuum of which there is comprehension of various meanings and words due to its various occurrences," it was said.
Một cách giải thích khác – "sự chỉ rõ các khía cạnh khác nhau là dành cho dòng tâm thức nào mà có sự nắm bắt các ý nghĩa và từ ngữ khác nhau do sự vận hành đa dạng của nó" đã được nói.
Yasmā ca so bhagavato vacanassa atthabyañjanappabhedaparicchedavasena sakalasāsanasampattiogāhanena niravasesaṃ parahitapāripūrīkaraṇabhūto evaṃ bhaddako ākāro na sammā appaṇihitattassa pubbe akatapuññassa vā hoti.
And because such an excellent mode—being the cause for the complete fulfillment of the welfare of others by pervading the entirety of the Dispensation through the analysis of the meanings and words of the Buddha's discourse—does not belong to one whose self is not rightly resolved or who has not performed meritorious deeds in the past.
Và bởi vì khía cạnh tốt đẹp như vậy, vốn là nguyên nhân hoàn thành lợi ích của người khác một cách trọn vẹn bằng cách thâm nhập vào toàn bộ sự giàu có của giáo pháp thông qua việc phân tích các loại ý nghĩa và từ ngữ trong lời dạy của Đức Phật, không thể có được đối với người không tự định hướng đúng đắn hoặc người chưa tạo công đức trong quá khứ.
Tasmā evanti iminā bhaddakena ākārena pacchimacakkadvayasampattimattano dīpeti, sutanti savanayogena purimacakkadvayasampattiṃ.
Therefore, by this excellent mode, Evaṃ, he indicates his own attainment of the latter two wheels (of prosperity), and by the word Sutaṃ, through the act of hearing, he indicates his attainment of the former two wheels.
Vì vậy, với khía cạnh tốt đẹp này, tức là evaṃ, Ngài biểu thị sự thành tựu của hai bánh xe cuối cùng của mình, và với từ sutaṃ, Ngài biểu thị sự thành tựu của hai bánh xe đầu tiên thông qua việc nghe.
Na hi appatirūpe dese vasato sappurisūpanissayavirahitassa ca savanaṃ atthi.
For there is no hearing for one who dwells in an unsuitable place or who is devoid of association with good people.
Thật vậy, không có sự nghe đối với người sống ở nơi không phù hợp và không có sự nương tựa vào bậc thiện trí.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhi siddhā hoti.
Thus, by his attainment of the latter two wheels, the purity of his disposition is perfected.
Vì thế, với sự thành tựu của hai bánh xe cuối cùng, sự thanh tịnh về ý định của Ngài đã được chứng minh.
Sammā paṇihitacitto pubbe ca katapuñño visuddhāsayo hoti tadasuddhihetūnaṃ kilesānaṃ dūrībhāvato.
One whose mind is rightly resolved and who has performed meritorious deeds in the past has a pure disposition, due to the removal of defilements, which are the causes of impurity.
Một người có tâm định hướng đúng đắn và đã tạo công đức trong quá khứ thì có ý định thanh tịnh, vì các phiền não là nguyên nhân của sự không thanh tịnh đã bị loại bỏ.
Tathā hi vuttaṃ ‘‘sammā paṇihitaṃ cittaṃ, seyyaso naṃ tato kare’’ti (dha. pa. 43) ‘‘katapuññosi tvaṃ, ānanda, padhānamanuyuñja, khippaṃ hohisi anāsavo’’ti (dī. ni. 2.207) ca.
Thus it is said: "A well-directed mind makes one better than that" (Dhp. 43) and "You are one who has done merit, Ānanda; devote yourself to exertion, and you will quickly become taintless" (Dī. Ni. 2.207).
Thật vậy, đã được nói: "Tâm được định hướng đúng đắn sẽ làm cho người đó trở nên tốt đẹp hơn" và "Này A-nanda, con đã tạo công đức, hãy tinh tấn tu tập, con sẽ nhanh chóng trở thành vô lậu".
Purimacakkadvayasiddhiyā payogasuddhi.
The purity of practice is achieved by the success of the first two wheels.
Với sự thành tựu của hai bánh xe đầu tiên, sự thanh tịnh trong thực hành đã được chứng minh.
Patirūpadesavāsena hi sappurisūpanissayena ca sādhūnaṃ diṭṭhānugatiāpajjanena parisuddhappayogo hoti.
Indeed, by dwelling in a suitable region and by associating with good people, and by following the example of the virtuous, one's practice becomes purified.
Thật vậy, với việc sống ở nơi phù hợp và nương tựa vào bậc thiện trí, và noi theo gương của các bậc thiện trí, người đó có sự thực hành thanh tịnh.
Tāya ca āsayasuddhiyā adhigamabyattisiddhi, pubbeyeva taṇhādiṭṭhisaṃkilesānaṃ visodhitattā payogasuddhiyā āgamabyattisiddhi.
And by that purity of aspiration, the success of realization is achieved, because defilements like craving and wrong view were already cleansed; by the purity of practice, the success of scriptural knowledge is achieved.
Và với sự thanh tịnh về ý định đó, sự thành tựu trong việc chứng đắc đã được chứng minh, vì các phiền não như tham ái và tà kiến đã được thanh lọc từ trước; với sự thanh tịnh trong thực hành, sự thành tựu trong việc học hỏi đã được chứng minh.
Suparisuddhakāyavacīpayogo hi vippaṭisārābhāvato avikkhittacitto pariyattiyaṃ visārado hoti.
For one whose bodily and verbal practice is perfectly pure, being free from remorse, has an unscattered mind and is confident in the Pariyatti.
Thật vậy, một người có sự thực hành thân và khẩu hoàn toàn thanh tịnh, do không có sự hối hận, có tâm không tán loạn và tinh thông trong việc học hỏi.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggamanaṃ viya sūriyassa udayato yonisomanasikāro viya ca kusalakammassa arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento evaṃ me sutantiādimāha.
Thus, the words of one whose practice and aspiration are pure, and who is accomplished in both scriptural knowledge and realization, are worthy to be a forerunner of the Buddha's words, just as the dawn is a forerunner of the sun's rising, and proper attention (yonisomanasikāra) is a forerunner of wholesome action. Therefore, placing the cause in its proper place, he said, "Thus have I heard" (evaṃ me sutaṃ).
Vì vậy, lời nói của một người có sự thanh tịnh trong thực hành và ý định, và đầy đủ cả việc học hỏi và chứng đắc, xứng đáng là phần mở đầu cho lời dạy của Đức Phật, giống như ánh bình minh là phần mở đầu cho sự mọc của mặt trời, và sự tác ý đúng đắn là phần mở đầu cho hành động thiện lành. Do đó, khi đặt nền tảng cho điều này, Ngài nói: "Evaṃ me sutaṃ" (Như vầy tôi nghe).
Aparo nayo – evanti iminā pubbe vuttanayeneva nānappakārappaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another method: By this word evaṃ, in the manner already stated, Venerable Ānanda reveals the existence of his attainment of paṭisambhidā (analytical knowledge) concerning meaning and perspicuity, by means of words that elucidate various kinds of penetration.
Một cách giải thích khác – với từ evaṃ, vốn biểu thị sự thấu hiểu đa dạng theo cách đã nói ở trên, Ngài biểu thị sự tồn tại của sự thành tựu về các phân tích về ý nghĩa và biện tài của mình.
Sutanti iminā evaṃsaddasannidhānato vakkhamānāpekkhāya vā sotabbabhedappaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ dīpeti.
By this word sutaṃ, due to its proximity to the word evaṃ, or with reference to what is to be said, he reveals the existence of his attainment of paṭisambhidā concerning Dhamma and language, by means of words that elucidate the penetration of various kinds of things to be heard.
Với từ sutaṃ, do sự gần gũi của từ evaṃ, hoặc do sự mong đợi những gì sẽ được nói đến sau, Ngài biểu thị sự tồn tại của sự thành tựu về các phân tích về Pháp và ngôn ngữ, vốn biểu thị sự thấu hiểu các loại điều cần nghe.
Evanti ca idaṃ vuttanayeneva yonisomanasikāradīpakavacanaṃ bhāsamāno ‘‘ete dhammā mayā manasānupekkhitā diṭṭhiyā suppaṭividdhā’’ti dīpeti.
And by uttering this word evaṃ, which, in the manner already stated, elucidates proper attention (yonisomanasikāra), he reveals, "These Dhammas have been reflected upon by me mentally and thoroughly penetrated by insight."
Và khi nói từ evaṃ, vốn biểu thị sự tác ý đúng đắn theo cách đã nói ở trên, Ngài biểu thị: "Những pháp này đã được tôi suy xét bằng tâm và đã được thấu hiểu rõ ràng bằng tuệ tri (diṭṭhi)."
Pariyattidhammo hi ‘‘idha sīlaṃ kathitaṃ, idha samādhi, idha paññā, ettakā ettha anusandhiyo’’tiādinā nayena manasā anupekkhito anussavākāraparivitakkasahitāya dhammanijjhānakkhantibhūtāya ñātapariññāsaṅkhātāya vā diṭṭhiyā tattha tattha vuttarūpārūpadhamme ‘‘iti rūpaṃ, ettakaṃ rūpa’’ntiādinā nayena suṭṭhu vavatthapetvā paṭividdho attano ca paresañca hitasukhāvaho hotīti.
For the Pariyatti Dhamma, when mentally reflected upon in ways such as "Here morality is taught, here concentration, here wisdom, and such are the connections here," and thoroughly penetrated by insight (diṭṭhi) which is accompanied by the mode of recollection and deep reflection, or which is called 'knowledge of the known' (ñātapariññā), by clearly discerning the material and immaterial phenomena taught therein, such as "This is form, this much is form," becomes conducive to one's own welfare and happiness, as well as that of others.
Thật vậy, Pháp học, khi được suy xét bằng tâm theo cách như "ở đây giới được nói đến, ở đây định, ở đây tuệ, có bấy nhiêu sự liên kết ở đây", v.v., và được thấu hiểu rõ ràng bằng tuệ tri, vốn bao gồm sự suy tư về cách thức đã nghe và sự chấp nhận về sự quán sát Pháp, hay còn gọi là sự hiểu biết về sự hiểu biết (ñātapariññā), sau khi đã phân định rõ ràng các pháp sắc và vô sắc được nói đến ở từng nơi theo cách như "đây là sắc, sắc có bấy nhiêu", v.v., thì sẽ mang lại lợi ích và hạnh phúc cho bản thân và cho người khác.
Sutanti idaṃ savanayogadīpakavacanaṃ bhāsamāno ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By uttering this word sutaṃ, which elucidates the faculty of hearing, he reveals, "Many Dhammas have been heard by me, retained, and familiarized verbally."
Khi nói từ sutaṃ, vốn biểu thị sự nghe, Ngài biểu thị: "Tôi đã nghe nhiều pháp, đã ghi nhớ chúng và đã quen thuộc với chúng bằng lời nói."
Sotāvadhānappaṭibaddhā hi pariyattidhammassa savanadhāraṇaparicayā.
Indeed, the hearing, retention, and familiarization of the Pariyatti Dhamma are bound up with the faculty of hearing.
Thật vậy, việc nghe, ghi nhớ và quen thuộc với Pháp học đều phụ thuộc vào sự chú tâm khi nghe.
Tadubhayenapi dhammassa svākkhātabhāvena, atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both of these, he generates reverence for hearing, by demonstrating the Dhamma's well-proclaimed nature and its completeness in meaning and letter.
Với cả hai điều đó, Ngài biểu thị sự đầy đủ về ý nghĩa và từ ngữ của Pháp là được thuyết giảng hoàn hảo, và Ngài khơi dậy sự chú tâm vào việc nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti ādaraṃ janetvā sakkaccaṃ dhammo sotabbo.
For one who does not listen respectfully to the Dhamma, which is complete in meaning and letter, is deprived of great benefit. Therefore, generating reverence, the Dhamma should be listened to respectfully.
Thật vậy, một người không lắng nghe Pháp đầy đủ ý nghĩa và từ ngữ một cách kính trọng sẽ bị thiếu hụt lợi ích lớn lao. Vì vậy, cần phải khơi dậy sự kính trọng và lắng nghe Pháp một cách cẩn thận.
Ekanti gaṇanaparicchedaniddeso.
Ekaṃ is an indication of numerical classification.
Ekaṃ (một) là sự chỉ định giới hạn về số lượng.
Ayañhi ekasaddo aññaseṭṭhāsahāyasaṅkhyādīsu dissati.
Indeed, this word eka is seen in the senses of 'another', 'best', 'alone', 'number', and so on.
Thật vậy, từ eka này được thấy trong các nghĩa như: khác, tối thượng, không có bạn đồng hành, số lượng, v.v.
Tathā hi ayaṃ ‘‘sassato attā ca loko ca, idameva saccaṃ moghamaññanti ittheke abhivadantī’’tiādīsu (ma. ni. 3.27; udā. 55) aññe dissati.
Thus, it is seen in the sense of 'another' in phrases like ‘‘the self and the world are eternal; this alone is true, all else is delusive’—thus some declare’’.
Ví dụ, trong các câu như “linh hồn và thế giới là thường còn, chỉ điều này là chân lý, những điều khác là vô nghĩa, một số người nói như vậy” (Ma. Ni. 3.27; Udā. 55), nó được thấy trong nghĩa khác.
‘‘Cetaso ekodibhāva’’ntiādīsu (pārā. 11; dī. ni. 1.228) seṭṭhe.
In the sense of 'best' in phrases like ‘‘the singleness of mind’’.
Trong các câu như “sự an định nhất tâm” (Pārā. 11; Dī. Ni. 1.228), nó được thấy trong nghĩa tối thượng.
‘‘Eko vūpakaṭṭho’’tiādīsu (cūḷava. 445; dī. ni. 1.405) asahāye.
In the sense of 'alone' in phrases like ‘‘one who is secluded’’.
Trong các câu như “một mình ẩn cư” (Cūḷava. 445; Dī. Ni. 1.405), nó được thấy trong nghĩa không có bạn đồng hành.
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) saṅkhyāyaṃ, idhāpi saṅkhyāyameva daṭṭhabbo.
In the sense of 'number' in phrases like ‘‘Indeed, bhikkhus, there is only one moment, one opportunity for living the holy life,’’ and here too, it should be understood in the sense of number.
Trong các câu như “Này các tỳ khưu, chỉ có một khoảnh khắc, một thời điểm để sống đời Phạm hạnh” (A. Ni. 8.29), nó được thấy trong nghĩa số lượng, và ở đây cũng nên hiểu là số lượng.
Tena vuttaṃ – ‘‘ekanti gaṇanaparicchedaniddeso’’ti.
Therefore, it is said: ‘‘ekaṃ is an indication of numerical classification.’’
Vì vậy, đã nói: “ Ekaṃ là sự chỉ định giới hạn về số lượng.”
Tathā hissa ‘‘appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho, yuttakālañca paccayasāmaggiñca labhitvāti hi adhippāyo, tasmā paccayasamavāyoti veditabbo.
Thus, in phrases like ‘‘We might perhaps approach tomorrow, depending on the suitable time and the conjunction of circumstances,’’ the meaning is 'conjunction of circumstances'; the intention is to obtain a suitable time and a conjunction of conditions, therefore it should be understood as a conjunction of conditions. In phrases like ‘‘Indeed, bhikkhus, there is only one moment, one opportunity for living the holy life,’’ the meaning is 'moment', that is, 'opportunity'. The arising of a Tathāgata, and so on, is indeed an opportunity for the path and the holy life, because it is the cause for the attainment of those conditions; a moment is indeed an opportunity, that which is called a moment and an opportunity, that is one. In phrases like ‘‘the hot season, the sweltering season,’’ the meaning is 'time'. In phrases like ‘‘the great assembly in the forest,’’ the meaning is 'collection'. The meaning of Mahāsamaya is indeed a great gathering of bhikkhus and devas. In phrases like ‘‘Indeed, Bhaddāli, your opportunity was not penetrated; the Blessed One dwells in Sāvatthī; the Blessed One will know me: ‘The bhikkhu named Bhaddāli is not one who fulfills the training in the Teacher’s Dispensation.’ Indeed, Bhaddāli, this opportunity of yours was not penetrated,’’ the meaning is 'cause'. The cause of the training rule is intended here as samaya. In phrases like ‘‘At that time, the wanderer Uggāhamāna, the son of Samaṇamuṇḍikā, was dwelling in the Mallikā’s park at Tindukācīra, in a single hall where doctrines were expounded,’’ the meaning is 'view'. There, the sectarians, sitting there, expound their respective views, which are called samaya, and so that wanderers’ park is called ‘‘Samayappavādaka’’.
Ví dụ, trong các câu như “Có lẽ ngày mai chúng ta sẽ đến, tùy theo thời gian và sự hội tụ của các duyên” (Dī. Ni. 1.447), nghĩa là sự hội tụ (samavāya), ý muốn nói là đạt được thời điểm thích hợp và sự đầy đủ của các duyên; do đó, nên hiểu là sự hội tụ của các duyên (paccayasamavāya).
‘‘Ekova kho, bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo, okāsoti attho.
In phrases like ‘‘Indeed, bhikkhus, there is only one moment, one opportunity for living the holy life,’’ the meaning is 'moment', that is, 'opportunity'.
Trong các câu như “Này các tỳ khưu, chỉ có một khoảnh khắc, một thời điểm để sống đời Phạm hạnh” (A. Ni. 8.29), nghĩa là khoảnh khắc (khaṇa), tức là cơ hội.
Tathāgatuppādādiko hi maggabrahmacariyassa okāso tappaccayappaṭilābhahetuttā, khaṇo eva ca samayo, yo khaṇoti ca samayoti ca vuccati, so eko yevāti hi attho.
The arising of a Tathāgata, and so on, is indeed an opportunity for the path and the holy life, because it is the cause for the attainment of those conditions; a moment is indeed an opportunity, that which is called a moment and an opportunity, that is one. This is the intended meaning.
Thật vậy, sự xuất hiện của Đức Như Lai là cơ hội cho đời sống Phạm hạnh của con đường (đạo lộ), vì nó là nguyên nhân để đạt được các duyên đó. Khoảnh khắc đó chính là thời điểm (samaya), điều được gọi là khoảnh khắc và thời điểm, chỉ là một. Ý nghĩa là như vậy.
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
In phrases like ‘‘the hot season, the sweltering season,’’ the meaning is 'time'.
Trong các câu như “thời tiết nóng bức, thời tiết oi ả” (Pāci. 358), nghĩa là thời gian (kāla).
‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho.
In phrases like ‘‘the great assembly in the forest,’’ the meaning is 'collection'.
Trong các câu như “đại hội trong rừng” (Dī. Ni. 2.332), nghĩa là sự tập hợp (samūha).
Mahāsamayoti hi bhikkhūnaṃ devatānañca mahāsannipātoti attho.
The meaning of Mahāsamaya is indeed a great gathering of bhikkhus and devas.
Thật vậy, đại hội (mahāsamaya) có nghĩa là sự tập hợp lớn của các tỳ khưu và chư thiên.
‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati ‘bhaddāli nāma bhikkhu satthusāsane sikkhāya na paripūrakārī’ti, ayampi kho te, bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
In phrases like ‘‘Indeed, Bhaddāli, your opportunity was not penetrated; the Blessed One dwells in Sāvatthī; the Blessed One will know me: ‘The bhikkhu named Bhaddāli is not one who fulfills the training in the Teacher’s Dispensation.’ Indeed, Bhaddāli, this opportunity of yours was not penetrated,’’ the meaning is 'cause'.
Trong các câu như “Này Bhaddāli, nguyên nhân (samaya) đó ông đã không thâm nhập. Đức Thế Tôn đang trú tại Sāvatthī. Đức Thế Tôn sẽ biết về tôi rằng ‘Tỳ khưu tên Bhaddāli không hoàn thành việc học trong Giáo Pháp của Bậc Đạo Sư’. Này Bhaddāli, nguyên nhân (samaya) này ông cũng đã không thâm nhập” (Ma. Ni. 2.135), nghĩa là nguyên nhân (hetu).
Sikkhāpadassa kāraṇañhi idha samayoti adhippetaṃ.
The cause of the training rule is intended here as samaya.
Ở đây, nguyên nhân của giới luật được hiểu là samaya.
‘‘Tena kho pana samayena uggāhamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
In phrases like ‘‘At that time, the wanderer Uggāhamāna, the son of Samaṇamuṇḍikā, was dwelling in the Mallikā’s park at Tindukācīra, in a single hall where doctrines were expounded,’’ the meaning is 'view'.
Trong các câu như “Vào thời điểm đó, du sĩ Uggāhamāna, con trai của Samaṇamuṇḍikā, đang trú tại khu vườn Mallikā, trong một hội trường duy nhất tại Tindukācīra, nơi các học thuyết (samayappavādaka) được trình bày” (Ma. Ni. 2.260), nghĩa là tà kiến (diṭṭhi).
Tattha hi nisinnā titthiyā attano attano diṭṭhisaṅkhātaṃ samayaṃ pavadantīti so paribbājakārāmo ‘‘samayappavādako’’ti vuccati.
There, the sectarians, sitting there, expound their respective views, which are called samaya, and so that wanderers’ park is called ‘‘Samayappavādaka’’.
Thật vậy, ở đó, các ngoại đạo ngồi và trình bày các học thuyết (samaya) được gọi là diṭṭhi của riêng họ; vì vậy, khu vườn của các du sĩ đó được gọi là “samayappavādaka” (nơi trình bày các học thuyết).
Ādīsu paṭilābho.
In phrases like these, the meaning is 'attainment'.
Trong các câu trên, nghĩa là sự thành tựu (paṭilābha).
Atthābhisamayāti hi atthassa adhigamāti attho.
Atthābhisamayāti means the attainment of benefit.
Thật vậy, Atthābhisamayā có nghĩa là sự đạt được ý nghĩa.
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (ma. ni. 1.28) pahānaṃ.
In phrases like ‘‘By fully comprehending conceit, one has made an end of suffering,’’ it means abandoning.
Trong các câu như “Do đoạn trừ kiêu mạn một cách đúng đắn, đã chấm dứt khổ đau” (Ma. Ni. 1.28), nghĩa là sự đoạn trừ (pahāna).
Adhikaraṇaṃ samayaṃ vūpasamanaṃ apagamoti abhisamayo pahānaṃ.
Abhisamaya is cessation, appeasement, and departure; it is abandonment.
Sự đoạn trừ (pahāna) là sự giải quyết (adhikaraṇaṃ), sự chấm dứt (samayaṃ), sự làm dịu (vūpasamanaṃ), sự biến mất (apagamo), đó là abhisamaya.
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. ma. 2.8) paṭivedho.
In phrases like ‘‘The meaning of suffering is to be afflicted, to be conditioned, to be tormented, to be subject to change, to be comprehended,’’ it is penetration.
Trong các câu như “Dukkha có nghĩa là sự áp bức, sự hữu vi, sự thiêu đốt, sự biến đổi, sự thâm nhập” (Paṭi. Ma. 2.8), nghĩa là sự thâm nhập (paṭivedha).
Paṭivedhoti hi abhisametabbato abhisamayo, abhisamayova attho abhisamayaṭṭhoti pīḷanādīni abhisametabbabhāvena ekībhāvaṃ upanetvā vuttāni, abhisamayassa vā paṭivedhassa visayabhūto attho abhisamayaṭṭhoti tāneva tathā ekantena vuttāni.
Indeed, penetration is abhisamaya because it is to be thoroughly understood. The meaning of abhisamaya, or rather, abhisamayaṭṭha, is stated by bringing affliction and so on into unity as aspects to be thoroughly understood. Or, abhisamayaṭṭha is the meaning that is the object of abhisamaya or paṭivedha, and thus these very things are stated decisively.
Thật vậy, Paṭivedha là abhisamaya vì nó cần được thâm nhập. Abhisamaya có nghĩa là abhisamayaṭṭha. Sự áp bức, v.v., được nói đến bằng cách đưa chúng vào sự đồng nhất với trạng thái cần được thâm nhập. Hoặc, abhisamayaṭṭha là ý nghĩa là đối tượng của abhisamaya, tức là sự thâm nhập; do đó, chúng được nói đến một cách tuyệt đối như vậy.
Tattha pīḷanaṃ dukkhasaccassa taṃsamaṅgino hiṃsanaṃ avipphārikatākaraṇaṃ.
Therein, affliction for the Noble Truth of suffering is the tormenting of one who possesses it, making it unexpansible.
Trong đó, sự áp bức (pīḷanaṃ) là sự làm hại, sự không cho lan rộng của dukkha-sacca (Khổ Đế) đối với người có nó.
Santāpo dukkhadukkhatādivasena santappanaṃ paridahanaṃ.
Torment is the burning and consuming in the sense of suffering-as-suffering and so on.
Santāpa là sự thiêu đốt, sự nung nấu theo nghĩa khổ khổ (dukkha-dukkhata) v.v.
Ettha ca sahakārīkāraṇasannijjhaṃ sameti samavetīti samavāyo samayo.
Here, samaya means convergence, because it brings about the harmonious coming together of co-operative causes.
Ở đây, samavāya (sự hội tụ) là samaya vì nó hội tụ, tụ họp (sameti samaveti) các nguyên nhân hỗ trợ.
Sameti samāgacchati ettha maggabrahmacariyaṃ tadādhārapuggalehīti khaṇo samayo.
Samaya means moment, because at this moment the noble practice of the path comes together through the individuals who are its foundation.
Khaṇa (khoảnh khắc) là samaya vì đời sống Phạm hạnh của con đường (maggabrahmacariyaṃ) hội tụ, đến (sameti samāgacchati) ở đây với những người là nền tảng của nó.
Sameti ettha etena vā saṃgacchati satto sabhāvadhammo vā uppādādīhi sahajātādīhi vāti kālo samayo.
Samaya means time, because at this time or by this time, a being or a natural phenomenon comes into being through origination, co-arising, and so on.
Kāla (thời gian) là samaya vì chúng sanh hoặc pháp tự tánh hội tụ, tương ứng (sameti saṃgacchati) ở đây hoặc bởi thời gian này với sự sinh khởi, v.v., hoặc với sự đồng sinh, v.v.
Dhammappavattimattatāya atthato abhūtopi hi kālo dhammappavattiyā adhikaraṇaṃ karaṇaṃ viya ca kappanāmattasiddhenānurūpena voharīyatīti.
Indeed, time, though unreal in ultimate truth as merely the occurrence of phenomena, is conventionally spoken of as an appropriate basis or instrument for the occurrence of phenomena, merely by conceptualization.
Mặc dù thời gian không thực sự tồn tại theo nghĩa của sự vận hành của các pháp, nhưng nó được gọi theo một cách thích hợp, được tạo ra bởi sự giả định, như thể nó là một nền tảng hoặc một công cụ cho sự vận hành của các pháp.
Samaṃ, saha vā avayavānaṃ ayanaṃ pavatti avaṭṭhānanti samūho samayo yathā samudāyoti.
Samaya means collection, as in samudaya, because it is the equal or combined coming together, the occurrence, the establishment of parts.
Samūha (sự tập hợp) là samaya, giống như samudāya (tập hợp), vì nó là sự vận hành (ayanaṃ pavatti) hay sự tồn tại (avaṭṭhānaṃ) của các bộ phận một cách hài hòa (samaṃ) hoặc cùng nhau (saha).
Avayavasahāvaṭṭhānameva hi samūho.
Indeed, a collection is nothing but the concurrent establishment of its parts.
Thật vậy, samūha là sự tồn tại cùng nhau của các bộ phận.
Avasesapaccayānaṃ samāgame sati eti phalametasmā uppajjati pavattatīti samayo hetu yathā samudayoti.
Samaya means cause, as in samudaya, because when there is a coming together of other conditions, the result proceeds from it, arises, and occurs.
Hetu (nguyên nhân) là samaya, giống như samudaya (nguyên nhân), vì khi các duyên còn lại hội tụ (samāgame sati), kết quả sinh khởi, vận hành từ đó (eti phalametasmā uppajjati pavattati).
Sameti saṃyojanabhāvato sambandho eti attano visaye pavattati, daḷhaggahaṇabhāvato vā saṃyuttā ayanti pavattanti sattā yathābhinivesaṃ etenāti samayo diṭṭhi.
Samaya means wrong view, because it connects as a fetter and proceeds within its own domain, or because beings, bound by firm grasping, proceed according to their inclination through it.
Diṭṭhi (tà kiến) là samaya, vì nó là sự ràng buộc (saṃyojanabhāvato sambandho) và vận hành trong lãnh vực của nó (eti attano visaye pavattati), hoặc vì chúng sanh bị ràng buộc (saṃyuttā ayanti pavattanti sattā) và vận hành theo sự chấp trước của họ bởi nó (etenāti) do sự nắm giữ vững chắc (daḷhaggahaṇabhāvato).
Diṭṭhisaṃyojanena hi sattā ativiya bajjhantīti.
Indeed, beings are excessively bound by the fetter of wrong view.
Thật vậy, chúng sanh bị trói buộc rất chặt bởi sự ràng buộc của tà kiến.
Samiti saṅgati samodhānanti samayo paṭilābho.
Samaya means acquisition, because it is conjunction and aggregation.
Paṭilābha (sự thành tựu) là samaya vì nó là sự đạt được (samiti saṅgati), sự hội tụ (samodhānaṃ).
Samayanaṃ upasamayanaṃ apagamoti samayo pahānaṃ.
Samaya means abandonment, because it is appeasement, calming, and departure.
Pahāna (sự đoạn trừ) là samaya vì nó là sự làm dịu (samayanaṃ upasamayanaṃ), sự biến mất (apagamo).
Samucchedappahānabhāvato pana adhiko samayoti abhisamayo yathā abhidhammoti.
However, because it is abandonment by cutting off, it is a superior samaya, thus abhisamaya, just as in abhidhamma.
Tuy nhiên, abhisamaya là samaya vượt trội hơn (adhiko samayo) vì nó là sự đoạn trừ tận gốc (samucchedappahānabhāvato), giống như Abhidhamma.
Abhimukhaṃ ñāṇena sammā etabbo abhisametabboti abhisamayo, dhammānaṃ aviparītasabhāvo.
Abhisamaya is that which is to be thoroughly understood, to be truly attained by knowledge directly, meaning the unperverted nature of phenomena.
Abhisamaya là sự thật không sai lệch của các pháp, vì nó phải được nhận thức (etabbo abhisametabbo) một cách đúng đắn bằng trí tuệ (ñāṇena sammā) đối diện (abhimukhaṃ).
Abhimukhabhāvena sammā eti gacchati bujjhatīti abhisamayo, dhammānaṃ yathābhūtasabhāvāvabodho.
Abhisamaya is that which truly comprehends, understands by knowledge in a direct manner, meaning the comprehension of the true nature of phenomena.
Abhisamaya là sự thấu hiểu bản chất thực sự của các pháp, vì nó đi đến (eti gacchati), hiểu biết (bujjhati) một cách đúng đắn (sammā) bằng cách đối diện (abhimukhabhāvena).
Evaṃ tasmiṃ tasmiṃ atthe samayasaddassa pavatti veditabbā.
Thus, the various applications of the word ‘samaya’ in these different meanings should be understood.
Như vậy, sự vận dụng của từ samaya trong từng ý nghĩa đó cần được hiểu.
Samayasaddassa atthuddhāre abhisamayasaddassa gahaṇe kāraṇaṃ vuttanayeneva veditabbaṃ.
The reason for including the word ‘abhisamaya’ in the explanation of the meaning of ‘samaya’ should be understood in the manner already stated.
Lý do để dùng từ abhisamaya khi giải thích ý nghĩa của từ samaya cần được hiểu theo cách đã nói.
Idha panassa kālo attho samavāyādīnaṃ asambhavato.
But here, its meaning is time, because co-existence and the like are not possible.
Tuy nhiên, ở đây, nghĩa của nó là thời gian (kāla) vì các nghĩa như sự hội tụ (samavāya) không thể xảy ra.
Desadesakaparisā viya hi desanāya nidānabhāve kālo eva icchitabboti.
For here, it is desired that the meaning be time, due to the sermon serving as an introduction, just like a local audience.
Thật vậy, thời gian là điều mong muốn như là khởi điểm của bài giảng, giống như hội chúng của người thuyết giảng.
Yasmā panettha samayoti kālo adhippeto, tasmā saṃvaccharautumāsaddhamāsarattidivasapubbaṇhamajjhanhikasāyanhapaṭhamayāma- majjhimayāmapacchimayāmamuhuttādīsu kālabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
Since ‘samaya’ here is intended to mean time, it indicates one time among the various divisions of time, such as years, seasons, months, fortnights, nights, days, forenoons, noons, afternoons, first watches, middle watches, last watches, and muhuttas.
Vì ở đây, samaya được hiểu là thời gian, nên nó chỉ ra một thời điểm (ekaṃ samayaṃ) trong số các loại thời gian khác nhau như năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, giữa trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v.
Kasmā panettha aniyamitavaseneva kālo niddiṭṭho, na utusaṃvaccharādivasena niyametvā niddiṭṭhoti ce?
If it is asked why time is indicated here in an unspecified manner, and not specified in terms of seasons, years, and so on?
Nếu hỏi tại sao ở đây thời gian được chỉ định một cách không xác định, mà không xác định rõ ràng theo mùa, năm, v.v.?
Kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yasmiṃ yasmiṃ saṃvacchare utumhi māse pakkhe rattibhāge divasabhāge vā vuttaṃ, sabbampi taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Although the Elder knew and had thoroughly established through wisdom all the suttas—which sutta was uttered in which year, season, month, fortnight, night part, or day part among these times like years and so on—
Mặc dù tất cả các bài kinh được thuyết giảng vào năm nào, mùa nào, tháng nào, nửa tháng nào, phần đêm nào hay phần ngày nào trong các thời điểm như năm, v.v., đều được vị Trưởng lão biết rõ và sắp xếp rõ ràng bằng trí tuệ.
Yasmā pana ‘‘evaṃ me sutaṃ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vā’’ti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
yet, if it were stated as ‘‘Thus have I heard, in such and such a year, in such and such a season, in such and such a month, in such and such a fortnight, in such and such a night part, or in such and such a day part,’’ it would not be easy to remember, recite, or cause to be recited, and much would have to be said; therefore, combining that meaning into a single word, it is said, ‘‘Ekaṃ samayaṃ’’ (at one time).
Tuy nhiên, vì nếu nói rằng: “Tôi đã nghe điều này vào năm này, mùa này, tháng này, tuần trăng này, phần đêm này, hoặc phần ngày này,” thì không thể dễ dàng ghi nhớ, hoặc giảng dạy, hoặc khiến người khác giảng dạy, và sẽ có nhiều điều phải nói; do đó, sau khi gom ý nghĩa đó vào một từ duy nhất, Ngài đã nói: “Một thời” (ekaṃ samayaṃ).
Ye vā ime gabbhokkantisamayo jātisamayo saṃvegasamayo abhinikkhamanasamayo dukkarakārikasamayo māravijayasamayo abhisambodhisamayo diṭṭhadhammasukhavihārasamayo desanāsamayo parinibbānasamayoti evamādayo bhagavato devamanussesu ativiya pakāsā anekakālappabhedā eva samayā, tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Or, among the many divisions of time that were extremely prominent for the Blessed One among gods and humans—such as the time of conception, the time of birth, the time of profound emotion, the time of renunciation, the time of arduous practice, the time of Māra’s defeat, the time of full enlightenment, the time of dwelling in the bliss of this very life, the time of teaching, and the time of parinibbāna—it indicates one time, that is, the time of teaching.
Hoặc, trong số những thời điểm như thời điểm nhập thai, thời điểm đản sinh, thời điểm khởi phát sự giác ngộ (saṃvega), thời điểm xuất gia, thời điểm thực hành khổ hạnh, thời điểm chiến thắng Ma vương, thời điểm chứng đắc Chánh Đẳng Giác, thời điểm an trú trong lạc trú hiện tại, thời điểm thuyết pháp, thời điểm nhập Niết Bàn Vô Dư, v.v., những thời điểm nổi bật đặc biệt của Đức Thế Tôn đối với chư thiên và loài người, là những phân loại thời gian đa dạng, Ngài chỉ ra rằng “một thời” là thời điểm thuyết pháp.
Yo vāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahitappaṭipattisamayesu parahitappaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammakathāsamayo, desanāpaṭipattisamayesu desanāsamayo, tesu samayesu aññatarasamayaṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
Or, regarding the time of the task of compassion among the times of the tasks of knowledge and compassion; regarding the time of practice for others’ welfare among the times of practice for one’s own welfare and others’ welfare; regarding the time of Dhamma talk among the times of two duties for those assembled; regarding the time of teaching among the times of teaching and practice—referring to one of these times, it is said, ‘‘Ekaṃ samayaṃ’’ (at one time).
Hoặc, trong số các thời điểm thực hiện trí tuệ và lòng bi mẫn, đó là thời điểm thực hiện lòng bi mẫn; trong số các thời điểm thực hành lợi ích cho bản thân và lợi ích cho người khác, đó là thời điểm thực hành lợi ích cho người khác; trong số hai thời điểm cần thiết cho những người đã tụ hội, đó là thời điểm thuyết pháp; trong số các thời điểm thuyết pháp và thực hành, đó là thời điểm thuyết pháp. Ngài nói “một thời” để chỉ một trong những thời điểm đó.
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hotī’’ti (dha. sa. 1) ca ito aññesu suttapadesu ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehi vivicca akusalehi dhammehī’’ti (a. ni. 4.200) ca bhummavacanena niddeso kato, vinaye ca ‘‘tena samayena buddho bhagavā’’ti (pārā. 1) karaṇavacanena niddeso kato, tathā akatvā ‘‘ekaṃ samaya’’nti accantasaṃyogatthe upayogavacanena niddeso katoti?
Why is it that here, in contrast to the Abhidhamma where it is stated in the locative case, ‘‘At which time a kāmāvacara wholesome consciousness arises’’ and in other suttas, ‘‘At which time, monks, a bhikkhu is detached from sensual pleasures, detached from unwholesome states,’’ and in the Vinaya where it is stated in the instrumental case, ‘‘At that time the Buddha, the Blessed One,’’ it is not done likewise, but rather stated in the accusative case, ‘‘ekaṃ samayaṃ,’’ indicating unbroken connection?
Tại sao ở đây, không giống như trong Abhidhamma, nơi có sự trình bày bằng cách sử dụng cách thức định vị (bhumma-vacana) như “Vào thời điểm nào, một tâm thiện dục giới sinh khởi?” và trong các đoạn kinh khác như “Này các Tỳ-khưu, vào thời điểm nào, một Tỳ-khưu hoàn toàn ly dục, ly ác pháp?”, và trong Luật tạng, nơi có sự trình bày bằng cách sử dụng cách thức công cụ (karaṇa-vacana) như “Vào thời điểm đó, Đức Phật, Thế Tôn,” mà lại trình bày bằng cách sử dụng cách thức đối cách (upayoga-vacana) “một thời” (ekaṃ samayaṃ) với ý nghĩa liên tục tuyệt đối?
Tattha tathā, idha ca aññathā atthasambhavato.
Because the meaning is possible in that way there, and in a different way here.
Ở đó là như vậy, còn ở đây là khác, vì ý nghĩa có thể xảy ra khác nhau.
Tattha hi abhidhamme ito aññesu ca suttantesu ādhāravisayasaṅkhāto adhikaraṇattho kiriyāya kiriyantaralakkhaṇasaṅkhāto bhāvenabhāvalakkhaṇattho ca sambhavatīti.
For in the Abhidhamma and other suttas, the locative meaning, which refers to the basis or sphere, and the meaning of indicating one action by another action (bhāvena bhāvalakkhaṇa), are possible.
Trong Abhidhamma và các kinh điển khác, ý nghĩa vị trí (adhikaraṇa-attha) dưới dạng đối tượng nền tảng và ý nghĩa biểu thị sự kiện (bhāvenabhāvalakkhaṇa-attha) dưới dạng sự kiện này biểu thị sự kiện khác đều có thể xảy ra.
Adhikaraṇañhi kālattho samūhattho ca samayo tattha vuttānaṃ phassādidhammānaṃ, tathā kālo sabhāvadhammappavattimattatāya paramatthato avijjamānopi ādhārabhāvena paññāto taṅkhaṇappavattānaṃ tato pubbe parato ca abhāvato yathā ‘‘pubbaṇhe jāto sāyanhe jāto’’tiādīsu.
For samaya, in the sense of time and in the sense of collection, is the basis of the phenomena like contact mentioned there. Similarly, time, though not ultimately existing as merely the occurrence of natural phenomena, is designated as a basis for phenomena occurring at that very moment, as they do not exist before or after that moment, just as in phrases like ‘‘born in the forenoon, born in the afternoon.’’
Thời gian (kāla) và tập hợp (samūha) là đối tượng nền tảng (adhikaraṇa) cho các pháp xúc (phassa) v.v. được đề cập ở đó. Tương tự, thời gian, mặc dù không tồn tại trên thực tế như một bản chất tự thân của các pháp, nhưng được nhận thức như một nền tảng cho sự tồn tại của các pháp trong khoảnh khắc đó, vì chúng không tồn tại trước hoặc sau khoảnh khắc đó, như trong các câu “sinh vào buổi sáng, sinh vào buổi tối,” v.v.
Samūhotipi avayavavinimutto paramatthato avijjamānopi kappanāmattasiddhena rūpena avayavānaṃ ādhārabhāvena paññāpīyati, yathā ‘‘rukkhe sākhā, yavo yavarāsimhi samuṭṭhito’’tiādīsu.
A collection, too, though not ultimately existing apart from its parts, is designated as a basis for the parts through a form that is established merely by conceptualization, just as in phrases like ‘‘branches on a tree,’’ ‘‘barley sprung from a heap of barley.’’
Tập hợp, mặc dù không tồn tại trên thực tế tách rời khỏi các thành phần, nhưng được nhận thức như một nền tảng cho các thành phần thông qua một hình thức chỉ tồn tại trong khái niệm, như trong các câu “cành cây trên cây, lúa mạch mọc từ đống lúa mạch,” v.v.
Yasmiṃ kāle dhammapuñje ca kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃyeva kāle dhammapuñje ca phassādayopi hontīti ayañhi tattha attho.
For the meaning here is that at the time and in the collection of phenomena when a kāmāvacara wholesome consciousness arises, at that very time and in that very collection of phenomena, contact and other states also exist.
Vì vậy, ý nghĩa ở đây là: vào thời điểm và trong tập hợp các pháp mà một tâm thiện dục giới sinh khởi, thì các pháp xúc v.v. cũng tồn tại vào chính thời điểm và trong chính tập hợp các pháp đó.
Tathā khaṇasamavāyahetusaṅkhātassa samayassa bhāvena tattha vuttānaṃ phassādidhammānaṃ bhāvo lakkhīyati.
Similarly, the existence of phenomena like contact mentioned there is indicated by the existence of samaya as a moment, conjunction (samavāya), and cause.
Tương tự, sự tồn tại của các pháp xúc v.v. được đề cập ở đó được biểu thị bằng sự tồn tại của thời điểm (samaya) dưới dạng khoảnh khắc, sự kết hợp (samavāya) và nguyên nhân (hetu).
Yathā hi ‘‘gāvīsu duyhamānāsu gato, duddhāsu āgato’’ti ettha gāvīnaṃ dohanakiriyāya gamanakiriyā lakkhīyati, evaṃ idhāpi yasmiṃ samayeti vutte ca padatthassa sattāvirahābhāvato satīti ayamattho viññāyamāno eva hotīti samayassa sattākiriyāya cittassa uppādakiriyā phassādīnaṃ bhavanakiriyā ca lakkhīyati.
Just as in the example, ‘‘He went while the cows were being milked; he came when they had been milked,’’ the act of going is indicated by the act of milking the cows, so too here, when ‘‘yasmiṃ samaye’’ is said, and since there is no absence of the existence of the meaning of the word, this meaning, ‘‘sati’’ (being present), is indeed understood. Thus, the arising of consciousness and the occurrence of contact (phassa) and so forth are indicated by the existence of the occasion (samaya).
Giống như trong câu “đi khi bò đang vắt sữa, đến khi bò đã vắt sữa,” hành động đi được biểu thị bằng hành động vắt sữa của bò, thì ở đây cũng vậy, khi nói “vào thời điểm nào” (yasmiṃ samaye), ý nghĩa rằng “có” (sati) là hiển nhiên, vì không có sự vắng mặt của thực thể của từ đó. Do đó, hành động sinh khởi của tâm và hành động tồn tại của xúc v.v. được biểu thị bằng hành động tồn tại của thời điểm.
Tathā yasmiṃ samaye yasmiṃ navame khaṇe yasmiṃ yonisomanasikārādihetumhi paccayasamavāye vā sati kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃ samaye khaṇe hetumhi paccayasamavāye ca phassādayopi hontīti.
Similarly, at whichever occasion, at whichever ninth moment, due to whichever cause such as proper attention (yonisomanasikāra), or when there is a concurrence of conditions, a kāmāvacara wholesome consciousness arises, at that very occasion, moment, cause, and concurrence of conditions, contact (phassa) and so forth also exist.
Tương tự, vào thời điểm nào, vào khoảnh khắc thứ chín nào, khi có nguyên nhân như tác ý đúng đắn (yonisomanasikāra) hoặc sự kết hợp các duyên nào, một tâm thiện dục giới sinh khởi, thì các pháp xúc v.v. cũng tồn tại vào chính thời điểm, khoảnh khắc, nguyên nhân và sự kết hợp các duyên đó.
Tasmā tadatthajotanatthaṃ bhummavacanena niddeso kato.
Therefore, to illuminate that meaning, the designation is made with the locative case.
Do đó, để làm rõ ý nghĩa đó, sự trình bày được thực hiện bằng cách thức định vị.
Vinaye ca ‘‘annena vasati, ajjhenena vasatī’’tiādīsu viya hetuattho, ‘‘pharasunā chindati, kudālena khaṇatī’’tiādīsu viya karaṇattho ca sambhavati.
In the Vinaya, the meaning of cause, as in ‘‘He dwells by food, he dwells by study,’’ and the meaning of instrument, as in ‘‘He cuts with an axe, he digs with a spade,’’ are both possible.
Trong Luật tạng, ý nghĩa nguyên nhân (hetu-attha) có thể xảy ra, như trong “sống nhờ thức ăn, sống nhờ sự học hỏi,” v.v., và ý nghĩa công cụ (karaṇa-attha) có thể xảy ra, như trong “chặt bằng rìu, đào bằng cuốc,” v.v.
Yo hi sikkhāpadapaññattisamayo dhammasenāpatiādīhipi dubbiññeyyo, tena samayena karaṇabhūtena hetubhūtena ca vītikkamaṃ sutvā bhikkhusaṅghaṃ sannipātāpetvā otiṇṇavatthukaṃ puggalaṃ paṭipucchitvā vigarahitvā ca taṃ taṃ vatthuṃ otiṇṇasamayasaṅkhātaṃ kālaṃ anatikkamitvā sikkhāpadāni paññāpento tatiyapārājikādīnaṃ viya sikkhāpadapaññattiyā hetuṃ apekkhamāno tattha tattha vihāsi, tasmā tadatthajotanatthaṃ vinaye karaṇavacanena niddeso kato.
Indeed, the occasion of the promulgation of a training rule (sikkhāpada) was difficult to understand even for the Dhamma-Commander (Dhammasenāpati) and others. At that time, acting as both instrument and cause, having heard of a transgression, having convened the Saṅgha of bhikkhus, having questioned the individual who had committed the offense, and having rebuked him, the Blessed One, without exceeding the time designated as the occasion of the offense, promulgated the training rules, looking to the cause for the promulgation of the training rules, as in the case of the third pārājika and so forth, and thus resided there. Therefore, to illuminate that meaning, the designation in the Vinaya is made with the instrumental case.
Thật vậy, thời điểm chế định giới luật, dù khó hiểu ngay cả đối với các vị như Pháp Tướng Quân (Dhammasenāpati), vào thời điểm đó, Đức Thế Tôn đã nghe về sự vi phạm, triệu tập Tăng đoàn, hỏi lại người đã phạm giới, quở trách họ, và không bỏ qua thời điểm phạm giới đó, Ngài đã chế định các giới luật, mong muốn nguyên nhân chế định giới luật như đối với các giới Pārājika thứ ba, v.v., và Ngài đã an trú ở đó. Do đó, để làm rõ ý nghĩa đó, trong Luật tạng, sự trình bày được thực hiện bằng cách thức công cụ.
Tattha seṭṭhavācakavacanaṃ seṭṭhanti vuttaṃ seṭṭhaguṇasahacaraṇato.
There, ‘‘seṭṭhaṃ’’ (supreme) is said to be a word denoting supremacy because it is associated with supreme qualities.
Ở đây, “seṭṭhaṃ” (tối thượng) được nói là “seṭṭha-vācaka-vacanaṃ” (từ chỉ sự tối thượng) vì nó đi kèm với các phẩm chất tối thượng.
Atha vā vuccatīti vacanaṃ, attho.
Alternatively, that which is spoken (vuccati) is a word (vacanaṃ), meaning a concept.
Hoặc, “vuccati” (được nói) là “vacanaṃ” (lời nói), tức là ý nghĩa.
Bhagavāti vacanaṃ seṭṭhanti bhagavāti iminā vacanena vacanīyo yo attho, so seṭṭhoti attho.
‘‘Bhagavāti vacanaṃ seṭṭhaṃ’’ means that the meaning denoted by this word Bhagavā is supreme.
Bhagavāti vacanaṃ seṭṭhaṃ (Lời Bhagavā là tối thượng) có nghĩa là ý nghĩa được chỉ ra bởi từ Bhagavā là tối thượng.
Bhagavāti vacanamuttamanti etthāpi vuttanayeneva attho veditabbo.
The meaning of ‘‘Bhagavāti vacanamuttamaṃ’’ should also be understood in the same way as explained.
Ở đây, ý nghĩa của Bhagavāti vacanamuttamaṃ (Lời Bhagavā là cao quý nhất) cũng phải được hiểu theo cách đã nói.
Gāravayuttoti garubhāvayutto garuguṇayogato visesagarukaraṇārahatāya vā gāravayutto.
Gāravayutto means endowed with reverence, due to being endowed with qualities worthy of respect, or due to being worthy of special veneration.
Gāravayutto (đầy lòng tôn kính) có nghĩa là đầy phẩm chất đáng kính do sự kết hợp của các phẩm chất đáng kính, hoặc đầy lòng tôn kính vì xứng đáng được tôn kính đặc biệt.
Evaṃ guṇavisiṭṭhasattuttamagarugāravādhivacanaṃ bhagavāti idaṃ vacananti veditabbaṃ.
Thus, the word Bhagavā is to be understood as a designation for one who is preeminent among beings in virtues, worthy of respect, and endowed with reverence.
Do đó, phải hiểu rằng từ Bhagavā này là một danh hiệu chỉ một chúng sinh có phẩm chất siêu việt, tối thượng, đáng kính và đầy lòng tôn kính.
Apica –
Furthermore:
Hơn nữa,
Apica bhāge vani, bhage vā vamīti bhagavā.
Furthermore, he who cultivated (vani) excellences (bhage), or he who vomited forth (vamī) excellences (bhage), is Bhagavā.
Hơn nữa, Bhagavā là người đã thực hành các phước đức (bhāge vani) hoặc đã từ bỏ các phước đức (bhage vā vamī).
Tathāgato hi dānasīlādipāramidhamme jhānavimokkhādiuttarimanussadhamme vani bhaji sevi bahulamakāsi, tasmā bhagavā.
Indeed, the Tathāgata practiced and cultivated the pāramī qualities such as generosity and morality, and the supramundane qualities (uttarimanussadhamma) such as jhāna and vimokkha, doing so extensively. Therefore, he is Bhagavā.
Thật vậy, Đức Như Lai đã thực hành, đã tu dưỡng, đã thực hiện nhiều lần các pháp Ba-la-mật như bố thí, trì giới, v.v., và các pháp siêu nhân (uttarimanussadhamma) như thiền định, giải thoát, v.v. Do đó, Ngài là Bhagavā.
Atha vā teyeva ‘‘veneyyasattasantānesu kathaṃ nu kho uppajjeyyu’’nti vani abhipatthayīti bhagavā.
Or else, he desired (abhīpatthayī) that these very qualities should arise in the minds of beings capable of being trained (veneyyasatta). Thus, he is Bhagavā.
Hoặc, Ngài là Bhagavā vì Ngài đã mong muốn rằng những pháp đó sẽ sinh khởi trong tâm của các chúng sinh cần được giáo hóa (veneyyasattasantāna).
Atha vā bhagasaṅkhātaṃ issariyaṃ yasañca vami uggiri kheḷapiṇḍaṃ viya anapekkho chaḍḍayīti bhagavā.
Or else, he vomited forth (vamī uggiri) sovereignty (issariya) and fame (yasa), which are called bhaga, abandoning them without attachment, like a lump of spittle. Thus, he is Bhagavā.
Hoặc, Ngài là Bhagavā vì Ngài đã từ bỏ quyền uy (issariya) và danh tiếng (yasa) được gọi là phước đức (bhaga), như nhổ bỏ một cục đờm mà không chút tiếc nuối.
Tathā hi tathāgato hatthagataṃ cakkavattisiriṃ devalokādhipaccasadisaṃ cātuddīpissariyaṃ, cakkavattisampattisannissayañca sattaratanasamujjalaṃ yasaṃ tiṇāyapi amaññamāno nirapekkho pahāya abhinikkhamitvā sammāsambodhiṃ abhisambuddho, tasmā ime siriādike bhage vamīti bhagavā.
For instance, the Tathāgata, not considering the glory of a universal monarch (cakkavattisiri) that had come into his hands—sovereignty over the four continents, comparable to dominion in the deva realms, and the fame resplendent with the seven jewels, which is the foundation of a universal monarch's prosperity—as even a blade of grass, abandoned it without attachment, went forth, and attained Perfect Self-Awakening. Therefore, he vomited forth these bhaga such as glory, and thus he is Bhagavā.
Như vậy, Đức Như Lai đã từ bỏ vô tư lự sự vinh quang của Chuyển Luân Vương đã nằm trong tay Ngài, sự thống trị bốn châu lục giống như quyền cai trị cõi trời, cùng với danh tiếng rực rỡ nhờ bảy báu, vốn là nền tảng của sự phú quý Chuyển Luân Vương, coi chúng như cỏ rác, rồi xuất gia và chứng đắc Chánh Đẳng Giác. Do đó, Ngài đã từ bỏ những phúc báu như vinh quang ấy, nên Ngài là Bhagavā (Thế Tôn).
Atha vā bhāni nāma nakkhattāni, tehi samaṃ gacchanti pavattantīti bhagā.
Or else, bhāni are called constellations (nakkhattāni); they proceed (gacchanti) or occur (pavattanti) in conjunction with these. Therefore, they are bhagā.
Hoặc nữa, "Bhāni" là các vì sao (nakkhattāni). Chúng vận hành đồng bộ với nhau, nên gọi là "Bhagā".
Sineruyugandharauttarakuruhimavantādibhājanalokavisesasannissayasobhā kappaṭṭhitibhāvato, tepi bhage vami, tannivāsisattāvāsasamatikkamanato tappaṭibaddhachandarāgappahānena pajahīti.
The splendor of the special receptacle-worlds (bhājanaloka) such as Sineru, Yugandhara, Uttarakuru, and Himavanta, due to their enduring for an eon (kappaṭṭhiti), and these bhaga he also vomited forth; he abandoned them by transcending the abodes of the beings dwelling therein and by relinquishing the desire and lust associated with them.
Núi Sineru, Yugandhara, châu Bắc Cưu Lư, dãy Himalaya và các thế giới vật chất đặc biệt khác có vẻ đẹp dựa trên sự tồn tại lâu dài theo kiếp, Ngài cũng đã từ bỏ những "Bhaga" ấy, vượt qua sự trú ngụ của chúng sinh trong đó và đoạn trừ tham ái chấp trước vào chúng.
Evampi bhage vamīti bhagavāti evamādinā nayena bhagavāti padassa attho veditabbo.
In this way, the meaning of the word Bhagavā, as one who vomited forth bhaga, and so on, should be understood.
Theo cách này, ý nghĩa của từ Bhagavā – tức là Ngài đã từ bỏ các "Bhaga" – cần được hiểu.
Ettāvatā cettha evaṃ me sutanti vacanena yathāsutaṃ dhammaṃ savanavasena bhāsanto bhagavato dhammasarīraṃ paccakkhaṃ karoti, tena ‘‘nayidaṃ atikkantasatthukaṃ pāvacanaṃ, ayaṃ vo satthā’’ti satthu adassanena ukkaṇṭhitaṃ janaṃ samassāseti.
By the statement "Thus have I heard" (Evaṃ me sutaṃ) in this context, the venerable Ānanda, by speaking the Dhamma as he heard it, makes the Dhamma-body of the Bhagavā manifest. Thereby, he reassures those who are distressed by the absence of the Teacher, saying, "This teaching is not without a Teacher who has passed away; this is your Teacher."
Cho đến đây, với lời nói “ Evaṃ me sutaṃ” (Như vầy tôi nghe), Tôn giả Ānanda, người thuyết giảng Pháp như đã nghe, đã làm cho Pháp thân của Đức Thế Tôn hiển hiện. Nhờ đó, Ngài an ủi những người đang buồn rầu vì không thấy Đức Bổn Sư, rằng: “Pháp này không phải là một giáo pháp không có Bổn Sư đã qua đời; đây là Bổn Sư của quý vị”.
Vuttañhetaṃ bhagavatā ‘‘yo kho, ānanda, mayā dhammo ca vinayo ca desito paññatto, so vo mamaccayena satthā’’ti (dī. ni. 2.216; mi. pa. 4.1.1).
For it was said by the Bhagavā: "The Dhamma and Vinaya, Ānanda, that I have taught and laid down, that shall be your Teacher after my passing."
Quả thật, Đức Thế Tôn đã dạy: “Này Ānanda, Pháp và Luật do Ta đã thuyết giảng và chế định, sau khi Ta diệt độ, Pháp và Luật ấy sẽ là Bổn Sư của các con”.
Ekaṃ samayaṃ bhagavāti vacanena tasmiṃ samaye bhagavato avijjamānabhāvaṃ dassento rūpakāyaparinibbānaṃ sādheti, tena ‘‘evaṃvidhassa nāma dhammassa desetā dasabaladharo vajirasaṅghātasamānakāyo sopi bhagavā parinibbuto, kenaññena jīvite āsā janetabbā’’ti jīvitamadamattaṃ janaṃ saṃvejeti, saddhamme cassa ussāhaṃ janeti.
By the statement "At one time the Bhagavā" (Ekaṃ samayaṃ Bhagavā), by showing the Bhagavā's non-existence at that time, he establishes the parinibbāna of the rūpakāya. Thereby, he inspires a sense of urgency in those who are intoxicated by the conceit of life, making them reflect: "Even such a teacher of the Dhamma, endowed with the ten powers, whose body was like a vajira-mass, that Bhagavā too attained parinibbāna; by whom else should hope for life be generated?" And he generates enthusiasm for the Saddhamma in them.
Với lời nói “ Ekaṃ samayaṃ Bhagavā” (Một thời nọ, Đức Thế Tôn), Tôn giả Ānanda đã làm hiển lộ sự diệt độ của sắc thân, cho thấy sự không tồn tại của Đức Thế Tôn vào thời điểm đó. Nhờ đó, Ngài đánh thức những người say đắm vào sự sống, rằng: “Một vị Bổn Sư như vậy, người thuyết giảng Pháp như vậy, người mang mười lực, với thân thể vững chắc như kim cương, Ngài cũng đã nhập Niết Bàn; ai khác có thể hy vọng vào sự sống nữa?” Và Ngài cũng khơi dậy sự tinh tấn trong Chánh Pháp nơi họ.
Evanti ca bhaṇanto desanāsampattiṃ niddisati, vakkhamānassa sakalasuttassa evanti nidassanato.
And by saying "Thus" (Evaṃ), he indicates the perfection of the teaching, because the entire Sutta to be expounded is indicated by "Thus."
Và khi nói “ Evaṃ” (Như vầy), Tôn giả Ānanda chỉ ra sự viên mãn của lời dạy, bởi vì toàn bộ bài kinh sắp được nói đều được chỉ dẫn bằng từ “Evaṃ”.
Me sutanti sāvakasampattiṃ savanasampattiñca niddisati, paṭisambhidāpattena pañcasu ṭhānesu bhagavatā etadagge ṭhapitena dhammabhaṇḍāgārikena sutabhāvadīpanato ‘‘tañca kho mayāva sutaṃ, na anussutikaṃ, na paramparābhata’’nti imassa catthassa dīpanato.
By "I have heard" (Me sutaṃ), he indicates the perfection of the disciple and the perfection of hearing, because it shows that it was heard by the treasurer of the Dhamma, who had attained the paṭisambhidā and was declared by the Bhagavā as foremost in five respects, and because it demonstrates the meaning that "this was heard by me myself, not by hearsay, nor transmitted through a lineage."
Khi nói “ Me sutaṃ” (tôi nghe), Tôn giả Ānanda chỉ ra sự viên mãn của thính chúng và sự viên mãn của việc nghe, bởi vì Tôn giả Ānanda, người đã đạt được Tứ Tuệ Phân Tích (paṭisambhidā) và được Đức Thế Tôn đặt vào vị trí đệ nhất trong năm phương diện, người nắm giữ kho tàng Pháp (Dhammabhaṇḍāgārika), đã xác nhận rằng mình đã nghe Pháp, và để làm rõ ý nghĩa rằng: “Pháp ấy tôi đã tự mình nghe, không phải nghe lại từ người khác, cũng không phải được truyền thừa từ đời này sang đời khác”.
Ekaṃ samayanti kālasampattiṃ niddisati bhagavato uruvelāyaṃ viharaṇasamayabhāvena buddhuppādappaṭimaṇḍitabhāvadīpanato.
The term “at one time” indicates the fulfillment of time, as it reveals the adornment of the time of the Buddha's arising, which was when the Blessed One was dwelling in Uruvelā.
Khi nói “ Ekaṃ samayaṃ” (Một thời nọ), Tôn giả Ānanda chỉ ra sự viên mãn của thời gian, bởi vì nó làm hiển lộ thời gian Đức Thế Tôn trú ngụ tại Uruvelā, được tô điểm bằng sự xuất hiện của một vị Phật.
Buddhuppādaparamā hi kālasampadā.
Indeed, the supreme fulfillment of time is the arising of the Buddha.
Quả thật, sự xuất hiện của một vị Phật là sự viên mãn tối thượng của thời gian.
Bhagavāti desakasampattiṃ niddisati guṇavisiṭṭhasattuttamagarubhāvadīpanato.
The term “the Blessed One” indicates the fulfillment of the teacher, as it reveals his supreme and venerable status among beings, distinguished by virtue.
Khi nói “ Bhagavā” (Đức Thế Tôn), Tôn giả Ānanda chỉ ra sự viên mãn của người thuyết giảng, bởi vì nó làm hiển lộ vị Thầy tối thượng, cao quý nhất trong các chúng sinh, với những phẩm chất siêu việt.
Atīte kira anuppanne buddhe dasasahassatāpasā tasmiṃ padese viharantā ‘‘kāyakammavacīkammāni paresampi pākaṭāni honti, manokammaṃ pana apākaṭaṃ.
It is said that in the past, before the Buddha arose, ten thousand ascetics dwelt in that region, and they made an agreement: ‘‘Bodily and verbal actions are evident to others, but mental actions are not evident.
Xưa kia, khi chưa có Phật xuất hiện, mười ngàn vị đạo sĩ trú ngụ tại nơi đó đã lập lời thề ước rằng: “Hành động thân và hành động lời của người khác thì hiển lộ, nhưng hành động ý thì không hiển lộ.
Tasmā yo micchāvitakkaṃ vitakketi, so attanāva attānaṃ codetvā pattapuṭena vālukaṃ āharitvā imasmiṃ ṭhāne ākiratu, idamassa daṇḍakamma’’nti katikavattaṃ katvā tato paṭṭhāya yo tādisaṃ vitakkaṃ vitakketi, so tattha pattapuṭena vālukaṃ āharitvā ākirati.
Therefore, whoever entertains a wrong thought should, by himself, censure himself and bring sand in a leaf-cup to scatter it in this place; this shall be his punishment.’’ From that time onward, whoever entertained such a thought would bring sand in a leaf-cup and scatter it there.
Do đó, ai có tà tư duy thì tự mình khiển trách mình, rồi dùng lá cây làm chén mang cát đến rải ở chỗ này; đây là hình phạt cho người đó”. Kể từ đó, ai có tà tư duy như vậy thì mang cát đến rải ở đó bằng chén lá.
Evaṃ tattha anukkamena mahāvālukārāsi jāto, tato naṃ pacchimā janatā parikkhipitvā cetiyaṭṭhānamakāsi.
Thus, in due course, a great heap of sand formed there, and later generations surrounded it and made it a shrine.
Cứ thế, dần dần một đống cát lớn hình thành ở đó, và sau này người dân đã vây quanh nó, biến nó thành một nơi thờ cúng.
Taṃ sandhāya vuttaṃ – ‘‘uruvelāyanti mahāvelāyaṃ, mahante vālukārāsimhīti attho daṭṭhabbo’’ti.
It is with reference to this that it was said, ‘‘‘Uruvelā’ means a great sand-bank; that is, in a large heap of sand, this meaning should be understood.’’
Liên quan đến điều đó, người ta đã nói: “Uruvelāyaṃ có nghĩa là ở Mahāvelā, tức là ở một đống cát lớn, ý nghĩa cần được hiểu như vậy”.
Viharatīti avisesena iriyāpathadibbabrahmaariyavihāresu aññataravihārasamaṅgitāparidīpanaṃ.
The term “dwells” generally indicates being endowed with one of the postures (
“ Viharatī” (trú ngụ) là sự chỉ rõ sự đầy đủ của một trong các tư thế oai nghi, các trú xứ Phạm thiên, hoặc các trú xứ Thánh, một cách không phân biệt.
Idha pana ṭhānanisajjāgamanasayanappabhedesu iriyāpathesu āsanasaṅkhātairiyāpathasamāyogaparidīpanaṃ ariyavihārasamaṅgitāparidīpanañcāti veditabbaṃ.
However, here it should be understood as indicating being endowed with the posture called sitting among the postures of standing, sitting, walking, and lying down, and also indicating being endowed with the noble abodes.
Tuy nhiên, ở đây cần hiểu rằng nó chỉ sự kết hợp với tư thế ngồi trong số các tư thế oai nghi như đứng, ngồi, đi, nằm, và cũng chỉ sự đầy đủ của trú xứ Thánh.
Tattha yasmā ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā aparipatantaṃ attabhāvaṃ harati pavatteti, tasmā viharatīti padassa iriyāpathavihāravasenettha attho veditabbo.
Among these, since one overcomes the discomfort of one posture with another posture, thereby sustaining and maintaining one’s existence without collapsing, the meaning of the word
Trong đó, bởi vì Đức Thế Tôn đã chấm dứt sự khó chịu của một tư thế oai nghi bằng một tư thế oai nghi khác, và duy trì thân thể không bị suy sụp, nên ý nghĩa của từ “viharatī” ở đây cần được hiểu theo nghĩa trú xứ oai nghi.
Yasmā pana bhagavā dibbavihārādīhi sattānaṃ vividhaṃ hitaṃ harati upaharati upaneti uppādeti, tasmā tesampi vasena vividhaṃ haratīti evamattho veditabbo.
And since the Blessed One brings, offers, bestows, and produces various benefits for beings through divine abodes and so forth, the meaning should also be understood as bringing forth various benefits through these (divine abodes, etc.).
Và bởi vì Đức Thế Tôn mang lại, cung cấp, dẫn dắt, và tạo ra nhiều lợi ích khác nhau cho chúng sinh bằng các trú xứ thiên thượng (dibbavihāra) và các trú xứ khác, nên ý nghĩa cũng cần được hiểu là Ngài mang lại nhiều lợi ích khác nhau theo các trú xứ đó.
Najjāti nadati sandatīti nadī, tassā najjā, nadiyā ninnagāyāti attho.
Of the river:
“ Najjā” có nghĩa là con sông, tức là con sông chảy xiết, con sông có dòng nước.
Nerañjarāyāti nelaṃ jalamassāti ‘‘nelañjalāyā’’ti vattabbe lakārassa rakāraṃ katvā ‘‘nerañjarāyā’’ti vuttaṃ, kaddamasevālapaṇakādidosarahitasalilāyāti attho.
Nerañjarā: It should be said as
“ Nerañjarāyā” được nói là “Nerañjarāyā” thay vì “Nelañjalāyā” bằng cách đổi âm “l” thành “r”. Có nghĩa là con sông có dòng nước trong sạch, không có bùn, rong rêu, tảo và các tạp chất khác.
Keci ‘‘nīlajalāyāti vattabbe nerañjarāyāti vutta’’nti vadanti.
Some say that it is called Nerañjarā where it should be called Nīlajalā (having blue water).
Một số người nói rằng “Nerañjarāyā” được nói thay vì “Nīlajalāyā” (có nước xanh).
Nāmameva vā etaṃ etissā nadiyāti veditabbaṃ.
Or it should be understood that this is merely the name of that river.
Hoặc nữa, cần hiểu rằng đây chỉ là tên của con sông này.
Tassā nadiyā tīre yattha bhagavā vihāsi, taṃ dassetuṃ ‘‘bodhirukkhamūle’’ti vuttaṃ.
To show the bank of that river where the Blessed One dwelt, it is said, “at the foot of the Bodhi tree.”
Để chỉ nơi Đức Thế Tôn trú ngụ bên bờ sông ấy, người ta đã nói “ bodhirukkhamūle” (dưới cội cây Bồ đề).
Tattha ‘‘bodhi vuccati catūsu maggesu ñāṇa’’nti ettha (cūḷani. khaggavisāṇasuttaniddesa 121) maggañāṇaṃ bodhīti vuttaṃ.
There, the path-knowledge (
Trong đó, “Bodhi” được gọi là trí tuệ trong Tứ Đạo (catūsu maggesu ñāṇaṃ) – ở đây, trí tuệ Đạo (maggañāṇaṃ) được gọi là Bodhi.
‘‘Pappoti bodhiṃ varabhūrimedhaso’’ti ettha (dī. ni. 3.217) sabbaññutaññāṇaṃ.
And here, ‘‘He attains Bodhi, the supreme knowledge of great wisdom,’’ refers to omniscience (
Trong câu “Pappoti bodhiṃ varabhūrimedhaso” (Vị đại trí tuệ ấy đạt được Bodhi), nó được gọi là Nhất Thiết Trí (sabbaññutaññāṇaṃ).
Tadubhayampi bodhiṃ bhagavā ettha pattoti rukkhopi bodhirukkhotveva nāmaṃ labhi.
Since the Blessed One attained both these Bodhis here, the tree also received the name Bodhi tree.
Đức Thế Tôn đã đạt được cả hai loại Bodhi ấy tại nơi này, nên cây đó cũng được gọi là cây Bồ đề.
Atha vā satta bojjhaṅge bujjhīti bhagavā bodhi, tena bujjhantena sannissitattā so rukkhopi bodhirukkhoti nāmaṃ labhi, tassa bodhirukkhassa.
Alternatively, since the Blessed One comprehended the seven factors of enlightenment (
Hoặc nữa, Đức Thế Tôn được gọi là Bodhi (Đấng Giác Ngộ) vì Ngài đã giác ngộ Bảy Chi Giác (satta bojjhaṅge). Vì cây đó là nơi nương tựa của Ngài, nên cây đó cũng được gọi là cây Bồ đề. Của cội cây Bồ đề ấy.
Mūleti samīpe.
at the root means nearby.
“ Mūle” có nghĩa là gần bên.
Ayañhi mūlasaddo ‘‘mūlāni uddhareyya antamaso usīranāḷamattānipī’’tiādīsu (a. ni. 4.195) mūlamūle dissati.
This word
Từ “mūla” này được thấy trong nghĩa gốc rễ như trong câu “Mūlāni uddhareyya antamaso usīranāḷamattānipī” (Hãy nhổ bỏ tận gốc rễ, dù chỉ là một sợi cỏ vetiver).
‘‘Lobho akusalamūla’’ntiādīsu (dī. ni. 3.305) asādhāraṇahetumhi.
It refers to an uncommon cause, as in ‘‘Greed is a root of unwholesomeness.’’
Trong nghĩa nguyên nhân không phổ biến như trong câu “Lobho akusalamūlaṃ” (Tham là gốc rễ của bất thiện).
‘‘Yāvatā majjhanhike kāle chāyā pharati, nivāte paṇṇāni patanti, ettāvatā rukkhamūla’’ntiādīsu samīpe.
It means proximity, as in ‘‘As far as the shadow extends at noon, or as far as the leaves fall in a windless place, that far is the foot of the tree.’’
Và trong nghĩa gần bên như trong câu “Yāvatā majjhanhike kāle chāyā pharati, nivāte paṇṇāni patanti, ettāvatā rukkhamūlaṃ” (Vào giữa trưa, bóng mát lan tỏa bao nhiêu, khi không gió, lá rụng bao nhiêu, chừng đó là gốc cây).
Idhāpi samīpe adhippeto, tasmā bodhirukkhassa mūle samīpeti evamettha attho daṭṭhabbo.
Here, too, proximity is intended. Therefore, the meaning here should be understood as: at the foot, nearby the Bodhi tree.
Ở đây cũng có ý nghĩa là gần bên, do đó, ý nghĩa cần được hiểu là gần cội cây Bồ đề.
Etthāha ‘‘kasmā dhammavinayasaṅgahe kayiramāne nidānavacanaṃ vuttaṃ, nanu bhagavatā bhāsitavacanasseva saṅgaho kātabbo’’ti?
Here it is asked, ‘‘Why was the introductory statement mentioned when the compilation of the Dhamma and Vinaya was being made? Should not only the words spoken by the Blessed One be compiled?’’
Ở đây, có người hỏi: “Tại sao khi kết tập Pháp và Luật lại nói lời dẫn nhập? Chẳng phải chỉ nên kết tập những lời Đức Thế Tôn đã thuyết giảng thôi sao?”
Vuccate – desanāya ciraṭṭhitiasammosasaddheyyabhāvasampādanatthaṃ.
It is said: To ensure the discourse’s longevity, absence of confusion, and credibility.
Xin được giải thích: Để lời dạy được tồn tại lâu dài, không bị lầm lẫn và đáng tin cậy.
Kāladesadesakavatthuādīhi upanibandhitvā ṭhapitā hi desanā ciraṭṭhitikā hoti asammosā saddheyyā ca desakālakattuhetunimittehi upanibaddho viya vohāravinicchayo.
Indeed, a discourse that is compiled and set down with reference to the time, place, teacher, and other circumstances becomes long-lasting, free from confusion, and credible, like a legal judgment bound by the circumstances of the speaker, time, agent, and cause.
Quả thật, lời dạy được thiết lập bằng cách liên kết với thời gian, địa điểm, người thuyết giảng, và các yếu tố khác sẽ tồn tại lâu dài, không bị lầm lẫn và đáng tin cậy, giống như một phán quyết pháp lý được thiết lập bằng cách liên kết với người thuyết giảng, thời gian, người thực hiện, nguyên nhân và dấu hiệu.
Teneva ca āyasmatā mahākassapena ‘‘paṭhamaṃ, āvuso ānanda, udānaṃ kattha bhāsita’’ntiādinā desādīsu pucchāya katāya vissajjanaṃ karontena dhammabhaṇḍāgārikena ‘‘evaṃ me suta’’ntiādinā udānassa nidānaṃ bhāsitanti.
And it is for this reason that when Venerable Mahākassapa questioned Venerable Ānanda, saying, ‘‘Friends Ānanda, where was the first Udāna spoken?’’ and so forth, the Treasurer of the Dhamma, in answering, recited the introduction to the Udāna, beginning with ‘‘Thus have I heard.’’
Chính vì thế, khi Tôn giả Mahākassapa hỏi: “Này hiền giả Ānanda, bài Udāna đầu tiên được thuyết giảng ở đâu?”, và các câu hỏi về địa điểm v.v., Tôn giả Ānanda, người nắm giữ kho tàng Pháp, đã trả lời bằng cách nói lời dẫn nhập của bài Udāna, bắt đầu bằng “Evaṃ me sutaṃ” (Như vầy tôi nghe).
Apica satthu sampattipakāsanatthaṃ nidānavacanaṃ.
Furthermore, the introductory statement is for revealing the perfections of the Teacher.
Hơn nữa, lời dẫn nhập còn có mục đích công bố sự viên mãn của Bổn Sư.
Tathāgatassa hi bhagavato pubbaracanānumānāgamatakkābhāvato sambuddhattasiddhi.
Indeed, the Tathāgata’s attainment of Buddhahood is established by the absence of prior composition, inference, tradition, and speculation.
Thật vậy, sự thành tựu của Đức Chánh Đẳng Giác nơi Đức Thế Tôn là do không có sự chuẩn bị trước, suy luận, truyền thống hay lý luận.
Na hi sammāsambuddhassa pubbaracanādīhi attho atthi sabbattha appaṭihatañāṇacāratāya ekappamāṇattā ñeyyadhammesu.
For a Perfectly Self-Enlightened One has no need of prior composition, etc., due to the unobstructed operation of his knowledge everywhere and the oneness of his measure regarding knowable phenomena.
Quả thật, đối với một bậc Chánh Đẳng Giác, không cần đến sự chuẩn bị trước và những điều tương tự, vì Ngài có trí tuệ không bị chướng ngại ở mọi nơi và có cùng một thước đo trong các pháp cần được biết.
Tathā ācariyamuṭṭhidhammamacchariyasāsanasāvakānurāgābhāvato khīṇāsavattasiddhi.
Likewise, the attainment of being one whose defilements are destroyed is established by the absence of the teacher’s closed-fist, stinginess regarding the Dhamma, and attachment to his disciples in the Dispensation.
Cũng vậy, do không có sự nắm giữ của bậc Đạo sư (ācariyamuṭṭhi), sự keo kiệt về pháp (dhammamacchariya), sự keo kiệt về giáo pháp (sāsanamacchariya) và sự keo kiệt đối với các đệ tử (sāvakānurāga), nên thành tựu quả vị A-la-hán (khīṇāsava).
Na hi sabbaso parikkhīṇāsavassa katthacipi ācariyamuṭṭhiādīnaṃ sambhavoti suvisuddhassa parānuggahappavatti.
Indeed, for one whose defilements are completely destroyed, there is no possibility of a teacher’s closed-fist, etc., anywhere, and thus his extremely pure actions proceed for the benefit of others.
Quả thật, đối với bậc đã hoàn toàn đoạn tận các lậu hoặc (āsava), sự nắm giữ của bậc Đạo sư (ācariyamuṭṭhi) và những điều tương tự không thể xảy ra ở bất cứ nơi nào; do đó, sự thuyết pháp của bậc hoàn toàn thanh tịnh là vì lợi ích của người khác.
Iti desakadosabhūtānaṃ diṭṭhisīlasampattidūsakānaṃ accantaṃ avijjātaṇhānaṃ abhāvasaṃsūcakehi ñāṇasampadāpahānasampadābhibyañjakehi ca sambuddhavisuddhabhāvehi purimavesārajjadvayasiddhi, tato ca antarāyikaniyyānikadhammesu sammohābhāvasiddhito pacchimavesārajjadvayasiddhīti bhagavato catuvesārajjasamannāgamo attahitaparahitappaṭipatti ca nidānavacanena pakāsitā honti, tattha tattha sampattaparisāya ajjhāsayānurūpaṃ ṭhānuppattikappaṭibhānena dhammadesanādīpanato.
Thus, the two former qualities of fearlessness are established by the purified states of the Buddha, which signify the absolute absence of ignorance and craving—which are the faults of the teacher, corrupting the perfections of right view and conduct—and which manifest the perfections of knowledge and abandonment; from that, the two latter qualities of fearlessness are established due to the cessation of delusion regarding obstructive and emancipating doctrines. In this way, the Blessed One’s possession of the four qualities of fearlessness and his practice for his own and others’ welfare are revealed by the introductory statement, because it illuminates the discourse on Dhamma in accordance with the disposition of the assembled audience at each particular place, with an immediate, opportune wisdom.
Như vậy, do sự không có mặt hoàn toàn của vô minh (avijjā) và ái (taṇhā) – vốn là những lỗi lầm của người thuyết pháp, làm ô nhiễm sự thành tựu của chánh kiến (diṭṭhi) và giới (sīla) – và do những phẩm chất thanh tịnh của bậc Chánh Đẳng Giác biểu lộ sự thành tựu của trí tuệ (ñāṇasampadā) và sự thành tựu của sự đoạn tận (pahānasampadā), nên hai sự tự tin (vesārajja) đầu tiên được thành tựu. Từ đó, do không có sự mê lầm đối với những pháp gây chướng ngại (antarāyika) và những pháp dẫn đến giải thoát (niyyānika), nên hai sự tự tin cuối cùng được thành tựu. Như vậy, sự thành tựu bốn sự tự tin (catuvesārajja) của Thế Tôn và sự thực hành vì lợi ích của bản thân (attahita) và lợi ích của người khác (parahita) được tuyên bố qua lời mở đầu, do Ngài đã thuyết pháp một cách ứng biến (paṭibhāna) phù hợp với xu hướng (ajjhāsaya) của hội chúng tụ tập tại mỗi nơi.
Idha pana vimuttisukhappaṭisaṃvedanapaṭiccasamuppādamanasikārapakāsanenāti yojetabbaṃ.
Here, however, it should be connected with the manifestation of the experience of the bliss of liberation and attention to dependent origination.
Ở đây, phải hiểu rằng điều này được kết hợp với sự tuyên bố về sự cảm nhận niềm an lạc giải thoát (vimuttisukha) và sự tác ý về Duyên khởi (paṭiccasamuppāda).
Tena vuttaṃ – ‘‘satthu sampattipakāsanatthaṃ nidānavacana’’nti.
Therefore it was said, ‘‘the introductory statement is for revealing the perfections of the Teacher.’’
Vì vậy, đã nói rằng: “Lời mở đầu là để tuyên bố sự thành tựu của Bậc Đạo sư.”
Tathā sāsanasampattipakāsanatthaṃ nidānavacanaṃ.
Likewise, the introductory statement is for revealing the perfections of the Dispensation.
Cũng vậy, lời mở đầu là để tuyên bố sự thành tựu của Giáo pháp (sāsana).
Ñāṇakaruṇāpariggahitasabbakiriyassa hi bhagavato natthi niratthakā paṭipatti attahitā vā.
Indeed, for the Blessed One, whose every action is guided by knowledge and compassion, there is no purposeless practice, nor any practice solely for his own benefit.
Quả thật, đối với Thế Tôn, người mà mọi hành động đều được bao hàm bởi trí tuệ (ñāṇa) và lòng bi mẫn (karuṇā), không có hành động nào vô ích hoặc chỉ vì lợi ích của bản thân.
Tasmā paresaṃyeva atthāya pavattasabbakiriyassa sammāsambuddhassa sakalampi kāyavacīmanokammaṃ yathāpavattaṃ vuccamānaṃ diṭṭhadhammikasamparāyikaparamatthehi yathārahaṃ sattānaṃ anusāsanaṭṭhena sāsanaṃ, na kabbaracanā.
Therefore, the entirety of the Perfectly Self-Enlightened One’s bodily, verbal, and mental actions, which proceed solely for the benefit of others, when spoken of as they occurred, constitute the Dispensation—not merely a literary composition—because they instruct beings appropriately with regard to immediate benefits, future benefits, and ultimate truths.
Do đó, đối với Đức Chánh Đẳng Giác, người mà mọi hành động đều vì lợi ích của người khác, tất cả các hành động thân, khẩu, ý của Ngài, khi được trình bày đúng như chúng đã xảy ra, được gọi là Giáo pháp (sāsana) theo nghĩa là sự giáo huấn chúng sinh một cách thích đáng về các lợi ích hiện tại (diṭṭhadhammika), lợi ích đời sau (samparāyika) và lợi ích tối thượng (paramattha), chứ không phải là sự sắp đặt câu chữ.
Tayidaṃ satthu caritaṃ kāladesadesakaparisāpadesādīhi saddhiṃ tattha tattha nidānavacanena yathārahaṃ pakāsīyati, idha pana abhisambodhivimuttisukhappaṭisaṃvedanapaṭiccasamuppādamanasikārenāti yojetabbaṃ.
That course of the Teacher is revealed appropriately in various texts by means of introductory discourses, together with* time, place, assembly, locale, and so forth. But here, it should be understood as by means of the full Enlightenment, the experience of the bliss of liberation, and the contemplation of Paṭiccasamuppāda.
Hành trạng này của Bậc Đạo sư được tuyên bố một cách thích đáng bằng lời mở đầu ở mỗi nơi, cùng với thời gian, địa điểm, người thuyết pháp và hội chúng, v.v. Ở đây, phải hiểu rằng điều này được kết hợp với sự chứng đắc Chánh Đẳng Giác (abhisambodhi), sự cảm nhận niềm an lạc giải thoát (vimuttisukha) và sự tác ý về Duyên khởi (paṭiccasamuppāda).
Tena vuttaṃ – ‘‘sāsanasampattipakāsanatthaṃ nidānavacana’’nti.
Therefore, it was said: "The introductory discourse is for revealing the accomplishment of the Sāsana."
Vì vậy, đã nói rằng: “Lời mở đầu là để tuyên bố sự thành tựu của Giáo pháp.”
Ettha ca attajjhāsayo parajjhāsayo pucchāvasiko aṭṭhuppattikoti cattāro suttanikkhepā veditabbā.
Here, four ways of presenting suttas should be understood: based on one's own inclination (attajjhāsaya), based on others' inclination (parajjhāsaya), based on a question (pucchāvasika), and based on an originating circumstance (aṭṭhuppattika).
Ở đây, phải hiểu có bốn cách trình bày kinh (suttanikkhepa): do ý muốn của bản thân (attajjhāsaya), do ý muốn của người khác (parajjhāsaya), do câu hỏi (pucchāvasika) và do sự kiện phát sinh (aṭṭhuppattika).
Yathā hi anekasataanekasahassabhedānipi suttāni saṃkilesabhāgiyādipaṭṭhānanayena soḷasavidhataṃ nātivattanti, evaṃ tāni sabbānipi attajjhāsayādisuttanikkhepavasena catubbidhabhāvaṃ nātivattanti.
Just as suttas, though of many hundreds and many thousands of kinds, do not exceed the sixteen types according to the classification of saṃkilesabhāgiya and so forth, so too, all of them do not exceed the four types according to the ways of presenting suttas such as attajjhāsaya.
Cũng như các kinh, dù có hàng trăm, hàng ngàn biến thể, không vượt quá mười sáu loại theo phương pháp khởi nguyên như các pháp thuộc về ô nhiễm (saṃkilesabhāgiya), v.v., thì tất cả chúng cũng không vượt quá bốn loại theo cách trình bày kinh như ý muốn của bản thân (attajjhāsaya), v.v.
Kāmañcettha attajjhāsayassa aṭṭhuppattiyā ca parajjhāsayapucchāvasikehi saddhiṃ saṃsaggabhedo sambhavati ajjhāsayānusandhipucchānusandhisambhavato, attajjhāsayaaṭṭhuppattīnaṃ aññamaññaṃ saṃsaggo natthīti niravaseso paṭṭhānanayo na sambhavati.
Although a difference of intermingling between attajjhāsaya and aṭṭhuppatti with parajjhāsaya and pucchāvasika is possible here due to the possibility of sequence of inclinations and sequence of questions, there is no intermingling between attajjhāsaya and aṭṭhuppatti with each other, so the complete method of classification is not possible.
Mặc dù ở đây, có thể có sự pha trộn giữa ý muốn của bản thân (attajjhāsaya) và sự kiện phát sinh (aṭṭhuppatti) với ý muốn của người khác (parajjhāsaya) và do câu hỏi (pucchāvasika), do có sự liên kết của ý muốn (ajjhāsayānusandhi) và sự liên kết của câu hỏi (pucchānusandhi); nhưng không có sự pha trộn lẫn nhau giữa ý muốn của bản thân (attajjhāsaya) và sự kiện phát sinh (aṭṭhuppatti), nên phương pháp khởi nguyên hoàn toàn không thể xảy ra.
Tadantogadhattā vā sambhavantānaṃ sesanikkhepānaṃ mūlanikkhepavasena cattāro suttanikkhepāti vuttaṃ.
Or, because the other possible ways of presenting suttas are included within these, it is said that there are four principal ways of presenting suttas.
Hoặc, đã nói rằng có bốn cách trình bày kinh (suttanikkhepa) theo cách trình bày gốc (mūlanikkhepa), vì các cách trình bày còn lại có thể xảy ra đều nằm trong đó.
Tatrāyaṃ vacanattho – nikkhipanaṃ nikkhepo, suttassa nikkhepo suttanikkhepo, suttadesanāti attho.
Among these, the meaning of the word is: 'laying down' is nikkhepa; 'laying down of a sutta' is suttanikkhepa; the meaning is 'exposition of a sutta'.
Ở đây, ý nghĩa của từ là: sự trình bày (nikkhipanaṃ) là sự trình bày (nikkhepo). Sự trình bày của kinh (suttassa nikkhepo) là sự trình bày kinh (suttanikkhepo), tức là sự thuyết giảng kinh.
Nikkhipīyatīti vā nikkhepo, suttaṃ eva nikkhepo suttanikkhepo.
Or, it is laid down, therefore it is nikkhepa. The sutta itself is nikkhepa, hence suttanikkhepa.
Hoặc, cái được trình bày (nikkhipīyati) là sự trình bày (nikkhepo). Chính kinh là sự trình bày kinh (suttanikkhepo).
Attano ajjhāsayo attajjhāsayo, so assa atthi kāraṇabhūtoti attajjhāsayo, attano ajjhāsayo etassāti vā attajjhāsayo.
One's own inclination is attajjhāsaya. This inclination is a cause for it, hence attajjhāsaya. Or, it has its own inclination, hence attajjhāsaya.
Ý muốn của bản thân (attano ajjhāsayo) là ý muốn của bản thân (attajjhāsayo). Ý muốn đó là nguyên nhân, nên là ý muốn của bản thân (attajjhāsayo). Hoặc, cái có ý muốn của bản thân là ý muốn của bản thân (attajjhāsayo).
Parajjhāsayepi eseva nayo.
The same method applies to parajjhāsaya.
Đối với ý muốn của người khác (parajjhāsaya) cũng theo cách tương tự.
Pucchāya vaso pucchāvaso, so etassa atthīti pucchāvasiko.
The power of a question is pucchāvasa. It has this, hence pucchāvasika.
Sự chi phối của câu hỏi (pucchāya vaso) là sự chi phối của câu hỏi (pucchāvaso). Cái có sự chi phối đó là do câu hỏi (pucchāvasiko).
Suttadesanāya vatthubhūtassa atthassa uppatti atthuppatti, atthuppatti eva aṭṭhuppatti, sā etassa atthīti aṭṭhuppattiko.
The arising of the circumstance that forms the basis for the exposition of a sutta is atthuppatti; atthuppatti itself is aṭṭhuppatti. It has this, hence aṭṭhuppattika.
Sự phát sinh của điều kiện (atthassa uppatti) là sự kiện phát sinh (aṭṭhuppatti), vốn là đối tượng của sự thuyết giảng kinh. Chính sự kiện phát sinh là sự kiện phát sinh (aṭṭhuppatti). Cái có sự kiện phát sinh đó là sự kiện phát sinh (aṭṭhuppattiko).
Atha vā nikkhipīyati suttaṃ etenāti nikkhepo, attajjhāsayādi eva.
Alternatively, that by which a sutta is laid down is nikkhepa, such as attajjhāsaya and so forth.
Hoặc, cái mà kinh được trình bày bởi nó là sự trình bày (nikkhepo), tức là ý muốn của bản thân (attajjhāsaya), v.v.
Etasmiṃ pana atthavikappe attano ajjhāsayo attajjhāsayo.
In this alternative interpretation of the meaning, one's own inclination is attajjhāsaya.
Tuy nhiên, trong cách giải thích ý nghĩa này, ý muốn của bản thân là ý muốn của bản thân (attajjhāsayo).
Paresaṃ ajjhāsayo parajjhāsayo.
Others' inclination is parajjhāsaya.
Ý muốn của người khác là ý muốn của người khác (parajjhāsayo).
Pucchīyatīti pucchā, pucchitabbo attho.
That which is questioned is pucchā, the meaning to be questioned.
Cái được hỏi là câu hỏi (pucchā), tức là ý nghĩa cần được hỏi.
Pucchanavasena pavattaṃ dhammappaṭiggāhakānaṃ vacanaṃ pucchāvasaṃ, tadeva nikkhepasaddāpekkhāya pucchāvasikoti pulliṅgavasena vuttaṃ.
The speech of those who receive the Dhamma, which proceeds by way of questioning, is pucchāvasa. That very* is referred to as pucchāvasika in the masculine gender, in reference to the word nikkhepa.
Lời nói của những người tiếp nhận pháp (dhammappaṭiggāhaka) diễn ra theo cách hỏi là sự chi phối của câu hỏi (pucchāvasaṃ). Chính điều đó, khi xem xét từ “nikkhepa”, được gọi là “pucchāvasiko” theo giống đực.
Tathā atthuppattiyeva aṭṭhuppattikoti evamettha attho veditabbo.
Similarly, that which is aṭṭhuppatti itself is aṭṭhuppattika. Thus, the meaning here should be understood.
Cũng vậy, chính sự kiện phát sinh là sự kiện phát sinh (aṭṭhuppattiko). Ý nghĩa ở đây phải được hiểu như vậy.
Ettha ca paresaṃ indriyaparipākādikāraṇanirapekkhattā attajjhāsayassa visuṃ suttanikkhepabhāvo yutto kevalaṃ attano ajjhāsayeneva dhammatantiṭhapanatthaṃ pavattitadesanattā, parajjhāsayapucchāvasikānaṃ pana paresaṃ ajjhāsayapucchānaṃ desanāpavattihetubhūtānaṃ uppattiyaṃ pavattitānaṃ kathamaṭṭhuppattiyā anavarodho, pucchāvasikaaṭṭhuppattipubbakānaṃ vā parajjhāsayānurodhena pavattitānaṃ kathaṃ parajjhāsaye anavarodhoti?
And here, it is fitting that attajjhāsaya is a distinct way of presenting suttas because it does not depend on factors such as the maturity of others' faculties, being an exposition that proceeds solely from one's own inclination for establishing the Dhamma tradition. But how is there no contradiction with aṭṭhuppatti for parajjhāsaya and pucchāvasika, which arise from the inclination and questions of others and proceed as causes for the exposition of Dhamma? Or how is there no contradiction with parajjhāsaya for pucchāvasika and aṭṭhuppattika, which proceed in accordance with others' inclinations?
Ở đây, việc cách trình bày kinh do ý muốn của bản thân (attajjhāsaya) được tách biệt là hợp lý, vì nó không phụ thuộc vào các nguyên nhân như sự chín muồi của căn (indriyaparipāka) của người khác, mà chỉ là sự thuyết giảng được thực hiện để thiết lập giáo lý (dhammatanti) chỉ dựa trên ý muốn của bản thân. Nhưng đối với cách trình bày do ý muốn của người khác (parajjhāsaya) và do câu hỏi (pucchāvasika), vốn phát sinh khi có sự phát sinh của ý muốn và câu hỏi của người khác làm nguyên nhân cho sự thuyết giảng, thì làm sao không mâu thuẫn với sự kiện phát sinh (aṭṭhuppatti)? Hoặc, đối với những cách trình bày do câu hỏi (pucchāvasika) và sự kiện phát sinh (aṭṭhuppattika) được thực hiện theo ý muốn của người khác (parajjhāsayānurodhena), thì làm sao không mâu thuẫn với ý muốn của người khác (parajjhāsaya)?
Na codetabbametaṃ.
This should not be criticized.
Không nên chất vấn điều này.
Paresañhi abhinīhāraparipucchādivinicchayādivinimuttasseva suttantadesanākāraṇuppādassa aṭṭhuppattibhāvena gahitattā parajjhāsayapucchāvasikānaṃ visuṃ gahaṇaṃ.
For the separate classification of parajjhāsaya and pucchāvasika arises from the fact that aṭṭhuppatti is taken as the originating circumstance of a sutta exposition that is free from others' aspirations, questions, and similar determinations.
Vì sự phát sinh của nguyên nhân thuyết giảng kinh (suttantadesanākāraṇuppāda) của người khác, vốn không liên quan đến sự phát nguyện (abhinīhāra), câu hỏi (paripucchā), v.v., được coi là sự kiện phát sinh (aṭṭhuppatti), nên cách trình bày do ý muốn của người khác (parajjhāsaya) và do câu hỏi (pucchāvasika) được tách riêng.
Tathā hi brahmajāladhammadāyādasuttādīnaṃ vaṇṇāvaṇṇaāmisuppādādidesanānimittaṃ aṭṭhuppatti vuccati, paresaṃ pucchāya vinā ajjhāsayameva nimittaṃ katvā desito parajjhāsayo, pucchāvasena desito pucchāvasikoti pākaṭoyamatthoti.
Thus, the originating circumstance (aṭṭhuppatti) for the Brahmajjāla Sutta, Dhammadāyāda Sutta, and so forth is said to be the cause of the teaching, such as praise, censure, or the provision of material gifts. Parajjhāsaya is when the teaching is given by making only one's own inclination the cause, without a question from others. Pucchāvasika is when it is taught by way of a question. This meaning is clear.
Cũng vậy, sự kiện phát sinh (aṭṭhuppatti) được nói đến là nguyên nhân của sự thuyết giảng về sự khen ngợi (vaṇṇa), sự khiển trách (avaṇṇa), sự phát sinh vật chất (āmisuppāda), v.v., trong các kinh như Brahmajalasutta, Dhammadāyādasutta, v.v. Ý muốn của người khác (parajjhāsaya) là kinh được thuyết giảng chỉ dựa trên ý muốn mà không có câu hỏi của người khác. Kinh được thuyết giảng do câu hỏi là do câu hỏi (pucchāvasika). Ý nghĩa này là rõ ràng.
Tattha paṭhamādīni tīṇi bodhisuttāni mucalindasuttaṃ, āyusaṅkhārossajjanasuttaṃ, paccavekkhaṇasuttaṃ, papañcasaññāsuttanti imesaṃ udānānaṃ attajjhāsayo nikkhepo.
Among these, the first three Bodhi suttas, namely the Mucalinda Sutta, the Āyusaṅkhārossajjana Sutta, the Paccavekkhaṇa Sutta, and the Papañcasaññā Sutta—these Udānas have attajjhāsaya as their mode of presentation.
Trong số đó, ba kinh Bồ-đề đầu tiên, kinh Mucalinda, kinh Ayusaṅkhārossajjana, kinh Paccavekkhaṇa và kinh Papañcasaññā, là những bài Udāna thuộc loại ý muốn của bản thân (attajjhāsaya).
Huhuṅkasuttaṃ, brāhmaṇajātikasuttaṃ, bāhiyasuttanti imesaṃ udānānaṃ pucchāvasiko nikkhepo.
The Hu-huṅka Sutta, the Brāhmaṇajātika Sutta, and the Bāhiya Sutta—these Udānas have pucchāvasika as their mode of presentation.
Các kinh Huhuṅka, Brāhmaṇajātika và Bāhiya là những bài Udāna thuộc loại do câu hỏi (pucchāvasika).
Rājasuttaṃ, sakkārasuttaṃ, ucchādanasuttaṃ, piṇḍapātikasuttaṃ, sippasuttaṃ, gopālasuttaṃ, sundarikasuttaṃ, mātusuttaṃ, saṅghabhedakasuttaṃ, udapānasuttaṃ, tathāgatuppādasuttaṃ, moneyyasuttaṃ, pāṭaligāmiyasuttaṃ, dvepi dabbasuttānīti etesaṃ udānānaṃ aṭṭhuppattiko nikkhepo.
The Rāja Sutta, the Sakkāra Sutta, the Ucchādana Sutta, the Piṇḍapātika Sutta, the Sippa Sutta, the Gopāla Sutta, the Sundarika Sutta, the Mātu Sutta, the Saṅghabhedaka Sutta, the Udapāna Sutta, the Tathāgatuppāda Sutta, the Moneyya Sutta, the Pāṭaligāmiya Sutta, and the two Dabba Suttas—these Udānas have aṭṭhuppattika as their mode of presentation.
Các kinh Rājasutta, Sakkārasutta, Ucchādanasutta, Piṇḍapātikasutta, Sippasutta, Gopālasutta, Sundarikasutta, Mātusutta, Saṅghabhedakasutta, Udapānasutta, Tathāgatuppādasutta, Moneyyasutta, Pāṭaligāmiyasutta, và hai kinh Dabbasutta này là sự trình bày theo nguyên nhân (aṭṭhuppattiko nikkhepo) của các bài Udāna đó.
Pālileyyasuttaṃ, piyasuttaṃ, nāgasamālasuttaṃ, visākhāsuttañcāti imesaṃ udānānaṃ attajjhāsayo parajjhāsayo ca nikkhepo.
The Pālileyya Sutta, the Piya Sutta, the Nāgasamāla Sutta, and the Visākhā Sutta—these Udānas have both attajjhāsaya and parajjhāsaya as their mode of presentation.
Các kinh Pālileyyasutta, Piyasutta, Nāgasamālasutta và Visākhāsutta này là sự trình bày theo ý nguyện của chính mình và ý nguyện của người khác (attajjhāsayo parajjhāsayo ca nikkhepo) của các bài Udāna đó.
Sesānaṃ ekapaññāsāya suttānaṃ parajjhāsayo nikkhepo.
The remaining fifty-three suttas have parajjhāsaya as their mode of presentation.
Sự trình bày theo ý nguyện của người khác (parajjhāsayo nikkhepo) là của năm mươi mốt kinh còn lại.
Evametesaṃ udānānaṃ attajjhāsayādivasena nikkhepaviseso veditabbo.
Thus, the specific mode of presentation of these Udānas, such as attajjhāsaya and so forth, should be understood.
Như vậy, cần phải hiểu sự trình bày đặc biệt của các bài Udāna này theo ý nguyện của chính mình, v.v.
Tena kho pana samayenātiādīsu tena samayenāti ca bhummatthe karaṇavacanaṃ, kho panāti nipāto, tasmiṃ samayeti attho.
In passages such as ‘ Tena kho pana samayena’ (At that time), ‘ tena samayena’ is an instrumental case word used in a locative sense, and ‘ kho pana’ is a particle. The meaning is ‘at that time’.
Trong các câu như “ Tena kho pana samayena” (Vào lúc bấy giờ), từ “ tena samayena” là cách dùng từ thuộc sở cách (bhummattha) trong ý nghĩa công cụ (karaṇavacana), và “ kho pana” là một từ ngữ phụ (nipāta). Ý nghĩa là “vào lúc đó”.
Kasmiṃ pana samaye?
But at what time?
Vậy, vào lúc nào?
Yaṃ samayaṃ bhagavā uruvelāyaṃ viharati najjā nerañjarāya tīre bodhirukkhamūle paṭhamābhisambuddho.
At the time when the Blessed One was dwelling in Uruvelā, on the bank of the Nerañjarā River, at the foot of the Bodhi tree, having just attained full enlightenment.
Vào lúc Đức Thế Tôn đang an trú tại Uruvelā, bên bờ sông Nerañjarā, dưới cội Bồ-đề, vừa mới thành tựu chánh đẳng chánh giác.
Tasmiṃ samaye.
At that time.
Vào lúc đó.
Sattāhanti satta ahāni sattāhaṃ, accantasaṃyogatthe etaṃ upayogavacanaṃ.
‘ Sattāhaṃ’ means seven days; this is a word of use in the sense of continuous connection.
“ Sattāhaṃ” có nghĩa là bảy ngày. Đây là cách dùng từ thuộc nghiệp cách (upayogavacana) trong ý nghĩa liên tục tuyệt đối (accantasaṃyoga).
Yasmā bhagavā taṃ sattāhaṃ nirantaratāya accantameva phalasamāpattisukhena vihāsi, tasmā sattāhanti accantasaṃyogavasena upayogavacanaṃ vuttaṃ.
Because the Blessed One dwelled continuously throughout those seven days, fully experiencing the bliss of fruition-attainment, therefore the word ‘sattāhaṃ’ is spoken in the sense of continuous connection.
Vì Đức Thế Tôn đã an trú liên tục trong bảy ngày đó với niềm an lạc của quả vị nhập định (phalasamāpattisukha), nên từ “sattāhaṃ” được nói theo nghĩa liên tục tuyệt đối.
Ekapallaṅkenāti visākhāpuṇṇamāya anatthaṅgateyeva sūriye aparājitapallaṅkavare vajirāsane nisinnakālato paṭṭhāya sakimpi anuṭṭhahitvā yathāābhujitena ekeneva pallaṅkena.
‘ Ekapallaṅkena’ means with a single cross-legged posture, without rising even once, in the same posture assumed from the time he sat on the supreme Vajirāsana, the unassailable seat, before the sun had set on the Visākhā full moon day.
“ Ekapallaṅkena” có nghĩa là ngồi kiết già một lần duy nhất, không đứng dậy dù chỉ một lần, kể từ lúc Đức Thế Tôn ngồi trên tòa kim cương (vajirāsana) cao quý, bất khả chiến bại, vào ngày trăng tròn Visākhā, trước khi mặt trời lặn.
Vimuttisukhapaṭisaṃvedīti vimuttisukhaṃ phalasamāpattisukhaṃ paṭisaṃvediyamāno nisinno hotīti attho.
‘ Vimuttisukhapaṭisaṃvedī’ means experiencing the bliss of liberation, which is the bliss of fruition-attainment, thus he sat experiencing it.
“ Vimuttisukhapaṭisaṃvedī” có nghĩa là an trú trong sự cảm nhận niềm an lạc của giải thoát (vimuttisukha), tức là niềm an lạc của quả vị nhập định (phalasamāpattisukha).
Tattha vimuttīti tadaṅgavimutti, vikkhambhanavimutti, samucchedavimutti, paṭippassaddhivimutti, nissaraṇavimuttīti pañca vimuttiyo.
Here, ‘ vimutti’ refers to five kinds of liberation: tadaṅga-vimutti, vikkhambhana-vimutti, samuccheda-vimutti, paṭippassaddhi-vimutti, and nissaraṇa-vimutti.
Ở đây, “ vimutti” (giải thoát) có năm loại: tadaṅgavimutti (giải thoát từng phần), vikkhambhanavimutti (giải thoát bằng cách trấn áp), samucchedavimutti (giải thoát bằng cách đoạn trừ), paṭippassaddhivimutti (giải thoát bằng cách an tịnh), và nissaraṇavimutti (giải thoát bằng cách xuất ly).
Tāsu yaṃ deyyadhammapariccāgādīhi tehi tehi guṇaṅgehi nāmarūpaparicchedādīhi vipassanaṅgehi ca yāva tassa tassa aṅgassa aparihānivasena pavatti, tāva taṃtaṃpaṭipakkhato vimuccanato vimuccanaṃ pahānaṃ.
Among these, the liberation and abandonment that occurs by means of giving meritorious gifts and other virtuous practices, and by means of insight practices like discerning name-and-form, as long as each of those factors is not lost, is a liberation from its respective opposing defilement.
Trong số đó, sự giải thoát, sự từ bỏ (pahāna) khỏi các đối thủ tương ứng, diễn ra chừng nào sự thực hành các yếu tố công đức như bố thí, v.v., và các yếu tố tuệ quán như phân biệt danh sắc, v.v., không bị suy giảm, thì đó là tadaṅgavimutti.
Seyyathidaṃ?
For example:
Chẳng hạn:
Dānena macchariyalobhādito, sīlena pāṇātipātādito, nāmarūpavavatthānena sakkāyadiṭṭhito, paccayapariggahena ahetuvisamahetudiṭṭhīhi, tasseva aparabhāgena kaṅkhāvitaraṇena kathaṃkathībhāvato, kalāpasammasanena ‘‘ahaṃ mamā’’ti gāhato, maggāmaggavavatthānena amagge maggasaññāya, udayadassanena ucchedadiṭṭhiyā, vayadassanena sassatadiṭṭhiyā, bhayadassanena sabhaye abhayasaññāya, ādīnavadassanena assādasaññāya, nibbidānupassanena abhiratisaññāya, muccitukamyatāñāṇena amuccitukamyatāya, upekkhāñāṇena anupekkhāya, anulomena dhammaṭṭhitiyaṃ nibbāne ca paṭilomabhāvato, gotrabhunā saṅkhāranimittabhāvato vimuccanaṃ, ayaṃ tadaṅgavimutti nāma.
By giving, liberation from stinginess, greed, and so on; by morality, from taking life, and so on; by discerning name-and-form, from personality view; by comprehending conditionality, from the views of causelessness and uneven cause; by the knowledge of doubt-crossing in its later stage, from a state of indecision; by contemplating aggregates, from the grasping of ‘I’ and ‘mine’; by discerning the path and non-path, from the perception of the non-path as the path; by observing arising, from the annihilation view; by observing passing away, from the eternalist view; by observing fear, from the perception of fearlessness in what is fearful; by observing danger, from the perception of enjoyment; by contemplating disenchantment, from the perception of delight; by the knowledge of the desire for liberation, from the desire for non-liberation; by the knowledge of equanimity, from non-equanimity; by conformity knowledge, from opposition to the stability of Dhamma and Nibbāna; by gotrabhū knowledge, from the state of being a sign of formations. This liberation is called tadaṅga-vimutti.
Bố thí giải thoát khỏi lòng tham keo kiệt, v.v.; trì giới giải thoát khỏi sát sinh, v.v.; phân biệt danh sắc giải thoát khỏi tà kiến thân kiến (sakkāyadiṭṭhi); nắm giữ nhân duyên giải thoát khỏi tà kiến vô nhân và dị nhân; sau đó, vượt qua nghi ngờ giải thoát khỏi trạng thái hoài nghi; quán xét các nhóm giải thoát khỏi sự chấp thủ “ta và của ta”; phân biệt đạo và phi đạo giải thoát khỏi sự nhận thức sai lầm về đạo; thấy sự sinh khởi giải thoát khỏi tà kiến đoạn kiến (ucchedadiṭṭhi); thấy sự diệt vong giải thoát khỏi tà kiến thường kiến (sassatadiṭṭhi); thấy sự sợ hãi giải thoát khỏi nhận thức không sợ hãi trong điều đáng sợ; thấy sự nguy hiểm giải thoát khỏi nhận thức về sự thích thú; quán chiếu sự nhàm chán giải thoát khỏi nhận thức về sự vui thích; trí tuệ muốn giải thoát giải thoát khỏi sự không muốn giải thoát; trí tuệ xả giải thoát khỏi sự không xả; thuận thứ giải thoát khỏi trạng thái nghịch lại với sự an trú của Pháp và Niết Bàn; trí tuệ chuyển tộc (gotrabhu) giải thoát khỏi trạng thái là tướng của các hành (saṅkhāranimitta). Đây gọi là tadaṅgavimutti.
Yaṃ pana upacārappanābhedena samādhinā yāvassa aparihānivasena pavatti, tāva kāmacchandādīnaṃ nīvaraṇānañceva, vitakkādīnañca paccanīkadhammānaṃ, anuppattisaññitaṃ vimuccanaṃ, ayaṃ vikkhambhanavimutti nāma.
The liberation which is the non-arising, as a result of jhāna, of hindrances such as sensual desire, and of antagonistic phenomena such as initial application, as long as that jhāna is not lost, is called vikkhambhana-vimutti.
Còn sự giải thoát khỏi các triền cái như dục ái, v.v., và các pháp đối nghịch như tầm, v.v., được gọi là không sinh khởi, diễn ra chừng nào sự định tâm (samādhi) theo cách cận định (upacāra) và an định (appanā) không bị suy giảm, thì đây gọi là vikkhambhanavimutti.
Yaṃ catunnaṃ ariyamaggānaṃ bhāvitattā taṃtaṃmaggavato ariyassa santāne yathārahaṃ ‘‘diṭṭhigatānaṃ pahānāyā’’tiādinā (dha. sa. 277; vibha. 628) nayena vuttassa samudayapakkhiyassa kilesagaṇassa puna accantaṃ appavattibhāvena samucchedappahānavasena vimuccanaṃ, ayaṃ samucchedavimutti nāma.
The liberation that is the complete eradication and abandonment of the group of defilements belonging to the origin, as stated in phrases like ‘for the abandonment of wrong views’ (Dhs. 277; Vbh. 628) in the appropriate manner in the continuum of a noble one who possesses that path, due to the cultivation of the four noble paths, is called samuccheda-vimutti.
Còn sự giải thoát bằng cách đoạn trừ hoàn toàn các nhóm phiền não thuộc về tập khởi, được thuyết giảng theo cách “để từ bỏ các tà kiến”, v.v., trong dòng tâm thức của các Bậc Thánh đã thành tựu các đạo quả tương ứng, do đã tu tập bốn Thánh đạo, thì đây gọi là samucchedavimutti.
Yaṃ pana phalakkhaṇe paṭippassaddhattaṃ kilesānaṃ, ayaṃ paṭippassaddhivimutti nāma.
That quiescence of defilements at the moment of fruition is called paṭippassaddhi-vimutti.
Còn sự an tịnh các phiền não trong khoảnh khắc quả, thì đây gọi là paṭippassaddhivimutti.
Sabbasaṅkhatanissaṭattā pana sabbasaṅkhāravimuttaṃ nibbānaṃ, ayaṃ nissaraṇavimutti nāma.
Nibbāna, however, being disengaged from all conditioned things, liberated from all formations, is called nissaraṇa-vimutti.
Còn Niết Bàn, là sự xuất ly khỏi mọi hành (saṅkhāra), do thoát ly khỏi mọi pháp hữu vi (saṅkhata), thì đây gọi là nissaraṇavimutti.
Idha pana bhagavato nibbānārammaṇā phalavimutti adhippetā.
Here, however, the fruition liberation, which has Nibbāna as its object, is intended for the Blessed One.
Ở đây, giải thoát quả (phalavimutti) với Niết Bàn làm đối tượng được Đức Thế Tôn đề cập.
Tena vuttaṃ – ‘‘vimuttisukhapaṭisaṃvedīti vimuttisukhaṃ phalasamāpattisukhaṃ paṭisaṃvediyamāno nisinno hotīti attho’’ti.
Therefore, it is said: ‘‘Vimuttisukhapaṭisaṃvedī’ means that he sat experiencing the bliss of liberation, which is the bliss of fruition-attainment,’—this is the meaning.’
Do đó, đã nói: “’Vimuttisukhapaṭisaṃvedī’ có nghĩa là an trú trong sự cảm nhận niềm an lạc của giải thoát, tức là niềm an lạc của quả vị nhập định.”
Vimuttīti ca upakkilesehi paṭippassaddhivasena cittassa vimuttabhāvo, cittameva vā tathā vimuttaṃ veditabbaṃ, tāya vimuttiyā jātaṃ sampayuttaṃ vā sukhaṃ vimuttisukhaṃ.
‘ Vimutti’ also means the state of mind being liberated through the calming of defilements, or the mind itself, thus liberated, should be understood. The happiness born of or associated with that liberation is the bliss of liberation.
Và “ vimutti” (giải thoát) là trạng thái tâm được giải thoát khỏi các cấu uế (upakkilesa) bằng cách an tịnh chúng, hoặc chính tâm được giải thoát như vậy cần được hiểu. Hạnh phúc sinh ra hoặc liên hệ với sự giải thoát đó là vimuttisukha (an lạc giải thoát).
‘‘Yāyaṃ, bhante, upekkhā sante sukhe vuttā bhagavatā’’ti (ma. ni. 2.88) vacanato upekkhāpi cettha sukhamicceva veditabbā.
As it is said, ‘Bhante, this equanimity spoken of by the Blessed One as a peaceful happiness’ (MN II, 88), equanimity here should also be understood as happiness.
Theo lời dạy của Đức Thế Tôn: “Bạch Thế Tôn, sự xả (upekkhā) này được Đức Thế Tôn nói là niềm an lạc an tịnh,” thì ở đây, xả cũng cần được hiểu là an lạc.
Tathā ca vuttaṃ sammohavinodaniyaṃ ‘‘upekkhā pana santattā, sukhamicceva bhāsitā’’ti (vibha. aṭṭha. 232).
And so it is said in the Sammohavinodanī, ‘Equanimity, being peaceful, is indeed spoken of as happiness’ (VibhA. 232).
Như đã nói trong Sammohavinodanī: “Sự xả, vì là an tịnh, nên được thuyết giảng là an lạc.”
Bhagavā hi catutthajjhānikaṃ arahattasamāpattiṃ samāpajjati, na itaraṃ.
For the Blessed One attains the fruition-attainment of Arahantship, which is associated with the fourth jhāna, not any other.
Đức Thế Tôn thực hành nhập A-la-hán quả định (arahattasamāpatti) thuộc Tứ thiền, chứ không phải các thiền khác.
Atha vā ‘‘tesaṃ vūpasamo sukho’’tiādīsu yathā saṅkhāradukkhūpasamo sukhoti vuccati, evaṃ sakalakilesadukkhūpasamabhāvato aggaphale labbhamānā paṭippassaddhivimutti eva idha sukhanti veditabbā.
Alternatively, just as the cessation of the suffering of formations is called happiness in phrases like ‘their appeasement is happiness’ and so on, so too, the paṭippassaddhi-vimutti attained in the highest fruition, being the cessation of the suffering of all defilements, should be understood as happiness here.
Hoặc, như trong các câu như “Sự an tịnh của chúng là an lạc,” sự an tịnh của khổ hành được gọi là an lạc, thì tương tự, sự giải thoát an tịnh (paṭippassaddhivimutti) đạt được trong quả vị tối thượng (aggaphala) do sự an tịnh của mọi khổ phiền não, cần được hiểu là an lạc ở đây.
Tayidaṃ vimuttisukhaṃ maggavīthiyaṃ kālantareti phalacittassa pavattivibhāgena duvidhaṃ hoti.
This bliss of liberation is of two kinds, distinguished by the occurrence of fruition-consciousness: in the path-process and at a later time.
An lạc giải thoát này có hai loại theo sự phân chia của tâm quả (phalacitta) trong lộ trình đạo (maggavīthi) và trong thời gian sau (kālantara).
Ekekassa hi ariyamaggassa anantarā tassa tasseva vipākabhūtāni nibbānārammaṇāni tīṇi dve vā phalacittāni uppajjanti anantaravipākattā lokuttarakusalānaṃ.
Immediately following each of the noble paths, three or two fruition-consciousnesses, which are the results of that noble path and have Nibbāna as their object, arise, due to supramundane wholesome kamma giving result immediately.
Vì các thiện pháp siêu thế (lokuttarakusala) có quả báo vô gián, nên ngay sau mỗi Thánh đạo, ba hoặc hai tâm quả làm đối tượng Niết Bàn, là quả báo của Thánh đạo đó, sẽ sinh khởi.
Yasmiñhi javanavāre ariyamaggo uppajjati, tattha yadā dve anulomāni, tadā tatiyaṃ gotrabhu, catutthaṃ maggacittaṃ, tato paraṃ tīṇi phalacittāni honti.
Indeed, in the javana-process wherein a noble path arises, when there are two conforming cognitions (anuloma), then the third is gotrabhū, the fourth is path-consciousness, and thereafter there are three fruition-consciousnesses.
Trong sát na tốc hành (javanavāra) nào Thánh đạo sinh khởi, nếu có hai tâm thuận thứ (anuloma), thì tâm chuyển tộc (gotrabhu) là thứ ba, tâm đạo là thứ tư, và sau đó là ba tâm quả.
Yadā pana tīṇi anulomāni, tadā catutthaṃ gotrabhu, pañcamaṃ maggacittaṃ, tato paraṃ dve phalacittāni honti.
However, when there are three conforming cognitions, then the fourth is gotrabhū, the fifth is path-consciousness, and thereafter there are two fruition-consciousnesses.
Nếu có ba tâm thuận thứ, thì tâm chuyển tộc là thứ tư, tâm đạo là thứ năm, và sau đó là hai tâm quả.
Evaṃ catutthaṃ pañcamaṃ appanāvasena pavattati, na tato paraṃ bhavaṅgassa āsannattā.
Thus, the fourth and fifth conscious-moments occur by way of absorption, and no further, because of the proximity of the life-continuum.
Như vậy, tâm thứ tư và thứ năm sinh khởi theo cách an định (appanā), không có tâm nào sau đó vì gần với hữu phần (bhavaṅga).
Keci pana ‘‘chaṭṭhampi cittaṃ appetī’’ti vadanti, taṃ aṭṭhakathāsu (visuddhi. 2.811) paṭikkhittaṃ.
Some, however, say that ‘the sixth consciousness also reaches absorption,’ but this is rejected in the Commentaries (Vism. 2.811).
Một số người nói rằng “tâm thứ sáu cũng an định,” nhưng điều đó đã bị bác bỏ trong các bản chú giải (aṭṭhakathā).
Evaṃ maggavīthiyaṃ phalaṃ veditabbaṃ.
Thus, fruition in the path-process should be understood.
Như vậy, quả trong lộ trình đạo cần được hiểu.
Kālantare phalaṃ pana phalasamāpattivasena pavattaṃ, nirodhā vuṭṭhahantassa uppajjamānañca eteneva saṅgahitaṃ.
Fruition at a later time, however, occurring by way of fruition-attainment, and arising for one emerging from the cessation-attainment, is also included in this.
Còn quả trong thời gian sau, sinh khởi theo cách quả nhập định (phalasamāpatti) và khi vị A-la-hán xuất khỏi diệt tận định (nirodha-samāpatti), cũng được bao gồm trong loại này.
Sā panāyaṃ phalasamāpatti atthato lokuttarakusalānaṃ vipākabhūtā nibbānārammaṇā appanāti daṭṭhabbā.
And this fruition-attainment is to be regarded, in essence, as the absorption that is the result of supramundane wholesome kamma and has Nibbāna as its object.
Và quả nhập định này, về bản chất, cần được xem là sự an định làm đối tượng Niết Bàn, là quả báo của các thiện pháp siêu thế.
Ke taṃ samāpajjanti, ke na samāpajjantīti?
Who attains it, and who does not attain it?
Ai thực hành nhập định đó, ai không thực hành nhập định đó?
Sabbepi puthujjanā na samāpajjanti anadhigatattā.
All ordinary people do not attain it, because they have not realized it.
Tất cả phàm nhân đều không thực hành nhập định đó vì chưa chứng đắc.
Tathā heṭṭhimā ariyā uparimaṃ, uparimāpi ariyā heṭṭhimaṃ na samāpajjantiyeva puggalantarabhāvūpagamanena paṭippassaddhabhāvato.
Likewise, lower noble ones do not attain higher fruition-attainments, nor do higher noble ones attain lower ones, because they have already transcended those states and their defilements are already appeased.
Tương tự, các Bậc Thánh thấp hơn không thực hành nhập định cao hơn, và các Bậc Thánh cao hơn cũng không thực hành nhập định thấp hơn, vì chúng đã được an tịnh bằng cách đạt đến trạng thái của một cá nhân khác.
Attano eva phalaṃ te te ariyā samāpajjanti.
Each of those noble ones attains only their own fruition.
Các Bậc Thánh đó chỉ thực hành nhập định quả vị của chính mình.
Keci pana ‘‘sotāpannasakadāgāmino phalasamāpattiṃ na samāpajjanti, uparimā dveyeva samāpajjanti samādhismiṃ paripūrakāribhāvato’’ti vadanti.
Some, however, say that ‘stream-enterers and once-returners do not attain fruition-attainment, only the two higher ones attain it because they are perfect in concentration.’
Một số người lại nói rằng: "Bậc Nhập Lưu (Sotāpanna) và Nhất Lai (Sakadāgāmī) không nhập quả định (phalasamāpatti), chỉ có hai bậc trên (Bất Lai và A-la-hán) mới nhập, vì họ đã thành tựu viên mãn về định (samādhi)."
Taṃ akāraṇaṃ puthujjanassāpi attanā paṭiladdhalokiyasamādhisamāpajjanato.
That is not reasonable, because even an ordinary person attains their own worldly concentration that they have gained.
Điều đó không có lý do, vì ngay cả phàm phu (puthujjana) cũng có thể nhập các thiền định thế gian (lokiyasamādhi) mà mình đã đạt được.
Kiṃ vā ettha kāraṇacintāya?
Or what is the point of considering a reason here?
Hơn nữa, có ích gì khi suy tư về lý do ở đây?
Vuttañhetaṃ paṭisambhidāyaṃ ‘‘katamā dasa saṅkhārupekkhā vipassanāvasena uppajjanti (paṭi. ma. 1.57), katame dasa gotrabhudhammā vipassanāvasena uppajjantī’’ti (paṭi. ma. 1.60) imesaṃ pañhānaṃ vissajjane sotāpattiphalasamāpattatthāya sakadāgāmiphalasamāpattatthāyāti tesampi ariyānaṃ phalasamāpattisamāpajjanaṃ vuttaṃ.
It is said in the Paṭisambhidāmagga, in the explanation of the questions "What are the ten equanimities regarding formations that arise by way of insight?" and "What are the ten gotrabhū qualities that arise by way of insight?", that even for these noble ones, the attainment of the fruit (phalasamāpatti) is mentioned for the purpose of attaining the fruit of Stream-entry and for the purpose of attaining the fruit of Once-returning.
Vì điều này đã được nói trong Paṭisambhidāmagga khi giải đáp các câu hỏi "Mười loại xả hành (saṅkhārupekkhā) nào phát sinh do tuệ quán (vipassanā)?" và "Mười pháp chuyển chủng (gotrabhudhammā) nào phát sinh do tuệ quán?", rằng các bậc Thánh đó cũng nhập quả định (phalasamāpatti) để đạt được quả Nhập Lưu (sotāpattiphala) và quả Nhất Lai (sakadāgāmiphala).
Tasmā sabbepi ariyā yathāsakaṃ phalaṃ samāpajjantīti niṭṭhamettha gantabbaṃ.
Therefore, it should be concluded here that all noble ones attain their respective fruits.
Vì vậy, phải kết luận rằng tất cả các bậc Thánh đều nhập quả định tương ứng với quả vị của mình.
Ayaṃ panettha samāpajjanakkamo – phalasamāpattitthikena ariyasāvakena rahogatena paṭisallīnena udayabbayādivasena saṅkhārā vipassitabbā.
This, here, is the method of entering (samāpatti): By an Ariya disciple desiring fruit-attainment, having gone to a secluded place and being in solitude, the formations should be contemplated with vipassanā by means of rise and fall, etc.
Đây là trình tự nhập định ở đây: Một Thánh đệ tử (ariyasāvaka) muốn nhập quả định, sau khi đi đến nơi vắng vẻ và ẩn mình, phải quán chiếu các hành (saṅkhāra) theo cách sinh diệt (udayabbayādivasena).
Tassevaṃ pavattānupubbavipassanasseva saṅkhārārammaṇagotrabhuñāṇānantaraṃ phalasamāpattivasena nirodhe cittamappeti, phalasamāpattininnabhāvena ca sekkhassāpi phalameva uppajjati, na maggo.
For that very person whose vipassanā is thus progressively developing, immediately after the gotrabhu-ñāṇa whose object is formations, the mind settles upon Nibbāna by way of fruit-attainment. And due to its inclination towards fruit-attainment, for a sekkha too, only the fruit arises, not the path.
Đối với người đã tu tập tuệ quán (vipassanā) tuần tự như vậy, ngay sau trí chuyển chủng (gotrabhuñāṇa) lấy các hành làm đối tượng, tâm sẽ hướng đến sự đoạn diệt (nirodhe) theo cách nhập quả định (phalasamāpattivasena), và do khuynh hướng hướng về quả định, ngay cả đối với bậc Hữu Học (sekkhassa), chỉ có quả (phala) phát sinh, chứ không phải đạo (magga).
Ye pana vadanti ‘‘sotāpanno attano phalasamāpattiṃ samāpajjissāmīti vipassanaṃ vaḍḍhetvā sakadāgāmī hoti, sakadāgāmī ca anāgāmī’’ti.
But those who say, “A sotāpanna, having developed vipassanā with the intention of attaining their own fruit-attainment, becomes a sakadāgāmī; and a sakadāgāmī becomes an anāgāmī,”
Còn những người nói rằng: "Bậc Nhập Lưu (Sotāpanna) tăng trưởng tuệ quán với ý định nhập quả định của mình thì trở thành bậc Nhất Lai (Sakadāgāmī), và bậc Nhất Lai thì trở thành bậc Bất Lai (Anāgāmī),"
Te vattabbā – evaṃ sante anāgāmī arahā bhavissati, arahā ca paccekabuddho, paccekabuddho ca sambuddhoti āpajjeyya, tasmā yathābhinivesaṃ yathājjhāsayaṃ vipassanā atthaṃ sādhetīti sekkhassāpi phalameva uppajjati, na maggo.
should be told: If that were the case, an anāgāmī would become an arahant, an arahant a Paccekabuddha, and a Paccekabuddha a Sammāsambuddha, which would follow. Therefore, since vipassanā accomplishes its purpose according to one’s resolve and disposition, for a sekkha too, only the fruit arises, not the path.
Thì họ phải được nói rằng: "Nếu vậy, bậc Bất Lai sẽ trở thành A-la-hán, A-la-hán sẽ trở thành Độc Giác Phật (Paccekabuddha), và Độc Giác Phật sẽ trở thành Chánh Đẳng Giác (Sambuddha)." Điều đó sẽ xảy ra, do đó, tuệ quán (vipassanā) đạt được mục đích tùy theo sự quyết tâm và ý định. Vì vậy, ngay cả đối với bậc Hữu Học (sekkhassa), chỉ có quả (phala) phát sinh, chứ không phải đạo (magga).
Phalampi tassa sace anena paṭhamajjhāniko maggo adhigato, paṭhamajjhānikameva uppajjati.
As for the fruit, if that person has attained the path associated with the first jhāna, then only the fruit associated with the first jhāna arises.
Nếu đạo (magga) mà người ấy đã đạt được là đạo liên hệ đến sơ thiền (paṭhamajjhānika), thì quả (phala) của người ấy cũng sẽ là quả liên hệ đến sơ thiền.
Sace dutiyādīsu aññatarajjhāniko, dutiyādīsu aññatarajjhānikamevāti.
If it is a path associated with any of the second (jhāna) and so on, then only the fruit associated with that particular jhāna, from the second and so on, arises.
Nếu là đạo liên hệ đến một trong các thiền thứ hai trở đi, thì quả cũng sẽ là quả liên hệ đến một trong các thiền thứ hai trở đi.
Kasmā panettha gotrabhuñāṇaṃ maggañāṇapurecārikaṃ viya nibbānārammaṇaṃ na hotīti?
Why, in this case, is the gotrabhu-ñāṇa not focused on Nibbāna, like the one preceding the path-knowledge?
Tại sao ở đây trí chuyển chủng (gotrabhuñāṇa) không lấy Nibbāna làm đối tượng như trí đi trước đạo trí (maggañāṇa)?
Phalañāṇānaṃ aniyyānikabhāvato.
Because the fruit-knowledges are not niyyānika (leading to liberation).
Vì các quả trí (phalañāṇa) không có tính chất xuất ly (aniyyānikabhāvato).
Ariyamaggadhammāyeva hi niyyānikā.
For only the Ariya path-dharmas are niyyānika.
Chỉ có các pháp Thánh đạo (ariyamaggadhammā) mới có tính chất xuất ly (niyyānika).
Vuttañhetaṃ ‘‘katame dhammā niyyānikā?
It has been said: “Which are the niyyānika dharmas?
Điều này đã được nói: "Những pháp nào có tính chất xuất ly?
Cattāro ariyamaggā apariyāpannā’’ti (dha. sa. 1295).
The four Ariya paths, not included (in the three realms).”
Bốn Thánh đạo (ariyamagga) không thuộc về ba cõi (apariyāpannā)."
Tasmā ekanteneva niyyānikabhāvassa ubhato vuṭṭhānabhāvena pavattamānassa anantarapaccayabhūtena ñāṇena nimittato vuṭṭhiteneva bhavitabbanti tassa nibbānārammaṇatā yuttā, na pana ariyamaggassa bhāvitattā tassa vipākabhāvena pavattamānānaṃ kilesānaṃ asamucchindanato aniyyānikattā avuṭṭhānasabhāvānaṃ phalañāṇānaṃ purecārikañāṇassa kadācipi nibbānārammaṇatā ubhayattha anulomañāṇānaṃ atulyākārato.
Therefore, it is appropriate for the knowledge (gotrabhu-ñāṇa) that is an immediate condition for the niyyānika state, which arises by rising from both (the mundane and supramundane), to have Nibbāna as its object, having risen from the sign (of formations). But it is not appropriate for the preceding knowledge of the fruit-knowledges, which are not niyyānika because they do not utterly cut off defilements, and which arise as the result of the Ariya path having been cultivated, and which are of a non-rising nature, to ever have Nibbāna as its object, because the nature of the anuloma-ñāṇas is not the same in both cases.
Vì vậy, trí đi trước (gotrabhuñāṇa) của quả trí, do không có tính chất xuất ly và không đoạn trừ hoàn toàn các phiền não phát sinh như là quả của Thánh đạo đã được tu tập, không thể lấy Nibbāna làm đối tượng trong bất kỳ trường hợp nào, bởi vì các trí thuận thứ (anulomañāṇa) trong cả hai trường hợp (trước đạo trí và trước quả trí) có đặc tính không tương đồng.
Ariyamaggavīthiyañhi anulomañāṇāni anibbiddhapubbānaṃ thūlathūlānaṃ lobhakkhandhādīnaṃ sātisayaṃ padālanena lokiyañāṇena ukkaṃsapāramippattāni maggañāṇānukūlāni uppajjanti, phalasamāpattivīthiyaṃ pana tāni tāni tena tena maggena tesaṃ tesaṃ kilesānaṃ samucchinnattā tattha nirussukkāni kevalaṃ ariyānaṃ phalasamāpattisukhasamaṅgibhāvassa parikammamattāni hutvā uppajjantīti na tesaṃ kutoci vuṭṭhānasambhavo, yato tesaṃ pariyosāne ñāṇaṃ saṅkhāranimittaṃ vuṭṭhānato nibbānārammaṇaṃ siyā.
For in the Ariya path-process, the anuloma-ñāṇas arise as conducive to the path-knowledge, having reached the pinnacle of excellence among mundane knowledges by intensely piercing the gross defilements such as the aggregate of greed, which had not been pierced before. In the fruit-attainment process, however, those same (anuloma-ñāṇas) arise as merely preparatory for the Ariyas’ enjoyment of the bliss of fruit-attainment, being unconcerned with piercing defilements, since those defilements have already been utterly cut off by their respective paths. Therefore, there is no possibility of their rising from anything, such that at their conclusion, knowledge (the gotrabhu-ñāṇa) would be focused on Nibbāna by rising from the sign of formations.
Trong tiến trình Thánh đạo (ariyamaggavīthiyaṃ), các trí thuận thứ (anulomañāṇa) phát sinh, đã đạt đến đỉnh cao của trí thế gian (lokiyañāṇa) bằng cách đoạn trừ một cách đặc biệt các khối tham ái thô thiển chưa từng bị xuyên phá trước đây, và chúng tương thích với đạo trí (maggañāṇa). Còn trong tiến trình nhập quả định (phalasamāpattivīthiyaṃ), do các phiền não đó đã được đoạn trừ hoàn toàn bằng đạo tương ứng, các trí thuận thứ đó trở nên không còn nỗ lực trong việc đoạn trừ phiền não, chỉ là sự chuẩn bị (parikamma) để các bậc Thánh đạt được hạnh phúc của quả định (phalasamāpattisukhasamaṅgibhāvassa), vì vậy không thể có sự xuất ly khỏi bất kỳ điều gì, từ đó trí cuối cùng của chúng có thể lấy Nibbāna làm đối tượng do xuất ly khỏi tướng của các hành (saṅkhāranimittaṃ).
Evañca katvā sekkhassa attano phalasamāpattivaḷañjanatthāya udayabbayādivasena saṅkhāre sammasantassa vipassanāñāṇānupubbāya phalameva uppajjati, na maggoti ayañca attho samatthito hoti.
And having established this, the meaning that for a sekkha, when contemplating formations by way of rise and fall, etc., for the purpose of experiencing their own fruit-attainment, only the fruit arises in sequence with the vipassanā-knowledges, and not the path, is thus confirmed.
Và như vậy, ý nghĩa này được xác lập rằng: khi bậc Hữu Học (sekkhassa) quán chiếu các hành (saṅkhāra) theo cách sinh diệt (udayabbayādivasena) để thọ hưởng quả định của mình, thì chỉ có quả (phala) phát sinh theo tuần tự của các tuệ quán (vipassanāñāṇa), chứ không phải đạo (magga).
Evaṃ tāva phalasamāpattiyā samāpajjanaṃ veditabbaṃ.
Thus, first, the entering of fruit-attainment should be understood.
Như vậy, trước hết, cần phải hiểu sự nhập quả định (phalasamāpattiyā samāpajjanaṃ).
Athāti adhikāratthe nipāto.
Atha is a particle in the sense of 'further' or 'subsequent'.
Athā là một từ phụ (nipāta) mang nghĩa "hơn nữa" (adhikāratthe).
Khoti padapūraṇe.
Kho is for filling out the phrase.
Kho là một từ phụ để làm đầy đủ câu (padapūraṇe).
Tesu adhikāratthena athāti iminā vimuttisukhapaṭisaṃvedanato aññaṃ adhikāraṃ dasseti.
Among these, by the particle atha in the sense of 'further', another subsequent matter is indicated, distinct from the experience of the bliss of liberation.
Trong số đó, với nghĩa "hơn nữa" (adhikāratthe), từ athā này chỉ ra một điều kiện khác ngoài việc cảm nhận niềm an lạc giải thoát.
Ko panesoti?
What is it?
Điều đó là gì?
Paṭiccasamuppādamanasikāro.
It is the attention to paṭiccasamuppāda.
Là sự tác ý đến Duyên Khởi (Paṭiccasamuppāda).
Athāti vā pacchāti etasmiṃ atthe nipāto, tena ‘‘tassa sattāhassa accayenā’’ti vakkhamānameva atthaṃ joteti.
Or, atha is a particle in the sense of 'afterwards'; thereby, it illuminates the meaning of what will be stated: “after the lapse of that week.”
Hoặc athā là một từ phụ mang nghĩa "sau đó" (pacchā). Từ đó, nó làm sáng tỏ ý nghĩa sẽ được nói đến là "sau khi bảy ngày đó trôi qua."
Tassa sattāhassāti pallaṅkasattāhassa.
Tassa sattāhassa means the week of the Bodhi-seat.
Tassa sattāhassa có nghĩa là "của bảy ngày ngồi kiết già (pallaṅkasattāhassa)."
Accayenāti apagamena.
Accayena means by the passing away.
Accayenā có nghĩa là "sau khi trôi qua" (apagamena).
Tamhā samādhimhāti arahattaphalasamādhito.
Tamhā samādhimhā means from that samādhi of Arahantship-fruit.
Tamhā samādhimhā có nghĩa là "từ định của quả A-la-hán (arahattaphalasamādhi)."
Idha pana ṭhatvā paṭipāṭiyā satta sattāhāni dassetabbānīti keci tāni vitthārayiṃsu.
Some here, staying in this context, expounded the seven weeks in sequence, saying they should be shown.
Ở đây, một số người đã mở rộng ra để trình bày bảy tuần lễ theo thứ tự.
Mayaṃ pana tāni khandhakapāṭhena imissā udānapāḷiyā avirodhadassanamukhena parato vaṇṇayissāma.
However, we shall describe them later in accordance with the Khandhaka text, in a way that shows no contradiction with this Udāna Pāḷi.
Tuy nhiên, chúng tôi sẽ giải thích chúng sau, theo văn bản của Khandhaka và theo cách trình bày sự hòa hợp với Kinh Udāna này.
Rattiyāti avayavasambandhe sāmivacanaṃ.
Rattiyā is a genitive case in the sense of a part-whole relationship (of the night).
Rattiyā là cách nói sở hữu (sāmivacanaṃ) trong mối quan hệ bộ phận.
Paṭhamanti accantasaṃyogatthe upayogavacanaṃ.
The word paṭhamaṃ is a term used for the accusative case in the sense of absolute connection.
Paṭhamaṃ là cách dùng đối cách (upayogavacanaṃ) trong nghĩa "liên tục" (accantasaṃyogatthe).
Bhagavā hi tassā rattiyā sakalampi paṭhamaṃ yāmaṃ teneva manasikārena yutto ahosīti.
Indeed, the Blessed One spent the entire first watch of that night engaged in that same mode of attention.
Vì Đức Thế Tôn đã an trụ trong sự tác ý đó suốt cả canh đầu của đêm ấy.
Paṭiccasamuppādanti paccayadhammaṃ.
Paṭiccasamuppāda means the aggregate of causal phenomena.
Paṭiccasamuppādaṃ là pháp nhân duyên (paccayadhammaṃ).
Avijjādayo hi paccayadhammā paṭiccasamuppādo.
Indeed, causal phenomena such as avijjā (ignorance) and so forth are paṭiccasamuppāda.
Các pháp nhân duyên như vô minh (avijjā) v.v... chính là Duyên Khởi (Paṭiccasamuppāda).
Kathamidaṃ jānitabbanti ce?
If one asks, "How is this to be known?"
Nếu hỏi: "Làm sao biết được điều này?"
Bhagavato vacanena.
Through the word of the Blessed One.
Là do lời dạy của Đức Thế Tôn.
Bhagavatā hi ‘‘tasmātihānanda, eseva hetu, etaṃ nidānaṃ, esa samudayo, esa paccayo jarāmaraṇassa, yadidaṃ jāti…pe… saṅkhārānaṃ, yadidaṃ avijjā’’ti (dī. ni. 2.105 ādayo) evaṃ avijjādayo hetūti vuttā.
For the Blessed One stated: "Therefore, Ānanda, this is the reason, this is the origin, this is the arising, this is the condition for old age and death, namely, birth... (abridged)... for formations, namely, avijjā," thus stating that avijjā and so forth are conditions.
Đức Thế Tôn đã dạy rằng các pháp như vô minh (avijjā) là nhân, như trong câu: "Này Ānanda, đây chính là nhân, đây là cội nguồn, đây là sự phát sinh, đây là duyên của già chết, tức là sinh... (v.v.)... của các hành (saṅkhārā), tức là vô minh."
Yathā dvādasa paccayā dvādasa paṭiccasamuppādāti.
Just as the twelve conditions are the twelve paṭiccasamuppādas.
Như mười hai duyên là mười hai Paṭiccasamuppāda (Duyên khởi).
Tatrāyaṃ vacanattho – aññamaññaṃ paṭicca paṭimukhaṃ katvā kāraṇasamavāyaṃ appaṭikkhipitvā sahite uppādetīti paṭiccasamuppādo.
In this context, the etymological meaning is: that which gives rise to associated (phenomena) by making each other a condition, without rejecting the concordance of causes, is paṭiccasamuppāda.
Ở đây, ý nghĩa của từ ngữ là: Paṭiccasamuppāda là sự phát sinh khi nương tựa lẫn nhau, không phủ nhận sự hòa hợp của các nhân, mà cùng nhau tạo ra các pháp đồng sinh.
Atha vā paṭicca paccetabbaṃ paccayārahataṃ paccayaṃ paṭigantvā na vinā tena sambandhassa uppādo paṭiccasamuppādo.
Alternatively, paṭiccasamuppāda is the arising of an effect that is connected to a condition, not without that condition, having approached a condition that is to be understood as a cause and is fit to be a condition.
Hoặc, Paṭiccasamuppāda là sự phát sinh của một mối liên hệ không thể thiếu, sau khi đã tiếp nhận một nhân đáng được nương tựa, một nhân có tính cách duyên.
Paṭiccasamuppādoti cettha samuppādapadaṭṭhānavacanaviññeyyo phalassa uppādanasamatthatāyutto hetu, na paṭiccasamuppattimattaṃ veditabbaṃ.
Here, in "paṭiccasamuppāda," the word "samuppāda" refers to a cause endowed with the ability to produce fruit, and it should not be understood as merely the arising of conditions.
Ở đây, Paṭiccasamuppāda cần được hiểu là nhân có khả năng tạo ra quả, không chỉ là sự phát sinh của các duyên.
Atha vā paccetuṃ arahanti naṃ paṇḍitāti paṭicco, sammā sayameva vā uppādetīti samuppādo, paṭicco ca so samuppādo cāti paṭiccasamuppādoti evamettha attho daṭṭhabbo.
Alternatively, the meaning here should be understood as: paṇḍitas are capable of approaching it, hence it is paṭicca; it arises rightly or by itself, hence it is samuppāda; it is paṭicca and it is samuppāda, thus it is paṭiccasamuppāda.
Hoặc, các bậc hiền trí nên nương tựa vào nó nên gọi là Paṭicca; tự nó sinh ra một cách đúng đắn nên gọi là Samuppāda; nó vừa là Paṭicca vừa là Samuppāda, nên gọi là Paṭiccasamuppāda. Ý nghĩa ở đây cần được hiểu như vậy.
Anulomanti ‘‘avijjāpaccayā saṅkhārā’’tiādinā nayena vutto avijjādiko paccayākāro attanā kattabbakiccakaraṇato anulomoti vuccati.
Anuloma is said to be the causal aspect beginning with avijjā, as described by the method starting with "dependent on avijjā are formations," because it performs its own designated function.
Anuloma (thuận chiều) được gọi như vậy vì cách thức duyên khởi như vô minh (avijjā) v.v., được nói theo cách "do vô minh có các hành (saṅkhārā)" v.v., thực hiện chức năng cần làm của chính nó.
Atha vā ādito paṭṭhāya antaṃ pāpetvā vuttattā pavattiyā vā anulomato anulomo, taṃ anulomaṃ.
Alternatively, it is called anuloma because it is stated from beginning to end, or because of its conformity with occurrence, and that is anuloma.
Hoặc, nó là anuloma vì được nói từ đầu đến cuối, hoặc vì sự vận hành theo chiều thuận.
Sādhukaṃ manasākāsīti sakkaccaṃ manasi akāsi.
Sādhukaṃ manasākāsi means he paid careful attention.
Sādhukaṃ manasākāsi (tác ý kỹ lưỡng) có nghĩa là chú tâm một cách cẩn trọng.
Yo yo paccayadhammo yassa yassa paccayuppannadhammassa yathā yathā hetupaccayādinā paccayabhāvena paccayo hoti, taṃ sabbaṃ aviparītaṃ aparihāpetvā anavasesato paccavekkhaṇavasena citte akāsīti attho.
The meaning is that he thoroughly reflected in his mind, without distortion, without omission, and without remainder, on how each causal phenomenon acts as a condition for its respective dependently arisen phenomenon by way of cause-condition and so forth.
Nghĩa là, Ngài đã tác ý vào tâm tất cả những cách thức mà mỗi pháp duyên là duyên cho mỗi pháp do duyên sinh, như nhân duyên v.v., một cách không sai lạc, không bỏ sót, không còn gì.
Yathā pana bhagavā paṭiccasamuppādānulomaṃ manasākāsi, taṃ saṅkhepena tāva dassetuṃ ‘‘iti imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjatī’’ti vuttaṃ.
And to briefly show how the Blessed One attended to the arising of paṭiccasamuppāda, it is said: "When this exists, that comes to be; with the arising of this, that arises."
Để tóm tắt cách Đức Thế Tôn đã tác ý thuận chiều Duyên khởi, đã nói rằng "Do cái này có mặt, cái kia có; do cái này sinh, cái kia sinh."
Tattha itīti evaṃ, anena pakārenāti attho.
Therein, iti means "thus," or "in this manner."
Trong đó, iti có nghĩa là "như vậy", "theo cách này".
Imasmiṃ sati idaṃ hotīti imasmiṃ avijjādike paccaye sati idaṃ saṅkhārādikaṃ phalaṃ hoti.
Imasmiṃ sati idaṃ hoti means: when this condition, such as avijjā, exists, then this result, such as saṅkhāras, comes to be.
Imasmiṃ sati idaṃ hoti có nghĩa là "khi duyên này, như vô minh (avijjā) v.v., có mặt, thì quả này, như các hành (saṅkhārā) v.v., có."
Imassuppādā idaṃ uppajjatīti imassa avijjādikassa paccayassa uppādā idaṃ saṅkhārādikaṃ phalaṃ uppajjatīti attho.
Imassuppādā idaṃ uppajjati means: with the arising of this condition, such as avijjā, this result, such as saṅkhāras, arises.
Imassuppādā idaṃ uppajjati có nghĩa là "do sự sinh khởi của duyên này, như vô minh (avijjā) v.v., thì quả này, như các hành (saṅkhārā) v.v., sinh khởi."
Imasmiṃ asati idaṃ na hoti, imassa nirodhā idaṃ nirujjhatīti avijjādīnaṃ abhāve saṅkhārādīnaṃ abhāvassa avijjādīnaṃ nirodhe saṅkhārādīnaṃ nirodhassa ca dutiyatatiyasuttavacanena etasmiṃ paccayalakkhaṇe niyamo dassito hoti – imasmiṃ sati eva, nāsati.
By the statement in the second and third suttas, "When this does not exist, that does not come to be; with the cessation of this, that ceases," a rule is shown regarding this characteristic of conditionality: only when this exists, not when it does not exist.
Với câu nói trong kinh thứ hai và thứ ba về "khi cái này không có, cái kia không có; do cái này diệt, cái kia diệt", quy luật trong đặc tính duyên này được chỉ ra là: "chỉ khi cái này có mặt, chứ không phải khi không có."
Imassuppādā eva, nānuppādā.
Only with the arising of this, not with its non-arising.
"Chỉ do cái này sinh, chứ không phải do không sinh."
Anirodhā eva, na nirodhāti.
Only with its non-cessation, not with its cessation.
"Chỉ do cái này không diệt, chứ không phải do diệt."
Tenetaṃ lakkhaṇaṃ antogadhaniyamaṃ idha paṭiccasamuppādassa vuttanti daṭṭhabbaṃ.
Therefore, it should be understood that this characteristic, which contains a rule, is stated here concerning paṭiccasamuppāda.
Vì vậy, đặc tính này, bao hàm quy luật, được nói ở đây là của Paṭiccasamuppāda.
Nirodhoti ca avijjādīnaṃ virāgādhigamena āyatiṃ anuppādo appavatti.
And nirodha (cessation) is the non-arising, the non-occurrence in the future, of avijjā and so forth, through their complete dispassion and attainment.
Và nirodha (sự diệt) có nghĩa là sự không sinh khởi, sự không tiếp diễn trong tương lai của vô minh (avijjā) v.v., thông qua sự ly tham (virāga).
Tathā hi vuttaṃ – ‘‘avijjāya tveva asesavirāganirodhā saṅkhāranirodho’’tiādi.
Thus it is said: "However, with the complete fading away and cessation of avijjā, there is the cessation of saṅkhāras," and so forth.
Quả thật, đã nói rằng: "Chỉ do sự ly tham hoàn toàn và sự diệt của vô minh (avijjā) mà có sự diệt của các hành (saṅkhārā)" v.v.
Nirodhanirodhī ca uppādanirodhībhāvena vutto ‘‘imassa nirodhā idaṃ nirujjhatī’’ti.
And the cessation of cessation is spoken of as the cessation of arising by the phrase "with the cessation of this, that ceases."
Sự đối lập với diệt (nirodha) là sinh (uppāda), và sự sinh này được nói là đối lập với diệt qua câu "do cái này diệt, cái kia diệt".
Tenetaṃ dasseti – anirodho uppādo nāma, so cettha atthibhāvotipi vuccatīti.
Thereby, it shows this meaning: non-cessation is called arising, and that arising is also called existence here.
Do đó, nó chỉ ra ý nghĩa này: cái không diệt (anirodha) được gọi là sự sinh (uppāda), và ở đây nó cũng được gọi là sự hiện hữu.
‘‘Imasmiṃ sati idaṃ hotī’’ti idameva hi lakkhaṇaṃ pariyāyantarena ‘‘imassa uppādā idaṃ uppajjatī’’ti vadantena parena purimaṃ visesitaṃ hoti.
Indeed, by stating this very characteristic in another way with "with the arising of this, that arises," the latter statement qualifies the former.
Quả thật, chính đặc tính "khi cái này có mặt, cái kia có" này đã được làm rõ bởi câu sau "do cái này sinh, cái kia sinh" thông qua một cách diễn đạt khác.
Tasmā na dharamānataṃyeva sandhāya ‘‘imasmiṃ satī’’ti vuttaṃ, atha kho maggena aniruddhabhāvañcāti viññāyati.
Therefore, "when this exists" is not stated merely with reference to its present existence, but it is understood that it also refers to its unceased state by means of the path.
Vì vậy, "khi cái này có mặt" không chỉ được nói để chỉ sự hiện hữu, mà còn để chỉ trạng thái chưa bị diệt bởi Đạo (magga).
Yasmā ca ‘‘imasmiṃ asati idaṃ na hoti, imassa nirodhā idaṃ nirujjhatī’’ti dvidhāpi uddiṭṭhassa lakkhaṇassa niddesaṃ vadantena ‘‘avijjāya tveva asesavirāganirodhā saṅkhāranirodho’’tiādinā nirodho eva vutto, tasmā natthibhāvopi nirodho evāti natthibhāvaviruddho atthibhāvo anirodhoti dassitaṃ hoti.
And since cessation is spoken of in both ways for the characteristic that is stated as "when this does not exist, that does not come to be; with the cessation of this, that ceases," by statements like "with the complete fading away and cessation of avijjā, there is the cessation of saṅkhāras," therefore it is shown that non-existence is also cessation, and that existence, which is contrary to non-existence, is non-cessation.
Và vì, khi nói về sự chỉ định của đặc tính được trình bày theo hai cách "khi cái này không có, cái kia không có; do cái này diệt, cái kia diệt", chỉ có sự diệt (nirodha) được nói đến qua câu "chỉ do sự ly tham hoàn toàn và sự diệt của vô minh (avijjā) mà có sự diệt của các hành (saṅkhārā)" v.v., nên trạng thái không hiện hữu cũng là sự diệt. Như vậy, trạng thái hiện hữu, đối lập với trạng thái không hiện hữu, được chỉ ra là không diệt (anirodha).
Tena anirodhasaṅkhātena atthibhāvena uppādaṃ viseseti.
Thereby, it qualifies arising by existence, which is called non-cessation.
Do đó, nó làm rõ sự sinh (uppāda) bằng trạng thái hiện hữu được gọi là không diệt.
Tato na idha atthibhāvamattaṃ uppādoti attho adhippeto, atha kho anirodhasaṅkhāto atthibhāvo cāti ayamattho vibhāvitoti.
From this, it is not intended that merely existence here is arising, but rather that existence, which is called non-cessation, is also intended, and this meaning is clarified.
Từ đó, ý nghĩa ở đây không phải là chỉ trạng thái hiện hữu đơn thuần là sự sinh (uppāda), mà là trạng thái hiện hữu được gọi là không diệt (anirodha). Ý nghĩa này đã được làm rõ.
Evametaṃ lakkhaṇadvayavacanaṃ aññamaññavisesanavisesitabbabhāvena sātthakanti veditabbaṃ.
Thus, it should be understood that this twofold characteristic statement is meaningful by way of qualifying and being qualified by each other.
Như vậy, hai cách diễn đạt đặc tính này có ý nghĩa vì chúng làm rõ lẫn nhau.
Na hi aggamaggādhigamato uddhaṃ yāva parinibbānā saḷāyatanādīnaṃ appavatti.
For it is not that the six sense bases and so forth do not occur from the attainment of the highest path until parinibbāna.
Quả thật, không phải từ khi đạt được đạo quả tối thượng (aggamagga) cho đến khi nhập Niết Bàn (parinibbāna) mà các sáu xứ (saḷāyatana) v.v. không còn tiếp diễn.
Atha kho natthitā nirodhasaddavacanīyatā khīṇasaṃyojanatāti nirodho vutto.
Rather, cessation is spoken of as non-existence and as being worthy of the term "cessation" because of the destruction of fetters.
Mà chính sự không hiện hữu, sự xứng đáng được gọi là diệt (nirodha) do sự diệt tận kiết sử (khīṇasaṃyojanatā) mới được gọi là diệt.
Apica cirakatampi kammaṃ anibbattitaphalatāya appahīnāhāratāya ca phalārahaṃ santaṃ eva nāma hoti, na nibbattitaphalaṃ, nāpi pahīnāhāranti.
Furthermore, even an action performed long ago is capable of producing results by virtue of its unripened fruit and its unabandoned support, and thus it merely exists, it is not a ripened fruit, nor is its support abandoned.
Hơn nữa, ngay cả nghiệp đã tạo từ lâu, nếu chưa sinh quả và chưa bị đoạn trừ nhân, thì nó vẫn được gọi là có khả năng sinh quả, chứ không phải là đã sinh quả, cũng không phải là nhân đã bị đoạn trừ.
Phaluppattipaccayānaṃ avijjāsaṅkhārādīnaṃ vuttanayeneva phalārahabhāvo anirodhoti veditabbo.
The fitness of avijjā, saṅkhāras, and other causes for the arising of results, in the manner stated, should be understood as non-cessation.
Khả năng sinh quả của các nhân sinh quả như vô minh (avijjā), các hành (saṅkhārā) v.v., theo cách đã nói, cần được hiểu là không diệt (anirodha).
Evaṃ aniruddhabhāveneva hi yena vinā phalaṃ na sambhavati, taṃ kāraṇaṃ atītantipi imasmiṃ satīti iminā vacanena vuttaṃ.
Indeed, in this way, the cause, without which the result does not come to be, even if it is past, is stated by the words "when this exists" precisely by virtue of its unceased state.
Quả thật, chính do trạng thái không diệt này mà nhân, nếu không có nó thì quả không thể sinh khởi, dù đã là quá khứ, cũng được nói bằng câu "khi cái này có mặt".
Tatoyeva ca avusitabrahmacariyassa appavattidhammataṃ anāpanno paccayuppādo kālabhedaṃ anāmasitvā anivattanāya eva imassa uppādāti vutto.
And for this very reason, the origination of a condition, not having attained the state of non-occurrence for one who has not completed the holy life, is spoken of as ‘its arising’ for its non-cessation, without considering any distinction of time.
Và chính vì vậy, sự sinh khởi của duyên, chưa đạt đến trạng thái không tiếp diễn của người chưa sống Phạm hạnh, được nói là "do cái này sinh" mà không đề cập đến sự khác biệt về thời gian, chỉ để chỉ sự không quay trở lại.
Atha vā avasesapaccayasamavāye avijjamānassapi vijjamānassa viya pageva vijjamānassa yā phaluppattiabhimukhatā, sā imassa uppādāti vuttā.
Alternatively, the readiness for the arising of a result, which exists in a manner as if it existed even when it does not, when the remaining conditions are complete, or even more so when it does exist, is called 'its arising'.
Hoặc, sự hướng đến sinh quả, dù không hiện hữu khi các duyên còn lại hòa hợp, nhưng như thể đã hiện hữu từ trước, được gọi là "sự sinh của cái này".
Tathā hi tato phalaṃ uppajjatīti tadavatthaṃ kāraṇaṃ phalassa uppādanabhāvena uṭṭhitaṃ uppatitaṃ nāma hoti, na vijjamānampi atadavatthanti tadavatthatā uppādoti veditabbo.
Indeed, it is said that the result arises from that*; therefore, that very cause, being in the state of producing the result, is said to have arisen or come into being. Thus, even what does not exist is not in that state; hence, the state of being in that condition is to be understood as arising.
Quả thật, từ đó quả sinh khởi. Do đó, nhân ở trạng thái đó, khi trỗi dậy để sinh quả, được gọi là đã sinh. Dù không hiện hữu, nhưng không ở trạng thái đó. Vì vậy, trạng thái đó cần được hiểu là sự sinh.
Tattha satīti iminā vijjamānatāmattena paccayabhāvaṃ vadanto abyāpārataṃ paṭiccasamuppādassa dasseti.
Here, by the word ‘sati’ (there being), by merely stating the existence of the condition, he shows the non-agency of paṭiccasamuppāda.
Trong đó, bằng từ sati (có mặt), khi nói về trạng thái duyên chỉ bằng sự hiện hữu, nó chỉ ra sự không hoạt động của Paṭiccasamuppāda.
Uppādāti uppattidhammataṃ asabbakālabhāvitaṃ phaluppattiabhimukhatañca dīpento aniccataṃ paṭiccasamuppādassa dasseti.
By ‘uppādā’ (from the arising), by illuminating the nature of arising, its not occurring at all times, and its readiness for the arising of the result, he shows the impermanence of paṭiccasamuppāda.
Bằng từ uppādā (do sinh), khi chỉ ra trạng thái có tính chất sinh khởi, sự không hiện hữu ở mọi thời điểm, và sự hướng đến sinh quả, nó chỉ ra tính vô thường (aniccata) của Paṭiccasamuppāda.
‘‘Sati, nāsati, uppādā, na nirodhā’’ti pana hetuatthehi bhummanissakkavacanehi samatthitaṃ nidānasamudayajātipabhavabhāvaṃ paṭiccasamuppādassa dasseti.
Furthermore, by the words ‘‘Sati, nāsati, uppādā, na nirodhā’’ (there being, there not being; from the arising, not from the cessation), which express a causal meaning through locative and ablative cases, he shows paṭiccasamuppāda as being the nidāna (source), samudaya (origin), jāti (birth), and pabhava (origin).
Tuy nhiên, với các từ ngữ ở cách vị trí (locative) và cách xuất xứ (ablative) mang ý nghĩa nhân quả, tức là ‘‘khi có, không phải khi không có; do sự phát sinh, không phải do sự diệt đi’’, thì nó trình bày trạng thái nhân duyên (nidāna), tập khởi (samudaya), sinh khởi (jāti) và phát sinh (pabhava) của Paṭiccasamuppāda đã được xác lập.
Hetuatthatā cettha bhummavacane yassa bhāve tadavinābhāviphalassa bhāvo lakkhīyati, tattha pavattiyā veditabbā yathā ‘‘adhanānaṃ dhane ananuppadīyamāne dāliddiyaṃ vepullaṃ agamāsī’’ti (dī. ni. 3.91) ca ‘‘nipphannesu sassesu subhikkhaṃ jāyatī’’ti ca.
Here, the causal meaning of the locative case is to be understood as applying where, by the existence of something, the existence of its inseparable result is indicated, as in ‘‘When wealth is not given to the poor, poverty will increase’’ and ‘‘When crops are abundant, prosperity arises.’’
Ở đây, ý nghĩa nhân quả trong cách vị trí cần được hiểu là khi sự tồn tại của một điều gì đó được nhận biết, thì sự tồn tại của kết quả không thể tách rời khỏi điều đó cũng được nhận biết, như trong câu ‘‘khi của cải không được phân phát cho người nghèo, sự nghèo đói lan rộng’’ và ‘‘khi mùa màng bội thu, sự sung túc phát sinh’’.
Nissakkavacanassāpi hetuatthatā phalassa pabhave pakatiyañca pavattito yathā ‘‘kalalā hoti abbudaṃ, abbudā jāyatī pesī’’ti (saṃ. ni. 1.235) ca ‘‘himavatā gaṅgā pabhavanti, siṅgato saro jāyatī’’ti ca.
The ablative case also has a causal meaning, due to its occurrence as the origin and nature of the result, as in ‘‘From the morula comes the embryo, from the embryo is born the flesh’’ and ‘‘The Ganges arises from the Himālayas, a lake is born from a peak.’’
Ý nghĩa nhân quả của cách xuất xứ cũng được hiểu là do sự phát sinh của quả và do sự khởi đầu của bản chất, như trong câu ‘‘từ máu đông thành cục thịt, từ cục thịt sinh ra miếng thịt’’ và ‘‘sông Gaṅgā phát nguyên từ Hy Mã Lạp Sơn, từ sừng sinh ra âm thanh’’.
Avijjādibhāve ca tadavinābhāvena saṅkhārādibhāvo lakkhīyati, avijjādīhi ca saṅkhārādayo pabhavanti pakariyanti cāti te tesaṃ pabhavo pakati ca, tasmā tadatthadīpanatthaṃ ‘‘imasmiṃ sati imassa uppādā’’ti hetuatthe bhummanissakkaniddesā katāti.
And by the existence of ignorance (avijjā) and so forth, the existence of formations (saṅkhārā) and so forth is indicated as inseparable from it; and from ignorance and so forth, formations and so forth arise and are produced. Therefore, these (ignorance etc.) are their (formations etc.) origin and nature. For this reason, in order to illuminate that meaning, locative and ablative designations in a causal sense, ‘‘imasmiṃ sati imassa uppādā’’ (when this exists, this arises), are made.
Và khi vô minh (avijjā) và các yếu tố khác hiện hữu, sự hiện hữu của các hành (saṅkhārā) và các yếu tố khác được nhận biết một cách không thể tách rời; và từ vô minh và các yếu tố khác, các hành và các yếu tố khác phát sinh và được tạo ra. Do đó, chúng là nguồn gốc và bản chất của những điều đó. Vì vậy, để làm sáng tỏ ý nghĩa đó, các chỉ định cách vị trí và cách xuất xứ với ý nghĩa nhân quả ‘‘khi có điều này, điều này phát sinh’’ đã được thực hiện.
Yasmā cettha ‘‘imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjatī’’ti saṅkhepena uddiṭṭhassa paṭiccasamuppādassa ‘‘avijjāpaccayā saṅkhārā’’tiādiko niddeso, tasmā yathāvutto atthibhāvo uppādo ca tesaṃ tesaṃ paccayuppannadhammānaṃ paccayabhāvoti viññāyati.
Since the paṭiccasamuppāda, briefly stated as ‘‘When this exists, this comes to be; from the arising of this, this arises,’’ is elucidated here by the exposition beginning with ‘‘avijjāpaccayā saṅkhārā’’ (conditioned by ignorance, formations arise), it is understood that the aforementioned state of being and arising constitute the conditionality of those conditioned phenomena.
Và bởi vì ở đây, Paṭiccasamuppāda được trình bày tóm tắt là ‘‘khi có điều này, điều này xảy ra; do sự phát sinh của điều này, điều này phát sinh’’, thì lời giải thích ‘‘do duyên vô minh mà có các hành’’ v.v. được hiểu là trạng thái hiện hữu và sự phát sinh đó chính là trạng thái duyên của các pháp duyên và pháp do duyên sinh đó.
Na hi aniruddhatāsaṅkhātaṃ atthibhāvaṃ uppādañca anivattasabhāvatāsaṅkhātaṃ udayāvatthatāsaṅkhātaṃ vā ‘‘sati eva, nāsati, uppādā eva, na nirodhā’’ti antogadhaniyamehi vacanehi abhihitaṃ muñcitvā añño paccayabhāvo nāma atthi, tasmā yathāvutto atthibhāvo uppādo ca paccayabhāvoti veditabbaṃ.
For there is no other conditionality apart from the aforementioned state of being (which is the state of non-cessation) and arising (which is the state of not returning or the state of arising), as expressed by the restrictive clauses ‘‘sati eva, nāsati, uppādā eva, na nirodhā’’ (only when it exists, not when it does not; only from its arising, not from its cessation). Therefore, the aforementioned state of being and arising are to be understood as conditionality.
Thật vậy, không có trạng thái duyên nào khác ngoài trạng thái hiện hữu được gọi là không diệt và sự phát sinh được gọi là không ngừng nghỉ, hoặc được gọi là trạng thái khởi sinh, được trình bày bằng những lời nói có quy tắc giới hạn: ‘‘chỉ khi có, không phải khi không có; chỉ do sự phát sinh, không phải do sự diệt đi’’. Do đó, trạng thái hiện hữu và sự phát sinh như đã nói cần được hiểu là trạng thái duyên.
Yepi paṭṭhāne āgatā hetuādayo catuvīsati paccayā, tepi etasseva paccayabhāvassa visesāti veditabbā.
And the twenty-four conditions, such as the root condition (hetu), found in the Paṭṭhāna, are also to be understood as specific distinctions of this very conditionality.
Ngay cả hai mươi bốn duyên như nhân duyên (hetu-paccaya) v.v. được đề cập trong Paṭṭhāna cũng cần được hiểu là những đặc điểm riêng của trạng thái duyên này.
Iti yathā vitthārena anulomaṃ paṭiccasamuppādaṃ manasi akāsi, taṃ dassetuṃ, ‘‘yadidaṃ avijjāpaccayā saṅkhārā’’tiādi vuttaṃ.
Thus, in order to show how the Blessed One contemplated the paṭiccasamuppāda in forward order extensively, the statement beginning with ‘‘yadidaṃ avijjāpaccayā saṅkhārā’’ has been made.
Như vậy, để trình bày cách đã quán xét Paṭiccasamuppāda theo chiều thuận một cách chi tiết, lời nói ‘‘đó là, do duyên vô minh mà có các hành’’ v.v. đã được nói.
Tattha yadidanti nipāto, tassa yo ayanti attho.
Here, yadidaṃ is a particle; its meaning is ‘this which is’.
Trong đó, yadidaṃ là một giới từ, có nghĩa là ‘‘điều này là gì’’.
Avijjāpaccayātiādīsu avindiyaṃ kāyaduccaritādiṃ vindatīti avijjā, vindiyaṃ kāyasucaritādiṃ na vindatīti avijjā, dhammānaṃ aviparītasabhāvaṃ aviditaṃ karotīti avijjā, antavirahite saṃsāre bhavādīsu satte javāpetīti avijjā, avijjamānesu javati vijjamānesu na javatīti avijjā, vijjāya paṭipakkhāti avijjā, sā ‘‘dukkhe aññāṇa’’ntiādinā catubbidhā veditabbā.
Among Avijjāpaccayā and so forth, that which finds what should not be found, such as wrong conduct by body, is avijjā (ignorance); that which does not find what should be found, such as right conduct by body, is avijjā; that which makes the unperverted nature of phenomena unknown is avijjā; that which makes beings rush in existences and so forth in the endless cycle of saṃsāra is avijjā; that which arises among what does not exist (ultimately) and does not arise among what does exist (ultimately) is avijjā; that which is the opposite of vijja (knowledge) is avijjā. This (avijjā) is to be understood as fourfold, as in ‘‘ignorance of suffering’’ and so forth.
Trong các từ Avijjāpaccayā v.v.: ‘‘Avijjā’’ là cái tìm thấy những điều không đáng tìm như thân ác hạnh v.v.; ‘‘avijjā’’ là cái không tìm thấy những điều đáng tìm như thân thiện hạnh v.v.; ‘‘avijjā’’ là cái làm cho bản chất không sai lệch của các pháp trở nên không được biết đến; ‘‘avijjā’’ là cái khiến chúng sinh chạy theo các cõi tái sinh v.v. trong vòng luân hồi vô tận; ‘‘avijjā’’ là cái chạy theo những điều không hiện hữu và không chạy theo những điều hiện hữu; ‘‘avijjā’’ là đối nghịch của minh (vijjā). Vô minh này cần được hiểu là có bốn loại, như ‘‘không biết khổ’’ v.v.
Paṭicca na vinā phalaṃ eti uppajjati ceva pavattati cāti paccayo, upakārakattho vā paccayo.
That, conditioned by which, a result comes to be, arises and persists, is paccaya (condition); or, a condition is a helper.
Cái nương tựa vào (paṭicca) mà quả không thể không sinh khởi và tiếp diễn, đó là paccaya (duyên), hoặc ‘‘paccaya’’ là cái có ý nghĩa hỗ trợ.
Avijjā ca sā paccayo cāti avijjāpaccayo, tasmā avijjāpaccayā.
That which is avijjā and is also a condition is avijjāpaccaya; therefore, avijjāpaccayā (conditioned by ignorance).
Vô minh (avijjā) là duyên, nên là avijjāpaccayo, do đó avijjāpaccayā.
Saṅkharontīti saṅkhārā, lokiyakusalākusalacetanā, sā puññāpuññāneñjābhisaṅkhāravasena tividhā veditabbā.
They fabricate or prepare; therefore, they are saṅkhārā (formations). These are mundane wholesome and unwholesome volitions. This (saṅkhārā) is to be understood as threefold in terms of meritorious (puññābhisaṅkhāra), demeritorious (apuññābhisaṅkhāra), and imperturbable (āneñjābhisaṅkhāra) formations.
Cái tạo tác là saṅkhārā (hành), tức là các ý định thiện và bất thiện thuộc thế gian. Hành này cần được hiểu là có ba loại: phước hành (puññābhisaṅkhāra), phi phước hành (apuññābhisaṅkhāra) và bất động hành (āneñjābhisaṅkhāra).
Vijānātīti viññāṇaṃ, taṃ lokiyavipākaviññāṇavasena dvattiṃsavidhaṃ.
It cognizes; therefore, it is viññāṇaṃ (consciousness). This is thirty-two-fold in terms of mundane resultant consciousness.
Cái biết là viññāṇaṃ (thức), thức này có ba mươi hai loại theo thức quả thuộc thế gian.
Namatīti nāmaṃ, vedanādikkhandhattayaṃ.
It inclines; therefore, it is nāmaṃ (mentality), which is the three aggregates beginning with feeling (vedanā).
Cái nghiêng về là nāmaṃ (danh), tức là ba uẩn: thọ (vedanā), tưởng (saññā) và hành (saṅkhārā).
Ruppatīti rūpaṃ, bhūtarūpaṃ cakkhādiupādārūpañca.
It is afflicted; therefore, it is rūpaṃ (materiality), which includes elemental matter (bhūtarūpa) and dependent matter like the eye (cakkhu).
Cái biến hoại là rūpaṃ (sắc), tức là đại chủng sắc (bhūtarūpa) và các sở y sắc như mắt v.v.
Āyatati āyatañca saṃsāradukkhaṃ nayatīti āyatanaṃ.
It extends (the suffering of saṃsāra) and leads to prolonged saṃsāric suffering; therefore, it is āyatanaṃ (sense-base).
Cái mở rộng (āyatati) và dẫn đến khổ đau luân hồi kéo dài (āyatañca saṃsāradukkhaṃ nayati) là āyatanaṃ (xứ).
Phusatīti phasso.
It contacts; therefore, it is phasso (contact).
Cái xúc chạm là phasso (xúc).
Vedayatīti vedanā.
It feels; therefore, it is vedanā (feeling).
Cái cảm thọ là vedanā (thọ).
Idampi dvayaṃ dvāravasena chabbidhaṃ, vipākavasena gahaṇe chattiṃsavidhaṃ.
These two (contact and feeling) are sixfold by way of their doors, and thirty-six-fold when taken by way of results.
Hai điều này (xúc và thọ) cũng có sáu loại theo cửa giác quan, và ba mươi sáu loại khi được hiểu theo quả dị thục.
Paritassatīti taṇhā, sā kāmataṇhādivasena saṅkhepato tividhā, vitthārato aṭṭhuttarasatavidhā ca.
It yearns intensely; therefore, it is taṇhā (craving). This (taṇhā) is threefold in brief, by way of sensual craving (kāmataṇhā) and so forth, and one hundred and eightfold in detail.
Cái khát khao là taṇhā (ái), ái này tóm tắt có ba loại như dục ái (kāmataṇhā) v.v., và chi tiết có một trăm lẻ tám loại.
Upādīyatīti upādānaṃ, taṃ kāmupādānādivasena catubbidhaṃ.
It is clung to; therefore, it is upādānaṃ (clinging). This (upādāna) is fourfold by way of sensual clinging (kāmupādāna) and so forth.
Cái được chấp thủ là upādānaṃ (thủ), thủ này có bốn loại như dục thủ (kāmupādāna) v.v.
Bhavati bhāvayati cāti bhavo, so kammūpapattibhedato duvidho.
It exists and causes to exist; therefore, it is bhavo (existence). This (bhava) is twofold, distinguished as kamma-bhava (kamma-becoming) and upapatti-bhava (rebirth-becoming).
Cái hiện hữu và tạo ra sự hiện hữu là bhavo (hữu), hữu này có hai loại theo nghiệp hữu (kammabhava) và tái sinh hữu (upapattibhava).
Jananaṃ jāti.
Being born is jāti (birth).
Sự sinh ra là jāti (sinh).
Jīraṇaṃ jarā.
Ageing is jarā (old age).
Sự già đi là jarā (già).
Maranti tenāti maraṇaṃ.
They die because of it; therefore, it is maraṇaṃ (death).
Cái mà do đó chúng sinh chết đi là maraṇaṃ (chết).
Socanaṃ soko.
Grieving is soko (sorrow).
Sự sầu muộn là soko (sầu).
Paridevanaṃ paridevo.
Lamenting is paridevo (lamentation).
Sự than khóc là paridevo (bi).
Dukkhayatīti dukkhaṃ, uppādaṭṭhitivasena dvedhā khaṇatīti dukkhaṃ.
It afflicts; therefore, it is dukkhaṃ (pain). Or, it cuts in two ways, by way of arising and ceasing; therefore, it is dukkha.
Cái gây đau khổ là dukkhaṃ (khổ), hoặc ‘‘dukkhaṃ’’ là cái hủy hoại theo hai cách: sinh và trụ.
Dumanassa bhāvo domanassaṃ.
The state of mental unpleasantness is domanassaṃ (distress).
Trạng thái của tâm bất mãn là domanassaṃ (ưu).
Bhuso āyāso upāyāso.
Intense despair is upāyāso (despair).
Sự phiền não tột độ là upāyāso (não).
Sambhavantīti nibbattanti.
Sambhavanti means they arise.
Sambhavantī có nghĩa là phát sinh.
Na kevalañca sokādīhiyeva, atha kho sabbapadehi ‘‘sambhavantī’’ti padassa yojanā kātabbā.
And the word ‘‘sambhavanti’’ (they arise) is not to be connected only with sorrow and so forth, but with all terms.
Và không chỉ riêng với sầu (soka) v.v., mà từ tất cả các từ đều phải kết hợp với từ ‘‘sambhavantī’’.
Evañhi ‘‘avijjāpaccayā saṅkhārā sambhavantī’’ti paccayapaccayuppannavavatthānaṃ dassitaṃ hoti.
In this way, by ‘‘avijjāpaccayā saṅkhārā sambhavanti’’ (conditioned by ignorance, formations arise), the distinction between condition and conditioned is shown.
Chính như vậy, sự phân định nhân duyên và quả duyên được trình bày là ‘‘do duyên vô minh mà các hành phát sinh’’.
Esa nayo sabbattha.
This method applies everywhere.
Nguyên tắc này áp dụng cho mọi trường hợp.
Tattha aññāṇalakkhaṇā avijjā, sammohanarasā, chādanapaccupaṭṭhānā, āsavapadaṭṭhānā.
Here, avijjā has the characteristic of ignorance, the function of delusion, the manifestation as concealment, and its proximate cause is the āsavas (cankers).
Trong đó, vô minh (avijjā) có đặc tính là không biết, có chức năng làm cho mê mờ, có biểu hiện là che lấp, và có nguyên nhân gần là các lậu hoặc (āsava).
Abhisaṅkharaṇalakkhaṇā saṅkhārā, āyūhanarasā, saṃvidahanapaccupaṭṭhānā, avijjāpadaṭṭhānā.
Saṅkhārā (formations) have the characteristic of fabricating, the function of striving, the manifestation as arranging, and their proximate cause is avijjā.
Các hành (saṅkhārā) có đặc tính là tạo tác, có chức năng là nỗ lực, có biểu hiện là sắp đặt, và có nguyên nhân gần là vô minh.
Vijānanalakkhaṇaṃ viññāṇaṃ, pubbaṅgamarasaṃ, paṭisandhipaccupaṭṭhānaṃ, saṅkhārapadaṭṭhānaṃ, vatthārammaṇapadaṭṭhānaṃ vā.
Viññāṇa (consciousness) has the characteristic of cognizing, the function of being a forerunner, the manifestation as reconnection (paṭisandhi), and its proximate cause is saṅkhārā, or alternatively, the base and object.
Thức (viññāṇa) có đặc tính là nhận biết, có chức năng là dẫn đầu, có biểu hiện là tái tục, và có nguyên nhân gần là các hành, hoặc có nguyên nhân gần là nền t tảng và đối tượng.
Namanalakkhaṇaṃ nāmaṃ, sampayogarasaṃ, avinibbhogapaccupaṭṭhānaṃ, viññāṇapadaṭṭhānaṃ.
Nāma (mentality) has the characteristic of inclining, the function of association, the manifestation as inseparability, and its proximate cause is viññāṇa.
Danh (nāma) có đặc tính là nghiêng về (đối tượng), có chức năng là kết hợp, có biểu hiện là không thể tách rời, và có nguyên nhân gần là thức.
Ruppanalakkhaṇaṃ rūpaṃ, vikiraṇarasaṃ, appaheyyabhāvapaccupaṭṭhānaṃ, viññāṇapadaṭṭhānaṃ.
Rūpa (materiality) has the characteristic of affliction, the function of dispersion, the manifestation as being irreducible, and its proximate cause is viññāṇa.
Sắc (rūpa) có đặc tính là biến hoại, có chức năng là phân tán, có biểu hiện là không thể từ bỏ, và có nguyên nhân gần là thức.
Āyatanalakkhaṇaṃ saḷāyatanaṃ, dassanādirasaṃ, vatthudvārabhāvapaccupaṭṭhānaṃ, nāmarūpapadaṭṭhānaṃ.
Saḷāyatana (six sense-bases) has the characteristic of being a base, the function of seeing and so forth, the manifestation as being a physical base or door, and its proximate cause is nāmarūpa.
Sáu xứ (saḷāyatana) có đặc tính là duyên cho sự sinh khởi (trong luân hồi), có chức năng là thấy v.v., có biểu hiện là nền tảng và cửa giác quan, và có nguyên nhân gần là danh sắc (nāmarūpa).
Phusanalakkhaṇo phasso, saṅghaṭṭanaraso, saṅgatipaccupaṭṭhāno, saḷāyatanapadaṭṭhāno.
Phassa (contact) has the characteristic of touching, the function of impact, the manifestation as conjunction, and its proximate cause is saḷāyatana.
Xúc (phasso) có đặc tính là xúc chạm, có chức năng là va chạm, có biểu hiện là sự kết hợp, và có nguyên nhân gần là sáu xứ.
Anubhavanalakkhaṇā vedanā, visayarasasambhogarasā, sukhadukkhapaccupaṭṭhānā, phassapadaṭṭhānā.
Vedanā (feeling) has the characteristic of experiencing, the function of enjoying the taste of the object, the manifestation as pleasure and pain, and its proximate cause is phassa.
Thọ (vedanā) có đặc tính là cảm nhận, có chức năng là hưởng thụ hương vị của đối tượng, có biểu hiện là lạc và khổ, và có nguyên nhân gần là xúc.
Hetubhāvalakkhaṇā taṇhā, abhinandanarasā, atittibhāvapaccupaṭṭhānā, vedanāpadaṭṭhānā.
Taṇhā (craving) has the characteristic of being a cause, the function of delighting, the manifestation as insatiability, and its proximate cause is vedanā.
Ái (taṇhā) có đặc tính là nhân, có chức năng là hoan hỷ, có biểu hiện là trạng thái không thỏa mãn, và có nguyên nhân gần là thọ.
Gahaṇalakkhaṇaṃ upādānaṃ, amuñcanarasaṃ, taṇhādaḷhattadiṭṭhipaccupaṭṭhānaṃ, taṇhāpadaṭṭhānaṃ.
Upādāna (clinging) has the characteristic of grasping, the function of not letting go, the manifestation as the strength of craving or wrong view, and its proximate cause is taṇhā.
Thủ (upādāna) có đặc tính là chấp giữ, có chức năng là không buông bỏ, có biểu hiện là sự chấp chặt của ái và tà kiến, và có nguyên nhân gần là ái.
Kammakammaphalalakkhaṇo bhavo, bhavanabhāvanaraso, kusalākusalābyākatapaccupaṭṭhāno, upādānapadaṭṭhāno.
Existence (bhava) has the characteristic of kamma and kamma-results, the function of becoming and causing to become, is manifested as wholesome, unwholesome, and indeterminate states, and has grasping (upādāna) as its proximate cause.
Hữu (bhavo) có đặc tính là nghiệp và quả của nghiệp, có chức năng là hiện hữu và tạo ra sự hiện hữu, có biểu hiện là thiện, bất thiện và vô ký, và có nguyên nhân gần là thủ.
Tattha tattha bhave paṭhamābhinibbattilakkhaṇā jāti, niyyātanarasā, atītabhavato idhuppannapaccupaṭṭhānā, dukkhavicittatāpaccupaṭṭhānā vā.
In each and every existence, birth (jāti) has the characteristic of first arising, the function of delivering, is manifested as appearing in this present existence from a past existence, or as the diverse nature of suffering.
Trong mỗi cõi hữu đó, sinh (jāti) có đặc tính là sự tái sinh đầu tiên, có chức năng là dẫn dắt, có biểu hiện là sự phát sinh ở đây từ cõi hữu quá khứ, hoặc có biểu hiện là sự đa dạng của khổ.
Khandhaparipākalakkhaṇā jarā, maraṇūpanayanarasā, yobbanavināsapaccupaṭṭhānā.
Aging (jarā) has the characteristic of maturing, the function of leading towards death, is manifested as the destruction of youth.
Già (jarā) có đặc tính là sự chín muồi của các uẩn, có chức năng là dẫn đến cái chết, có biểu hiện là sự hủy hoại của tuổi trẻ.
Cutilakkhaṇaṃ maraṇaṃ, visaṃyogarasaṃ, gativippavāsapaccupaṭṭhānaṃ.
Death (maraṇa) has the characteristic of falling away, the function of disjoining, is manifested as departure from a state of being.
Chết (maraṇa) có đặc tính là sự chuyển dời, có chức năng là sự chia lìa, có biểu hiện là sự rời bỏ cõi tái sinh.
Antonijjhānalakkhaṇo soko, cetaso nijjhānaraso, anusocanapaccupaṭṭhāno.
Sorrow (soka) has the characteristic of internal burning, the function of mental burning, is manifested as lamenting.
Sầu (soko) có đặc tính là sự thiêu đốt bên trong, có chức năng là sự thiêu đốt của tâm, có biểu hiện là sự than vãn.
Lālappanalakkhaṇo paridevo, guṇadosaparikittanaraso, sambhamapaccupaṭṭhāno.
Lamentation (parideva) has the characteristic of wailing, the function of proclaiming virtues and faults, is manifested as agitation.
Bi (paridevo) có đặc tính là sự than khóc, có chức năng là ca ngợi những điều tốt và xấu, có biểu hiện là sự bối rối.
Kāyapīḷanalakkhaṇaṃ dukkhaṃ, duppaññānaṃ domanassakaraṇarasaṃ, kāyikābādhapaccupaṭṭhānaṃ.
Physical pain (dukkha) has the characteristic of bodily affliction, the function of causing mental distress (domanassa) for the unwise, is manifested as bodily ailment.
Khổ (dukkha) có đặc tính là sự đau đớn về thân, có chức năng là gây ra ưu cho những người thiếu trí tuệ, có biểu hiện là sự khó chịu về thân thể.
Cittapīḷanalakkhaṇaṃ domanassaṃ, manovighātanarasaṃ, mānasabyādhipaccupaṭṭhānaṃ.
Mental distress (domanassa) has the characteristic of mental affliction, the function of mental vexation, is manifested as mental sickness.
Ưu (domanassa) có đặc tính là sự đau đớn về tâm, có chức năng là sự hủy hoại của ý, có biểu hiện là bệnh tật về tâm.
Cittaparidahanalakkhaṇo upāyāso, nitthunanaraso, visādapaccupaṭṭhāno.
Despair (upāyāsa) has the characteristic of intense mental burning, the function of sighing, is manifested as dejection.
Não (upāyāso) có đặc tính là sự thiêu đốt của tâm, có chức năng là sự rên rỉ, có biểu hiện là sự chán nản.
Evamete avijjādayo lakkhaṇāditopi veditabbāti.
Thus, these ignorance (avijjā) and so on, should also be known from their characteristics, etc.
Như vậy, vô minh và các yếu tố khác cần được hiểu theo đặc tính của chúng.
Ayamettha saṅkhepo, vitthāro pana sabbākārasampannaṃ vinicchayaṃ icchantena sammohavinodaniyā (vibha. aṭṭha. 225) vibhaṅgaṭṭhakathāya gahetabbo.
This is the brief account here. For the detailed explanation, one who desires a comprehensive analysis should refer to the Vibhaṅgaṭṭhakathā, called Sammohavinodanī (Vbha.a. 225).
Đây là phần tóm tắt, còn phần chi tiết thì người muốn có sự phân định hoàn hảo về mọi khía cạnh nên tham khảo từ Vibhaṅgaṭṭhakathā (VibhA. 225) được gọi là Sammohavinodanī.
Tassattho – yadāti yasmiṃ kāle.
Its meaning: ‘yadā’ means at what time.
Ý nghĩa của lời cảm hứng đó là: Yadā (Khi) nghĩa là, vào thời điểm nào.
Haveti byattanti imasmiṃ atthe nipāto.
‘Have’ is a particle here in the sense of 'certainly'.
Have là một giới từ trong ý nghĩa “rõ ràng”.
Keci pana ‘‘haveti āhave yuddhe’’ti atthaṃ vadanti, ‘‘yodhetha māraṃ paññāvudhenā’’ti (dha. pa. 40) vacanato kilesamārena yujjhanasamayeti tesaṃ adhippāyo.
Some, however, interpret ‘have’ as ‘in battle, in war’, their intention being that it is the time of fighting with the defilement-Māra, in accordance with the saying: “Fight Māra with the weapon of wisdom.”
Tuy nhiên, một số người giải thích rằng “have” có nghĩa là “trong chiến trận”, ý của họ là vào thời điểm chiến đấu với phiền não ma (kilesamāra), theo câu “Hãy chiến đấu với ma bằng vũ khí trí tuệ” (Dhp. 40).
Pātubhavantīti uppajjanti.
‘Pātubhavanti’ means arise.
Pātubhavanti (xuất hiện) nghĩa là, sinh khởi.
Dhammāti anulomapaccayākārapaṭivedhasādhakā bodhipakkhiyadhammā.
‘Dhammā’ means the Bodhipakkhiyadhammas that bring about the penetration of the causal sequence in direct order (anuloma-paccayākāra).
Dhammā (các pháp) nghĩa là, các pháp giác chi (bodhipakkhiyadhammā) hỗ trợ cho sự thâm nhập vào các khía cạnh của duyên thuận chiều.
Atha vā pātubhavantīti pakāsenti, abhisamayavasena byattā pākaṭā honti.
Or else, ‘pātubhavanti’ means become manifest, become clear and evident through realization.
Hoặc pātubhavanti (xuất hiện) nghĩa là, hiển lộ, trở nên rõ ràng, hiển nhiên qua sự thâm nhập (abhisamaya).
Dhammāti catuariyasaccadhammā, ātāpo vuccati kilesasantāpanaṭṭhena vīriyaṃ.
‘Dhammā’ means the four Noble Truths. Zeal (ātāpo) is called energy (vīriya) by reason of burning up defilements.
Dhammā (các pháp) nghĩa là, các pháp Tứ Diệu Đế (catuariyasaccadhammā). Ātāpo (nhiệt tâm) được gọi là tinh tấn (vīriya) vì nó làm thiêu đốt các phiền não.
Ātāpinoti sammappadhānavīriyavato.
‘Ātāpino’ means one who possesses the energy of right endeavor.
Ātāpino (người có nhiệt tâm) nghĩa là, người có chánh tinh tấn (sammappadhānavīriya).
Jhāyatoti ārammaṇūpanijjhānena lakkhaṇūpanijjhānena jhāyantassa.
‘Jhāyato’ means one who meditates with jhāna of observing the object and jhāna of observing the characteristics.
Jhāyato (người thiền định) nghĩa là, người thiền định bằng sự quán sát đối tượng (ārammaṇūpanijjhāna) và sự quán sát đặc tính (lakkhaṇūpanijjhāna).
Brāhmaṇassāti bāhitapāpassa khīṇāsavassa.
‘Brāhmaṇassa’ means one who has banished evil, an arahant (khīṇāsava).
Brāhmaṇassa (của vị Bà-la-môn) nghĩa là, của vị A-la-hán đã loại bỏ ác pháp (bāhitapāpassa), đã diệt trừ lậu hoặc (khīṇāsavassa).
Athassa kaṅkhā vapayanti sabbāti athassa evaṃ pātubhūtadhammassa yā etā ‘‘ko nu kho, bhante, phusatīti.
‘Athassa kaṅkhā vapayanti sabbā’ means then all his doubts, which are stated concerning the causal sequence in such a way as, “Venerable Sir, who indeed touches? The Blessed One said, ‘The question is not appropriate,’”
Athassa kaṅkhā vapayanti sabbā (Rồi tất cả mọi nghi ngờ của vị ấy đều tan biến) nghĩa là, tất cả những nghi ngờ về duyên khởi đã được nói đến theo cách như “Bạch Thế Tôn, ai là người chạm đến?” “Đức Thế Tôn đã nói rằng đó không phải là câu hỏi đúng” (Saṃ. Ni. 2.12),
No kallo pañhoti bhagavā avocā’’tiādinā (saṃ. ni. 2.12) nayena, ‘‘katamaṃ nu kho, bhante, jarāmaraṇaṃ, kassa ca panidaṃ jarāmaraṇanti.
and in such a way as, “Venerable Sir, what indeed is aging and death? And to whom does this aging and death belong? The Blessed One said, ‘The question is not appropriate,’”
và theo cách như “Bạch Thế Tôn, già chết là gì? Già chết này thuộc về ai?” “Đức Thế Tôn đã nói rằng đó không phải là câu hỏi đúng” (Saṃ. Ni. 2.35),
No kallo pañhoti bhagavā avocā’’tiādinā (saṃ. ni. 2.35) nayena paccayākāre kaṅkhā vuttā, yā ca paccayākārasseva appaṭividdhattā ‘‘ahosiṃ nu kho ahaṃ atītamaddhāna’’ntiādinā (ma. ni. 1.18; saṃ. ni. 2.20) soḷasa kaṅkhā āgatā.
and also the sixteen doubts that arose due to the non-penetration of the causal sequence itself, in such a way as, “Was I indeed in the past?”
cũng như mười sáu loại nghi ngờ đã được đề cập theo cách “Ta đã từng tồn tại trong quá khứ chăng?” (Ma. Ni. 1.18; Saṃ. Ni. 2.20) do chưa thâm nhập được duyên khởi.
Tā sabbā vapayanti apagacchanti nirujjhanti.
All those cease, vanish, and are extinguished.
Tất cả những nghi ngờ đó đều tan biến, biến mất, diệt trừ.
Yato pajānāti sahetudhammaṃ, yasmā avijjādikena hetunā sahetukaṃ imaṃ saṅkhārādikaṃ kevalaṃ dukkhakkhandhadhammaṃ pajānāti aññāsi paṭivijjhīti.
‘Yato pajānāti sahetudhammaṁ,’ because he knows, he comprehends, he penetrates this entire aggregate of suffering, which comprises formations (saṅkhāra) and so on, and is with a cause, due to causes such as ignorance (avijjā) and so on.
Yato pajānāti sahetudhammaṃ (Vì vị ấy liễu tri pháp có nguyên nhân), vì vị ấy liễu tri, thấu hiểu, thâm nhập pháp duyên khởi này, khối khổ uẩn gồm các hành (saṅkhāra) v.v., có nguyên nhân là vô minh (avijjā) v.v., là hoàn toàn khổ.
Ayampi udāno vutto bhagavatā iti me sutanti ayaṃ pāḷi kesuciyeva potthakesu dissati.
‘Ayampi udāno vutto bhagavatā iti me sutaṁ’ – this Pali text is found only in some manuscripts.
Ayampi udāno vutto Bhagavatā iti me sutaṃ (Lời cảm hứng này cũng đã được Đức Thế Tôn nói, tôi nghe như vậy) – câu Pāḷi này chỉ xuất hiện trong một số bản kinh.
Tattha ayampīti pisaddo ‘‘idampi buddhe ratanaṃ paṇītaṃ, ayampi pārājiko hotī’’tiādīsu viya sampiṇḍanattho, tena uparimaṃ sampiṇḍeti.
There, in ‘ayampi’, the particle ‘pi’ has the meaning of inclusion, as in “This gem, the Buddha, is excellent. This monk also becomes defeated,” and so on, thereby including what follows.
Ở đó, ayampi (cũng vậy) – từ “pi” có nghĩa là tổng hợp, như trong “Idampi Buddhe ratanaṃ paṇītaṃ, ayampi pārājiko hotī” (Đây cũng là một viên ngọc quý trong Đức Phật, đây cũng là một tội Pārājika), v.v. Do đó, nó tổng hợp các lời cảm hứng tiếp theo.
Vuttoti ayaṃ vuttasaddo kesohāraṇavappanavāpasamīkaraṇajīvitavuttipamuttabhāvapāvacanabhāvena pavattana ajjhenakathanādīsu dissati.
In ‘vutto’, this word ‘vutta’ is seen in the meanings of shaving hair, sowing, leveling, livelihood, being released, verbal expression, reciting, and speaking.
Vutto (được nói) – từ “vutta” này được thấy trong các ý nghĩa như cạo tóc, gieo trồng, san bằng, sinh kế, giải thoát, được nói ra như một lời nói, học thuộc lòng, kể, v.v.
Tathā hesa ‘‘kāpaṭiko māṇavo daharo vuttasiro’’tiādīsu (ma. ni. 2.426) kesohāraṇe āgato.
For instance, it occurs in the sense of shaving hair in phrases like, “A young, deceitful Brahmin boy with a shaven head,” and so on.
Thật vậy, nó xuất hiện trong ý nghĩa cạo tóc trong các câu như “Kāpaṭiko māṇavo daharo vuttasiro” (Maṇava trẻ tuổi, đầu đã cạo) v.v.
Ādīsu (jā. 2.22.19) vappane.
And so on, in the sense of sowing.
Nó xuất hiện trong ý nghĩa gieo trồng trong các câu như trên (Jā. 2.22.19).
‘‘No ca kho paṭivutta’’ntiādīsu (pārā. 289) aṭṭhadaṇḍakādīhi vāpasamīkaraṇe.
In phrases like, “Not indeed leveled,” and so on, in the sense of leveling with an eight-pronged harrow, etc.
Nó xuất hiện trong ý nghĩa san bằng bằng tám răng cào v.v., trong các câu như “No ca kho paṭivuttaṃ” (Nhưng không được san bằng) v.v.
‘‘Pannalomo paradattavutto migabhūtena cetasā viharāmī’’tiādīsu (cūḷava. 332) jīvitavuttiyaṃ.
In phrases like, “With plucked hair, living on what others give, I dwell with a mind like a wild animal,” and so on, in the sense of livelihood.
Nó xuất hiện trong ý nghĩa sinh kế trong các câu như “Pannalomo paradattavutto migabhūtena cetasā viharāmī” (Tôi sống với tâm như loài thú, lông đã rụng, sống nhờ vật bố thí của người khác) v.v.
‘‘Paṇḍupalāso bandhanā pavutto abhabbo haritattāyā’’tiādīsu (pārā. 92) bandhanato pamuttabhāve.
In phrases like, “A yellow leaf released from its stem cannot become green again,” and so on, in the sense of being released from a bond.
Nó xuất hiện trong ý nghĩa giải thoát khỏi sự ràng buộc trong các câu như “Paṇḍupalāso bandhanā pavutto abhabbo haritattāyā” (Lá vàng đã lìa cành thì không thể xanh trở lại) v.v.
‘‘Gītaṃ vuttaṃ samīhita’’ntiādīsu (dī. ni. 1.285) pāvacanabhāvena pavattite.
In phrases like, “A song uttered, intended,” and so on, in the sense of expressing verbally.
Nó xuất hiện trong ý nghĩa được nói ra như một lời nói trong các câu như “Gītaṃ vuttaṃ samīhitaṃ” (Lời ca đã được nói ra, đã được mong muốn) v.v.
‘‘Vutto pārāyaṇo’’tiādīsu ajjhene.
In phrases like ‘‘Vutto pārāyaṇo’’, it means recitation.
Nó xuất hiện trong ý nghĩa học thuộc lòng trong các câu như “Vutto pārāyaṇo” (Người đã học thuộc lòng Pārāyaṇa).
‘‘Vuttaṃ kho panetaṃ bhagavatā ‘dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’’’tiādīsu (ma. ni. 1.30) kathane.
In phrases like ‘‘Vuttaṃ kho panetaṃ bhagavatā ‘dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’’’, it means speaking.
Nó xuất hiện trong ý nghĩa kể trong các câu như “Vuttaṃ kho panetaṃ Bhagavatā ‘Dhammadāyādā me, bhikkhave, bhavatha, mā āmisadāyādā’” (Thật vậy, điều này đã được Đức Thế Tôn nói: ‘Này các Tỳ-kheo, hãy là người thừa kế Pháp của Ta, đừng là người thừa kế vật chất’) v.v.
Idhāpi kathane eva daṭṭhabbo, tena ayampi udāno bhāsitoti attho.
Here too, it should be understood as speaking; thus, the meaning is that this Udāna was also spoken.
Ở đây, nó cũng nên được hiểu theo ý nghĩa kể. Do đó, ý nghĩa là lời cảm hứng này cũng đã được nói.
Itīti evaṃ.
Iti means thus.
Iti (như vậy) nghĩa là, như thế này.
Me sutanti padadvayassa attho nidānavaṇṇanāyaṃ sabbākārato vuttoyeva.
The meaning of the two words me sutaṃ has already been fully explained in the Nidāna-vaṇṇanā.
Ý nghĩa của hai từ me sutaṃ (tôi nghe như vậy) đã được giải thích đầy đủ trong phần chú giải về duyên khởi (nidānavaṇṇanā).
Pubbe ‘‘evaṃ me suta’’nti nidānavasena vuttoyeva hi attho idha nigamanavasena ‘‘iti me suta’’nti puna vutto.
Indeed, the meaning previously stated as ‘‘evaṃ me sutaṃ’’ in the sense of the introduction is here stated again as ‘‘iti me sutaṃ’’ in the sense of conclusion.
Thật vậy, ý nghĩa đã được nói đến trước đây theo cách duyên khởi là “Evaṃ me sutaṃ” (Tôi nghe như vậy), nay lại được nói đến một lần nữa theo cách kết luận là “Iti me sutaṃ” (Tôi nghe như vậy).
Vuttasseva hi atthassa puna vacanaṃ nigamananti.
For, the repetition of a meaning already stated is a conclusion.
Thật vậy, việc lặp lại ý nghĩa đã được nói là kết luận.
Itisaddassa atthuddhāro evaṃ-saddena samānatthatāya ‘‘evaṃ me suta’’nti ettha viya, atthayojanā ca itivuttakavaṇṇanāya amhehi pakāsitāyevāti tattha vuttanayeneva veditabboti.
The extraction of the meaning of the word iti is, as in ‘‘evaṃ me sutaṃ’’, due to its synonymity with the word evaṃ, and its application of meaning has already been explained by us in the Itivuttaka-vaṇṇanā; thus, it should be understood in the manner stated there.
Sự giải thích ý nghĩa của từ “iti” cũng giống như trong “Evaṃ me sutaṃ” (Tôi nghe như vậy) vì nó có cùng ý nghĩa với từ “evaṃ” (như vậy), và sự áp dụng ý nghĩa đã được chúng tôi trình bày trong chú giải Itivuttaka, nên cần được hiểu theo cách đã nói ở đó.
2. Dutiye paṭilomanti ‘‘avijjānirodhā saṅkhāranirodho’’tiādinā nayena vutto avijjādikoyeva paccayākāro anuppādanirodhena nirujjhamāno attano kattabbakiccassa akaraṇato paṭilomoti vuccati.
2. In the second sutta, paṭilomaṃ means the causal condition of avijjā and so forth, as stated in the manner of ‘‘with the cessation of avijjā, there is the cessation of saṅkhāras’’, which, ceasing through non-arising and complete cessation, is called paṭiloma because it does not perform its function.
Trong kinh thứ hai, paṭilomaṃ (nghịch chiều) nghĩa là, chính duyên khởi được nói đến theo cách “Do vô minh diệt nên hành diệt” v.v., khi diệt trừ bằng sự diệt không sinh khởi (anuppādanirodha), được gọi là nghịch chiều vì không thực hiện chức năng cần làm của chính nó.
Pavattiyā vā vilomanato paṭilomo, antato pana majjhato vā paṭṭhāya ādiṃ pāpetvā avuttattā ito aññenatthenettha paṭilomatā na yujjati.
Or, it is paṭiloma because it is contrary to the process of existence. However, since it is not stated starting from the end or from the middle and bringing it to the beginning, paṭilomatā in any other sense is not appropriate here.
Hoặc nó là nghịch chiều vì ngược lại với sự tiếp diễn. Tuy nhiên, ở đây, sự nghịch chiều không phù hợp với bất kỳ ý nghĩa nào khác ngoài ý nghĩa đã nói, vì nó không được nói là bắt đầu từ cuối cùng hoặc từ giữa để đạt đến khởi đầu.
Paṭilomanti ca ‘‘visamaṃ candasūriyā parivattantī’’tiādīsu viya bhāvanapuṃsakaniddeso.
And paṭilomaṃ is an indication of the bhāvanapuṃsaka (neuter verbal noun) as in ‘‘the moon and sun revolve irregularly’’.
Và paṭilomaṃ là một từ chỉ giống trung tính (bhāvanapuṃsakaniddesa), như trong các câu “Mặt trăng và mặt trời xoay chuyển bất thường (visamaṃ candasūriyā parivattanti)” v.v.
Imasmiṃ asati idaṃ na hotīti imasmiṃ avijjādike paccaye asati maggena pahīne idaṃ saṅkhārādikaṃ phalaṃ na hoti nappavattati.
Imasmiṃ asati idaṃ na hoti means: when this cause, avijjā and so forth, is absent, being abandoned by the path, this result, saṅkhāras and so forth, does not occur, does not proceed.
Imasmiṃ asati idaṃ na hoti (Khi cái này không có, cái kia không có) nghĩa là, khi duyên vô minh (avijjā) v.v., này không có, đã được diệt trừ bằng đạo, thì quả hành (saṅkhāra) v.v., này không sinh khởi, không tiếp diễn.
Imassa nirodhā idaṃ nirujjhatīti imassa avijjādikassa paccayassa nirodhā maggena anuppattidhammataṃ āpāditattā idaṃ saṅkhārādikaṃ phalaṃ nirujjhati, nappavattatīti attho.
Imassa nirodhā idaṃ nirujjhati means: due to the cessation of this cause, avijjā and so forth, having been brought to the state of non-arising by the path, this result, saṅkhāras and so forth, ceases, does not proceed. This is the meaning.
Imassa nirodhā idaṃ nirujjhati (Do cái này diệt nên cái kia diệt) nghĩa là, do sự diệt trừ duyên vô minh (avijjā) v.v., này, đã được đưa về trạng thái không sinh khởi bằng đạo, thì quả hành (saṅkhāra) v.v., này diệt trừ, không tiếp diễn.
Idhāpi yathā ‘‘imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjatī’’ti ettha ‘‘imasmiṃ satiyeva, nāsati, imassa uppādā eva, na nirodhā’’ti antogadhaniyamatā dassitā.
Here too, just as in ‘‘when this exists, this comes to be; with the arising of this, this arises’’, the implicit certainty was shown as ‘‘only when this exists, not when it does not exist; only with the arising of this, not with its cessation.’’
Ở đây cũng vậy, như trong câu “Imasmiṃ sati idaṃ hoti, imassuppādā idaṃ uppajjati” (Khi cái này có, cái kia có; do cái này sinh, cái kia sinh), sự giới hạn nội tại được chỉ ra là “chỉ khi cái này có, không phải khi không có; chỉ do cái này sinh, không phải do cái này diệt”.
Evaṃ imasmiṃ asatiyeva, na sati, imassa nirodhā eva, na uppādāti antogadhaniyamatālakkhaṇā dassitāti veditabbaṃ.
Similarly, it should be understood that the characteristic of implicit certainty is shown as ‘‘only when this is absent, not when it exists; only with the cessation of this, not with its arising.’’
Tương tự, cần hiểu rằng ở đây, đặc tính của sự giới hạn nội tại được chỉ ra là “chỉ khi cái này không có, không phải khi có; chỉ do cái này diệt, không phải do cái này sinh”.
Sesamettha yaṃ vattabbaṃ, taṃ paṭhamabodhisuttavaṇṇanāya vuttanayānusārena veditabbaṃ.
Whatever else needs to be said here should be understood according to the method stated in the commentary on the first Bodhi Sutta.
Những gì còn lại cần nói ở đây, nên được hiểu theo cách đã được trình bày trong phần chú giải kinh Paṭhamabodhi.
Evaṃ yathā bhagavā paṭilomapaṭiccasamuppādaṃ manasi akāsi, taṃ saṅkhepena dassetvā idāni vitthārena dassetuṃ ‘‘avijjānirodhā saṅkhāranirodho’’tiādi vuttaṃ.
Having thus briefly shown how the Blessed One attended to the dependent origination in reverse order, it is now said, “With the cessation of ignorance, volitional formations cease,” and so on, in order to show it in detail.
Như vậy, sau khi đã trình bày tóm tắt cách Thế Tôn quán chiếu Duyên Khởi theo chiều nghịch (paṭiloma-paṭiccasamuppāda), bây giờ để trình bày chi tiết, đoạn kinh “Do vô minh diệt nên hành diệt” v.v. đã được nói đến.
Tattha avijjānirodhāti ariyamaggena avijjāya anavasesanirodhā, anusayappahānavasena aggamaggena avijjāya accantasamugghāṭatoti attho.
There, “with the cessation of ignorance” means the complete cessation of ignorance through the noble path, that is, the utter eradication of ignorance by the highest path (arahattamagga) through the abandoning of latent tendencies.
Trong đó, “do vô minh diệt” có nghĩa là do sự diệt tận vô minh không còn sót lại bằng Thánh đạo, nghĩa là do sự nhổ tận gốc vô minh bằng A-la-hán đạo theo cách đoạn trừ các tùy miên.
Yadipi heṭṭhimamaggehi pahīyamānā avijjā accantasamugghāṭavaseneva pahīyati, tathāpi na anavasesato pahīyati.
Although ignorance is abandoned by the lower paths through utter eradication, it is not abandoned completely.
Mặc dù vô minh được đoạn trừ bằng các đạo thấp hơn cũng được đoạn trừ theo cách nhổ tận gốc, nhưng nó không được đoạn trừ hoàn toàn không còn sót lại.
Apāyagāminiyā hi avijjā paṭhamamaggena pahīyati.
For ignorance leading to the lower realms is abandoned by the first path (sotāpattimagga).
Thật vậy, vô minh dẫn đến khổ cảnh được đoạn trừ bằng đạo thứ nhất (Tu-đà-hoàn đạo).
Tathā sakideva imasmiṃ loke sabbattha ca anariyabhūmiyaṃ upapattipaccayabhūtā avijjā yathākkamaṃ dutiyatatiyamaggehi pahīyati, na itarāti.
Similarly, ignorance that is a condition for rebirth in this sense-sphere existence and in all ignoble realms at once is abandoned by the second and third paths respectively, but not the other.
Tương tự, vô minh là nhân duyên cho sự tái sinh chỉ một lần trong cõi này và khắp các cõi bất thiện được đoạn trừ lần lượt bằng đạo thứ hai và thứ ba, chứ không phải các loại vô minh khác.
Arahattamaggeneva hi sā anavasesaṃ pahīyatīti.
For it is by the Arahantship Path (arahattamagga) that it is completely abandoned.
Chỉ bằng A-la-hán đạo, nó mới được đoạn trừ hoàn toàn không còn sót lại.
Saṅkhāranirodhoti saṅkhārānaṃ anuppādanirodho hoti.
“Cessation of volitional formations” means the cessation of volitional formations through non-arising.
“Hành diệt” có nghĩa là sự diệt trừ các hành, tức là sự không tái sinh của các hành.
Evaṃ niruddhānaṃ pana saṅkhārānaṃ nirodhā viññāṇaṃ, viññāṇādīnañca nirodhā nāmarūpādīni niruddhāni eva hontīti dassetuṃ ‘‘saṅkhāranirodhā viññāṇanirodho’’tiādiṃ vatvā ‘‘evametassa kevalassa dukkhakkhandhassa nirodho hotī’’ti vuttaṃ.
In order to show that with the cessation of such ceased volitional formations, consciousness ceases, and with the cessation of consciousness and so on, mentality-materiality and so on also cease, it is said, “With the cessation of volitional formations, consciousness ceases,” and so on, and then it is said, “Thus there is the cessation of this entire mass of suffering.”
Để chỉ ra rằng khi các hành đã diệt như vậy, thì thức cũng diệt, và do thức v.v. diệt nên danh-sắc v.v. cũng diệt, nên sau khi nói “do hành diệt nên thức diệt” v.v., đoạn kinh “như vậy, toàn bộ khối khổ này diệt tận” đã được nói đến.
Tattha yaṃ vattabbaṃ, taṃ heṭṭhā vuttanayameva.
What needs to be said there is the same as what was said earlier.
Những gì cần nói ở đây cũng giống như cách đã nói ở trên.
Apicettha kiñcāpi ‘‘avijjānirodhā saṅkhāranirodho, saṅkhāranirodhā viññāṇanirodho’’ti ettāvatāpi sakalassa dukkhakkhandhassa anavasesato nirodho vutto hoti, tathāpi yathā anulome yassa yassa paccayadhammassa atthitāya yo yo paccayuppannadhammo na nirujjhati pavattati evāti imassa atthassa dassanatthaṃ ‘‘avijjāpaccayā saṅkhārā…pe… samudayo hotī’’ti vuttaṃ.
Furthermore, even though here, by saying, “With the cessation of ignorance, volitional formations cease; with the cessation of volitional formations, consciousness ceases,” the complete cessation of the entire mass of suffering is stated, yet just as in the direct order, it was said, “With ignorance as condition, volitional formations arise… and so on… there is the origin,” to show that due to the existence of each conditioning phenomenon, each conditioned phenomenon does not cease but continues to arise.
Hơn nữa, mặc dù ở đây, chỉ với câu “do vô minh diệt nên hành diệt, do hành diệt nên thức diệt” cũng đã nói lên sự diệt tận hoàn toàn của toàn bộ khối khổ, nhưng giống như trong chiều thuận, để chỉ rõ ý nghĩa rằng “do sự hiện hữu của nhân duyên pháp này nên quả duyên sinh pháp kia không diệt mà tiếp tục tồn tại”, nên đã nói “do vô minh duyên nên có hành…v.v…khởi lên”.
Evaṃ tappaṭipakkhato tassa tassa paccayadhammassa abhāve so so paccayuppannadhammo nirujjhati nappavattatīti dassanatthaṃ idha ‘‘avijjānirodhā saṅkhāranirodho, saṅkhāranirodhā viññāṇanirodho…pe… dukkhakkhandhassa nirodho hotī’’ti vuttaṃ, na pana anulome viya kālattayapariyāpannassa dukkhakkhandhassa nirodhadassanatthaṃ.
Similarly, to show that, conversely, in the absence of each conditioning phenomenon, each conditioned phenomenon ceases and does not arise, it is said here, “With the cessation of ignorance, volitional formations cease; with the cessation of volitional formations, consciousness ceases… and so on… there is the cessation of the mass of suffering,” and not, as in the direct order, to show the cessation of the mass of suffering pertaining to all three times.
Tương tự, để chỉ rõ rằng theo chiều ngược lại, khi không có nhân duyên pháp kia thì quả duyên sinh pháp kia sẽ diệt và không tiếp tục tồn tại, nên ở đây đã nói “do vô minh diệt nên hành diệt, do hành diệt nên thức diệt…v.v…toàn bộ khối khổ này diệt tận”, chứ không phải để chỉ sự diệt tận của khối khổ thuộc ba thời như trong chiều thuận.
Anāgatasseva hi ariyamaggabhāvanāya asati uppajjanārahassa dukkhakkhandhassa ariyamaggabhāvanāya nirodho icchitoti ayampi viseso veditabbo.
For the cessation of the mass of suffering, which is capable of arising in the future if the noble path is not cultivated, is desired through the cultivation of the noble path; this distinction should also be understood.
Thật vậy, sự diệt tận của khối khổ đáng lẽ sẽ sinh khởi trong tương lai nếu không có sự tu tập Thánh đạo, được mong muốn là do sự tu tập Thánh đạo. Đây cũng là một điểm khác biệt cần được hiểu.
3. Tatiye anulomapaṭilomanti anulomañca paṭilomañca, yathāvuttaanulomavasena ceva paṭilomavasena cāti attho.
3. In the third, “in direct and reverse order” (anulomapaṭilomaṃ) means both in direct and reverse order, that is, in the manner of the direct order and in the manner of the reverse order as stated.
Trong kinh thứ ba, “chiều thuận và chiều nghịch” (anulomapaṭilomaṃ) có nghĩa là theo chiều thuận và chiều nghịch, tức là theo cách chiều thuận và chiều nghịch như đã nói.
Nanu ca pubbepi anulomavasena paṭilomavasena ca paṭiccasamuppāde manasikārappavatti suttadvaye vuttā, idha kasmā punapi tadubhayavasena manasikārappavatti vuccatīti?
Now, was not the occurrence of attention to dependent origination in both direct and reverse order already stated in the two previous suttas? Why is the occurrence of attention in both ways mentioned again here?
Há chẳng phải trước đây, trong hai kinh đã nói về sự quán chiếu Duyên Khởi theo chiều thuận và chiều nghịch rồi sao? Tại sao ở đây lại nói về sự quán chiếu theo cả hai chiều một lần nữa?
Tadubhayavasena tatiyavāraṃ tattha manasikārassa pavattitattā.
Because attention to it occurred for the third time in both ways.
Bởi vì sự quán chiếu Duyên Khởi theo cả hai chiều đã diễn ra lần thứ ba.
Kathaṃ pana tadubhayavasena manasikāro pavattito?
How then was attention directed in both ways?
Nhưng làm thế nào mà sự quán chiếu theo cả hai chiều lại diễn ra?
Na hi sakkā apubbaṃ acarimaṃ anulomapaṭilomaṃ paṭiccasamuppādassa manasikāraṃ pavattetunti?
For is it not possible to direct attention to dependent origination (paṭiccasamuppāda) in forward and reverse order, without any precedence or subsequence?
Chẳng phải không thể quán chiếu Duyên Khởi theo chiều thuận và chiều nghịch cùng một lúc sao?
Na kho panetaṃ evaṃ daṭṭhabbaṃ ‘‘tadubhayaṃ ekajjhaṃ manasākāsī’’ti, atha kho vārena.
Indeed, this should not be understood thus: ‘He attended to both simultaneously,’ but rather in turn.
Tuy nhiên, điều này không nên được hiểu là “vị ấy đã quán chiếu cả hai cùng một lúc”, mà là theo từng lượt.
Bhagavā hi paṭhamaṃ anulomavasena paṭiccasamuppādaṃ manasi karitvā tadanurūpaṃ paṭhamaṃ udānaṃ udānesi.
For the Blessed One, having first attended to Dependent Origination in direct order, uttered the first Udāna corresponding to that.
Thật vậy, Thế Tôn trước tiên đã quán chiếu Duyên Khởi theo chiều thuận và thốt lên lời cảm hứng thứ nhất phù hợp với điều đó.
Dutiyampi paṭilomavasena taṃ manasi karitvā tadanurūpameva udānaṃ udānesi.
Secondly, having attended to it in reverse order, He uttered the Udāna corresponding to that.
Lần thứ hai, Ngài quán chiếu Duyên Khởi theo chiều nghịch và thốt lên lời cảm hứng phù hợp với điều đó.
Tatiyavāre pana kālena anulomaṃ kālena paṭilomaṃ manasikaraṇavasena anulomapaṭilomaṃ manasi akāsi.
But in the third turn, He attended to it both in direct and reverse order, sometimes in direct order, sometimes in reverse order, by way of mental reflection.
Đến lần thứ ba, Ngài đã quán chiếu Duyên Khởi theo chiều thuận và chiều nghịch bằng cách lúc thì quán chiếu theo chiều thuận, lúc thì quán chiếu theo chiều nghịch.
Tena vuttaṃ – ‘‘anulomapaṭilomanti anulomañca paṭilomañca, yathāvuttaanulomavasena ceva paṭilomavasena cā’’ti.
Therefore, it is said: “‘Direct and reverse order’ means both direct and reverse order, in the manner of the direct and reverse order as stated.”
Vì vậy, đã nói: “chiều thuận và chiều nghịch có nghĩa là theo chiều thuận và chiều nghịch, tức là theo cách chiều thuận và chiều nghịch như đã nói.”
Iminā manasikārassa paguṇabalavabhāvo ca vasībhāvo ca pakāsito hoti.
By this, the mastery, strength, and proficiency of the mental reflection are revealed.
Bằng cách này, sự thành thạo, mạnh mẽ và khả năng làm chủ của sự quán chiếu đã được biểu lộ.
Ettha ca ‘‘anulomaṃ manasi karissāmi, paṭilomaṃ manasi karissāmi, anulomapaṭilomaṃ manasi karissāmī’’ti evaṃ pavattānaṃ pubbābhogānaṃ vasena nesaṃ vibhāgo veditabbo.
And here, the distinction between them should be understood by means of the preliminary intentions that occurred, such as: “I will attend to the direct order, I will attend to the reverse order, I will attend to both direct and reverse order.”
Ở đây, sự phân biệt của chúng cần được hiểu dựa trên những ý định trước đó như “Ta sẽ quán chiếu theo chiều thuận, ta sẽ quán chiếu theo chiều nghịch, ta sẽ quán chiếu theo chiều thuận và chiều nghịch”.
Tattha avijjāya tvevāti avijjāya tu eva.
Therein, avijjāya tvevā means indeed by ignorance alone.
Trong đó, “chỉ do vô minh” (avijjāya tveva) có nghĩa là chỉ riêng vô minh.
Asesavirāganirodhāti virāgasaṅkhātena maggena asesanirodhā, aggamaggena anavasesaanuppādappahānāti attho.
Asesavirāganirodhā means by the path called ‘detachment’ (virāga), by the complete cessation of it; the meaning is the utter and complete abandoning, non-arising again, by the Arahant Path.
“Do sự diệt tận hoàn toàn không còn luyến ái” (asesavirāganirodhā) có nghĩa là do sự diệt tận hoàn toàn không còn sót lại bằng đạo gọi là ly tham (virāga), tức là sự đoạn trừ không tái sinh hoàn toàn bằng A-la-hán đạo.
Saṅkhāranirodhoti sabbesaṃ saṅkhārānaṃ anavasesaṃ anuppādanirodho.
Saṅkhāranirodho means the complete cessation, without remainder, of all saṅkhārās, their non-arising.
“Hành diệt” có nghĩa là sự diệt tận hoàn toàn không tái sinh của tất cả các hành.
Heṭṭhimena hi maggattayena keci saṅkhārā nirujjhanti, keci na nirujjhanti avijjāya sāvasesanirodhā.
For by the three lower paths, some saṅkhārās cease, but some do not cease, due to the cessation of ignorance with a remainder.
Thật vậy, bằng ba đạo thấp hơn, một số hành diệt, một số không diệt, do sự diệt trừ vô minh còn sót lại.
Aggamaggena panassā anavasesanirodhā na keci saṅkhārā na nirujjhantīti.
But by the Arahant Path, due to the complete cessation of ignorance without remainder, no saṅkhārās remain unceased.
Tuy nhiên, bằng A-la-hán đạo, do sự diệt trừ vô minh hoàn toàn không còn sót lại, nên không có hành nào không diệt.
Evaṃ bhagavatā paṭhamaṃ paccayākārapajānanassa, dutiyaṃ paccayakkhayādhigamassa, tatiyaṃ ariyamaggassa ānubhāvappakāsanāni imāni tīṇi udānāni tīsu yāmesu bhāsitāni.
Thus, these three Udānas, uttered by the Blessed One in the three watches of the night, are revelations of the power of understanding the nature of conditionality (paccaya-ākāra-pajānana), secondly, the attainment of the destruction of conditions (paccayakkhaya-adhigama), and thirdly, the Noble Path.
Như vậy, ba bài kệ ca tụng này đã được Đức Thế Tôn thuyết giảng trong ba canh, nhằm tuyên bố uy lực của việc giác ngộ nhân duyên (Paccaya-ākāra-pajānanassa) lần thứ nhất, việc đạt đến sự diệt trừ nhân duyên (Paccayakkhayādhigamassa) lần thứ hai, và của Thánh đạo (Ariyamaggassa) lần thứ ba.
Katarāya rattiyā?
On which night?
Vào đêm nào?
Abhisambodhito sattamāya rattiyā.
On the seventh night after His Perfect Enlightenment.
Vào đêm thứ bảy kể từ ngày chứng đắc Chánh Đẳng Giác.
Bhagavā hi visākhapuṇṇamāya rattiyā paṭhamayāme pubbenivāsaṃ anussaritvā majjhimayāme dibbacakkhuṃ visodhetvā pacchimayāme paṭiccasamuppāde ñāṇaṃ otāretvā nānānayehi tebhūmakasaṅkhāre sammasitvā ‘‘idāni aruṇo uggamissatī’’ti sammāsambodhiṃ pāpuṇi, sabbaññutappattisamanantarameva ca aruṇo uggacchīti.
For on the full moon night of Visākha, in the first watch, the Blessed One recollected His past lives; in the middle watch, He purified His divine eye; and in the last watch, He immersed His knowledge in Dependent Origination, contemplated the three planes of existence in various ways, and attained Perfect Self-Enlightenment, thinking, “Now the dawn will break.” And indeed, the dawn broke immediately upon His attainment of omniscience.
Thật vậy, Đức Thế Tôn đã chứng đắc Chánh Đẳng Giác vào canh đầu đêm trăng tròn tháng Visākha, sau khi nhớ lại các đời sống quá khứ; vào canh giữa, sau khi thanh tịnh thiên nhãn (dibbacakkhu); và vào canh cuối, sau khi quán xét trí tuệ về Duyên khởi (Paṭiccasamuppāda), và tư duy các hành (saṅkhāra) thuộc ba cõi (tebhūmaka) bằng nhiều phương cách khác nhau, và ngay khi Ngài đạt được Chánh Đẳng Giác, bình minh đã ló dạng.
Tato teneva pallaṅkena bodhirukkhamūle sattāhaṃ vītināmento sampattāya pāṭipadarattiyā tīsu yāmesu vuttanayena paṭiccasamuppādaṃ manasi karitvā yathākkamaṃ imāni udānāni udānesi.
Thereafter, remaining on that very same seat under the Bodhi tree for seven days, on the Pāṭipada night (the first day after the full moon), He attended to Dependent Origination in the manner described in the three watches, and uttered these Udānas in sequence.
Sau đó, Ngài ở lại dưới cội Bồ-đề trong bảy ngày với cùng một tư thế kiết già, và vào đêm đầu tháng (pāṭipada) của ngày thứ bảy, Ngài đã quán niệm Duyên khởi theo cách đã nói trong ba canh, và lần lượt thốt ra ba bài kệ ca tụng này.
4. Catutthe ajapālanigrodheti tassa kira chāyāyaṃ ajapālā gantvā nisīdanti, tenassa ‘‘ajapālanigrodho’’tveva nāmaṃ udapādi.
4. In the fourth Sutta, Ajapāla Nigrodha: It is said that goat-herders used to go and sit in its shade; hence it came to be known as Ajapāla Nigrodha.
4. Trong bài kinh thứ tư, Ajapālanigrodhe (dưới gốc cây đa Ajapāla) – Nghe nói các người chăn dê thường đến ngồi dưới bóng cây đó, nên nó có tên là “Ajapālanigrodha”.
Keci pana ‘‘yasmā tattha vede sajjhāyituṃ asamatthā mahallakabrāhmaṇā pākāraparikkhepayuttāni nivesanāni katvā sabbe vasiṃsu, tasmā ajapālanigrodhoti nāmaṃ jāta’’nti vadanti.
Some, however, say that the name Ajapāla Nigrodha arose because elderly brahmins, who were unable to recite the Vedas, built houses surrounded by walls and all dwelt there.
Một số người lại nói rằng: “Vì ở đó, các vị Bà-la-môn già không thể tụng đọc kinh Veda đã xây nhà có tường rào bao quanh và tất cả đều ở đó, nên nó có tên là Ajapālanigrodha.”
Tatrāyaṃ vacanattho – na japantīti ajapā, mantānaṃ anajjhāyakāti attho, ajapā lanti ādiyanti nivāsaṃ etthāti ajapāloti.
Therein, the meaning of the word is: Those who do not recite are ajapā; that is, those who do not study the mantras. Ajapā + āla (from ādiyanti, to take) means where the ajapā take up residence.
Ở đây, ý nghĩa của từ này là: “Những người không tụng đọc” (na japanti) là “ajapā”, nghĩa là những người không học kinh Veda; “ajapāla” là nơi mà các “ajapā” (những người không tụng đọc) đến và cư trú.
Yasmā vā majjhanhike samaye anto paviṭṭhe aje attano chāyāya pāleti rakkhati, tasmā ‘ajapālo’tissa nāmaṃ rūḷhanti apare.
Others say that its name became ‘Ajapāla’ because at midday, it protects (pāleti) the goats (aje) that have entered its shade.
Hoặc một số người khác nói rằng: Vì vào buổi trưa, cây này bảo vệ những con dê đi vào trong bóng của nó, nên nó có tên là ‘ajapāla’.
Sabbathāpi nāmametaṃ tassa rukkhassa, tassa samīpe.
In any case, this is the name of that tree, and it refers to its vicinity.
Dù bằng cách nào, đây cũng là tên của cái cây đó, ở gần cái cây đó.
Samīpatthe hi etaṃ bhummaṃ ‘‘ajapālanigrodhe’’ti.
Indeed, this locative form “ajapālanigrodhe” is in the sense of vicinity.
Vì đây là dạng định sở cách (bhummaṃ) với ý nghĩa gần kề, “ajapālanigrodhe” (dưới gốc cây đa Ajapāla).
Tatrāyaṃ anupubbikathā – bhagavati kira sammāsambodhiṃ patvā sattāhaṃ ekapallaṅkena nisinne ‘‘na bhagavā vuṭṭhāti, kinnu kho aññepi buddhattakarā dhammā atthī’’ti ekaccānaṃ devatānaṃ kaṅkhā udapādi.
Therein, this is the sequence of events: It is said that when the Blessed One attained Perfect Self-Enlightenment and sat for seven days on a single seat (pallaṅka), some deities harbored doubt, thinking, “The Blessed One has not risen; are there perhaps other qualities that lead to Buddhahood?”
Đây là câu chuyện tuần tự về điều đó: Khi Đức Thế Tôn chứng đắc Chánh Đẳng Giác và ngồi kiết già trong bảy ngày, một số chư thiên đã nảy sinh nghi ngờ: “Đức Thế Tôn không đứng dậy, liệu có còn những pháp khác để trở thành Phật nữa không?”
Atha bhagavā aṭṭhame divase samāpattito vuṭṭhāya devatānaṃ kaṅkhaṃ ñatvā kaṅkhāvidhamanatthaṃ ākāse uppatitvā yamakapāṭihāriyaṃ dassetvā tāsaṃ kaṅkhaṃ vidhametvā pallaṅkato īsakaṃ pācīnanissite uttaradisābhāge ṭhatvā cattāri asaṅkhyeyyāni kappasatasahassañca upacitānaṃ pāramīnaṃ balādhigamaṭṭhānaṃ pallaṅkaṃ bodhirukkhañca animisehi cakkhūhi olokayamāno sattāhaṃ vītināmesi, taṃ ṭhānaṃ animisacetiyaṃ nāma jātaṃ.
Then, on the eighth day, the Blessed One arose from that attainment. Having known the devas' doubt, and to dispel that doubt, He rose into the sky, performed the Twin Miracle, and dispelled their doubt. Then, having stood in the northern quarter, slightly to the east of the Bodhi-seat, He spent a week gazing with unblinking eyes at the Bodhi-seat and the Bodhi tree, which was the place where the fruit of the Pāramīs accumulated over four asaṅkheyyas and a hundred thousand aeons was attained. That place became known as Animisacetiya.
Rồi vào ngày thứ tám, Đức Thế Tôn xuất khỏi thiền định, biết được sự nghi ngờ của chư thiên, và để xua tan nghi ngờ đó, Ngài bay lên không trung, thể hiện song thần thông (yamakapāṭihāriyaṃ), xua tan nghi ngờ của họ, rồi đứng ở phía bắc, hơi nghiêng về phía đông so với chỗ kiết già, Ngài nhìn chằm chằm vào chỗ kiết già và cây Bồ-đề—nơi thành tựu các Ba-la-mật đã tích lũy trong bốn a-tăng-kỳ và một trăm ngàn đại kiếp—bằng đôi mắt không chớp trong bảy ngày. Nơi đó được gọi là Animisacetiya.
Atha pallaṅkassa ca ṭhitaṭṭhānassa ca antarā puratthimato ca pacchimato ca āyate ratanacaṅkame caṅkamanto sattāhaṃ vītināmesi, taṃ ratanacaṅkamacetiyaṃ nāma jātaṃ.
Then, for a week, He walked back and forth on a jeweled promenade, which was long and extended from east to west, between the Bodhi-seat and the place where He stood. That place became known as Ratanacaṅkamacetiya.
Sau đó, Ngài đi kinh hành trong bảy ngày trên con đường kinh hành bằng ngọc trải dài từ đông sang tây, giữa chỗ kiết già và chỗ Ngài đứng. Nơi đó được gọi là Ratanacaṅkamacetiya.
Tato pacchimadisābhāge devatā ratanagharaṃ māpayiṃsu, tattha pallaṅkena nisīditvā abhidhammapiṭakaṃ visesato anantanayaṃ samantapaṭṭhānaṃ vicinanto sattāhaṃ vītināmesi, taṃ ṭhānaṃ ratanagharacetiyaṃ nāma jātaṃ.
After that, in the western quarter, devas created a jeweled house. There, seated cross-legged, He spent a week contemplating the Abhidhamma Piṭaka, especially the Samantapaṭṭhāna with its infinite methods. That place became known as Ratanagharacetiya.
Rồi ở phía tây, chư thiên đã tạo ra một ngôi nhà bằng ngọc. Ở đó, Ngài ngồi kiết già và quán xét Tạng Vi diệu pháp (Abhidhammapiṭaka), đặc biệt là Samantapaṭṭhāna với vô số phương cách trong bảy ngày. Nơi đó được gọi là Ratanagharacetiya.
Evaṃ bodhisamīpeyeva cattāri sattāhāni vītināmetvā pañcame sattāhe bodhirukkhato ajapālanigrodhaṃ upasaṅkamitvā tassa mūle pallaṅkena nisīdi.
Having thus spent four weeks right near the Bodhi tree, in the fifth week, He approached the Ajapāla Nigrodha tree from the Bodhi tree and sat cross-legged at its root.
Như vậy, sau khi trải qua bốn bảy ngày ngay gần cây Bồ-đề, vào bảy ngày thứ năm, Ngài rời cây Bồ-đề, đến cây đa Ajapāla và ngồi kiết già dưới gốc cây đó.
Tamhā samādhimhā vuṭṭhāsīti tato phalasamāpattisamādhito yathākālaparicchedaṃ vuṭṭhahi, vuṭṭhahitvā ca pana tattha evaṃ nisinne bhagavati eko brāhmaṇo taṃ gantvā pañhaṃ pucchi.
He arose from that concentration means He arose from that fruit-attainment concentration at the appointed time. Having arisen, while the Blessed One was sitting there, a certain brahmin went to Him and asked a question.
Tamhā samādhimhā vuṭṭhāsī (Ngài xuất khỏi thiền định đó) – Ngài xuất khỏi thiền định quả vị (phalasamāpatti) theo thời gian đã định, và khi Ngài đang ngồi ở đó, một Bà-la-môn đã đến hỏi Ngài một câu hỏi.
Tena vuttaṃ ‘‘atha kho aññataro’’tiādi.
Therefore, it is said, "Then a certain one" and so on.
Vì thế, có lời nói “atha kho aññataro” (rồi một người nào đó) và vân vân.
Tattha aññataroti nāmagottavasena anabhiññāto apākaṭo eko.
Here, a certain one means one whose name and clan were unknown and not prominent.
Ở đây, aññataro (một người nào đó) là một người không được biết đến hay không nổi tiếng theo tên và dòng họ.
Huṃhuṅkajātikoti so kira diṭṭhamaṅgaliko mānathaddho mānavasena kodhavasena ca sabbaṃ avokkhajātikaṃ passitvā jigucchanto ‘‘huṃhu’’nti karonto vicarati, tasmā ‘‘huṃhuṅkajātiko’’ti vuccati, ‘‘huhukkajātiko’’tipi pāṭho.
Huṃhuṅkajātiko means that brahmin, having a superstitious belief and being stiff with conceit, saw all those of inferior birth with disdain due to his conceit and anger, and went about making a "huṃhuṃ" sound, thus he is called "huṃhuṅkajātiko." There is also the reading "huhukkajātiko."
Huṃhuṅkajātiko (thuộc loại Huṃhuṅka) – Nghe nói, người đó có tín ngưỡng mê tín (diṭṭhamaṅgalika), kiêu căng và do kiêu mạn và giận dữ, khi thấy bất cứ ai thuộc dòng dõi thấp kém hơn mình, y đều ghê tởm và đi lại kêu “huṃhuṃ”. Vì thế, y được gọi là “huṃhuṅkajātiko”. Cũng có bản đọc là “huhukkajātiko”.
Brāhmaṇoti jātiyā brāhmaṇo.
Brāhmaṇo means a brahmin by birth.
Brāhmaṇo (Bà-la-môn) – là Bà-la-môn về dòng dõi.
Yena bhagavāti yassaṃ disāyaṃ bhagavā nisinno.
Where the Blessed One was refers to the direction in which the Blessed One was seated.
Yena bhagavā (Đến chỗ Đức Thế Tôn) – Đến hướng mà Đức Thế Tôn đang ngồi.
Bhummatthe hi etaṃ karaṇavacanaṃ.
Indeed, this instrumental case is used in the sense of location.
Thật vậy, đây là từ ở dạng công cụ cách (karaṇavacanaṃ) với ý nghĩa định sở cách (bhummatthe).
Yena vā disābhāgena bhagavā upasaṅkamitabbo, tena disābhāgena upasaṅkami.
Alternatively, he approached the direction in which the Blessed One was to be approached.
Hoặc, y đã đến theo hướng mà Đức Thế Tôn nên được đến.
Atha vā yenāti hetuatthe karaṇavacanaṃ, yena kāraṇena bhagavā devamanussehi upasaṅkamitabbo, tena kāraṇena upasaṅkamīti attho.
Or, yena is an instrumental case in the sense of cause. The meaning is: he approached for the reason for which the Blessed One is to be approached by devas and humans.
Hoặc, yenā (bằng cái gì) là từ ở dạng công cụ cách với ý nghĩa nguyên nhân (hetuatthe), nghĩa là: y đã đến vì lý do mà Đức Thế Tôn nên được chư thiên và loài người đến.
Kena ca kāraṇena bhagavā upasaṅkamitabbo?
And for what reason is the Blessed One to be approached?
Và vì lý do gì mà Đức Thế Tôn nên được đến?
Nānappakārarogadukkhābhipīḷitattā āturakāyehi mahājanehi mahānubhāvo bhisakko viya rogatikicchanatthaṃ, nānāvidhakilesabyādhipīḷitattā āturacittehi devamanussehi kilesabyādhitikicchanatthaṃ dhammassavanapañhapucchanādikāraṇehi bhagavā upasaṅkamitabbo.
He is to be approached by devas and humans, whose bodies are afflicted with various kinds of diseases and suffering, for the treatment of their diseases, just as a great and powerful physician is approached by sick people for the treatment of their ailments; and whose minds are afflicted with various kinds of defilements and illnesses, for the treatment of their defilement-illnesses, for the purpose of hearing the Dhamma, asking questions, and so on.
Vì chúng sanh bị hành hạ bởi đủ loại bệnh tật và khổ đau, giống như những người bệnh nặng đến gặp một vị lương y vĩ đại để chữa bệnh; và vì chư thiên và loài người bị hành hạ bởi đủ loại bệnh phiền não (kilesabyādhi), Đức Thế Tôn nên được đến vì các lý do như nghe Pháp và hỏi các câu hỏi để chữa trị bệnh phiền não.
Tena ayampi brāhmaṇo attano kaṅkhaṃ chinditukāmo upasaṅkami.
This brahmin, too, wishing to cut off his own doubt, approached Him.
Vì thế, Bà-la-môn này cũng đã đến, muốn giải tỏa nghi ngờ của mình.
Upasaṅkamitvāti upasaṅkamanapariyosānadīpanaṃ.
Upasaṅkamitvā indicates the completion of the approach.
Upasaṅkamitvā (sau khi đến gần) – chỉ sự kết thúc của việc đến gần.
Atha vā yaṃ ṭhānaṃ upasaṅkami, tatopi bhagavato samīpabhūtaṃ āsannataraṃ ṭhānaṃ upagantvāti attho.
Alternatively, it means having gone to a place closer and nearer to the Blessed One than the place he first approached.
Hoặc, nghĩa là: sau khi đến gần hơn nữa, đến một chỗ gần Đức Thế Tôn hơn chỗ y đã đến.
Sammodīti samaṃ sammā vā modi, bhagavā cānena, sopi bhagavatā ‘‘kacci bhoto khamanīyaṃ kacci yāpanīya’’ntiādinā paṭisanthārakaraṇavasena samappavattamodo ahosi.
Sammodī means he rejoiced equally or properly. The Blessed One rejoiced with him, and he with the Blessed One, in a manner of mutual pleasant conversation, such as "Is all well with you, sir? Is life manageable?"
Sammodī (Ngài hoan hỷ) – Ngài đã hoan hỷ một cách bình đẳng hoặc một cách đúng đắn; Đức Thế Tôn đã hoan hỷ với y, và y cũng đã hoan hỷ một cách bình đẳng với Đức Thế Tôn thông qua việc chào hỏi như “Này bạn, bạn có khỏe không, bạn có sống được không?” và vân vân.
Sammodanīyanti sammodanārahaṃ sammodajananayoggaṃ.
Sammodanīyaṃ means worthy of rejoicing, suitable for generating joy.
Sammodanīyaṃ (đáng hoan hỷ) – đáng được hoan hỷ, thích hợp để tạo ra sự hoan hỷ.
Kathanti kathāsallāpaṃ.
Kathaṃ means a conversation or discourse.
Kathaṃ (cuộc đàm luận) – cuộc trò chuyện.
Sāraṇīyanti saritabbayuttaṃ sādhujanehi pavattetabbaṃ, kālantare vā cintetabbaṃ.
Sāraṇīyaṃ means fit to be remembered, suitable to be engaged in by virtuous people, or to be contemplated later.
Sāraṇīyaṃ (đáng ghi nhớ) – đáng được nhớ, đáng được người tốt thực hiện, hoặc đáng được suy nghĩ vào một thời điểm khác.
Vītisāretvāti niṭṭhāpetvā.
Vītisāretvā means having concluded it.
Vītisāretvā (sau khi kết thúc) – sau khi hoàn tất.
Ekamantanti bhāvanapuṃsakaniddeso.
Ekamantaṃ is an indication of an adverbial neuter noun.
Ekamantaṃ (sang một bên) – là cách chỉ định danh từ trung tính thuộc loại trạng từ.
Ekasmiṃ ṭhāne, atisammukhādike cha nisajjadose vajjetvā ekasmiṃ padeseti attho.
It means in one place, in a single spot, avoiding the six faults of sitting, such as being too close.
Nghĩa là: ở một chỗ, tránh sáu lỗi ngồi như quá gần mặt, ở một nơi.
Etadavocāti etaṃ idāni vattabbaṃ ‘‘kittāvatā nu kho’’tiādivacanaṃ avoca.
Etadavocā means he spoke these words, which are now to be said, starting with "By what extent, pray, then..."
Etadavocā (y đã nói điều này) – y đã nói những lời sắp nói bây giờ, như “kittāvatā nu kho” (cho đến mức độ nào vậy?) và vân vân.
Tattha kittāvatāti kittakena pamāṇena.
Here, kittāvatā means by what measure.
Ở đây, kittāvatā (cho đến mức độ nào) – với bao nhiêu giới hạn.
Nūti saṃsayatthe nipāto.
Nū is a particle in the sense of doubt.
Nū (vậy) – là một giới từ với ý nghĩa nghi vấn.
Khoti padapūraṇe.
Kho is for filling out the line.
Kho (thật vậy) – là một giới từ để làm đầy đủ câu.
Bhoti brāhmaṇānaṃ jātisamudāgataṃ ālapanaṃ.
Bho is a form of address inherent to brahmins by birth.
Bho (này) – là cách xưng hô tự nhiên của Bà-la-môn.
Tathā hi vuttaṃ – ‘‘bhovādi nāma so hoti, sace hoti sakiñcano’’ti (ma. ni. 2.457; dha. pa. 396).
As it is said: "He is called 'bhovādi' if he has nothing."
Như đã nói: “Người nào có tài sản thì được gọi là ‘bhovādī’.”
Gotamāti bhagavantaṃ gottena ālapati.
Gotamā means he addresses the Blessed One by His clan.
Gotama là gọi Đức Thế Tôn bằng họ.
Kathaṃ panāyaṃ brāhmaṇo sampatisamāgato bhagavato gottaṃ jānātīti?
How, then, did this brahmin, meeting Him now, know the Blessed One's clan?
Thế thì, làm sao vị Bà-la-môn này, mới gặp mà lại biết được họ của Đức Thế Tôn?
Nāyaṃ sampatisamāgato, chabbassāni padhānakaraṇakāle upaṭṭhahantehi pañcavaggiyehi saddhiṃ caramānopi, aparabhāge taṃ vataṃ chaḍḍetvā uruvelāyaṃ senanigame eko adutiyo hutvā piṇḍāya caramānopi tena brāhmaṇena diṭṭhapubbo ceva sallapitapubbo ca.
He was not meeting Him for the first time. Even while the Blessed One was practicing austerities for six years with the group of five monks who attended Him, and later, having abandoned that practice, when He was wandering alone for alms in Uruvelā in the Senānigama, that brahmin had seen Him before and conversed with Him before.
Vị này không phải là người mới gặp, mà đã từng được vị Bà-la-môn đó nhìn thấy và nói chuyện trước đây, khi Ngài còn tu khổ hạnh sáu năm cùng với nhóm năm vị Tỳ-kheo hầu hạ, và sau đó, khi Ngài từ bỏ khổ hạnh, một mình không bạn đồng hành, đi khất thực tại làng Senanigama ở Uruvelā.
Tena so pubbe pañcavaggiyehi gayhamānaṃ bhagavato gottaṃ anussaranto, ‘‘bho gotamā’’ti bhagavantaṃ gottena ālapati.
Therefore, remembering the Blessed One's clan, which was used by the group of five monks previously, he addressed the Blessed One by clan, saying, "Bho Gotamā."
Do đó, vị Bà-la-môn này, nhớ lại họ của Đức Thế Tôn mà nhóm năm vị Tỳ-kheo đã dùng trước đây, nên gọi Đức Thế Tôn bằng họ: “Bạch Gotama!”
Yato paṭṭhāya vā bhagavā mahābhinikkhamanaṃ nikkhamanto anomanadītīre pabbajito, tato pabhuti ‘‘samaṇo gotamo’’ti cando viya sūriyo viya ca pākaṭo paññāto, na tassa gottajānane kāraṇaṃ gavesitabbaṃ.
Or, from the time the Blessed One went forth on the Great Renunciation and renounced the world on the banks of the Anoma River, from that time onwards, "Samaṇa Gotama" became as well-known and famous as the moon or the sun; there is no need to search for a reason why he knew His clan.
Hoặc, kể từ khi Đức Thế Tôn xuất gia đại từ bỏ, đi tu tại bờ sông Anoma, từ đó Ngài đã trở nên nổi tiếng, được biết đến như mặt trăng, mặt trời, với danh hiệu “Sa-môn Gotama”, nên không cần phải tìm kiếm lý do để biết họ của Ngài.
Etamatthaṃ viditvāti etaṃ tena puṭṭhassa pañhassa sikhāpattaṃ atthaṃ viditvā tāyaṃ velāyaṃ imaṃ udānaṃ udānesi, na pana tassa brāhmaṇassa dhammaṃ desesi.
Etamatthaṃ viditvā means having understood the supreme meaning of the question asked by that brahmin, He uttered this solemn utterance (udāna) at that time, but He did not preach the Dhamma to that brahmin.
Etamatthaṃ viditvā: là sau khi biết ý nghĩa cao quý của câu hỏi mà vị ấy đã hỏi, Đức Thế Tôn đã thốt lên lời cảm hứng này vào lúc đó, chứ không thuyết pháp cho vị Bà-la-môn đó.
Dhammadesanāya abhājanabhāvato.
Because he was not a fit recipient for the Dhamma teaching.
Vì vị ấy không phải là người xứng đáng để nghe pháp.
Tathā hi tassa brāhmaṇassa imaṃ gāthaṃ sutvā na saccābhisamayo ahosi.
Indeed, that brahmin, having heard this verse, did not attain the realization of the truth.
Thật vậy, sau khi nghe bài kệ này, vị Bà-la-môn đó đã không chứng ngộ chân lý.
Yathā ca imassa, evaṃ upakassa ājīvakassa buddhaguṇappakāsanaṃ.
Just as with him, so too with Upaka the Ājīvaka, it was merely an exposition of the Buddha's qualities.
Cũng như trường hợp của vị này, sự tuyên bố phẩm hạnh của Đức Phật đối với Upaka, vị du sĩ Ājīvaka, cũng tương tự.
Dhammacakkappavattanato hi pubbabhāge bhagavatā bhāsitaṃ paresaṃ suṇantānampi tapussabhallikānaṃ saraṇadānaṃ viya vāsanābhāgiyameva jātaṃ, na sekkhabhāgiyaṃ, na nibbedhabhāgiyaṃ.
For, before the turning of the Wheel of Dhamma, what was spoken by the Blessed One, even to those who listened, like the giving of refuge to Tapassu and Bhallika, only became conducive to future dispositions (vāsanābhāgiya), not conducive to higher training (sekkhabhāgiya) nor to penetration (nibbedhabhāgiya).
Thật vậy, những lời Đức Thế Tôn đã thuyết trước khi chuyển Pháp luân, ngay cả khi người khác nghe, như việc ban Tam quy cho Tapussa và Bhallika, chỉ là những gì thuộc về phần huân tập (vāsanābhāgiya), chứ không phải thuộc về phần học (sekkhabhāgiya), cũng không phải thuộc về phần thấu triệt (nibbedhabhāgiya).
Esā hi dhammatāti.
For this is the nature of things.
Đây là lẽ tự nhiên của pháp.
Tattha yo brāhmaṇoti yo bāhitapāpadhammatāya brāhmaṇo, na diṭṭhamaṅgalikatāya huṃhuṅkārakasāvādipāpadhammayutto hutvā kevalaṃ jātimattakena brahmaññaṃ paṭijānāti.
Here, yo brāhmaṇo means a brahmin who is such by having expelled evil qualities, not one who, being imbued with evil qualities like superstition and making "huṃhuṃ" sounds, merely claims brahminhood by birth alone.
Trong đó, yo brāhmaṇo (vị Bà-la-môn nào) là vị Bà-la-môn do đã loại bỏ các pháp ác, chứ không phải do có tín ngưỡng mê tín, không phải do dính mắc vào các pháp ác như "huṃhuṅkāra" (tiếng hừ mũi) và "kasāva" (ô nhiễm), chỉ đơn thuần tự xưng là Bà-la-môn do dòng dõi.
So brāhmaṇo bāhitapāpadhammattā huṃhuṅkārappahānena nihuṃhuṅko, rāgādikasāvābhāvena nikkasāvo, bhāvanānuyogayuttacittatāya yatatto, sīlasaṃyamena vā saṃyatacittatāya yatatto, catumaggañāṇasaṅkhātehi vedehi antaṃ saṅkhārapariyosānaṃ nibbānaṃ, vedānaṃ vā antaṃ gatattā vedantagū.
Such a brahmin, by having expelled evil qualities, and by abandoning the "huṃhuṃ" sounds, is nihuṃhuṅko (one who does not make "huṃhuṃ" sounds), without defilements like passion (rāga), he is nikkasāvo (taintless), by having a mind engaged in meditative development, he is yatatto (self-controlled), or by self-restraint in morality, he is yatatto (self-controlled), and by having reached the end of existence (saṅkhāras), which is Nibbāna, through the four path-knowledges (maggañāṇa), or by having reached the end of the Vedas, he is vedantagū (one who has reached the end of the Vedas).
Vị Bà-la-môn đó, do đã loại bỏ các pháp ác, do đã từ bỏ tiếng hừ mũi nên nihuṃhuṅko (không hừ mũi), do không có các ô nhiễm như tham ái nên nikkasāvo (không ô nhiễm), do tâm chuyên chú vào việc tu tập nên yatatto (tâm được chế ngự), hoặc do tâm được chế ngự bởi sự giữ giới và tự chủ nên yatatto (tâm được chế ngự), do đã đạt đến Niết-bàn, tức là sự chấm dứt của các hành, bằng các tri kiến của bốn đạo, hoặc do đã đạt đến tận cùng của các Veda nên vedantagū (người đã đạt đến tận cùng của Veda).
Maggabrahmacariyassa vusitattā vusitabrahmacariyo, dhammena so brahmavādaṃ vadeyya ‘‘brāhmaṇo aha’’nti etaṃ vādaṃ dhammena ñāyena vadeyya.
Because the noble practice of the path has been lived, he is one for whom the noble practice has been lived. He should utter the assertion of a Brāhmaṇa righteously, meaning, he should utter this assertion, ‘I am a Brāhmaṇa,’ righteously and properly.
Do đã hoàn thành phạm hạnh của đạo nên vusitabrahmacariyo (người đã hoàn thành phạm hạnh), dhammena so brahmavādaṃ vadeyya (vị ấy nên nói lời của Bà-la-môn một cách đúng đắn), nghĩa là vị ấy nên nói lời này: "Tôi là Bà-la-môn" một cách đúng đắn, hợp lý.
Yassa sakalalokasannivāsepi kuhiñci ekārammaṇepi rāgussado, dosussado, mohussado, mānussado, diṭṭhussadoti ime ussadā natthi, anavasesaṃ pahīnāti attho.
For whom, even in the entire world assembly, nowhere, even in any single object, these excesses—the excess of lust, the excess of hatred, the excess of delusion, the excess of conceit, the excess of wrong view— do not exist, meaning, they are completely abandoned.
Yassa (mà của ai), ngay cả trong toàn bộ thế giới, kuhiñci (ở bất cứ đâu), dù chỉ là một đối tượng, không có những sự dâng trào này: sự dâng trào của tham ái, sự dâng trào của sân hận, sự dâng trào của si mê, sự dâng trào của kiêu mạn, sự dâng trào của tà kiến, nghĩa là tất cả đều đã được đoạn trừ không còn sót lại.
Tassaṃ sāvatthiyaṃ, samīpatthe cetaṃ bhummavacanaṃ.
In that Sāvatthī, this locative case is in the sense of proximity.
Trong Sāvatthiyaṃ đó, đây là cách dùng locative case (chỉ nơi chốn) với ý nghĩa gần kề.
Jetavaneti attano paccatthike jinātīti jeto, raññā vā paccatthikajane jite jātoti jeto, maṅgalakamyatāya vā tassa evaṃ nāmameva katanti jeto.
In Jetavana: Jeta is so called because he conquers his enemies, or because he was born when his father, the king, had conquered his enemies, or because the name Jeta was given for auspicious reasons.
Jetavane (tại Jetavana): Vị nào chiến thắng kẻ thù của mình thì gọi là Jeta; hoặc Jeta vì sinh ra khi vua đã chiến thắng kẻ thù; hoặc Jeta là tên được đặt để cầu mong điều tốt lành.
Vanayatīti vanaṃ, attano sampattiyā sattānaṃ attani bhattiṃ karoti uppādetīti attho.
It is a forest (vana) because it delights; meaning, by its abundance it causes beings to have devotion and delight in it.
Vanaṃ (khu rừng) là nơi làm cho chúng sinh có lòng tin vào mình nhờ sự sung túc của nó, tức là làm phát sinh lòng tin.
Vanuke iti vā vanaṃ, nānāvidhakusumagandhasammodamattakokilādivihaṅgavirutālāpehi mandamārutacalitarukkhasākhāpallavahatthehi ca ‘‘etha maṃ paribhuñjathā’’ti pāṇino yācati viyāti attho.
Or, it is a forest (vana) because it invites, meaning, it is as if it invites creatures, saying, "Come, enjoy me," with the sounds of various fragrant flowers, the songs of intoxicated cuckoos and other birds, and the leaf-hands of trees swaying in the gentle breeze.
Hoặc vanaṃ (khu rừng) là nơi mời gọi chúng sinh đến hưởng thụ, như thể nó đang mời gọi bằng những tiếng hót líu lo của các loài chim như chim cu gáy say sưa với hương thơm của các loài hoa đa dạng, và bằng những cành cây, lá cây lay động nhẹ nhàng theo làn gió mát.
Jetassa vanaṃ jetavanaṃ.
The forest of Jeta is Jetavana.
Khu rừng của Jeta là Jetavanaṃ.
Tañhi jetena kumārena ropitaṃ saṃvaddhitaṃ paripālitaṃ.
Indeed, it was planted, nurtured, and maintained by Prince Jeta.
Khu rừng đó được Thái tử Jeta trồng, vun đắp và bảo vệ.
Sova tassa sāmī ahosi, tasmā jetavananti vuccati, tasmiṃ jetavane.
He was its owner; therefore, it is called Jetavana. In that Jetavana.
Chính Thái tử là chủ của khu rừng đó, nên được gọi là Jetavana. Tại Jetavane đó.
Anāthapiṇḍikassa ārāmeti mātāpitūhi gahitanāmavasena sudatto nāma so mahāseṭṭhi, sabbakāmasamiddhitāya pana vigatamalamaccheratāya karuṇādiguṇasamaṅgitāya ca niccakālaṃ anāthānaṃ piṇḍaṃ deti, tasmā anāthapiṇḍikoti vuccati.
In Anāthapiṇḍika’s pleasure garden: That great financier, Sudatta by name, was so called by his parents. But because of his complete material prosperity, his freedom from defilements and stinginess, and his possession of qualities like compassion, he constantly gave alms to the helpless, so he was called Anāthapiṇḍika.
Anāthapiṇḍikassa ārāme (tại tinh xá của Anāthapiṇḍika): Vị đại phú hộ đó tên là Sudatta theo tên cha mẹ đặt, nhưng vì luôn cho cơm cho những người khốn khó, do sự sung túc mọi ham muốn, do không còn cấu uế và keo kiệt, và do có các đức tính như lòng bi mẫn, nên được gọi là Anāthapiṇḍika.
Āramanti ettha pāṇino visesena pabbajitāti ārāmo, pupphaphalādisobhāya nātidūranāccāsannatādipañcavidhasenāsanaṅgasampattiyā ca tato tato āgamma ramanti abhiramanti anukkaṇṭhitā hutvā vasantīti attho.
It is a pleasure garden (ārāma) because beings, especially monastics, delight therein; meaning, due to the beauty of its flowers, fruits, etc., and its possession of the five excellent characteristics of a dwelling place, such as being neither too far nor too near, people come from all directions, find delight, rejoice, and reside there without weariness.
Ārāmo (tinh xá) là nơi chúng sinh, đặc biệt là các vị xuất gia, hoan hỷ; có nghĩa là do vẻ đẹp của hoa quả, v.v., và do sự đầy đủ năm yếu tố của chỗ ở (senāsana) như không quá xa, không quá gần, v.v., nên chúng sinh từ khắp nơi đến đây hoan hỷ, vui thích và an trú mà không cảm thấy chán nản.
Vuttappakārāya vā sampattiyā tattha tattha gatepi attano abbhantaraṃyeva ānetvā rametīti ārāmo.
Or, it is a pleasure garden because, by its aforementioned prosperity, it draws those who have gone elsewhere back into its midst and delights them.
Hoặc ārāmo (tinh xá) là nơi kéo những người đã đi đến nơi khác vào bên trong mình và làm cho họ hoan hỷ bằng sự sung túc đã nói trên.
So hi anāthapiṇḍikena gahapatinā jetassa rājakumārassa hatthato aṭṭhārasahi hiraññakoṭīhi koṭisanthārena kiṇitvā aṭṭhārasahi hiraññakoṭīhi senāsanāni kārāpetvā aṭṭhārasahi hiraññakoṭīhi vihāramahaṃ niṭṭhāpetvā evaṃ catupaññāsahiraññakoṭipariccāgena buddhappamukhassa saṅghassa niyyātito, tasmā ‘‘anāthapiṇḍikassa ārāmo’’ti vuccati.
Indeed, that pleasure garden was bought by Anāthapiṇḍika the householder from Prince Jeta for eighteen crores of gold coins by covering the ground with them, and then, after building dwelling places for another eighteen crores of gold coins, and completing the ceremony of dedicating the monastery for yet another eighteen crores of gold coins, thus spending fifty-four crores of gold coins, he dedicated it to the Saṅgha, headed by the Buddha. Therefore, it is called "Anāthapiṇḍika’s pleasure garden."
Tinh xá đó đã được gia chủ Anāthapiṇḍika mua từ Thái tử Jeta với giá mười tám triệu đồng tiền vàng (hiraññakoṭī) bằng cách trải tiền vàng khắp mặt đất, sau đó xây dựng các chỗ ở (senāsana) với mười tám triệu đồng tiền vàng, và hoàn tất đại lễ dâng tinh xá với mười tám triệu đồng tiền vàng, tổng cộng là năm mươi bốn triệu đồng tiền vàng, rồi dâng cúng cho Tăng đoàn do Đức Phật đứng đầu. Vì vậy, nó được gọi là “tinh xá của Anāthapiṇḍika”.
Tasmiṃ anāthapiṇḍikassa ārāme.
In that Anāthapiṇḍika’s pleasure garden.
Tại Anāthapiṇḍikassa ārāme đó.
Tattha siyā – yadi tāva bhagavā sāvatthiyaṃ viharati, ‘‘jetavane’’ti na vattabbaṃ.
Here, one might ask: If the Blessed One dwells in Sāvatthī, then "Jetavana" should not be said.
Ở đây, có thể có câu hỏi: Nếu Đức Thế Tôn cư ngụ tại Sāvatthī, thì không nên nói “tại Jetavana”.
Atha jetavane viharati, ‘‘sāvatthiya’’nti na vattabbaṃ.
And if he dwells in Jetavana, then "Sāvatthī" should not be said.
Nếu Ngài cư ngụ tại Jetavana, thì không nên nói “tại Sāvatthī”.
Na hi sakkā ubhayattha ekaṃ samayaṃ viharitunti.
For it is not possible to dwell in both places at once.
Vì không thể cư ngụ ở cả hai nơi cùng một lúc.
Na kho panetaṃ evaṃ daṭṭhabbaṃ, nanu avocumhā ‘‘samīpatthe etaṃ bhummavacana’’nti.
However, it should not be seen in this way, for did we not say earlier that "this is a locative case in the sense of proximity"?
Tuy nhiên, điều này không nên được hiểu như vậy, chẳng phải chúng ta đã nói rằng “đây là cách dùng locative case với ý nghĩa gần kề” sao?
Tasmā yadidaṃ sāvatthiyā samīpe jetavanaṃ, tattha viharanto ‘‘sāvatthiyaṃ viharati jetavane’’ti vutto.
Therefore, since Jetavana is near Sāvatthī, one dwelling there is spoken of as "dwelling in Sāvatthī, in Jetavana."
Vì vậy, khu rừng Jetavana này nằm gần Sāvatthī, nên khi cư ngụ ở đó, Đức Thế Tôn được nói là “cư ngụ tại Sāvatthī, tại Jetavana”.
Gocaragāmanidassanatthaṃ hissa sāvatthivacanaṃ, pabbajitānurūpanivāsaṭṭhānadassanatthaṃ sesavacananti.
The mention of Sāvatthī is to indicate his alms-resort village, and the rest of the statement is to indicate a dwelling place suitable for monastics.
Lời nói “Sāvatthī” là để chỉ ra ngôi làng khất thực của Ngài, còn những lời khác là để chỉ ra nơi cư ngụ phù hợp với một vị xuất gia.
Āyasmā ca sāriputtotiādīsu āyasmāti piyavacanaṃ.
In the phrases such as "and the Venerable Sāriputta," "Venerable" is an affectionate term.
Trong các từ như Āyasmā ca Sāriputto (và Tôn giả Sāriputta), Āyasmā là một từ thân mật.
Casaddo samuccayattho.
The word "ca" (and) is in the sense of aggregation.
Từ “ca” có nghĩa là tập hợp.
Rūpasāriyā nāma brāhmaṇiyā puttoti sāriputto.
Sāriputta means the son of the Brāhmaṇī named Rūpasārī.
Sāriputto là con trai của nữ Bà-la-môn tên Rūpasārī.
Mahāmoggallānoti pūjāvacanaṃ.
Mahāmoggallāna is a term of veneration.
Mahāmoggallāno là một từ tôn kính.
Guṇavisesehi mahanto moggallānoti hi mahāmoggallāno.
Indeed, Moggallāna is Mahāmoggallāna because he is great in special qualities.
Thật vậy, Mahāmoggallāno là Moggallāna vĩ đại nhờ các phẩm chất đặc biệt.
Revatoti khadiravanikarevato, na kaṅkhārevato.
Revata refers to Revata of the acacia grove, not Kaṅkhārevata.
Revato có nghĩa là Revata sống trong rừng cây keo, không phải là Kaṅkhārevata.
Ekasmiñhi divase bhagavā rattasāṇiparikkhitto viya suvaṇṇayūpo, pavāḷadhajaparivārito viya suvaṇṇapabbato, navutihaṃsasahassaparivārito viya dhataraṭṭho haṃsarājā, sattaratanasamujjalāya caturaṅginiyā senāya parivārito viya cakkavatti rājā, mahābhikkhusaṅghaparivuto gaganamajjhe candaṃ uṭṭhāpento viya catunnaṃ parisānaṃ majjhe dhammaṃ desento nisinno hoti.
For one day, the Blessed One sat preaching the Dhamma in the midst of the four assemblies, like a golden pillar encircled by crimson cloths, like a golden mountain surrounded by coral banners, like Dhātaraṭṭha, the king of geese, accompanied by ninety thousand geese, like a universal monarch surrounded by a fourfold army resplendent with seven jewels, or like raising the moon in the middle of the sky, accompanied by a great assembly of bhikkhus.
Thật vậy, một ngày nọ, Thế Tôn ngự tọa thuyết pháp giữa bốn chúng hội, như một tháp vàng được bao quanh bởi những tấm vải len đỏ, như một ngọn núi vàng được bao quanh bởi năm ngọn lửa rực rỡ, như vua thiên nga Dhataraṭṭha được chín mươi ngàn con thiên nga vây quanh, như một vị Chuyển Luân Vương được bao quanh bởi đạo quân bốn binh chủng rực rỡ với bảy báu vật, như mặt trăng mọc giữa hư không được bao quanh bởi đại Tăng đoàn.
Tasmiṃ samaye ime aggasāvakā mahāsāvakā ca bhagavato pāde vandanatthāya upasaṅkamiṃsu.
At that time, these chief disciples and great disciples approached to pay homage to the feet of the Blessed One.
Vào thời điểm đó, các vị Thượng Thủ Thanh Văn và Đại Thanh Văn này đã đến để đảnh lễ chân của Thế Tôn.
Bhikkhū āmantesīti attānaṃ parivāretvā nisinnabhikkhū te āgacchante dassetvā abhāsi.
He addressed the bhikkhus, meaning, he showed those venerable ones approaching to the bhikkhus seated surrounding him and spoke.
Bhikkhū āmantesī (Thế Tôn gọi các Tỳ-kheo) có nghĩa là Thế Tôn đã chỉ các vị ấy đang đến cho các Tỳ-kheo đang ngồi vây quanh Ngài và nói.
Bhagavā hi te āyasmante sīlasamādhipaññādiguṇasampanne paramena upasamena samannāgate paramāya ākappasampattiyā yutte upasaṅkamante passitvā pasannamānaso tesaṃ guṇavisesaparikittanatthaṃ bhikkhū āmantesi ‘‘ete, bhikkhave, brāhmaṇā āgacchanti, ete, bhikkhave, brāhmaṇā āgacchantī’’ti.
Indeed, the Blessed One, seeing those venerable ones approaching—endowed with virtues such as morality, concentration, and wisdom, possessed of supreme tranquility, and adorned with supreme decorum—was delighted in mind. To extol their special qualities, he addressed the bhikkhus, "These Brāhmaṇas, bhikkhus, are approaching. These Brāhmaṇas, bhikkhus, are approaching."
Thật vậy, Thế Tôn thấy các Tôn giả ấy, những người đầy đủ các đức tánh như giới, định, tuệ, có sự an tịnh tối thượng, và có oai nghi tối thượng, đang đến gần, Ngài hoan hỷ trong tâm, và để tán thán những phẩm chất đặc biệt của các vị ấy, Ngài đã gọi các Tỳ-kheo: “Này các Tỳ-kheo, các vị Bà-la-môn này đang đến, này các Tỳ-kheo, các vị Bà-la-môn này đang đến.”
Pasādavasena etaṃ āmeḍitaṃ, pasaṃsāvasenātipi vattuṃ yuttaṃ.
This repetition is spoken out of delight; it is also appropriate to say it is out of praise.
Câu lặp lại này được nói với ý hoan hỷ, và cũng có thể nói là với ý tán thán.
Evaṃ vutteti evaṃ bhagavatā te āyasmante ‘‘brāhmaṇā’’ti vutte.
When this was said, meaning, when the Blessed One thus called those venerable ones "Brāhmaṇas."
Evaṃ vutte (Khi được nói như vậy) có nghĩa là khi các Tôn giả ấy được Thế Tôn gọi là “Bà-la-môn” như vậy.
Aññataroti nāmagottena apākaṭo, tassaṃ parisāyaṃ nisinno eko bhikkhu.
A certain one, meaning, a bhikkhu, whose name and lineage were not publicly known, was seated in that assembly.
Aññataro (Một Tỳ-kheo khác) có nghĩa là một Tỳ-kheo không rõ tên họ, đang ngồi trong hội chúng đó.
Brāhmaṇajātikoti brāhmaṇakule jāto.
Of Brāhmaṇa birth, meaning, born into a Brāhmaṇa family.
Brāhmaṇajātiko (sinh trong dòng Bà-la-môn) có nghĩa là sinh ra trong gia đình Bà-la-môn.
So hi uḷārabhogā brāhmaṇamahāsālakulā pabbajito.
Indeed, he had gone forth from a wealthy family of great Brāhmaṇas.
Thật vậy, vị ấy đã xuất gia từ một gia đình Bà-la-môn đại phú.
Tassa kira evaṃ ahosi ‘‘ime lokiyā ubhatosujātiyā brāhmaṇasikkhānipphattiyā ca brāhmaṇo hoti, na aññathāti vadanti, bhagavā ca ete āyasmante brāhmaṇāti vadati, handāhaṃ bhagavantaṃ brāhmaṇalakkhaṇaṃ puccheyya’’nti etadatthameva hi bhagavā tadā te there ‘‘brāhmaṇā’’ti abhāsi.
It occurred to him: "These worldly people say that one is a brāhmaṇa by being well-born on both sides and by attaining the brāhmaṇa training, and not otherwise. And the Blessed One calls these venerable ones 'brāhmaṇas'. Let me ask the Blessed One about the characteristic of a brāhmaṇa." It was precisely for this purpose that the Blessed One then addressed those elders as "brāhmaṇas."
Vị ấy đã nghĩ rằng: “Những người thế tục này nói rằng một Bà-la-môn là người có dòng dõi tốt đẹp từ hai phía (cha mẹ) và đã hoàn thành việc học Bà-la-môn, chứ không phải cách nào khác. Thế Tôn cũng gọi các Tôn giả này là Bà-la-môn. Vậy ta hãy hỏi Thế Tôn về đặc điểm của một Bà-la-môn.” Thật vậy, vì mục đích này mà Thế Tôn đã gọi các Trưởng lão đó là “Bà-la-môn” vào lúc đó.
Brahmaṃ aṇatīti brāhmaṇoti hi jātibrāhmaṇānaṃ nibbacanaṃ.
For the etymology of a birth-brāhmaṇa is "brāhmaṇa" because he recites the Vedas.
Thật vậy, “Brāhmaṇa” (Bà-la-môn) có nghĩa là người tụng đọc kinh Veda (Brahmaṃ aṇatīti brāhmaṇo) là định nghĩa cho Bà-la-môn theo dòng dõi.
Ariyā pana bāhitapāpatāya brāhmaṇā.
But the Noble Ones (ariyā) are brāhmaṇas because they have banished evil.
Còn các bậc Thánh, do đã loại bỏ ác nghiệp, nên được gọi là Bà-la-môn.
Vuttañhetaṃ – ‘‘bāhitapāpoti brāhmaṇo, samacariyā samaṇoti vuccatī’’ti (dha. pa. 388).
For it has been said: "One is a brāhmaṇa because he has banished evil; one is called a samaṇa because of his peaceful conduct."
Điều này đã được nói: “Do đã loại bỏ ác nghiệp nên gọi là Bà-la-môn, do sống thanh tịnh nên gọi là Sa-môn.”
Vakkhati ca ‘‘bāhitvā pāpake dhamme’’ti.
And it will be said: "having banished evil states."
Và sẽ nói: “Do đã loại bỏ các pháp ác.”
Tattha bāhitvāti bahi katvā, attano santānato nīharitvā samucchedappahānavasena pajahitvāti attho.
Therein, having banished means having put outside, having removed from one's own continuum, having abandoned by way of eradication, is the meaning.
Trong đó, bāhitvā (sau khi loại bỏ) có nghĩa là đã loại bỏ, đã tách ra khỏi dòng tâm thức của mình, đã từ bỏ bằng cách đoạn trừ hoàn toàn.
Pāpake dhammeti lāmake dhamme, duccaritavasena tividhaduccaritadhamme, cittuppādavasena dvādasākusalacittuppāde, kammapathavasena dasākusalakammapathe, pavattibhedavasena anekabhedabhinne sabbepi akusaladhammeti attho.
Evil states means base states, three kinds of evil conduct by way of misconduct, twelve unwholesome thought-arisings by way of thought-arising, ten unwholesome courses of action by way of courses of action, and all unwholesome states of many different kinds by way of differences in occurrence, is the meaning.
Pāpake dhamme (các pháp ác) có nghĩa là các pháp thấp kém, theo cách hành động ác là ba loại ác hạnh, theo cách tâm sinh là mười hai loại tâm bất thiện, theo cách nghiệp đạo là mười nghiệp bất thiện, theo cách phân loại sự vận hành là tất cả các pháp bất thiện khác nhau.
Ye caranti sadā satāti ye sativepullappattatāya sabbakālaṃ rūpādīsu chasupi ārammaṇesu satatavihāravasena satā satimanto hutvā catūhi iriyāpathehi caranti.
Who always abide mindfully means those who, having attained the fullness of mindfulness, abide mindfully, endowed with mindfulness, at all times, by way of continuous abiding in the six objects such as forms, and conduct themselves in the four postures.
Ye caranti sadā satā (những ai luôn hành trì với chánh niệm) có nghĩa là những người đã đạt đến sự sung mãn của chánh niệm, luôn sống với chánh niệm trong sáu đối tượng như sắc pháp, và hành trì bằng bốn oai nghi.
Satiggahaṇeneva cettha sampajaññampi gahitanti veditabbaṃ.
It should be understood that by the mention of mindfulness (sati), clear comprehension (sampajañña) is also included here.
Cần hiểu rằng với việc đề cập đến chánh niệm ở đây, sự tỉnh giác cũng được bao hàm.
Khīṇasaṃyojanāti catūhipi ariyamaggehi dasavidhassa saṃyojanassa samucchinnattā parikkhīṇasaṃyojanā.
Whose fetters are destroyed means those whose ten kinds of fetters have been utterly cut off by all four Noble Paths, whose fetters are completely exhausted.
Khīṇasaṃyojanā (những người đã diệt trừ các kiết sử) có nghĩa là những người đã diệt trừ hoàn toàn mười loại kiết sử bằng bốn Thánh đạo.
Buddhāti catusaccasambodhena buddhā.
Buddhas means those who are enlightened by the full comprehension of the Four Noble Truths.
Buddhā (các bậc giác ngộ) có nghĩa là những người đã giác ngộ Tứ Diệu Đế.
Te ca pana sāvakabuddhā, paccekabuddhā, sammāsambuddhāti tividhā, tesu idha sāvakabuddhā adhippetā.
These are of three kinds: Sāvakabuddhas, Paccekabuddhas, and Sammāsambuddhas; among them, Sāvakabuddhas are intended here.
Các bậc giác ngộ này có ba loại: Thanh Văn Giác, Độc Giác và Chánh Đẳng Giác. Trong trường hợp này, ý muốn nói đến Thanh Văn Giác.
Te ve lokasmi brāhmaṇāti te seṭṭhatthena brāhmaṇasaṅkhāte dhamme ariyāya jātiyā jātā, brāhmaṇabhūtassa vā bhagavato orasaputtāti imasmiṃ sattaloke paramatthato brāhmaṇā nāma, na jātigottamattehi, na jaṭādhāraṇādimattena vāti attho.
They indeed are brāhmaṇas in the world means those disciples of the Buddha, born of a noble birth in the states called brāhmaṇa by their excellence, or who are true sons of the Blessed One who has become a brāhmaṇa, are indeed called brāhmaṇas in this world of beings in the ultimate sense, not merely by birth or lineage, nor merely by wearing matted hair, is the meaning.
Te ve lokasmi brāhmaṇā (chính họ là Bà-la-môn trong thế gian này) có nghĩa là các vị đệ tử của Phật, những người đã giác ngộ Tứ Diệu Đế, là những người đã sinh ra trong dòng dõi Thánh, là những người con ruột của Thế Tôn, bậc đã thành Bà-la-môn. Do đó, trong thế gian này, họ thực sự là Bà-la-môn, không phải chỉ vì dòng dõi hay việc giữ búi tóc, v.v.
Evaṃ imesu dvīsu suttesu brāhmaṇakarā dhammā arahattaṃ pāpetvā kathitā, nānajjhāsayatāya pana sattānaṃ desanāvilāsena abhilāpanānattena desanānānattaṃ veditabbaṃ.
Thus, in these two suttas, the states that make one a brāhmaṇa are taught after leading to Arahantship; however, the diversity of teaching should be understood as due to the diversity of expression, in accordance with the diverse dispositions of beings and the beauty of the discourse.
Như vậy, trong hai bài kinh này, các pháp tạo nên một Bà-la-môn được nói đến sau khi đạt được A-la-hán quả. Tuy nhiên, sự khác biệt trong lời dạy là do sự khác biệt trong khuynh hướng của chúng sinh và sự đa dạng trong cách diễn đạt của lời dạy.
6. Chaṭṭhe rājagaheti evaṃnāmake nagare.
6. In the sixth, at Rājagaha means in the city of that name.
Trong bài kinh thứ sáu, Rājagahe (tại Rājagaha) có nghĩa là tại thành phố có tên như vậy.
Tañhi mahāmandhātumahāgovindādīhi pariggahitattā ‘‘rājagaha’’nti vuccati.
For it is called "Rājagaha" because it was taken possession of by Mahāmandhātu, Mahāgovinda, and others.
Thật vậy, thành phố đó được gọi là "Rājagaha" vì nó đã được các vị vua như Mandhātu và Mahāgovinda chiếm giữ.
‘‘Durabhibhavanīyattā paṭirājūnaṃ gahabhūtanti rājagaha’’ntiādinā aññenettha pakārena vaṇṇayanti.
Others explain it in another way, saying: "Rājagaha is a stronghold for rival kings, difficult to overcome," and so on.
Người ta giải thích theo cách khác, ví dụ như: "Rājagaha" vì nó là nơi mà các vị vua đối địch khó có thể chinh phục.
Kintehi?
What is the use of those explanations?
Những cách giải thích đó có ích gì?
Nāmametaṃ tassa nagarassa.
This is merely the name of that city.
Đó chỉ là tên của thành phố đó.
Taṃ panetaṃ buddhakāle cakkavattikāle ca nagaraṃ hoti, sesakāle suññaṃ yakkhapariggahitaṃ tesaṃ vasanaṭṭhānaṃ hutvā tiṭṭhati.
This city was inhabited during the time of the Buddha and during the time of a Cakkavatti king, but in other times, it remains empty, inhabited by yakkhas, serving as their dwelling place.
Thành phố này là một thành phố trong thời kỳ của Đức Phật và thời kỳ của Chuyển Luân Vương, còn vào các thời kỳ khác, nó hoang vắng, bị Dạ-xoa chiếm giữ và trở thành nơi ở của chúng.
Veḷuvane kalandakanivāpeti veḷuvananti tassa vihārassa nāmaṃ.
In Veḷuvana, the Kalandakanivāpa means Veḷuvana is the name of that monastery.
Veḷuvane kalandakanivāpe (trong Rừng Trúc, nơi cho sóc ăn) có nghĩa là Veḷuvana là tên của tu viện đó.
Taṃ kira aṭṭhārasahatthubbedhena pākārena parikkhittaṃ buddhassa bhagavato vasanānucchavikāya mahatiyā gandhakuṭiyā aññehi ca pāsādakuṭileṇamaṇḍapacaṅkamadvārakoṭṭhakādīhi paṭimaṇḍitaṃ bahi veḷūhi parikkhittaṃ ahosi nīlobhāsaṃ manoramaṃ, tena ‘‘veḷuvana’’nti vuccati.
It is said that this monastery was surrounded by a wall eighteen cubits high, adorned with a large Perfumed Chamber (gandhakuṭi) suitable for the Blessed Buddha's dwelling, and other palaces, cells, caves, pavilions, cloisters, gates, and gatehouses, and it was surrounded by bamboos on the outside, having a beautiful blue-green luster; therefore, it is called "Veḷuvana."
Người ta nói rằng tu viện đó được bao quanh bởi một bức tường cao mười tám cubit, được trang trí bằng một hương thất lớn phù hợp cho Đức Phật cư ngụ, cùng với các cung điện, am thất, hang động, giảng đường, đường kinh hành, cổng và tháp cổng khác. Bên ngoài, nó được bao quanh bởi những cây tre xanh biếc, đẹp mắt, nên được gọi là "Veḷuvana".
Kalandakānañcettha nivāpaṃ adaṃsu, tasmā ‘‘kalandakanivāpo’’ti vuccati.
And here, food was given to the squirrels (kalandaka); therefore, it is called "Kalandakanivāpa" (Squirrels' Feeding Ground).
Và ở đó, người ta đã cho sóc ăn, vì vậy nó được gọi là “Kalandakanivāpa”.
Pubbe kira aññataro rājā taṃ uyyānaṃ kīḷanatthaṃ paviṭṭho surāmadamatto divāseyyaṃ upagato supi, parijanopissa ‘‘sutto rājā’’ti pupphaphalādīhi palobhiyamāno ito cito ca pakkāmi.
It is said that formerly a certain king, having entered that park for amusement, became intoxicated with liquor and fell asleep, taking a day-rest. His attendants, knowing that "the king is asleep," were enticed by flowers, fruits, and so on, and departed hither and thither.
Người ta kể rằng, trước đây, một vị vua nọ say rượu, vào khu vườn đó để vui chơi, rồi ngủ thiếp đi vào ban ngày. Các cận thần của ông ta, nghĩ rằng "vua đã ngủ", bị hoa quả và các thứ khác cám dỗ, đã bỏ đi đây đó.
Atha surāgandhena aññatarasmā rukkhasusirā kaṇhasappo nikkhamitvā rañño abhimukho āgacchati.
Then, due to the smell of liquor, a black snake came out from a certain tree hollow and approached the king.
Lúc đó, một con rắn hổ mang đen từ một cái lỗ cây chui ra, tiến thẳng về phía nhà vua do mùi rượu.
Taṃ disvā rukkhadevatā ‘‘rañño jīvitaṃ dassāmī’’ti kalandakavesena gantvā kaṇṇamūle saddamakāsi.
Having seen that snake coming, the tree deity, thinking "I will save the king's life," went in the guise of a black squirrel and made a sound near his ear.
Thấy vậy, vị thần cây, nghĩ rằng "ta sẽ cứu mạng nhà vua", đã hóa thành một con sóc đen, đến bên tai nhà vua và phát ra tiếng động.
Rājā paṭibujjhi, kaṇhasappo nivatto.
The king awoke, and the black snake turned back.
Nhà vua tỉnh dậy, và con rắn hổ mang đã quay đầu bỏ đi.
So taṃ disvā ‘‘imāya kāḷakāya mama jīvitaṃ dinna’’nti kāḷakānaṃ nivāpaṃ tattha paṭṭhapesi, abhayaghosañca ghosāpesi.
Seeing that*, the king thought, "This black creature has saved my life," and established a feeding ground for black creatures there, and also proclaimed a declaration of safety.
Thấy con sóc đó, nhà vua nghĩ rằng "con sóc đen này đã cứu mạng ta", và đã thiết lập một nơi cho sóc đen ăn ở đó, đồng thời ban bố lệnh miễn trừ sợ hãi.
Tasmā tato paṭṭhāya taṃ ‘‘kalandakanivāpa’’nti saṅkhaṃ gataṃ.
Therefore, from that time onwards, it became known as "Kalandakanivāpa."
Vì vậy, từ đó trở đi, nơi đó được gọi là "Kalandakanivāpa".
Kalandakāti hi kāḷakānaṃ nāmaṃ, tasmiṃ veḷuvane kalandakanivāpe.
Indeed, kalandaka is the name for black creatures, in that Kalandakanivāpa in Veḷuvana.
Thật vậy, Kalandaka là tên của loài sóc đen, tại Veḷuvane kalandakanivāpe (trong Rừng Trúc, nơi cho sóc đen ăn) đó.
Mahākassapoti mahantehi sīlakkhandhādīhi samannāgatattā mahanto kassapoti mahākassapo, apica kumārakassapattheraṃ upādāya ayaṃ mahāthero ‘‘mahākassapo’’ti vuccati.
Mahākassapa means "Kassapa the Great" because he was endowed with great aggregates of virtue (sīlakkhandha) and so on. Furthermore, this Elder is called "Mahākassapa" in distinction from Kumārakassapa Thera.
Mahākassapo (Đại Ca-diếp) có nghĩa là Kassapa vĩ đại vì Ngài được phú cho các uẩn giới vĩ đại, v.v. Hơn nữa, vị Đại Trưởng lão này được gọi là "Mahākassapa" để phân biệt với Trưởng lão Kumārakassapa.
Pippaliguhāyanti tassā kira guhāya dvārasamīpe eko pippalirukkho ahosi, tena sā ‘‘pippaliguhā’’ti paññāyittha.
In Pippaliguhā means that near the entrance of that cave, there was a pippali tree, and because of it, the cave became known as "Pippaliguhā."
Pippaliguhāya (trong hang Pippali) có nghĩa là gần cửa hang đó có một cây Pippali, vì vậy hang đó được gọi là "Pippaliguhā".
Tassaṃ pippaliguhāyaṃ.
In that Pippaliguhā.
Trong hang Pippali đó.
Ābādhikoti ābādho assa atthīti ābādhiko, byādhikoti attho.
Ābādhiko means "he has an illness," which is to say, "he is sick."
Ābādhiko (bị bệnh) có nghĩa là bị bệnh, tức là bị ốm.
Dukkhitoti kāyasannissitaṃ dukkhaṃ sañjātaṃ assāti dukkhito, dukkhappattoti attho.
Dukkhito means "suffering has arisen in his body," which is to say, "he has met with suffering."
Dukkhito (đau khổ) có nghĩa là bị đau khổ về thân, tức là bị đau đớn.
Bāḷhagilānoti adhimattagelañño, taṃ pana gelaññaṃ sato sampajāno hutvā adhivāsesi.
Bāḷhagilāno means "severely ill." He endured that illness mindfully and with full awareness.
Bāḷhagilāno (bệnh nặng) có nghĩa là bệnh rất nặng, nhưng Ngài đã chịu đựng cơn bệnh đó với chánh niệm và tỉnh giác.
Athassa bhagavā taṃ pavattiṃ ñatvā tattha gantvā bojjhaṅgaparittaṃ abhāsi, teneva therassa so ābādho vūpasami.
Then the Blessed One, knowing of his condition, went there and recited the Bojjhaṅga Paritta, and by that, the Elder's illness subsided.
Sau đó, Thế Tôn biết được tình trạng đó, Ngài đã đến đó và thuyết bài kinh Bojjhaṅgaparitta (kinh Thất Giác Chi), nhờ đó mà bệnh của Trưởng lão đã thuyên giảm.
Vuttañhetaṃ bojjhaṅgasaṃyutte –
This was stated in the Bojjhaṅga Saṃyutta:
Điều này đã được nói trong Bojjhaṅgasaṃyutta (Tương Ưng Thất Giác Chi):
‘‘Tena kho pana samayena āyasmā mahākassapo pippaliguhāyaṃ viharati ābādhiko dukkhito bāḷhagilāno.
“Now at that time, Venerable Mahākassapa was dwelling in Pippaliguhā, afflicted, suffering, gravely ill.
“Vào lúc đó, Tôn giả Mahākassapa đang trú tại hang Pippali, bị bệnh, đau khổ, bệnh nặng.
Atha kho bhagavā sāyanhasamayaṃ paṭisallānā vuṭṭhito yenāyasmā mahākassapo tenupasaṅkami, upasaṅkamitvā paññatte āsane nisīdi.
Then the Blessed One, having risen from seclusion in the evening, approached Venerable Mahākassapa, and having approached, sat down on the seat prepared.
Rồi Thế Tôn, vào buổi chiều, từ thiền định đứng dậy, đi đến chỗ Tôn giả Mahākassapa, sau khi đến, Ngài ngồi xuống trên chỗ đã trải sẵn.
Nisajja kho bhagavā…pe… etadavoca – ‘kacci te, kassapa, khamanīyaṃ, kacci yāpanīyaṃ, kacci dukkhā vedanā paṭikkamanti, no abhikkamanti, paṭikkamosānaṃ paññāyati no abhikkamo’ti?
Having sat down, the Blessed One… (pe) …said this: ‘I hope, Kassapa, you are able to bear up, I hope you are getting along, I hope your painful feelings are receding and not advancing, that their receding is evident and not their advancing?’
Đức Thế Tôn ngồi xuống… và nói rằng: ‘Này Kassapa, ông có kham nhẫn được không? Ông có sống được không? Các cảm thọ khổ có thuyên giảm không, không gia tăng không? Sự thuyên giảm của chúng có hiện rõ không, không phải sự gia tăng của chúng không?’
‘Na me, bhante, khamanīyaṃ, na yāpanīyaṃ, bāḷhā me bhante, dukkhā vedanā abhikkamanti no paṭikkamanti, abhikkamosānaṃ paññāyati no paṭikkamo’ti.
‘I am not able to bear up, Bhante, I am not getting along, Bhante; my painful feelings are advancing and not receding, their advancing is evident and not their receding.’
‘Bạch Thế Tôn, con không kham nhẫn được, con không sống được. Bạch Thế Tôn, các cảm thọ khổ của con đang gia tăng, không thuyên giảm. Sự gia tăng của chúng hiện rõ, không phải sự thuyên giảm của chúng.’
‘‘‘Sattime, kassapa, bojjhaṅgā mayā sammadakkhātā bhāvitā bahulīkatā abhiññāya sambodhāya nibbānāya saṃvattanti.
“‘These seven factors of awakening, Kassapa, have been rightly taught by me, developed, and often practiced; they conduce to direct knowledge, to full enlightenment, to Nibbāna.
‘‘‘Này Kassapa, bảy chi phần giác ngộ này đã được Ta giảng dạy đúng đắn, được tu tập, được làm cho sung mãn, dẫn đến thắng trí, giác ngộ hoàn toàn và Niết Bàn.
Katame satta?
Which seven?
Bảy điều đó là gì?
Satisambojjhaṅgo kho, kassapa, mayā sammadakkhāto bhāvito bahulīkato abhiññāya sambodhāya nibbānāya saṃvattati…pe… upekkhāsambojjhaṅgo kho, kassapa, mayā sammadakkhāto bhāvito bahulīkato abhiññāya sambodhāya nibbānāya saṃvattati.
The mindfulness factor of awakening, Kassapa, has been rightly taught by me, developed, and often practiced; it conduces to direct knowledge, to full enlightenment, to Nibbāna… (pe) …the equanimity factor of awakening, Kassapa, has been rightly taught by me, developed, and often practiced; it conduces to direct knowledge, to full enlightenment, to Nibbāna.
Này Kassapa, chi phần giác ngộ niệm (satisambojjhaṅgo) đã được Ta giảng dạy đúng đắn, được tu tập, được làm cho sung mãn, dẫn đến thắng trí, giác ngộ hoàn toàn và Niết Bàn… Này Kassapa, chi phần giác ngộ xả (upekkhāsambojjhaṅgo) đã được Ta giảng dạy đúng đắn, được tu tập, được làm cho sung mãn, dẫn đến thắng trí, giác ngộ hoàn toàn và Niết Bàn.
Ime kho, kassapa, satta bojjhaṅgā mayā sammadakkhātā bhāvitā bahūlīkatā abhiññāya sambodhāya nibbānāya saṃvattantī’ti.
These seven factors of awakening, Kassapa, have been rightly taught by me, developed, and often practiced; they conduce to direct knowledge, to full enlightenment, to Nibbāna.’
Này Kassapa, bảy chi phần giác ngộ này đã được Ta giảng dạy đúng đắn, được tu tập, được làm cho sung mãn, dẫn đến thắng trí, giác ngộ hoàn toàn và Niết Bàn.’’
‘Taggha bhagavā bojjhaṅgā, taggha, sugata, bojjhaṅgā’’’ti.
‘Indeed, Blessed One, they are factors of awakening! Indeed, Sugata, they are factors of awakening!’”
‘Thật vậy, bạch Thế Tôn, là các chi phần giác ngộ! Thật vậy, Thiện Thệ, là các chi phần giác ngộ!’’’
Etadahosīti pubbe gelaññadivasesu saddhivihārikehi upanītaṃ piṇḍapātaṃ paribhuñjitvā vihāre eva ahosi.
Etadahosī means that previously, on the days of his illness, he would consume the almsfood brought by his co-residents and remain in the monastery.
Điều này đã xảy ra (Etadahosīti) có nghĩa là trước đó, vào những ngày bệnh, sau khi thọ thực bát cơm khất thực do các học trò cùng tu (saddhivihārika) mang đến, ngài đã ở trong tu viện.
Athassa tamhā ābādhā vuṭṭhitassa etaṃ ‘‘yaṃnūnāhaṃ rājagahaṃ piṇḍāya paviseyya’’nti parivitakko ahosi.
Then, after recovering from that illness, this thought occurred to him: "How good it would be if I were to enter Rājagaha for alms!"
Sau khi ngài khỏi bệnh đó, ý nghĩ này đã khởi lên trong ngài: “Hay là ta nên vào thành Rājagaha để khất thực?”
Pañcamattāni devatāsatānīti sakkassa devarañño paricārikā pañcasatā kakuṭapādiniyo accharāyo.
Pañcamattāni devatāsatāni means five hundred Kakuṭapādini nymphs, attendants of Sakka, the king of devas.
Năm trăm vị thiên nữ (Pañcamattāni devatāsatānīti) là năm trăm tiên nữ Kakuṭapādinī, những người hầu của Thiên vương Sakka.
Ussukkaṃ āpannāni hontīti therassa piṇḍapātaṃ dassāmāti pañcapiṇḍapātasatāni sajjetvā suvaṇṇabhājanehi ādāya antarāmagge ṭhatvā, ‘‘bhante, imaṃ piṇḍapātaṃ gaṇhatha, saṅgahaṃ no karothā’’ti vadamānā piṇḍapātadāne yuttappayuttāni honti.
They became eager (to offer almsfood) – having prepared five hundred portions of almsfood, thinking, "We will offer almsfood to the Elder," and taking them in golden bowls, they stood in the middle of the road, saying, "Venerable sir, please accept this almsfood, show us your favor." Thus, they were diligently engaged in offering almsfood.
Đã trở nên bận rộn (Ussukkaṃ āpannāni honti) có nghĩa là họ đã chuẩn bị năm trăm bát cơm khất thực, nghĩ rằng “Chúng ta sẽ cúng dường bát cơm khất thực cho vị Trưởng lão,” và mang theo trong những chiếc bát vàng, đứng trên đường, nói rằng, “Bạch Đại đức, xin hãy nhận bát cơm khất thực này, xin hãy ban phước cho chúng con,” họ đã trở nên rất cố gắng và bận rộn trong việc cúng dường cơm khất thực.
Tena vuttaṃ ‘‘āyasmato mahākassapassa piṇḍapātappaṭilābhāyā’’ti.
Therefore, it is said in the Pāli: "for the Venerable Mahākassapa to receive almsfood."
Do đó đã nói: ‘‘Để Trưởng lão Mahākassapa nhận được cơm khất thực.’’
Sakko kira devarājā therassa cittappavattiṃ ñatvā tā accharāyo uyyojesi ‘‘gacchatha tumhe ayyassa mahākassapattherassa piṇḍapātaṃ datvā attano patiṭṭhaṃ karothā’’ti.
It is said that Sakka, the king of devas, knowing the Elder's inclination, dispatched those devas, saying, "Go, give almsfood to the noble Elder Mahākassapa, and establish a foundation for yourselves."
Nghe nói, Thiên vương Sakka biết được ý định của vị Trưởng lão, đã phái các tiên nữ đó đi, nói rằng: “Các con hãy đi, cúng dường cơm khất thực cho Đại đức Mahākassapa Trưởng lão và tạo lập chỗ dựa cho chính mình.”
Evaṃ hissa ahosi ‘‘imāsu sabbāsu gatāsu kadāci ekissāpi hatthato piṇḍapātaṃ thero paṭiggaṇheyya, taṃ tassā bhavissati dīgharattaṃ hitāya sukhāyā’’ti.
For it occurred to him, "When all of them have gone, perhaps the Elder might accept almsfood from the hand of even one of them, and that would be for her welfare and happiness for a long time."
Vì ngài nghĩ rằng: “Khi tất cả những vị này đã đi, có thể vị Trưởng lão sẽ nhận cơm khất thực từ tay một vị thiên nữ nào đó, điều đó sẽ mang lại lợi ích và hạnh phúc lâu dài cho vị ấy.”
Paṭikkhipi thero, ‘‘bhante, mayhaṃ piṇḍapātaṃ gaṇhatha, mayhaṃ piṇḍapātaṃ gaṇhathā’’ti vadantiyo ‘‘gacchatha tumhe katapuññā mahābhogā, ahaṃ duggatānaṃ saṅgahaṃ karissāmī’’ti vatvā, ‘‘bhante, mā no nāsetha, saṅgahaṃ no karothā’’ti vadantiyo punapi paṭikkhipitvā punapi apagantuṃ anicchamānā yācantiyo ‘‘na attano pamāṇaṃ jānātha, apagacchathā’’ti vatvā accharaṃ pahari.
The Elder refused them. To those who were saying, "Venerable sir, please accept my almsfood, please accept my almsfood," he said, "Go, you who have done meritorious deeds and possess great wealth; I will show favor to the poor." When they, saying, "Venerable sir, do not destroy us, show us your favor," again refused to leave after being refused, and continued to plead, he said, "You do not know your own measure, go away!" and snapped his fingers at the deva.
Vị Trưởng lão đã từ chối, nói với các tiên nữ đang van xin: “Bạch Đại đức, xin hãy nhận bát cơm khất thực của con, xin hãy nhận bát cơm khất thực của con,” rằng: “Các con hãy đi đi, các con đã tạo công đức lớn, có tài sản lớn, ta sẽ giúp đỡ những người nghèo khó.” Khi các tiên nữ lại van xin: “Bạch Đại đức, xin đừng làm chúng con thất vọng, xin hãy giúp đỡ chúng con,” ngài lại từ chối và nói: “Các con không biết giới hạn của mình sao? Hãy đi đi!” rồi ngài vỗ tay.
Tā therassa accharāsaddaṃ sutvā santajjitā ṭhātuṃ asakkontiyo palāyitvā devalokameva gatā.
Hearing the sound of the Elder's snapped fingers, those devas, intimidated, were unable to remain and fled back to the deva realm.
Nghe tiếng vỗ tay của vị Trưởng lão, các vị ấy sợ hãi, không thể đứng vững, bỏ chạy và trở về cõi trời.
Tena vuttaṃ – ‘‘pañcamattāni devatāsatāni paṭikkhipitvā’’ti.
Therefore, it is said: "having refused five hundred devas."
Do đó đã nói: ‘‘Sau khi từ chối năm trăm vị thiên nữ.’’
Pubbaṇhasamayanti pubbaṇhe ekaṃ samayaṃ, ekasmiṃ kāle.
In the forenoon means at one time, at one moment in the forenoon.
Vào buổi sáng (Pubbaṇhasamayanti) nghĩa là vào một buổi sáng, vào một thời điểm.
Nivāsetvāti vihāranivāsanaparivattanavasena nivāsanaṃ daḷhaṃ nivāsetvā.
Having put on his lower robe means having firmly put on his lower robe by way of adjusting his monastic robe in the monastery.
Mặc y (Nivāsetvā) nghĩa là mặc y chắc chắn bằng cách thay đổi y hạ (nivāsana) trong tu viện.
Pattacīvaramādāyāti cīvaraṃ pārupitvā pattaṃ hatthena gahetvā.
Taking his bowl and outer robe means having draped his outer robe and taken his bowl in his hand.
Cầm bát và y (Pattacīvaramādāya) nghĩa là khoác y và cầm bát trong tay.
Piṇḍāya pāvisīti piṇḍapātatthāya pāvisi.
He entered for alms means he entered for the purpose of almsfood.
Vào khất thực (Piṇḍāya pāvisī) nghĩa là vào để khất thực.
Daliddavisikhāti duggatamanussānaṃ vasanokāso.
Daliddavisikhā means the dwelling place of poor people.
Phố của người nghèo (Daliddavisikhā) là nơi ở của những người nghèo khổ.
Kapaṇavisikhāti bhogapārijuññappattiyā dīnamanussānaṃ vāso.
Kapaṇavisikhā means the dwelling place of wretched people who have fallen into poverty.
Phố của người khốn khó (Kapaṇavisikhā) là nơi ở của những người khốn khổ do mất mát tài sản.
Pesakāravisikhāti tantavāyavāso.
Pesakāravisikhā means the dwelling place of weavers.
Phố của thợ dệt (Pesakāravisikhā) là nơi ở của những người thợ dệt.
Addasā kho bhagavāti kathaṃ addasa?
The Blessed One saw means: how did he see?
Đức Thế Tôn đã thấy (Addasā kho bhagavā) nghĩa là đã thấy như thế nào?
‘‘Ābādhā vuṭṭhito mama putto kassapo kinnu kho karotī’’ti āvajjento veḷuvane nisinno eva bhagavā dibbacakkhunā addasa.
Thinking, "What is my son Kassapa doing, having recovered from his illness?" the Blessed One, while seated in Veḷuvana, saw with his divine eye.
Đức Thế Tôn, đang ngồi trong rừng Trúc Lâm, đã thấy bằng thiên nhãn, suy xét: “Con trai ta, Kassapa, đã khỏi bệnh, liệu nó đang làm gì?”
Tattha anaññaposinti aññaṃ posetīti aññaposī, na aññaposī anaññaposī, attanā posetabbassa aññassa abhāvena adutiyo, ekakoti attho.
In that (utterance), anaññaposī means: one who nourishes another is aññaposī; one who does not nourish another is anaññaposī. He is without a second due to the absence of another to be nourished by himself; the meaning is "alone."
Trong đó, anaññaposī (không nuôi dưỡng người khác) có nghĩa là: người nuôi dưỡng người khác là aññaposī; không nuôi dưỡng người khác là anaññaposī. Vì không có ai khác cần được nuôi dưỡng bởi chính mình, nên ngài là vô song, độc nhất. Đó là ý nghĩa.
Tena therassa subharataṃ dasseti.
Thereby, it shows the Elder's ease of support.
Điều này cho thấy sự dễ nuôi dưỡng của vị Trưởng lão.
Thero hi kāyaparihārikena cīvarena kucchiparihārikena ca piṇḍapātena attānameva posento paramappiccho hutvā viharati, aññaṃ ñātimittādīsu kañci na poseti katthaci alaggabhāvato.
For the Elder, nourishing only himself with robes for the body and almsfood for the stomach, dwells as one of extreme fewness of wishes, and does not nourish anyone among relatives or friends, being unattached anywhere.
Thật vậy, vị Trưởng lão sống với ít dục vọng tột cùng, tự nuôi dưỡng mình bằng y phục che thân và bát cơm khất thực nuôi dưỡng bụng, không nuôi dưỡng bất kỳ ai khác trong số bà con, bạn bè, v.v., vì ngài không dính mắc vào bất cứ điều gì.
Atha vā aññena aññatarena posetabbatāya abhāvato anaññaposī.
Alternatively, anaññaposī means one who is not to be nourished by any other.
Hoặc, anaññaposī vì không có ai khác cần được nuôi dưỡng bởi người khác.
Yo hi ekasmiṃyeva paccayadāyake paṭibaddhacatupaccayo so anaññaposī nāma na hoti ekāyattavuttito.
Indeed, one whose four requisites are dependent on a single donor is not called anaññaposī, because his livelihood is dependent on one person.
Người mà bốn vật dụng (tứ y) phụ thuộc vào một người cúng dường duy nhất thì không phải là anaññaposī, vì cuộc sống của người đó phụ thuộc vào một người duy nhất.
Thero pana ‘‘yathāpi bhamaro puppha’’nti (dha. pa. 49) gāthāya vuttanayena jaṅghābalaṃ nissāya piṇḍāya caranto kulesu niccanavo hutvā missakabhattena yāpeti.
But the Elder, relying on the strength of his legs, wanders for alms, always fresh in the households, and sustains himself with mixed food, in the manner described in the verse "Just as a bee from a flower" (Dhp. 49).
Nhưng vị Trưởng lão, nương vào sức mạnh của đôi chân, đi khất thực theo cách đã nói trong kệ ‘‘Như ong đến hoa’’ (Dhammapada 49), luôn mới mẻ trong các gia đình và sống nhờ vào cơm trộn.
Tathā hi naṃ bhagavā candūpamappaṭipadāya thomesi.
Thus, the Blessed One praised him for his practice resembling the moon.
Vì vậy, Đức Thế Tôn đã khen ngợi ngài về hạnh đầu đà (paṭipadā) giống như mặt trăng.
Aññātanti abhiññātaṃ, yathābhuccaguṇehi patthaṭayasaṃ, teneva vā anaññaposibhāvena appicchatāsantuṭṭhitāhi ñātaṃ.
Aññāta means well-known, one whose fame has spread due to his true qualities, or known by fewness of wishes and contentment due to that very state of anaññaposī.
Aññātaṃ (đã biết) nghĩa là đã được biết rõ, danh tiếng lan rộng bởi những phẩm chất chân thực, hoặc đã được biết đến bởi sự anaññaposī, sự ít dục vọng và sự tri túc.
Atha vā aññātanti sabbaso pahīnataṇhatāya lābhasakkārasilokanikāmanahetu attānaṃ jānāpanavasena na ñātaṃ.
Alternatively, aññāta means not known by way of making oneself known for the sake of gain, honor, or praise, due to the complete abandonment of craving.
Hoặc, aññātaṃ nghĩa là không được biết đến bằng cách tự giới thiệu mình vì lợi lộc, danh vọng, lời khen, do tham ái đã được đoạn trừ hoàn toàn.
Avītataṇho hi pāpiccho kuhakatāya sambhāvanādhippāyena attānaṃ jānāpeti.
Indeed, one with uneradicated craving and evil desires makes himself known for the sake of deceit, with the intention of being esteemed.
Thật vậy, kẻ có tham ái chưa đoạn trừ, với tâm tà ác, tự giới thiệu mình với ý định được tôn trọng vì sự lừa dối.
Dantanti chaḷaṅgupekkhāvasena indriyesu uttamadamanena dantaṃ.
Danta (tamed) means tamed by the supreme taming of the faculties through the six-limbed equanimity (chaḷaṅgupekkhā).
Dantaṃ (đã được điều phục) nghĩa là đã được điều phục bằng sự điều phục tối thượng các căn (indriya) theo cách xả sáu chi (chaḷaṅgupekkhā).
Sāre patiṭṭhitanti vimuttisāre avaṭṭhitaṃ, asekkhasīlakkhandhādike vā sīlādisāre patiṭṭhitaṃ.
Sāre patiṭṭhita (established in the essence) means established in the essence of liberation (vimuttisāra), or established in the essence of virtue (sīla) and so forth, such as the aggregate of the unexcelled virtue (asekkhasīlakkhandha).
Sāre patiṭṭhitaṃ (đã an trú trong cốt lõi) nghĩa là đã an trú trong cốt lõi của giải thoát (vimuttisāra), hoặc đã an trú trong cốt lõi của giới (sīla) và các phẩm chất khác, như giới uẩn (sīlakkhandha) của bậc vô học.
Khīṇāsavaṃ vantadosanti kāmāsavādīnaṃ catunnaṃ āsavānaṃ anavasesaṃ pahīnattā khīṇāsavaṃ.
Khīṇāsavaṃ vantadosa (one whose defilements are destroyed, who has vomited forth faults) means one whose defilements (āsava) are destroyed because the four defilements, such as the defilement of sensual desire (kāmāsava), have been completely abandoned.
Khīṇāsavaṃ vantadosaṃ (đã tận diệt lậu hoặc, đã nhổ bỏ lỗi lầm) nghĩa là đã tận diệt lậu hoặc (khīṇāsava) vì bốn lậu hoặc như dục lậu (kāmāsava) đã được đoạn trừ hoàn toàn.
Tato eva rāgādidosānaṃ sabbaso vantattā vantadosaṃ.
For that very reason, he is one who has vomited forth faults, having completely vomited forth faults such as lust.
Do đó, đã nhổ bỏ lỗi lầm (vantadosaṃ) vì các lỗi lầm như tham ái đã được nhổ bỏ hoàn toàn.
Tamahaṃ brūmi brāhmaṇanti taṃ yathāvuttaguṇaṃ paramatthabrāhmaṇaṃ ahaṃ brāhmaṇanti vadāmīti.
Tamahaṃ brūmi brāhmaṇa (Him I call a brāhmaṇa) means, "That person, possessing the qualities mentioned, I call a true brāhmaṇa."
Tamahaṃ brūmi brāhmaṇaṃ (Ta gọi người đó là Bà-la-môn) nghĩa là Ta gọi người có phẩm chất như đã nói là Bà-la-môn chân thật.
Idhāpi heṭṭhā vuttanayeneva desanānānattaṃ veditabbaṃ.
Here too, the diversity of teachings should be understood in the manner explained below.
Ở đây, sự khác biệt của giáo pháp cũng nên được hiểu theo cách đã nói ở trên.
7. Sattame pāvāyanti evaṃnāmake mallarājūnaṃ nagare.
In the seventh (sutta), Pāvāya means in the city of the Malla kings, so named.
7. Trong bài kinh thứ bảy, Pāvāya có nghĩa là tại thành phố cùng tên của các vương tử Malla.
Ajakalāpake cetiyeti ajakalāpakena nāma yakkhena pariggahitattā ‘‘ajakalāpaka’’nti laddhanāme manussānaṃ cittīkataṭṭhāne.
Ajakalāpake cetiye (at the Ajakalāpaka shrine) means at a place revered by humans, which received the name "Ajakalāpaka" because it was taken possession of by a yakkha named Ajakalāpaka.
Tại tháp Ajakalāpaka (Ajakalāpake cetiye) là tại địa điểm được người dân tôn kính, được gọi là “Ajakalāpaka” vì được một dạ-xoa tên Ajakalāpaka chiếm giữ.
So kira yakkho aje kalāpe katvā bandhanena ajakoṭṭhāsena saddhiṃ baliṃ paṭicchati, na aññathā, tasmā ‘‘ajakalāpako’’ti paññāyittha.
It is said that this yakkha accepts offerings along with a bundle of goats tied together, and not otherwise; therefore, he was known as Ajakalāpaka.
Nghe nói, dạ-xoa đó nhận lễ vật cùng với một bó dê bị trói buộc, không theo cách nào khác. Vì vậy, nó được biết đến với tên “Ajakalāpaka.”
Keci panāhu – ajake viya satte lāpetīti ajakalāpakoti.
Some, however, say: "He is called Ajakalāpaka because he makes beings cry out like goats."
Một số người khác nói rằng: “Ajakalāpaka” vì nó khiến chúng sinh kêu la như dê.
Tassa kira sattā baliṃ upanetvā yadā ajasaddaṃ katvā baliṃ upaharanti, tadā so tussati, tasmā ‘‘ajakalāpako’’ti vuccatīti.
It is said that when people bring offerings to that yakkha and make a goat sound, he becomes pleased; therefore, he is called Ajakalāpaka, so say some teachers.
Nghe nói, khi chúng sinh mang lễ vật đến cho dạ-xoa đó và cúng dường lễ vật bằng tiếng dê kêu, lúc đó nó mới hài lòng. Vì vậy, nó được gọi là “Ajakalāpaka.”
So pana yakkho ānubhāvasampanno kakkhaḷo pharuso tattha ca sannihito, tasmā taṃ ṭhānaṃ manussā cittiṃ karonti, kālena kālaṃ baliṃ upaharanti.
That yakkha was powerful, fierce, and harsh, and he resided there; therefore, people revered that place and brought offerings from time to time.
Vị Dạ-xoa ấy có đầy đủ thần thông, hung ác và thô bạo, lại thường trú ở đó, do vậy, người đời tôn kính nơi ấy và dâng cúng lễ vật theo thời gian.
Tena vuttaṃ ‘‘ajakalāpake cetiye’’ti.
Thus it is said, " ajakalāpake cetiye."
Do đó, đã nói: “tại ngôi thờ Ajakalāpaka”.
Ajakalāpakassa yakkhassa bhavaneti tassa yakkhassa vimāne.
"In the dwelling of the Ajakaḷāpaka yakkha" means in the mansion of that yakkha.
Trong cung điện của Dạ-xoa Ajakalāpaka có nghĩa là trong cung điện của vị Dạ-xoa ấy.
Tadā kira satthā taṃ yakkhaṃ dametukāmo sāyanhasamaye eko adutiyo pattacīvaraṃ ādāya ajakalāpakassa yakkhassa bhavanadvāraṃ gantvā tassa dovārikaṃ bhavanapavisanatthāya yāci.
It is said that at that time, the Teacher, desiring to tame that yakkha, took his alms-bowl and robe and went alone, unaccompanied, to the door of the Ajakaḷāpaka yakkha’s dwelling in the evening, and requested the doorkeeper for permission to enter the dwelling.
Khi ấy, Đức Đạo Sư, với ý muốn nhiếp phục vị Dạ-xoa ấy, vào buổi chiều tối, một mình không có ai đi cùng, Ngài mang bát và y, đến cửa cung điện của Dạ-xoa Ajakalāpaka và xin phép người gác cổng để vào cung điện.
So ‘‘kakkhaḷo, bhante, ajakalāpako yakkho, samaṇoti vā brāhmaṇoti vā gāravaṃ na karoti, tasmā tumhe eva jānātha, mayhaṃ pana tassa anārocanaṃ na yutta’’nti tāvadeva yakkhasamāgamaṃ gatassa ajakalāpakassa santikaṃ vātavegena agamāsi.
He replied, ‘‘Venerable Sir, the Ajakaḷāpaka yakkha is fierce; he shows no respect to ascetics or brahmins, therefore, Your Reverence should know for yourself; as for me, it is not proper for me not to inform him.’’ Thereupon, he went with the speed of wind to Ajakaḷāpaka, who had gone to an assembly of yakkhas.
Người gác cổng ấy thưa: “Bạch Thế Tôn, Dạ-xoa Ajakalāpaka hung ác, không tôn trọng Sa-môn hay Bà-la-môn, do vậy, Ngài tự biết, còn tôi thì không nên không báo cho ông ta biết.” Nói xong, người gác cổng ấy liền nhanh như gió đi đến chỗ Ajakalāpaka, người đang ở hội họp của các Dạ-xoa.
Satthā antobhavanaṃ pavisitvā ajakalāpakassa nisīdanamaṇḍape paññattāsane nisīdi.
The Teacher entered the dwelling and sat down on the prepared seat in Ajakaḷāpaka’s sitting pavilion.
Đức Đạo Sư đi vào trong cung điện và ngồi trên chỗ ngồi đã được sắp đặt trong sảnh đường của Ajakalāpaka.
Yakkhassa orodhā satthāraṃ upasaṅkamitvā vanditvā ekamantaṃ aṭṭhaṃsu.
The yakkha’s female attendants approached the Teacher, paid homage, and stood to one side.
Các thị nữ của Dạ-xoa đến gần Đức Đạo Sư, đảnh lễ và đứng sang một bên.
Satthā tāsaṃ kālayuttaṃ dhammiṃ kathaṃ kathesi.
The Teacher delivered a Dhamma talk appropriate for the occasion to them.
Đức Đạo Sư đã thuyết pháp thích hợp với thời điểm cho các vị ấy.
Tena vuttaṃ – ‘‘pāvāyaṃ viharati ajakalāpake cetiye ajakalāpakassa yakkhassa bhavane’’ti.
Therefore it was said – ‘‘resides in Pāvā, at the Ajakaḷāpaka shrine, in the dwelling of the Ajakaḷāpaka yakkha.’’
Do đó, đã nói: “Vị ấy trú tại Pāvā, ở ngôi thờ Ajakalāpaka, trong cung điện của Dạ-xoa Ajakalāpaka.”
Tasmiṃ samaye sātāgirahemavatā ajakalāpakassa bhavanamatthakena yakkhasamāgamaṃ gacchantā attano gamane asampajjamāne ‘‘kiṃ nu kho kāraṇa’’nti āvajjentā satthāraṃ ajakalāpakassa bhavane nisinnaṃ disvā tattha gantvā bhagavantaṃ vanditvā ‘‘mayaṃ, bhante, yakkhasamāgamaṃ gamissāmā’’ti āpucchitvā padakkhiṇaṃ katvā gatā yakkhasannipāte ajakalāpakaṃ disvā tuṭṭhiṃ pavedayiṃsu ‘‘lābhā te, āvuso, ajakalāpaka, yassa te bhavane sadevake loke aggapuggalo bhagavā nisinno, upasaṅkamitvā bhagavantaṃ payirupāsassu, dhammañca suṇāhī’’ti.
At that time, Sātāgira and Hemavata, going to a yakkha assembly over the Ajakaḷāpaka’s dwelling, and finding their path obstructed, wondered ‘‘What could be the reason?’’ Reflecting, they saw the Teacher seated in Ajakaḷāpaka’s dwelling. They went there, paid homage to the Blessed One, and asked for permission, saying, ‘‘Venerable Sir, we are going to the yakkha assembly.’’ After circumambulating him, they departed. At the yakkha gathering, they saw Ajakaḷāpaka and joyfully announced, ‘‘It is your gain, friend Ajakaḷāpaka, in whose dwelling the Blessed One, the foremost personage in the world with its devas, is seated! Go and attend upon the Blessed One, and listen to the Dhamma!’’
Vào thời điểm đó, Sātāgira và Hemavata đang đi đến hội họp của các Dạ-xoa ngang qua trên nóc cung điện của Ajakalāpaka. Khi thấy đường đi của mình không thuận lợi, họ suy xét: “Nguyên nhân là gì vậy?” và thấy Đức Đạo Sư đang ngồi trong cung điện của Ajakalāpaka. Họ liền đến đó, đảnh lễ Đức Thế Tôn và xin phép: “Bạch Thế Tôn, chúng con sẽ đi đến hội họp của các Dạ-xoa.” Sau khi đi nhiễu hữu, họ đi đến chỗ hội họp của các Dạ-xoa và thấy Ajakalāpaka. Họ hân hoan báo tin: “Này hiền hữu Ajakalāpaka, thật là điều may mắn cho hiền hữu, vì Đức Thế Tôn, bậc tối thượng trong thế gian cùng với chư thiên, đang ngự trong cung điện của hiền hữu. Hãy đến gần Đức Thế Tôn và hầu hạ Ngài, hãy lắng nghe Pháp!”
So tesaṃ kathaṃ sutvā ‘‘ime tassa muṇḍakassa samaṇakassa mama bhavane nisinnabhāvaṃ kathentī’’ti kodhābhibhūto hutvā ‘‘ajja mayhaṃ tena samaṇena saddhiṃ saṅgāmo bhavissatī’’ti cintetvā yakkhasannipātato uṭṭhahitvā dakkhiṇaṃ pādaṃ ukkhipitvā saṭṭhiyojanamattaṃ pabbatakūṭaṃ akkami, taṃ bhijjitvā dvidhā ahosi.
Upon hearing their words, he became overcome with anger, thinking, ‘‘These devas are speaking of that bald-headed ascetic seated in my dwelling! Today there will be a battle between that ascetic and me!’’ Thinking thus, he rose from the yakkha assembly, lifted his right foot, and stepped on a mountain peak sixty yojanas high, splitting it in two.
Vị Dạ-xoa ấy nghe lời họ nói, liền nghĩ: “Những kẻ này đang nói về việc Sa-môn đầu trọc ấy ngồi trong cung điện của ta!” Ông ta nổi cơn thịnh nộ và nghĩ: “Hôm nay ta sẽ chiến đấu với Sa-môn ấy!” Rồi ông ta đứng dậy từ hội họp của các Dạ-xoa, nhấc chân phải lên và đạp vào một đỉnh núi cao sáu mươi do-tuần, khiến nó vỡ ra làm đôi.
Sesaṃ ettha yaṃ vattabbaṃ, taṃ āḷavakasuttavaṇṇanāyaṃ (saṃ. ni. aṭṭha. 1.1.246) āgatanayeneva veditabbaṃ.
The rest of what needs to be said here should be understood in the same way as it appears in the commentary to the Āḷavaka Sutta.
Những điều còn lại cần nói ở đây, nên được hiểu theo cách đã được trình bày trong Chú giải kinh Āḷavaka (Saṃ. Ni. Aṭṭha. 1.1.246).
Ajakalāpakassa samāgamo hi āḷavakasamāgamasadisova ṭhapetvā pañhakaraṇaṃ vissajjanaṃ bhavanato tikkhattuṃ nikkhamanaṃ pavesanañca.
Indeed, the encounter with Ajakaḷāpaka was similar to the encounter with Āḷavaka, with the exception of the asking and answering of questions, and the three times of exiting and entering the dwelling.
Cuộc hội ngộ của Ajakalāpaka cũng giống như cuộc hội ngộ của Āḷavaka, ngoại trừ việc đặt câu hỏi, trả lời, và ba lần ra vào cung điện.
Ajakalāpako hi āgacchantoyeva ‘‘etehiyeva taṃ samaṇaṃ palāpessāmī’’ti vātamaṇḍalādike navavasse samuṭṭhāpetvā tehi bhagavato calanamattampi kātuṃ asakkonto nānāvidhappaharaṇahatthe ativiya bhayānakarūpe bhūtagaṇe nimminitvā tehi saddhiṃ bhagavantaṃ upasaṅkamitvā antanteneva caranto sabbarattiṃ nānappakāraṃ vippakāraṃ katvāpi bhagavato kiñci kesaggamattampi nisinnaṭṭhānato calanaṃ kātuṃ nāsakkhi.
As Ajakaḷāpaka was approaching, he thought, "I will scare away this ascetic with these very wind-storms and the like." He stirred up the nine types of rain, but was unable to make the Blessed One move even a little. Then he created multitudes of extremely terrifying ghosts with various weapons in their hands. Approaching the Blessed One with them, he moved continuously around him, and even after causing various disturbances throughout the entire night, he could not make the Blessed One move even a hair's breadth from his seated position.
Ajakalāpaka, khi đang đến, đã nghĩ: “Ta sẽ xua đuổi Sa-môn ấy bằng những cơn gió lốc này!” Ông ta tạo ra chín loại gió lốc và mưa lớn, nhưng không thể làm Đức Thế Tôn lay chuyển dù chỉ một chút. Sau đó, ông ta tạo ra vô số quỷ thần với hình dạng cực kỳ đáng sợ, tay cầm đủ loại vũ khí, và cùng với chúng, ông ta đến gần Đức Thế Tôn. Ông ta đi vòng quanh Ngài suốt đêm, tạo ra đủ loại quấy nhiễu, nhưng vẫn không thể làm Đức Thế Tôn lay chuyển khỏi chỗ ngồi dù chỉ một sợi tóc.
Kevalaṃ pana ‘‘ayaṃ samaṇo maṃ anāpucchā mayhaṃ bhavanaṃ pavisitvā nisīdatī’’ti kodhavasena pajjali.
He merely blazed with anger, thinking, ‘‘This ascetic entered my dwelling and sat down without asking me.’’
Tuy nhiên, ông ta chỉ bừng bừng lửa giận vì nghĩ: “Sa-môn này đã vào cung điện của ta và ngồi xuống mà không hỏi ý ta!”
Athassa bhagavā cittappavattiṃ ñatvā ‘‘seyyathāpi nāma caṇḍassa kukkurassa nāsāya pittaṃ bhindeyya, evaṃ so bhiyyosomattāya caṇḍataro assa, evamevāyaṃ yakkho mayi idha nisinne cittaṃ padūseti, yaṃnūnāhaṃ bahi nikkhameyya’’nti sayameva bhavanato nikkhamitvā abbhokāse nisīdi.
Then the Blessed One, knowing the arising of his thought, reflected: ‘‘Just as if one were to inject bile into the nose of a fierce dog, it would become even fiercer; in the same way, this yakkha pollutes his mind while I am seated here. What if I were to go outside?’’ So he himself came out of the dwelling and sat in the open air.
Bấy giờ, Đức Thế Tôn biết được tâm niệm của ông ta, liền nghĩ: “Cũng như nếu người ta đổ mật rắn vào mũi một con chó dữ, thì nó sẽ càng trở nên dữ tợn hơn. Cũng vậy, Dạ-xoa này đang làm ô nhiễm tâm mình khi ta ngồi ở đây. Tốt hơn là ta nên đi ra ngoài.” Ngài liền tự mình rời khỏi cung điện và ngồi ở ngoài trời.
Tena vuttaṃ – ‘‘tena kho pana samayena bhagavā rattandhakāratimisāyaṃ abbhokāse nisinno hotī’’ti.
Therefore it was said – ‘‘At that time, the Blessed One was seated in the open air in the utter darkness of the night.’’
Do đó, đã nói: “Vào lúc ấy, Đức Thế Tôn đang ngồi giữa đêm tối mịt mùng ở ngoài trời.”
Tattha rattandhakāratimisāyanti rattiyaṃ andhakaraṇatamasi, cakkhuviññāṇuppattivirahite bahalandhakāreti attho.
There, rattandhakāratimisāya means in the blinding darkness of the night, that is to say, in a dense darkness where the arising of eye-consciousness is absent.
Ở đây, rattandhakāratimisāyaṃ có nghĩa là trong bóng tối dày đặc của đêm, nơi không thể phát sinh nhãn thức, tức là bóng tối cực kỳ dày đặc.
Caturaṅgasamannāgato kira tadā andhakāro pavattīti.
It is said that at that time, the darkness was complete with four aspects.
Khi ấy, bóng tối được cho là có đủ bốn yếu tố.
Devoti megho ekamekaṃ phusitakaṃ udakabinduṃ pāteti.
Devo means a cloud that drops individual raindrops.
Devo (trời) có nghĩa là mây làm rơi từng giọt nước mưa.
Atha yakkho ‘‘iminā saddena tāsetvā imaṃ samaṇaṃ palāpessāmī’’ti bhagavato samīpaṃ gantvā ‘‘akkulo’’tiādinā taṃ bhiṃsanaṃ akāsi.
Then the yakkha, thinking, ‘‘I will terrify this ascetic with this sound and make him flee,’’ went near the Blessed One and made frightening noises such as ‘‘Akkulo!’’ and so on.
Khi ấy, Dạ-xoa nghĩ: “Ta sẽ dọa Sa-môn này bằng tiếng động này và khiến ông ấy bỏ chạy.” Hắn đến gần Đức Thế Tôn và tạo ra tiếng động đáng sợ đó bằng cách nói “akkulo” và những lời tương tự.
Tena vuttaṃ ‘‘atha kho ajakalāpako’’tiādi.
Therefore it was said: ‘‘Then Ajakaḷāpaka…’’ and so forth.
Do đó, đã nói: “Atha kho ajakalāpako” (Rồi Dạ-xoa Ajakalāpaka) và những lời tiếp theo.
Tattha bhayanti cittutrāsaṃ, chambhitattanti ūrutthambhakasarīrassa chambhitabhāvaṃ.
There, bhayaṃ means mental terror, and chambhitattaṃ means the trembling state of a body with stiff thighs like pillars.
Ở đây, bhayaṃ có nghĩa là sự sợ hãi trong tâm, chambhitattaṃ có nghĩa là sự run rẩy của cơ thể, với đùi cứng đờ.
Lomahaṃsanti lomānaṃ pahaṭṭhabhāvaṃ, tīhipi padehi bhayuppattimeva dasseti.
Lomahaṃsaṃ means the standing on end of the hairs; all three terms indicate the arising of fear.
Lomahaṃsaṃ có nghĩa là sự dựng tóc gáy. Cả ba từ này đều chỉ sự phát sinh của nỗi sợ hãi.
Upasaṅkamīti kasmā panāyaṃ evamadhippāyo upasaṅkami, nanu pubbe attanā kātabbaṃ vippakāraṃ akāsīti?
Upasaṅkamī – Why did he approach with such an intention, when he had already caused disturbances before?
Upasaṅkamī (đến gần): Tại sao hắn lại đến gần với ý định như vậy? Chẳng phải trước đó hắn đã làm những điều quấy nhiễu rồi sao?
Saccamakāsi, taṃ panesa ‘‘antobhavane khemaṭṭhāne thirabhūmiyaṃ ṭhitassa na kiñci kātuṃ asakkhi, idāni bahi ṭhitaṃ evaṃ bhiṃsāpetvā palāpetuṃ sakkā’’ti maññamāno upasaṅkami.
It is true that he did, but he approached again thinking, "I could not do anything to this ascetic while he was in my dwelling, a safe place on firm ground. Now that he is outside, I can surely frighten him and make him flee."
Đúng là hắn đã làm vậy, nhưng hắn nghĩ: “Trong cung điện, nơi an toàn, trên nền đất vững chắc, ta không thể làm gì được Sa-môn này. Bây giờ, khi ông ấy ở bên ngoài, ta có thể dọa nạt và xua đuổi ông ấy.” Nghĩ vậy, hắn liền đến gần.
Ayañhi yakkho attano bhavanaṃ ‘‘thirabhūmī’’ti maññati, ‘‘tattha ṭhitattā ayaṃ samaṇo na bhāyatī’’ti ca.
Indeed, this yakkha considered his dwelling to be "firm ground," and thought, "This ascetic is not afraid because he is standing there."
Dạ-xoa này xem cung điện của mình là “nền đất vững chắc”, và nghĩ rằng: “Vì ở đó, Sa-môn này không sợ hãi.”
Tikkhattuṃ ‘‘akkulo pakkulo’’ti akkulapakkulikaṃ akāsīti tayo vāre ‘‘akkulo pakkulo’’ti bhiṃsāpetukāmatāya evarūpaṃ saddaṃ akāsi.
‘‘Three times he made the ‘Akkulo, Pakkulo’ sound, an akkulapakkulika’’ means he made such a sound three times with the intention of terrifying, saying ‘‘Akkulo, Pakkulo.’’
Tikkhattuṃ “akkulo pakkulo”ti akkulapakkulikaṃ akāsī (Ba lần hắn tạo ra tiếng “akkulo pakkulo”): Ba lần hắn tạo ra tiếng động như vậy với ý định hăm dọa bằng cách nói “akkulo pakkulo”.
Anukaraṇasaddo hi ayaṃ.
This is an imitative sound.
Đây là một từ tượng thanh.
Tadā hi so yakkho sineruṃ ukkhipanto viya mahāpathaviṃ parivattento viya ca mahatā ussāhena asanisatasaddasaṅghāṭaṃ viya ekasmiṃ ṭhāne puñjīkataṃ hutvā viniccharantaṃ disāgajānaṃ hatthigajjitaṃ, kesarasīhānaṃ sīhaninnādaṃ, yakkhānaṃ hiṃkārasaddaṃ, bhūtānaṃ aṭṭahāsaṃ, asurānaṃ apphoṭanaghosaṃ, indassa devarañño vajiranigghātanigghosaṃ, attano gambhīratāya vipphārikatāya bhayānakatāya ca avasesasaddaṃ avahasantamiva abhibhavantamiva ca kappavuṭṭhānamahāvātamaṇḍalikāya vinigghosaṃ puthujjanānaṃ hadayaṃ phālentaṃ viya mahantaṃ paṭibhayanigghosaṃ abyattakkharaṃ tikkhattuṃ attano yakkhagajjitaṃ gajji ‘‘etena imaṃ samaṇaṃ bhiṃsāpetvā palāpessāmī’’ti.
At that time, that yakkha, with great effort, as if lifting Mount Sineru or overturning the great earth, gathered together a sound like a hundred thunderclaps in one place. He roared his yakkha roar three times with an indistinct guttural sound—a great and fearsome roar that seemed to mock and overpower the roars of the quarter-elephants, the lions' mighty bellows, the yakkhas' 'hiṃkāra' sounds, the ogres' eight great laughs, the asuras' slapping sounds, and the thunder of Sakka, the king of devas' vajira weapon, because of its depth, breadth, and terrifying nature—like the great wind of the destruction of a world cycle, as if it would cleave the hearts of ordinary people.
Khi ấy, vị Dạ-xoa ấy, như thể đang nhấc núi Sineru hoặc lật úp đại địa, với nỗ lực phi thường, đã tạo ra một tiếng gầm lớn, đáng sợ, không rõ ràng, như tiếng sấm sét của hàng trăm tia chớp dồn lại một chỗ, như tiếng gầm của voi rừng, tiếng gầm của sư tử bờm, tiếng hú của Dạ-xoa, tiếng cười lớn của quỷ thần, tiếng vỗ tay của A-tu-la, tiếng sét của vua trời Sakka, và như tiếng gió lốc lớn khi tận thế, vượt qua và chế ngự mọi âm thanh khác bởi sự sâu thẳm, rộng lớn và đáng sợ của nó, như thể đang xé toạc trái tim của phàm nhân. Hắn gầm lên tiếng gầm của Dạ-xoa ba lần, nghĩ: “Bằng tiếng này, ta sẽ hù dọa và xua đuổi Sa-môn này.”
Yaṃ yaṃ niccharati, tena tena pabbatā papaṭikaṃ muñciṃsu, vanappatijeṭṭhake upādāya sabbesu rukkhalatāgumbesu pattaphalapupphāni sīdayiṃsu, tiyojanasahassavitthatopi himavantapabbatarājā saṅkampi sampakampi sampavedhi, bhummadevatā ādiṃ katvā yebhuyyena devatānampi ahudeva bhayaṃ chambhitattaṃ lomahaṃso, pageva manussānaṃ.
Wherever that sound resonated, mountains shed their layers, and leaves, fruits, and flowers fell from all trees, creepers, and bushes, starting with the chief forest trees. Even the Himālaya, the king of mountains, which was three thousand yojanas wide, trembled, shook, and quaked. Most of the devas, beginning with the earth devas, also experienced fear, trepidation, and goosebumps; how much more so humans!
Mỗi khi tiếng gầm vang lên, các ngọn núi đều vỡ vụn thành từng mảnh, lá, quả và hoa trên tất cả cây cối, dây leo, bụi rậm, kể cả những cây cổ thụ trong rừng, đều rụng xuống. Núi chúa Hy-mã-lạp Sơn, rộng ba ngàn do-tuần, cũng rung chuyển, chấn động và run rẩy dữ dội. Chư thiên, bắt đầu từ các vị thần đất, phần lớn đều cảm thấy sợ hãi, run rẩy và dựng tóc gáy, huống chi là loài người.
Aññesañca apadadvipadacatuppadānaṃ mahāpathaviyā undriyanakālo viya mahatī vibhiṃsanakā ahosi, sakalasmiṃ jambudīpatale mahantaṃ kolāhalaṃ udapādi.
For other creatures, those without feet, with two feet, and with four feet, it was like a time when the great earth was being swallowed up, and a great commotion arose throughout the entire Jambudīpa continent.
Đối với các loài không chân, hai chân và bốn chân khác, đó là một sự khủng bố lớn, như thể đại địa đang bị phá hủy. Một sự hỗn loạn lớn đã nổi lên trên toàn bộ mặt đất Jambudīpa.
Bhagavā pana taṃ saddaṃ ‘‘kimī’’ti amaññamāno niccalo nisīdi, ‘‘mā kassaci iminā antarāyo hotū’’ti adhiṭṭhāsi.
The Blessed One, however, not considering that sound as "What is this?", remained motionless and sat down. He resolved, "May no harm come to anyone by this."
Tuy nhiên, Đức Thế Tôn, không nghĩ tiếng động đó là gì, vẫn ngồi bất động, và Ngài đã quyết định: “Mong rằng không ai bị nguy hiểm vì tiếng động này.”
Yasmā pana so saddo ‘‘akkula pakkula’’ iti iminā ākārena sattānaṃ sotapathaṃ agamāsi, tasmā tassa anukaraṇavasena ‘‘akkulo pakkulo’’ti, yakkhassa ca tassaṃ nigghosanicchāraṇāyaṃ akkulapakkulakaraṇaṃ atthīti katvā ‘‘akkulapakkulikaṃ akāsī’’ti saṅgahaṃ āropayiṃsu.
Because that sound reached the ears of beings as "akkula pakkula," therefore, in imitation of it, "akkulo pakkulo" was said, and because the yakkha's act of uttering that mighty roar contained this "akkulapakkula" action, they included it in the Pāli collection as "akkulapakkulikaṃ akāsī."
Vì tiếng động ấy đã đến tai chúng sinh dưới dạng “akkula pakkula”, nên theo cách tượng thanh đó, các vị kết tập đã đưa vào kinh điển là “akkulo pakkulo”, và vì hành động tạo ra tiếng gầm đáng sợ đó của Dạ-xoa có tính chất “akkulapakkula”, nên đã nói “akkulapakkulikaṃ akāsī”.
Keci pana ‘‘ākulabyākula iti padadvayassa pariyāyābhidhānavasena akkulo bakkuloti ayaṃ saddo vutto’’ti vadanti yathā ‘‘ekaṃ ekaka’’nti.
Some, however, say that the words "ākulabyākula" were expressed as "akkulo bakkulo" by way of an alternative designation, just as "ekaṃ ekakaṃ" (one, a single one).
Một số vị lại nói rằng: "Từ 'akkulo bakkulo' này được nói theo nghĩa đồng nghĩa của hai từ 'ākulabyākula'", như trong trường hợp "ekaṃ ekakaṃ" (một là một).
Yasmā ekavāraṃ jāto paṭhamuppattivaseneva nibbattattā ākuloti ādiattho ākāro, tassa ca kakārāgamaṃ katvā rassattaṃ katanti.
Because the first-born is called ākula by reason of being produced by the very first arising, the initial sound ā becomes a (shortened) by the insertion of the consonant k.
Bởi vì, từ 'ākulo' (ākula) có nghĩa ban đầu là sự xuất hiện đầu tiên, tức là sinh ra chỉ một lần, và từ 'ākāro' (ākāra) được tạo thành bằng cách thêm phụ âm 'k' và rút ngắn nguyên âm 'ā'.
Dve vāre pana jāto bakkulo, kulasaddo cettha jātipariyāyo kolaṃkolotiādīsu viya.
One born twice is bakkulo. Here, the word kula is a synonym for birth, as in kolaṃkolaṃ and so forth.
Còn từ 'bakkulo' (bakkula) là sinh ra hai lần, và ở đây, từ 'kula' là một từ đồng nghĩa với 'jāti' (sự sinh), như trong các trường hợp như 'kolaṃkolaṃ' (từ dòng này đến dòng khác).
Vuttaadhippāyānuvidhāyī ca saddappayogoti paṭhamena padena jalābujasīhabyagghādayo, dutiyena aṇḍajaāsīvisakaṇhasappādayo vuccanti, tasmā sīhādiko viya āsīvisādiko viya ca ‘‘ahaṃ te jīvitahārako’’ti imaṃ atthaṃ yakkho padadvayena dassetīti aññe.
And the usage of the words aligns with the intended meaning; thus, by the first word, creatures like those born from moisture, such as lions and tigers, are meant, and by the second, those born from eggs, such as vipers and black snakes. Therefore, others say that the yakkha expresses the meaning "I am a taker of your life," just like a lion or a viper, with these two words.
Và cách dùng từ này phù hợp với ý định của văn bản, vì vậy từ đầu tiên chỉ các loài sinh ra từ thai như sư tử, hổ, v.v., và từ thứ hai chỉ các loài sinh ra từ trứng như rắn độc, rắn hổ mang đen, v.v. Do đó, những vị khác nói rằng, vị dạ-xoa dùng hai từ này để thể hiện ý nghĩa "ta là kẻ đoạt mạng sống của ngươi", như sư tử, v.v., hoặc như rắn độc, v.v.
Apare pana ‘‘akkhulo bhakkhulo’’ti pāḷiṃ vatvā ‘‘akkhetuṃ khepetuṃ vināsetuṃ ulati pavattetīti akkhulo, bhakkhituṃ khādituṃ ulatīti bhakkhulo.
Others, however, stating the Pāli as "akkhulo bhakkhulo," say its meaning is: "akkhulo" means one who impels to destroy, to obliterate, to annihilate; "bhakkhulo" means one who impels to devour, to consume.
Những vị khác lại nói rằng, đọc là "akkhulo bhakkhulo" và giải thích ý nghĩa của nó là "akkhulo" là kẻ thúc đẩy để tiêu diệt, để hủy hoại; "bhakkhulo" là kẻ thúc đẩy để ăn, để nuốt chửng.
Ko paneso?
Who, then, is this?
Vậy kẻ đó là ai?
Yakkharakkhasapisācasīhabyagghādīsu aññataro yo koci manussānaṃ anatthāvaho’’ti tassa atthaṃ vadanti.
"It is some yakkha, rākkhasa, pisāca, lion, tiger, or other such being that is harmful to humans."
Kẻ đó là một trong các loài dạ-xoa, la-sát, quỷ, sư tử, hổ, v.v., bất cứ ai gây hại cho con người.
Idhāpi pubbe vuttanayeneva adhippāyayojanā veditabbā.
Here too, the interpretation of the meaning should be understood in the manner explained previously.
Ở đây, cách giải thích ý nghĩa cũng nên được hiểu theo cách đã nói ở trên.
Tattha yadā sakesu dhammesūti yasmiṃ kāle sakaattabhāvasaṅkhātesu pañcasu upādānakkhandhadhammesu.
Therein, when one is a crosser of the shore in one's own dhammas refers to the time when one has crossed to the other shore with regard to the five aggregates of clinging, which are referred to as one's own existence.
Trong đó, Khi nào một Bà-la-môn (yadā sakesu dhammesu): Vào lúc nào, trong các pháp thuộc về tự thân, tức là năm uẩn chấp thủ.
Pāragūti pariññābhisamayapāripūrivasena pāraṅgato, tatoyeva tesaṃ hetubhūte samudaye, tadappavattilakkhaṇe nirodhe, nirodhagāminiyā paṭipadāya ca pahānasacchikiriyābhāvanābhisamayapāripūrivasena pāragato.
A crosser of the shore means one who has reached the other shore through the completion of full comprehension and penetration; and precisely for that reason, with regard to the origin which is their cause, the cessation characterized by their non-occurrence, and the path leading to cessation, one has reached the other shore through the completion of abandonment, realization, and development, and penetration.
Đã đến bờ bên kia (Pāragū): Đã đến bờ bên kia bằng cách hoàn thành sự thấu hiểu và chứng ngộ; và do đó, đã đến bờ bên kia bằng cách hoàn thành sự đoạn trừ, chứng ngộ và tu tập trong tập khởi (samudaya) là nguyên nhân của chúng, trong diệt (nirodha) là đặc tính của sự không tái diễn của chúng, và trong con đường dẫn đến diệt (nirodhagāminī paṭipadā).
Hoti brāhmaṇoti evaṃ sabbaso bāhitapāpattā brāhmaṇo nāma hoti, sabbaso sakaattabhāvāvabodhanepi catusaccābhisamayo hoti.
Is a brāhmaṇa means such a one, having completely cast out evil, is called a brāhmaṇa. And through the perfect understanding of one's own existence in every way, the penetration of the Four Noble Truths occurs.
Trở thành Bà-la-môn (Hoti brāhmaṇo): Một người như vậy, vì đã hoàn toàn loại bỏ các ác pháp, được gọi là Bà-la-môn; và ngay cả trong việc hoàn toàn giác ngộ tự thân, cũng có sự chứng ngộ Tứ Diệu Đế.
Vuttañcetaṃ – ‘‘imasmiṃyeva byāmamatte kaḷevare sasaññimhi samanake lokañca lokasamudayañca paññapemī’’tiādi (saṃ. ni. 1.107; a. ni. 4.45).
It was also said: "In this very fathom-long body, with its perceptions and mind, I declare the world and the origin of the world," and so on.
Điều này đã được nói: "Trong cái thân chỉ một sải tay này, có tưởng và có ý này, ta tuyên bố thế giới và tập khởi của thế giới", v.v.
Atha vā sakesu dhammesūti attano dhammesu, attano dhammā nāma atthakāmassa puggalassa sīlādidhammā.
Alternatively, in one's own dhammas means in one's own qualities. One's own qualities are those qualities like sīla for a person desiring well-being.
Hoặc là, trong các pháp của mình (sakesu dhammesu): trong các pháp của chính mình. Các pháp của chính mình là các pháp như giới, v.v., của một người mong cầu lợi ích.
Sīlasamādhipaññāvimuttiādayo hi vodānadhammā ekantahitasukhasampādanena purisassa attano dhammā nāma, na anatthāvahā saṃkilesadhammā viya asakadhammā.
For moral virtue (sīla), concentration (samādhi), wisdom (paññā), liberation (vimutti), and so forth, being purifying qualities, are truly one's own qualities because they bring about ultimate welfare and happiness, unlike defiling qualities which bring harm and are not one's own qualities.
Thật vậy, các pháp thanh tịnh như giới, định, tuệ, giải thoát, v.v., được gọi là các pháp của chính mình đối với một người, vì chúng mang lại lợi ích và hạnh phúc tuyệt đối, chứ không phải là các pháp ô nhiễm gây hại, vốn không phải là các pháp của mình.
Pāragūti tesaṃ sīlādīnaṃ pāripūriyā pāraṃ pariyantaṃ gato.
A crosser of the shore means one who has reached the other shore or the limit through the fulfillment of these qualities such as sīla.
Đã đến bờ bên kia (Pāragū): Đã đạt đến sự hoàn thiện, tức là bờ bên kia của các pháp giới, v.v.
Tattha sīlaṃ tāva lokiyalokuttaravasena duvidhaṃ.
Among these, sīla is twofold: mundane and supramundane.
Trong đó, giới có hai loại: thế gian và xuất thế gian.
Tesu lokiyaṃ pubbabhāgasīlaṃ.
Of these, the mundane sīla is preliminary virtue.
Trong hai loại đó, giới thế gian là giới thuộc phần ban đầu.
Taṃ saṅkhepato pātimokkhasaṃvarādivasena catubbidhaṃ, vitthārato pana anekappabhedaṃ.
It is briefly fourfold, according to the Pātimokkha restraint and so forth, but extensively, it is of many kinds.
Tóm lại, giới này có bốn loại theo giới bổn Pātimokkha, v.v., nhưng nếu nói rộng ra thì có vô số loại.
Lokuttaraṃ maggaphalavasena duvidhaṃ, atthato sammāvācāsammākammantasammāājīvā.
Supramundane sīla is twofold, according to the path and fruit; in essence, it is right speech, right action, and right livelihood.
Giới xuất thế gian có hai loại theo đạo và quả, về mặt ý nghĩa là Chánh Ngữ, Chánh Nghiệp, Chánh Mạng.
Yathā ca sīlaṃ, tathā samādhipaññā ca lokiyalokuttaravasena duvidhā.
Just as sīla, so too are samādhi and paññā twofold, according to mundane and supramundane.
Giống như giới, định và tuệ cũng có hai loại: thế gian và xuất thế gian.
Tattha lokiyasamādhi saha upacārena aṭṭha samāpattiyo, lokuttarasamādhi maggapariyāpanno.
Of these, mundane samādhi consists of the eight attainments together with access concentration; supramundane samādhi is that which is included in the path.
Trong đó, định thế gian là tám thiền chứng cùng với cận định; định xuất thế gian là định thuộc về đạo.
Paññāpi lokiyā sutamayā, cintāmayā, bhāvanāmayā ca sāsavā, lokuttarā pana maggasampayuttā phalasampayuttā ca.
Wisdom (paññā) is also mundane when it is knowledge gained from hearing, knowledge gained from reflection, and knowledge gained from development, all of which are with taints; supramundane wisdom, however, is that associated with the path and that associated with the fruit.
Tuệ thế gian là tuệ do nghe, do tư duy, và do tu tập, có lậu; còn tuệ xuất thế gian là tuệ tương ưng với đạo và tương ưng với quả.
Vimutti nāma phalavimutti nibbānañca, tasmā sā lokuttarāva.
Vimutti refers to the liberation of the fruit (of arahantship) and Nibbāna; therefore, it is always supramundane.
Giải thoát (vimutti) là giải thoát quả và Niết-bàn; do đó, giải thoát này chỉ là xuất thế gian.
Vimuttiñāṇadassanaṃ lokiyameva, taṃ ekūnavīsatividhaṃ paccavekkhaṇañāṇabhāvato.
The knowledge and vision of liberation is mundane; it is of nineteen kinds, being the knowledge of reviewing.
Giải thoát tri kiến (vimuttiñāṇadassana) chỉ là thế gian, nó có mười chín loại vì là các tuệ quán xét.
Evaṃ etesaṃ sīlādidhammānaṃ attano santāne arahattaphalādhigamena anavasesato nibbattapāripūriyā pāraṃ pariyantaṃ gatoti sakesu dhammesu pāragū.
Thus, one who has reached the end or limit through the complete and full accomplishment of these qualities, such as sīla, in one's own continuum through the attainment of the fruit of arahantship, is a crosser of the shore in one's own dhammas.
Như vậy, đã đến bờ bên kia trong các pháp của mình (sakesu dhammesu pāragū) nghĩa là đã đạt đến sự hoàn thiện không còn sót lại của các pháp giới, v.v., trong dòng tâm thức của mình bằng cách chứng đắc quả A-la-hán.
Atha vā sotāpattiphalādhigamena sīlasmiṃ pāragū.
Alternatively, one who has attained the fruit of Stream-entry is a crosser of the shore in sīla.
Hoặc là, đã đến bờ bên kia trong giới bằng cách chứng đắc quả Nhập Lưu (Sotāpatti).
So hi ‘‘sīlesu paripūrakārī’’ti vutto, sotāpannaggahaṇeneva cettha sakadāgāmīpi gahito hoti.
For such a one is called "one who fulfills sīla," and by the inclusion of a Stream-enterer, a Once-returner is also included here.
Vị ấy được gọi là "người hoàn thành giới", và khi nói đến vị Nhập Lưu, thì vị Nhất Lai (Sakadāgāmī) cũng được bao gồm ở đây.
Anāgāmiphalādhigamena samādhismiṃ pāragū.
One who has attained the fruit of Non-returning is a crosser of the shore in samādhi.
Đã đến bờ bên kia trong định bằng cách chứng đắc quả Bất Hoàn (Anāgāmī).
So hi ‘‘samādhismiṃ paripūrakārī’’ti vutto.
For such a one is called "one who fulfills samādhi."
Vị ấy được gọi là "người hoàn thành định".
Arahattaphalādhigamena itaresu tīsu pāragū.
One who has attained the fruit of Arahantship is a crosser of the shore in the other three.
Đã đến bờ bên kia trong ba pháp còn lại bằng cách chứng đắc quả A-la-hán.
Arahā hi paññāvepullappattiyā aggabhūtāya akuppāya cetovimuttiyā adhigatattā paccavekkhaṇañāṇassa ca pariyosānagamanato paññāvimuttivimuttiñāṇadassanesu pāragū nāma hoti.
For an Arahant, having attained unshakeable liberation of mind (cetovimutti), which is supreme in the fullness of wisdom, and having reached the culmination of the reviewing knowledge, is called a crosser of the shore in wisdom, liberation, and the knowledge and vision of liberation.
Quả thật, vị A-la-hán, vì đã đạt đến sự phát triển tột bậc của tuệ, đã chứng đắc giải thoát tâm bất động tối thượng, và vì tuệ quán xét đã đạt đến đỉnh điểm, nên được gọi là người đã đến bờ bên kia trong tuệ, giải thoát và giải thoát tri kiến.
Evaṃ sabbathāpi catūsu ariyasaccesu catumaggavasena pariññādisoḷasavidhāya kiccanipphattiyā yathāvuttesu tasmiṃ tasmiṃ kāle sakesu dhammesu pāragato.
Thus, in every way, through the accomplishment of the sixteen kinds of duties such as full comprehension in the Four Noble Truths by way of the four paths, one is a crosser of the shore in one's own dhammas at the respective times as stated.
Như vậy, trong mọi phương diện, bằng sự hoàn thành mười sáu loại phận sự như sự thấu hiểu, v.v., thông qua Tứ Đạo trong Tứ Diệu Đế, vào mỗi thời điểm, vị ấy đã đến bờ bên kia trong các pháp của mình như đã nói.
8. Aṭṭhame saṅgāmajīti evaṃnāmo.
8. In the eighth (sutta), Saṅgāmajī means of this name.
8. Trong bài kinh thứ tám, Saṅgāmajī là tên của vị ấy.
Ayañhi āyasmā sāvatthiyaṃ aññatarassa mahāvibhavassa seṭṭhino putto, vayappattakāle mātāpitūhi patirūpena dārena niyojetvā sāpateyyaṃ niyyātetvā gharabandhanena baddho hoti.
This venerable one was the son of a very wealthy financier in Sāvatthī; when he reached maturity, his parents arranged his marriage to a suitable wife, handed over his assets, and he was bound by the ties of a household.
Vị Tôn giả này là con trai của một vị trưởng giả rất giàu có ở Sāvatthī. Khi đến tuổi trưởng thành, cha mẹ đã gả cho ông một người vợ phù hợp, giao phó tài sản cho ông, và ông bị ràng buộc bởi cuộc sống gia đình.
So ekadivasaṃ sāvatthivāsino upāsake pubbaṇhasamayaṃ dānaṃ datvā sīlaṃ samādiyitvā sāyanhasamaye suddhavatthe suddhuttarāsaṅge gandhamālādihatthe dhammassavanatthaṃ jetavanābhimukhe gacchante disvā ‘‘kattha tumhe gacchathā’’ti pucchitvā ‘‘dhammassavanatthaṃ jetavane satthu santika’’nti vutte ‘‘tena hi ahampi gamissāmī’’ti tehi saddhiṃ jetavanaṃ agamāsi.
One day, he saw the lay followers residing in Sāvatthī, who, having given alms and undertaken the precepts in the forenoon, were proceeding towards Jetavana in the evening, wearing clean clothes and clean outer robes, with perfumes and garlands in their hands, for the purpose of listening to the Dhamma. He asked them, "Where are you going?" When they replied, "To the Lord's presence in Jetavana to listen to the Dhamma," he said, "Then I too will go," and went to Jetavana with them.
Một ngày nọ, ông thấy các cư sĩ sống ở Sāvatthī, sau khi dâng cúng dường vào buổi sáng và thọ trì giới, vào buổi tối, họ mặc y phục sạch sẽ, khoác y thượng sạch sẽ, tay cầm hương hoa, v.v., đi về phía Jetavana để nghe Pháp. Ông hỏi: "Các vị đi đâu vậy?". Khi họ trả lời: "Chúng tôi đi đến chỗ Đức Đạo Sư ở Jetavana để nghe Pháp", ông nói: "Vậy thì tôi cũng sẽ đi", và cùng họ đến Jetavana.
Tena ca samayena bhagavā kañcanaguhāyaṃ sīhanādaṃ nadanto kesarasīho viya saddhammamaṇḍape paññattavarabuddhāsane nisīditvā catuparisamajjhe dhammaṃ deseti.
At that time, the Blessed One, seated on the excellent Buddha-seat spread in the pavilion of the True Dhamma, like a majestic lion roaring in a golden cave, was teaching the Dhamma in the midst of the four assemblies.
Vào lúc đó, Đức Thế Tôn đang ngồi trên tòa Phật cao quý được trải sẵn trong Pháp đường (saddhammamaṇḍapa), như một con sư tử có bờm gầm lên tiếng sư tử hống trong hang vàng (kañcanaguhā), và thuyết Pháp giữa bốn hội chúng.
Atha kho te upāsakā bhagavantaṃ vanditvā ekamantaṃ nisīdiṃsu, saṅgāmajipi kulaputto tassā parisāya pariyante dhammaṃ suṇanto nisīdi.
Then those lay followers, having paid homage to the Blessed One, sat down to one side. The young man Saṅgāmaji also sat listening to the Dhamma at the edge of that assembly.
Sau đó, các cư sĩ đó đảnh lễ Đức Thế Tôn và ngồi sang một bên. Vị thiện gia Saṅgāmajī cũng ngồi ở rìa hội chúng để nghe Pháp.
Bhagavā anupubbikathaṃ kathetvā cattāri saccāni pakāsesi, saccapariyosāne anekesaṃ pāṇasahassānaṃ dhammābhisamayo ahosi.
The Blessed One, having delivered a gradual discourse, expounded the Four Noble Truths. At the conclusion of the Truths, the realization of the Dhamma occurred for many thousands of beings.
Đức Thế Tôn đã thuyết giảng câu chuyện tuần tự (anupubbikathā), rồi tuyên bố Tứ Diệu Đế. Khi kết thúc bài giảng về Tứ Diệu Đế, hàng ngàn chúng sinh đã chứng ngộ Pháp.
Saṅgāmajipi kulaputto sotāpattiphalaṃ patvā parisāya vuṭṭhitāya bhagavantaṃ upasaṅkamitvā vanditvā pabbajjaṃ yāci ‘‘pabbājetha maṃ bhagavā’’ti.
The young man Saṅgāmaji, having attained the fruit of stream-entry, approached the Blessed One after the assembly dispersed, paid homage, and requested ordination, saying, "May the Blessed One ordain me."
Vị thiện gia Saṅgāmajī cũng chứng đắc quả Nhập Lưu (Sotāpatti). Khi hội chúng đã giải tán, ông đến gần Đức Thế Tôn, đảnh lễ và thỉnh cầu xuất gia: "Bạch Đức Thế Tôn, xin hãy cho con xuất gia."
‘‘Anuññātosi pana tvaṃ mātāpitūhi pabbajjāyā’’ti?
"Are you permitted by your parents to be ordained?"
“Này Saṅgāmaji, ngươi đã được cha mẹ cho phép xuất gia chưa?”
‘‘Nāhaṃ, bhante, anuññāto’’ti.
"Venerable Sir, I am not permitted."
“Bạch Thế Tôn, con chưa được cho phép.”
‘‘Na kho, saṅgāmaji, tathāgatā mātāpitūhi ananuññātaṃ puttaṃ pabbājentī’’ti.
"Indeed, Saṅgāmaji, Tathāgatas do not ordain a son who is not permitted by his parents."
“Này Saṅgāmaji, chư Như Lai không cho xuất gia đối với người con chưa được cha mẹ cho phép.”
‘‘Sohaṃ, bhante, tathā karissāmi, yathā maṃ mātāpitaro pabbajituṃ anujānantī’’ti.
"Venerable Sir, I will act in such a way that my parents will permit me to be ordained."
“Bạch Thế Tôn, con sẽ làm như vậy, để cha mẹ con cho phép con xuất gia.”
So bhagavantaṃ vanditvā padakkhiṇaṃ katvā mātāpitaro upasaṅkamitvā, ‘‘ammatātā, anujānātha maṃ pabbajitu’’nti āha.
Having paid homage to the Blessed One and circumambulated him clockwise, he approached his parents and said, "Mother, Father, permit me to be ordained."
Vị ấy đảnh lễ Thế Tôn, đi nhiễu hữu rồi đến gặp cha mẹ và nói: “Thưa cha mẹ, xin hãy cho phép con xuất gia.”
Tato paraṃ raṭṭhapālasutte (ma. ni. 2.293 ādayo) āgatanayena veditabbaṃ.
From that point onwards, it should be understood according to the manner described in the Raṭṭhapālasutta.
Từ đó trở đi, nên hiểu theo cách đã được trình bày trong kinh Raṭṭhapāla.
So hāyasmā dhuragāme piṇḍāya caritvā pacchābhattaṃ piṇḍapātapaṭikkanto jetavanaṃ pavisitvā bhagavantaṃ upasaṅkamitvā bhagavatā saddhiṃ katapaṭisanthāro aññaṃ byākaritvā puna bhagavantaṃ vanditvā padakkhiṇaṃ katvā nikkhamitvā aññatarasmiṃ rukkhamūle divāvihāraṃ nisīdi.
That Venerable One, having gone for alms in the nearby village and having returned from his alms round after the meal, entered Jetavana, approached the Blessed One, exchanged greetings with the Blessed One, then declared his arahantship, and again, having paid homage to the Blessed One and circumambulated him clockwise, he departed and sat down for his day-residence at the foot of a certain tree.
Trưởng lão ấy, sau khi khất thực ở ngôi làng đầu tiên và dùng bữa xong, trở về từ chuyến khất thực, đi vào Tịnh xá Jetavana, đến gặp Thế Tôn, trao đổi những lời chào hỏi thân mật với Thế Tôn, tuyên bố chứng A-la-hán, rồi lại đảnh lễ Thế Tôn, đi nhiễu hữu, rồi đi ra và ngồi nghỉ trưa dưới gốc cây nọ.
Athassa mātāpitaro ñātimittā cassa āgamanaṃ sutvā, ‘‘saṅgāmaji, kira idhāgato’’ti haṭṭhatuṭṭhā turitaturitā vihāraṃ gantvā pariyesantā naṃ tattha nisinnaṃ disvā upasaṅkamitvā paṭisanthāraṃ katvā ‘‘mā aputtakaṃ sāpateyyaṃ rājāno hareyyuṃ, appiyā dāyādā vā gaṇheyyuṃ, nālaṃ pabbajjāya, ehi, tāta, vibbhamā’’ti yāciṃsu.
Then, his parents, relatives, and friends, having heard of his arrival, were delighted and overjoyed, and quickly went to the monastery. Searching for him, they saw him sitting there. They approached him, exchanged greetings, and pleaded, "Let not the kings take away our sonless property, nor let unpleasant heirs seize it. This going forth is not proper. Come, dear son, renounce it."
Khi ấy, cha mẹ, bà con và bạn bè của vị ấy nghe tin vị ấy trở về, nói rằng: “Nghe nói Saṅgāmaji đã về đây,” họ vui mừng hớn hở, vội vàng đến tịnh xá tìm kiếm, thấy vị ấy đang ngồi ở đó, liền đến gần, chào hỏi thân mật và khẩn cầu: “Đừng để các vị vua chiếm đoạt tài sản không có con nối dõi của chúng con, hoặc để những người thừa kế không được ưa thích chiếm đoạt. Xuất gia không phải là điều phù hợp. Này con, hãy trở về nhà đi.”
Taṃ sutvā thero ‘‘ime mayhaṃ kāmehi anatthikabhāvaṃ na jānanti, gūthadhārī viya gūthapiṇḍe kāmesuyeva allīyanaṃ icchanti, nayime sakkā dhammakathāya saññāpetu’’nti assuṇanto viya nisīdi.
Hearing that, the Elder thought, "These people do not know my disinterest in sensual pleasures; like excrement-eating creatures clinging to a lump of excrement, they desire attachment to sensual pleasures. These cannot be persuaded by a discourse on the Dhamma." So he sat as if he had not heard them.
Nghe vậy, vị Trưởng lão nghĩ: “Những người này không biết rằng ta không còn ham muốn các dục. Họ muốn bám víu vào các dục như chó lợn bám víu vào đống phân. Không thể thuyết phục họ bằng pháp thoại.” Rồi vị ấy ngồi im như không nghe thấy gì.
Te nānappakāraṃ yācitvā attano vacanaṃ aggaṇhantaṃ disvā gharaṃ pavisitvā puttena saddhiṃ tassa bhariyaṃ saparivāraṃ uyyojesuṃ ‘‘mayaṃ nānappakāraṃ taṃ yācantāpi tassa manaṃ alabhitvā āgatā, gaccha tvaṃ, bhadde, tava bhattāraṃ puttasandassanena yācitvā saññāpehī’’ti.
Having pleaded in various ways and seeing that he did not heed their words, they went home and sent his former wife with their son and retinue, saying, "We pleaded with him in many ways but could not win his mind. Go, good lady, persuade your husband by showing him your son."
Họ đã khẩn cầu đủ mọi cách nhưng thấy vị ấy không chấp nhận lời của mình, liền trở về nhà và sai vợ cũ của vị ấy cùng với con trai và đoàn tùy tùng đi đến: “Chúng ta đã khẩn cầu nó đủ mọi cách nhưng không lay chuyển được tâm ý của nó, nên đành trở về. Này con dâu hiền, con hãy đi đến, khẩn cầu chồng con bằng cách cho nó thấy con trai, và thuyết phục nó đi.”
Tāya kira āpannasattāya ayamāyasmā pabbajito.
It was when she was pregnant that this Venerable One had gone forth.
Khi Trưởng lão này xuất gia, người vợ ấy đang mang thai.
Sā ‘‘sādhū’’ti sampaṭicchitvā dārakamādāya mahatā parivārena jetavanaṃ agamāsi.
She, accepting with "So be it," took the child and went to Jetavana with a large retinue.
Nàng đáp “Vâng,” rồi ẵm đứa bé, cùng với đoàn tùy tùng đông đảo đi đến Tịnh xá Jetavana.
Taṃ sandhāya vuttaṃ – ‘‘assosi kho āyasmato saṅgāmajissā’’tiādi.
Concerning this, it is said: "Indeed, Venerable Saṅgāmaji's..." and so forth.
Vì vậy, có lời nói: “Khi ấy, vợ cũ của Trưởng lão Saṅgāmaji…” và vân vân.
Tattha purāṇadutiyikāti pubbe gihikāle pādaparicaraṇavasena dutiyikā, bhariyāti attho.
Therein, purāṇadutiyikā means "former second wife," implying "wife" in the sense of one who served at his feet during his householder life.
Ở đây, purāṇadutiyikā có nghĩa là vợ, người bạn đời cũ trong thời còn là cư sĩ, người đã phụng sự dưới chân.
Ayyoti ‘‘ayyaputto’’ti vattabbe pabbajitānaṃ anucchavikavohārena vadati.
Ayyo (noble one): This is said as a fitting address for renunciants, where "ayyaputta" (noble son) would otherwise be used.
Ayyo là cách gọi phù hợp cho người xuất gia, thay vì nói “ayyaputto” (con trai của ngài).
Kirāti anussavanatthe nipāto, tassa anuppatto kirāti sambandho veditabbo.
Kirā is an indeclinable particle denoting hearsay; its connection should be understood as "has arrived, so it is said."
Kirā là một từ phụ dùng để chỉ điều nghe nói, nên hiểu là có liên hệ với “anuppatto kira” (nghe nói đã đến).
Khuddaputtañhi samaṇa, posa manti āpannasattameva maṃ chaḍḍetvā pabbajito, sāhaṃ etarahi khuddaputtā, tādisaṃ maṃ chaḍḍetvāva tava samaṇadhammakaraṇaṃ ayuttaṃ, tasmā, samaṇa, puttadutiyaṃ maṃ ghāsacchādanādīhi bharassūti.
"Samaṇa, support me with my small child": "You went forth, abandoning me while I was pregnant with your child. Now I have a small child. It is not proper for you to continue your ascetic practice, abandoning me in such a state. Therefore, samaṇa, support me, who has a child, with food and clothing, etc."
Khuddaputtañhi samaṇa, posa maṃ có nghĩa là: “Ngài đã xuất gia khi con đang mang thai, nay con có đứa con nhỏ. Ngài bỏ rơi con như vậy để thực hành pháp Sa-môn là không phù hợp. Vì vậy, này Sa-môn, xin hãy nuôi dưỡng con, người có đứa con nhỏ này, bằng cách cấp dưỡng thức ăn, y phục, v.v.”
Āyasmā pana, saṅgāmaji, indriyāni ukkhipitvā taṃ neva oloketi, nāpi ālapati.
However, Venerable Saṅgāmaji lowered his faculties (indriyāni) and neither looked at nor spoke to her.
Tuy nhiên, Trưởng lão Saṅgāmaji đã hạ thấp các căn của mình, không nhìn cũng không nói chuyện với nàng.
Tena vuttaṃ – ‘‘evaṃ vutte āyasmā saṅgāmaji tuṇhī ahosī’’ti.
Therefore, it is said: "When this was said, Venerable Saṅgāmaji remained silent."
Vì vậy, có lời nói: “Khi được nói như vậy, Trưởng lão Saṅgāmaji vẫn im lặng.”
Sā tikkhattuṃ tatheva vatvā tuṇhībhūtameva taṃ disvā ‘‘purisā nāma bhariyāsu nirapekkhāpi puttesu sāpekkhā honti, puttasineho pitu aṭṭhimiñjaṃ āhacca tiṭṭhati, tasmā puttapemenāpi mayhaṃ vase vatteyyā’’ti maññamānā puttaṃ therassa aṅke nikkhipitvā ekamantaṃ apakkamma ‘‘eso te, samaṇa, putto, posa na’’nti vatvā thokaṃ agamāsi.
She, having spoken three times in the same way, and seeing him remaining silent, thought, "Men, though indifferent to wives, are attentive to their sons. Filial affection penetrates to the marrow of a father's bones. Therefore, out of love for his son, he might yield to my wishes." So, placing the child on the Elder's lap, she stepped aside and said, "This, samaṇa, is your son; support him," and walked a little distance away.
Nàng đã nói như vậy ba lần, nhưng thấy vị ấy vẫn im lặng, nàng nghĩ: “Đàn ông có thể không quan tâm đến vợ, nhưng họ vẫn quan tâm đến con cái. Tình yêu con cái thấm sâu vào xương tủy của người cha. Vì vậy, có lẽ vì tình yêu con, ông ấy sẽ làm theo ý ta.” Nàng đặt đứa bé vào lòng vị Trưởng lão, rồi lùi sang một bên và nói: “Này Sa-môn, đây là con của ngài, xin hãy nuôi dưỡng nó.” Rồi nàng đi một đoạn ngắn.
Sā kira samaṇatejenassa sammukhe ṭhātuṃ nāsakkhi.
It is said that she could not stand long in his presence due to the samaṇa's spiritual power.
Nghe nói, nàng không thể đứng trước vị Trưởng lão vì uy lực của một Sa-môn.
Thero dārakampi neva oloketi nāpi ālapati.
The Elder neither looked at the child nor spoke to him.
Vị Trưởng lão cũng không nhìn đứa bé, cũng không nói chuyện với nó.
Atha sā itthī avidūre ṭhatvā mukhaṃ parivattetvā olokentī therassa ākāraṃ ñatvā paṭinivattitvā ‘‘puttenapi ayaṃ samaṇo anatthiko’’ti dārakaṃ gahetvā pakkāmi.
Then that woman, standing not far away, turned her face and observed him. Understanding the Elder's disposition, she returned, thinking, "This samaṇa is not interested even in his own son," took the child, and departed.
Sau đó, người phụ nữ ấy đứng cách đó không xa, quay mặt lại nhìn, nhận ra thái độ của vị Trưởng lão, liền quay trở lại, nghĩ: “Vị Sa-môn này không quan tâm đến con trai, huống chi là những thứ khác.” Nàng ẵm đứa bé và bỏ đi.
Tena vuttaṃ – ‘‘atha kho āyasmato saṅgāmajissa purāṇadutiyikā’’tiādi.
Concerning this, it is said: "Then, indeed, Venerable Saṅgāmaji's former wife..." and so forth.
Vì vậy, có lời nói: “Khi ấy, vợ cũ của Trưởng lão Saṅgāmaji…” và vân vân.
Tattha puttenapīti ayaṃ samaṇo attano orasaputtenapi anatthiko, pageva aññehīti adhippāyo.
Therein, "even in his son" means that this samaṇa is not interested even in his own biological son, let alone others – this is the intention.
Ở đây, puttenapī có ý nghĩa là: vị Sa-môn này không quan tâm đến đứa con ruột của mình, huống chi là những người khác.
Dibbenāti ettha dibbasadisattā dibbaṃ.
In Dibbenā, it is dibba because it is similar to the divine.
Trong từ Dibbenā, “dibba” có nghĩa là giống như chư thiên.
Devatānañhi sucaritakammanibbattaṃ pittasemharuhirādīhi apalibuddhaṃ dūrepi ārammaṇasampaṭicchanasamatthaṃ dibbaṃ pasādacakkhu hoti.
Indeed, the sense-faculty of sight of devas, born of meritorious deeds, unhindered by bile, phlegm, blood, etc., and capable of apprehending objects even from afar, is called dibba (divine).
Thật vậy, mắt thần (pasādacakkhu) của chư thiên, được sinh ra từ nghiệp thiện, không bị vướng mắc bởi mật, đờm, máu, v.v., và có khả năng nhận biết đối tượng từ xa.
Idampi catutthajjhānasamādhinibbattaṃ abhiññācakkhuṃ tādisanti dibbaṃ viyāti dibbaṃ, dibbavihārasannissayena laddhattā vā dibbaṃ, mahājutikattā mahāgatikattā vā dibbaṃ, tena dibbena.
This eye of supernormal knowledge (abhiññācakkhu), born of the samādhi of the fourth jhāna, is also similar, hence dibba, like the divine; or it is dibba because it was obtained through reliance on a divine abiding (dibbavihāra); or it is dibba because it is greatly luminous and has great range. By that dibba.
Mắt tuệ (abhiññācakkhu) này, được sinh ra từ định của Tứ thiền, cũng tương tự như vậy, nên được gọi là dibba (thần thánh), hoặc được gọi là dibba vì được đạt được nhờ nương tựa vào sự an trú của chư thiên (dibbavihāra), hoặc dibba vì có ánh sáng rực rỡ và khả năng đi lại siêu việt. Do đó, bằng mắt thần (dibba) ấy.
Visuddhenāti nīvaraṇādisaṃkilesavigamena suparisuddhena.
Visuddhenā means "perfectly purified by the elimination of defilements such as hindrances."
Visuddhenā có nghĩa là hoàn toàn trong sạch, không còn các phiền não như năm triền cái.
Atikkantamānusakenāti manussānaṃ visayātītena.
Atikkantamānusakenā means "transcending human (vision)."
Atikkantamānusakenā có nghĩa là vượt ngoài tầm nhìn của con người.
Imaṃ evarūpaṃ vippakāranti imaṃ evaṃ vippakāraṃ yathāvuttaṃ pabbajitesu asāruppaṃ aṅke puttaṭṭhapanasaṅkhātaṃ virūpakiriyaṃ.
Imaṃ evarūpaṃ vippakāraṃ: this kind of transgression, this inappropriate conduct for renunciants as described, meaning the perverse action of placing the child on his lap.
Imaṃ evarūpaṃ vippakāraṃ có nghĩa là hành động không phù hợp với người xuất gia như đã nói, tức là việc đặt đứa bé vào lòng.
Tattha āyantinti āgacchantiṃ, purāṇadutiyikanti adhippāyo.
In that verse: by 'coming' (āyantiṃ) means coming, the implied meaning is 'his former wife'.
Ở đây, āyantiṃ có nghĩa là người đang đến, tức là vợ cũ.
Nābhinandatīti daṭṭhuṃ maṃ āgatāti na nandati na tussati.
By 'he does not rejoice' (nābhinandati) means he does not rejoice or exult, thinking, "She has come to see me."
Nābhinandatī có nghĩa là không vui mừng, không hoan hỷ khi thấy nàng đến gặp mình.
Pakkamantinti sā ayaṃ mayā asammoditāva gacchatīti gacchantiṃ.
By 'departing' (pakkamantiṃ) means seeing her departing, thinking, "This wife of mine is leaving without me having spoken to her joyfully."
Pakkamantiṃ có nghĩa là người đang rời đi, tức là nàng rời đi mà không được ta chào hỏi.
Na socatīti na cittasantāpamāpajjati.
By 'he does not grieve' (na socati) means he does not become distressed in mind.
Na socatī có nghĩa là không đau khổ trong tâm.
Yena pana kāraṇena thero evaṃ nābhinandati na socati, taṃ dassetuṃ ‘‘saṅgā saṅgāmajiṃ mutta’’nti vuttaṃ.
To show the reason why the Elder neither rejoiced nor grieved in this way, it was said: “Released from ties, Saṅgāmaji.”
Để chỉ ra lý do vì sao vị Trưởng lão không vui mừng và không đau khổ như vậy, có lời nói: “Saṅgā Saṅgāmajiṃ mutta.”
Tattha saṅgāti rāgasaṅgo dosamohamānadiṭṭhisaṅgoti pañcavidhāpi saṅgā samucchedappaṭipassaddhivimuttīhi vimuttaṃ saṅgāmajiṃ bhikkhuṃ.
There, 'from ties' (saṅgā) refers to all five kinds of ties—the ties of lust, hatred, delusion, conceit, and wrong view—from which the monk Saṅgāmaji is liberated through eradication and tranquilisation (samucchedappaṭipassaddhivimuttīhi).
Ở đây, saṅgā có nghĩa là tất cả năm loại ràng buộc (saṅga): ràng buộc của tham (rāgasaṅga), ràng buộc của sân, si, mạn, tà kiến (dosamohamānadiṭṭhisaṅga), đã được giải thoát hoàn toàn khỏi ràng buộc (vimuttaṃ) bởi sự đoạn diệt (samuccheda) và sự an tịnh (paṭipassaddhi) đối với vị Tỳ-khưu Saṅgāmaji.
Tamahaṃ brūmi brāhmaṇanti taṃ tādibhāvappattaṃ khīṇāsavaṃ ahaṃ sabbaso bāhitapāpattā brāhmaṇanti vadāmīti.
By 'Him I call a brāhmaṇa' (Tamahaṃ brūmi brāhmaṇaṃ) means, "That Arahant (khīṇāsava) who has attained this state of imperturbability, I call a brāhmaṇa because he has utterly banished all evil."
Tamahaṃ brūmi brāhmaṇaṃ có nghĩa là: “Ta gọi vị A-la-hán đã đạt đến trạng thái bình thản ấy là Bà-la-môn (Brāhmaṇa) vì vị ấy đã hoàn toàn loại bỏ mọi ác nghiệp.”
9. Navame gayāyanti ettha gayāti gāmopi titthampi vuccati.
In the ninth Sutta, regarding 'at Gayā' (gayāyaṃ), 'Gayā' is used to refer to both a village and a ford.
Trong bài kinh thứ chín, ở đây, gayāyaṃ, Gayā được gọi là cả làng và bến sông.
Gayāgāmassa hi avidūre viharanto bhagavā ‘‘gayāyaṃ viharatī’’ti vuccati, tathā gayātitthassa.
For the Blessed One, dwelling not far from Gayā village, is said to be "dwelling at Gayā," and similarly for Gayā ford.
Khi Thế Tôn trú gần làng Gayā, Ngài được gọi là “trú ở Gayā,” cũng như ở bến sông Gayā.
Gayātitthanti hi gayāgāmassa avidūre ekā pokkharaṇī atthi nadīpi, tadubhayaṃ ‘‘pāpapavāhanatittha’’nti lokiyamahājano samudācarati.
For "Gayā ford" refers to a pond and a river not far from Gayā village, both of which the common people call the "ford for washing away sins."
Thật vậy, bến sông Gayā là một hồ nước và một con sông gần làng Gayā, cả hai đều được dân chúng thế tục gọi là “bến tẩy tội.”
Gayāsīseti gajasīsasadisasikharo tattha eko pabbato gayāsīsanāmako, yattha hatthikumbhasadiso piṭṭhipāsāṇo bhikkhusahassassa okāso pahoti, tatra bhagavā viharati.
By 'at Gayāsīsa': There is a mountain there called Gayāsīsa, with a peak resembling an elephant's head, where a rock slab, like an elephant's forehead, provides space for a thousand monks, and the Blessed One dwells there.
Gayāsīse là một ngọn núi ở đó tên là Gayāsīsa, có đỉnh giống đầu voi, nơi có một phiến đá phẳng giống như trán voi, có thể chứa một ngàn vị Tỳ-khưu. Thế Tôn trú ở đó.
Tena vuttaṃ – ‘‘gayāyaṃ viharati gayāsīse’’ti.
Therefore it was said: “He dwells at Gayā, at Gayāsīsa.”
Vì vậy, có lời nói: “Trú ở Gayā, trên đỉnh Gayāsīsa.”
Tattha hi keci ‘‘ekummujjaneneva pāpasuddhi hotī’’ti evaṃdiṭṭhikā, te ummujjanameva katvā gacchanti.
For some there, holding the view that "purification from defilements occurs with just one emergence," emerge once and then depart.
Trong số đó, một số người có quan điểm rằng “chỉ cần trồi lên một lần là tội lỗi được thanh tịnh”, họ chỉ trồi lên rồi đi.
Ummujjanaṃ pana nimujjanamantarena natthīti avinābhāvato nimujjanampi te karontiyeva.
But since emergence is impossible without immersion, they also perform immersion due to its inseparability.
Tuy nhiên, việc trồi lên không thể không có việc lặn xuống trước đó, do sự không thể tách rời này, họ cũng thực hiện việc lặn xuống.
Yepi ‘‘ekanimujjaneneva pāpasuddhi hotī’’ti evaṃdiṭṭhikā, tepi ekavārameva nimujjitvā vuttanayena avinābhāvato ummujjanampi katvā pakkamanti.
And those who hold the view that "purification from defilements occurs with just one immersion" also immerse themselves once and then depart, also performing emergence due to its inseparability, as explained.
Ngay cả những người có quan điểm rằng “chỉ cần lặn xuống một lần là tội lỗi được thanh tịnh”, họ cũng chỉ lặn xuống một lần, rồi theo cách đã nói, do sự không thể tách rời, họ cũng thực hiện việc trồi lên rồi rời đi.
Ye pana ‘‘tasmiṃ titthe nimujjaneneva pāpasuddhi hotī’’ti evaṃdiṭṭhikā, te tattha nimujjitvā assāse sannirumbhitvā maruppapātapatitā viya tattheva jīvitakkhayaṃ pāpuṇanti.
However, those who hold the view that "purification from defilements occurs by merely immersing in that ford" immerse themselves there, suppress their breaths, and die right there, like those who fall from a cliff.
Còn những người có quan điểm rằng “chỉ cần lặn xuống ở bến sông đó là tội lỗi được thanh tịnh”, họ lặn xuống đó, nín thở, và chết ngay tại đó như những người rơi xuống từ vách núi.
Apare ‘‘punappunaṃ ummujjananimujjanāni katvā nhāte pāpasuddhi hotī’’ti evaṃdiṭṭhikā, te kālena kālaṃ ummujjananimujjanāni karonti.
Others, holding the view that "purification from defilements occurs by bathing after repeated emerging and immersing," perform emerging and immersing from time to time.
Những người khác có quan điểm rằng “tội lỗi được thanh tịnh sau khi tắm bằng cách trồi lên và lặn xuống nhiều lần”, họ thực hiện việc trồi lên và lặn xuống theo thời gian.
Te sabbepi sandhāya vuttaṃ – ‘‘ ummujjantipi nimujjantipi ummujjanimujjampi karontī’’ti. Ettha ca kiñcāpi nimujjanapubbakaṃ ummujjanaṃ, nimujjanameva pana karontā katipayā, ummujjanaṃ tadubhayañca karontā bahūti tesaṃ yebhuyyabhāvadassanatthaṃ ummujjanaṃ paṭhamaṃ vuttaṃ.
It was said, “they emerge, they immerse, and they also perform emerging and immersing,” referring to all of them. And although immersion precedes emergence, since only a few perform just immersion, and many perform both emergence and that (immersion), emergence was mentioned first to show their prevalence.
Tất cả những người đó đều được đề cập khi nói: “ họ trồi lên, họ lặn xuống, và họ làm cả việc trồi lên và lặn xuống”. Ở đây, mặc dù việc trồi lên có trước việc lặn xuống, nhưng vì số người chỉ lặn xuống là ít, còn số người trồi lên và làm cả hai việc là nhiều, nên việc trồi lên được nói trước để chỉ ra đa số của họ.
Tathā sambahulā jaṭilāti jaṭilānaṃ yebhuyyatāya vuttaṃ, muṇḍasikhaṇḍinopi ca brāhmaṇā udakasuddhikā tasmiṃ kāle tattha tathā karonti.
Similarly, 'many Jaṭilas' was stated due to the prevalence of Jaṭilas, but also shaven-headed and top-knotted Brahmins, who believe in water purification, perform the same actions there at that time.
Tương tự, “ rất nhiều đạo sĩ có búi tóc (jaṭilā)” được nói để chỉ sự đông đảo của các đạo sĩ có búi tóc, nhưng các Bà-la-môn đầu trọc và đầu búi tóc, những người tin vào sự thanh tịnh nhờ nước, cũng làm như vậy ở đó vào thời điểm đó.
Ummujjanādi cettha nidassanamattaṃ vuttanti daṭṭhabbaṃ.
It should be understood that the mention of emerging and so forth here is merely an example.
Việc trồi lên, v.v., ở đây nên được hiểu là chỉ là một ví dụ.
Tesu hi keci udakavāsaṃ vasanti, keci udakassañjaliṃ denti, keci tasmiṃ udake ṭhatvā candimasūriye anuparivattanti, keci anekasahassavāraṃ sāvittiādike japanti, keci ‘‘inda āgacchā’’tiādinā vijjājapaṃ avhāyanti, keci mahatupaṭṭhānaṃ karonti, evañca karontā keci otaranti, keci uttaranti keci uttaritvā suddhikaācamanaṃ karonti, keci antoudake ṭhitā tantī vādenti, vīṇaṃ vādentīti evamādikā nānappakārakiriyā dassenti.
For among them, some dwell in water, some offer water with clasped hands, some stand in that water and follow the sun and moon, some recite Sāvitti and other texts countless thousands of times, some invoke deities with magical incantations beginning "Indra, come!", some perform great devotions, and doing so, some descend, some ascend, some ascend and perform ritual ablutions for purification, some stand in the water and play stringed instruments, play lutes; and in this way they display various kinds of actions.
Trong số họ, một số sống trong nước, một số chắp tay vái nước, một số đứng trong nước đó rồi đi theo mặt trăng và mặt trời, một số tụng niệm hàng ngàn lần các bài chú Sāvitti, v.v., một số kêu gọi các vị thần bằng các câu chú như “Inda, hãy đến!”, v.v., một số thực hiện sự cúng dường lớn, và khi làm như vậy, một số xuống nước, một số lên bờ, một số lên bờ rồi thực hiện việc súc miệng thanh tịnh, một số đứng trong nước rồi chơi đàn dây, chơi đàn vīṇā – họ thể hiện nhiều loại hành vi khác nhau như vậy.
Yasmā vā te evarūpā vikārakiriyā karontāpi tasmiṃ udake nimujjanaummujjanapubbakameva karonti, tasmā taṃ sabbaṃ nimujjanummujjanantogadhameva katvā ‘‘ummujjantī’’tipiādi vuttaṃ.
Because those who perform such strange actions always do so by first immersing and emerging in that water, all of that was included within immersion and emergence, and thus phrases like 'they emerge' and so forth were used.
Và bởi vì ngay cả khi họ thực hiện những hành vi kỳ lạ như vậy, họ cũng làm điều đó sau khi đã lặn xuống và trồi lên trong nước đó, nên tất cả những điều đó được bao gồm trong việc lặn xuống và trồi lên khi nói “họ trồi lên”, v.v.
Evaṃ tattha ākulabyākule vattamāne uparipabbate ṭhito bhagavā tesaṃ taṃ kolāhalaṃ sutvā ‘‘kinnu kho eta’’nti olokento taṃ kiriyavikāraṃ addasa, taṃ sandhāya vuttaṃ – ‘‘addasā kho bhagavā…pe… iminā suddhī’’ti, taṃ vuttatthameva.
While such a confused commotion was occurring there, the Blessed One, standing on the mountain above, heard their clamor and, wondering "What is this?", observed their strange actions. Referring to that, it was said: “The Blessed One saw… and thought, 'With this is purity'.” That has already been explained.
Khi sự hỗn loạn như vậy đang diễn ra ở đó, Thế Tôn đứng trên đỉnh núi phía trên, nghe thấy tiếng ồn ào đó, Ngài nhìn xem “điều gì đang xảy ra vậy?” và thấy những hành vi kỳ lạ đó, điều này được đề cập khi nói: “ Thế Tôn thấy…pe… nhờ điều này mà có sự thanh tịnh”, ý nghĩa của nó đã được giải thích.
Tattha na udakena sucī hotīti ettha udakenāti udakummujjanādinā.
In that verse of solemn utterance, regarding 'one is not pure by water' (na udakena sucī hoti), 'by water' (udakena) means by emerging from water and so forth.
Ở đây, trong câu không thanh tịnh bằng nước, từ bằng nước có nghĩa là bằng việc trồi lên trong nước, v.v.
Udakummujjanādi hi idha uttarapadalopena ‘‘udaka’’nti vuttaṃ yathā rūpabhavo rūpanti.
For "udakummujjana-ādi" (emerging from water and so forth) is here called "udaka" (water) by the elision of the latter part of the compound, just as "rūpabhava" (existence of form) is called "rūpa" (form).
Việc trồi lên trong nước, v.v., ở đây được gọi là “nước” bằng cách lược bỏ hậu tố, giống như rūpabhava được gọi là rūpa.
Atha vā udakenāti ummujjanādikiriyāya sādhanabhūtena udakena suci sattassa suddhi nāma na hoti, natthīti attho.
Alternatively, 'by water' (udakena) means that a being's purity, or being 'pure' from defilement, does not occur by water which serves as the means for actions like emerging; that is, it does not exist.
Hoặc, bằng nước có nghĩa là sự thanh tịnh của chúng sinh không thể có được bằng nước, là phương tiện để thực hiện các hành vi như trồi lên, v.v., nghĩa là không có sự thanh tịnh đó.
Atha vā sucīti tena yathāvuttena udakena suci pāpamalato suddho nāma satto na hoti.
Alternatively, 'pure' (sucī) means that a being is not pure from the stains of evil by that water as described.
Hoặc, thanh tịnh có nghĩa là chúng sinh không thể thanh tịnh khỏi ô nhiễm tội lỗi bằng nước đã nói.
Bahvettha nhāyatī jano.
'Many people bathe here'.
Nhiều người tắm ở đó.
Yadi hi udakorohanādinā yathāvuttena pāpasuddhi nāma siyā, bahu ettha udake jano nhāyati, mātughātādipāpakammakārī añño ca gomahiṃsādiko antamaso macchakacchape upādāya, tassa sabbassāpi pāpasuddhi siyā, na panevaṃ hoti.
For if purification from evil could occur by means of bathing in water or by the aforementioned methods, then many people bathe in this water—murderers and other evildoers, and even cattle, buffaloes, down to fish and turtles—all of them would be purified from evil. But this is not the case.
Nếu sự thanh tịnh tội lỗi có thể có được bằng việc xuống nước, v.v., như đã nói, thì nhiều người tắm ở đó, bao gồm cả những người phạm tội ác như giết mẹ, và các loài vật khác như bò, trâu, cho đến cả cá và rùa, tất cả họ đều sẽ được thanh tịnh tội lỗi, nhưng điều đó không xảy ra.
Nhānassa pāpahetūnaṃ appaṭipakkhabhāvato.
Because bathing is not an antidote to the causes of evil.
Vì việc tắm không phải là đối nghịch với các nguyên nhân của tội lỗi.
Yañhi yaṃ vināseti, so tassa paṭipakkho yathā āloko andhakārassa, vijjā ca avijjāya, na evaṃ nhānaṃ pāpassa.
That which destroys something is its opposite, just as light is the opposite of darkness, and wisdom of ignorance. Bathing is not the opposite of evil in the same way.
Thật vậy, cái gì hủy diệt cái gì thì cái đó là đối nghịch của nó, như ánh sáng là đối nghịch của bóng tối, và trí tuệ là đối nghịch của vô minh; việc tắm không phải là đối nghịch của tội lỗi như vậy.
Tasmā niṭṭhamettha gantabbaṃ ‘‘na udakena suci hotī’’ti.
Therefore, it must be concluded that "one is not purified by water."
Do đó, cần phải kết luận rằng “không thanh tịnh bằng nước”.
Yena pana suci hoti, taṃ dassetuṃ ‘‘yamhi saccañcā’’tiādimāha.
To show by what one is purified, he said, " yamhi saccañcā" (in whom there is truth), and so on.
Để chỉ ra điều gì giúp thanh tịnh, Ngài nói: “ nơi có chân lý”, v.v.
Tattha yamhīti yasmiṃ puggale.
Therein, yamhī means: in which person.
Ở đây, nơi có có nghĩa là nơi cá nhân đó.
Saccanti vacīsaccañceva viratisaccañca.
Saccaṃ means: both verbal truth and the truth of abstinence (viratisacca).
Chân lý có nghĩa là chân lý lời nói và chân lý giới hạnh.
Atha vā saccanti ñāṇasaccañceva paramatthasaccañca.
Alternatively, saccaṃ means: both the truth of knowledge (ñāṇasacca) and ultimate truth (paramatthasacca).
Hoặc, chân lý có nghĩa là chân lý trí tuệ và chân lý tối hậu.
Dhammoti ariyamaggadhammo, phaladhammo ca, so sabbopi yasmiṃ puggale upalabbhati, so sucī so ca brāhmaṇoti so ariyapuggalo visesato khīṇāsavo accantasuddhiyā suci ca brāhmaṇo cāti.
Dhammo means: the noble path-Dhamma and the fruition-Dhamma. All of that is found in a certain person, and " so sucī so ca brāhmaṇo" (that one is pure and that one is a brāhmaṇa) means that noble person, especially an Arahant, is pure and a brāhmaṇa by virtue of ultimate purity.
Pháp có nghĩa là pháp đạo Thánh và pháp quả, tất cả những điều đó được tìm thấy nơi cá nhân nào, người đó là thanh tịnh, người đó là Bà-la-môn có nghĩa là cá nhân Thánh đó, đặc biệt là vị A-la-hán, là thanh tịnh tuyệt đối và là Bà-la-môn.
Kasmā panettha saccaṃ dhammato visuṃ katvā gahitaṃ?
Why is truth (sacca) mentioned separately from Dhamma here?
Tại sao ở đây chân lý được tách riêng khỏi pháp?
Saccassa bahūpakārattā.
Because truth is of great benefit.
Vì chân lý có nhiều lợi ích.
Tathā hi ‘‘saccaṃ ve amatā vācā (su. ni. 455), saccaṃ have sādutaraṃ rasānaṃ (saṃ. ni. 1.246; su. ni. 184), sacce atthe ca dhamme ca, āhu santo patiṭṭhitā (su. ni. 455), sacce ṭhitā samaṇabrāhmaṇā cā’’tiādinā (jā. 2.21.433) anekesu suttapadesu saccaguṇā pakāsitā.
Indeed, the virtues of truth have been proclaimed in many Sutta passages such as, "Truth is verily the immortal speech," "Truth is indeed sweeter than all flavors," "The virtuous are established in truth, purpose, and Dhamma," and "ascetics and brāhmaṇas stand in truth," and so on.
Thật vậy, các đức tính của chân lý đã được công bố trong nhiều bài kinh như: “Lời chân thật là bất tử” (Kinh Tập 455), “Chân lý thật sự ngọt ngào hơn mọi hương vị” (Tương Ưng Bộ I.246; Kinh Tập 184), “Các bậc thiện nhân nói rằng họ an trú trong chân lý, trong lợi ích và trong Pháp” (Kinh Tập 455), “Các sa-môn và Bà-la-môn an trú trong chân lý” (Jātaka II.21.433), v.v.
Saccavipariyassa ca ‘‘ekaṃ dhammaṃ atītassa, musāvādissa jantuno (dha. pa. 176), abhūtavādī nirayaṃ upetī’’ti (dha. pa. 306) ca ādinā pakāsitāti.
And the opposite of truth has been proclaimed, for example, "For one who transgresses a single Dhamma, for a person who utters falsehood," and "the speaker of falsehood goes to hell."
Và sự trái ngược của chân lý cũng đã được công bố qua: “Kẻ vượt qua một pháp, nói lời dối trá” (Pháp Cú 176), “Kẻ nói lời không thật đi vào địa ngục” (Pháp Cú 306), v.v.
Tatrāyaṃ anupubbīkathā – ito kira kappasatasahassamatthake padumuttarasammāsambuddhakāle eko kulaputto haṃsavatīnagare dasabalassa dhammadesanaṃ suṇanto satthāraṃ ekaṃ bhikkhuṃ khippābhiññānaṃ etadagge ṭhapentaṃ disvā ‘‘mahā vatāyaṃ bhikkhu, yo satthārā evaṃ etadagge ṭhapīyati, aho vatāhampi anāgate evarūpassa sammāsambuddhassa sāsane pabbajitvā satthārā edise ṭhāne etadagge ṭhapetabbo bhaveyyaṃ yathāyaṃ bhikkhū’’ti taṃ ṭhānantaraṃ patthetvā tadanurūpaṃ adhikārakammaṃ katvā yāvajīvaṃ puññaṃ katvā saggaparāyaṇo hutvā devamanussesu saṃsaranto kassapadasabalassa sāsane pabbajitvā paripuṇṇasīlo samaṇadhammaṃ karontova jīvitakkhayaṃ patvā devaloke nibbatti.
The sequential story here is as follows: It is said that one hundred thousand eons ago, during the time of Padumuttara Sammāsambuddha, a certain young man of good family, while listening to the Dasabala’s Dhamma discourse in Haṃsavati city, saw the Teacher declare a certain bhikkhu as foremost among those swift in psychic power. He thought, "This bhikkhu is indeed fortunate, being declared foremost by the Teacher in such a way! Oh, if only I too, in the future, could become an ascetic in the dispensation of such a Sammāsambuddha and be declared foremost by the Teacher in such a position, just like this bhikkhu!" Having made this aspiration for that position and performed meritorious deeds suitable for it, he accumulated merit throughout his life and, after passing away, became destined for heaven. Transmigrating among devas and humans, he became an ascetic in the dispensation of Kassapa Dasabala and, being fully endowed with sīla, he continued to practice the ascetic life until the end of his life, whereupon he was reborn in the deva realm.
Ở đây, đây là câu chuyện tuần tự: Vào khoảng một trăm ngàn đại kiếp trước, trong thời Đức Padumuttara Sammāsambuddha, có một thiện nam tử ở thành phố Haṃsāvatī, khi nghe Đức Thập Lực thuyết pháp, thấy Đức Đạo Sư đặt một vị Tỳ-khưu vào hàng tối thắng về trí tuệ nhanh chóng (khippābhiññā), liền nghĩ: “Thật vĩ đại thay vị Tỳ-khưu này, người mà Đức Đạo Sư đã đặt vào hàng tối thắng như vậy! Ước gì trong tương lai, ta cũng có thể xuất gia trong giáo pháp của một Đức Sammāsambuddha như vậy và được Đức Đạo Sư đặt vào một vị trí tối thắng như vị Tỳ-khưu này!” Sau khi phát nguyện cho vị trí đó, ông đã thực hiện những công đức tương xứng, làm phước trọn đời, rồi làm nơi nương tựa cho chư thiên và loài người, luân hồi trong cõi trời và cõi người. Sau đó, ông xuất gia trong giáo pháp của Đức Kassapa Thập Lực, giữ giới hạnh viên mãn, và trong khi thực hành đời sống Sa-môn, ông đã đạt đến cuối đời và tái sinh vào cõi trời.
So ekaṃ buddhantaraṃ devaloke vasitvā imasmiṃ buddhuppāde bāhiyaraṭṭhe kulagehe paṭisandhiṃ gaṇhi, taṃ bāhiyaraṭṭhe jātattā bāhiyoti sañjāniṃsu.
Having dwelt in the deva realm for one Buddha-interval, he was reborn in a good family in the Bāhiya country during this present Buddha’s arising. Because he was born in the Bāhiya country, they knew him as Bāhiya.
Sau khi sống ở cõi trời trong một khoảng thời gian giữa hai Đức Phật, trong thời kỳ Đức Phật này xuất hiện, ông đã tái sinh vào một gia đình quý tộc ở xứ Bāhiya. Vì sinh ra ở xứ Bāhiya, người ta gọi ông là Bāhiya.
So vayappatto gharāvāsaṃ vasanto vaṇijjatthāya bahūnaṃ bhaṇḍānaṃ nāvaṃ pūretvā samuddaṃ pavisitvā aparāparaṃ sañcaranto satta vāre saddhiṃyeva parisāya attano nagaraṃ upagañchi.
When he came of age, he led a household life and, for the purpose of trade, filled a ship with many goods, entered the ocean, and traveled back and forth, reaching his own city seven times with his company.
Khi đến tuổi trưởng thành, ông sống đời gia đình, rồi chất đầy hàng hóa lên thuyền để buôn bán, đi lại trên biển. Ông đã về đến thành phố của mình bảy lần cùng với đoàn người.
Aṭṭhame vāre pana ‘‘suvaṇṇabhūmiṃ gamissāmī’’ti āropitabhaṇḍo nāvaṃ abhiruhi.
On the eighth voyage, however, he boarded a ship with goods loaded, thinking, "I will go to Suvaṇṇabhūmi."
Đến lần thứ tám, ông lên thuyền với hàng hóa đã chất đầy, nghĩ rằng: “Ta sẽ đi đến Suvaṇṇabhūmi (Xứ Vàng).”
Nāvā mahāsamuddaṃ ajjhogāhetvā icchitadesaṃ apatvāva samuddamajjhe vipannā.
The ship, having plunged into the great ocean, became wrecked in the middle of the sea without reaching its desired destination.
Con thuyền đi vào đại dương, nhưng chưa đến được nơi mong muốn thì đã gặp nạn giữa biển.
Mahājano macchakacchapabhakkho ahosi.
Many people became food for fish and turtles.
Đại chúng trở thành mồi cho cá và rùa.
Bāhiyo pana ekaṃ nāvāphalakaṃ gahetvā taranto ūmivegena mandamandaṃ khipamāno bhassitvā samudde patitattā jātarūpeneva samuddatīre nipanno.
Bāhiya, however, took a plank of the ship and swam. Being slowly tossed by the force of the waves, he was swept away and, having fallen into the sea, he landed on the seashore completely naked.
Riêng Bāhiya, ông bám vào một tấm ván thuyền, trôi dạt theo sóng biển, từ từ bị đẩy vào bờ, và nằm trên bờ biển trong trạng thái trần truồng.
Parissamaṃ vinodetvā assāsamattaṃ labhitvā uṭṭhāya lajjāya gumbantaraṃ pavisitvā acchādanaṃ aññaṃ kiñci apassanto akkanāḷāni chinditvā vākehi paliveṭhetvā nivāsanapāvuraṇāni katvā acchādesi.
After recovering from exhaustion and regaining his breath, he got up and, out of shame, entered a thicket. Finding nothing else for covering, he broke off stalks of water lilies and, wrapping them with bark, made coverings for his lower and upper body, and dressed himself.
Sau khi xua tan mệt mỏi và lấy lại hơi sức, ông đứng dậy, vì xấu hổ, liền đi vào một bụi cây. Không thấy bất cứ thứ gì khác để che thân, ông liền cắt những cây akkanaḷa (cây dứa dại), quấn bằng vỏ cây để làm y phục và áo choàng, rồi mặc vào.
Keci pana ‘‘dāruphalakāni vijjhitvā vākena āvuṇitvā nivāsanapāvuraṇaṃ katvā acchādesī’’ti vadanti.
Some, however, say that "he pierced wooden planks and strung them with bark to make robes for covering himself."
Một số người khác nói rằng: “Ông ấy đã đục các tấm ván gỗ, xâu chúng lại bằng vỏ cây để làm y phục và áo choàng, rồi mặc vào.”
Evaṃ sabbathāpi dārumayacīradhāritāya ‘‘dārucīriyo’’ti purimavohārena ‘‘bāhiyo’’ti ca paññāyittha.
Thus, in any case, due to wearing bark robes, he became known as " Dārucīriya" (bark-clad) and by his former designation, " Bāhiya."
Vì vậy, do luôn mặc y phục bằng gỗ, ông được biết đến với tên gọi Dārucīriya (người mặc vỏ cây) theo cách gọi cũ, và Bāhiya.
Taṃ ekaṃ kapālaṃ gahetvā vuttaniyāmena suppārakapaṭṭane piṇḍāya carantaṃ disvā manussā cintesuṃ ‘‘sace loke arahanto nāma honti, evaṃvidhehi bhavitabbaṃ, kinnu kho ayaṃ ayyo vatthaṃ diyyamānaṃ gaṇheyya, udāhu appicchatāya na gaṇheyyā’’ti vīmaṃsantā nānādisāhi vatthāni upanesuṃ.
The people, seeing him begging for alms in the port of Suppāraka with a single bowl, in the manner described, thought: "If there are Arahants in the world, they must be like this. Would this venerable one accept clothes if offered, or would he not accept them out of fewness of wishes?" Pondering this, they brought clothes from various directions.
Khi người ta thấy ông cầm một cái bát sứt, đi khất thực ở cảng Suppāraka theo cách đã nói, họ nghĩ: “Nếu có các vị A-la-hán trên đời, thì hẳn phải là những người như thế này. Vị Tôn giả này có nhận y phục khi được dâng cúng không, hay vì ít ham muốn mà không nhận?” Để thử, họ đã dâng y phục từ nhiều hướng khác nhau.
So cintesi – ‘‘sacāhaṃ iminā niyāmena nāgamissaṃ, nayime evaṃ mayi pasīdeyyuṃ, yaṃnūnāhaṃ imāni paṭikkhipitvā imināva nīhārena vihareyyaṃ, evaṃ me lābhasakkāro uppajjissatī’’ti.
He thought: "If I approach them in this manner, they will not be pleased with me in this way. Why don't I refuse these and live in this very style? Then offerings and respect will arise for me."
Ông nghĩ: “Nếu ta không hành xử theo cách này, họ sẽ không có đức tin nơi ta như vậy. Hay là ta nên từ chối những thứ này và sống theo cách này, như vậy lợi lộc và sự tôn kính sẽ phát sinh cho ta.”
So evaṃ cintetvā kohaññe ṭhatvā vatthāni na paṭiggaṇhi.
Having thought thus, he stood in self-glorification and did not accept the clothes.
Nghĩ vậy, ông giữ thái độ khoe khoang và không nhận y phục.
Manussā ‘‘aho appiccho vatāyaṃ ayyo’’ti bhiyyosomattāya pasannamānasā mahantaṃ sakkārasammānaṃ kariṃsu.
The people, thinking, "Oh, how few-wished is this venerable one!", became exceedingly pleased and rendered him great homage and respect.
Mọi người nghĩ: “Ôi, vị Tôn giả này thật ít ham muốn!” Với tâm ý càng thêm hoan hỷ, họ đã thực hiện sự cúng dường và tôn kính lớn lao.
Sopi bhattakiccaṃ katvā avidūraṭṭhāne ekaṃ devāyatanaṃ agamāsi.
Having finished his meal, he went to a shrine located not far away.
Sau khi ăn xong, ông đến một đền thờ thần không xa.
Mahājano tena saddhiṃ eva gantvā taṃ devāyatanaṃ paṭijaggitvā adāsi.
Many people went with him and, having tidied up that shrine, offered it to him.
Đại chúng cũng đi theo ông, dọn dẹp và dâng cúng đền thờ đó cho ông.
So ‘‘ime mayhaṃ cīradhāraṇamatte pasīditvā evaṃvidhaṃ sakkārasammānaṃ karonti, etesaṃ mayā ukkaṭṭhavuttinā bhavituṃ vaṭṭatī’’ti sallahukaparikkhāro appicchova hutvā vihāsi.
He reflected, "These people, being pleased merely by my wearing bark robes, are showing me such great homage and respect. It is fitting for me to live a noble life." So, with light requisites, he lived with few wishes.
Ông nghĩ: “Những người này tin tưởng ta chỉ vì ta mặc vỏ cây và cúng dường, tôn kính ta như vậy. Ta nên sống một đời sống cao thượng hơn vì họ.” Thế là ông sống với ít vật dụng và ít ham muốn.
‘‘Arahā’’ti pana tehi sambhāvīyamāno ‘‘arahā’’ti attānaṃ amaññi, uparūpari cassa sakkāragarukāro abhivaḍḍhi, lābhī ca ahosi uḷārānaṃ paccayānaṃ.
Being honored by them as an Arahant, he considered himself an Arahant. And his homage and veneration increased more and more, and he became one who obtained abundant requisites.
Vì được họ tin là A-la-hán, ông cũng tự cho mình là A-la-hán. Sự tôn kính và trọng vọng dành cho ông ngày càng tăng lên, và ông cũng nhận được nhiều vật dụng thiết yếu quý giá.
Tena vuttaṃ – ‘‘tena kho pana samayena bāhiyo dārucīriyo suppārake paṭivasati samuddatīre sakkato garukato’’tiādi.
Therefore, it is said: " At that time, Bāhiya Dārucīriya was residing in Suppāraka, on the seashore, honored, respected," and so on.
Do đó, có lời dạy: “Vào lúc bấy giờ, Bāhiya Dārucīriya sống ở Suppāraka, trên bờ biển, được tôn kính, trọng vọng,” v.v.
Aparo nayo – sakkatoti sakkārappatto.
Another interpretation: sakkato means: one who has attained honor.
Một cách giải thích khác: sakkato nghĩa là được tôn kính.
Garukatoti garukārappatto.
Garukato means: one who has attained respect.
Garukato nghĩa là được trọng vọng.
Mānitoti bahumānito manasā piyāyito ca.
Mānito means highly esteemed and cherished in mind.
Mānito nghĩa là được kính trọng và yêu mến trong tâm.
Pūjitoti catupaccayābhipūjāya pūjito.
Pūjito means honored with the homage of the four requisites.
Pūjito nghĩa là được cúng dường bằng cách cúng dường bốn vật dụng thiết yếu.
Apacitoti apacāyanappatto.
Apacito means one who has attained respectful veneration.
Apacito nghĩa là được cung kính.
Yassa hi cattāro paccaye sakkatvā suabhisaṅkhate paṇītapaṇīte denti, so sakkato.
Indeed, one to whom the four requisites are given with reverence, being well-prepared and exquisitely excellent, is respected (sakkato).
Người nào được dâng cúng bốn vật dụng thiết yếu cao quý, được chuẩn bị kỹ lưỡng và trang trọng, thì người đó là sakkato.
Yasmiṃ garubhāvaṃ paccupaṭṭhapetvā denti, so garukato.
One to whom gifts are offered with a sense of high esteem is held in high regard (garukato).
Người nào được dâng cúng với thái độ trọng vọng, thì người đó là garukato.
Yaṃ manasā piyāyanti bahumaññanti ca, so mānito.
One who is cherished and greatly admired in mind is honored (mānito).
Người nào được yêu mến và kính trọng trong tâm, thì người đó là mānito.
Yassa sabbampetaṃ pūjanavasena karonti, so pūjito.
One for whom all this is done in the way of veneration is worshipped (pūjito).
Người nào được thực hiện tất cả những điều này với ý niệm cúng dường, thì người đó là pūjito.
Yassa abhivādanapaccuṭṭhānañjalikammādivasena paramanipaccakāraṃ karonti, so apacito.
One to whom the highest reverence is shown through salutation, rising to greet, and the act of respectful anointing, and so on, is venerated (apacito).
Người nào được thực hiện sự cung kính tối thượng bằng cách chào hỏi, đứng dậy đón tiếp, chắp tay, v.v., thì người đó là apacito.
Bāhiyassa pana te sabbametaṃ akaṃsu.
Now, for Bāhiya, they did all of this.
Và những người đó đã làm tất cả những điều này cho Bāhiya.
Tena vuttaṃ – ‘‘bāhiyo dārucīriyo suppārake paṭivasati sakkato’’tiādi.
Therefore, it was said: "Bāhiya Dārucīriya dwells in Suppāraka, respected," and so on.
Do đó, có lời dạy: “Bāhiya Dārucīriya sống ở Suppāraka, được tôn kính,” v.v.
Ettha ca cīvaraṃ so aggaṇhantopi ‘‘ehi, bhante, imaṃ vatthaṃ paṭiggaṇhāhī’’ti upanāmanavasena cīvarassāpi ‘‘lābhī’’tveva vutto.
Here, even though he did not accept robes, he was called "a recipient of robes" due to the manner of offering them with "Come, Venerable Sir, accept this cloth."
Trong đoạn này, mặc dù ông không nhận y phục, nhưng vì người ta dâng cúng y phục với lời: “Bạch Đại đức, xin hãy đến và nhận y phục này,” nên ông vẫn được gọi là “người được lợi lộc” về y phục.
Pubbe kira kassapadasabalassa sāsane osakkamāne sāmaṇerādīnaṃ vippakāraṃ disvā satta bhikkhū saṃvegappattā ‘‘yāva sāsanaṃ na antaradhāyati, tāva attano patiṭṭhaṃ karissāmā’’ti suvaṇṇacetiyaṃ vanditvā araññaṃ paviṭṭhā ekaṃ pabbataṃ disvā ‘‘jīvite sālayā nivattantu, nirālayā imaṃ pabbataṃ abhiruhantū’’ti vatvā nisseṇiṃ bandhitvā sabbe taṃ pabbataṃ abhiruyha nisseṇiṃ pātetvā samaṇadhammaṃ kariṃsu.
It is said that previously, during the time when the Dispensation of Kassapa, the Lord of Ten Powers, was declining, seven bhikkhus, seeing the misconduct of novice monks and others, were struck with spiritual urgency. They resolved, "Before the Dispensation vanishes, we will establish our own foundation." After venerating the golden stūpa, they entered the forest. Seeing a certain mountain, they said, "Let those who are attached to life turn back; let those who are unattached ascend this mountain." They then set up a ladder, all ascended the mountain, and after discarding the ladder, they practiced the ascetic life.
Nghe nói, trước kia, trong giáo pháp của Đức Kassapa Thập Lực, khi thấy sự suy thoái của giáo pháp và những hành vi sai trái của các Sa-di, v.v., bảy vị Tỳ-khưu đã cảm thấy xúc động và nghĩ: “Chừng nào giáo pháp chưa biến mất, chúng ta hãy tự lập chỗ nương tựa cho mình.” Sau khi đảnh lễ bảo tháp vàng, họ đi vào rừng, thấy một ngọn núi, liền nói: “Những ai còn chấp thủ vào sự sống hãy quay lại, những ai không chấp thủ hãy leo lên ngọn núi này.” Sau đó, họ buộc thang, tất cả đều leo lên núi, rồi hạ thang xuống và thực hành đời sống Sa-môn.
Tesu saṅghatthero ekarattātikkameneva arahattaṃ pāpuṇi.
Among them, the senior bhikkhu in the Saṅgha attained arahantship within a single night.
Trong số đó, vị Tăng-thượng tọa đã đạt A-la-hán quả chỉ sau một đêm.
So uttarakuruto piṇḍapātaṃ ānetvā te bhikkhū, ‘‘āvuso, ito piṇḍapātaṃ paribhuñjathā’’ti āha.
He brought alms-food from Uttarakuru and said to the other bhikkhus, "Friends, eat alms-food from here."
Vị ấy mang bát cơm từ Uttarakuru về và nói với các Tỳ-khưu kia: “Này chư hiền, hãy thọ dụng bát cơm này.”
Te ‘‘tumhe, bhante, attano ānubhāvena evaṃ akattha, mayampi sace tumhe viya visesaṃ nibbattessāma, sayameva āharitvā bhuñjissāmā’’ti bhuñjituṃ na icchiṃsu.
They replied, "Venerable Sir, you did this through your own power. If we also achieve a special attainment like you, we will bring it ourselves and eat." Thus, they did not wish to eat.
Các vị ấy không muốn thọ dụng, nói: “Bạch Đại đức, Đại đức đã làm được điều này bằng thần thông của mình. Nếu chúng con cũng đạt được những thành tựu đặc biệt như Đại đức, chúng con sẽ tự mình mang về và thọ dụng.”
Tato dutiyadivase dutiyatthero anāgāmiphalaṃ pāpuṇi, sopi tatheva piṇḍapātaṃ ādāya tattha gantvā itare nimantesi, tepi tatheva paṭikkhipiṃsu.
Then, on the second day, the second elder attained the fruit of anāgāmiphala. He also took alms-food in the same way, went there, and invited the others, but they likewise refused.
Sau đó, vào ngày thứ hai, vị Tỳ-khưu trưởng lão thứ hai đạt được quả Anāgāmī. Ngài cũng như vậy, mang bát cơm khất thực đến đó và mời các vị Tỳ-khưu còn lại. Các vị ấy cũng như vậy, từ chối.
Tesu arahattappatto parinibbāyi, anāgāmī suddhāvāsabhūmiyaṃ nibbatti.
Among them, the one who attained arahantship attained parinibbāna, and the anāgāmī was reborn in the Pure Abodes.
Trong số đó, vị đạt Arahant đã nhập Niết-bàn, vị Anāgāmī tái sinh vào cõi Tịnh Cư thiên (Suddhāvāsa).
Itare pana pañca janā ghaṭentā vāyamantāpi visesaṃ nibbattetuṃ nāsakkhiṃsu.
The other five, however, despite striving and exerting themselves, were unable to achieve any special attainment.
Năm vị còn lại, dù đã cố gắng và nỗ lực, cũng không thể chứng đắc được bất cứ pháp đặc biệt nào.
Te asakkontā tattheva parisussitvā devaloke nibbattā.
Being unsuccessful, they wasted away there and were reborn in the celestial realms.
Vì không thể chứng đắc, các vị ấy đã chết ngay tại đó và tái sinh vào cõi chư thiên.
Ekaṃ buddhantaraṃ devesuyeva saṃsaritvā imasmiṃ buddhuppāde devalokato cavitvā tattha tattha kulaghare nibbattiṃsu.
After wandering through the celestial realms for one Buddha-interval, they passed away from the heavens during the arising of this Buddha and were reborn in various noble families.
Sau khi luân hồi trong cõi chư thiên suốt một thời kỳ giữa hai Đức Phật, trong thời kỳ Đức Phật này xuất hiện, các vị ấy đã từ bỏ cõi chư thiên và tái sinh vào các gia đình khác nhau.
Tesu hi eko pakkusāti rājā ahosi, eko kumārakassapo, eko dabbo mallaputto, eko sabhiyo paribbājako, eko bāhiyo dārucīriyo.
Among them, one became King Pakkusāti, one Kumārakassapa, one Dabba Mallaputta, one Sabhiya the Wanderer, and one Bāhiya Dārucīriya.
Trong số đó, một vị là vua Pakkusāti, một vị là Kumārakassapa, một vị là Dabba Mallaputta, một vị là Sabhiya Paribbājaka, và một vị là Bāhiya Dārucīriya.
Tattha yo so anāgāmī brahmaloke nibbatto, taṃ sandhāyetaṃ vuttaṃ ‘‘purāṇasālohitā devatā’’ti.
Referring to that anāgāmī who was reborn in the Brahmā realm, it is said, " a deity who was a former relative (purāṇasālohitā devatā). "
Trong số đó, vị Anāgāmī tái sinh vào cõi Phạm thiên, liên quan đến vị ấy mà lời này được nói: "vị thiên nhân thân quyến cũ".
Devaputtopi hi devadhītā viya devo eva devatāti katvā devatāti vuccati ‘‘atha kho aññatarā devatā’’tiādīsu viya.
Even a son of a deity (devaputta) is called a deity (devatā) just as a daughter of a deity is called a deity, for the deity is indeed a god, as in phrases like "Then a certain deity" and so on.
Một thiên tử cũng được gọi là thiên nhân (devatā), giống như một thiên nữ, vì là một vị trời (deva), như trong các câu "Rồi một thiên nhân nào đó" v.v.
Idha pana brahmā devatāti adhippeto.
Here, however, Brahmā is intended as the deity.
Tuy nhiên, ở đây, Phạm thiên được hiểu là devatā.
Tassa hi brahmuno tattha nibbattasamanantarameva attano brahmasampattiṃ oloketvā āgataṭṭhānaṃ āvajjentassa sattannaṃ janānaṃ pabbataṃ āruyha samaṇadhammakaraṇaṃ, tatthekassa parinibbutabhāvo, anāgāmiphalaṃ patvā attano ca ettha nibbattabhāvo upaṭṭhāsi.
Immediately after that Brahmā was reborn there, while contemplating his own Brahmā-splendor and reflecting on the place from which he had come, the following came to his mind: the seven individuals ascending the mountain and practicing the ascetic life, one of them attaining parinibbāna, and his own rebirth there after attaining the anāgāmiphala.
Ngay sau khi vị Phạm thiên ấy tái sinh ở đó, khi nhìn lại sự giàu sang của mình và hồi tưởng về nơi mình đã đến, Ngài nhớ lại việc bảy vị đã leo lên núi và thực hành pháp Sa-môn, việc một vị đã nhập Niết-bàn ở đó, và việc chính Ngài đã đạt quả Anāgāmī và tái sinh ở đây.
So ‘‘kattha nu kho itare pañca janā’’ti āvajjento kāmāvacaradevaloke tesaṃ nibbattabhāvaṃ ñatvā aparabhāge kālānukālaṃ ‘‘kinnu kho karontī’’ti tesaṃ pavattiṃ oloketiyeva.
Reflecting on "Where are the other five individuals now?", he learned of their rebirth in the sensual celestial realms. Later, from time to time, he would observe their activities, thinking, "What are they doing now?"
Ngài tự hỏi: "Năm vị kia hiện đang ở đâu?", và khi biết rằng họ đã tái sinh vào cõi chư thiên dục giới, Ngài vẫn tiếp tục theo dõi diễn biến của họ theo thời gian, tự hỏi: "Họ đang làm gì vậy?".
Imasmiṃ pana kāle ‘‘kahaṃ nu kho’’ti āvajjento bāhiyaṃ suppārakapaṭṭanaṃ upanissāya dārucīradhāriṃ kohaññena jīvikaṃ kappentaṃ disvā ‘‘ayaṃ mayā saddhiṃ pubbe nisseṇiṃ bandhitvā pabbataṃ abhiruhitvā samaṇadhammaṃ karonto atisallekhavuttiyā jīvite anapekkho arahatāpi ābhataṃ piṇḍapātaṃ aparibhuñjitvā idāni sambhāvanādhippāyo anarahāva arahattaṃ paṭijānitvā vicarati lābhasakkārasilokaṃ nikāmayamāno, dasabalassa ca nibbattabhāvaṃ na jānāti, handa naṃ saṃvejetvā buddhuppādaṃ jānāpessāmī’’ti tāvadeva brahmalokato otaritvā rattibhāge suppārakapaṭṭane dārucīriyassa sammukhe pāturahosi.
At this particular time, upon reflecting "Where is he now?", he saw Bāhiya, living near the port town of Suppāraka, wearing a bark-garment and earning a living by boasting. He thought, "This Bāhiya, who formerly, along with me, tied a ladder, ascended the mountain, and practiced the ascetic life with an extremely austere livelihood, unconcerned about his life, even refusing alms-food brought by an arahant, is now desirous of veneration. Though not an arahant, he claims to be one and wanders about, desiring gain, honor, and fame. He does not even know of the arising of the Lord of Ten Powers. Let me stir him to spiritual urgency and make him aware of the Buddha's arising." Instantly, he descended from the Brahmā realm and appeared before Bāhiya Dārucīriya in the port town of Suppāraka during the night.
Vào thời điểm này, khi tự hỏi: "Họ đang ở đâu vậy?", Ngài thấy Bāhiya đang sống gần cảng Suppāraka, mặc vỏ cây và kiếm sống bằng nghề lừa đảo. Ngài nghĩ: "Người này, cùng với ta, đã từng leo lên núi bằng cách buộc thang và thực hành pháp Sa-môn. Khi ấy, ông ta sống một đời sống vô cùng thanh đạm, không màng đến mạng sống, thậm chí không thọ dụng bát cơm khất thực do một Arahant mang đến. Bây giờ, ông ta lại muốn được tôn kính, dù không phải Arahant nhưng lại tự xưng là Arahant và đi đây đó, khao khát danh lợi, cung kính, và tiếng tăm. Ông ta lại không biết rằng Đức Thập Lực đã xuất hiện trên thế gian. Thôi, ta hãy làm cho ông ta kinh hãi và cho ông ta biết về sự xuất hiện của Đức Phật." Ngay lập tức, Ngài từ cõi Phạm thiên giáng xuống và xuất hiện trước mặt Bāhiya Dārucīriya tại cảng Suppāraka vào ban đêm.
Bāhiyo attano vasanaṭṭhāne uḷāraṃ obhāsaṃ disvā ‘‘kiṃ nu kho eta’’nti bahi nikkhamitvā olokento ākāse ṭhitaṃ mahābrahmānaṃ disvā añjaliṃ paggayha ‘‘ke tumhe’’ti pucchi.
Bāhiya, seeing a splendid radiance in his dwelling place, stepped outside, thinking, "What could this be?" As he looked, he saw the Great Brahmā standing in the sky. He raised his hands in salutation and asked, "Who are you?"
Bāhiya thấy ánh sáng rực rỡ trong nơi mình ở, tự hỏi: "Cái gì vậy?", rồi đi ra ngoài nhìn lên, thấy vị Đại Phạm thiên đứng trên không trung, bèn chắp tay hỏi: "Ngài là ai?".
Athassa so brahmā ‘‘ahaṃ te porāṇakasahāyo tadā anāgāmiphalaṃ patvā brahmaloke nibbatto, tvaṃ pana kiñci visesaṃ nibbattetuṃ asakkonto tadā puthujjanakālakiriyaṃ katvā saṃsaranto idāni titthiyavesadhārī anarahāva samāno ‘arahā aha’nti imaṃ laddhiṃ gahetvā vicarasīti ñatvā āgato, neva kho tvaṃ, bāhiya, arahā, paṭinissajjetaṃ pāpakaṃ diṭṭhigataṃ, mā te ahosi dīgharattaṃ ahitāya dukkhāya, sammāsambuddho loke uppanno.
Then that Brahmā said to him, "I am your old companion who, at that time, attained the anāgāmiphala and was reborn in the Brahmā realm. As for you, being unable to achieve any special attainment then, you died as a worldling and have been wandering in transmigration. Now, wearing the garb of a sectarian, you, who are not an arahant, have adopted this doctrine, thinking 'I am an arahant,' and wander about. Knowing this, I have come. Indeed, Bāhiya, you are not an arahant. Abandon this evil wrong view, lest it lead to your harm and suffering for a long time. A Perfectly Enlightened Buddha has arisen in the world.
Vị Phạm thiên ấy nói với ông ta: "Ta là người bạn cũ của ngươi. Khi ấy, ta đã đạt quả Anāgāmī và tái sinh vào cõi Phạm thiên. Còn ngươi, vì không thể chứng đắc được pháp đặc biệt nào, đã chết như một phàm nhân và luân hồi. Bây giờ, ngươi lại mang hình dáng của một ngoại đạo, dù không phải Arahant nhưng lại giữ tà kiến này, tự xưng là Arahant và đi đây đó. Ta đã biết điều đó nên đến đây. Này Bāhiya, ngươi không phải là Arahant. Hãy từ bỏ tà kiến xấu xa ấy, đừng để nó gây hại và khổ đau cho ngươi lâu dài. Một vị Chánh Đẳng Giác đã xuất hiện trên thế gian.
So hi bhagavā arahā, gaccha naṃ payirupāsassū’’ti āha.
That Blessed One is indeed an arahant. Go and attend upon him."
Chính Đức Thế Tôn ấy là Arahant. Hãy đi và đến gần Ngài để phụng sự."
Tena vuttaṃ – ‘‘atha kho bāhiyassa dārucīriyassa purāṇasālohitā devatā’’tiādi.
Therefore, it was said: " Then a deity, a former relative of Bāhiya Dārucīriya," and so on.
Do đó, lời này được nói: "Rồi một thiên nhân thân quyến cũ của Bāhiya Dārucīriya" v.v.
Tattha anukampikāti anuggahasīlā karuṇādhikā.
Here, anukampikā means compassionate, predisposed to kindness.
Trong đó, anukampikā có nghĩa là có lòng giúp đỡ, giàu lòng bi mẫn.
Atthakāmāti hitakāmā mettādhikā.
Atthakāmā means wishing for welfare, predisposed to loving-kindness.
Atthakāmā có nghĩa là mong muốn lợi ích, giàu lòng từ ái.
Purimapadena cettha bāhiyassa dukkhāpanayanakāmataṃ tassā devatāya dasseti, pacchimena hitūpasaṃhāraṃ.
With the former term, the deity's desire to alleviate Bāhiya's suffering is shown, and with the latter, her bringing of benefit.
Ở đây, với từ đầu tiên, vị thiên nhân ấy thể hiện mong muốn loại bỏ khổ đau cho Bāhiya, và với từ sau cùng, thể hiện việc mang lại lợi ích cho ông ta.
Cetasāti attano cittena, cetosīsena cettha cetopariyañāṇaṃ gahitanti veditabbaṃ.
Cetasā means with one's own mind. It should be understood that here, by cetosīsa (the mind as principal), mind-penetrating knowledge (cetopariyañāṇa) is intended.
Cetasā có nghĩa là bằng tâm của chính mình. Ở đây, cần hiểu rằng với từ cetosīsena (tâm làm gốc), cetopariyañāṇa (tâm thông trí) được hàm ý.
Cetoparivitakkanti tassa cittappavattiṃ.
Cetoparivitakkaṃ means the course of his mind.
Cetoparivitakkaṃ có nghĩa là sự vận hành của tâm ông ta.
Aññāyāti jānitvā.
Aññāya means having known.
Aññāyā có nghĩa là đã biết.
Tenupasaṅkamīti seyyathāpi nāma balavā puriso samiñjitaṃ vā bāhaṃ pasāreyya, pasāritaṃ vā bāhaṃ samiñjeyya, evameva brahmaloke antarahito bāhiyassa purato pātubhavanavasena upasaṅkami.
Tenupasaṅkamī means, just as a strong man might extend a bent arm or bend an extended arm, even so, having vanished from the Brahma-world, he appeared before Bāhiya by way of manifesting himself.
Tenupasaṅkamī có nghĩa là đã đến gần, giống như một người đàn ông mạnh mẽ có thể duỗi cánh tay đang co lại hoặc co lại cánh tay đang duỗi ra, vị Phạm thiên ấy cũng như vậy, biến mất khỏi cõi Phạm thiên và xuất hiện trước mặt Bāhiya.
Etadavocāti ‘‘ye kho keci loke arahanto vā’’tiādipavattamicchāparivitakkaṃ bāhiyaṃ sahoḍhaṃ coraṃ gaṇhanto viya ‘‘neva kho tvaṃ, bāhiya, arahā’’tiādikaṃ etaṃ idāni vuccamānavacanaṃ brahmā avoca.
Etadavocā means that Brahmā, like someone catching a thief with his possessions, spoke these words to Bāhiya, whose mind was filled with the mistaken thought, "Indeed, whatever Arahants there are in the world…" beginning with "You are certainly not an Arahant, Bāhiya," and so forth, the words now being stated.
Etadavocā có nghĩa là vị Phạm thiên đã nói những lời này, như sắp nói, bắt lấy Bāhiya với tà kiến sai lầm về sự vận hành của tâm, tự cho rằng "những ai là Arahant trên thế gian" v.v., giống như bắt một tên trộm với vật chứng, nói: "Này Bāhiya, ngươi không phải là Arahant" v.v.
Neva kho tvaṃ, bāhiya, arahāti etena tadā bāhiyassa asekkhabhāvaṃ paṭikkhipati, nāpi arahattamaggaṃ vā samāpannoti etena sekkhabhāvaṃ, ubhayenapissa anariyabhāvameva dīpeti.
With "You are certainly not an Arahant, Bāhiya," he denies Bāhiya's asekha status at that time; with "nor are you one who has entered the path to Arahantship," he denies his sekha status, thereby indicating his non-Noble status by both statements.
Với câu "Này Bāhiya, ngươi không phải là Arahant", Ngài phủ nhận việc Bāhiya là bậc Vô Học (Asekkhā). Với câu "cũng không phải là người đã nhập Arahant-magga (đạo Arahant)", Ngài phủ nhận việc Bāhiya là bậc Hữu Học (Sekkhā). Với cả hai câu, Ngài chỉ ra rằng Bāhiya không phải là bậc Thánh.
Sāpi te paṭipadā natthi, yāya tvaṃ arahā vā assa arahattamaggaṃ vā samāpannoti iminā panassa kalyāṇaputhujjanabhāvampi paṭikkhipati.
With "That practice is also not yours, by which you would be an Arahant or one who has entered the path to Arahantship," he also denies him even the status of a Noble Worldling (kalyāṇaputhujjana).
Với câu "Ngươi cũng không có con đường thực hành nào mà nhờ đó ngươi có thể là Arahant hoặc là người đã nhập Arahant-magga", Ngài phủ nhận cả việc Bāhiya là một phàm nhân thiện lành.
Tattha paṭipadāti sīlavisuddhiādayo cha visuddhiyo.
Here, paṭipadā refers to the six purifications (visuddhi) beginning with purification of morality (sīlavisuddhi).
Trong đó, paṭipadā là sáu sự thanh tịnh như giới thanh tịnh (sīlavisuddhi) v.v.
Paṭipajjati etāya ariyamaggeti paṭipadā.
It is called paṭipadā because one practices by means of it to the Noble Path.
Con đường mà nhờ đó người ta thực hành để đạt đến Thánh đạo (ariyamagga) được gọi là paṭipadā.
Assāti bhaveyyāsi.
Assā means 'you would be'.
Assā có nghĩa là ngươi sẽ là.
Ayañcassa arahattādhimāno kiṃ nissāya uppannoti?
"Based on what did this overestimation of Arahantship arise in him?"
Sự kiêu mạn tự cho là Arahant của ông ta phát sinh dựa trên điều gì?
‘‘Appicchatāya santuṭṭhitāya sallekhatāya dīgharattaṃ katādhikārattā tadaṅgappahānavasena kilesānaṃ vihatattā arahattādhimāno uppanno’’ti keci vadanti.
Some say, "The overestimation of Arahantship arose due to his being of few wishes, content, austere, having made aspirations for a long time, and having suppressed defilements by way of temporary abandonment (tadaṅgappahāna)."
Một số người nói rằng: "Sự kiêu mạn tự cho là Arahant phát sinh do ông ta có ít dục vọng, biết đủ, sống thanh đạm, đã tạo công đức lâu dài, và các phiền não đã bị loại bỏ tạm thời."
Apare panāhu ‘‘bāhiyo paṭhamādijhānacatukkalābhī, tasmāssa vikkhambhanappahānena kilesānaṃ asamudācārato arahattādhimāno uppajjatī’’ti.
Others, however, say, "Bāhiya had attained the four jhānas starting from the first, therefore, his overestimation of Arahantship arose because the defilements were not aroused due to suppression by vikkhambhana."
Một số người khác lại nói: "Bāhiya là người đạt được bốn tầng thiền đầu tiên, do đó, sự kiêu mạn tự cho là Arahant phát sinh do các phiền não không còn khởi lên nhờ sự đoạn trừ bằng cách trấn áp (vikkhambhanappahāna)."
Tadubhayampi tesaṃ matimattameva ‘‘sambhāvanādhippāyo lābhasakkārasilokaṃ nikāmayamāno’’ti ca aṭṭhakathāyaṃ āgatattā.
Both of these are merely their own opinions, because it is stated in the commentary that he was "desirous of praise, gain, honor, and fame, with the intention of glorification."
Cả hai điều đó đều chỉ là ý kiến của họ, vì trong Chú giải có nói: "ông ta khao khát danh lợi, cung kính, và tiếng tăm, mong muốn được tôn kính."
Tasmā vuttanayenevettha attho veditabbo.
Therefore, the meaning here should be understood according to the stated method.
Do đó, ý nghĩa ở đây cần được hiểu theo cách đã nói.
Arahanti ārakattā arahaṃ.
Arahaṃ means 'worthy' because of being far away.
Arahant có nghĩa là bậc Arahant vì Ngài ở xa (các phiền não).
Ārakā hi so sabbakilesehi suvidūravidūre ṭhito maggena savāsanānaṃ kilesānaṃ viddhaṃsitattā.
For he stands far, far away from all defilements, having destroyed the defilements with their latent tendencies (vāsana) by means of the path.
Quả thật, Ngài ở rất xa, xa nhất khỏi tất cả các phiền não, vì Ngài đã tiêu diệt các phiền não cùng với các khuynh hướng tiềm ẩn (vāsana) bằng Thánh đạo.
Arīnaṃ vā hatattā arahaṃ.
Or he is an Arahant because he has slain the enemies (ari).
Hoặc Ngài là Arahant vì đã tiêu diệt kẻ thù (phiền não).
Bhagavatā hi kilesārayo anavasesato ariyamaggena hatā samucchinnāti.
For the Blessed One utterly destroyed and cut off the enemy of defilements completely by the Noble Path.
Quả thật, Đức Thế Tôn đã tiêu diệt hoàn toàn các phiền não là kẻ thù bằng Thánh đạo.
Arānaṃ vā hatattā arahaṃ.
Or he is an Arahant because he has destroyed the spokes (ara).
Hoặc Ngài là Arahant vì đã phá hủy các nan hoa (của bánh xe luân hồi).
Yañca avijjābhavataṇhāmayanābhi puññādiabhisaṅkhārāraṃ jarāmaraṇanemi āsavasamudayamayena akkhena vijjhitvā tibhavarathe samāyojitaṃ anādikālappavattaṃ saṃsāracakkaṃ.
Which is the wheel of saṃsāra, set in motion from time immemorial, joined to the three-fold existence chariot by an axle made of the arising of āsavas, having a rim of old age and death, and spokes of meritorious formations (puññābhisaṅkhāra) and so forth, with a nave made of ignorance, existence, and craving.
Và bánh xe luân hồi, đã vận hành từ vô thủy, được gắn vào cỗ xe tam giới bằng trục là sự tập khởi của các lậu hoặc (āsava), với vành là già chết, và các nan hoa là các hành thiện (puññābhisaṅkhāra) v.v., với rốn là vô minh và ái dục hữu.
Tassānena bodhimaṇḍe vīriyapādehi sīlapathaviyaṃ patiṭṭhāya saddhāhatthena kammakkhayakarañāṇapharasuṃ gahetvā sabbepi arā hatā vihatā viddhaṃsitāti.
By him, on the Bodhi-maṇḍa, standing firm on the ground of morality with the feet of energy, and taking the axe of wisdom that ends kamma with the hand of faith, all the spokes were struck, destroyed, and shattered.
Đức Thế Tôn đã đứng vững trên nền tảng giới hạnh (sīlapathaviyaṃ) với đôi chân tinh tấn (vīriyapādehi) tại Bồ-đề đạo tràng (bodhimaṇḍa), cầm chiếc rìu trí tuệ (ñāṇapharasuṃ) bằng bàn tay tín tâm (saddhāhatthena), và đã phá hủy, tiêu diệt, và đập tan tất cả các nan hoa ấy.
Arahatīti vā arahaṃ.
Or, he is an Arahant because he is worthy (arahati).
Hoặc Ngài là Arahant vì Ngài xứng đáng.
Bhagavā hi sadevake loke aggadakkhiṇeyyattā uḷāre cīvarādipaccaye pūjāvisesañca arahati.
For the Blessed One is worthy of supreme offerings, such as robes and other requisites, and special veneration, being the foremost recipient of gifts in the world of gods and humans.
Thật vậy, Thế Tôn là bậc đáng được cúng dường tối thượng trong thế gian cùng với chư thiên, nên Ngài xứng đáng nhận các vật dụng cao quý như y phục và sự cúng dường đặc biệt.
Rahābhāvato vā arahaṃ.
Or, he is an Arahant because there is no secrecy (rahābhāvato).
Hoặc Ngài là A-la-hán vì không có nơi bí mật (rahābhāvato).
Tathāgato hi sabbaso samucchinnarāgādikilesattā pāpakilesassāpi asambhavato pāpakaraṇe rahābhāvatopi arahanti vuccati.
For the Tathāgata is called an Arahant because he has utterly eradicated defilements such as passion, and because there is no possibility of any evil defilement, there is no secrecy in committing evil deeds.
Thật vậy, Như Lai được gọi là A-la-hán vì đã diệt tận hoàn toàn các phiền não như tham ái, nên không thể có bất kỳ phiền não xấu xa nào, và cũng vì không có nơi bí mật để làm điều ác.
Apica kusale dhamme anavajjasukhavipākato, akusale dhamme sāvajjadukkhavipākatotiādinā sabbattikadukādivasena ayamattho netabbo.
Furthermore, this meaning should be understood in terms of the all-inclusive dyads (sabbattikaduka) and so forth: wholesome phenomena as having blameless and pleasant results, unwholesome phenomena as having blameworthy and painful results, and so forth.
Hơn nữa, ý nghĩa này nên được hiểu theo cách phân loại nhị nguyên, v.v., như: các pháp thiện thì có quả báo an lạc không lỗi lầm, các pháp bất thiện thì có quả báo đau khổ có lỗi lầm, v.v.
Iti aviparītaṃ sayambhuñāṇena sabbākārato sabbadhammānaṃ abhisambuddhattā sammāsambuddhoti ayamettha saṅkhepo.
Thus, this is the summary here: He is the Sammāsambuddha because he fully comprehended all phenomena in every aspect, correctly, by his own self-originated knowledge.
Tóm lại, do đã tự mình thấu triệt tất cả các pháp một cách không sai lệch, bằng trí tuệ tự sinh, dưới mọi phương diện, nên Ngài là Sammāsambuddha.
Vitthāro pana visuddhimagge (visuddhi. 1.129-131) āgatanayeneva veditabbo.
The detailed explanation, however, should be understood according to the method found in the Visuddhimagga.
Tuy nhiên, phần giải thích chi tiết nên được hiểu theo phương pháp đã nêu trong Thanh Tịnh Đạo (Visuddhimagga).
Arahattāyāti aggaphalappaṭilābhāya.
Arahattāya means 'for the attainment of the highest fruit' (Arahantship).
Arahattāyā nghĩa là để đạt được quả tối thượng (quả A-la-hán).
Dhammaṃ desetīti ādikalyāṇādiguṇavisesayuttaṃ sīlādipaṭipadādhammaṃ samathavipassanādhammameva vā veneyyajjhāsayānurūpaṃ upadisati katheti.
Dhammaṃ deseti means he teaches and explains the Dhamma of practice, such as morality, endowed with excellent qualities like being good in the beginning, or merely the Dhamma of tranquility and insight, in accordance with the dispositions of those who are to be guided.
Dhammaṃ deseti nghĩa là Ngài thuyết giảng và chỉ dạy giáo pháp về con đường thực hành giới, v.v., có những đặc tính tốt đẹp như ban đầu, v.v., hoặc chỉ là giáo pháp về samatha và vipassanā, phù hợp với khuynh hướng của những người có thể giáo hóa.
Saṃvejitoti ‘‘dhiratthu vata, bho, puthujjanabhāvassa, yenāhaṃ anarahāva samāno arahāti amaññiṃ, sammāsambuddhañca loke uppajjitvā dhammaṃ desentaṃ na jāniṃ, dujjānaṃ kho panidaṃ jīvitaṃ, dujjānaṃ maraṇa’’nti saṃvegamāpādito, devatāvacanena yathāvuttenākārena saṃviggamānasoti attho.
Saṃvejito means 'stirred to spiritual urgency', having been made to experience a sense of urgency, as if thinking, "Fie upon the state of being a worldling, by which I, though not an Arahant, imagined myself to be one, and did not recognize the Perfectly Self-Enlightened One who arose in the world and taught the Dhamma! Indeed, this life is difficult to know, and death is difficult to know!" This means he was stirred in his mind by the words of the deity in the manner described.
Saṃvejito nghĩa là được thúc đẩy bởi sự xúc động, như: “Ôi! Thật đáng hổ thẹn cho thân phận phàm phu, vì ta đã tự cho mình là A-la-hán trong khi chưa phải là A-la-hán, và khi một vị Sammāsambuddha xuất hiện trên thế gian thuyết giảng giáo pháp, ta lại không biết. Quả thật, cuộc sống này khó biết, cái chết này cũng khó biết.” Tức là, tâm của Bāhiya đã được xúc động theo cách đã nói bởi lời của vị chư thiên.
Tāvadevāti tasmiṃyeva khaṇe.
Tāvadevā means 'at that very moment'.
Tāvadevā nghĩa là ngay trong khoảnh khắc đó.
Suppārakā pakkāmīti buddhoti nāmamapi savanena uppannāya buddhārammaṇāya pītiyā saṃvegena ca codiyamānahadayo suppārakapaṭṭanato sāvatthiṃ uddissa pakkanto.
Suppārakā pakkāmī means, his heart being urged by the joy that arose from merely hearing the name 'Buddha' and by spiritual urgency, he departed from Suppāraka port, heading for Sāvatthī.
Suppārakā pakkāmī nghĩa là, với trái tim được thúc đẩy bởi niềm hoan hỷ đối với Đức Phật (phát sinh chỉ từ việc nghe danh hiệu Phật) và sự xúc động, Bāhiya đã rời cảng Suppāraka để đi đến Sāvatthī.
Sabbattha ekarattiparivāsenāti sabbasmiṃ magge ekarattivāseneva agamāsi.
Sabbattha ekarattiparivāsenā means he traveled the entire journey, staying only one night at each stop.
Sabbattha ekarattiparivāsenā nghĩa là ông đi suốt cả quãng đường chỉ nghỉ đêm một lần.
Suppārakapaṭṭanato hi sāvatthi vīsayojanasate hoti, tañcāyaṃ ettakaṃ addhānaṃ ekarattivāsena agamāsi.
For Sāvatthī is one hundred and twenty yojanas from Suppāraka port, and he traversed this entire distance by staying only one night (at each stop).
Từ cảng Suppāraka đến Sāvatthī là một trăm hai mươi dojana, và ông đã đi quãng đường dài như vậy chỉ trong một đêm.
Yadā suppārakato nikkhanto, tadaheva sāvatthiṃ sampattoti.
Meaning, when he set out from Suppāraka, he arrived in Sāvatthī on the same day.
Khi ông rời Suppāraka, ông đã đến Sāvatthī ngay trong ngày đó.
Kathaṃ panāyaṃ evaṃ agamāsīti?
"How then did he travel in this manner?"
Làm thế nào ông có thể đi như vậy?
Devatānubhāvena, ‘‘buddhānubhāvenā’’tipi vadanti.
By the power of deities, some also say, "by the power of the Buddha."
Bởi thần lực của chư thiên, một số người nói là “bởi thần lực của Đức Phật.”
‘‘Sabbattha ekarattiparivāsenā’’ti pana vuttattā maggassa ca vīsayojanasatikattā antarāmagge gāmanigamarājadhānīsu yattha yattha rattiyaṃ vasati, tattha tattha dutiyaṃ aruṇaṃ anuṭṭhāpetvā sabbattha ekarattivāseneva sāvatthiṃ upasaṅkamīti ayamattho dīpito hotīti.
However, because it is stated "Sabbattha ekarattiparivāsenā" (staying one night at each place) and because the journey is one hundred and twenty yojanas, the meaning indicated is that he did not allow a second dawn to break wherever he stayed for the night in the villages, towns, and royal capitals along the way, but arrived in Sāvatthī by staying only one night at each place.
Một số người giải thích rằng: “ Sabbattha ekarattiparivāsenā” có nghĩa là vì quãng đường dài một trăm hai mươi dojana, nên ở bất cứ làng mạc, thị trấn hay kinh đô nào trên đường mà ông nghỉ đêm, ông đã không để bình minh thứ hai mọc lên ở đó, mà chỉ nghỉ đêm một lần ở mỗi nơi rồi đến Sāvatthī.
Nayidaṃ evaṃ daṭṭhabbaṃ.
This should not be understood in that way.
Tuy nhiên, điều này không nên được hiểu như vậy.
Sabbasmiṃ vīsayojanasatike magge ekarattivāsenāti imassa atthassa adhippetattā.
Because the intended meaning is that he spent only one night on the entire one hundred and twenty yojana journey.
Vì ý nghĩa được ngụ ý là ông chỉ nghỉ đêm một lần trên toàn bộ quãng đường dài một trăm hai mươi dojana.
Ekarattimattaṃ so sakalasmiṃ tasmiṃ magge vasitvā pacchimadivase pubbaṇhasamaye sāvatthiṃ anuppattoti.
He spent only one night on that entire journey and arrived in Sāvatthī in the forenoon of the last day.
Ông đã nghỉ đêm một lần trên toàn bộ quãng đường đó và đến Sāvatthī vào buổi sáng ngày cuối cùng.
Bhagavāpi bāhiyassa āgamanaṃ ñatvā ‘‘na tāvassa indriyāni paripākaṃ gatāni, khaṇantare pana paripākaṃ gamissantī’’ti tassa indriyānaṃ paripākaṃ āgamayamāno mahābhikkhusaṅghaparivuto tasmiṃ khaṇe sāvatthiṃ piṇḍāya pāvisi.
The Blessed One, knowing of Bāhiya’s arrival, and reflecting, “His faculties are not yet mature, but in a moment, they will mature,” and awaiting the maturation of his faculties, entered Sāvatthī for alms at that very moment, surrounded by a large Saṅgha of bhikkhus.
Đức Thế Tôn, biết được sự đến của Bāhiya và nghĩ rằng: “Các căn của ông ấy chưa chín muồi, nhưng sẽ chín muồi trong chốc lát,” đã chờ đợi sự chín muồi của các căn của ông, và cùng với một đoàn Tỳ-kheo lớn, Ngài đã vào Sāvatthī để khất thực vào lúc đó.
So ca jetavanaṃ pavisitvā bhuttapātarāse kāyālasiyavimocanatthaṃ abbhokāse caṅkamante sambahule bhikkhū passitvā ‘‘kahaṃ nu kho etarahi bhagavā’’ti pucchi.
And Bāhiya, having entered Jetavana, after his morning meal, saw many bhikkhus walking in the open air to relieve the laziness of their bodies, and asked, “Where is the Blessed One now?”
Bāhiya, sau khi vào Tịnh Xá Jetavana và thấy nhiều Tỳ-kheo đang kinh hành ngoài trời để giải tỏa sự uể oải sau bữa sáng, đã hỏi: “Bây giờ Đức Thế Tôn đang ở đâu?”
Bhikkhū ‘‘bhagavā sāvatthiṃ piṇḍāya paviṭṭho’’ti vatvā pucchiṃsu ‘‘tvaṃ pana kuto āgato’’ti?
The bhikkhus said, “The Blessed One has entered Sāvatthī for alms,” and then asked him, “But where have you come from?”
Các Tỳ-kheo nói: “Đức Thế Tôn đã vào Sāvatthī để khất thực,” rồi hỏi: “Còn ông từ đâu đến?”
‘‘Suppārakapaṭṭanato āgatomhī’’ti.
“I have come from Suppāraka Port.”
“Tôi đến từ cảng Suppāraka.”
‘‘Dūrato āgatosi, nisīda, tāva pāde dhovitvā makkhetvā thokaṃ vissamāhi, āgatakāle satthāraṃ dakkhasī’’ti.
“You have come from afar, sit down for a while, wash and anoint your feet, and rest a little. You will see the Teacher when he returns.”
“Ông đã đi một quãng đường xa. Hãy ngồi xuống, rửa chân, thoa dầu và nghỉ ngơi một chút. Khi Đức Đạo Sư trở về, ông sẽ được gặp Ngài.”
‘‘Ahaṃ, bhante, attano jīvitantarāyaṃ na jānāmi, ekarattenevamhi katthacipi ciraṃ aṭṭhatvā anisīditvā vīsayojanasatikaṃ maggaṃ āgato, satthāraṃ passitvāva vissamissāmī’’ti vatvā taramānarūpo sāvatthiṃ pavisitvā anopamāya buddhasiriyā virocamānaṃ bhagavantaṃ passi.
“Venerables, I do not know the danger to my life. I have traveled a distance of one hundred and twenty yojanas in a single night without stopping or sitting anywhere for long. I will rest only after seeing the Teacher,” he said, and hurrying, entered Sāvatthī and saw the Blessed One, radiant with incomparable Buddha-splendor.
Bāhiya nói: “Thưa các Ngài, tôi không biết khi nào sự nguy hiểm đến tính mạng của tôi sẽ xảy ra. Tôi đã đi một quãng đường dài một trăm hai mươi dojana chỉ trong một đêm mà không dừng lại lâu ở bất cứ đâu hay ngồi xuống. Tôi sẽ nghỉ ngơi sau khi gặp Đức Đạo Sư.” Nói vậy, ông vội vã vào Sāvatthī và thấy Đức Thế Tôn đang tỏa sáng với vẻ đẹp Phật vô song.
Tena vuttaṃ ‘‘tena kho pana samayena sambahulā bhikkhū abbhokāse caṅkamanti.
Therefore it is said: “Now at that time, many bhikkhus were walking in the open air.
Vì vậy, đã nói: “Vào lúc đó, có nhiều Tỳ-kheo đang kinh hành ngoài trời.
Atha kho bāhiyo dārucīriyo yena te bhikkhū tenupasaṅkamī’’tiādi.
Then Bāhiya Dārucīriya approached those bhikkhus” and so on.
Rồi Bāhiya Dārucīriya đi đến chỗ các Tỳ-kheo đó,” v.v.
Tattha kahanti kattha.
Therein, ‘kahaṃ’ means ‘where’.
Trong đó, kahaṃ nghĩa là ở đâu.
Nūti saṃsaye, khoti padapūraṇe, kasmiṃ nu kho padeseti attho.
‘Nū’ is for doubt, ‘kho’ is a mere particle; the meaning is, “in what place?”
Nū là một từ nghi vấn, kho là một từ đệm, có nghĩa là ở nơi nào.
Dassanakāmamhāti daṭṭhukāmā amha.
‘Dassanakāmhā’ means ‘we wish to see’.
Dassanakāmamhā nghĩa là chúng tôi muốn thấy.
Mayañhi taṃ bhagavantaṃ andho viya cakkhuṃ, badhiro viya sotaṃ, mūgo viya kalyāṇavākkaraṇaṃ, hatthapādavikalo viya hatthapāde, daliddo viya dhanasampadaṃ, kantāraddhānappaṭipanno viya khemantabhūmiṃ, rogābhibhūto viya ārogyaṃ, mahāsamudde bhinnanāvo viya mahākullaṃ passituṃ upasaṅkamituñca icchāmāti dasseti.
This indicates, "We wish to see and approach that Blessed One, just as a blind person desires eyes, a deaf person desires ears, a mute person desires good speech, one with disabled hands and feet desires hands and feet, a pauper desires wealth, a traveler in a wilderness desires a safe land, a sick person desires health, or those whose ship has broken in the great ocean desire a large raft."
Chúng tôi muốn thấy và đến gần Đức Thế Tôn đó, như người mù muốn có mắt, người điếc muốn có tai, người câm muốn có lời nói tốt đẹp, người tàn tật tay chân muốn có tay chân, người nghèo muốn có tài sản, người đi lạc trên đường hoang muốn đến nơi an toàn, người bệnh muốn có sức khỏe, người bị đắm tàu giữa đại dương muốn có một chiếc bè lớn.
Taramānarūpoti taramānākāro.
‘Taramānarūpo’ means ‘in a hurrying manner’.
Taramānarūpo nghĩa là với vẻ vội vã.
Pāsādikanti bāttiṃsamahāpurisalakkhaṇaasītianubyañjanabyāmappabhāketumālālaṅkatāya samantapāsādikāya attano sarīrasobhāsampattiyā rūpakāyadassanabyāvaṭassa janassa sabbabhāgato pasādāvahaṃ.
‘Pāsādikaṃ’ means inspiring serene joy in people engaged in seeing his physical body, from all aspects, due to the perfection of his bodily beauty, adorned with the thirty-two marks of a great man, the eighty minor characteristics, and an aura of light a fathom in width and a halo-like radiance.
Pāsādikaṃ nghĩa là làm cho mọi người chú tâm chiêm ngưỡng thân tướng Ngài đều hoan hỷ từ mọi phía, nhờ sự trang nghiêm của thân tướng Ngài, được trang hoàng bằng ba mươi hai tướng tốt của bậc Đại nhân, tám mươi tướng phụ, hào quang một tầm và vầng sáng trên đỉnh đầu.
Pasādanīyanti dasabalacatuvesārajjachaasādhāraṇañāṇaaṭṭhārasāveṇika- buddhadhammappabhutiaparimāṇaguṇagaṇasamannāgatāya dhammakāyasampattiyā sarikkhakajanassa pasādanīyaṃ pasīditabbayuttaṃ pasādārahaṃ vā.
‘Pasādanīyaṃ’ means inspiring serene joy in those of similar disposition, worthy of confidence, due to the perfection of his Dhamma-body, endowed with innumerable qualities such as the ten powers, the four kinds of self-confidence, the six unique knowledges, and the eighteen Buddha-dhamma.
Pasādanīyaṃ nghĩa là đáng được những người cùng chí hướng hoan hỷ hoặc đáng được hoan hỷ, nhờ sự viên mãn của Pháp thân, được đầy đủ vô lượng công đức như mười lực, bốn vô úy, sáu trí tuệ bất cộng và mười tám Phật pháp đặc biệt.
Santindriyanti cakkhādipañcindriyalolabhāvāpagamanena vūpasantapañcindriyaṃ.
‘Santindriyaṃ’ means having the five faculties, such as the eye, tranquilized, due to the cessation of their wavering and unsteadiness.
Santindriyaṃ nghĩa là các căn đã an tịnh, do đã từ bỏ sự buông thả của năm căn như mắt, v.v.
Santamānasanti chaṭṭhassa manindriyassa nibbisevanabhāvūpagamanena vūpasantamānasaṃ.
‘Santamānasaṃ’ means having a tranquil mind, due to the sixth faculty, the mind, having attained a state of non-indulgence.
Santamānasaṃ nghĩa là tâm đã an tịnh, do đã đạt đến trạng thái không còn sự phục tùng của căn ý thứ sáu.
Uttamadamathasamathamanuppattanti lokuttarapaññāvimutticetovimuttisaṅkhātaṃ uttamaṃ damathaṃ samathañca anuppatvā adhigantvā ṭhitaṃ.
‘Uttamadamathasamathamanuppattaṃ’ means having attained and established in the supreme taming (damatha) and tranquility (samatha), which are called supramundane wisdom-liberation and mind-liberation.
Uttamadamathasamathamanuppattaṃ nghĩa là đã đạt được sự điều phục và an tịnh tối thượng, tức là trí tuệ siêu thế, giải thoát tâm và giải thoát tuệ.
Dantanti suparisuddhakāyasamācāratāya ceva hatthapādakukkuccābhāvato davādiabhāvato ca kāyena dantaṃ.
‘Dantaṃ’ means tamed in body, due to utterly purified bodily conduct, absence of fidgeting of hands and feet, and absence of frivolous behavior.
Dantaṃ nghĩa là đã được điều phục về thân, nhờ sự thanh tịnh tuyệt đối trong oai nghi thân và không có sự bồn chồn của tay chân, cũng như không có sự vui đùa, v.v.
Guttanti suparisuddhavacīsamācāratāya ceva niratthakavācābhāvato davādiabhāvato ca vācāya guttaṃ.
‘Guttaṃ’ means guarded in speech, due to utterly purified verbal conduct, absence of useless speech, and absence of frivolous and erratic behavior.
Guttaṃ nghĩa là đã được bảo vệ về lời nói, nhờ sự thanh tịnh tuyệt đối trong oai nghi lời nói và không có lời nói vô ích, cũng như không có sự vui đùa, v.v.
Yatindriyanti suparisuddhamanosamācāratāya ariyiddhiyogena abyāvaṭaappaṭisaṅkhānupekkhābhāvato ca manindriyavasena yatindriyaṃ.
‘Yatindriyaṃ’ means controlled in faculties, specifically the mind-faculty, due to utterly purified mental conduct, and being unconcerned and indifferent through Aryan psychic power, without being preoccupied with non-reflection.
Yatindriyaṃ nghĩa là các căn đã được chế ngự về ý căn, nhờ sự thanh tịnh tuyệt đối trong oai nghi ý và không có sự xao lãng hay xả bỏ không suy xét do sự kết hợp với thần thông của bậc Thánh.
Nāganti chandādivasena agamanato, pahīnānaṃ rāgādikilesānaṃ punānāgamanato, kassacipi āgussa sabbathāpi akaraṇato, punabbhavassa ca agamanatoti imehi kāraṇehi nāgaṃ.
‘Nāgaṃ’ means a nāga for these reasons: not going astray due to desires and so on; the non-return of abandoned defilements like lust; never doing any evil whatsoever; and not returning to re-existence.
Nāgaṃ nghĩa là Nāga (Rồng) bởi các lý do sau: không đi theo tham dục, v.v.; các phiền não như tham dục đã được đoạn trừ sẽ không tái phát; không làm bất kỳ điều ác nào dưới mọi hình thức; và không có tái sinh.
Ettha ca pāsādikanti iminā rūpakāyena bhagavato pamāṇabhūtataṃ dīpeti, pasādanīyanti iminā dhammakāyena, santindriyantiādinā sesehi pamāṇabhūtataṃ dīpeti.
Here, by “pāsādikaṃ” (inspiring serene joy), the measure of the Blessed One by his physical body is shown, and by “pasādanīyaṃ” (worthy of confidence), by his Dhamma-body. By “santindriyaṃ” and so on, the measure by the remaining qualities is shown.
Ở đây, với từ pāsādikaṃ, Ngài biểu thị sự vĩ đại của Đức Thế Tôn về sắc thân; với từ pasādanīyaṃ, về pháp thân; và với các từ còn lại như santindriyaṃ, v.v., Ngài biểu thị sự vĩ đại về các phương diện khác.
Tena catuppamāṇike lokasannivāse anavasesato sattānaṃ bhagavato pamāṇabhāvo pakāsitoti veditabbo.
Thus, it should be understood that the Blessed One’s being the measure for all beings in the fourfold measured world-dwelling is fully declared.
Do đó, nên hiểu rằng sự vĩ đại của Đức Thế Tôn đối với tất cả chúng sinh trong thế gian bốn phương đã được tuyên bố một cách trọn vẹn.
Evaṃbhūtañca bhagavantaṃ antaravīthiyaṃ gacchantaṃ disvā ‘‘cirassaṃ vata me sammāsambuddho diṭṭho’’ti haṭṭhatuṭṭho pañcavaṇṇāya pītiyā nirantaraṃ phuṭasarīro pītivipphāritavivaṭaniccalalocano diṭṭhaṭṭhānato paṭṭhāya oṇatasarīro bhagavato sarīrappabhāvemajjhaṃ ajjhogāhetvā tattha nimujjanto bhagavato samīpaṃ upasaṅkamitvā pañcapatiṭṭhitena vanditvā bhagavato pāde sambāhanto paricumbanto ‘‘desetu me, bhante, bhagavā dhamma’’nti āha.
Seeing the Blessed One, who was of such a nature, walking in the middle of the street, Bāhiya was overjoyed and delighted, saying, “It has been a long time since I have seen the Perfectly Self-Enlightened One!” His entire body was continuously suffused with fivefold rapture, his eyes wide with joy, unblinking and unwavering. From the place he first saw the Blessed One, he bent his body low, plunged into the midst of the Buddha’s radiant aura, submerged himself there, approached the Blessed One, bowed down with five-point prostration, massaged and kissed the Blessed One’s feet, and said, “Venerable sir, may the Blessed One teach me the Dhamma.”
Khi thấy Đức Thế Tôn với những phẩm chất như vậy đang đi giữa đường, Bāhiya vô cùng hoan hỷ và vui sướng, toàn thân tràn ngập năm loại hỷ lạc không ngừng, với đôi mắt mở to, bất động, không chớp do hỷ lạc lan tỏa. Từ nơi mình thấy, ông khom người, lặn vào giữa luồng hào quang của Đức Thế Tôn, rồi tiến đến gần Đức Thế Tôn, đảnh lễ bằng năm chi chạm đất. Vừa xoa bóp vừa hôn chân Đức Thế Tôn, ông thưa: “Bạch Thế Tôn, xin Đức Thế Tôn thuyết giảng Pháp cho con!”
Tena vuttaṃ – ‘‘bhagavato pāde sirasā nipatitvā bhagavantaṃ etadavoca – ‘desetu me, bhante, bhagavā dhammaṃ, desetu sugato dhammaṃ, yaṃ mamassa dīgharattaṃ hitāya sukhāyā’’’ti.
Therefore it is said: “Having fallen at the Blessed One’s feet with his head, he said this to the Blessed One: ‘Venerable sir, may the Blessed One teach me the Dhamma; may the Sugata teach me the Dhamma, which would be for my long-term welfare and happiness.’”
Vì thế, có lời dạy: “Với đầu cúi xuống dưới chân Đức Thế Tôn, ông thưa với Đức Thế Tôn rằng: ‘Bạch Thế Tôn, xin Đức Thế Tôn thuyết giảng Pháp cho con! Bạch Thiện Thệ, xin Ngài thuyết giảng Pháp, để con được lợi ích và an lạc lâu dài!’”
Tattha sugatoti sobhanagamanattā, sundaraṃ ṭhānaṃ gatattā, sammā gatattā, sammā gadattā sugato.
Therein, ‘Sugato’ means one who has gone well (sobhanagamana), one who has gone to a good state (sundaraṃ ṭhānaṃ), one who has gone rightly (sammā gata), or one who has spoken rightly (sammā gada).
Ở đây, Thiện Thệ (Sugata) có nghĩa là Thiện Thệ vì Ngài có sự đi tốt đẹp (sobhanagamana), đã đi đến nơi tốt đẹp (sundaraṃ ṭhānaṃ), đã đi đúng đắn (sammā gata), và đã nói đúng đắn (sammā gada).
Gamanampi hi gatanti vuccati, tañca bhagavato sobhanaṃ parisuddhaṃ anavajjaṃ.
For ‘going’ is also called ‘gata’. And the Blessed One’s going is excellent, utterly pure, and blameless.
Sự đi cũng được gọi là gata, và sự đi ấy của Đức Thế Tôn là tốt đẹp, thanh tịnh, không lỗi lầm.
Kiṃ pana tanti?
What is that going?
Vậy đó là gì?
Ariyamaggo.
The Noble Path.
Đó là Thánh đạo (Ariya-magga).
Tena hesa gamanena khemaṃ disaṃ asajjamāno gato, aññepi gametīti sobhanagamanattā sugato.
By this going, he has gone to the safe direction without attachment, and he leads others to go; thus, he is Sugata by having gone well.
Vì Ngài đã đi đến phương an ổn (Nibbāna) không vướng mắc bằng sự đi ấy, và cũng đưa những người khác đến đó, nên Ngài là Thiện Thệ (Sugata) do có sự đi tốt đẹp.
Sundarañcesa ṭhānaṃ amataṃ nibbānaṃ gatoti sundaraṃ ṭhānaṃ gatattā sugato.
And he has gone to the excellent state, the deathless Nibbāna; thus, he is Sugata by having gone to an excellent state.
Và Ngài đã đi đến nơi tốt đẹp, tức là Nibbāna bất tử, nên Ngài là Thiện Thệ (Sugata) do đã đi đến nơi tốt đẹp.
Sammā ca gatattā sugato tena tena maggena pahīne kilese puna apaccāgamanato.
And he is Sugata by having gone rightly, by not returning to the defilements abandoned by each respective path.
Và Ngài là Thiện Thệ (Sugata) do đã đi đúng đắn (sammā gata) vì các phiền não đã được đoạn trừ bằng con đường đó sẽ không bao giờ trở lại.
Vuttañhetaṃ –
For this has been said:
Điều này đã được nói:
Atha vā sammā gatattāti tīsupi avatthāsu sammāpaṭipattiyā gatattā, suppaṭipannattāti attho.
Alternatively, he is Sugata by having gone rightly (sammā gata), meaning, by having practiced rightly in all three stages; that is, by having practiced perfectly.
Hoặc là, Thiện Thệ (Sugata) do đã đi đúng đắn (sammā gata) có nghĩa là đã đi đúng đắn trong cả ba giai đoạn (ti-bhūmi) bằng sự thực hành đúng đắn, tức là đã thực hành tốt đẹp (suppaṭipanna).
Dīpaṅkarapādamūlato hi paṭṭhāya yāva mahābodhimaṇḍā tāva samatiṃsapāramipūritāya sammāpaṭipattiyā ñātatthacariyāya lokatthacariyāya buddhatthacariyāya koṭiṃ pāpuṇitvā sabbalokassa hitasukhameva paribrūhanto sassataṃ ucchedaṃ kāmasukhaṃ attakilamathanti ime ante anupagacchantiyā anuttarāya bojjhaṅgabhāvanāsaṅkhātāya majjhimāya paṭipadāya ariyasaccesu tato paraṃ samadhigatadhammādhipateyyo sabbasattesu avisayāya sammāpaṭipattiyā ca gato paṭipannoti evampi sammā gatattā sugato.
From the foot of Dīpaṅkara Buddha, up to the Great Bodhi-maṇḍa, he attained the culmination of practicing for his relatives' welfare, the world's welfare, and Buddhahood's welfare by fulfilling the thirty Pāramīs with right practice. Continually fostering the welfare and happiness of all beings, he walked the Middle Path, which does not incline to the extremes of eternalism, annihilationism, sensual pleasures, or self-mortification—this path being the development of the factors of awakening. Beyond that, he is Sugata by having gone and practiced with right practice, having attained supremacy in the Dhamma and being inaccessible to all beings concerning the Noble Truths.
Quả thật, từ dưới chân Đức Phật Dīpaṅkara cho đến Đại Bồ-đề đạo tràng, Ngài đã đi đến tột cùng của sự thực hành đúng đắn bằng cách hoàn thành ba mươi Ba-la-mật, bằng sự thực hành vì lợi ích của thân quyến (ñātatthacariya), vì lợi ích của thế gian (lokatthacariya), vì lợi ích của Phật quả (buddhatthacariya). Ngài đã đi trên con đường Trung đạo (Majjhimāpaṭipadā) tối thượng, tức là sự tu tập các chi phần giác ngộ (bojjhaṅga-bhāvanā), không rơi vào hai cực đoan là thường kiến (sassata), đoạn kiến (uccheda), dục lạc (kāmasukha) và khổ hạnh ép xác (attakilamatha). Sau đó, Ngài đã đạt được sự làm chủ Pháp tối thượng trên các Thánh đế (Ariyasacca), và đã thực hành đúng đắn không giới hạn đối với tất cả chúng sinh. Do đó, Ngài là Thiện Thệ (Sugata) vì đã đi đúng đắn như vậy.
Sammā cesa gadati yuttaṭṭhāne yuttameva vācaṃ bhāsatīti sugato.
And he is Sugata because he speaks rightly, uttering only what is proper in a proper place.
Và Ngài là Thiện Thệ (Sugata) vì Ngài nói đúng đắn (sammā gadati), tức là Ngài chỉ nói lời đúng đắn ở nơi thích hợp.
Vuttampi cetaṃ –
And this has been said:
Điều này cũng đã được nói:
Yaṃ mamassa dīgharattaṃ hitāya sukhāyāti yaṃ dhammassa upadisanaṃ cirakālaṃ mama jhānavimokkhādihitāya tadadhigantabbasukhāya ca siyā.
“Which would be for my long-term welfare and happiness” refers to such a teaching of the Dhamma as would lead to my welfare, such as jhāna and vimokkha, and to the happiness to be attained thereby, for a long time.
“Để con được lợi ích và an lạc lâu dài” có nghĩa là sự thuyết giảng Pháp ấy sẽ là lợi ích cho con về thiền định, giải thoát, v.v., và là an lạc đạt được những điều đó trong một thời gian dài.
Akālo kho tāva bāhiyāti tava dhammadesanāya na tāva kāloti attho.
“It is not the time yet, Bāhiya,” means that it is not yet the time for your Dhamma discourse.
“Bāhiya này, bây giờ chưa phải lúc” có nghĩa là, bây giờ chưa phải lúc để thuyết Pháp cho ông.
Kiṃ pana bhagavato sattahitapaṭipattiyā akālopi nāma atthi, yato bhagavā kālavādīti?
But is there really a "not-time" for the Buddha's conduct for the welfare of beings, since the Buddha is a "speaker at the right time"?
Nhưng Đức Thế Tôn có bao giờ không đúng lúc trong việc thực hành vì lợi ích chúng sinh chăng, vì Ngài là bậc nói đúng lúc (kālavādī)?
Vuccate – kāloti cettha veneyyānaṃ indriyaparipākakālo adhippeto.
It is said: here, “time” refers to the time when the faculties of those to be disciplined are mature.
Được nói rằng: “Lúc” ở đây có nghĩa là lúc các căn của những người có thể giác ngộ đã chín muồi.
Yasmā pana tadā bāhiyassa attano indriyānaṃ paripakkāparipakkabhāvo dubbiññeyyo, tasmā bhagavā taṃ avatvā attano antaravīthiyaṃ ṭhitabhāvamassa kāraṇaṃ apadisanto āha ‘‘antaragharaṃ paviṭṭhamhā’’ti.
Since at that time it was difficult for Bāhiya to know whether his own faculties were mature or not, the Bhagavā, without stating that, indicating his own state of being in the street within the village as the reason, said: “We have entered the village for alms.”
Vì lúc đó Bāhiya khó có thể biết được các căn của mình đã chín muồi hay chưa, nên Đức Thế Tôn không nói điều đó, mà viện dẫn việc Ngài đang ở giữa đường làm lý do, và nói: “Chúng ta đã vào trong làng.”
Dujjānanti dubbiññeyyaṃ.
“Difficult to know” means difficult to discern.
“Dujjānaṃ” có nghĩa là khó biết.
Jīvitantarāyānanti jīvitassa antarāyakaradhammānaṃ vattanaṃ avattanaṃ vāti vattukāmo sambhamavasena ‘‘jīvitantarāyāna’’nti āha.
“Of dangers to life”: wanting to state whether or not the conditions causing danger to life exist, he said “of dangers to life” due to urgency.
“Jīvitantarāyānaṃ” có nghĩa là ông ta muốn nói về sự xuất hiện hay không xuất hiện của những điều gây nguy hiểm cho mạng sống, nhưng do sự bối rối, ông đã nói “jīvitantarāyānaṃ” (những nguy hiểm cho mạng sống).
Tathā hi anekapaccayappaṭibaddhavuttijīvitaṃ anekarūpā ca tadantarāyā.
Indeed, life's existence is dependent on many conditions, and its dangers are manifold.
Quả thật, mạng sống tồn tại nhờ nhiều điều kiện, và những nguy hiểm cho mạng sống cũng có nhiều loại.
Vuttañhi –
For it has been said:
Điều này đã được nói:
Kasmā panāyaṃ jīvitantarāyameva tāva purakkharoti?
But why does he emphasize danger to life first?
Tại sao ông ấy lại đặt nặng vấn đề nguy hiểm đến mạng sống trước tiên?
‘‘Nimittaññutāya adiṭṭhakosallena vā’’ti keci.
Some say, “Because of knowledge of signs or skill in the undesirable.”
Một số người nói: “Do khả năng nhận biết điềm báo hoặc do sự khéo léo trong việc nhìn thấy điều không mong muốn.”
Apare ‘‘devatāya santike jīvitantarāyassa sutattā’’ti vadanti.
Others say, “Because he heard about the danger to life from the deity.”
Những người khác nói: “Do đã nghe về nguy hiểm đến mạng sống từ một vị thiên nhân.”
Antimabhavikattā pana upanissayasampattiyā codiyamāno evamāha.
Being of his last existence, he spoke thus, being urged by the abundance of his supporting conditions.
Tuy nhiên, vì là người có kiếp sống cuối cùng (antimabhavika) và được thúc đẩy bởi sự đầy đủ của các duyên hỗ trợ (upanissaya-sampatti), ông đã nói như vậy.
Na hi tesaṃ appattaarahattānaṃ jīvitakkhayo hoti.
For the life-span of those who have not attained Arahantship does not come to an end.
Thật vậy, những người chưa đạt A-la-hán không bị mất mạng sống.
Kiṃ pana kāraṇā bhagavā tassa dhammaṃ desetukāmova dvikkhattuṃ paṭikkhipi?
But what was the reason the Bhagavā, though wishing to teach him the Dhamma, rejected him twice?
Nhưng vì lý do gì mà Đức Thế Tôn, dù muốn thuyết Pháp cho ông ấy, lại từ chối hai lần?
Evaṃ kirassa ahosi ‘‘imassa maṃ diṭṭhakālato paṭṭhāya sakalasarīraṃ pītiyā nirantaraṃ phuṭaṃ, atibalavā pītivego, dhammaṃ sutvāpi na tāva sakkhissati paṭivijjhituṃ.
It was thus, it is said, that he thought: “From the time he first saw me, his entire body has been continuously pervaded by joy; the surge of joy is exceedingly strong. Even if he were to hear the Dhamma, he would not yet be able to penetrate it.
Ngài đã nghĩ rằng: “Từ lúc ông ấy thấy Ta, toàn bộ thân thể ông ấy tràn ngập hỷ lạc không ngừng, động lực hỷ lạc quá mạnh mẽ. Dù có nghe Pháp, ông ấy cũng chưa thể thấu hiểu ngay. Hãy đợi cho đến khi sự xả trung bình (majjhattupekkhā) ổn định. Hơn nữa, vì đã đi một quãng đường một trăm hai mươi do-tuần (vīsayojanasataṃ), sự mệt mỏi trong thân thể ông ấy rất mạnh, hãy để nó lắng xuống trước đã.”
Yāva pana majjhattupekkhā saṇṭhāti, tāva tiṭṭhatu, vīsayojanasataṃ maggaṃ āgatattā darathopissa kāye balavā, sopi tāva paṭippassambhatū’’ti.
Let him wait until equanimity is established. And since he has travelled a hundred yojanas, there is also strong fatigue in his body; let that also subside for now.”
Vì vậy, Ngài đã từ chối hai lần.
Tasmā dvikkhattuṃ paṭikkhipi.
Therefore, he rejected him twice.
Một số người nói: “Đức Thế Tôn làm như vậy để tạo sự chú tâm vào việc nghe Pháp.”
Keci pana ‘‘dhammassavane ādarajananatthaṃ bhagavā evamakāsī’’ti vadanti.
However, some say, “The Bhagavā did this to arouse reverence for hearing the Dhamma.”
Nhưng khi được thỉnh cầu lần thứ ba, thấy sự xả trung bình đã hiện diện, sự mệt mỏi đã lắng xuống, và nguy hiểm đến mạng sống đang cận kề của ông ấy, Đức Thế Tôn nghĩ: “Bây giờ là lúc thuyết Pháp,” rồi bắt đầu thuyết Pháp bằng câu “Do đó, này Bāhiya...” (tasmā tihā).
Tatiyavāraṃ yācito pana majjhattupekkhaṃ darathappaṭipassaddhiṃ paccupaṭṭhitañcassa jīvitantarāyaṃ disvā ‘‘idāni dhammadesanāya kālo’’ti cintetvā ‘‘tasmā tihā’’tiādinā dhammadesanaṃ ārabhi.
But when he was asked for the third time, seeing that equanimity and the subsidence of fatigue were present in him, and that danger to his life was imminent, he thought, “Now is the time for teaching the Dhamma,” and began the Dhamma discourse with “Therefore, Bāhiya...” and so on.
Ở đây, “tasmā” (do đó) có nghĩa là: vì ông quá sốt sắng thỉnh cầu Ta, hoặc vì ông nói rằng những nguy hiểm đến mạng sống là khó biết, và các căn của ông đã chín muồi, do đó.
Tattha diṭṭhe diṭṭhamattanti rūpāyatane cakkhuviññāṇena diṭṭhamattaṃ.
There, “in the seen, only the seen” refers to merely what is seen by eye-consciousness in the visible object.
Ở đây, “diṭṭhe diṭṭhamattaṃ” (trong cái thấy, chỉ là cái thấy) có nghĩa là: trong sắc xứ (rūpāyatana), chỉ là cái thấy bằng nhãn thức (cakkhuviññāṇa).
Yathā hi cakkhuviññāṇaṃ rūpe rūpamattameva passati, na aniccādisabhāvaṃ, evameva sesaṃ.
Just as eye-consciousness perceives merely the visible in the visible object, not its nature as impermanent, etc., so it is with the rest.
Cũng như nhãn thức chỉ thấy sắc tướng (rūpamatta) chứ không thấy bản chất vô thường (anicca) v.v., các giác quan khác cũng vậy.
Cakkhudvārikaviññāṇena hi me diṭṭhamattameva bhavissatīti sikkhitabbanti attho.
The meaning is that one should train oneself that for me, there will be merely what is seen by eye-door consciousness.
Điều đó có nghĩa là: “Cần phải học rằng đối với tôi, chỉ là cái thấy bằng nhãn thức.”
Atha vā diṭṭhe diṭṭhaṃ nāma cakkhuviññāṇena rūpavijānananti attho.
Alternatively, “the seen in the seen” means the knowing of a visible object by eye-consciousness.
Hoặc là, “cái thấy chỉ là cái thấy” có nghĩa là: cái thấy bằng nhãn thức là sự nhận biết sắc tướng.
Mattanti pamāṇaṃ.
“Mattaṃ” means limit.
Matta (chỉ) có nghĩa là giới hạn.
Diṭṭhā mattā etassāti diṭṭhamattaṃ, cakkhuviññāṇamattameva cittaṃ bhavissatīti attho.
“Diṭṭhamattaṃ” means “whose limit is the seen”; the meaning is that the mind will be merely eye-consciousness.
Vì cái thấy là giới hạn của nó, nên đó là “cái thấy chỉ là cái thấy,” có nghĩa là tâm sẽ chỉ là nhãn thức.
Idaṃ vuttaṃ hoti – yathā āpāthagate rūpe cakkhuviññāṇaṃ na rajjati, na dussati, na muyhati, evaṃ rāgādivirahena cakkhuviññāṇamattameva me javanaṃ bhavissati, cakkhuviññāṇappamāṇeneva javanaṃ ṭhapessāmīti.
This is what is meant: just as eye-consciousness in a visible object that comes into its range does not become attached, nor averse, nor deluded, so, due to the absence of lust, etc., my impulsion (javana) will be merely eye-consciousness; I will establish the impulsion (javana) by the measure of eye-consciousness.
Điều này có nghĩa là: cũng như nhãn thức không tham đắm, không sân hận, không si mê đối với sắc tướng hiện tiền, thì đối với tôi, sự tốc hành (javana) sẽ chỉ là nhãn thức do không có tham ái, v.v. Tôi sẽ giữ sự tốc hành ở mức độ của nhãn thức.
Atha vā diṭṭhaṃ nāma cakkhuviññāṇena diṭṭhaṃ rūpaṃ, diṭṭhamattaṃ nāma tattheva uppannaṃ sampaṭicchanasantīraṇavoṭṭhabbanasaṅkhātaṃ cittattayaṃ.
Alternatively, “diṭṭhaṃ” refers to the visible object seen by eye-consciousness, and “diṭṭhamattaṃ” refers to the three states of mind — receiving, investigating, and determining — that arise only with respect to that same visible object.
Hoặc là, diṭṭha (cái thấy) có nghĩa là sắc tướng được thấy bằng nhãn thức, còn diṭṭhamatta (chỉ là cái thấy) có nghĩa là ba loại tâm (citta-ttaya) phát sinh ngay tại đó, tức là tâm tiếp thọ (sampaṭicchana), tâm suy tư (santīraṇa) và tâm quyết định (voṭṭhabbana).
Yathā taṃ na rajjati, na dussati, na muyhati, evaṃ āpāthagate rūpe teneva sampaṭicchanādippamāṇena javanaṃ uppādessāmi, nāhaṃ taṃ pamāṇaṃ atikkamitvā rajjanādivasena uppajjituṃ dassāmīti evamettha attho daṭṭhabbo.
Just as these do not become attached, nor averse, nor deluded, so too, regarding a visible object that comes into range, I will generate the impulsion (javana) solely by the measure of that receiving, etc., and I will not allow it to arise in terms of attachment, etc., by exceeding that measure. This is the meaning to be understood here.
Cũng như chúng không tham đắm, không sân hận, không si mê, thì đối với sắc tướng hiện tiền, tôi sẽ làm cho sự tốc hành phát sinh chỉ ở mức độ của tâm tiếp thọ, v.v. Tôi sẽ không để nó vượt quá giới hạn đó để phát sinh tham đắm, v.v. Ý nghĩa ở đây nên được hiểu như vậy.
Eseva nayo sutamute.
The same method applies to the heard and the cognized.
Tương tự như vậy đối với điều đã nghe và điều đã cảm nhận.
Mutanti tadārammaṇaviññāṇehi saddhiṃ gandharasaphoṭṭhabbāyatanaṃ veditabbaṃ.
“Cognized” here should be understood as the sense objects of smell, taste, and touch together with their corresponding consciousnesses.
Muta (điều đã cảm nhận) là các đối tượng của khứu giác, vị giác, xúc giác cùng với các thức tương ứng.
Viññāte viññātamattanti ettha pana viññātaṃ nāma manodvārāvajjanena viññātārammaṇaṃ.
In “in the cognized, only the cognized,” “cognized” refers to the object cognized by mind-door adverting (manodvārāvajjanena viññātārammaṇaṃ).
Trong câu "điều đã được biết chỉ là điều đã được biết" ở đây, điều được biết (viññāta) là đối tượng được biết bởi sự hướng tâm của ý môn (manodvārāvajjanena).
Tasmiṃ viññāte viññātamattanti āvajjanappamāṇaṃ.
“In that which is cognized, only the cognized” refers to the measure of adverting.
Khi điều đó đã được biết, "chỉ là điều đã được biết" có nghĩa là ở mức độ của sự hướng tâm.
Yathā āvajjanaṃ na rajjati, na dussati, na muyhati, evaṃ rajjanādivasena ca uppajjituṃ adatvā āvajjanappamāṇeneva cittaṃ ṭhapessāmīti ayamettha attho.
Just as adverting does not become attached, nor averse, nor deluded, so too, without allowing attachment, etc., to arise, I will establish the mind only by the measure of adverting. This is the meaning here.
Nghĩa ở đây là: giống như sự hướng tâm không tham đắm, không sân hận, không si mê, thì ta sẽ giữ tâm ở mức độ của sự hướng tâm, không cho phép nó phát sinh sự tham đắm, v.v.
Evañhi te, bāhiya, sikkhitabbanti evaṃ imāya paṭipadāya tayā, bāhiya, tissannaṃ sikkhānaṃ anuvattanavasena sikkhitabbaṃ.
“Thus indeed, Bāhiya, you should train yourself” means: in this way, Bāhiya, by this method, you should train yourself by practicing the three trainings.
"Này Bāhiya, con phải học tập như vậy" nghĩa là: này Bāhiya, con phải học tập theo con đường này, bằng cách thực hành ba sự học tập.
Iti bhagavā bāhiyassa saṃkhittarucitāya chahi viññāṇakāyehi saddhiṃ chaḷārammaṇabhedabhinnaṃ vipassanāya visayaṃ diṭṭhādīhi catūhi koṭṭhāsehi vibhajitvā tatthassa ñātatīraṇapariññaṃ dasseti.
Thus, the Bhagavā, knowing Bāhiya's brief interest, divided the domain of insight, which is differentiated into six sense objects along with the six consciousness groups, into four parts: seen, heard, cognized, and known, and thereby revealed to him the comprehension through knowing and the comprehension through investigation.
Như vậy, Thế Tôn đã chia đối tượng của thiền quán, được phân loại thành sáu loại cảnh giới (chaḷārammaṇa) cùng với sáu loại thức (cha viññāṇakāya), thành bốn phần: cái đã thấy, v.v., để chỉ cho Bāhiya, người có sở thích tóm tắt, về Ñātapariññā (sự hiểu biết rõ ràng) và Tīraṇapariññā (sự thẩm sát rõ ràng).
Ettha hi rūpāyatanaṃ passitabbaṭṭhena diṭṭhaṃ nāma, cakkhuviññāṇaṃ pana saddhiṃ taṃdvārikaviññāṇehi dassanaṭṭhena, tadubhayampi yathāpaccayaṃ pavattamānaṃ dhammamattameva, na ettha koci kattā vā kāretā vā, yato taṃ hutvā abhāvaṭṭhena aniccaṃ, udayabbayappaṭipīḷanaṭṭhena dukkhaṃ, avasavattanaṭṭhena anattāti kuto tattha paṇḍitassa rajjanādīnaṃ okāsoti?
Here, the visible object (rūpāyatana) is "seen" in the sense of being perceptible, while eye-consciousness along with its associated door-consciousnesses is "seen" in the sense of seeing. Both, arising dependently, are merely phenomena. There is no agent or instigator here, because they are impermanent by nature of existing and then ceasing, suffering by nature of being continually oppressed by arising and ceasing, and non-self by nature of not being subject to control. So, how can there be any room for attachment, etc., for a wise person in such a reality?
Ở đây, sắc cảnh (rūpāyatana) được gọi là cái đã thấy (diṭṭha) theo nghĩa là cái cần được thấy; còn nhãn thức (cakkhuviññāṇa) cùng với các thức thuộc nhãn môn được gọi là cái đã thấy theo nghĩa là cái thấy. Cả hai đều là những pháp thuần túy vận hành theo duyên, không có ai là người tạo tác hay người sai khiến. Vì chúng là vô thường theo nghĩa là đã có rồi không còn nữa, là khổ theo nghĩa bị sự sinh diệt bức bách, là vô ngã theo nghĩa không thể kiểm soát được, vậy thì đối với người trí, đâu còn chỗ cho sự tham đắm, v.v.?
Ayamettha adhippāyo sutādīsupi.
This is the meaning here, and similarly in the cases of the heard, etc.
Đây cũng là ý nghĩa trong các điều đã nghe, v.v.
Idāni ñātatīraṇapariññāsu patiṭṭhitassa upari saha maggaphalena pahānapariññaṃ dassetuṃ, ‘‘yato kho te, bāhiyā’’tiādi āraddhaṃ.
Now, to show the comprehension through abandoning, together with the path and its fruit, to one established in the comprehension through knowing and the comprehension through investigation, the phrase “When for you, Bāhiya,” and so on, was begun.
Bây giờ, để chỉ ra Pahānapariññā (sự đoạn trừ rõ ràng) cùng với đạo và quả cho người đã an trú trong Ñātapariññā và Tīraṇapariññā, câu "Này Bāhiya, khi nào con..." đã được bắt đầu.
Tattha yatoti yadā, yasmā vā.
There, “yato” means when, or from what cause.
Ở đó, "yato" có nghĩa là "khi nào" hoặc "vì lý do gì".
Teti tava.
“Te” means your.
"Te" là "của con".
Tatoti tadā, tasmā vā.
“Tato” means then, or therefore.
"Tato" có nghĩa là "khi đó" hoặc "vì lý do đó".
Tenāti tena diṭṭhādinā, diṭṭhādipaṭibaddhena rāgādinā vā.
“Tenā” means by that seen, etc., or by the attachment, etc., connected with the seen, etc.
"Tenā" có nghĩa là "bởi cái đã thấy, v.v." hoặc "bởi tham ái, v.v. liên quan đến cái đã thấy, v.v.".
Idaṃ vuttaṃ hoti – bāhiya, tava yasmiṃ kāle yena vā kāraṇena diṭṭhādīsu mayā vuttavidhiṃ paṭipajjantassa aviparītasabhāvāvabodhena diṭṭhādimattaṃ bhavissati, tasmiṃ kāle tena vā kāraṇena diṭṭhādipaṭibaddhena rāgādinā saha na bhavissasi, ratto vā duṭṭho vā mūḷho vā na bhavissasi, pahīnarāgādikattā tena vā diṭṭhādinā saha paṭibaddho na bhavissasīti.
This is what is meant: "Bāhiya, when, or for whatever reason, you practice the method I have taught regarding the seen, etc., by understanding things as they truly are, there will be for you merely the seen, etc. At that time, or for that reason, you will not be with lust, etc., bound to the seen, etc. You will not be impassioned, or hateful, or deluded. Because lust, etc., has been abandoned, you will not be bound to that seen, etc."
Điều này có nghĩa là: Này Bāhiya, khi nào hoặc vì lý do nào, con thực hành theo phương pháp mà Ta đã dạy về cái đã thấy, v.v., và con sẽ chỉ là cái đã thấy, v.v. với sự thấu hiểu bản chất không sai lệch, thì khi đó hoặc vì lý do đó, con sẽ không còn cùng với tham ái, v.v. liên quan đến cái đã thấy, v.v. Con sẽ không còn tham đắm, không còn sân hận, không còn si mê. Vì đã đoạn trừ tham ái, v.v., con sẽ không còn bị ràng buộc bởi cái đã thấy, v.v.
Tato tvaṃ, bāhiya, na tatthāti yadā yasmā vā tvaṃ tena rāgena vā ratto dosena vā duṭṭho mohena vā mūḷho na bhavissasi, tadā tasmā vā tvaṃ tattha diṭṭhādike na bhavissasi, tasmiṃ diṭṭhe vā sutamutaviññāte vā ‘‘etaṃ mama, esohamasmi, eso me attā’’ti taṇhāmānadiṭṭhīhi allīno patiṭṭhito na bhavissasi.
Then, Bāhiya, you are not there (Na tattha): when or because you will not be impassioned by that lust, or hateful by that hatred, or deluded by that delusion, then or because you will not be there, in the seen, etc. You will not adhere to or be established in that seen, heard, sensed, or cognized with craving, conceit, and wrong views, thinking, "This is mine, this I am, this is my self."
"Này Bāhiya, khi đó con sẽ không ở đó" có nghĩa là: khi nào hoặc vì lý do nào con không còn tham đắm bởi tham ái, không còn sân hận bởi sân hận, không còn si mê bởi si mê, thì khi đó hoặc vì lý do đó, con sẽ không còn ở trong cái đã thấy, v.v. Con sẽ không còn bám víu, không còn an trú trong cái đã thấy, cái đã nghe, cái đã cảm nhận, cái đã biết, với các tà kiến "đây là của tôi, đây là tôi, đây là tự ngã của tôi", do tham ái, kiêu mạn và tà kiến.
Ettāvatā pahānapariññaṃ matthakaṃ pāpetvā khīṇāsavabhūmi dassitā.
To this extent, the discernment of abandoning (pahānapariññā) is brought to its culmination, and the stage of an arahant (khīṇāsavabhūmi) is shown.
Đến đây, Pahānapariññā đã được hoàn thiện và cảnh giới của một vị Arahant đã được chỉ ra.
Tato tvaṃ, bāhiya, nevidha na huraṃ na ubhayamantarenāti yadā tvaṃ, bāhiya, tena rāgādinā tattha diṭṭhādīsu paṭibaddho na bhavissasi, tadā tvaṃ neva idhaloke na paraloke na ubhayatthāpi.
Then, Bāhiya, you are neither in this world nor in the next, nor in between the two (nevidha na huraṃ na ubhayamantarenā): Bāhiya, when you are not bound by that lust, etc., in the seen, etc., then you are neither in this world, nor in the other world, nor in both.
"Này Bāhiya, khi đó con sẽ không ở đây, không ở thế giới bên kia, cũng không ở giữa hai nơi" có nghĩa là: Này Bāhiya, khi nào con không còn bị ràng buộc bởi tham ái, v.v. trong cái đã thấy, v.v., thì khi đó con sẽ không còn ở thế giới này, không ở thế giới bên kia, và cũng không ở cả hai nơi.
Esevanto dukkhassāti kilesadukkhassa ca vaṭṭadukkhassa ca ayameva hi anto ayaṃ parivaṭumabhāvoti ayameva hi ettha attho.
This indeed is the end of suffering (esevanto dukkhassā). This is indeed the end of suffering, both the suffering of defilements (kilesadukkha) and the suffering of the round of existence (vaṭṭadukkha). This is indeed the cessation of recurrence in the round of existence. This is the only meaning here.
"Đó là sự chấm dứt của khổ đau" có nghĩa là: đây chính là sự chấm dứt của khổ đau phiền não và khổ đau luân hồi, đây là trạng thái không còn tái diễn trong vòng luân hồi.
Ye pana ‘‘ubhayamantarenā’’ti padaṃ gahetvā antarābhavaṃ nāma icchanti, tesaṃ taṃ micchā.
However, for those who take the phrase "between the two" to mean an intermediate existence (antarābhava), that is a wrong view.
Tuy nhiên, những ai chấp nhận từ "ubhayamantarenā" và muốn có một trạng thái trung gian (antarābhava) thì điều đó là sai lầm.
Antarābhavassa hi bhāvo abhidhamme paṭikkhittoyeva.
Indeed, the existence of an intermediate state (antarābhava) is explicitly rejected in the Abhidhamma.
Bởi vì sự tồn tại của trạng thái trung gian đã bị bác bỏ trong Vi Diệu Pháp.
Antarenāti vacanaṃ pana vikappantaradīpanaṃ, tasmā ayamettha attho – ‘‘neva idha na huraṃ, aparo vikappo na ubhaya’’nti.
The word "antarenā" indicates an alternative possibility. Therefore, the meaning here is: "Neither in this world nor in the next; a different alternative is neither of the two."
Còn từ "antarenā" chỉ ra một sự lựa chọn khác. Do đó, ý nghĩa ở đây là – "không ở đây, không ở thế giới bên kia, và một lựa chọn khác là không ở cả hai nơi".
Atha vā antarenāti vacanaṃ pana vikappantarābhāvadīpanaṃ.
Alternatively, the word "antarenā" signifies the absence of another alternative.
Hoặc, từ "antarenā" chỉ ra sự không có sự lựa chọn khác.
Tassattho – ‘‘neva idha na huraṃ, ubhayamantare pana na aññaṭṭhānaṃ atthī’’ti.
Its meaning is: "Neither in this world nor in the next, and there is no other state in between the two."
Ý nghĩa của nó là – "không ở đây, không ở thế giới bên kia, và không có nơi nào khác giữa hai nơi đó".
Yepi ca ‘‘antarāparinibbāyī sambhavesī’’ti ca imesaṃ suttapadānaṃ atthaṃ ayoniso gahetvā ‘‘atthiyeva antarābhavo’’ti vadanti, tepi yasmā avihādīsu tattha tattha āyuvemajjhaṃ anatikkamitvā antarā aggamaggādhigamena anavasesakilesaparinibbānena parinibbāyatīti antarāparinibbāyī, na antarābhavabhūtoti purimassa suttapadassa attho.
And those who, by misunderstanding the meaning of the sutta phrases "antarāparinibbāyī" (one who attains Nibbāna in the interval) and "sambhavesī" (one who is seeking rebirth), say "there is indeed an intermediate existence," are also mistaken. This is because the meaning of the former sutta phrase refers to one who attains Nibbāna by achieving the highest path in the interval of life, without exceeding the lifespan in Aviha and other realms, through the cessation of all defilements (anavasesakilesaparinibbāna), and is thus called "antarāparinibbāyī," not one existing in an intermediate state.
Và những ai giải thích sai các từ trong kinh như "antarāparinibbāyī" (người nhập Niết-bàn giữa chừng) và "sambhavesī" (người đang tìm kiếm sự tái sinh) để nói rằng "có tồn tại trạng thái trung gian", thì họ cũng sai lầm. Bởi vì ý nghĩa của từ kinh đầu tiên là "antarāparinibbāyī" là người nhập Niết-bàn giữa chừng, không phải là người ở trạng thái trung gian, vì họ nhập Niết-bàn với sự đoạn diệt hoàn toàn phiền não bằng cách đạt được Đạo quả tối thượng giữa chừng, không vượt quá tuổi thọ trung bình ở các cõi như Avihā, v.v.
Pacchimassa ca ye bhūtā eva, na bhavissanti, te khīṇāsavā purimapade bhūtāti vuttā.
And regarding the latter phrase, those arahants who are already "existent" (bhūta) will not become "existent" (bhavissanti); they are referred to as "bhūtā" in the previous phrase.
Còn ý nghĩa của từ kinh sau là: những vị đã là "bhūta" (đã hiện hữu), không còn "bhavissanti" (sẽ hiện hữu) nữa, đó là các vị Arahant, được gọi là "bhūta" trong từ kinh trước.
Tabbiruddhatāya sambhavamesantīti sambhavesino, appahīnabhavasaṃyojanattā sekhā puthujjanā ca.
Due to the opposition to this, "sambhavesino" are those who are seeking existence, i.e., those trainees (sekhā) and ordinary people (puthujjanā) whose fetters leading to rebirth (bhavasaṃyojana) have not yet been abandoned.
Do sự trái ngược đó, những người đang tìm kiếm sự tái sinh (sambhavaṃ esanti) được gọi là "sambhavesino" (người đang tìm kiếm sự tái sinh), đó là các bậc Hữu học (sekha) và phàm phu (puthujjana) vì chưa đoạn trừ các kiết sử của hữu.
Catūsu vā yonīsu aṇḍajajalābujasattā yāva aṇḍakosaṃ vatthikosañca na bhindanti, tāva sambhavesī nāma, aṇḍakosato vatthikosato ca bahi nikkhantā bhūtā nāma.
Alternatively, among the four modes of generation, creatures born from eggs (aṇḍaja) and those born from wombs (jalābuja) are called "sambhavesī" as long as they do not break out of the eggshell or the uterine sac, respectively. When they emerge from the eggshell or uterine sac, they are called "bhūtā."
Hoặc, trong bốn loại sinh, các chúng sinh sinh từ trứng (aṇḍaja) và sinh từ thai (jalābuja) được gọi là "sambhavesī" chừng nào chúng chưa phá vỡ vỏ trứng hay bọc thai; khi đã ra khỏi vỏ trứng hay bọc thai thì được gọi là "bhūta".
Saṃsedajā opapātikā ca paṭhamacittakkhaṇe sambhavesī nāma, dutiyacittakkhaṇato paṭṭhāya bhūtā nāma.
Those born of moisture (saṃsedajā) and spontaneously (opapātikā) are called "sambhavesī" at the first moment of consciousness; from the second moment of consciousness onwards, they are called "bhūtā."
Các chúng sinh sinh hóa (saṃsedaja) và hóa sinh (opapātika) được gọi là "sambhavesī" ở sát-na tâm đầu tiên, và được gọi là "bhūta" kể từ sát-na tâm thứ hai trở đi.
Yena vā iriyāpathena jāyanti, yāva tato aññaṃ na pāpuṇanti, tāva sambhavesino, tato paraṃ bhūtāti attho.
Or, by whatever posture they are born, as long as they do not assume another posture, they are called "sambhavesino." After that, they are "bhūtā." This is the meaning.
Hoặc, chừng nào chúng sinh còn đang sinh ra trong một tư thế nào đó và chưa đạt đến một tư thế khác, thì chúng được gọi là "sambhavesino"; sau đó thì được gọi là "bhūta".
Tasmā natthīti paṭikkhipitabbā.
Therefore, such (views of antarābhava) should be rejected as non-existent.
Do đó, cần phải bác bỏ quan điểm cho rằng không có trạng thái trung gian.
Sati hi ujuke pāḷianugate atthe kiṃ aniddhāritasāmatthiyena antarābhavena parikappitena payojananti.
For if there is a straightforward meaning consistent with the Pāḷi, what is the purpose of conceiving an intermediate existence whose power has not been established?
Khi có một ý nghĩa trực tiếp, phù hợp với Pāḷi, thì việc giả định một trạng thái trung gian với khả năng không xác định thì có ích gì?
Ye pana ‘‘santānavasena pavattamānānaṃ dhammānaṃ avicchedena desantaresu pātubhāvo diṭṭho, yathā taṃ vīhiādiaviññāṇakasantāne, evaṃ saviññāṇakasantānepi avicchedena desantaresu pātubhāvena bhavitabbaṃ.
However, those who argue that "the uninterrupted appearance of phenomena progressing in a continuum is observed in other places, just as in the continuum of non-sentient things like rice, etc., so too must there be an uninterrupted appearance in other places in the continuum of sentient beings.
Tuy nhiên, những người đưa ra lý lẽ rằng: "Sự xuất hiện của các pháp vận hành theo dòng tương tục đã được thấy ở những nơi khác mà không bị gián đoạn, giống như trong dòng tương tục của các vật vô tri như lúa, v.v. Tương tự, trong dòng tương tục của các vật hữu tri cũng phải có sự xuất hiện ở những nơi khác mà không bị gián đoạn.
Ayañca nayo sati antarābhave yujjati, na aññathā’’ti yuttiṃ vadanti.
And this method is only applicable if there is an intermediate existence; otherwise, it is not," they should then explain the applicability of an accomplished person (iddhimato) who has mastered the mind (cetovasippattassa) creating a body conforming to the mind (cittānugatikaṃ kāyaṃ), instantly moving from the Brahma-world to here, or from here to the Brahma-world.
Và quy tắc này chỉ hợp lý khi có trạng thái trung gian, nếu không thì không hợp lý".
Tena hi iddhimato cetovasippattassa cittānugatikaṃ kāyaṃ adhiṭṭhahantassa khaṇena brahmalokato idhūpasaṅkamane ito vā brahmalokagamane yutti vattabbā.
They should then explain the reasoning for an accomplished person who has attained mastery over the mind and creates a body that follows the mind, instantly appearing here from the Brahma-world or going from here to the Brahma-world.
Nếu vậy, thì phải nói rằng điều này hợp lý đối với một người có thần thông, đã đạt được sự thành thạo về tâm, khi người đó biến hóa thân thể theo ý muốn, có thể xuất hiện ở đây từ cõi Phạm thiên trong chốc lát, hoặc đi từ đây đến cõi Phạm thiên.
Yadi sabbattheva avicchinnadese dhammānaṃ pavatti icchitā, yadipi siyā iddhimantānaṃ iddhivisayo acinteyyoti.
If the continuous occurrence of phenomena in an uninterrupted space is desired everywhere, it might be said that the sphere of powers of those with psychic abilities is inconceivable.
Nếu sự vận hành của các pháp luôn được mong muốn ở một nơi không bị gián đoạn, thì ngay cả khi đó là phạm vi thần thông của các bậc có thần thông là không thể nghĩ bàn.
Taṃ idhāpi samānaṃ ‘‘kammavipāko acinteyyo’’ti vacanato.
That is equally valid here, according to the saying, "The result of kamma is inconceivable."
Điều này cũng tương tự ở đây theo câu "quả nghiệp là không thể nghĩ bàn".
Tasmā taṃ tesaṃ matimattameva.
Therefore, that is merely their opinion.
Do đó, đó chỉ là quan điểm của họ.
Acinteyyasabhāvā hi sabhāvadhammā, te katthaci paccayavasena vicchinnadese pātubhavanti, katthaci avicchinnadese.
Indeed, phenomena (sabhāvadhammā) are of an inconceivable nature; they appear in some places in a discontinuous manner due to conditions, and in other places in a continuous manner.
Các pháp bản chất là không thể nghĩ bàn; chúng xuất hiện ở một nơi bị gián đoạn do duyên, và ở một nơi không bị gián đoạn.
Tathā hi mukhaghosādīhi paccayehi aññasmiṃ dese ādāsapabbatappadesādike paṭibimbapaṭighosādikaṃ paccayuppannaṃ nibbattamānaṃ dissati, tasmā na sabbaṃ sabbattha upanetabbanti ayamettha saṅkhepo.
Thus, it is seen that the reflection or echo, etc., which arise dependently from conditions such as the face or sound, etc., appear in other places like a mirror or a mountain region, etc. Therefore, not everything should be applied everywhere. This is the summary here.
Thật vậy, các hiện tượng như hình ảnh phản chiếu và tiếng vang, v.v., được tạo ra do duyên bởi các nguyên nhân như tiếng nói từ miệng, v.v., được thấy xuất hiện ở một nơi khác như gương, vùng núi, v.v. Do đó, không phải tất cả mọi thứ đều phải được áp dụng ở mọi nơi. Đây là tóm tắt ở đây.
Vitthāro pana paṭibimbassa udāharaṇabhāvasādhanādiko antarābhavakathāvicāro kathāvatthupakaraṇassa (kathā. 505; kathā. aṭṭha. 505) ṭīkāyaṃ gahetabbo.
However, the extensive consideration of the intermediate state (antarābhavakathāvicāro), including the establishment of the example of a reflection (paṭibimbassa udāharaṇabhāvasādhanādiko), should be taken from the commentary (ṭīkā) to the Kathāvatthuppakaraṇa.
Phần giải thích chi tiết về việc chứng minh tính ví dụ của hình ảnh phản chiếu, v.v., và sự xem xét về trạng thái trung gian, cần được tham khảo trong chú giải của Kathāvatthuppakaraṇa.
Apare pana ‘‘idhāti kāmabhavo, huranti arūpabhavo, ubhayamantarenāti rūpabhavo vutto’’ti.
Others say, "Here (idhā) refers to the Sense-sphere existence (Kāma-bhava), there (huraṃ) refers to the Formless-sphere existence (Arūpa-bhava), and between the two (ubhayamantarenā) refers to the Form-sphere existence (Rūpa-bhava)."
Những người khác nói: "idha" là cõi Dục giới (kāmabhava), "huraṃ" là cõi Vô sắc giới (arūpabhava), và "ubhayamantarenā" là cõi Sắc giới (rūpabhava).
Aññe ‘‘idhāti ajjhattikāyatanāni, huranti bāhirāyatanāni, ubhayamantarenāti cittacetasikā’’ti.
Still others say, "Here (idhā) refers to the internal sense-bases, there (huraṃ) refers to the external sense-bases, and between the two (ubhayamantarenā) refers to consciousness and mental factors (citta-cetasikā)."
Những người khác nói: "idha" là các nội xứ (ajjhattikāyatana), "huraṃ" là các ngoại xứ (bāhirāyatana), và "ubhayamantarenā" là tâm và các tâm sở (cittacetasikā).
‘‘Idhāti vā paccayadhammā, huranti paccayuppannadhammā, ubhayamantarenāti paṇṇattidhammā vuttā’’ti vadanti.
Or they say, "Here (idhā) refers to conditioned phenomena (paccayadhammā), there (huraṃ) refers to dependently arisen phenomena (paccayuppannadhammā), and between the two (ubhayamantarenā) refers to conceptual phenomena (paṇṇattidhammā)."
Hoặc họ nói: "idha" là các pháp duyên (paccayadhamma), "huraṃ" là các pháp do duyên sinh (paccayuppannadhamma), và "ubhayamantarenā" là các pháp chế định (paññattidhamma).
Taṃ sabbaṃ aṭṭhakathāsu natthi.
All of that is not found in the Aṭṭhakathās.
Tất cả những điều đó không có trong các Chú giải (Aṭṭhakathā).
Evaṃ tāva ‘‘diṭṭhe diṭṭhamattaṃ bhavissatī’’tiādinā diṭṭhādivasena catudhā tebhūmakadhammā saṅgahetabbā.
Thus, the phenomena of the three realms should be categorized in four ways based on the seen, etc., beginning with "in the seen there will be merely the seen."
Như vậy, các pháp thuộc ba cõi (tebhūmakadhamma) cần được thâu tóm thành bốn loại theo cái đã thấy, v.v., bắt đầu bằng "cái đã thấy chỉ là cái đã thấy".
Tattha subhasukhaniccaattaggāhaparivajjanamukhena asubhadukkhāniccānattānupassanā dassitāti heṭṭhimāhi visuddhīhi saddhiṃ saṅkhepeneva vipassanā kathitā.
Here, by means of avoiding the apprehension of pleasantness, happiness, permanence, and self, the contemplation of unpleasantness, suffering, impermanence, and non-self is shown. Thus, insight (vipassanā) is taught in brief, together with the purifications mentioned earlier.
Ở đó, sự quán tưởng về bất tịnh, khổ, vô thường và vô ngã đã được chỉ ra bằng cách tránh chấp thủ về tịnh, lạc, thường và ngã. Như vậy, thiền quán đã được giảng giải một cách tóm tắt cùng với các sự thanh tịnh ở dưới.
‘‘Tato tvaṃ, bāhiya, na tenā’’ti iminā rāgādīnaṃ samucchedassa adhippetattā maggo.
By "Then, Bāhiya, you are not with that" (Tato tvaṃ, bāhiya, na tenā), the path (magga) is implied, as the complete eradication (samuccheda) of lust, etc., is intended.
Với câu ‘Này Bāhiya, từ đó ngươi không phải là cái đó’, vì ý muốn đoạn trừ hoàn toàn các phiền não như tham ái, nên đây là con đường (magga).
‘‘Tato tvaṃ, bāhiya, na tatthā’’ti iminā phalaṃ.
By "Then, Bāhiya, you are not there" (Tato tvaṃ, bāhiya, na tatthā), the fruition (phala) is indicated.
Với câu ‘Này Bāhiya, từ đó ngươi không phải ở đó’, đây là quả (phala).
‘‘Nevidhā’’tiādinā anupādisesā parinibbānadhātu kathitāti daṭṭhabbaṃ.
And by "neither here" (nevidhā), etc., the Nibbāna-element without residual clinging (anupādisesā parinibbānadhātu) is declared. This should be understood.
Với câu ‘Nevidhā’ v.v., cần hiểu rằng đây là nói về Niết-bàn giới vô dư y (anupādisesā parinibbānadhātu).
Tena vuttaṃ – ‘‘atha kho bāhiyassa…pe… āsavehi cittaṃ vimuccī’’ti.
Therefore, it was said: "Then Bāhiya's... his mind was liberated from the taints."
Do đó, đã nói: “Rồi tâm của Bāhiya…pe… được giải thoát khỏi các lậu hoặc (āsava)”.
Imāya saṃkhittapadāya desanāya tāvadevāti tasmiṃyeva khaṇe, na kālantare.
Through this brief discourse, "at that very moment" (tāvadeva) means in that very moment, not at a later time.
Trong lời dạy tóm tắt này, tāvadeva có nghĩa là ngay trong khoảnh khắc đó, không phải vào lúc khác.
Anupādāyāti aggahetvā.
"Without clinging" (anupādāya) means without grasping.
Anupādāyā có nghĩa là không chấp thủ.
Āsavehīti ābhavaggaṃ āgotrabhuṃ savanato pavattanato cirapārivāsiyaṭṭhena madirādiāsavasadisatāya ca ‘‘āsavā’’ti laddhanāmehi kāmarāgādīhi.
"From the taints" (āsavehi): these are called "āsavā" because they flow (savanato) or proceed (pavattanto) up to the highest existence (bhavagga) and up to the change-of-lineage moment (gotrabhū), and because they are like liquors (madirādi) that have permeated for a long time (cirapārivāsiyaṭṭhena), such as sensual lust (kāmarāga), etc.
Āsavehī là từ các lậu hoặc (āsava) được gọi như vậy vì chúng tràn ra (savana) và lưu chuyển (pavattana) cho đến tận cõi hữu (bhavagga) và cõi Gotrabhu, và vì chúng giống như rượu (madira) v.v., đã ủ lâu ngày (cirapārivāsiyaṭṭhena), như dục ái (kāmarāga) v.v.
Vimuccīti samucchedavimuttiyā paṭippassaddhivimuttiyā ca vimucci nissajji.
"Was liberated" (vimucci) means was freed, released, by liberation through eradication (samucchedavimutti) and liberation through tranquility (paṭippassaddhivimutti).
Vimuccī có nghĩa là được giải thoát bằng sự giải thoát đoạn trừ (samucchedavimutti) và sự giải thoát an tịnh (paṭippassaddhivimutti), được buông bỏ.
So hi satthu dhammaṃ suṇanto eva sīlāni sodhetvā yathāladdhaṃ cittasamādhiṃ nissāya vipassanaṃ paṭṭhapetvā khippābhiññatāya tāvadeva sabbāsave khepetvā saha paṭisambhidāhi arahattaṃ pāpuṇi.
Listening to the Master's Dhamma, he purified his virtues (sīla), relied on his attained concentration of mind (cittasamādhi), established insight (vipassanā), and, due to his quick comprehension, immediately extinguished all taints (āsava), attaining arahantship along with the four analytical knowledges (paṭisambhidā).
Ngài, khi đang nghe pháp của Đức Đạo Sư, đã thanh lọc giới hạnh, nương vào định tâm đã đạt được, thiết lập thiền quán (vipassanā), và với khả năng chứng ngộ nhanh chóng (khippābhiññatāya), ngay lúc đó đã đoạn tận mọi lậu hoặc (sabbāsava) và đạt đến A-la-hán quả (arahatta) cùng với các tuệ phân tích (paṭisambhidā).
So saṃsārasotaṃ chinditvā katavaṭṭapariyanto antimadehadharo hutvā ekūnavīsatiyā paccavekkhaṇāsu pavattāsu dhammatāya codiyamāno bhagavantaṃ pabbajjaṃ yāci.
Having cut off the stream of saṃsāra, and brought the round of existence to an end, he became one bearing his last body. Prompted by the natural course of things by the nineteen retrospective contemplations that had arisen, he requested ordination from the Blessed One.
Ngài đã cắt đứt dòng luân hồi (saṃsārasota), chấm dứt vòng tái sinh (vaṭṭapariyanto), trở thành người mang thân cuối cùng (antimadehadharo), và được thúc đẩy bởi bản chất tự nhiên (dhammatāya) của hai mươi loại quán xét (paccavekkhaṇā) đã khởi lên, liền cầu xin Đức Thế Tôn cho xuất gia.
‘‘Paripuṇṇaṃ te pattacīvara’’nti puṭṭho ‘‘na paripuṇṇa’’nti āha.
When asked, “Are your bowl and robes complete?” he replied, “They are not complete, Venerable Sir.”
Khi được hỏi: “Y bát của ngươi đã đầy đủ chưa?”, ngài đáp: “Chưa đầy đủ.”
Atha naṃ satthā ‘‘tena hi pattacīvaraṃ pariyesā’’ti vatvā pakkāmi.
Then the Teacher said to him, “If that is so, seek a bowl and robes,” and departed.
Sau đó, Đức Đạo Sư bảo ngài: “Vậy thì hãy đi tìm y bát,” rồi Ngài rời đi.
Tena vuttaṃ – ‘‘atha kho bhagavā…pe… pakkāmī’’ti.
Concerning this, it is said in the Pāli, " Then the Blessed One… (abridged)… departed.”
Do đó, đã nói: “Rồi Đức Thế Tôn…pe… rời đi”.
So kira kassapadasabalassa sāsane vīsavassasahassāni samaṇadhammaṃ karonto ‘‘bhikkhunā nāma attanā paccaye labhitvā yathādānaṃ karontena attanāva paribhuñjituṃ vaṭṭatī’’ti ekassa bhikkhussapi pattena vā cīvarena vā saṅgahaṃ nākāsi, tenassa ehibhikkhuupasampadāya upanissayo nāhosi.
It is said that in the Dispensation of Kassapa Dasabala, for twenty thousand years, while practicing the ascetic's duties, he held the view that "a monk, having obtained requisites himself, should only use them for himself, and not give them away." Therefore, he did not provide a bowl or robe to even a single monk. For this reason, he did not have the requisite condition for ordination with the "Ehi Bhikkhu" formula.
Nghe nói, khi vị ấy đang thực hành pháp hạnh Sa-môn trong giáo pháp của Đức Phật Kassapa Dasabala trong hai mươi ngàn năm, vị ấy đã không bố thí y bát cho bất kỳ vị Tỳ-khưu nào, với suy nghĩ rằng: “Một Tỳ-khưu sau khi nhận được vật dụng thì chỉ nên tự mình thọ dụng, không nên bố thí.” Vì vậy, vị ấy không có duyên lành để được thọ giới tỳ-khưu theo hình thức “Ehi Bhikkhu” (Hãy đến, Tỳ-khưu).
Keci panāhu – ‘‘so kira buddhasuññe loke coro hutvā dhanukalāpaṃ sannayhitvā araññe corikaṃ karonto ekaṃ paccekabuddhaṃ disvā pattacīvaralobhena taṃ usunā vijjhitvā pattacīvaraṃ gaṇhi, tenassa iddhimayapattacīvaraṃ na uppajjissatīti, satthā taṃ ñatvā ehibhikkhubhāvena pabbajjaṃ na adāsī’’ti.
Some, however, say: "It is said that in a world devoid of a Buddha, he was a thief. Having strapped on a quiver of arrows, he committed robbery in the forest. Seeing a Paccekabuddha, out of greed for his bowl and robes, he shot him with an arrow and took his bowl and robes. For this reason, a miraculous bowl and robes would not arise for him. The Teacher, knowing this, did not grant him ordination with the 'Ehi Bhikkhu' formula."
Tuy nhiên, một số người khác nói rằng: “Nghe nói, trong một thời kỳ không có Phật (buddhasuññe loke), vị ấy đã làm một tên cướp, mang cung tên vào rừng để cướp bóc. Khi thấy một vị Độc Giác Phật (Paccekabuddha), vì lòng tham y bát, vị ấy đã dùng mũi tên bắn chết vị ấy và lấy y bát. Vì vậy, y bát thần thông sẽ không hiện ra cho vị ấy, và Đức Đạo Sư biết điều đó nên đã không cho vị ấy xuất gia theo hình thức Ehi Bhikkhu.”
Tampi pattacīvarapariyesanaṃ caramānaṃ ekā dhenu vegena āpatantī paharitvā jīvitakkhayaṃ pāpesi.
As he was engaged in seeking those bowl and robes, a cow, rushing at full speed, struck him and caused his death.
Khi vị ấy đang đi tìm y bát đó, một con bò cái có nghé con lao tới nhanh chóng, húc chết vị ấy.
Taṃ sandhāya vuttaṃ ‘‘atha kho acirapakkantassa bhagavato bāhiyaṃ dārucīriyaṃ gāvī taruṇavacchā adhipatitvā jīvitā voropesī’’ti.
Regarding this, it is said, " Then, not long after the Blessed One had departed, a young calf cow knocked down Bāhiya Dārucīriya and deprived him of his life.”
Liên quan đến việc đó, đã nói: “Rồi, không lâu sau khi Đức Thế Tôn rời đi, một con bò cái có nghé con đã húc và cướp đi mạng sống của Bāhiya Dārucīriya.”
Satthā piṇḍāya caritvā katabhattakicco sambahulehi bhikkhūhi saddhiṃ nagarato nikkhamanto bāhiyassa sarīraṃ saṅkāraṭṭhāne patitaṃ disvā bhikkhū āṇāpesi – ‘‘bhikkhave, ekasmiṃ gharadvāre ṭhatvā mañcakaṃ āharāpetvā idaṃ sarīraṃ nagarato nīharitvā jhāpetvā thūpaṃ karothā’’ti, bhikkhū tathā akaṃsu.
The Teacher, having wandered for alms and completed his meal, left the city with many bhikkhus. Seeing Bāhiya's body fallen in the refuse heap, he instructed the bhikkhus, "Bhikkhus, stand at a certain house door, have a cot brought, carry this body out of the city, cremate it, and build a stupa for it." The bhikkhus did so.
Đức Đạo Sư, sau khi khất thực và hoàn tất bữa ăn, đang rời thành phố cùng với nhiều Tỳ-khưu khác. Khi thấy thi thể của Bāhiya nằm ở bãi rác, Ngài ra lệnh cho các Tỳ-khưu: “Này các Tỳ-khưu, hãy đứng ở một cửa nhà, mang một cái giường đến, khiêng thi thể này ra khỏi thành phố, hỏa táng và xây tháp.” Các Tỳ-khưu đã làm như vậy.
Katvā ca pana vihāraṃ gantvā satthāraṃ upasaṅkamitvā attanā katakiccaṃ ārocetvā tassa abhisamparāyaṃ pucchiṃsu.
Having done so, they went to the monastery, approached the Teacher, reported what they had done, and asked about Bāhiya’s destiny in the next world.
Sau khi hoàn thành, họ đến Tịnh xá, trình bày công việc đã làm với Đức Đạo Sư và hỏi về đời sau của vị ấy.
Atha nesaṃ bhagavā tassa parinibbutabhāvaṃ ācikkhi.
Then the Blessed One informed them of his parinibbāna.
Rồi Đức Thế Tôn đã nói cho họ biết về sự Niết-bàn của vị ấy.
Bhikkhū ‘‘tumhe, bhante, ‘bāhiyo dārucīriyo arahattaṃ patto’ti vadatha, kadā so arahattaṃ patto’’ti pucchiṃsu.
The bhikkhus asked, “Venerable Sir, you say that Bāhiya Dārucīriya attained arahantship. When did he attain arahantship?”
Các Tỳ-khưu hỏi: “Bạch Đức Thế Tôn, Ngài nói rằng Bāhiya Dārucīriya đã đạt A-la-hán quả. Khi nào thì vị ấy đạt A-la-hán quả?”
‘‘Mama dhammaṃ sutakāle’’ti ca vutte ‘‘kadā panassa tumhehi dhammo kathito’’ti?
When it was said, “At the time he heard my Dhamma,” they asked, “When, then, Venerable Sir, did you teach him the Dhamma?”
Khi được nói: “Vào lúc nghe Pháp của Ta”, họ lại hỏi: “Bạch Đức Thế Tôn, khi nào Ngài đã thuyết Pháp cho vị ấy?”
‘‘Piṇḍāya carantena ajjeva antaravīthiyaṃ ṭhatvā’’ti.
“Just today, while wandering for alms, standing in the middle of the street.”
“Hôm nay, khi Ta đang khất thực, đứng giữa đường phố.”
‘‘Appamattako so, bhante, tumhehi antaravīthiyaṃ ṭhatvā kathitadhammo, kathaṃ so tāvatakena visesaṃ nibbattesī’’ti?
“Venerable Sir, the Dhamma taught by you while standing in the middle of the street was very brief. How could he have achieved such a special attainment with so little?”
“Bạch Đức Thế Tôn, Pháp mà Ngài thuyết khi đứng giữa đường phố thật ít ỏi, làm sao vị ấy có thể đạt được sự ưu việt (visesa) như vậy chỉ với bấy nhiêu Pháp?”
‘‘Kiṃ, bhikkhave, mama dhammaṃ ‘appaṃ vā bahuṃ vā’ti pamiṇatha, anekāni gāthāsahassānipi anatthasaṃhitāni na seyyo, atthanissitaṃ pana ekampi gāthāpadaṃ seyyo’’ti dassento –
“Bhikkhus, why do you measure my Dhamma as ‘little or much’? Even thousands of verses that are not connected with the goal are not superior. But a single verse connected with the goal is superior,” intending to show this, he said –
Để chỉ ra rằng: “Này các Tỳ-khưu, các ông đo lường Pháp của Ta là ‘ít hay nhiều’ ư? Ngàn câu kệ không liên quan đến lợi ích cũng không bằng, nhưng một câu kệ có liên quan đến lợi ích thì tốt hơn,” Ngài đã nói:
Tattha pacchābhattanti bhattakiccato pacchā.
There, pacchābhattaṃ means after the meal.
Ở đây, pacchābhattaṃ có nghĩa là sau bữa ăn.
Piṇḍapātapaṭikkantoti piṇḍapātapariyesanato paṭinivatto.
Piṇḍapātapaṭikkanto means returned from seeking almsfood.
Piṇḍapātapaṭikkanto có nghĩa là trở về từ việc khất thực.
Padadvayenāpi katabhattakiccoti vuttaṃ hoti.
By both terms, it is meant that he had completed his meal.
Cả hai từ này đều có nghĩa là đã hoàn tất bữa ăn.
Nīharitvāti nagarato bahi netvā.
Nīharitvā means having carried it out of the city.
Nīharitvā có nghĩa là mang ra ngoài thành phố.
Jhāpethāti dahatha.
Jhāpethā means burn it.
Jhāpethā có nghĩa là hãy hỏa táng.
Thūpañcassa karothāti assa bāhiyassa sarīradhātuyo gahetvā cetiyañca karotha.
Thūpañcassa karothā means, having taken Bāhiya's bodily relics, build a cetiya for him.
Thūpañcassa karothā có nghĩa là hãy lấy xá lợi của Bāhiya và xây tháp cho ngài.
Tattha kāraṇamāha – ‘‘sabrahmacārī vo, bhikkhave, kālakato’’ti.
There, he stated the reason: “Bhikkhus, your fellow monastic has passed away.”
Ở đây, nguyên nhân được nói là: “Này các Tỳ-khưu, vị đồng Phạm hạnh của các ông đã qua đời.”
Tassattho – yaṃ tumhe seṭṭhaṭṭhena brahmaṃ adhisīlādipaṭipattidhammaṃ sandiṭṭhaṃ caratha, taṃ so tumhehi samānaṃ brahmaṃ acarīti sabrahmacārī maraṇakālassa pattiyāva kālakato, tasmā taṃ mañcakena nīharitvā jhāpetha, thūpañcassa karothāti.
The meaning of this is: That supreme holy practice, the Dhamma of moral conduct and other practices which you, O monks, observe in its noble sense—that holy practice was observed by Bāhiya, equal to you. Thus, he, your fellow monastic, has passed away, having reached the time of death. Therefore, carry his body out on a cot, cremate it, and erect a stupa for him.
Ý nghĩa của câu đó là: Phạm hạnh (brahma) mà các ông đang thực hành, tức là pháp hạnh của giới hạnh tối thượng (adhisīla) v.v., thì vị ấy cũng đã thực hành Phạm hạnh tương tự như các ông. Vì vậy, vị đồng Phạm hạnh (sabrahmacārī) đã qua đời (kālakato) do đã đến lúc chết. Do đó, hãy mang thi thể ấy bằng cáng ra ngoài và hỏa táng, rồi xây tháp cho vị ấy.
Paṇḍitoti aggamaggapaññāya adhigatattā paṇḍena ito gato pavattoti paṇḍito.
Paṇḍito means wise, because he attained wisdom of the highest path and proceeded with wisdom.
Paṇḍito có nghĩa là người trí (paṇḍito) vì đã đạt được trí tuệ con đường tối thượng (aggamaggapaññāya), tức là đã đi (ito gato) với trí tuệ (paṇḍena) đó.
Paccapādīti paṭipajji.
Paccapādī means he practiced.
Paccapādī có nghĩa là đã thực hành.
Dhammassāti lokuttaradhammassa.
Dhammassā means of the Supramundane Dhamma.
Dhammassā có nghĩa là Pháp siêu thế (lokuttaradhamma).
Anudhammanti sīlavisuddhiādipaṭipadādhammaṃ.
Anudhammaṃ means the Dhamma of practice, such as purification of morality.
Anudhammaṃ có nghĩa là pháp hạnh của sự thanh tịnh giới (sīlavisuddhi) v.v.
Atha vā dhammassāti nibbānadhammassa.
Or dhammassā means of the Dhamma of Nibbāna.
Hoặc, dhammassā có nghĩa là pháp Niết-bàn.
Anudhammanti ariyamaggaphaladhammaṃ.
Anudhammaṃ means the Dhamma of the Ariyan Path and Fruition, which is in accordance with it.
Anudhammaṃ có nghĩa là pháp của Thánh đạo và Thánh quả.
Na ca maṃ dhammādhikaraṇanti dhammadesanāhetu na ca maṃ vihesesi yathānusiṭṭhaṃ paṭipannattā.
Na ca maṃ dhammādhikaraṇaṃ means he did not trouble me on account of the Dhamma discourse, because he practiced as instructed.
Na ca maṃ dhammādhikaraṇaṃ có nghĩa là vì đã thực hành đúng như được dạy, nên không làm khổ Ta vì lý do thuyết pháp.
Yo hi satthu santike dhammaṃ sutvā kammaṭṭhānaṃ vā gahetvā yathānusiṭṭhaṃ na paṭipajjati, so satthāraṃ viheseti nāma.
Indeed, one who, having heard the Dhamma or received a meditation subject from the Teacher, does not practice as instructed, is said to trouble the Teacher.
Vì một người nào đó sau khi nghe Pháp hoặc nhận đề mục thiền (kammaṭṭhāna) từ Đức Đạo Sư mà không thực hành đúng như được dạy, thì người đó được gọi là làm khổ Đức Đạo Sư.
Yaṃ sandhāya vuttaṃ – ‘‘vihiṃsasaññī paguṇaṃ na bhāsiṃ, dhammaṃ paṇītaṃ manujesu brahme’’ti (mahāva. 9; ma. ni. 1.283; 2.339).
Referring to this, it is said: "Thinking that I would weary myself, O Brahmā, I did not speak the profound Dhamma to men."
Liên quan đến điều đó, đã nói: “Vihiṃsasaññī paguṇaṃ na bhāsiṃ, dhammaṃ paṇītaṃ manujesu brahme” (Mahāva. 9; Ma. Ni. 1.283; 2.339).
Atha vā na ca maṃ dhammādhikaraṇanti na ca imaṃ dhammādhikaraṇaṃ.
Alternatively, na ca maṃ dhammādhikaraṇaṃ means nor did he harass this matter of Dhamma.
Hoặc, na ca maṃ dhammādhikaraṇaṃ có nghĩa là không làm khổ Ta với vấn đề Pháp này.
Idaṃ vuttaṃ hoti – vaṭṭadukkhato niyyānahetubhūtaṃ imaṃ mama sāsanadhammaṃ suppaṭipannattā na viheseti.
This is what is meant: He did not trouble this Dhamma of my Teaching, which is the cause of liberation from the suffering of saṃsāra, because he practiced correctly.
Điều này có nghĩa là: Ông ấy không làm tổn hại đến giáo pháp này của ta, vốn là nguyên nhân dẫn đến sự thoát ly khỏi khổ luân hồi, vì ông ấy đã thực hành đúng đắn.
Duppaṭipanno hi sāsanaṃ bhindanto satthu dhammasarīre pahāraṃ deti nāma.
Indeed, one who practices wrongly, by breaking the Dispensation, is said to strike the Dhamma-body of the Teacher.
Thật vậy, kẻ thực hành sai lầm, khi phá hoại giáo pháp, được gọi là kẻ gây tổn hại đến Pháp thân của Đức Đạo Sư.
Ayaṃ pana sammāpaṭipattiṃ matthakaṃ pāpetvā anupādisesāya nibbānadhātuyā parinibbāyi.
But this one brought his right practice to its culmination and attained parinibbāna with the anupādisesa Nibbāna-dhātu.
Còn vị này, sau khi hoàn thành sự thực hành đúng đắn, đã nhập Niết-bàn với Niết-bàn giới không còn dư y.
Tena vuttaṃ – ‘‘parinibbuto, bhikkhave, bāhiyo dārucīriyo’’ti.
Therefore it is said, " Bāhiya Dārucīriya, bhikkhus, has attained parinibbāna.”
Vì vậy, đã nói: “Này các Tỳ-kheo, Bāhiya Dārucīriya đã nhập Niết-bàn.”
Tattha yatthāti yasmiṃ nibbāne āpo ca na gādhati, pathavī ca tejo ca vāyo ca na gādhati, na patiṭṭhāti.
In this regard, “ wherein” means: in that Nibbāna, water does not gain a footing, nor do earth, fire, or air gain a footing; they do not stand firm.
Trong đó, nơi mà là nơi Niết bàn ấy nước không đứng, đất, lửa và gió cũng không đứng, không an trú.
Nibbānassa asaṅkhatasabhāvattā.
Because Nibbāna is of an unconditioned nature (asaṅkhata-sabhāva).
Vì Niết bàn có bản chất là vô vi (asaṅkhata).
Na hi tattha saṅkhatadhammānaṃ lesopi sambhavati.
Indeed, not even a trace of conditioned phenomena can exist there.
Thật vậy, ở đó không thể có dù chỉ một chút pháp hữu vi.
Sukkāti sukkavaṇṇatāya sukkāti laddhanāmā gahanakkhattatārakā.
“ Sukkā” means: the celestial bodies and stars, so named because of their white color.
Sukkā là các vì sao, chòm sao được gọi là Sukkā (trắng) vì có màu trắng.
Na jotantīti na bhāsanti.
“ Do not shine” means: do not blaze forth.
Không chiếu sáng là không tỏa sáng.
Ādicco nappakāsatīti tīsu dīpesu ekasmiṃ khaṇe ālokapharaṇasamattho ādiccopi ābhāvasena na dibbati.
“ The sun does not illuminate” means: even the sun, which is capable of spreading light over the three continents at once, does not shine due to its non-existence there.
Mặt trời không chiếu rọi là ngay cả mặt trời, có khả năng chiếu sáng khắp ba cõi trong một khoảnh khắc, cũng không tỏa sáng vì không có ánh sáng.
Na tattha candimā bhātīti satipi bhāsurabhāve kantasītalakiraṇo candopi tasmiṃ nibbāne abhāvato eva attano juṇhāvibhāsanena na virocati.
“ Nor does the moon radiate there” means: even the moon, with its beautiful cool rays, though luminous, does not shine with its moonlight there because of its non-existence in that Nibbāna.
Ở đó mặt trăng không chiếu rọi là dù có ánh sáng rực rỡ, mặt trăng với những tia sáng dịu mát, cũng không chiếu rọi ở Niết bàn ấy vì không tồn tại, do đó không thể chiếu sáng ánh trăng của mình.
Yadi tattha candimasūriyādayo natthi, lokantaro viya niccandhakārameva taṃ bhaveyyāti āsaṅkaṃ sandhāyāha ‘‘tamo tattha na vijjatī’’ti.
If the moon and sun do not exist there, it would be perpetually dark, like an inter-cosmic hell (lokantaro), anticipating this doubt, it is said: “ Darkness is not found there.”
Nếu ở đó không có mặt trăng, mặt trời và các vì sao, thì nơi ấy sẽ hoàn toàn tối tăm như một thế giới khác, do dự đoán đó mà Đức Thế Tôn nói: “Ở đó không có bóng tối.”
Sati hi rūpābhāve tamo nāma na siyā.
For if there were no form (rūpa), there would be no darkness.
Thật vậy, nếu không có sắc, thì không thể có bóng tối.
Yadā ca attanā vedi, muni monena brāhmaṇoti catusaccamunanato monanti laddhanāmena maggañāṇena kāyamoneyyādīhi ca samannāgatattā ‘‘munī’’ti laddhanāmo ariyasāvakabrāhmaṇo teneva monasaṅkhātena paṭivedhañāṇena yadā yasmiṃ kāle aggamaggakkhaṇe attanā sayameva anussavādike pahāya attapaccakkhaṃ katvā nibbānaṃ vedi paṭivijjhi.
“ When the sage, the brāhmaṇa, knew by silence (mona) for himself” means: the noble disciple brāhmaṇa, named “sage” (munī) due to being endowed with body-silence (kāyamoneyya) and so forth, and named “silence” (mona) because of knowing the four Noble Truths, when, at the moment of the highest Path, by that wisdom of penetration called mona, he himself, abandoning hearsay and other sources, directly perceived Nibbāna.
Khi vị ẩn sĩ, bậc Bà-la-môn đã tự mình biết bằng sự tịch tịnh là khi nào, vào lúc nào, trong khoảnh khắc của đạo quả tối thượng, vị Bà-la-môn đệ tử Thánh được gọi là "ẩn sĩ" (muni) vì tu tập bốn Chân lý, và được gọi là "Bà-la-môn" vì thành tựu sự tịch tịnh thân (kāyamoneyya) và các đức hạnh khác, đã tự mình từ bỏ sự nghe truyền và các điều tương tự, tự mình chứng nghiệm và biết rõ, thấu hiểu Niết bàn bằng trí tuệ thấu đạt gọi là sự tịch tịnh ấy.
‘‘Avedī’’tipi pāṭho, aññāsīti attho.
“ Avedī” is also a reading, meaning “he understood.”
Cũng có bản đọc là "Avedī", nghĩa là đã biết.
Atha rūpā arūpā ca, sukhadukkhā pamuccatīti athāti tassa nibbānassa jānanato pacchā.
“ Then from forms and formlessness, from pleasure and pain, he is released” means: “ then” refers to after knowing that Nibbāna.
Rồi thoát khỏi sắc và vô sắc, khỏi khổ và lạc là rồi là sau khi biết Niết bàn ấy.
Rūpāti rūpadhammā, tena pañcavokārabhavo ekavokārabhavo ca gahito hoti.
“ From forms” refers to rūpa-dhamma; thereby, the five-constituent existence (pañcavokārabha-va) and the single-constituent existence (ekavokārabha-va) are included.
Sắc là các pháp sắc, qua đó bao gồm cõi ngũ uẩn (pañcavokārabhava) và cõi nhất uẩn (ekavokārabhava).
Arūpāti arūpadhammā, tena rūpenāmissīkato arūpabhavo gahito hoti.
“ From formlessness” refers to arūpa-dhamma; thereby, the arūpa-bhava, unmixed with rūpa, is included.
Vô sắc là các pháp vô sắc, qua đó bao gồm cõi vô sắc (arūpabhava) không lẫn lộn với sắc.
So ‘‘catuvokārabhavo’’tipi vuccati.
That is also called the “four-constituent existence” (catuvokārabha-va).
Cõi đó cũng được gọi là "cõi tứ uẩn" (catuvokārabhavo).
Sukhadukkhāti sabbattha uppajjanakasukhadukkhatopi vaṭṭato.
“ From pleasure and pain” refers to being free from the pleasure and pain that arise everywhere in saṃsāra.
Khổ và lạc là thoát khỏi vòng luân hồi, ngay cả khỏi khổ và lạc phát sinh ở khắp mọi nơi.
Atha vā rūpāti rūpalokapaṭisandhito.
Alternatively, “ from forms” refers to rebirth in the form realm (rūpaloka-paṭisandhi).
Hoặc sắc là từ sự tái sinh ở cõi sắc.
Arūpāti arūpalokapaṭisandhito.
“ From formlessness” refers to rebirth in the formless realm (arūpaloka-paṭisandhi).
Vô sắc là từ sự tái sinh ở cõi vô sắc.
Sukhadukkhāti kāmāvacarapaṭisandhito.
“ From pleasure and pain” refers to rebirth in the sense-desire realm (kāmāvacara-paṭisandhi).
Khổ và lạc là từ sự tái sinh ở cõi dục giới.
Kāmabhavo hi byāmissasukhadukkho.
For the sense-desire existence (kāmabhava) is mixed with pleasure and pain.
Thật vậy, cõi dục là nơi có khổ và lạc lẫn lộn.
Evametasmā sakalatopi vaṭṭato accantameva muccatīti gāthādvayenapi bhagavā ‘‘mayhaṃ puttassa bāhiyassa evarūpā nibbānagatī’’ti dasseti.
Thus, by these two verses, the Blessed One shows that “such is the destination of my son, Bāhiya’s Nibbāna.”
Như vậy, qua hai câu kệ này, Đức Thế Tôn cho thấy: "Nơi đến Niết bàn của con trai Ta, Bāhiya, là như thế này."