Table of Contents

Sīlakkhandhavagga-abhinavaṭīkā-2

Edit
532
Addhānagamanavaṇṇanā
Commentary on the Journey
Giải thích về cuộc hành trình
533
254. Evaṃ sāmaññaphalasuttaṃ saṃvaṇṇetvā idāni ambaṭṭhasuttaṃ saṃvaṇṇento yathānupubbaṃ saṃvaṇṇokāsassa pattabhāvaṃ vibhāvetuṃ, sāmaññaphalasuttassānantaraṃ saṅgītassa suttassa ambaṭṭhasuttabhāvaṃ pakāsetuṃ ‘‘evaṃ me sutaṃ…pe… kosalesūti ambaṭṭhasutta’’nti āha.
Having thus commented on the Sāmaññaphalasutta, the commentator now, intending to comment on the Ambaṭṭhasutta, and to make clear that the occasion for commentary has arrived in due order, and to announce that the Sutta recited after the Sāmaññaphalasutta is the Ambaṭṭhasutta, said: “Evaṃ me sutaṃ…pe… Kosalesūti Ambaṭṭhasuttaṃ” (Thus have I heard... etc., Kosala - this is the Ambaṭṭhasutta).
254. Sau khi giải thích Sāmaññaphala Sutta như vậy, bây giờ để giải thích Ambaṭṭha Sutta, và để làm rõ rằng thời điểm thích hợp để giải thích theo thứ tự đã đến, cũng như để công bố rằng Sutta được tụng sau Sāmaññaphala Sutta là Ambaṭṭha Sutta, vị Luận sư đã nói: “evaṃ me sutaṃ…pe… kosalesūti ambaṭṭhasutta” (Tôi đã nghe như vầy… tại xứ Kosala, đó là Ambaṭṭha Sutta).
Evamīdisesu.
Thus in such suttas.
Trong những Sutta tương tự như vậy.
Itisaddo cettha ādiattho, padatthavipallāsajotako pana itisaddo luttaniddiṭṭho, ādisaddalopo vā esa, upalakkhaṇaniddeso vā.
Here, the word “iti” has the meaning of 'and so on'. The word "iti" which indicates a reversal of meaning is elliptically expressed, or it is an elision of the word "ādi", or it is an indication by way of illustration.
Ở đây, từ “iti” có nghĩa là “vân vân”, còn từ “iti” biểu thị sự đảo ngữ của từ ngữ thì bị lược bỏ, hoặc đó là sự lược bỏ của từ “ādi” (vân vân), hoặc là sự chỉ định theo cách biểu trưng.
Apubbapadavaṇṇanā nāma heṭṭhā aggahitatāya apubbassa padassa atthavibhajanā.
"Apubbapadavaṇṇanā" (commentary on previously unmentioned terms) means the explanation of the meaning of a new term because it has not been taken up before.
“Apubbapadavaṇṇanā” có nghĩa là giải thích ý nghĩa của một từ chưa được đề cập trước đây.
‘‘Hitvā punappunāgata-matthaṃ atthaṃ pakāsayissāmī’’ti (dī. ni. aṭṭha. 1.ganthārambhakathā) hi vuttaṃ, ‘‘anupubbapadavaṇṇanā’’ti katthaci pāṭho, so ayuttova ṭīkāya anuddhaṭattā, tathā asaṃvaṇṇitattā ca.
For it was stated: "Having omitted repeated meanings, I will elucidate meaning after meaning." Some readings have "anupubbapadavaṇṇanā" (commentary on terms in due order), but that is inappropriate as it is not cited in the Ṭīkā and is not commented upon in that way.
Thật vậy, đã nói trong Nidānakathā của Chú giải Dīgha Nikāya: “Tôi sẽ giải thích từng ý nghĩa, bỏ qua những ý nghĩa đã được lặp đi lặp lại.” Ở một số bản, có đọc là “anupubbapadavaṇṇanā” (giải thích từng từ theo thứ tự), nhưng cách đọc đó không hợp lý vì không được trích dẫn trong Tīkā và cũng không được giải thích như vậy.
534
‘‘Rājakumārā gottavasena kosalā nāmā’’ti (dī. ni. ṭī. 1.254) ācariyena vuttaṃ.
The Teacher said: “The princes are named Kosalas by lineage.”
Vị Luận sư đã nói: “Các vị hoàng tử theo dòng họ được gọi là Kosala.”
Akkharacintakā pana vadanti ‘‘kosaṃ lanti gaṇhanti, kusalaṃ vā pucchantīti kosalā’’ti.
But grammarians say: “They gather (lanti) a treasury (kosaṃ), or they inquire (pucchanti) about what is skillful (kusalaṃ); therefore, they are Kosalas.”
Tuy nhiên, các nhà ngữ pháp lại nói rằng: “Họ gom góp kho tàng (kosaṃ lanti), hoặc hỏi về sự khéo léo (kusalaṃ pucchanti), nên được gọi là Kosala.”
Janapadinoti janapadavanto, janapadassa vā issarā.
Janapadino means those who possess districts, or rulers of districts.
Janapadino có nghĩa là những người có xứ sở, hoặc là những người cai quản xứ sở.
‘‘Kosalā nāma rājakumārā’’ti vutteyeva siddhepi ‘‘janapadino’’ti vacanaṃ santesupi aññesu taṃtaṃnāmapaññātesu tattha nivasantesu janapadibhāvato tesameva nivasanamupādāya janapadassāyaṃ samaññāti dassanatthaṃ.
Even though it is established by saying "rājakumārā Kosalā nāma" (princes named Kosalas), the statement "janapadino" is made to show that this designation of the district arises from the dwelling of these very people, because they are district-dwellers (janapadino), even when there are others known by those names who reside there.
Dù đã rõ khi nói “các vị hoàng tử tên là Kosala”, nhưng việc thêm từ “janapadino” là để chỉ rõ rằng tên gọi này của xứ sở là do sự cư trú của chính những vị hoàng tử đó, mặc dù có những người khác cũng sống ở đó và được biết đến với những tên gọi khác.
‘‘Tesaṃ nivāso’’ti iminā ‘‘kosalānaṃ nivāsā kosalā’’ti taddhitaṃ dasseti.
By “Tesaṃ nivāso” (Their dwelling place), the Taddhita suffix (in Kosala) is shown to mean “the dwelling place of the Kosalas is Kosala.”
Với câu “Tesaṃ nivāso” (nơi cư trú của họ), từ này cho thấy sự biến cách taddhita: “Kosala là nơi cư trú của các vị Kosala.”
‘‘Ekopi janapado’’ti iminā pana saddatoyevetaṃ puthuvacanaṃ, atthato panesa eko evāti vibhāveti.
By “Ekopi janapado” (even one district), it is clarified that this plural form is merely linguistic, but in reality, it is only one district.
Tuy nhiên, với câu “Ekopi janapado” (dù chỉ một xứ sở), câu này làm rõ rằng về mặt từ ngữ, đó là số nhiều, nhưng về mặt ý nghĩa, đó chỉ là một xứ sở.
Api-saddo cettha anuggahe, tena kāmaṃ ekoyevesa janapado, tathāpi iminā kāraṇena puthuvacanamupapannanti anuggaṇhāti.
Here, the word “api” is for emphasis. By it, although this district is indeed one, still, due to this reason, the plural form is admissible—this is emphasized.
Ở đây, từ “api” có ý nghĩa hỗ trợ, theo đó, mặc dù xứ sở này chỉ là một, nhưng vì lý do này, số nhiều vẫn được chấp nhận.
Yadi ekova janapado, kathaṃ tattha bahuvacananti āha ‘‘ruḷhisaddenā’’tiādi, ruḷhisaddattā bahuvacanamupapannanti vuttaṃ hoti.
If it is only one district, how can there be a plural form there? He replies by saying “ruḷhisaddena” (by common usage), and so on, meaning that the plural form is admissible due to common usage.
Nếu chỉ là một xứ sở, tại sao lại dùng số nhiều ở đó? Vị Luận sư đã nói: “ruḷhisaddenā” (theo cách dùng thông thường), v.v. Điều đó có nghĩa là do cách dùng thông thường, số nhiều là hợp lý.
Nissitesu payuttassa puthuvacanassa, puthubhāvassa vā nissaye abhiniropanā idha ruḷhi, tena vuttaṃ ācariyena idha ceva aññattha ca majjhimāgamaṭīkādīsu ‘‘akkharacintakā hi īdisesu ṭhānesu yutte viya īdisaliṅgavacanāni icchanti, ayamettha ruḷhi yathā ‘aññatthāpi kurūsu viharati, aṅgesu viharatī’ti cā’’ti.
Here, ruḷhi (common usage) refers to the imputation of the plural form or plurality to the substratum (nissaya) when the plural is used with those who are dependent. Therefore, the Teacher said here and elsewhere, such as in the Majjhimāgamaṭīkā, that “grammarians desire such genders and numbers in such places, just as they would consider appropriate, and this is the common usage here, as in ‘he dwells in the Kurus elsewhere,’ and ‘he dwells in the Aṅgas,’ and so on.”
Ở đây, “ruḷhi” (cách dùng thông thường) là sự gán ghép số nhiều, hoặc sự đa dạng, vào một từ chỉ sự nương tựa, được dùng cho những đối tượng nương tựa. Do đó, vị Luận sư đã nói ở đây và ở những nơi khác, như trong Majjhimāgamaṭīkā, v.v.: “Thật vậy, các nhà ngữ pháp mong muốn những giới tính và số từ như vậy là hợp lý ở những trường hợp như thế này; đây là cách dùng thông thường ở đây, giống như ‘aññatthāpi kurūsu viharati, aṅgesu viharatī’ti cā” (cũng ở những nơi khác, Ngài trú tại xứ Kuru, Ngài trú tại xứ Aṅga).
Keci pana kosalanāmābhiniropanamicchanti, ayuttametaṃ puthuvacanassa appayujjitabbattā.
Some, however, desire the attribution of the name Kosala, but this is inappropriate because the plural form should not be used.
Tuy nhiên, một số người lại muốn gán ghép tên gọi Kosala, nhưng điều này không hợp lý vì không nên dùng số nhiều.
Nāmābhiniropanāya hi ekavacanampi bhavati yathā ‘‘sīho gāyatī’’ti.
For the attribution of a name, even the singular form is used, as in “the lion sings.”
Thật vậy, đối với sự gán ghép tên gọi, số ít cũng có thể được dùng, ví dụ như “sīho gāyatī” (con sư tử hát).
Tabbisesitepi janapadasadde jātisaddattā ekavacanameva.
Even when the word janapada (district) is specified by that (Kosala), it remains in the singular form because it is a generic term.
Ngay cả khi từ “janapada” được xác định bởi từ đó, nó vẫn là số ít vì là từ chỉ loài.
Tenāha ‘‘tasmiṃ kosalesu janapade’’ti, kosalanāmake tasmiṃ janapadeti attho.
Therefore, he said, “tasmiṃ kosalesu janapade” (in that district of Kosala), meaning in that district named Kosala.
Do đó, vị Luận sư đã nói: “tasmiṃ kosalesu janapade” (tại xứ sở Kosala đó), có nghĩa là tại xứ sở tên là Kosala đó.
Abhūtato hi vohāramattaṃ ruḷhi, bhūtatoyeva attho vinicchinitabbo.
For common usage (ruḷhi) is merely a conventional expression from what is unreal, but the meaning should be determined from what is real.
Thật vậy, “ruḷhi” chỉ là một cách gọi không có thật, ý nghĩa phải được xác định từ sự thật.
Yathā hi –
Just as—
Giống như –
535
‘‘Santi puttā videhānaṃ, dīghāvu raṭṭhavaḍḍhano;
“The Videhas have sons, Dīghāvu, the increaser of the kingdom;
“Các con của Videha, Dīghāvu và Raṭṭhavaḍḍhana, đang có mặt;
536
Te rajjaṃ kārayissanti, mithilāyaṃ pajāpatī’’ti.(jā. 2.22.276) ādīsu –
They will rule the kingdom in Mithilā as sovereigns.” and so on—
Chúng sẽ cai trị vương quốc tại Mithilā, hỡi Pajāpatī.” (Jā. 2.22.276) và những câu tương tự –
537
Taṃputtasaṅkhātassa ekatthassa ruḷhivasena ‘‘puttā’’ti bahuvacanapayogo, tathā idhāpi tannivāsasaṅkhātassa ekatthassa ruḷhivasena ‘‘kosalesū’’ti bahuvacanapayogo hoti.
Here, the plural form “puttā” (sons) is used by convention for a single meaning, namely, "their son." Similarly, here too, the plural form “kosalesu” is used by convention for a single meaning, namely, "their dwelling place."
Ở đó, từ “puttā” (các con) được dùng ở số nhiều theo cách dùng thông thường cho một ý nghĩa duy nhất là “những người con đó”. Tương tự, ở đây, từ “kosalesu” (tại xứ Kosala) cũng được dùng ở số nhiều theo cách dùng thông thường cho một ý nghĩa duy nhất là “nơi cư trú của họ”.
Yathā ca ‘‘pāṇaṃ na haññe, na ca’dinnamādiye’’tiādīsu (a. ni. 8.42, 43, 45) jātivasena bahvatthānamekavacanapayogo, tathā idhāpi jātivasena avayavappabhedena bahvatthassa ‘‘janapade’’ti ekavacanapayogo hoti.
And just as in “One should not harm a living being, nor take what is not given,” and so on, the singular form is used for many meanings due to the generic sense, so too here, the singular form “janapade” (in the district) is used for a multitude of meanings due to specific parts in a generic sense.
Và giống như trong “pāṇaṃ na haññe, na ca’dinnamādiye” (không nên sát sinh, cũng không nên lấy của không cho) và những câu tương tự, từ số ít được dùng cho nhiều ý nghĩa theo cách chỉ chung loại; tương tự, ở đây, từ “janapade” (tại xứ sở) cũng được dùng ở số ít cho một ý nghĩa có nhiều phần tử theo cách chỉ chung loại.
Vuttañca ācariyena majjhimāgamaṭīkāyaṃ ‘‘tabbisesanepi janapadasadde jātisadde ekavacanameva.
And the Teacher said in the Majjhimāgamaṭīkā: “Even in the word janapada, which is specified by that, it is in the singular form because it is a generic word.
Vị Luận sư cũng đã nói trong Majjhimāgamaṭīkā: “Ngay cả khi từ ‘janapada’ được xác định bởi từ đó, nó vẫn là số ít vì là từ chỉ loài.
Tenāha ‘tasmiṃ aṅgesu janapade’ti’’.
Therefore, he said, ‘in that district of Aṅga’.”
Do đó, Ngài đã nói ‘tasmiṃ aṅgesu janapade’ (tại xứ sở Aṅga đó).”
538
Evaṃ ruḷhivasena bahumhi viya vattabbe bahuvacanaṃ dassetvā idāni bahvatthavasena bahumpi eva vattabbe bahuvacanaṃ dassento ‘‘porāṇā panāhū’’tiādimāha.
Having thus shown the plural form used as if for many by common usage, he now begins by saying “Porāṇā panāhū” (The ancients, however, said), and so on, to show the plural form used for many based on multiple meanings.
Sau khi trình bày cách dùng số nhiều theo cách dùng thông thường, như thể nói về nhiều thứ, bây giờ để trình bày cách dùng số nhiều khi thực sự nói về nhiều ý nghĩa, vị Luận sư đã nói: “porāṇā panāhū” (nhưng các vị cổ đức đã nói), v.v.
Pana-saddo cettha visesatthajotano, tena puthuatthavisayatāya evetaṃ puthuvacanaṃ, na ruḷhivasenāti vakkhamānaṃ visesaṃ joteti.
Here, the word “pana” indicates a special meaning. By it, it illuminates the special point to be stated, namely, that this plural form (Kosalesu) refers to multiple objects, not merely common usage.
Ở đây, từ “pana” làm sáng tỏ ý nghĩa đặc biệt, theo đó, nó làm rõ sự đặc biệt sẽ được nói đến, rằng từ số nhiều này là do có nhiều ý nghĩa khác nhau, chứ không phải do cách dùng thông thường.
So hi padeso tiyojanasataparimāṇatāya bahuppabhedoti, imasmiṃ pana naye tesu kosalesu janapadesūti attho veditabbo.
For that region, being three hundred yojanas in extent, had many divisions. In this approach, therefore, the meaning should be understood as “in those districts of the Kosalas.”
Thật vậy, xứ sở đó có nhiều loại khác nhau với diện tích ba trăm dojana, và theo cách này, cần hiểu rằng ý nghĩa là “tại những xứ sở Kosala đó”.
Mahāpanādanti mahāpanādajātaka (jā. 1.3.40, 41, 42) surucijātakesu (jā. 1.14.102 ādayo) āgataṃ surucino nāma videharañño puttaṃ mahāpanādanāmakaṃ rājakumāraṃ.
Mahāpanādaṃ refers to the prince named Mahāpanāda, the son of King Suruci of Videha, as mentioned in the Mahāpanāda Jātaka and Suruci Jātaka.
Mahāpanāda là hoàng tử tên Mahāpanāda, con trai của vua Videha tên Suruci, được đề cập trong Mahāpanāda Jātaka và Suruci Jātaka.
Nānānāṭakānīti bhaṇḍukaṇḍapaṇḍukaṇḍapamukhāni chasatasahassāni nānāvidhanāṭakāni, katthaci pana ādisaddopi diṭṭho, so jātakaṭṭhakathāyaṃ na dissati, yadi ca dissati, tena naṭalaṅghakādīnaṃ saṅgaho daṭṭhabbo.
Nānānāṭakānīti refers to six hundred thousand performers of various kinds of plays, with Bhaṇḍukaṇḍa and Paṇḍukaṇḍa as their leaders. In some texts, however, the word ādi is also seen. It is not found in the Jātaka Commentary, but if it is seen, then the inclusion of dancers, acrobats, and so forth should be understood by that*.
Nānānāṭakānīti có nghĩa là sáu trăm ngàn loại hình biểu diễn khác nhau, do các diễn viên chính như Bhaṇḍukaṇḍa và Paṇḍukaṇḍa dẫn đầu. Ở một số bản, có thấy từ ādi (vân vân), nhưng trong Chú giải Jātaka thì không thấy. Nếu có thấy, thì nên hiểu rằng nó bao gồm cả các diễn viên nhào lộn và những người khác.
Sitamattampīti mihitamattampi.
Sitamattampīti means merely a smile.
Sitamattampīti có nghĩa là chỉ một nụ cười.
Tassa kira dibbanāṭakānaṃ anantarabhaveyeva diṭṭhattā manussanāṭakānaṃ naccaṃ amanuññaṃ ahosi.
It is said that because he had seen divine plays in his immediately preceding existence, human plays were not pleasing to him.
Nghe nói, vì hoàng tử ấy đã từng thấy các điệu múa của chư thiên trong kiếp sống ngay trước đó, nên điệu múa của con người trở nên không còn đẹp đẽ nữa.
Naṅgalānipi chaḍḍetvāti kasikammappahānavasena naṅgalāni pahāya, nidassanamattañcetaṃ.
Naṅgalānipi chaḍḍetvāti means by abandoning the act of tilling, having given up ploughs. This is merely an example.
Naṅgalānipi chaḍḍetvāti có nghĩa là từ bỏ cày bừa do từ bỏ công việc đồng áng. Đây chỉ là một ví dụ.
Na hi kevalaṃ kassakā eva, atha kho aññepi ubhayaraṭṭhavāsino manussā attano attano kiccaṃ pahāya tasmiṃ maṅgalaṭṭhāne sannipatiṃsu.
It was not only the farmers, but also other people residing in both countries who gave up their respective tasks and assembled at that auspicious place.
Không chỉ có những người nông dân, mà những người dân ở cả hai quốc gia khác cũng từ bỏ công việc của mình và tụ tập tại nơi lễ hội đó.
Tadā kira mahāpanādakumārassa pāsādamaṅgalaṃ, chattamaṅgalaṃ, āvāhamaṅgalanti tīṇi maṅgalāni ekato akaṃsu, kāsivideharaṭṭhavāsinopi tattha sannipatitvā atirekasattavassāni chaṇamanubhaviṃsūti, adhunā pana ‘‘naṅgalādīnī’’ti pāṭho dissati, so na porāṇapāṭho ṭīkāyamanuddhaṭattā.
At that time, it is said, three ceremonies—the ceremony of the palace, the ceremony of the parasol, and the wedding ceremony—were performed simultaneously for Prince Mahāpanāda. Even the residents of Kāsī and Videha assembled there and enjoyed the festival for more than seven years. Currently, however, the reading “naṅgalādīnī” (ploughs, etc.) is seen; this is not an ancient reading because it is not quoted in the Tīkā.
Khi đó, người ta đã tổ chức ba lễ hội cùng một lúc cho hoàng tử Mahāpanāda: lễ khánh thành cung điện, lễ đăng quang và lễ thành hôn. Người dân từ các xứ Kāsī và Videha cũng tụ tập ở đó và hưởng thụ lễ hội kéo dài hơn bảy năm. Hiện nay, có một bản đọc là "naṅgalādīnī" (cày bừa và những thứ khác), nhưng đó không phải là bản đọc cổ vì nó không được trích dẫn trong Chú giải.
539
Mahājanakāye sannipatiteti keci ‘‘pahaṃsanavidhiṃ dassetvā rājakumāraṃ hāsāpessāmā’’ti, keci ‘‘taṃ kīḷanaṃ passissāmā’’ti evaṃ mahājanasamūhe sannipatite.
Mahājanakāye sannipatiteti means when a large assembly of people had gathered, some thinking, “We will make the prince laugh by showing him entertaining displays,” and others thinking, “We will watch that performance.”
Mahājanakāye sannipatiteti có nghĩa là khi một đám đông lớn tụ tập, một số người nghĩ "chúng ta sẽ biểu diễn trò vui để làm hoàng tử cười", một số người nghĩ "chúng ta sẽ xem trò chơi đó".
Atulambābhiruhanadārucitakapavesanādi nānākīḷāyo dassetvā. Sakkapesito kira dibbanāṭako rājaṅgaṇe ākāse ṭhatvā upaḍḍhabhāgaṃ nāma dasseti, ekova hattho, eko pādo, ekaṃ akkhi, ekā dāṭhā naccati calati, upaḍḍhaṃ phandati, sesaṃ niccalamahosi, taṃ disvā mahāpanādo thokaṃ hasitamakāsi, imamatthaṃ sandhāya ‘‘so dibbanāṭakaṃ dassetvā hasāpesī’’ti vuttaṃ.
Nānākīḷāyo dassetvā means having shown various plays such as climbing an immensely tall mango tree and entering a wooden effigy. It is said that the divine dancer sent by Sakka stood in the sky in the royal courtyard and showed half of his body. Only one hand, one foot, one eye, and one tusk danced and moved; half of his body quivered, while the rest remained motionless. Seeing that, Mahāpanāda smiled slightly. Referring to this matter, it is said, “so dibbanāṭakaṃ dassetvā hasāpesī” (he made him laugh by showing him a divine play).
Nānākīḷāyo dassetvā (biểu diễn nhiều trò chơi khác nhau) như leo cây xoài cao vút, vào hình nộm gỗ, v.v. Nghe nói, diễn viên chư thiên do Sakkā (Đế Thích) phái đến đã đứng trên không trung tại sân hoàng cung và biểu diễn phần nửa thân: chỉ một tay, một chân, một mắt, một răng nanh cử động và nhảy múa; nửa thân còn lại bất động. Thấy vậy, Mahāpanāda đã cười một chút. Nhấn mạnh ý này, nên mới nói "so dibbanāṭakaṃ dassetvā hasāpesī" (người ấy đã làm cho cười bằng cách biểu diễn điệu múa của chư thiên).
Suhajjā nāma vissāsikā ‘‘suṭṭhu hadayametesa’’nti katvā.
Suhajjā are called intimate friends, because “they have good hearts” (suṭṭhu hadayametesaṃ).
Suhajjā là những người thân tín, vì "họ có trái tim tốt".
Ādisaddena ñātakaparijanādīnaṃ saṅgaho.
By the word ādi, relatives, attendants, and so forth are included.
Với từ Ādi (vân vân), bao gồm cả bà con, quyến thuộc, v.v.
Tasmāti tathā vacanato.
Tasmāti means because it was so (i.e., because of the aforementioned manner).
Tasmāti (do đó) là vì lý do ấy.
Taṃ kusalanti vacanaṃ upādāyāti ettha ‘‘kacci kusalaṃ?
Taṃ kusalanti vacanaṃ upādāyāti. In this regard, when asked, “Is all well (kacci kusalaṃ)?”
Taṃ kusalanti vacanaṃ upādāyāti (lấy lời "kusala" đó làm căn cứ), ở đây, khi hỏi "Kacci kusalaṃ?" (Có khỏe không?), họ đáp "Āma kusalaṃ" (Vâng, khỏe). Do sự trao đổi lời nói như vậy, những người ấy ban đầu đã được gọi là "kusalā" (người khỏe mạnh).
Āma kusala’’nti vacanapaṭivacanavasena pavattakusalavāditāya te manussā ādito ‘‘kusalā’’ti samaññaṃ labhiṃsu, tesaṃ kusalānaṃ issarāti rājakumārā kosalā nāma jātā, tesaṃ nivāsaṭṭhānatāya pana padeso kosalāti pubbe vuttanayameva.
and they replied, “Yes, all is well (āma kusalaṃ),” due to this exchange of words where they customarily used kusala, those people originally gained the designation “kusalā.” The princes, being the masters of these kusalā people, came to be known as Kosalā. And the region, being their dwelling place, was named Kosalā, in the manner explained previously.
Các hoàng tử là chủ nhân của những người kusala đó, nên họ được gọi là kosalā. Còn vùng đất đó được gọi là kosalā vì là nơi cư trú của họ, như đã nói trước đây.
Tenāha ‘‘so padeso kosalāti vuccatī’’ti.
Therefore, it is said, “So padeso kosalāti vuccati” (That region is called Kosalā).
Do đó, có câu "so padeso kosalāti vuccatī" (vùng đất đó được gọi là Kosalā).
Evaṃ majjhimāgamaṭīkāyaṃ ācariyeneva vuttaṃ.
Thus, it was stated by the venerable teacher in the Majjhimāgamaṭīkā.
Điều này đã được chính vị thầy nói trong Majjhimāgamaṭīkā.
Tatrāyamadhippāyo siyā – ‘‘so padeso kosalāti vuccatī’’ti saññīsaññā yathākkamaṃ ekavacanabahuvacanavasena vuttattā purimanaye viya idhāpi ruḷhivaseneva bahuvacanaṃ hoti.
The intention here might be: in "so padeso kosalāti vuccati," since the nominative and the predicated nouns are expressed in singular and plural respectively, the plural form is used due to common usage, as in the previous explanation.
Ở đây có thể có ý nghĩa là: "so padeso kosalāti vuccatī" (vùng đất đó được gọi là Kosalā) được nói với số ít và số nhiều theo thứ tự của danh từ và tên gọi, nên ở đây cũng dùng số nhiều theo cách dùng thông thường như trường hợp trước.
Rājakumārānaṃ nāmalābhahetumattañhettha visesoti.
The distinctive point here is merely the cause for the princes' gaining their name.
Sự khác biệt ở đây chỉ là nguyên nhân của việc các hoàng tử có được tên gọi.
Idha pana ācariyena evaṃ vuttaṃ so padesoti padesasāmaññato vuttaṃ, vacanavipallāsena vā, te padesāti attho.
However, here it is stated by the teacher, “so padeso” is said in a general sense of region, or due to a change in number (vacanavipallāsena vā), meaning "those regions."
Tuy nhiên, ở đây vị thầy đã nói như sau: so padeso được nói theo nghĩa chung của vùng đất, hoặc do sự đảo ngữ, có nghĩa là "những vùng đất đó".
Kosalāti vuccati kusalā eva kosalāti katvā’’ti (dī. ni. ṭī. 1.254) tatrāyamadhippāyo siyā – so padesoti jātisaddavasena, vacanavipallāsena vā vuttattā puthuatthavisayatāya eva bahuvacanaṃ hoti.
Kosalāti vuccati means "Kosalā are indeed Kusalā" (kusalā eva kosalāti katvā). The intention here might be: so padeso is said in the sense of a class-noun, or due to a change in number, hence the plural form is used precisely because it refers to multiple distinct entities.
Kosalāti vuccati (được gọi là Kosalā) vì "chính những người kusala là kosala". Ở đây có thể có ý nghĩa là: so padeso được nói theo nghĩa của danh từ chỉ chủng loại, hoặc do sự đảo ngữ, nên số nhiều xảy ra chỉ do sự đa dạng về ý nghĩa.
Padesassa nāmalābhahetu hettha visesoti.
The distinctive point here is the reason for the region's gaining its name.
Sự khác biệt ở đây là nguyên nhân của việc vùng đất có được tên gọi.
‘‘Kusala’’nti hi vacanamupādāya ruḷhināmavasena vuttanayena kosalā yathā ‘‘yevāpanakaṃ, natumhākavaggo’’ti.
The term "Kosalā" is derived from the word "kusala," signifying a common usage, similar to "yevāpanakaṃ, na tumhākavaggo."
Thật vậy, lấy từ "kusala" làm căn cứ, theo cách dùng thông thường, các Kosala cũng như "yevāpanakaṃ, natumhākavaggo" (chỉ là những thứ vặt vãnh, không phải nhóm của các người).
Apica vacanapaṭivacanavasena ‘‘kusala’’nti vadanti etthāti kosalā. Vicitrā hi taddhitavuttīti.
Furthermore, they are called Kosalā because they say "kusala" in their exchange of words. For, indeed, the formation of secondary derivatives (taddhitavutti) is diverse.
Hơn nữa, ở đây người ta nói "kusala" qua lại trong đối thoại, nên gọi là kosalā. Thật vậy, cách dùng của taddhita (hậu tố phái sinh) rất đa dạng.
Kusalanti ca ārogyaṃ ‘‘kacci nu bhoto kusalaṃ, kacci bhoto anāmaya’’ntiādīsu (jā. 1.15.145; jā. 2.20.129) viya, kacci tumhākaṃ ārogyaṃ hotīti attho, chekaṃ vā ‘‘kusalā naccagītassa, sikkhitā cāturitthiyo’’tiādīsu (jā. 2.22.94) viya, kacci tesaṃ nāṭakānaṃ chekatā hotīti attho.
And kusala means health, as in phrases like “kacci nu bhoto kusalaṃ, kacci bhoto anāmayaṃ” (is Master well, is Master healthy?), meaning, “Is health for you, Master?” Or it means skillful, as in “kusalā naccagītassa, sikkhitā cāturitthiyo” (the four trained women are skilled in dancing and singing), meaning, “Are those dancers skillful?”
kusala có nghĩa là sức khỏe, như trong các câu "kacci nu bhoto kusalaṃ, kacci bhoto anāmaya" (Thưa ngài có khỏe không, thưa ngài có bình an không?) có nghĩa là "ngài có khỏe không?". Hoặc có nghĩa là khéo léo, như trong các câu "kusalā naccagītassa, sikkhitā cāturitthiyo" (bốn người phụ nữ khéo léo trong ca múa) có nghĩa là "họ có khéo léo trong các điệu múa đó không?".
540
Caraṇaṃ cārikā, caraṇaṃ vā cāro, so eva cārikā, tayidaṃ maggagamanameva idhādhippetaṃ, na cuṇṇikagamanamattanti dassetuṃ ‘‘addhānagamana’’nti vuttaṃ, bhāvanapuṃsakañcetaṃ, addhānagamanasaṅkhātāya cārikāya caramānoti vuttaṃ hoti, abhedepi vā bhedavohārena vuttaṃ yathā ‘‘divāvihāraṃ nisīdī’’ti, (ma. ni. 1.256) addhānagamanasaṅkhātaṃ cārikaṃ caramāno, caraṇaṃ karontoti attho.
Moving about (caraṇaṃ) is cārikā; or moving about (caraṇaṃ) is cāra, and that very cāra is cārikā. To show that only travelling on a path is intended here, not just moving about gently, it is said “addhānagamanaṃ.” This is a gerundive in the neuter gender. Thus, it is said that he wanders on a pilgrimage (cārikā) which is called travelling a long distance. Or it is said by way of a distinction of speech where there is no distinction, as in “divāvihāraṃ nisīdī” (he sat down for a day's rest). Cārikaṃ caramāno means performing the act of wandering, which is called travelling a long distance.
Hành trình cārikā, hoặc hành trình là cāro, chính là cārikā đó. Để chỉ ra rằng ở đây ý muốn nói về việc đi đường dài, chứ không phải chỉ là việc đi lại nhẹ nhàng, đã nói "addhānagamanaṃ" (đi đường dài). Đây là danh từ hành động trung tính, có nghĩa là "đang đi trên con đường dài được gọi là cārikā". Hoặc, trong trường hợp không có sự phân biệt, được nói bằng cách dùng từ phân biệt, như "divāvihāraṃ nisīdī" (ngồi nghỉ ban ngày). Cārikaṃ caramāno (đang đi cārikā) là "đang thực hiện hành trình được gọi là đi đường dài", có nghĩa là "đang đi".
Sabbatthako hi karabhūdhātūnamatthoti.
For the root kar and bhū have meaning everywhere.
Thật vậy, các động từ karabhū có ý nghĩa bao quát.
‘‘Addhānamagga’’ntipi katthaci pāṭho, so na sundaro.
In some places, the reading is also “addhānamaggaṃ,” but that is not good.
Ở một số nơi, cũng có bản đọc là "addhānamaggaṃ", nhưng đó không phải là bản tốt.
Na hi cārikāsaddo maggavācakoti.
For the word cārikā does not denote a path.
Vì từ cārikā không có nghĩa là con đường.
Idāni taṃ vibhāgena dassetvā idhādhippetaṃ niyamento ‘‘cārikā ca nāmesā’’tiādimāha.
Now, showing it by way of distinction and specifying what is intended here, he states “cārikā ca nāmesā” and so forth.
Bây giờ, để trình bày rõ ràng điều đó và xác định ý nghĩa được mong muốn ở đây, đã nói "cārikā ca nāmesā" (và đây được gọi là cārikā), v.v.
Sāvakānampi ruḷhivasena cārikāya sambhavato tato viseseti ‘‘bhagavato’’ti iminā.
Since wandering (cārikā) can also apply to disciples by common usage, it is distinguished from that by the word “bhagavato.”
Vì các đệ tử cũng có thể đi cārikā theo nghĩa thông thường, nên đã phân biệt bằng từ "bhagavato" (của Đức Thế Tôn).
Tathā hi majjhimāgamaṭṭhakathāyaṃ vuttaṃ ‘‘cārikaṃ caramānoti ettha kiñcāpi ayaṃ cārikā nāma mahājanasaṅgahatthaṃ buddhānaṃyeva labbhati, buddhe upādāya pana ruḷhisaddena sāvakānampi vuccati kilañjādīhi katabījanīpi tālavaṇṭaṃ viyā’’ti.
Thus, it is stated in the Majjhimāgamaṭṭhakathā: “Regarding ‘cārikaṃ caramāno,’ although this wandering (cārikā) is available only to Buddhas for the purpose of benefiting many people, by conventional usage, it is also applied to disciples, just as a fan made of grass, etc., is also called a palm-leaf fan.”
Thật vậy, trong Majjhimāgamaṭṭhakathā đã nói: "Trong câu 'cārikaṃ caramāno' (đang đi cārikā), mặc dù cārikā này chỉ được dùng cho các vị Phật với mục đích giáo hóa chúng sinh, nhưng theo cách dùng thông thường, nó cũng được nói cho các đệ tử, giống như chiếc quạt được làm từ lá cây kilanja, v.v., cũng được gọi là quạt lá cọ."
Dūrepīti ettha pi-saddena, api-saddena vā nātidūrepīti sampiṇḍanaṃ tatthāpi cārikāsambhavato.
In dūrepīti, by the particle pi or api, it comprehensively indicates “not too far either,” since wandering is also possible there.
Trong câu Dūrepīti (ngay cả ở xa), với từ pi hoặc api, bao gồm cả "không quá xa", vì cārikā cũng có thể xảy ra ở đó.
Bodhaneyyapuggalanti catusaccapaṭivedhavasena bodhanārahapuggalaṃ.
Bodhaneyyapuggalaṃ means a person worthy of awakening through the penetration of the Four Noble Truths.
Bodhaneyyapuggalaṃ (người có thể được giác ngộ) là người xứng đáng được giác ngộ bằng cách thấu hiểu Tứ Thánh Đế.
Sahasā gamananti sīghagamanaṃ.
Sahasā gamanaṃ means swift going.
Sahasā gamanaṃ (đi nhanh) là đi mau lẹ.
‘‘Mahākassapassa paccuggamanādīsū’’ti vuttameva sarūpato dasseti ‘‘bhagavā hī’’tiādinā.
He graphically illustrates what was already stated in brief as “Mahākassapassa paccuggamanādīsu” (in the instances of going forth to meet Mahākassapa, etc.) with “bhagavā hī” and so forth.
Những điều đã nói như "Mahākassapassa paccuggamanādīsū" (việc đi đón Mahākassapa, v.v.) được trình bày chi tiết bằng cách bắt đầu bằng "bhagavā hī" (Thật vậy, Đức Thế Tôn), v.v.
Paccuggacchantoti paṭimukhaṃ gacchanto, paccuṭṭhahantoti attho.
Paccuggacchantoti means going forth to meet, that is, going to receive.
Paccuggacchantoti có nghĩa là "đi đối mặt", tức là "đi đón tiếp".
‘‘Tathā’’ti iminā ‘‘tiṃsayojana’’nti padamanukaḍḍhati.
By “Tathā,” the word “tiṃsayojana” (thirty yojanas) is drawn in.
Với từ "Tathā" (như vậy), kéo theo từ "tiṃsayojana" (ba mươi dojana).
Pakkusāti nāma gandhārarājā.
Pakkusāti is the name of the king of Gandhāra.
Pakkusāti là tên của vua Gandhāra.
Mahākappino nāma kukkuṭavatīrājā.
Mahākappino is the name of the king of Kukkuṭavatī.
Mahākappino là tên của vua Kukkuṭavatī.
Dhaniyo nāma koraṇḍaseṭṭhiputto gopo.
Dhaniyo is the name of the cowherd, the son of the treasurer Koraṇḍa.
Dhaniyo là người chăn bò, con trai của phú hộ Koraṇḍa.
541
Evaṃ dhammagarutākittanamukhena mahākassapapaccuggamanādīni (saṃ. ni. aṭṭha. 2.154) ekadesena dassetvā idāni vanavāsitissasāmaṇerassa vatthuṃ vitthāretvā cārikaṃ dassetuṃ ‘‘ekadivasa’’ntiādi āraddhaṃ.
Having thus shown the instances of going forth to meet Mahākassapa and so forth in part, by way of proclaiming respect for the Dhamma, he now begins with “ekadivasa” (one day) and so forth, to elaborate on the story of the novice Tissa of Vanavāsa and to explain the meaning of cārikā.
Sau khi trình bày một phần các sự kiện như việc đi đón Mahākassapa, v.v., thông qua việc tán dương sự tôn kính Pháp, bây giờ để trình bày cārikā bằng cách kể chi tiết câu chuyện về Tissa sāmaṇera sống trong rừng, đã bắt đầu bằng "ekadivasa" (một ngày nọ), v.v.
Ko panesa tissasāmaṇero nāma?
Who, then, is this novice Tissa?
Vậy Tissa sāmaṇera này là ai?
Sāvatthiyaṃ dhammasenāpatino upaṭṭhākakule jāto mahāpuñño ‘‘piṇḍapātadāyakatisso, kambaladāyakatisso’’ti ca pubbe laddhanāmo pacchā ‘‘vanavāsitisso’’ti pākaṭo khīṇāsavasāmaṇero.
He was a very meritorious arahant-novice who was born in Sāvatthī in the family of the lay supporter of the General of the Dhamma (Sāriputta Thera), previously named Piṇḍapātadāyaka Tissa and Kambaladāyaka Tissa, and later became famous as Vanavāsa Tissa.
Vị ấy là một sāmaṇera đã diệt tận lậu hoặc (khīṇāsava) nổi tiếng, sinh ra trong gia đình hộ độ của Pháp tướng (Dhammasenāpati) ở Sāvatthī, có phước báu lớn, trước đây được gọi là "Piṇḍapātadāyaka Tissa" (Tissa người cúng dường vật thực khất thực) và "Kambaladāyaka Tissa" (Tissa người cúng dường chăn mền), sau này được biết đến là "Vanavāsī Tissa" (Tissa người sống trong rừng).
Vitthāro dhammapade (dha. pa. aṭṭha. 1.74 vanavāsītissasāmaṇeravatthu).
The full account is in the Dhammapada.
Chi tiết được tìm thấy trong Dhammapada (Dhammapada Aṭṭhakathā 1.74, câu chuyện về Vanavāsī Tissa Sāmaṇera).
Ākāsagāmīhi saddhiṃ ākāseneva gantukāmo bhagavā ‘‘chaḷabhiññānaṃ ārocehī’’ti avoca.
The Blessed One, desiring to go by air with those who could travel through the air, said, “Inform those with the six supernormal powers.”
Đức Thế Tôn, vì muốn đi trên không trung cùng với các vị có thần thông (ākāsagāmī), đã nói: "Hãy báo cho các vị có sáu thắng trí (chaḷabhiññā) biết."
Tassāti tissasāmaṇerassa.
Tassāti means of the novice Tissa.
Tassā là của Tissa sāmaṇera.
Tanti bhagavantaṃ saddhiṃ bhikkhusaṅghena cīvaraṃ pārupantaṃ.
“That” refers to the Blessed One, together with the community of bhikkhus, wearing the robe.
Ta (nghĩa là) Đức Thế Tôn đang đắp y cùng với Tăng đoàn tỳ khưu.
No thero no oramattako vatāti sambandho, guṇena lāmakappamāṇiko no hotīti attho.
“Not an elder, not one of mean measure” is the connection; the meaning is that he is not an elder of base standing in terms of virtue.
Có sự liên kết là: “Vị Trưởng lão của chúng ta không phải là người thấp kém”. Ý nghĩa là: Ngài không phải là một Trưởng lão có phẩm hạnh thấp kém.
542
Attano pattāsaneti bhikkhūnaṃ āsanapariyante.
“In his own appointed seat” means at the edge of the bhikkhus’ seating.
Attano pattāsane (nghĩa là) ở rìa chỗ ngồi của các tỳ khưu.
Tesaṃ gāmikānaṃ dānapaṭisaṃyuttaṃ maṅgalaṃ vatvā. Kasmā pana sadevakassa lokassa maggadesakopi samāno bhagavā evamāhāti codanaṃ sodhetuṃ ‘‘bhagavā kirā’’tiādi vuttaṃ.
Having spoken an auspicious discourse related to generosity to those villagers, the passage beginning with “‘Indeed, the Blessed One…’” was stated to answer the question, “Why did the Blessed One, even though he was the guide for the world with its devas, speak thus?”
Sau khi nói lời chúc phúc liên quan đến việc cúng dường cho những người dân làng đó. Để giải tỏa thắc mắc: “Tại sao Đức Thế Tôn, bậc chỉ đường cho thế giới cùng với chư thiên, lại nói như vậy?”, lời giải thích “Đức Thế Tôn quả thực” v.v. đã được nói.
Maggadesakoti nibbānamaggassa, sugatimaggassa vā desako.
“Guide” means a guide to the path to Nibbāna or to the path to a good destination.
Maggadesako (nghĩa là) bậc chỉ đường đến con đường Niết Bàn, hoặc con đường tái sinh tốt lành.
543
Tāyāti araññasaññāya.
“With that” means with the perception of a forest.
Tāyā (nghĩa là) với tưởng về rừng.
Saṅghakammavasena sijjhamānāpi upasampadā satthu āṇāvasena sijjhanato ‘‘buddhadāyajjaṃ te dassāmī’’ti vuttanti vadanti.
They say that even though the Higher Ordination is accomplished by way of a Saṅgha Kamma, it is accomplished by the power of the Teacher’s command, hence it was said, “‘I will give you the Buddha’s inheritance.’”
Các vị nói rằng: “Dù sự thọ giới (upasampadā) được thực hiện theo nghi thức của Tăng đoàn, nhưng vì nó được thành tựu theo mệnh lệnh của Đức Đạo Sư, nên lời nói ‘Ta sẽ trao cho con di sản của Đức Phật’ đã được nói.”
Apare pana ‘‘aparipuṇṇavīsativassasseva tassa upasampadaṃ anujānanto satthā ‘buddhadāyajjaṃ te dassāmī’ti avocā’’ti vadanti.
Others say that the Teacher, allowing his Higher Ordination even though he had not yet completed twenty years, said, “‘I will give you the Buddha’s inheritance.’”
Những người khác lại nói rằng: “Đức Đạo Sư đã nói ‘Ta sẽ trao cho con di sản của Đức Phật’ khi Ngài cho phép vị ấy thọ giới dù chưa đủ hai mươi tuổi.”
Dhammasenāpatinā upajjhāyena upasampādetvā, tatoyevesa dhammasenāpatino saddhivihārikoti aṭṭhakathāsu vutto.
Having ordained him with the Dhammasenāpati as his preceptor, it is stated in the commentaries that he was indeed a co-resident of the Dhammasenāpati from that point on.
Trong các bản Chú giải, vị ấy được nói là đệ tử cùng học với Đức Pháp Quân (Dhammasenāpati) là vị Hòa thượng của mình, sau khi được Đức Pháp Quân thọ giới cho.
Dhammapadaṭṭhakathāyaṃ pana dhammasenāpatiāditherānaṃ cattālīsabhikkhusahassaparivārānaṃ attano attano parivārehi saddhiṃ paccekaṃ gamanaṃ, bhagavato ca ekakasseva gamanaṃ khuddakabhāṇakānaṃ matena vuttaṃ, idha, pana majjhimāgamaṭṭhakathāyañca (ma. ni. aṭṭha. 2.65) aññathā gamanaṃ dīghabhāṇakamajjhimabhāṇakānaṃ matenāti daṭṭhabbaṃ.
However, in the Dhammapada Commentary, the separate departure of the elder Dhammasenāpati and others, surrounded by forty thousand bhikkhus, each with his own retinue, and the departure of the Blessed One alone, is stated according to the view of the Khuddakabhāṇakas. Here, and in the Majjhimāgama Commentary, their departure is described differently, according to the view of the Dīghabhāṇakas and Majjhimabhāṇakas, which should be understood.
Tuy nhiên, trong Chú giải Pháp Cú, việc các Trưởng lão như Đức Pháp Quân cùng với bốn mươi ngàn tỳ khưu tùy tùng của mỗi vị đi riêng rẽ, và Đức Thế Tôn đi một mình, được nói theo quan điểm của các Tiểu Bộ Sư (Khuddakabhāṇaka). Còn ở đây và trong Chú giải Trung Bộ (Majjhimāgamaṭṭhakathā), việc đi lại khác được nói theo quan điểm của các Trường Bộ Sư (Dīghabhāṇaka) và Trung Bộ Sư (Majjhimabhāṇaka) thì nên hiểu như vậy.
Ayanti mahākassapādīnamatthāya cārikā.
“This” refers to the journey for the benefit of Mahākassapa and others.
Aya (nghĩa là) chuyến du hành này là vì lợi ích của các vị như Đại Ca Diếp.
Yaṃ pana anuggaṇhantassa bhagavato gamanaṃ, ayaṃ aturitacārikā nāmāti sambandho.
And the journey of the Blessed One, who wishes to bestow his compassion, this is called a slow journey.
Có sự liên kết là: “Việc Đức Thế Tôn du hành để giúp đỡ (các chúng sinh) được gọi là chuyến du hành không vội vã.”
544
Imaṃ pana cārikanti aturitacārikaṃ.
“This journey” refers to the slow journey.
Imaṃ pana cārikaṃ (nghĩa là) chuyến du hành không vội vã.
Mahāmaṇḍalanti majjhimadesapariyāpanneneva bāhirimena pamāṇena paricchinnattā mahantataraṃ maṇḍalaṃ.
“Large district” means a larger district, being delimited by the outer boundary that is included in the Middle Country.
Mahāmaṇḍala (nghĩa là) một vòng tròn rất lớn, vì nó được giới hạn bởi kích thước bên ngoài thuộc về vùng Trung Ấn.
Majjhimamaṇḍalanti itaresaṃ ubhinnaṃ vemajjhe pavattaṃ maṇḍalaṃ.
“Middle district” means the district located in the middle of the other two.
Majjhimamaṇḍala (nghĩa là) vòng tròn nằm giữa hai vòng tròn còn lại.
Antomaṇḍalanti itarehi khuddakaṃ maṇḍalaṃ, itaresaṃ vā antogadhattā antimaṃ maṇḍalaṃ, abbhantarimaṃ maṇḍalanti vuttaṃ hoti.
“Inner district” means a smaller district compared to the others, or it means the innermost district, being included within the others.
Antomaṇḍala (nghĩa là) vòng tròn nhỏ hơn so với hai vòng tròn kia, hoặc là vòng tròn cuối cùng vì nó nằm trong hai vòng tròn kia, tức là vòng tròn bên trong.
Kiṃ panimesaṃ pamāṇanti āha ‘‘katthā’’tiādi.
Then he asks, “What is the measure of these?” with the words “‘Where…’” and so forth.
Thế thì kích thước của chúng là bao nhiêu? (Vị ấy) nói “Katthā” v.v.
Tattha navayojanasatikatā majjhimadesapariyāpannavaseneva gahetabbā tato paraṃ aturitacārikāya agamanato.
There, the extent of nine hundred yojanas should be understood as falling within the Middle Country itself, because the slow journey does not extend beyond that.
Trong đó, việc có chín trăm dojana nên được hiểu là chỉ trong phạm vi vùng Trung Ấn, vì sau đó Ngài không du hành một cách không vội vã.
Taduttari hi turitacārikāya eva tathāgato gacchati, na aturitacārikāya.
Indeed, beyond that, the Tathāgata travels only with a swift journey, not with a slow journey.
Quả thực, sau đó Đức Như Lai chỉ du hành một cách vội vã, chứ không du hành một cách không vội vã.
Pavāretvāva cārikācaraṇaṃ buddhāciṇṇanti vuttaṃ ‘‘mahāpavāraṇāya pavāretvā’’tiādi.
It is said that undertaking a journey only after the Pavāraṇā is a practice of the Buddhas, as stated in “‘having performed the great Pavāraṇā…’” and so forth.
Việc du hành sau khi đã mãn hạ được nói là truyền thống của các Đức Phật, như trong lời “sau khi mãn đại Pavāraṇā” v.v.
Pāṭipadadivaseti paṭhamakattikapuṇṇamiyā anantare pāṭipadavase.
“On the first day of the fortnight” means on the first day of the fortnight immediately following the full moon of the first Kattika month.
Pāṭipadadivase (nghĩa là) vào ngày mùng một sau ngày trăng tròn đầu tiên của tháng Kattika.
Samantāti gatagataṭṭhānassa catūsu passesu samantato.
“All around” means from all four sides of the place visited.
Samantā (nghĩa là) khắp bốn phía của nơi đã đến.
Mahājanakāyassa sannipatanato purimaṃ purimaṃ āgatā nimantetuṃ labhanti.
Because a large crowd gathers, “those who arrive first are able to invite.”
Do sự tụ tập của đông đảo quần chúng, những người đến trước được phép thỉnh mời.
Tathā sannipatanameva dassetuṃ ‘‘itaresū’’tiādi vuttaṃ.
To show such a gathering, the phrase beginning with “‘among the others…’” was stated.
Để chỉ ra sự tụ tập như vậy, lời “itaresū” v.v. đã được nói.
Samathavipassanā taruṇā hontīti ettha samathassa taruṇabhāvo upacārasamādhivasena, vipassanāya pana saṅkhāraparicchedañāṇaṃ, kaṅkhāvitaraṇañāṇaṃ, sammasanañāṇaṃ, maggāmaggañāṇanti catunnaṃ ñāṇānaṃ vasena veditabbo.
In “calm and insight are fresh,” the freshness of calm is to be understood in terms of access concentration; the freshness of insight, however, is to be understood in terms of the four knowledges: knowledge of discerning formations, knowledge of overcoming doubt, knowledge of comprehension, and knowledge of the path and not the path.
Ở đây, trong câu “samathavipassanā taruṇā hontī” (tức là thiền chỉ và thiền quán còn non trẻ), sự non trẻ của thiền chỉ nên được hiểu theo nghĩa định cận hành (upacārasamādhi), còn sự non trẻ của thiền quán nên được hiểu theo bốn loại tuệ: tuệ phân biệt hành (saṅkhāraparicchedañāṇa), tuệ thoát nghi (kaṅkhāvitaraṇañāṇa), tuệ quán sát (sammasanañāṇa), và tuệ phân biệt đạo và phi đạo (maggāmaggañāṇa).
Taruṇavipassanāti hi tesaṃ catunnaṃ ñāṇānamadhivacanaṃ.
Indeed, “fresh insight” is a term for these four knowledges.
Quả thực, taruṇavipassanā (thiền quán non trẻ) là tên gọi chung cho bốn loại tuệ đó.
Pavāraṇāsaṅgahaṃ datvāti anumatidānavasena datvā.
“Having given the Pavāraṇā allowance” means having given it by way of granting permission.
Pavāraṇāsaṅgahaṃ datvā (nghĩa là) sau khi cho phép theo ý muốn của các tỳ khưu.
Kattikapuṇṇamāyanti pacchimakattikapuṇṇamiyaṃ.
“On the Kattika full moon” means on the last Kattika full moon.
Kattikapuṇṇamāyaṃ (nghĩa là) vào ngày trăng tròn cuối cùng của tháng Kattika.
‘‘Migasirassa paṭhamapāṭipadadivase’’ti idaṃ majjhimadesavohāravasena migasiramāsassa paṭhamaṃ pāṭipadadivasaṃ sandhāya vuttaṃ, etarahi pavattavohāravasena pana pacchimakattikamāsassa kāḷapakkhapāṭipadadivaso veditabbo.
“On the first day of the fortnight of Migasira” was stated referring to the first day of the fortnight of the Migasira month according to the regional usage of the Middle Country. However, according to the current usage, it should be understood as the first day of the dark half of the last Kattika month.
Câu “Migasirassa paṭhamapāṭipadadivase” này được nói để chỉ ngày mùng một đầu tiên của tháng Migasira theo cách gọi thông thường ở vùng Trung Ấn. Tuy nhiên, theo cách gọi thông thường hiện nay, nên hiểu đó là ngày mùng một của nửa tối tháng Kattika cuối cùng.
545
Aññenapi kāraṇenāti bhikkhūnaṃ samathavipassanātaruṇabhāvato aññenapi majjhimamaṇḍale veneyyānaṃ ñāṇaparipākādikāraṇena.
“For another reason also” means for another reason, such as the ripeness of the knowledge of those who are to be disciplined in the Middle Region, in addition to the freshness of the bhikkhus’ calm and insight.
Aññenapi kāraṇenā (nghĩa là) ngoài lý do thiền chỉ và thiền quán của các tỳ khưu còn non trẻ, còn có những lý do khác như sự trưởng thành của tuệ giác của những chúng sinh có thể được giáo hóa ở vùng Trung Ấn.
Catumāsanti āsaḷhīpuṇṇamiyā pāṭipadato yāva pacchimakattikapuṇṇamī, tāva catumāsaṃ.
“Four months” means the four months from the first day of the fortnight of the Āsaḷhi full moon until the full moon of the last Kattika month.
Catumāsaṃ (nghĩa là) bốn tháng, từ ngày mùng một của tháng Āsaḷhī đến ngày trăng tròn cuối cùng của tháng Kattika.
‘‘Samantā yojanasata’’ntiādinā vuttanayeneva.
By the method stated, such as “a hundred yojanas all around.”
Theo cách đã nói trong câu “Samantā yojanasata” v.v.
Vasanaṃ vassaṃ, vasanakiriyā, vutthaṃ vasitaṃ vassamassāti vutthavasso, tassa.
vasanaṃ vassaṃ, living (is) the rains retreat; the act of living. vutthaṃ vasitaṃ vassamassāti vutthavasso, tassa. The rains retreat has been lived by him, so he is one who has completed the rains retreat; of him.
Vasanaṃ là an cư, vassaṃ là an cư. Vutthavasso là người đã an cư, của người ấy.
Tathāgatena vinetabbattā ‘‘bhagavato veneyyasattā’’ti sāminiddeso vutto, kattuniddeso vā esa.
Because they are to be disciplined by the Tathāgata, “the Blessed One’s disciples” is stated as a genitive of possession, or it is a genitive of the agent.
Vì các chúng sinh có thể được Đức Như Lai giáo hóa, nên “bhagavato veneyyasattā” được nói là sở hữu cách, hoặc đó là chủ cách.
Veneyyasattāti ca caritānurūpaṃ vinetabbasattā.
And “disciples” means beings who are to be disciplined according to their temperaments.
Veneyyasattā (nghĩa là) những chúng sinh có thể được giáo hóa phù hợp với bản chất của họ.
Indriyaparipākaṃ āgamayamānoti saddhādiindriyānaṃ vimuttiparipācanabhāvena paripakkaṃ paṭimānento.
“Awaiting the ripening of the faculties” means expecting the ripening of the faculties such as faith, by means of their bringing about the ripening of liberation.
Indriyaparipākaṃ āgamayamāno (nghĩa là) chờ đợi sự trưởng thành của các căn như tín căn, với ý nghĩa là sự trưởng thành giúp giải thoát khỏi phiền não.
Phussamāghaphagguṇacittamāsānaṃ aññataramāsassa paṭhamadivase nikkhamanato māsaniyamo ettha na katoti daṭṭhabbaṃ.
It should be understood that no definite month was specified here for the departure, since it occurred on the first day of one of the months of Phussa, Māgha, Phagguṇa, or Citta.
Nên hiểu rằng ở đây không có quy định về tháng, vì Ngài du hành vào ngày đầu tiên của một trong các tháng Phussa, Māgha, Phagguṇa, Citta.
Tenāha ‘‘ekamāsaṃ vā dviticatumāsaṃ vā tattheva vasitvā’’ti.
Therefore, it is said, “having stayed there for one month, or two, three, or four months.”
Vì vậy (vị ấy) nói “ekamāsaṃ vā dviticatumāsaṃ vā tattheva vasitvā”.
Tatthevāti vassūpagamanaṭṭhāne eva.
“Therein” means at the very place where the rains retreat was observed.
Tattheva (nghĩa là) ngay tại nơi an cư.
‘‘Sattahi vā’’tiādi ‘‘ekamāsaṃ vā’’tiādinā yathākkamaṃ yojetabbaṃ – yadi aparampi ekamāsaṃ tattheva vasati, sattahi māsehi cārikaṃ pariyosāpeti.
“Or by seven” and so forth should be connected in order with “for one month or” and so forth: if he stays there for another month, he completes the journey in seven months.
“Sattahi vā” v.v. nên được kết hợp tuần tự với “ekamāsaṃ vā” v.v. – Nếu Ngài an cư thêm một tháng ở đó, thì Ngài kết thúc chuyến du hành trong bảy tháng.
Yadi dvimāsaṃ chahi, yadi timāsaṃ pañcahi, yadi catumāsaṃ tattheva vasati, catūhi māsehi cārikaṃ pariyosāpetīti.
If he stays two months, he completes it in six; if three months, in five; if four months, he completes the journey in four months.
Nếu an cư hai tháng thì sáu tháng, nếu an cư ba tháng thì năm tháng, nếu an cư bốn tháng ở đó, thì Ngài kết thúc chuyến du hành trong bốn tháng.
Kasmā pana cārikāgamananti āsaṅkānivattanatthaṃ ‘‘itī’’tiādi vuttaṃ.
The phrase beginning with “‘Thus…’” was stated to remove the doubt about why there is a journey.
Để giải tỏa nghi ngờ về lý do du hành, lời “itī” v.v. đã được nói.
Atirekaṃ jarādubbalo bāḷhajiṇṇo.
“Very old” means excessively infirm with old age.
Bāḷhajiṇṇo (nghĩa là) người rất già yếu, suy nhược do tuổi già.
Te kadā passissanti, na passissanti eva.
“When will they see?” They will not see him at all.
Te kadā passissanti (nghĩa là) họ sẽ thấy khi nào? Họ sẽ không thấy được.
Lokānukampakāyāti lokānukampakāya eva.
“Out of compassion for the world” means indeed out of compassion for the world.
Lokānukampakāyā (nghĩa là) vì lòng từ bi đối với thế gian.
Tena vuttaṃ ‘‘na cīvarādihetū’’ti.
Therefore it was said, “not for robes and so forth.”
Vì vậy (vị ấy) nói “không phải vì y phục” v.v.
546
Jaṅghavihāravasenāti jaṅghāhi vicaraṇavasena, jaṅghāhi vicaritvā tattha tattha katipāhaṃ nivasanavasena vā.
“By way of walking about” means by way of wandering on foot, or by way of wandering on foot and staying in various places for a few days.
Jaṅghavihāravasenā (nghĩa là) bằng cách đi bộ, hoặc bằng cách đi bộ và ở lại đó vài ngày.
Sabbiriyāpathasādhāraṇañhi vihāravacanaṃ.
Indeed, the word vihāra is common to all postures.
Thật vậy, từ vihāra (an trú) là chung cho mọi oai nghi.
Sarīraphāsukatthāyāti ekasmiṃyeva ṭhāne nibaddhavāsavasena ussannadhātukassa sarīrassa vicaraṇena phāsubhāvatthāya.
“For the physical comfort” means for the physical comfort of a body with abundant elements by moving about, rather than staying in one fixed place.
Sarīraphāsukatthāyā (nghĩa là) vì sự thoải mái của thân thể, một thân thể có nhiều yếu tố (dhātu) dồi dào, bằng cách đi lại thay vì ở một chỗ cố định.
Aṭṭhuppattikālābhikaṅkhanatthāyāti aggikkhandhopamasutta (a. ni. 7.72) maghadevajātakādi (jā. 1.1.9) desanānaṃ viya dhammadesanāya abhikaṅkhitabbaaṭṭhuppattikālatthāya, aṭṭhuppattikālassa vā abhikaṅkhanatthāya, aṭṭhuppattikāle dhammadesanatthāyāti vuttaṃ hoti.
“For the sake of longing for the opportune moment of arising” means for the sake of the opportune moment for a Dhamma discourse, just like the discourses of the Aggikkhandhopama Sutta and the Maghadeva Jātaka and so forth, or for the sake of longing for the opportune moment of arising, or it is stated as for the sake of teaching the Dhamma at the opportune moment of arising.
Aṭṭhuppattikālābhikaṅkhanatthāyā (nghĩa là) vì thời điểm thích hợp để thuyết pháp, giống như các bài thuyết pháp như kinh Aggikkhandhopama (A.N. 7.72) và Maghadevajātakādi (Jā. 1.1.9), hoặc vì mong muốn có thời điểm thích hợp, tức là để thuyết pháp vào thời điểm thích hợp.
Sikkhāpadapaññāpanatthāyāti surāpānasikkhāpadādi (pāci. 327, 328, 329) paññāpane viya sikkhāpadānaṃ paññāpanatthāya.
“For the sake of establishing training rules” means for the sake of establishing training rules, as in the establishment of the rule concerning intoxicating drinks and so forth.
Sikkhāpadapaññāpanatthāyā (nghĩa là) để chế định các giới luật, giống như việc chế định giới luật về uống rượu (pāci. 327, 328, 329) v.v.
Bodhanatthāyāti aṅgulimālādayo (ma. ni. 2.347) viya bodhaneyyasatte catusaccabodhanatthāya.
“For the sake of awakening” means for the sake of awakening the beings to be disciplined to the Four Noble Truths, like Aṅgulimāla and others.
Bodhanatthāyā (nghĩa là) để giác ngộ chúng sinh có thể được giác ngộ về Tứ Diệu Đế, giống như Angulimāla v.v.
Mahatāti mahatiyā.
“Great” means extensive.
Mahatā (nghĩa là) với số lượng lớn.
Kañci, katipaye vā puggale uddissa cārikā nibaddhacārikā. Tadaññā sambahule uddissa gāmanigamanagarapaṭipāṭiyā cārikā anibaddhacārikā. Tenāha ‘‘tatthā’’tiādi.
A nibaddhacārikā (fixed wandering) is a journey undertaken with a specific individual or a few individuals in mind. An anibaddhacārikā (unfixed wandering) is a journey undertaken, without specific individuals in mind, through villages, towns, and cities in sequence. Therefore, it is said, " tatthā" (there) and so on.
Việc du hành đến một số ít người, hoặc một vài người nào đó, được gọi là nibaddhacārikā (du hành có mục đích cố định). Việc du hành đến nhiều người khác, theo thứ tự làng, thị trấn, thành phố, được gọi là anibaddhacārikā (du hành không có mục đích cố định). Vì vậy, (Luận sư) đã nói (từ) “tatthā” và các từ tiếp theo.
Yaṃ caratīti kiriyāparāmasanaṃ.
" Yaṃ carati" (what one wanders) is a reference to the action.
“Yaṃ carati” (điều gì Ngài du hành) là sự đề cập đến hành động.
547
‘‘Esā idha adhippetā’’ti vuttameva vitthārato dassetuṃ ‘‘tadā kirā’’tiādi vuttaṃ.
In order to explain in detail what has been stated as "This is intended here," the passage beginning with " tadā kirā" (then indeed) was stated.
Để giải thích chi tiết hơn điều đã nói “Điều này được đề cập ở đây”, (Luận sư) đã nói (từ) “tadā kirā” và các từ tiếp theo.
Dasasahassilokadhātuyāti jātikkhettabhūtaṃ dasasahassacakkavāḷaṃ sandhāya vuttaṃ.
Dasasahassilokadhātuyā (in the ten-thousand world-system) is stated with reference to the ten-thousand world-cycles, which are the field of birth.
“Trong mười ngàn thế giới” được nói để chỉ mười ngàn cõi giới là trường sanh.
Kasmāti ce?
Why so?
Tại sao vậy?
Tattheva bhabbasattānaṃ sambhavato.
Because capable beings exist only there.
Vì chỉ ở đó mới có sự xuất hiện của những chúng sanh có thể được giác ngộ.
Tattha hi satte bhabbe paripakkindriye passituṃ buddhañāṇaṃ abhinīharitvā ṭhito bhagavā ñāṇajālaṃ pattharatīti vuccati, idañca devabrahmānaṃ vasena vuttaṃ.
It is said that in that place, the Blessed One, having focused his Buddha-knowledge to see the capable beings with mature faculties, spreads the net of knowledge. This is stated with reference to devas and Brahmas.
Ở đó, Đức Thế Tôn, đã an trú sau khi hướng trí tuệ Phật của Ngài để thấy những chúng sanh có thể được giác ngộ, với các căn đã chín muồi, được nói là đã trải rộng mạng lưới trí tuệ, và điều này được nói theo phương diện chư thiên và Phạm thiên.
Manussā pana imasmiṃyeva cakkavāḷe, imasmiṃyeva ca saparivāre jambudīpe bodhaneyyā honti.
Humans, however, are capable of being enlightened only in this world-system and only in this Jambudīpa with its retinue.
Còn con người thì chỉ có thể được giác ngộ trong cõi giới này, và chỉ trong cõi Diêm Phù Đề này cùng với quyến thuộc của nó.
Bodhaneyyabandhaveti bodhaneyyasattasaṅkhāte bhagavato bandhave.
Bodhaneyyabandhave means the relatives of the Blessed One, who are considered capable of enlightenment.
“Bodhaneyyabandhave” (bà con có thể được giác ngộ) là những người bà con của Đức Thế Tôn, tức là những chúng sanh có thể được giác ngộ.
Gottādisambandhā viya hi saccapaṭivedhasambandhā veneyyā bhagavato bandhavā nāmāti.
Indeed, just as there are relatives by lineage and so forth, those who are trainable (veneyya) are called the Buddha's relatives because they are related through the penetration of the Truths.
Vì những người có thể được giác ngộ là bà con của Đức Thế Tôn do mối liên hệ giác ngộ Chân Lý, giống như mối liên hệ huyết thống và các mối liên hệ khác.
Gocarabhāvūpagamanaṃ sandhāya ‘‘sabbaññutaññāṇajālassa anto paviṭṭho’’ti vuttaṃ.
Referring to the entering into the state of being an object of knowledge, it is said, "entered into the net of omniscience."
“Đi vào trong mạng lưới trí tuệ Nhất Thiết Trí” được nói để chỉ sự đi vào phạm vi của trí tuệ.
Bhagavā kira mahākaruṇāsamāpattiṃ samāpajjitvā tato vuṭṭhāya ‘‘ye sattā bhabbā paripakkañāṇā, te mayhaṃ ñāṇassa upaṭṭhahantū’’ti cittaṃ adhiṭṭhāya samannāharati, tassa sahasamannāhārā eko vā dve vā sambahulā vā tadā vinayūpagā veneyyā ñāṇassa āpāthamāgacchanti, ayamettha buddhānubhāvo.
It is said that the Blessed One, having entered into the attainment of great compassion, arose from it and, resolving his mind with the thought, "May those beings who are capable and whose faculties are mature appear to my knowledge," he attends to them. At that moment of his attention, one, two, or many trainable (veneyya) beings, who are fit for discipline, come within the range of his knowledge. This is the Buddha's power in this matter.
Đức Thế Tôn, sau khi nhập Đại Bi Định và xuất định, đã quyết tâm trong tâm rằng “Nguyện cho những chúng sanh có khả năng giác ngộ, với trí tuệ đã chín muồi, hiện ra trong trí tuệ của Ta”, rồi Ngài quán sát. Nhờ sự quán sát tức thì đó, một, hai, hoặc nhiều chúng sanh có thể được giáo hóa, có khả năng được thuần hóa, liền hiện ra trong tầm nhìn của trí tuệ. Đây là uy lực của chư Phật trong trường hợp này.
Evamāpāthagatānaṃ pana nesaṃ upanissayaṃ pubbacariyaṃ, pubbahetuṃ, sampati vattamānañca paṭipattiṃ oloketi.
Having thus brought them within the range of his knowledge, he then observes their supporting conditions (upanissaya), past conduct, past causes, and their present practice.
Đối với những người đã hiện ra trong tầm nhìn như vậy, Ngài quán sát duyên lành của họ, hành vi trong quá khứ, nhân duyên trong quá khứ, và thực hành hiện tại của họ.
Veneyyasattapariggaṇhanatthañhi samannāhāre kate paṭhamaṃ nesaṃ veneyyabhāvena upaṭṭhānaṃ hoti, atha ‘‘kiṃ nu kho bhavissatī’’ti saraṇagamanādivasena kañci nipphattiṃ vīmaṃsamāno pubbūpanissayādīni oloketi.
When attention is given for the purpose of gathering trainable beings, first, their state as trainable beings becomes apparent. Then, pondering "what will become of them?", he examines their past supporting conditions and so forth, with a view to some accomplishment such as taking refuge.
Thật vậy, khi sự quán sát được thực hiện để thâu tóm những chúng sanh có thể được giáo hóa, trước tiên, họ hiện ra với tư cách là những người có thể được giáo hóa. Sau đó, Ngài quán sát các duyên lành trong quá khứ và những điều khác, tự hỏi “Điều gì sẽ xảy ra?” và tìm kiếm một thành tựu nào đó, chẳng hạn như sự quy y.
Tenāha ‘‘atha bhagavā’’tiādi.
Therefore, it is said, "Then the Blessed One," and so on.
Vì vậy, (Luận sư) đã nói (từ) “atha bhagavā” (rồi Đức Thế Tôn) và các từ tiếp theo.
Soti ambaṭṭho.
"So" refers to Ambaṭṭha.
“So” (người đó) là Ambhaṭṭha.
Vādapaṭivādaṃ katvāti ‘‘evaṃ nu te ambaṭṭhā’’tiādinā (dī. ni. 1.262) mayā vuttavacanassa ‘‘ye ca kho te bho gotama muṇḍakā samaṇakā’’tiādinā (dī. ni. 1.263) paṭivacanaṃ datvā, asabbhivākyanti asappurisavācaṃ, tikkhattuṃ ibbhavādanipātanavasena nānappakāraṃ sādhusabhāvāya vācāya vattumayuttaṃ vākyaṃ vakkhatīti vuttaṃ hoti.
"Having engaged in debate and counter-debate" means that, in response to the words spoken by me, such as "Is it so, Ambaṭṭha?", he gave a reply with words like "But those shaven-headed ascetics, good Gotama," and so on. "Unworthy speech" means speech of ignoble persons, words that are improper to utter with noble speech in various ways, by thrice casting down the term "ibbha" (low-born), which means he will speak words unfit to be spoken with noble speech, in various ways, by thrice uttering the term "ibbha" (low-born) due to pride and arrogance.
“Vādapaṭivādaṃ katvā” (sau khi tranh luận qua lại) có nghĩa là sau khi đưa ra câu trả lời cho lời nói của Ta, như “Này Ambhaṭṭha, có phải ông nghĩ vậy không?” (Dī. Ni. 1.262), bằng lời nói như “Này Gotama, những vị sa-môn đầu trọc của ông…” (Dī. Ni. 1.263), và “asabbhivākyaṃ” (lời nói bất thiện) có nghĩa là lời nói của kẻ không phải bậc thiện nhân, tức là lời nói không nên nói bằng ngôn ngữ thiện lành, theo cách ba lần hạ thấp bằng lời lẽ thô tục.
Nibbisevananti vigatatudanaṃ, mānadappavasena apagataparinipphandananti attho.
"Nibbisevana" means free from abuse, meaning free from mental agitation due to pride and arrogance.
“Nibbisevanaṃ” (không bị kích động) có nghĩa là không còn sự chọc ghẹo, tức là không còn sự dao động của tâm do kiêu mạn và ngạo mạn.
548
Avasaritabbanti upagantabbaṃ.
"Avasaritabbaṃ" means to be approached.
“Avasaritabbaṃ” (nên đến) có nghĩa là nên tiếp cận.
Tassa gāmassa idaṃ nāmamattaṃ, kimettha atthapariyesanāyāti vuttaṃ ‘‘ijjhānaṅgalantipi pāṭho’’ti.
This is merely the name of that village; what is the point of seeking meaning here? Thus it is said, "Ijjhānaṅgalanti is also a reading."
Để nói rằng đây chỉ là tên của ngôi làng đó, không cần tìm kiếm ý nghĩa ở đây, (Luận sư) đã nói “ijjhānaṅgalantipi pāṭho” (cũng có bản đọc là Ijjhānaṅgala).
‘‘Yena disābhāgenā’’ti karaṇaniddesānurūpaṃ karaṇatthe upayogavacananti dasseti ‘‘tena avasarī’’ti iminā.
"By which direction" indicates that it is a word used in the instrumental sense, corresponding to an instrumental indication, as shown by "tena avasarī" (he approached by that*).
“Tena avasarī” (Ngài đã đến bằng cách đó) cho thấy rằng “yena disābhāgenā” (bằng hướng đó) là một từ được sử dụng trong ý nghĩa công cụ, phù hợp với cách chỉ định công cụ.
‘‘Yasmiṃ padese’’ti pana bhummaniddesānurūpaṃ ‘‘taṃ vā avasarī’’ti vuttaṃ.
"In which place" is said as "taṃ vā avasarī" (or he approached that*), corresponding to a locative indication.
Còn “taṃ vā avasarī” (hoặc Ngài đã đến đó) được nói phù hợp với cách chỉ định vị trí, tức là “yasmiṃ padese” (ở nơi nào).
Tadubhayamevatthaṃ vivarati ‘‘tena disābhāgenā’’tiādinā.
Both meanings are explained by "tena disābhāgenā" and so on.
Cả hai ý nghĩa đó được giải thích bằng (cụm từ) “tena disābhāgenā” và các từ tiếp theo.
Gatoti upagato, agamāsīti attho.
"Gato" means approached, arrived.
“Gato” (đã đi) có nghĩa là đã đến, tức là đã đi tới.
Puna gatoti sampatto, sampāpuṇīti attho.
Again, "gato" means reached, attained.
Lại nữa, “gato” (đã đi) có nghĩa là đã tới, tức là đã đến nơi.
‘‘Icchānaṅgale’’ti idaṃ tadā bhagavato gocaragāmanidassanaṃ, samīpatthe cetaṃ bhummaṃ.
"Icchānaṅgale" here indicates the Blessed One's going for alms at that time, and this locative case is in the sense of proximity.
“Icchānaṅgale” (ở Icchānaṅgala) là sự chỉ dẫn về ngôi làng đi khất thực của Đức Thế Tôn vào thời điểm đó, và đây là một từ ở thể vị trí với ý nghĩa gần kề.
‘‘Icchānaṅgalavanasaṇḍe’’ti idaṃ pana nivāsaṭṭhānadassanaṃ, nippariyāyato adhikaraṇe cetaṃ bhummanti tadubhayampi padaṃ visesatthadassanena vivaranto ‘‘icchānaṅgalaṃ upanissāyā’’tiādimāha.
"Icchānaṅgalavanasaṇḍe" indicates the place of residence, and this locative case is directly in the sense of location. Thus, wishing to explain both words by showing their specific meanings, he said, "upanissāya Icchānaṅgalaṃ" (residing near Icchānaṅgala) and so on.
Còn “Icchānaṅgalavanasaṇḍe” (trong rừng Icchānaṅgala) là sự chỉ dẫn về nơi cư trú, và đây là một từ ở thể vị trí theo nghĩa sở y trực tiếp. Do đó, để giải thích cả hai từ này bằng cách chỉ ra ý nghĩa đặc biệt, (Luận sư) đã nói “icchānaṅgalaṃ upanissāyā” (nương tựa Icchānaṅgala) và các từ tiếp theo.
‘‘Sīlakhandhāvāra’’ntiādi vuttanayena veneyyahitasamapekkhanavaseneva bhagavato vihāradassanaṃ.
The Blessed One's dwelling, as described by "Sīlakhandhāvāra" and so on, is solely out of consideration for the welfare of those who are trainable.
Sự chỉ dẫn về nơi Đức Thế Tôn cư trú, như đã nói trong “Sīlakhandhāvāra” (trại quân giới luật) và các từ tiếp theo, chỉ là do Ngài quán sát lợi ích của những người có thể được giáo hóa.
Tattha dhammarājassa bhagavato sabbaso adhammaniggaṇhanaparā eva paṭipatti, sā ca sīlasamādhipaññāvasenāti sīlādittayasseva gahaṇaṃ.
In that context, the practice of the Dhamma-king, the Blessed One, is entirely devoted to suppressing unrighteousness, and that is through sīla, samādhi, and paññā. Thus, only the triad of sīla and so forth is taken.
Trong đó, sự thực hành của Đức Thế Tôn, vị vua Pháp, hoàn toàn là để chế ngự mọi điều phi pháp, và điều đó được thực hiện thông qua giới, định, tuệ. Vì vậy, chỉ ba điều giới, định, tuệ được đề cập.
Sīlakhandhāvāranti cakkavattirañño dāruiṭṭhakādikataṃ khandhāvārasadisaṃ sīlasaṅkhātaṃ khandhāvāraṃ bandhitvā viharatīti sambandho.
"Sīlakhandhāvāra" is to be connected as: "He dwells having established a fortress (khandhāvāra) called sīla, similar to the fortress made of wood, bricks, etc., of a Wheel-turning Monarch."
“Sīlakhandhāvāraṃ” (trại quân giới luật) có liên hệ đến việc Ngài an trú sau khi dựng lên một “trại quân” gọi là giới, giống như trại quân làm bằng gỗ, gạch của một vị Chuyển Luân Vương.
Dārukkhandhādīhi āsamantato varanti parikkhipanti etthāti hi khandhāvāro a-kārassa dīghaṃ katvā, rājūnaṃ aciranivāsaṭṭhānaṃ.
Indeed, "khandhāvāro" is where they surround and enclose all around with logs of wood and so forth, making the 'a' long; it is a temporary dwelling place for kings.
Thật vậy, khandhāvāro (trại quân) là nơi mà các thân cây gỗ và những thứ khác bao quanh, được tạo thành bằng cách kéo dài chữ ‘a’, là nơi cư trú tạm thời của các vị vua.
Tattha pana bhagavato aciranivasanakiriyāsambandhamattena bhayanivāraṇaṭṭhena taṃsadisatāya sīlampi tathā vuccati.
But in that context, sīla is also called that due to its similarity, in the sense of averting danger, merely by its connection to the Blessed One's act of dwelling temporarily.
Tuy nhiên, giới cũng được gọi như vậy vì sự tương đồng với nơi đó, chỉ do mối liên hệ với hành động cư trú tạm thời của Đức Thế Tôn và với ý nghĩa ngăn chặn sợ hãi.
Samādhikontanti sammāsamādhisaṅkhātaṃ maṅgalasattiṃ.
"Samādhikontaṃ" means the auspicious spear called sammāsamādhi.
“Samādhikontaṃ” (mũi giáo định) là mũi giáo may mắn gọi là chánh định.
Sabbaññutaññāṇapadanti sabbaññutaññāṇasaṅkhātaṃ jayamantapadaṃ.
"Sabbaññutaññāṇapadaṃ" means the victorious mantra-word called omniscience.
“Sabbaññutaññāṇapadaṃ” (từ trí tuệ Nhất Thiết Trí) là từ thần chú chiến thắng gọi là trí tuệ Nhất Thiết Trí.
Parivattayamānoti parijappamāno.
"Parivattayamāno" means reciting repeatedly.
“Parivattayamāno” (xoay chuyển) có nghĩa là niệm đi niệm lại.
‘‘Sabbaññutaññāṇasara’’ntipi pāṭho, sabbaññutaññāṇavajiraggasaraṃ aparāparaṃ samparivattamānoti attho.
"Sabbaññutaññāṇasaraṃ" is also a reading, meaning repeatedly turning the arrow-point of the vajra of omniscience.
Cũng có bản đọc là “Sabbaññutaññāṇasaraṃ” (mũi tên trí tuệ Nhất Thiết Trí), có nghĩa là xoay chuyển đi xoay chuyển lại mũi tên có đầu kim cương là trí tuệ Nhất Thiết Trí.
Yathābhirucitena vihārenāti sabbavihārasādhāraṇadassanaṃ, dibbavihārādīsu yena yena attanā abhirucitena vihārena viharatīti attho.
"Yathābhirucitena vihārenā" indicates a general presentation of all abodes, meaning he dwells in whatever abode he prefers among the divine abodes and so on.
“Yathābhirucitena vihārenā” (với cách an trú tùy thích) là sự chỉ dẫn chung cho tất cả các cách an trú, có nghĩa là Ngài an trú bằng cách an trú nào mà Ngài tự mình ưa thích, trong số các cách an trú như thiên trú (dibbavihāra) và các cách khác.
549
Pokkharasātivatthuvaṇṇanā
Description of Pokkharasāti’s Story
Giải thích về câu chuyện của Pokkharasāti
550
255. Manteti iruvedādimantasatthe.
255. Mantras means the sacred texts beginning with the Ṛgveda.
“Mante” (các bài thần chú) là các kinh điển thần chú như Iruveda và các kinh điển khác.
Iruvedādayo hi guttabhāsitabbaṭṭhena ‘‘mantā’’ti vuccanti.
Indeed, the Ṛgveda and others are called ‘mantras’ because they are to be recited in a protected place.
Thật vậy, Iruveda và các kinh điển khác được gọi là “mantā” (thần chú) vì chúng được tụng đọc ở nơi kín đáo.
Aṇa-saddo saddeti āha ‘‘sajjhāyatī’’ti.
The word aṇa is used in the sense of sound, thus it is said to mean ‘recites’.
Từ “aṇa” có nghĩa là tạo ra âm thanh, vì vậy (Luận sư) đã nói “sajjhāyatī” (tụng đọc).
Lokiyā pana vadanti ‘‘brahmuno apaccaṃ brāhmaṇo, nāgamo, ṇattaṃ, dīghādī’’ti.
But worldly teachers say, ‘‘A brāhmaṇa is a descendant of Brahmā; there is no ṇa-augmentation, ṇa-suffix, or lengthening, etc.’’
Tuy nhiên, những người thế tục nói rằng “brahmaṇo” (Bà-la-môn) là con cháu của Brahmā, không phải là sự đi tới, cũng không phải là trạng thái ‘ṇa’, cũng không phải là sự kéo dài v.v...
Kasmā ayameva vacanattho vuttoti āha ‘‘idamevā’’tiādi.
Why is only this etymology stated? To this question, it is said, ‘‘This very*’’ and so on.
Để trả lời câu hỏi “Tại sao chỉ có cách giải thích từ này được nói?”, (Luận sư) đã nói “idamevā” (chỉ điều này) và các từ tiếp theo.
Atha kesaṃ itaro vacanatthoti codanamapaneti ‘‘ariyā panā’’tiādinā.
Then, to remove the question as to whose is the other etymology, it states, ‘‘But the Noble Ones’’ and so on.
Sau đó, để loại bỏ câu hỏi “Vậy thì cách giải thích từ kia là của ai?”, (Luận sư) đã nói “ariyā panā” (nhưng các bậc Thánh) và các từ tiếp theo.
Atha vā yaṃ lokiyā vadanti ‘‘brahmunā jāto brāhmaṇo’’tiādiniruttiṃ, taṃ paṭikkhipituṃ evaṃ vuttaṃ.
Or, what worldly people say, ‘‘A brāhmaṇa is one born from Brahmā,’’ and so forth, that etymology is rejected by this statement.
Hoặc, điều này được nói để bác bỏ cách giải thích từ mà những người thế tục nói, như “brahmaṇo” (Bà-la-môn) là người sinh ra từ Brahmā.
‘‘Idamevā’’ti hi avadhāraṇena taṃ paṭikkhipati.
Indeed, by the emphatic word ‘this very’, that* is rejected.
Thật vậy, bằng cách nhấn mạnh với từ “idamevā” (chỉ điều này), (Luận sư) đã bác bỏ cách giải thích đó.
‘‘Jātibrāhmaṇāna’’nti pana iminā saddantarena dassitesu jātibrāhmaṇavisuddhibrāhmaṇavasena duvidhesu brāhmaṇesu visuddhibrāhmaṇānaṃ niruttiṃ dassento ‘‘ariyā panā’’tiādimāha.
However, by this other word ‘‘of brāhmaṇas by birth’’, showing the etymology for pure brāhmaṇas among the two kinds of brāhmaṇas — brāhmaṇas by birth and pure brāhmaṇas — that are indicated by this word, it states, ‘‘But the Noble Ones’’ and so on.
Tuy nhiên, bằng từ “jātibrāhmaṇānaṃ” (của những Bà-la-môn sinh ra), (Luận sư) đã nói “ariyā panā” (nhưng các bậc Thánh) và các từ tiếp theo, để chỉ ra cách giải thích từ của những Bà-la-môn thanh tịnh, trong số hai loại Bà-la-môn là Bà-la-môn sinh ra và Bà-la-môn thanh tịnh được chỉ ra bằng một từ khác.
Bahanti pāpe bahi karontīti hi ariyā brāhmaṇā niruttinayena.
Indeed, the Noble Ones are brāhmaṇas in the sense of etymology because they remove evils, making them external.
Thật vậy, những bậc Thánh được gọi là brāhmaṇā (Bà-la-môn) theo cách giải thích từ, vì họ “bahanti” (loại bỏ) những điều ác, tức là “bahi karonti” (đẩy ra ngoài).
‘‘Tassa kira kāyo setapokkharasadiso’’ti idamevassa nāmalābhahetudassanaṃ, sesaṃ pana tappasaṅgena yathāvijjamānavisesadassanameva.
‘‘Indeed, his body was like a white lotus’’ – this alone is the explanation for his name, while the rest is merely a description of the existing distinctions in connection with that.
“Tassa kira kāyo setapokkharasadiso” (thân của ông ấy giống như hoa sen trắng) chỉ là sự chỉ dẫn về nguyên nhân có được tên của ông ấy, còn phần còn lại chỉ là sự chỉ dẫn về những đặc điểm đặc biệt hiện có liên quan đến ông ấy.
Tenāha ‘‘iti naṃ pokkharasadisattā pokkharasātīti sañjānantī’’ti.
Therefore, it is said, ‘‘Thus, because he was like a lotus, they knew him as Pokkharasāti’’.
Vì vậy, (Luận sư) đã nói “iti naṃ pokkharasadisattā pokkharasātīti sañjānantī” (vì thân ông ấy giống như hoa sen, nên họ gọi ông ấy là Pokkharasāti).
Pokkharena sadiso kāyo yassāti hi pokkharasātī niruttinayena.
Indeed, Pokkharasāti means, according to etymology, one whose body is like a lotus.
Thật vậy, pokkharasātī (Pokkharasāti) theo cách giải thích từ, là người có thân giống như hoa sen (pokkhara).
Sātasaddo vā sadisattho, pokkharena sāto sadiso kāyo tathā, so yassāti pokkharasātī.
Or, the word sāta means ‘like’; one whose body is like a lotus, thus he is Pokkharasāti.
Hoặc, từ “sāta” có nghĩa là “giống như”, thân giống như hoa sen (pokkhara), người có thân như vậy thì được gọi là pokkharasātī.
Setapokkharasadisoti setapadumavaṇṇo.
Like a white lotus means having the colour of a white lotus.
“Setapokkharasadiso” (giống như hoa sen trắng) có nghĩa là có màu sắc như hoa sen trắng.
Devanagareti ālakamandādidevapure.
In the city of devas means in the divine city such as Ālakamandā.
“Devanagare” (ở thành phố chư thiên) là ở các thành phố chư thiên như Ālakamanda và các thành phố khác.
Ussāpitarajatatoraṇanti gambhīranemanikhātaṃ accuggataṃ rajatamayaṃ indakhīlaṃ.
Ussāpitarajatatoraṇa means a silver pillar (indakhīla) made of silver, deeply rooted in the ground and exceedingly tall.
Ussāpitarajatatoraṇa nghĩa là cột trụ cửa bằng bạc được chôn sâu dưới đất và dựng rất cao.
Kāḷamegharājīti kadāci dissamānā kāḷaabbhalekhā.
Kāḷamegharājī means a streak of dark, dusky clouds appearing occasionally.
Kāḷamegharājī nghĩa là những vệt mây đen thỉnh thoảng xuất hiện.
Rajatapanāḷikāti rajatamayatumbaṃ.
Rajatapanāḷikā means a silver vessel.
Rajatapanāḷikā nghĩa là cái ống bạc.
Suvaṭṭitāti vaṭṭabhāvassa yuttaṭṭhāne suṭṭhu vaṭṭulā.
Suvaṭṭitā means perfectly rounded in a suitable place for roundness.
Suvaṭṭitā nghĩa là tròn trịa một cách hoàn hảo ở những chỗ cần tròn.
Kāḷavaṅgatilakādīnamabhāvena suparisuddhā. ‘‘Arājake’’tiādināpi sobhaggappattabhāvameva nidasseti.
Suparisuddhā means thoroughly pure, due to the absence of black blemishes, moles, and so on. By "Arājake" and so forth, it merely indicates the state of having attained beauty.
Vì không có những vết đen, nốt ruồi hay tì vết khác, nên suparisuddhā (hoàn toàn trong sạch). Ngay cả với cụm từ “Arājake” và các cụm từ tương tự cũng chỉ ra trạng thái đạt được vẻ đẹp.
551
Idāni aparampi tassa nāmalābhahetuṃ dassento ‘‘ayaṃ panā’’tiādimāha.
Now, in showing another cause for his name, the Teacher says, "ayaṃ pana" and so forth.
Bây giờ, để trình bày một nguyên nhân khác cho việc đặt tên của vị ấy, vị thầy đã nói “ayaṃ pana” và những từ tương tự.
Tattha ca ‘‘himavantapadese mahāsare padumagabbhe nibbattī’’ti idamevassa nāmalābhahetudassanaṃ.
Therein, the statement, "born in the womb of a lotus in a great lake in the Himavanta region," is itself the indication of the cause for his name.
Trong đó, cụm từ “himavantapadese mahāsare padumagabbhe nibbattī” (sinh ra trong một bông sen lớn ở vùng Hy Mã Lạp Sơn) là sự trình bày nguyên nhân cho việc đặt tên của vị ấy.
Sesaṃ pana tappasaṅgena tathāpavattākāradassanameva.
The rest is merely an illustration of how it occurred in that context.
Phần còn lại chỉ là sự trình bày về cách thức diễn ra sự việc liên quan đến vị ấy.
Tenāha ‘‘iti naṃ pokkhare sayitattā pokkharasātīti sañjānantī’’ti.
Therefore, it is said, "Thus, knowing him to have rested in a lotus, they called him Pokkharasāti."
Do đó, vị ấy nói: “iti naṃ pokkhare sayitattā pokkharasātīti sañjānantī” (Do vậy, vì nằm trong hoa sen, vị ấy được gọi là Pokkharasāti).
Pokkhare kamale sayatīti hi pokkharasātī, sātaṃ vā vuccati samasaṇṭhānaṃ, pokkhare jātaṃ samasaṇṭhānaṃ tathā, tamassatthītipi pokkharasātī.
Indeed, one who rests in a lotus (pokkhara) is pokkharasāti. Or, "sāta" refers to a symmetrical form; thus, a symmetrical form born in a lotus is like that. One who has such a form is also pokkharasāti.
Thật vậy, vị ấy nằm trong hoa sen (pokkhara) nên là pokkharasātī. Hoặc sāta được gọi là hình dạng tương tự, hình dạng tương tự sinh ra trong hoa sen là như vậy, và vì vị ấy có hình dạng đó nên cũng là pokkharasātī.
Yaṃ pana ācariyena vuttaṃ ‘‘imassa brāhmaṇassa kīdiso pubbayogo, yena naṃ bhagavā anuggaṇhituṃ taṃ ṭhānaṃ upagatoti āhā’’ti, (dī. ni. ṭī. 1.255) tadetaṃ ‘‘ayaṃ panā’’tiādivacanaṃ ekadesameva sandhāya vuttaṃ.
What the Teacher said—"What was the past meritorious deed of this brahmin, due to which the Blessed One went to that place to show him favor?"—refers to only a part of the statement "ayaṃ pana" and so forth.
Về điều mà vị thầy đã nói: “Vị Bà-la-môn này có nhân duyên đời trước như thế nào, mà Đức Thế Tôn đã đến nơi đó để ban ân cho vị ấy?” thì lời nói “ayaṃ pana” và các cụm từ tương tự chỉ đề cập đến một phần của điều đó.
‘‘So tato manussaloka’’ntiādivacanato devaloke nibbattīti ettha aparāparaṃ nibbatti eva vuttāti daṭṭhabbaṃ.
From the statement "So tato manussaloka" and so forth, it should be understood that continuous births (aparāparaṃ nibbatti) in the deva-loka (devaloke) were meant.
Từ lời nói “So tato manussaloka” và các cụm từ tương tự, cần phải hiểu rằng cụm từ devaloke nibbattī (sinh ra ở cõi trời) chỉ đề cập đến sự tái sinh liên tiếp.
Tathārūpena kammena nibbattimeva sandhāya ‘‘mātukucchivāsaṃ jigucchitvā’’tiādi vuttaṃ.
Referring to birth through such karma, "mātukucchivāsaṃ jigucchitvā" and so forth was said.
Cụm từ “mātukucchivāsaṃ jigucchitvā” và các cụm từ tương tự được nói ra để chỉ sự tái sinh do nghiệp như vậy.
‘‘Padumagabbhe nibbattī’’ti iminā saṃsedajoyeva hutvā nibbattīti dasseti.
By "born in the womb of a lotus," it shows that he was born as a saṃsedajja being.
Cụm từ “Padumagabbhe nibbattī” cho thấy vị ấy sinh ra từ ẩm thấp (saṃsedaja).
Na pupphatīti na vikasati.
Na pupphatī means it does not bloom.
Na pupphatī nghĩa là không nở hoa.
Tenāti tāpasena.
Tena means by that ascetic.
Tena nghĩa là bởi vị ẩn sĩ.
Nāḷatoti pupphadaṇḍato.
Nāḷato means from the flower stalk.
Nāḷato nghĩa là từ cuống hoa.
Suvaṇṇacuṇṇehi piñjaraṃ hemavaṇṇo yassāti suvaṇṇacuṇṇapiñjaro, taṃ, suvaṇṇacuṇṇehi vikiṇṇabhāvena hemavaṇṇanti attho.
Suvaṇṇacuṇṇapiñjaro means one whose golden color is tinged with gold dust, meaning it has a golden hue due to being sprinkled with gold dust.
Suvaṇṇacuṇṇapiñjaro nghĩa là màu vàng óng ánh với bột vàng, tức là có màu vàng do được rắc bột vàng.
Piñjarasaddo hi hemavaṇṇapariyāyoti sāratthadīpaniyaṃ (sārattha. ṭī. 1.22) vuttaṃ.
Indeed, the word piñjara is a synonym for a golden color, as stated in the Sāratthadīpanī.
Thật vậy, từ piñjara là từ đồng nghĩa với màu vàng, như đã nói trong Sāratthadīpanī.
Esa nayo padumareṇupiñjaranti etthāpi.
The same method applies to padumareṇupiñjara.
Nguyên tắc này cũng áp dụng cho cụm từ padumareṇupiñjara.
Rajatabimbakanti rūpiyamayarūpakaṃ.
Rajatabimbaka means a silver statue.
Rajatabimbaka nghĩa là tượng bạc.
Paṭijaggāmīti posemi.
Paṭijaggāmī means I nourish.
Paṭijaggāmī nghĩa là tôi nuôi dưỡng.
Pāranti pariyosānaṃ, nipphatti vā vuccati nadīsamuddādīnaṃ pariyosānabhūtaṃ pāraṃ viyāti katvā.
Pāra refers to the end or completion, considering it like the shore that is the end of rivers, oceans, and so forth.
Pāra nghĩa là sự kết thúc, hoặc được gọi là sự hoàn thành, như bờ bên kia là điểm kết thúc của sông, biển, v.v.
Paṭisandhipaññāsaṅkhātena sabhāvañāṇena paṇḍito. Iti kattabbesu, vedesu vā visāradapaññāsaṅkhātena veyyattiyena byatto.
Paṇḍito means wise, by natural knowledge, which is the wisdom of saṃsandhi. Or, byatto means skilled, by sagacious wisdom, which is excellent wisdom in the Vedas or duties (kattabbesu).
Vị ấy là paṇḍito (người trí tuệ) nhờ trí tuệ bẩm sinh được gọi là trí tuệ tái tục (paṭisandhipaññā). Hoặc vị ấy là byatto (người thông thái) nhờ sự khéo léo được gọi là trí tuệ tinh thông trong các việc cần làm hoặc trong các kinh Veda.
Aggabrāhmaṇoti disāpāmokkhabrāhmaṇo.
Aggabrāhmaṇo means a chief brahmin (disāpāmokkhabrāhmaṇo).
Aggabrāhmaṇo nghĩa là vị Bà-la-môn trưởng của các phương (disāpāmokkhabrāhmaṇo).
Sippanti vedasippaṃ tasseva pakaraṇādhigatattā.
Sippa refers to the Veda-craft, as it is understood from the context of that very Veda.
Sippa nghĩa là học vấn Veda, vì chỉ liên quan đến việc học các kinh Veda.
Brahmadeyyaṃ adāsīti vakkhamānanayena brahmadeyyaṃ katvā adāsi.
Brahmadeyyaṃ adāsī means he gave the brahmadeyya in the manner that will be explained.
Brahmadeyyaṃ adāsī nghĩa là đã ban tặng một món quà linh thiêng theo cách sẽ được trình bày.
552
‘‘Ajjhāvasatī’’ti ettha adhi-saddo, ā-saddo ca upasaggamattaṃ, tato ‘‘ukkaṭṭha’’nti idaṃ ajjhāpubbavasayoge bhummatthe upayogavacanaṃ.
In "Ajjhāvasatī," the prefixes adhi and ā are merely upasaggas, and therefore, "ukkaṭṭha" is a term used in the locative case with the verb stem vas preceded by ajjhā.
Trong cụm từ “Ajjhāvasatī”, các tiền tố adhiā chỉ là các giới từ. Do đó, cụm từ “ukkaṭṭha” này là một từ được sử dụng ở vị trí sở thuộc (bhummattha) trong cấu trúc kết hợp với vasa đi trước bởi ajjhā.
Adhi-saddo vā issariyattho, ā-saddo mariyādattho tato ‘‘ukkaṭṭha’’nti idaṃ kammappavacanīyayoge bhummatthe upayogavacananti dasseti ‘‘ukkaṭṭhanāmake’’tiādinā.
Alternatively, the prefix adhi signifies sovereignty, and the prefix ā signifies boundary. Thus, "ukkaṭṭha" is a term used in the locative case with the sense of kammappavacanīya (a particle governing the accusative or locative), as indicated by "ukkaṭṭhanāmake" and so forth.
Hoặc tiền tố adhi có nghĩa là quyền lực, tiền tố ā có nghĩa là giới hạn. Do đó, cụm từ “ukkaṭṭha” này là một từ được sử dụng ở vị trí sở thuộc trong cấu trúc kết hợp với kammappavacanīya, như đã trình bày bằng cụm từ “ukkaṭṭhanāmake” và các cụm từ tương tự.
Tadevatthaṃ vivarituṃ ‘‘tassā’’tiādi vuttaṃ.
To explain that very meaning, "tassā" and so forth was said.
Để giải thích ý nghĩa đó, cụm từ “tassā” và các cụm từ tương tự đã được nói ra.
‘‘Tassa nagarassa sāmiko hutvā’’ti hi ‘‘abhibhavitvā’’ti etassatthavivaraṇaṃ, tenetaṃ dīpeti ‘‘sāmibhāvo abhibhavana’’nti.
Indeed, "tassa nagarassa sāmiko hutvā" is an explanation of the meaning of "abhibhavitvā," thereby indicating that "sāmibhāvo is abhibhavanaṃ (sovereignty is overwhelming)."
Thật vậy, cụm từ “tassa nagarassa sāmiko hutvā” là để giải thích ý nghĩa của cụm từ “abhibhavitvā”, do đó nó chỉ ra rằng “quyền làm chủ là sự chế ngự”.
‘‘Yāya mariyādāyā’’tiādi pana ā-saddassatthavivaraṇaṃ, tenetaṃ dīpeti ‘‘āsaddo mariyādattho, mariyādā ca nāma yāya tattha vasitabbaṃ, sāyeva aparādhīnatā’’ti.
But "Yāya mariyādāyā" and so forth is an explanation of the meaning of the prefix ā, thereby indicating that "āsaddo mariyādattho (the prefix ā means boundary), and mariyādā is that by which one dwells there, which is self-sufficiency (aparādhīnatā)."
Cụm từ “Yāya mariyādāyā” và các cụm từ tương tự là để giải thích ý nghĩa của tiền tố ā, do đó nó chỉ ra rằng “tiền tố ā có nghĩa là giới hạn, và giới hạn đó là sự không phụ thuộc vào người khác, mà nhờ đó người ta cư trú ở đó”.
Yāya mariyādāyāti hi yāya aparādhīnatāsaṅkhātāya anaññasādhāraṇāya avatthāyāti attho.
Indeed, "Yāya mariyādāyā" means by which state of unique non-dependence.
Thật vậy, Yāya mariyādāyā có nghĩa là nhờ vào trạng thái không phụ thuộc vào người khác, không chung với người khác.
‘‘Upasaggavasenā’’tiādi pana ‘‘ukkaṭṭhanāmake’’ti etassatthavivaraṇaṃ, tenetaṃ dīpeti ‘‘satipi bhummavacanappasaṅge dhātvatthānuvattakavisesakabhūtehi duvidhehipi upasaggehi yuttattā upayogavacanamevettha vihita’’nti.
However, "Upasaggavasena" and so forth is an explanation of the meaning of "ukkaṭṭhanāmake," thereby indicating that "even though there is an occasion for the locative case, due to being conjoined with both kinds of upasaggas (prefixes) that function as qualifiers following the meaning of the root, only the accusative case (upayogavacanaṃ) is prescribed here."
Cụm từ “Upasaggavasenā” và các cụm từ tương tự là để giải thích ý nghĩa của cụm từ “ukkaṭṭhanāmake”, do đó nó chỉ ra rằng “mặc dù có thể có trường hợp sử dụng từ sở thuộc, nhưng ở đây chỉ có từ được sử dụng ở vị trí đối cách (upayogavacana) được quy định, vì nó được kết hợp với hai loại giới từ đóng vai trò bổ nghĩa cho ý nghĩa của động từ”.
‘‘Tassa kirā’’tiādi pana atthānugatasamaññāparidīpanaṃ.
But "Tassa kirā" and so forth is an exposition of a designation consistent with the meaning.
Cụm từ “Tassa kirā” và các cụm từ tương tự là để làm sáng tỏ tên gọi phù hợp với ý nghĩa.
Vatthu nāma nagaramāpanārahabhūmippadeso ‘‘ārāmavatthu, vihāravatthū’’tiādīsu viya.
Vatthu means a piece of land suitable for building a town, as in "ārāmavatthu, vihāravatthu" and so forth.
Vatthu là khu đất thích hợp để xây dựng thành phố, như trong các cụm từ “ārāmavatthu, vihāravatthu” và các cụm từ tương tự.
553
Ukkāti daṇḍadīpikā.
Ukkā means torch-lights.
Ukkā nghĩa là ngọn đuốc cầm tay.
Aggahesunti ‘‘ajja maṅgaladivaso, tasmā sunakkhattaṃ, tatthāpi ayaṃ sukhaṇo mā atikkamī’’ti rattivibhāyanaṃ anurakkhantā, rattiyaṃ ālokakaraṇatthāya ukkā ṭhapetvā ukkāsu jalamānāsu nagarassa vatthuṃ aggahesuṃ, tenetaṃ dīpeti – ukkāsu ṭhitāti ukkaṭṭhā. Mūlavibhujādi ākatigaṇapakkhepena, niruttinayena vā ukkāsu vijjotayantīsu ṭhitāti ukkaṭṭhā, tathā ukkāsu ṭhitāsu ṭhitā āsītipi ukkaṭṭhāti.
Aggahesuṃ means they took possession of the town-site by placing torches and lighting them for illumination at night, preserving the auspicious day and moment, thinking, "Today is an auspicious day, therefore the constellation is good; may this favorable moment not pass." This indicates that ukkaṭṭhā means "standing amidst the torches." Either by inclusion in the Mūlavibhujādi group of ākatigaṇa, or by the method of nirutti, it means ukkaṭṭhā because they were established amidst the shining torches. Likewise, it means ukkaṭṭhā because they were established when the torches were established.
Aggahesuṃ nghĩa là họ đã chiếm lấy khu đất của thành phố khi những ngọn đuốc đang cháy, giữ cho đêm không trôi qua, nghĩ rằng “hôm nay là ngày tốt lành, vì vậy đây là sao tốt, và khoảnh khắc tốt lành này không nên bỏ lỡ”, để tạo ánh sáng vào ban đêm. Do đó, nó chỉ ra rằng: “Họ đã đứng trên những ngọn đuốc” nên là ukkaṭṭhā. Hoặc, theo cách thêm vào nhóm từ mūlavibhujādiākati hoặc theo ngữ pháp, “họ đã đứng khi những ngọn đuốc đang chiếu sáng” nên là ukkaṭṭhā. Tương tự, “họ đã đứng khi những ngọn đuốc đã được đặt” cũng là ukkaṭṭhā.
Majjhimāgamaṭṭhakathāyaṃ pana evaṃ vuttaṃ ‘‘tañca nagaraṃ ‘maṅgaladivaso sukhaṇo, sunakkhattaṃ mā atikkamī’ti rattimpi ukkāsu ṭhitāsu māpitattā ukkaṭṭhātipi vuccati, daṇḍadīpikāsu jāletvā dhāriyamānāsu māpitattāti vuttaṃ hotī’’ti, (ma. ni. aṭṭha. 1.mūlapariyāyasuttavaṇṇanā) tadapiminā saṃsandati ceva sameti ca nagaravatthupariggahassapi nagaramāpanapariyāpannattāti daṭṭhabbaṃ.
In the Majjhimāgamaṭṭhakathā, however, it is stated thus: "And that town is also called Ukkaṭṭhā because it was built even at night while torches were lit, thinking, 'May the auspicious day and favorable moment not pass.' It is said to mean that it was built while torch-lights were lit and held." This also corresponds and agrees with the present text, as the taking possession of the town-site is included within the act of building the town.
Tuy nhiên, trong Majjhimāgamaṭṭhakathā đã nói như sau: “Thành phố đó cũng được gọi là Ukkaṭṭhā vì nó được xây dựng suốt đêm khi những ngọn đuốc đang cháy, với ý nghĩ ‘hôm nay là ngày tốt lành, khoảnh khắc tốt lành, sao tốt lành không nên bỏ lỡ’, tức là được xây dựng khi những ngọn đuốc cầm tay được thắp sáng và giữ vững”. Điều này cũng phù hợp và tương thích với điều này, vì việc chiếm hữu khu đất thành phố cũng nằm trong phạm vi xây dựng thành phố.
Apare pana bhaṇanti ‘‘bhūmibhāgasampattiyā, upakaraṇasampattiyā, manussasampattiyā ca taṃ nagaraṃ ukkaṭṭhaguṇayogato ukkaṭṭhāti nāmaṃ labhatī’’ti.
Others say that "the town received the name Ukkaṭṭhā due to its excellence in terms of land, facilities, and people."
Những người khác lại nói rằng: “Thành phố đó có tên là Ukkaṭṭhā vì nó đạt được phẩm chất cao cấp nhờ sự thịnh vượng về đất đai, sự thịnh vượng về tiện nghi và sự thịnh vượng về con người”.
Lokiyā pana vadanti ‘‘ukkā dhārīyati etassa māpitakāleti ukkaṭṭhā, vaṇṇavikāroya’’nti, itthiliṅgavasena cāyaṃ samaññā, tenevidha payogo dissati ‘‘yathā ca bhavaṃ gotamo ukkaṭṭhāya aññāni upāsakakulāni upasaṅkamatī’’ti (dī. ni. 1.299) mūlapariyāyasuttādīsu (ma. ni. 1.1) ca ‘‘ekaṃ samayaṃ bhagavā ukkaṭṭhāyaṃ viharati subhagavane sālarājamūle’’tiādi.
But worldly people say: "The town is called Ukkaṭṭhā because torches (ukkā) were held (dhārīyati) at the time of its construction; this is a phonetic change." And this designation is in the feminine gender, hence such usage is seen in passages like "yathā ca bhavaṃ gotamo ukkaṭṭhāya aññāni upāsakakulāni upasaṅkamatī" and in the Mūlapariyāyasutta and so forth, "ekaṃ samayaṃ bhagavā ukkaṭṭhāyaṃ viharati subhagavane sālarājamūle" (at one time the Blessed One was dwelling in Ukkaṭṭhā, in the Subhaga forest, at the foot of a Sāla tree-king).
Tuy nhiên, những người thế tục nói rằng: “ Ukkaṭṭhā là nơi những ngọn đuốc được giữ khi nó được xây dựng, đây là một sự biến đổi âm thanh”, và tên gọi này là theo giống cái (itthiliṅga). Do đó, cách dùng này được thấy trong các bài kệ như “yathā ca bhavaṃ gotamo ukkaṭṭhāya aññāni upāsakakulāni upasaṅkamatī” và trong Mūlapariyāyasutta và các bài kinh tương tự, “ekaṃ samayaṃ bhagavā ukkaṭṭhāyaṃ viharati subhagavane sālarājamūle” và các bài kinh tương tự.
Evamettha hotu upasaggavasena upayogavacanaṃ, kathaṃ panetaṃ sesapadesu siyāti anuyogenāha ‘‘tassa anupayogattā sesapadesū’’ti.
Even if the accusative case (upayogavacanaṃ) is here by means of upasagga (prefix), how can it be in the other terms? To address this question, he says, "tassa anupayogattā sesapadesū" (due to its inapplicability in the other terms).
Nếu ở đây là từ được sử dụng ở vị trí đối cách theo giới từ, thì làm thế nào điều này có thể xảy ra ở các vị trí khác? Để giải đáp câu hỏi này, vị ấy nói: “tassa anupayogattā sesapadesū”.
Tattha tassāti upasaggavasena upayogasaññuttassa ‘‘ukkaṭṭha’’nti padassa.
Therein, tassā refers to the word "ukkaṭṭha" which is connected with the accusative case (upayogasaññuttassa) by means of an upasagga.
Trong đó, tassā là của từ “ukkaṭṭha” được sử dụng ở vị trí đối cách theo giới từ.
Anupayogattāti visesanabhāvena anupayuttattā.
Anupayogattā means due to being inapplicable as a qualifier.
Anupayogattā nghĩa là không được sử dụng như một bổ ngữ.
Sesapadesūti ‘‘sattussada’’ntiādīsu sattasu padesu.
Sesapadesū means in the seven terms such as "sattussada" and so forth.
Sesapadesū nghĩa là trong bảy vị trí như “sattussada” và các cụm từ tương tự.
554
Kiṃ nu khvāyaṃ saddapayogo saddalakkhaṇānugatoti codanamapaneti ‘‘tattha…pe… pariyesitabba’’nti iminā.
He dispels the objection "Is this usage of words consistent with the rules of grammar?" by saying, "tattha…pe… pariyesitabbaṃ."
Để loại bỏ câu hỏi liệu cách dùng từ này có phù hợp với ngữ pháp hay không, vị ấy nói: “tattha…pe… pariyesitabba”.
Tatthāti upasaggavasena, anupayogavasena ca upayogavacananti vutte dubbidhepi vidhāne.
Tatthā means in both methods, whether the accusative case (upayogavacanaṃ) is stated by means of an upasagga or by means of inapplicability.
Tatthā nghĩa là trong cả hai cách quy định, tức là khi được nói là từ được sử dụng ở vị trí đối cách theo giới từ và theo cách không sử dụng.
Lakkhaṇanti gahaṇūpāyañāyabhūtaṃ saddalakkhaṇaṃ, suttaṃ vā.
"Lakkhaṇa" means the grammatical characteristic, which is suitable as a means of apprehension, or a Sutta.
Lakkhaṇa (đặc tính) là đặc tính của từ, là cái phù hợp với phương tiện để nắm bắt, hoặc là một bài kinh (sutta).
Pariyesitabbanti saddasatthesu vijjamānattā ñāṇena gavesitabbaṃ, gahetabbanti vuttaṃ hoti.
"Pariyesitabba" means that, because it exists in grammatical treatises, it should be sought with wisdom, or it is said that it should be taken.
Pariyesitabba (nên tìm kiếm) có nghĩa là nên tìm kiếm bằng trí tuệ, nên nắm bắt, vì nó có mặt trong các bộ ngữ pháp.
Etena hi saddalakkhaṇānugatovāyaṃ saddapayogoti dasseti, saddavidū ca icchanti ‘‘upaanuadhiāiccādipubbavasayoge sattamiyatthe upayogavacanaṃ pāpuṇāti, visesitabbapade ca yathāvidhimanupayogo visesanapadānaṃ samānādhikaraṇabhūtāna’’nti.
For indeed, by this (word) it is shown that this usage of words follows grammatical characteristics, and grammarians also wish that "in the usage of vas with upa, anu, adhi, ā, etc., the locative case is reached in the sense of the locative, and in the word to be qualified (visesitabba-pada), the non-usage of qualificatory words (visesana-pada) that are in apposition should follow the rule."
Thật vậy, với điều này, nó chỉ ra rằng cách dùng từ này phù hợp với đặc tính của từ. Các nhà ngữ pháp cũng mong muốn rằng: “Khi động từ vasa được dùng với các tiền tố upa, anu, adhi, ā, v.v., thì từ đó sẽ nhận cách dùng của thất cách (locative case); và trong từ được bổ nghĩa, cách dùng của các từ bổ nghĩa ở cùng một vị trí sẽ là cách dùng thông thường theo quy tắc.”
Tatra yadā adhi-saddo, ā-saddo ca upasaggamattaṃ, tadā ‘‘tatiyāsattamīnañcā’’ti lakkhaṇena ajjhāpubbavasayoge upayogavacanaṃ.
Therein, when the word adhi and the word ā are merely prefixes, then the locative case in the usage of vas preceded by adhi and ā is by the rule "tatiyāsattamīnañcā" (for the third and seventh cases).
Trong trường hợp đó, khi các từ adhiā chỉ là tiền tố, thì từ đó sẽ nhận cách dùng của thất cách khi động từ vasa được dùng với tiền tố ajjhā theo quy tắc “tatiyāsattamīnañcā” (của tam cách và thất cách).
Tathā hi vadanti ‘‘sattamiyatthe kāladisāsu upānvajjhāvasayoge, adhipubbasiṭhāvasānaṃ payoge, tappānacāresu ca dutiyā.
Thus they say, "In the sense of the locative, in time and directions, the second case occurs in the usage of vas with upa, anu, adhi, ā, in the usage of , ṭhā, vas with adhi, and in cases of drinking and moving."
Thật vậy, họ nói rằng: “Trong ý nghĩa của thất cách, trong thời gian và phương hướng, khi động từ vasa được dùng với tiền tố upa, anu, ajjhā, ā; khi động từ siṭṭhāvasāna được dùng với tiền tố adhi; và trong các hành động uống, đi, thì dùng nhị cách (accusative case).
Kāle pubbaṇhasamayaṃ nivāsetvā, ekaṃ samayaṃ bhagavā, kañci kālaṃ purejātapaccayena paccayo, imaṃ rattiṃ cattāro mahārājāno.
In time: Having worn the lower robe in the forenoon, once the Blessed One, for some time, was beneficial by way of the pre-arisen condition, four Great Kings (were) this night.
Trong thời gian: pubbaṇhasamayaṃ nivāsetvā (sau khi mặc y vào buổi sáng); ekaṃ samayaṃ bhagavā (một thời Đức Thế Tôn); kañci kālaṃ purejātapaccayena paccayo (trong một số thời điểm, duyên tiền sanh là duyên); imaṃ rattiṃ cattāro mahārājāno (trong đêm này, bốn vị đại vương).
Disāyaṃ purimaṃ disaṃ dhataraṭṭho.
In direction: Dhataraṭṭha (was) in the eastern direction.
Trong phương hướng: purimaṃ disaṃ dhataraṭṭho (vua Dhataraṭṭha ở phương đông).
Upādipubbavasayoge gāmaṃ upavasati, gāmaṃ anuvasati, gāmaṃ āvasati, agāraṃ ajjhāvasati, adhipubbasiṭhāvasānaṃ payoge pathaviṃ adhisessati, gāmaṃ adhitiṭṭhati, gāmaṃ ajjhāvasati.
In the usage of vas preceded by upa etc.: Gāmaṃ upavasati (dwells near the village), gāmaṃ anuvasati (dwells after the village), gāmaṃ āvasati (dwells in the village), agāraṃ ajjhāvasati (dwells ruling over the house). In the usage of , ṭhā, vas preceded by adhi: Pathaviṃ adhisessati (will lie upon the earth), gāmaṃ adhitiṭṭhati (stands ruling over the village), gāmaṃ ajjhāvasati (dwells ruling over the village).
Khi động từ vasa được dùng với tiền tố upa, v.v.: gāmaṃ upavasati (cư trú gần làng), gāmaṃ anuvasati (cư trú theo làng), gāmaṃ āvasati (cư trú tại làng), agāraṃ ajjhāvasati (cư trú trong nhà); khi động từ siṭṭhāvasāna được dùng với tiền tố adhi: pathaviṃ adhisessati (sẽ nằm trên đất), gāmaṃ adhitiṭṭhati (đứng trên làng), gāmaṃ ajjhāvasati (cư trú tại làng).
Tappānacāresu nadiṃ pivati, gāmaṃ carati iccādīti.
In drinking and moving: Nadiṃ pivati (drinks at the river), gāmaṃ carati (roams in the village), and so on.
Trong các hành động uống và đi: nadiṃ pivati (uống nước sông), gāmaṃ carati (đi lại trong làng), v.v.”
555
Yadā pana adhi-saddo issariyattho, ā-saddo ca mariyādattho, tadā ‘‘kammappavacanīyayutte’’ti lakkhaṇena kammappavacanīyayoge upayogavacanaṃ.
However, when the word adhi means "sovereignty" and the word ā means "boundary," then the second case occurs in the usage of kammappavacanīya by the rule "kammappavacanīyayutte" (when conjoined with a kammappavacanīya).
Tuy nhiên, khi từ adhi có nghĩa là quyền lực, và từ ā có nghĩa là giới hạn, thì từ đó sẽ nhận cách dùng của kammappavacanīya theo quy tắc “kammappavacanīyayutte” (khi dùng với kammappavacanīya).
Tathā hi vadanti ‘‘anuādayo upasaggā, dhīādayo nipātā ca kammappavacanīyasaññā honti kiriyāsaṅkhātaṃ kammaṃ pavacanīyaṃ yesaṃ te kammappavacanīyā’’ti.
Thus they say, "The prefixes anu etc., and the particles dhī etc., are called kammappavacanīya (prepositions governing the accusative case) because 'action' (kamma) refers to the verb which they qualify."
Thật vậy, họ nói rằng: “Các tiền tố anu, ā, v.v., và các giới từ dhī, ā, v.v., được gọi là kammappavacanīya, tức là những từ mà hành động được gọi là kamma (nghiệp) được diễn tả bởi chúng.”
Sesapadānaṃ pana yathāvidhimanupayoge katarena lakkhaṇena upayogavacananti?
But for the remaining words, by what rule does the second case occur when there is no apposition according to the rule?
Còn đối với các từ còn lại, khi không có cách dùng thông thường theo quy tắc, thì từ đó sẽ nhận cách dùng của cách nào?
Yathāvuttalakkhaṇeneva.
It is by the aforementioned rule itself.
Chính là theo quy tắc đã nêu.
Yajjevaṃ tesampi ādhārabhāvato nānādhāratā siyāti?
If it were so, then wouldn't there be different bases for those (words) too, because of their being bases?
Nếu vậy, ngay cả những từ đó cũng có thể có nhiều cơ sở hỗ trợ khác nhau, phải không?
Na, bahūnampi padānaṃ nagaravasena ekatthabhāvato.
No, because many words, like a city, have one meaning.
Không, vì nhiều từ cũng có cùng một ý nghĩa như một thành phố.
Sakatthamattañhi tesaṃ nānākaraṇanti.
Their individual meaning is merely what makes them different.
Vì bản chất riêng của chúng là khác nhau.
Aññe pana saddavidū evamicchanti ‘‘samānādhikaraṇapadānaṃ paccekaṃ kiriyāsambandhanena visesitabbapadena samānavacanatā yathā ‘kaṭaṃ karoti, vipulaṃ, dassanīya’nti ettha ‘kaṭaṃ karoti, vipulaṃ karoti, dassanīyaṃ karotī’ti paccekaṃ kiriyāsambandhanena kammattheyeva dutiyā’’ti, tadetaṃ vicāretabbaṃ visesanapadānaṃ samānādhikaraṇānaṃ kiriyāsambajjhanābhāvato.
Other grammarians, however, wish thus: "For words in apposition, there is agreement in case with the qualified word due to their individual connection with the verb, just as in 'he makes a mat, broad, beautiful,' where due to the individual connection with the verb 'makes,' the accusative case occurs only in the sense of the object." This should be examined because words of qualification in apposition do not connect with the verb.
Tuy nhiên, các nhà ngữ pháp khác lại mong muốn như sau: “Các từ ở cùng một vị trí (samānādhikaraṇa) có cùng một cách dùng với từ được bổ nghĩa thông qua sự liên kết riêng lẻ với động từ, giống như trong ‘kaṭaṃ karoti, vipulaṃ, dassanīya’ (làm chiếu, rộng lớn, đáng xem), ở đây, nhị cách được dùng chỉ trong ý nghĩa của hành động thông qua sự liên kết riêng lẻ với động từ ‘kaṭaṃ karoti, vipulaṃ karoti, dassanīyaṃ karoti’ (làm chiếu, làm rộng lớn, làm đáng xem).” Điều này cần được xem xét vì các từ bổ nghĩa ở cùng một vị trí không liên kết với động từ.
Yadā hi kiriyāsambajjhanaṃ, tadā visesanameva na hotīti.
For when there is a connection with the verb, it is no longer merely a qualifier.
Thật vậy, khi có sự liên kết với động từ, thì đó không phải là từ bổ nghĩa.
556
Ussadatā nāmettha bahulatāti vuttaṃ ‘‘bahujana’’nti.
"Ussadatā" here means abundance, as it is said in "bahujana" (many people).
Ở đây, ussadatā có nghĩa là sự đông đúc, đó là lý do tại sao từ bahujana (nhiều người) được dùng.
Taṃ pana bahulataṃ dasseti ‘‘ākiṇṇamanussa’’ntiādinā.
That abundance is shown by "ākiṇṇamanussa" (crowded with people) and so on.
Sự đông đúc đó được chỉ ra bởi ākiṇṇamanussa (người đông đúc) và các từ khác.
Araññādīsu gahetvā posetabbā posāvaniyā, etena tesaṃ dhammabhāvaṃ dasseti.
Creatures that should be caught and raised in forests etc. are "posāvaniya" (domesticated animals); by this, their tamable nature is shown.
Những con vật được bắt và nuôi dưỡng trong rừng, v.v., được gọi là posāvaniyā (những con vật được nuôi dưỡng). Điều này chỉ ra rằng chúng là những con vật được thuần hóa.
Āvijjhitvāti parikkhipitvā.
"Āvijjhitvā" means having surrounded.
Āvijjhitvā có nghĩa là bao quanh.
Khaṇitvā katā pokkharaṇī, ābandhitvā kataṃ taḷākaṃ.
A "pokkharaṇī" (lotus pond) is made by digging; a "taḷāka" (pond) is made by building banks.
Pokkharaṇī là một cái ao được đào; một cái hồ được đắp đập gọi là taḷākaṃ.
Acchinnūdakaṭṭhāneyeva jalajakusumāni jātānīti vuttaṃ ‘‘udakassa niccabharitānevā’’ti.
It is said "udakassa niccabharitānevā" (always full of water) because aquatic flowers grow only in places where water is continuous.
Hoa sen chỉ mọc ở những nơi có nước không bao giờ cạn, đó là lý do tại sao từ udakassa niccabharitānevā (luôn đầy nước) được dùng.
Udakassāti ca pūraṇakiriyāyoge karaṇatthe sāmivacanaṃ ‘‘mahante mahante sāṇipasibbake kārāpetvā hiraññasuvaṇṇassa pūrāpetvā’’tiādīsu (pārā. 34) viya.
And "udakassa" is a possessive case in the sense of an instrument in conjunction with the verb "to fill," as in "having caused to fill large sacks with gold and silver" and so on.
Từ udakassa ở đây là thuộc cách (genitive case) trong ý nghĩa của công cụ khi liên kết với hành động làm đầy, giống như trong các trường hợp “mahante mahante sāṇipasibbake kārāpetvā hiraññasuvaṇṇassa pūrāpetvā” (sau khi làm những túi vải lớn và đổ đầy vàng bạc).
Saha dhaññenāti sadhaññanti nagarasaddāpekkhāya napuṃsakaliṅgena vuttaṃ, yathāvākyaṃ vā upayogavacanena.
"Saha dhaññena" is expressed as "sadhañña" in the neuter gender, referring to the word "nagara" (city), or it is a nominative case according to the sentence structure.
Saha dhaññenāti sadhañña (cùng với ngũ cốc) được dùng ở giống trung tính (neuter gender) do liên quan đến từ nagara (thành phố), hoặc là cách dùng của nhị cách theo câu.
Evaṃ sabbattha.
Thus in all cases.
Cũng vậy ở mọi nơi.
Pubbaṇṇāparaṇṇādibhedaṃ bahudhaññasannicayanti ettha ādisaddena tadubhayavinimuttaṃ alābukumbhaṇḍādisūpeyyaṃ saṅgaṇhāti.
In "pubbaṇṇāparaṇṇādibhedaṃ bahudhaññasannicaya" (a collection of various grains, such as early and late crops), the word "ādi" (etc.) includes edible vegetables like gourds and pumpkins, which are distinct from both.
Trong cụm từ pubbaṇṇāparaṇṇādibhedaṃ bahudhaññasannicaya (tích trữ nhiều loại ngũ cốc, như ngũ cốc mùa sớm và mùa muộn), từ ādi (v.v.) bao gồm các loại rau củ như bí ngô, bầu, v.v., không thuộc hai loại trên.
Tenāyamattho viññāyati – nayidha dhaññasaddo sāliādidhaññavisesavācako, posane sādhuttamattena pana niravasesapubbaṇṇāparaṇṇasūpeyyavācako, virūpekasesavasena vā payuttoti.
Therefore, this meaning is understood: the word "dhañña" here does not denote specific grains like rice, but rather, by virtue of its excellence in nourishment, it denotes all early and late crops and edible vegetables, or it is used in the sense of virūpekasesa (retention of one term of a compound whose terms are dissimilar).
Do đó, ý nghĩa được hiểu là: ở đây, từ dhañña (ngũ cốc) không chỉ là một loại ngũ cốc cụ thể như gạo, v.v., mà là tất cả các loại ngũ cốc mùa sớm, mùa muộn và rau củ dùng làm thức ăn, vì chúng tốt cho việc nuôi dưỡng; hoặc nó được dùng theo cách virūpekasesa (một phần của từ phức có các thành phần khác nhau).
Ettāvatāti yathāvuttapadattayena.
"Ettāvatā" means by these three aforementioned words.
Ettāvatā (đến mức này) là với ba từ đã nêu.
Rājalīlāyāti rājūnaṃ vilāsena.
"Rājalīlāyā" means with the splendor of kings.
Rājalīlāyā (với phong cách của vua) là với sự sang trọng của các vị vua.
Samiddhiyā upabhogaparibhogasampuṇṇabhāvena sampatti samiddhisampatti.
"Samiddhisampatti" is prosperity through the abundance of consumables and enjoyables.
Samiddhisampatti (sự thành tựu của thịnh vượng) là sự thành tựu của sự thịnh vượng với đầy đủ các vật phẩm để hưởng thụ và sử dụng.
557
‘‘Rājabhogga’’nti vutte ‘‘kena dinna’’nti avassaṃ pucchitabbato evaṃ vuttanti dasseti ‘‘kenā’’tiādinā.
It is said "rājabhogga" (royal property) to show that it would necessarily be asked "by whom was it given?", thus it is said "kenā" (by whom) and so on.
Khi nói “rājabhogga” (vật phẩm của vua), vì nhất định phải hỏi “kena dinna” (do ai ban tặng), nên điều này được nói để chỉ ra ý nghĩa đó, bắt đầu bằng kenā (do ai).
Raññā viya bhuñjitabbanti vā rājabhogganti aṭṭhakathāto aparo nayo.
Or another interpretation from the Aṭṭhakathā is that "rājabhogga" means to be enjoyed like by a king.
Một cách giải thích khác từ chú giải là rājabhogga (vật phẩm của vua) có nghĩa là nên được hưởng thụ như một vị vua.
Yāva puttanattapanattaparamparā kulasantakabhāvena rājato laddhattā ‘‘rañño dāyabhūta’’nti vuttaṃ.
It is said "rañño dāyabhūta" (become a royal gift) because it was received from the king, remaining as family property for generations of sons, grandsons, and great-grandsons.
Từ rañño dāyabhūta (là tài sản thừa kế của vua) được dùng vì nó được nhận từ vua và trở thành tài sản của gia đình qua các thế hệ con cháu, chắt, chút.
‘‘Dhammadāyādā me bhikkhave bhavathā’’tiādīsu (ma. ni. 1.29) viya ca dāyasaddo dāyajjapariyāyoti āha ‘‘dāyajjanti attho’’ti.
And just as in "bhikkhus, be heirs of the Dhamma, not of material things," and so on, the word "dāya" is a synonym for "dāyajja" (inheritance), thus he says, "the meaning is inheritance."
Và giống như trong “Dhammadāyādā me bhikkhave bhavathā” (Này các tỳ khưu, hãy là những người thừa kế Pháp của Ta) và các câu tương tự, từ dāya (thừa kế) là từ đồng nghĩa với dāyajjapariyāya (tài sản thừa kế), đó là lý do tại sao nói dāyajjanti attho (có nghĩa là tài sản thừa kế).
Kathaṃ dinnattā brahmadeyyaṃ nāmāti codanaṃ pariharati ‘‘chattaṃ ussāpetvā’’tiādinā.
He refutes the question, "how is it called a brahmadeyya (divine gift) by being given?" by saying "chattaṃ ussāpetvā" (having raised the parasol) and so on.
Để giải quyết câu hỏi “Do cách ban tặng nào mà nó được gọi là brahmadeyya (vật phẩm thiêng liêng)?”, nó được giải thích bắt đầu bằng chattaṃ ussāpetvā (sau khi giương lọng).
Rājanīhārena paribhuñjitabbato hi uddhaṃ paribhogalābhassa brahmadeyyatā nāma natthi, idañca tathā dinnameva, tasmā brahmadeyyaṃ nāmāti vuttaṃ hoti.
Indeed, there is no such thing as a "brahmadeyya" (divine gift) for a gain of enjoyment above that which is enjoyed by royal custom; this (gift) was given in that manner, therefore it is called a brahmadeyya.
Thật vậy, không có cái gọi là brahmadeyyatā (sự ban tặng thiêng liêng) cho việc hưởng thụ lợi lộc cao hơn việc hưởng thụ theo cách của vua. Và điều này đã được ban tặng theo cách đó, do đó, nó được gọi là brahmadeyya.
Chejjabhejjanti sarīradaṇḍadhanadaṇḍādibhedaṃ daṇḍamāha.
"Chejjabhejja" refers to punishment such as corporal punishment and monetary fines.
Chejjabhejja (cắt xẻo và đánh đập) nói về các hình phạt như hình phạt thân thể và hình phạt tiền bạc.
Nadītitthapabbatādīsūti nadītitthapabbatapādagāmadvāraaṭavimukhādīsu.
"Nadītitthapabbatādīsu" refers to river fords, mountain bases, village gates, forest entrances, and so on.
Nadītitthapabbatādīsu (ở các bến sông, núi, v.v.) là ở các bến sông, chân núi, cổng làng, cửa rừng, v.v.
Setacchattaggahaṇena sesarājakakudhabhaṇḍampi gahitaṃ tappamukhattāti veditabbaṃ.
It should be understood that by "setacchattaggahaṇena" (by taking the white parasol), the other royal regalia are also included, as it is prominent among them.
Nên hiểu rằng việc dùng từ setacchattaggahaṇena (giương lọng trắng) cũng bao gồm các vật phẩm hoàng gia khác, vì nó là vật phẩm chính.
‘‘Raññā bhuñjitabba’’ntveva vutte idhādhippetattho na pākaṭoti hutvā-saddaggahaṇaṃ kataṃ.
When it was merely said "raññā bhuñjitabba" (to be enjoyed by the king), the intended meaning here was not clear, so the word "hutvā" (having become) was included.
Nếu chỉ nói “raññā bhuñjitabbaṃ” (nên được vua hưởng thụ), ý nghĩa được mong muốn ở đây sẽ không rõ ràng, đó là lý do tại sao từ hutvā (trở thành) được thêm vào.
Tañhi so rājakulato asamudāgatopi rājā hutvā bhuñjituṃ labhatīti ayamidhādhippeto attho.
For the meaning intended here is that even if he did not originate from a royal family, he obtains the right to enjoy it by having become a king.
Ý nghĩa được mong muốn ở đây là: ngay cả khi người đó không xuất thân từ dòng dõi hoàng tộc, người đó vẫn có thể trở thành vua và hưởng thụ.
Dātabbanti dāyaṃ, ‘‘rājadāya’’nti imināva raññā dinnabhāve siddhe ‘‘raññā pasenadinā kosalena dinna’’nti puna ca vacanaṃ kimatthiyanti āha ‘‘dāyakarājadīpanattha’’ntiādi.
"Dāyaṃ" means what is to be given. Since "rājadāya" (royal gift) itself implies that it was given by a king, why is it stated again, "given by King Pasenadi of Kosala"? He says, "dāyakarājadīpanattha" (for the purpose of showing the giving king) and so on.
Nên ban tặng là dāyaṃ (vật ban tặng). Khi đã rõ ràng rằng nó được vua ban tặng bởi từ “rājadāyaṃ” (vật ban tặng của vua), thì tại sao lại nói thêm “raññā pasenadinā kosalena dinna” (được vua Pasenadi của Kosala ban tặng)? Điều này được giải thích là để dāyakarājadīpanattha (chỉ ra vị vua ban tặng) và các điều khác.
Asukena raññā dinnanti dāyakarājassa adīpitattā evaṃ vuttanti adhippāyo.
The intention is that it is stated this way because the king who gave it, by whom it was given, was not explicitly mentioned.
Ý nghĩa là điều này được nói vì vị vua ban tặng chưa được chỉ ra là “được vị vua nào đó ban tặng”.
Ettha ca paṭhamanaye ‘‘rājabhogga’’nti pade pucchāsambhavato idaṃ vuttaṃ, dutiyanaye pana ‘‘rājadāya’’nti padeti ayampi viseso daṭṭhabbo.
And here, in the first method, this was said due to the possibility of a question concerning the word "rājabhogga"; in the second method, it was concerning the word "rājadāya"—this distinction should also be observed.
Và ở đây, trong cách giải thích thứ nhất, điều này được nói vì có thể có câu hỏi về từ “rājabhogga”; còn trong cách giải thích thứ hai, điều này được nói về từ “rājadāya”. Đây cũng là một điểm khác biệt cần lưu ý.
Tattha atibahulatāya purato ṭhapanokāsābhāvato passenapi odanasūpabyañjanādi dīyati etassāti pasenadi, aluttasamāsavasena.
Therein, due to the excessive abundance (of food) for placing in front, rice, curries, and sauces, etc., are given even from the side (passena api) to this king, hence he is called "Pasenadi," according to the aluttasamāsa (indeclinable compound).
Ở đó, do sự quá mức phong phú, không có chỗ để đặt ở phía trước, nên ngay cả thức ăn, súp và các món ăn kèm cũng được đặt ở bên cạnh cho người này, đó là lý do tại sao ông được gọi là Pasenadi, theo cách hợp chất không biến đổi (aluttasamāsa).
So hi rājā taṇḍuladoṇassa odanampi tadupiyena sūpabyañjanena bhuñjati.
That king would eat rice from a doṇa of rice, along with curries and sauces appropriate for it.
Vị vua đó ăn một đấu gạo với súp và các món ăn kèm phù hợp.
Tathā hi naṃ bhuttapātarāsakāle satthu santikamāgantvā ito cito ca samparivattantaṃ niddāya abhibhuyyamānaṃ ujukaṃ nisīditumasakkontaṃ bhagavā –
Thus, when he came to the Master after breakfast, rolling from side to side, overcome by sleep, unable to sit upright, the Blessed One (said to him):—
Thật vậy, khi vua Pasenadi của Kosala đến gặp Đức Phật sau bữa sáng, Đức Phật thấy vua đang lăn lộn qua lại, bị giấc ngủ chế ngự, không thể ngồi thẳng, liền nói:
558
‘‘Middhī yadā hoti mahagghaso ca,
"When one is sleepy and a great glutton,
“Khi người biếng nhác, tham ăn,
559
Niddāyitā samparivattasāyī;
A sleeper, lying about,
Hay ngủ, nằm lăn lóc,
560
Mahāvarāhova nivāpavuṭṭho,
Like a huge boar, fed in a trough,
Như heo rừng mới ra khỏi chuồng,
561
Punappunaṃ gabbhamupeti mando’’ti.(dha. pa. 325; netti. 26, 90);
the foolish one repeatedly enters a womb.”
kẻ ngu si tái sinh hết lần này đến lần khác vào bào thai.”
562
Imāya gāthāya ovadi.
He admonished with this verse.
Ngài đã răn dạy bằng bài kệ này.
Bhāgineyyañca so sudassanaṃ nāma māṇavaṃ –
That King Pasenadi also admonished his nephew, the youth named Sudassana—
Và Ngài cũng đã răn dạy người cháu trai tên Sudassana,
563
‘‘Manujassa sadā satīmato,
“For a mindful person always,
“Đối với người luôn có niệm,
564
Mattaṃ jānato laddhabhojane;
who knows moderation in food received;
Biết tiết độ trong việc thọ dụng thực phẩm;
565
Tanukassa bhavanti vedanā,
his feelings are slight,
Các cảm thọ của người ấy trở nên yếu ớt,
566
Saṇikaṃ jīrati āyupālaya’’nti.(saṃ. ni. 1.24) –
he grows old slowly, protecting his life.” –
Và tuổi thọ được bảo vệ, dần dần già đi.”
567
Imaṃ gāthaṃ bhagavato santike uggahāpetvā attano bhuñjantassa osānapiṇḍakāle devasikaṃ bhaṇāpeti, so aparena samayena tassā gāthāya atthaṃ sallakkhetvā punappunaṃ osānapiṇḍapariharaṇena nāḷikodanamattāya saṇṭhahitvā tanusarīro balavā sukhappatto ahosīti.
Having made him learn this verse from the Blessed One, he would have him recite it daily at the time of the last mouthful of his meal. Later, reflecting on the meaning of that verse, by repeatedly abstaining from the last portion of food and subsisting on just a nāḷikā of cooked rice, he became lean, strong, and attained happiness.
Sau khi khiến người cháu học thuộc bài kệ này từ Đức Thế Tôn, nhà vua đã khiến người cháu đọc tụng bài kệ ấy hằng ngày vào lúc cuối bữa ăn của mình. Sau một thời gian, người cháu đã suy xét ý nghĩa của bài kệ đó và nhờ việc từ bỏ phần cơm cuối cùng hết lần này đến lần khác, người cháu đã có thể duy trì thân thể chỉ với một chén cơm, trở nên gầy gò nhưng mạnh khỏe và đạt được an lạc.
Udānaṭṭhakathāyaṃ (udā. aṭṭha. 12) pana evaṃ vuttaṃ ‘‘paccāmittaṃ parasenaṃ jinātīti pasenadī’’ti.
However, in the Udānaṭṭhakathā, it is stated thus: "He conquers opposing enemies, hence Pasenadi."
Tuy nhiên, trong Udānaṭṭhakathā có nói rằng: “Vua Pasenadi là người chinh phục kẻ thù và quân địch.”
Saddavidūpi hi ja-kārassa da-kāre idamudāharanti.
Indeed, grammarians also cite this (word Pasenadi) when changing 'ja' to 'da'.
Các nhà ngữ pháp học cũng dùng ví dụ này khi thay đổi âm “ja” thành “da”.
So hi attano bhāgineyyaṃ ajātasatturājānaṃ, pañcacorasatādīni ca avaruddhakāni jinātīti.
Indeed, he conquered his nephew King Ajātasattu, and the five hundred bandits, etc., who were unsubdued.
Thật vậy, vua ấy đã chinh phục vua Ajātasattu là cháu trai của mình, và năm trăm tên cướp cùng những kẻ nổi loạn khác.
Kosalaraṭṭhassādhipatibhāvato kosalo, tasmā kosalādhipatinā pasenadi nāmakena raññā dinnanti attho veditabbo.
The meaning should be understood as: "Kosalā" because he was the ruler of the Kosala country, and thus, given by the king named Pasenadi, the ruler of Kosala.
Vì là người cai trị xứ Kosala nên gọi là Kosala, do đó, phải hiểu rằng đó là vật được ban tặng bởi vua Pasenadi, người cai trị xứ Kosala.
Nissaṭṭhapariccattatāsaṅkhātena puna aggahetabbabhāveneva dinnattā idha brahmadeyyaṃ nāma, na tu purimanaye viya rājasaṅkhepena paribhuñjitabbabhāvena dinnattāti āha ‘‘yathā’’tiādi.
Here, it is called brahmadeyya because it was given with the understanding of being abandoned and completely relinquished, never to be taken back again, not as given to be enjoyed under the guise of royalty, as in the former manner; thus he says “yathā” and so on.
Ở đây, brahmadeyyaṃ có nghĩa là được ban tặng theo cách đã được từ bỏ hoàn toàn, không thể lấy lại được nữa, chứ không phải được ban tặng để thọ dụng như một vị vua theo cách trước đây. Vì vậy, kinh nói “yathā” (như thế nào) v.v.
Nissaṭṭhaṃ hutvā, nissaṭṭhabhāvena vā pariccattaṃ nissaṭṭhapariccattaṃ, muttacāgavasena cajitanti attho.
“Nissaṭṭhapariccattaṃ” means given up by being renounced, or renounced by way of having been renounced, meaning abandoned by way of absolute relinquishment.
Nissaṭṭhaṃ (đã từ bỏ) hoặc nissaṭṭhabhāvena (bằng cách từ bỏ) là nissaṭṭhapariccattaṃ (đã từ bỏ hoàn toàn), nghĩa là đã bố thí một cách tự do.
568
Savanaṃ upalabbhoti dasseti ‘‘upalabhī’’ti iminā, so cāyamupalabbho savanavaseneva jānananti vuttaṃ ‘‘sotadvārasampattavacananigghosānusārena aññāsī’’ti.
That he attained hearing is shown by "upalabhī", and this attainment is said to be knowing merely by way of hearing, as stated in "sotadvārasampattavacananigghosānusārena aññāsī" (he understood by means of the sound of speech that reached his ear-door).
Việc nghe được (savanaṃ) hiển thị bằng từ “upalabhī” (đã nhận được), và sự nhận được này được nói là sự hiểu biết thông qua việc nghe, như đã nói “aññāsī” (đã hiểu) theo tiếng vang của lời nói đã đến cửa tai.
Sotadvārānusāraviññāṇavīthivasena jānanameva hi idha savanaṃ teneva ‘‘samaṇo khalu bho gotamo’’tiādinā vuttassatthassa adhigatattā, na pana sotadvāravīthivasena sutamattaṃ tena tadatthassa anadhigatattā.
Indeed, knowing by way of the mind-door thought-process that follows the ear-door is what is meant by hearing here, because thereby the meaning spoken of in "the ascetic Gotama, good sirs," and so forth, was understood, not merely hearing by way of the ear-door thought-process, for thereby that meaning would not have been understood.
Thật vậy, ở đây, việc nghe là sự hiểu biết thông qua lộ trình thức tâm tùy theo cửa tai, vì ý nghĩa của lời nói “Samaṇo khalu bho Gotamo” (Thật vậy, Sa-môn Gotama) v.v. đã được thấu hiểu. Chứ không phải chỉ là việc nghe đơn thuần qua lộ trình thức cửa tai, vì ý nghĩa đó chưa được thấu hiểu.
Avadhāraṇaphalattā saddapayogassa sabbampi vākyaṃ antogadhāvadhāraṇaṃ.
Since the use of the word serves the purpose of ascertainment, the entire statement implies ascertainment within itself.
Vì việc sử dụng từ có kết quả là sự xác định, nên toàn bộ câu đều chứa đựng sự xác định.
Tasmā tadatthajotakasaddena vināpi aññatthāpohanavasena assosi eva, nāssa koci savanantarāyo ahosīti ayamattho viññāyatīti āha ‘‘padapūraṇamatte nipāto’’ti, antogadhāvadhāraṇepi ca sabbasmiṃ vākye nītatthato avadhāraṇatthaṃ kho-saddaggahaṇaṃ ‘‘evā’’ti sāmatthiyā sātisayaṃ etadatthassa viññāyamānattāti paṭhamavikappo vutto, nītatthato avadhāraṇena ko attho ekantiko kato, avadhārito cāti vuttaṃ ‘‘tatthā’’tiādi.
Therefore, it is understood that even without a word indicating that meaning, he did indeed hear, by excluding other meanings, and there was no impediment to his hearing; hence he says, “the particle is merely for filling out the sentence”; and even when ascertainment is implied within the entire statement by its direct meaning, the inclusion of the word kho for the purpose of ascertainment is stated as the first alternative, because the meaning is understood with exceptional emphasis by the power of the word eva. What purpose is served by ascertainment through direct meaning, and what is definitively ascertained? Thus, it is stated “tatthā” and so on.
Do đó, ngay cả khi không có từ biểu thị ý nghĩa đó, ông ấy vẫn nghe được (assosi eva) bằng cách loại trừ các ý nghĩa khác, và không có chướng ngại nào đối với việc nghe của ông ấy. Ý nghĩa này được hiểu, vì vậy kinh nói “padapūraṇamatte nipāto” (từ nghi vấn chỉ để bổ túc câu). Và trong toàn bộ câu chứa đựng sự xác định, việc dùng từ “kho” để xác định ý nghĩa là do khả năng của từ “eva” (chắc chắn), vì ý nghĩa này được hiểu một cách đặc biệt. Vì vậy, phương án đầu tiên đã được nói. Ý nghĩa gì đã được xác định một cách tuyệt đối bằng sự xác định từ ý nghĩa trực tiếp? Và điều đã được xác định, đã được thực hiện. Vì vậy, kinh nói “tatthā” (ở đó) v.v.
Atha padapūraṇamattena kho-saddena kiṃ payojananti codanamapaneti ‘‘padapūraṇenā’’tiādinā, akkharasamūhapadassa, padasamūhavākyassa ca siliṭṭhatāpayojanamattamevāti attho.
Then, to dispel the objection, "What is the purpose of the particle kho being merely for filling out the sentence?", he says, "padapūraṇena" and so on, meaning it is merely for the purpose of fluency of the word formed by a group of syllables and the sentence formed by a group of words.
Sau đó, để giải đáp câu hỏi “Từ ‘kho’ chỉ để bổ túc câu thì có lợi ích gì?”, kinh nói “padapūraṇenā” (bằng cách bổ túc câu) v.v., nghĩa là chỉ có lợi ích làm cho từ ngữ và câu văn trở nên trôi chảy, mạch lạc.
‘‘Assosī’’ti hidaṃ padaṃ kho-sadde gahite tena phullitaṃ maṇḍitaṃ vibhūsitaṃ viya hontaṃ pūritaṃ nāma hoti, tena ca purimapacchimapadāni sukhuccāraṇavasena siliṭṭhāni honti, na tasmiṃ aggahite, tasmā padapūraṇamattampi padabyañjanasiliṭṭhatāpayojananti vuttaṃ hoti.
Indeed, when the word assosī is used with the word kho, it becomes as if blossomed, adorned, and beautified by it, thus it is called "filled"; and by it, the preceding and succeeding words become fluent for easy pronunciation, which they are not if it is not included. Therefore, it is said that even merely filling out the sentence serves the purpose of making the words and phrases fluent.
Thật vậy, khi từ “kho” được dùng, từ “assosī” này trở nên đầy đủ, như thể được nở hoa, được trang điểm, được tô điểm, và nhờ đó, các từ trước và sau trở nên trôi chảy khi phát âm dễ dàng, điều này không xảy ra khi từ đó không được dùng. Do đó, ngay cả việc bổ túc câu cũng có lợi ích làm cho từ ngữ và câu văn trở nên trôi chảy, mạch lạc.
Mattasaddo cettha visesanivattiattho, tenassa anatthantaradīpanatā dassitā, eva-saddena pana padabyañjanasiliṭṭhatāya ekantikatā.
Here, the word matta (merely) has the meaning of excluding additional significance, thereby showing that it does not signify another meaning, while the word eva indicates the certainty of the fluency of the words and phrases.
Ở đây, từ “matta” có nghĩa là loại trừ sự đặc biệt, do đó nó cho thấy rằng từ này không biểu thị ý nghĩa khác. Còn từ “eva” (chắc chắn) thì cho thấy tính tuyệt đối của sự trôi chảy, mạch lạc của từ ngữ và câu văn.
569
‘‘Samaṇo khalū’’tiādi yathāsutatthanidassananti dasseti ‘‘idānī’’tiādinā.
That "samaṇo khalū" and so on indicates the meaning as heard, he shows by "idānī" and so on.
Kinh nói “idānī” (bây giờ) v.v. để chỉ ra rằng “Samaṇo khalū” (Thật vậy, Sa-môn) v.v. là sự trình bày ý nghĩa theo đúng nghĩa đen.
Samitapāpattāti ettha accantaṃ anavasesato savāsanaṃ samitapāpattāti attho gahetabbo.
In "samitapāpattā", the meaning to be taken is that one's evil deeds have been completely eradicated, utterly, and together with their latent tendencies (vāsanā).
Trong từ Samitapāpattā (người đã làm lắng dịu tội lỗi), phải hiểu là đã làm lắng dịu tội lỗi một cách tuyệt đối, hoàn toàn, không còn sót lại chút dấu vết nào (savāsanaṃ).
Evañhi bāhirakavītarāgasekkhāsekkhapāpasamanato bhagavato pāpasamanaṃ yathārahaṃ visesitaṃ hoti.
Only thus is the eradication of evil deeds of the Blessed One appropriately distinguished from the eradication of evil deeds by external ascetics, those who are free from passion (vītarāga), and those who are on the path of training (sekkha) and those who are perfected (asekkha).
Chỉ khi đó, sự làm lắng dịu tội lỗi của Đức Thế Tôn mới được phân biệt một cách thích đáng với sự làm lắng dịu tội lỗi của các bậc hữu học (sekkhā), vô học (asekkhā) và những người đã ly tham (vītarāga) bên ngoài.
Tena vuttaṃ ‘‘bhagavā ca anuttarena ariyamaggena samitapāpo’’ti.
Therefore, it is said: "The Blessed One has eradicated evil by the unsurpassed Noble Path."
Vì vậy, kinh nói “Bhagavā ca anuttarena ariyamaggena samitapāpo” (Đức Thế Tôn là người đã làm lắng dịu tội lỗi bằng con đường Thánh vô thượng).
Tadevatthaṃ niddesapāṭhena sādhetuṃ ‘‘ vuttañheta’’ntiādimāha.
To establish this very meaning with the explanatory text, he says "vuttañheta" and so on.
Để chứng minh ý nghĩa đó bằng đoạn văn giải thích, kinh nói “vuttañheta” (điều này đã được nói) v.v.
Assāti anena bhikkhunā, bhagavatā vā.
"Assā" means by this bhikkhu, or by the Blessed One.
Assā (của vị ấy) là của vị tỳ-khưu này, hoặc của Đức Thế Tôn.
Samitāti samāpitā, samabhāvaṃ vā āpādayitā, assa vā sampadānabhūtassa santā hontīti attho.
"Samitā" means brought to an end, or made to attain a state of peace; or the meaning is that they are appeased for him who is the recipient.
Samitā (đã được làm lắng dịu) là đã được chấm dứt, hoặc đã được làm cho trở nên bình đẳng. Hoặc có nghĩa là các tội lỗi đã lắng dịu đối với người đã được ban tặng.
Atthānugatā cāyaṃ bhagavati samaññāti vuttaṃ ‘‘bhagavā cā’’tiādi.
And this appellation for the Blessed One is in accordance with the meaning, as stated in "bhagavā cā" and so on.
Và danh xưng này (samaññā) phù hợp với Đức Thế Tôn, vì vậy kinh nói “Bhagavā cā” (và Đức Thế Tôn) v.v.
Tenāti tathā samitapāpattā.
"Tenā" means by being thus one whose evil deeds are appeased.
Tenā (bởi vì thế) là bởi vì đã làm lắng dịu tội lỗi như vậy.
Yathābhūtaṃ pavatto yathābhuccaṃ, tadeva guṇo, tena adhigataṃ tathā.
That which has occurred as it truly is, is "yathābhuccaṃ" (as it truly is); that very thing is a quality (guṇa), and by that, it is attained thus.
Yathābhuccaṃ (chân thật) là điều đã xảy ra đúng như bản chất. Đó chính là đức tính, và đã đạt được như vậy bằng đức tính đó.
‘‘Khalū’’ti idaṃ nepātikaṃ khalupacchābhattikapade (mi. pa. 4.1.8) viya, na nāmaṃ, anekatthattā ca nipātānaṃ anussavanatthova idhādhippetoti āha ‘‘anussavanatthe nipāto’’ti, paramparasavanañcettha anussavanaṃ.
The word "khalū" here is a particle (nipāta), like in the word khalupacchābhattika; it is not a noun. And since particles have many meanings, only the meaning of "traditional report" (anussavana) is intended here; thus he says "anussavanatthe nipāto" (it is a particle in the sense of traditional report). And here, traditional report is hearing from one to another.
Từ “khalū” (thật vậy) này là một từ nghi vấn (nipātikaṃ), giống như trong từ “khalupacchābhattikapade” (từ ‘khalu’ sau bữa ăn), chứ không phải là một danh từ. Và vì các từ nghi vấn có nhiều nghĩa, ở đây chỉ có ý nghĩa nghe truyền lại (anussavanaṃ) là được đề cập đến. Vì vậy, kinh nói “anussavanatthe nipāto” (từ nghi vấn có nghĩa nghe truyền lại). Và ở đây, anussavanaṃ là việc nghe truyền lại từ người khác.
Brāhmaṇajātisamudāgatanti brāhmaṇajātiyā āgataṃ, jātisiddhanti vuttaṃ hoti.
"Brāhmaṇajātisamudāgataṃ" means having come by way of the Brahmin birth, meaning it is inherent by birth.
Brāhmaṇajātisamudāgataṃ (sinh ra từ dòng dõi Bà-la-môn) có nghĩa là xuất thân từ dòng dõi Bà-la-môn, tức là đã được xác lập theo dòng dõi.
Ālapanamattanti piyālapanavacanamattaṃ, na taduttari atthaparidīpanaṃ.
"Ālapanamattaṃ" means merely a loving address, not a further elucidation of meaning.
Ālapanamattaṃ (chỉ là lời chào hỏi) là chỉ là lời nói chào hỏi thân ái, chứ không phải là sự giải thích ý nghĩa sâu xa hơn.
Piyasamudāhārā hete ‘‘bho’’ti vā ‘‘āvuso’’ti vā ‘‘devānaṃ piyā’’ti vā.
Indeed, these are terms of affectionate address: "bho", or "āvuso", or "devānaṃ piyā".
Những lời chào hỏi thân ái này là “bho” (này bạn), hoặc “āvuso” (này hiền giả), hoặc “devānaṃ piyā” (người được chư thiên yêu mến).
Dhammapade brāhmaṇavatthupāṭhena, (dha. pa. 315 ādayo) suttanipāte ca vāseṭṭhasuttapadena brāhmaṇajātisamudāgatālapanabhāvaṃ samatthetuṃ ‘‘vuttampi ceta’’ntiādimāha.
To establish the fact that it is an address that originates from the brahmin caste, with the text of the Brāhmaṇavatthu in the Dhammapada and the Vāseṭṭhasutta text in the Suttanipāta, he says "vuttampi ceta" and so on.
Để chứng minh rằng việc chào hỏi xuất thân từ dòng dõi Bà-la-môn được nói đến trong Dhammapada (với đoạn văn về Bà-la-môn) và trong Suttanipāta (với đoạn văn Vāseṭṭhasutta), kinh nói “vuttampi ceta” (điều này cũng đã được nói) v.v.
570
Tatrāyamattho – sace rāgādikiñcanehi sakiñcano assa, so āmantanādīsu ‘‘bho bho’’ti vadanto hutvā vicaraṇato bhovādīyeva nāma hoti, na brāhmaṇo.
In that Pāḷi, this is the meaning: If one were burdened with defilements such as passion, and going about saying "bho bho" in addressing others and so on, then he would indeed be merely a "bhovādī" (one who says "bho"), not a true brahmin.
Ở đó, ý nghĩa là: nếu một người có phiền não (sakiñcano) với các cấu uế như tham ái v.v., thì người đó, khi chào hỏi bằng những lời như “này bạn, này bạn”, chỉ là một người nói “này bạn” (bhovādī), chứ không phải là một Bà-la-môn chân chính.
‘‘Akiñcanaṃ anādānaṃ, tamahaṃ brūmi brāhmaṇa’’nti (dha. pa. 396, su. ni. 625) sesagāthāpadaṃ.
The remaining part of the verse is: "One who is unburdened, ungrasping, him I call a brahmin."
“Ta gọi người không phiền não, không chấp thủ là Bà-la-môn” là đoạn kệ còn lại.
Tattha rāgādayo satte kiñcanti maddanti palibuddhantīti kiñcanāni. Manussā kira goṇehi khalaṃ maddāpentā ‘‘kiñcehi kapila, kiñcehi kāḷakā’’ti vadanti, tasmā kiñcanasaddo maddanattho veditabbo.
There, the defilements such as passion are called kiñcanā because they harass (kiñcanti) and oppress (maddanti) beings. Indeed, people say "Kiñcehi Kapila, kiñcehi Kāḷakā" (Harass, Kapila! Harass, Kāḷaka!) when making oxen tread on the threshing floor. Therefore, the word kiñcana should be understood in the sense of 'harassing' or 'oppressing'.
Ở đó, các cấu uế như tham ái v.v. đè nén (kiñcanti), nghiền nát (maddanti), và trói buộc (palibuddhanti) chúng sinh, nên gọi là kiñcanāni (các cấu uế). Người ta nói rằng, khi con người dùng bò để giẫm lúa trên sân đập lúa, họ nói “giẫm đi Kapila, giẫm đi Kālaka”. Do đó, từ “kiñcana” phải được hiểu theo nghĩa đè nén.
Yathāha niddese ‘‘akiñcananti rāgakiñcanaṃ, dosa, moha, māna, diṭṭhi, kilesakiñcanaṃ, duccaritakiñcanaṃ, yassete kiñcanā pahīnā samucchinnā vūpasantā paṭippassaddhā abhabbuppattikā ñāṇagginā daḍḍhā, so vuccati akiñcano’’ti (cūḷani. 28, 32, 60, 63).
As stated in the Niddesa: "'Akiñcana' means one who has no defilement of lust, hatred, delusion, conceit, wrong view, or evil conduct. One for whom these defilements are abandoned, utterly cut off, appeased, thoroughly tranquillized, incapable of arising again, burnt up by the fire of wisdom, he is called akiñcana (unburdened)."
Như đã nói trong Niddesa: “Akiñcanaṃ (không phiền não) là không có tham ái cấu uế, sân hận, si mê, kiêu mạn, tà kiến, phiền não cấu uế, ác hạnh cấu uế. Người mà các cấu uế này đã được đoạn trừ, đã được nhổ tận gốc, đã được lắng dịu, đã được an tịnh, không thể tái sinh, đã bị thiêu cháy bởi lửa trí tuệ, người đó được gọi là akiñcanaṃ.”
Gotamoti gottavasena parikittanaṃ, yaṃ ‘‘ādiccagotta’’ntipi loke vadanti, sakyaputtoti pana jātivasena sākiyoti ca tasseva vevacanaṃ.
Gotama is a designation based on lineage (gotta), which people also call "Ādiccagotta" (of the Solar clan); Sakyaputta, however, is a designation based on birth, and Sākiya is also a synonym for the same.
Gotamo (Cồ-đàm) là sự xưng tán theo dòng họ, điều mà người đời cũng gọi là “dòng họ Mặt Trời” (ādiccagotta). Còn Sakyaputto (Thích tử) là sự đồng nghĩa của từ Sakya (Thích-ca) theo dòng dõi.
Vuttañhetaṃ pabbajjāsutte
This is stated in the Pabbajjāsutta:
Điều này đã được nói trong Pabbajjāsutta (Kinh Xuất Gia):
571
‘‘Ādiccā nāma gottena, sākiyā nāma jātiyā;
“By lineage I am Ādicca, by birth Sākiya;
“Ta thuộc dòng họ Ādicca,
572
Tamhā kulā pabbajitomhi, na kāme abhipatthaya’’nti.(su. ni. 425);
From that clan have I gone forth, I do not crave for sensual pleasures.”
Thuộc chủng tộc Sākiya; Ta đã xuất gia từ dòng dõi ấy, không còn khao khát dục lạc.”
573
Tathā cāha ‘‘gotamoti bhagavantaṃ gottavasena parikittetī’’tiādi.
And thus he says: "Gotama means describing the Blessed One by his lineage." and so on.
Và kinh cũng nói “Gotamo” (Cồ-đàm) v.v. là xưng tán Đức Thế Tôn theo dòng họ.
Tattha gaṃ tāyatīti gottaṃ, ‘‘gotamo’’ti pavattamānaṃ abhidhānaṃ, buddhiñca ekaṃsikavisayatāya rakkhatīti attho.
In this context, gotta (lineage) means ‘that which protects go (speech/cognition).’ The meaning is that the appellation ‘Gotamo’ and cognition are protected by virtue of being objects of certainty.
Trong đó, gottaṃ (gia tộc) là bảo vệ tri thức (gaṃ); ý nghĩa là cái tên "Gotama" đang hiện hành bảo vệ từ ngữ và trí tuệ do tính chất đối tượng chắc chắn.
Yathā hi buddhi ārammaṇabhūtena atthena vinā na vattati, evaṃ abhidhānaṃ abhidheyyabhūtena, tasmā so gottasaṅkhāto attho tāni rakkhatīti vuccati, go-saddo cettha abhidhāne, buddhiyañca vattati.
Just as cognition does not arise without an object, so too an appellation does not arise without a designated entity. Therefore, that meaning, called gotta, is said to protect them, and here the word go refers to appellation and cognition.
Thật vậy, giống như trí tuệ không vận hành nếu không có đối tượng, thì từ ngữ cũng vậy, không có đối tượng được gọi. Do đó, ý nghĩa được gọi là gottaṃ được nói là bảo vệ chúng (tức là từ ngữ và trí tuệ). Và ở đây, từ go- được dùng cho từ ngữ và trí tuệ.
Tathā hi vadanti –
Thus they say:
Thật vậy, họ nói:
574
‘‘Go goṇe cendriye bhumyaṃ, vacane ceva buddhiyaṃ;
Go refers to cattle, sense faculties, earth, speech, and also to cognition;
“Go được dùng cho bò, giác quan, đất đai, lời nói và trí tuệ;
575
Ādicce rasmiyañceva, pānīyepi ca vattate;
It also refers to the sun, rays, and water;
Cũng như cho mặt trời, tia sáng và nước;
576
Tesu atthesu goṇe thī, pumā ca itare pumā’’ti.
Among these meanings, go is feminine for cows, and masculine for the others.”
Trong các ý nghĩa đó, go là giống cái khi nói về bò, còn các ý nghĩa khác là giống đực.”
577
Tattha ‘‘gosu duyhamānāsu gato, gopañcamo’’tiādīsu gosaddo goṇe vattati.
Among those meanings, in phrases like ‘‘Gosū duyhamānāsu gato, gopañcamo,’’ the word go refers to cattle.
Trong đó, từ go được dùng cho bò trong các câu như “Gosu duyhamānāsu gato, gopañcamo” (Khi những con bò cái được vắt sữa, người ấy đi, con bò thứ năm).
‘‘Gocaro’’tiādīsu indriye.
In phrases like ‘‘Gocaro,’’ it refers to the sense faculties.
Trong các câu như “Gocaro” (phạm vi hoạt động), nó được dùng cho giác quan.
‘‘Gorakkha’’ntiādīsu bhūmiyaṃ.
In phrases like ‘‘Gorakkhaṃ’’, it refers to the earth.
Trong các câu như “Gorakkhaṃ” (bảo vệ đất đai), nó được dùng cho đất đai.
Tathā hi suttanipātaṭṭhakathāya vāseṭṭhasuttasaṃvaṇṇanāyaṃ vuttaṃ ‘‘gorakkhanti khettarakkhaṃ, kasikammanti vuttaṃ hoti.
Thus, it is stated in the commentary on the Vāseṭṭhasutta in the Suttanipāta commentary: ‘‘Gorakkhaṃ refers to protection of fields, meaning agricultural work.
Thật vậy, trong phần giải thích kinh Vāseṭṭha của Chú giải Suttanipāta, có nói: “Gorakkhaṃ là bảo vệ ruộng đất, tức là công việc cày cấy.
Pathavī hi ‘go’ti vuccati, tappabhedo ca ‘‘khetta’’nti (su. ni. aṭṭha. 2.619-626).
For the earth is called ‘go’, and its divisions are called ‘fields’.’’
Đất đai được gọi là ‘go’, và loại đất đó được gọi là ‘khettaṃ’ (ruộng).”
‘‘Gottaṃ nāma dve gottāni hīnañca gottaṃ, ukkaṭṭhañca gotta’’ntiādīsu (pāci. 15) vacane, buddhiyañca vattati.
In phrases like ‘‘Gottaṃ nāma dve gottāni hīnañca gottaṃ, ukkaṭṭhañca gottaṃ’’, it refers to speech and cognition.
Trong các câu như “Gotama nāma dve gottāni hīnañca gottaṃ, ukkaṭṭhañca gottaṃ” (Gotama có hai dòng dõi: dòng dõi thấp kém và dòng dõi cao quý), nó được dùng cho lời nói và trí tuệ.
‘‘Gogottaṃ gotamaṃ name’’ti porāṇakaviracanāya ādicce, ādiccabandhuṃ gotamaṃ sammāsambuddhaṃ namāmīti hi attho, ‘‘uṇhagū’’tiādīsu rasmiyaṃ, uṇhā gāvo rasmiyo etassāti hi uṇhagu, sūriyo.
In the ancient poetic composition ‘‘Gogottaṃ gotamaṃ name,’’ it refers to the sun; for the meaning is, ‘I pay homage to the Perfectly Enlightened Buddha, Gotama, a kinsman of the sun’; in phrases like ‘‘Uṇhagū’’, it refers to rays, for uṇhagu means ‘he whose rays are hot’, i.e., the sun.
Trong sáng tác của các nhà thơ cổ “Gogottaṃ gotamaṃ name” (Tôi đảnh lễ Gotama thuộc dòng dõi mặt trời), nó được dùng cho mặt trời; ý nghĩa là tôi đảnh lễ Đức Chánh Đẳng Giác Gotama, người thân thuộc với mặt trời. Trong các câu như “Uṇhagū” (mặt trời), nó được dùng cho tia sáng, vì uṇhā gāvo (những tia sáng nóng) là của người ấy, nên người ấy là uṇhagu, tức mặt trời.
‘‘Gosītacandana’’ntiādīsu (a. ni. ṭī. 1.49) pānīye, gosaṅkhātaṃ pānīyaṃ viya sītaṃ, tadeva candanaṃ tathā.
In phrases like ‘‘Gosītacandanaṃ’’, it refers to water; meaning, sandalwood as cool as water, which is also called gosīta.
Trong các câu như “Gosītacandanaṃ” (gỗ đàn hương mát lạnh như nước), nó được dùng cho nước. Nước được gọi là go, và gỗ đàn hương đó mát lạnh như nước.
Tasmiñhi uddhanato uddharitapakkuthitatelasmiṃ pakkhitte taṅkhaṇaññeva taṃ telaṃ sītalaṃ hotīti.
For when placed in boiled oil just removed from the stove, that oil instantly becomes cool.
Thật vậy, khi gỗ đàn hương đó được cho vào dầu đã được lấy ra khỏi lò và đang sôi sùng sục, ngay lập tức dầu đó trở nên mát lạnh.
Etesu pana atthesu goṇe vattamāno go-saddo yathārahaṃ itthiliṅgo ceva pulliṅgo ca, sesesu pana pulliṅgoyeva.
Among these meanings, the word go when referring to cattle is either feminine or masculine as appropriate, but in other instances, it is only masculine.
Trong các ý nghĩa này, từ go khi dùng cho bò thì có thể là giống cái hoặc giống đực tùy theo ngữ cảnh, nhưng trong các ý nghĩa còn lại thì chỉ là giống đực.
578
Kiṃ panetaṃ gottaṃ nāmāti?
What, then, is this gotta?
Vậy gottaṃ này là gì?
Aññakulaparamparāya asādhāraṇaṃ tassa kulassa ādipurisasamudāgataṃ taṃkulapariyāpannasādhāraṇaṃ sāmaññarūpanti daṭṭhabbaṃ.
It should be understood as a common characteristic of that clan, not shared by other lineages, originating from the progenitor of that clan and common to all included in it.
Nên hiểu đó là một hình thái chung, không phổ biến với các dòng dõi khác, mà chỉ phổ biến với những người thuộc dòng dõi đó, xuất phát từ vị tổ tiên của dòng dõi đó.
Sādhāraṇameva hi idaṃ taṃkulapariyāpannānaṃ sādhāraṇato ca sāmaññarūpaṃ.
Indeed, this is common to those included in that clan, and because it is common, it is a common characteristic.
Thật vậy, đây là một hình thái chung đối với những người thuộc dòng dõi đó, và vì tính phổ biến đó mà nó là một hình thái chung.
Tathā hi taṃkule jātā suddhodanamahārājādayopi ‘‘gotamo’’ tveva vuccanti, teneva bhagavā attano pitaraṃ suddhodanamahārājānaṃ ‘‘atikkantavarā kho gotama tathāgatā’’ti (mahāva. 105) avoca, vessavaṇopi mahārājā bhagavantaṃ ‘‘vijjācaraṇasampannaṃ, buddhaṃ vandāma gotama’’nti, (dī. ni. 3.288) āyasmāpi vaṅgīso āyasmantaṃ ānandaṃ ‘‘sādhu nibbāpanaṃ brūhi, anukampāya gotamā’’ti (saṃ. ni. 1.212).
Thus, great kings like Suddhodana, born in that clan, are also called ‘‘Gotama.’’ For this reason, the Blessed One addressed his father, King Suddhodana, saying, ‘‘Gotama, are the Tathāgatas indeed superior?’’ And King Vessavaṇa addressed the Blessed One, saying, ‘‘We pay homage to the Buddha Gotama, perfected in knowledge and conduct.’’ And Venerable Vaṅgīsa addressed Venerable Ānanda, saying, ‘‘Gotama, please declare the appeasement out of compassion.’’
Thật vậy, những người sinh ra trong dòng dõi đó, như Đại vương Suddhodana, cũng được gọi là “Gotama”. Chính vì thế, Đức Thế Tôn đã nói với cha mình, Đại vương Suddhodana, rằng: “Này Gotama, các vị Như Lai đã vượt qua những điều cao quý nhất” và Đại vương Vessavaṇa cũng đã nói với Đức Thế Tôn rằng: “Chúng tôi đảnh lễ Đức Phật Gotama, bậc đầy đủ minh hạnh”. Tôn giả Vaṅgīsa cũng đã nói với Tôn giả Ānanda rằng: “Này Gotama, xin hãy nói về sự dập tắt (phiền não) vì lòng từ bi”.
Idha pana bhagavantameva.
Here, however, it refers solely to the Blessed One.
Ở đây, chỉ nói đến Đức Thế Tôn.
Tenāha ‘‘bhagavantaṃ gottavasena parikittetī’’ti.
Therefore, it is said: ‘‘He extols the Blessed One by means of his gotta.’’
Vì thế, có câu: “Khen ngợi Đức Thế Tôn theo dòng dõi.”
Tasmāti yathāvuttamatthattayaṃ paccāmasati.
Therefore (tasmā) refers back to the three meanings mentioned above.
Do đó (Tasmā) nhắc lại ba ý nghĩa đã nói trên.
Ettha ca ‘‘samaṇo’’ti iminā sarikkhakajanehi bhagavato bahumatabhāvo dassito tabbisayasamitapāpatāparikittanato, ‘‘gotamo’’ti iminā lokiyajanehi tabbisayauḷāragottasambhūtatāparikittanato.
Here, by ‘‘samaṇo’’ (ascetic), the reverence of the ordinary people for the Blessed One is shown, because it praises him as one who has calmed evil; and by ‘‘gotamo’’ (Gotama), it praises him as one born of a noble clan, reverenced by worldly people.
Ở đây, với từ “samaṇo” (sa-môn), sự được tôn kính của Đức Thế Tôn bởi những người cùng giới được thể hiện qua việc ca ngợi sự diệt trừ tội lỗi của Ngài. Với từ “gotamo” (Gotama), sự được tôn kính của Ngài bởi những người thế gian được thể hiện qua việc ca ngợi sự xuất thân từ dòng dõi cao quý của Ngài.
579
Sakyassa suddhodanamahārājassa putto sakyaputto, iminā pana uccākulaparidīpanaṃ uditoditavipulakhattiyakulasambhūtatāparikittanato.
Sakyaputto (son of the Sakyas) is the son of King Suddhodana of the Sakya clan; this indicates his high birth, as it praises him as one born into an exceedingly prosperous and distinguished warrior clan.
Sakyaputto (con của Sakya) là con của Đại vương Suddhodana thuộc dòng Sakya. Từ này thể hiện sự xuất thân từ dòng dõi cao quý, tức là ca ngợi sự sinh ra trong một dòng dõi Sát-đế-lỵ cao quý và phát triển không ngừng.
Sabbakhattiyānañhi ādibhūtamahāsammatamahārājato paṭṭhāya asambhinnaṃ uḷāratamaṃ sakyarājakulaṃ.
For the Sakya royal clan has been unmixed and extremely noble, ever since the Great King Mahāsammata, the progenitor of all warrior clans.
Thật vậy, dòng dõi hoàng gia Sakya là dòng dõi cao quý nhất, không bị pha tạp, bắt đầu từ Đại vương Mahāsammata, vị vua đầu tiên của tất cả các Sát-đế-lỵ.
Yathāha –
As it is said:
Như đã nói:
580
‘‘Mahāsammatarājassa, vaṃsajo hi mahāmuni;
‘‘Indeed, the Great Sage is a descendant of King Mahāsammata;
“Đại Hiền Giả thuộc dòng dõi Đại vương Mahāsammata;
581
Kappādismiñhi rājāsi, mahāsammatanāmako’’ti.(mahāvaṃse dutiyaparicchede paṭhamagāthā);
For at the beginning of the eon, there was a king named Mahāsammata.’’
Thật vậy, vào đầu kiếp, có một vị vua tên là Mahāsammata.”
582
Kathaṃ saddhāpabbajitabhāvaparidīpananti āha ‘‘kenacī’’tiādi.
To show that he renounced out of faith, it is said: ‘‘By some…’’ and so on.
Để giải thích làm thế nào để thể hiện trạng thái xuất gia do đức tin, có câu “kenacī” (bởi bất kỳ điều gì) v.v.
Parijiyanaṃ parihāyanaṃ pārijuññaṃ, parijiratīti vā parijiṇṇo, tassa bhāvo pārijuññaṃ, tena.
Falling away, decline is pārijuñña; or, that which declines is parijiṇṇa, and its state is pārijuñña, meaning by that.
Sự suy giảm, sự hao mòn là pārijuññaṃ. Hoặc, người suy yếu là parijiṇṇo, trạng thái của người đó là pārijuññaṃ, do đó.
Ñātipārijuññabhogapārijuññādinā kenaci pārijuññena parihāniyā anabhibhūto anajjhotthaṭo hutvā pabbajitoti attho.
The meaning is that he went forth having not been overcome or overwhelmed by any decline, such as a decline of relatives or a decline of wealth.
Ý nghĩa là Ngài đã xuất gia mà không bị ảnh hưởng hay bị chế ngự bởi bất kỳ sự suy yếu nào, như sự suy yếu của bà con hay sự suy yếu của tài sản.
Tadeva pariyāyantarena vibhāvetuṃ ‘‘aparikkhīṇaṃyeva taṃ kulaṃ pahāyā’’ti vuttaṃ.
To illustrate this same meaning in another way, it is said: ‘‘having abandoned that clan which was not in decline.’’
Để giải thích điều đó bằng một cách diễn đạt khác, có nói: “aparikkhīṇaṃyeva taṃ kulaṃ pahāyā” (từ bỏ dòng dõi đó khi nó chưa suy tàn).
Aparikkhīṇanti hi ñātipārijuññabhogapārijuññādinā kenaci pārijuññena aparikkhayaṃ.
For ‘‘aparikkhīṇaṃ’’ means not depleted by any decline, such as a decline of relatives or a decline of wealth.
Aparikkhīṇaṃ (chưa suy tàn) nghĩa là không bị suy tàn bởi bất kỳ sự suy yếu nào như sự suy yếu của bà con hay sự suy yếu của tài sản.
Saddhāya pabbajitoti saddhāya eva pabbajito.
Saddhāya pabbajito means he went forth solely out of faith.
Saddhāya pabbajito (xuất gia do đức tin) nghĩa là chỉ xuất gia do đức tin.
Evañhi ‘‘kenacī’’tiādinā nivattitavacanaṃ sūpapannaṃ hoti.
In this way, the statement negated by ‘‘kenacī’’ and so on becomes well-substantiated.
Như vậy, lời nói được ngăn chặn bởi “kenacī” v.v. là hoàn toàn hợp lý.
Nanu ca ‘‘sakyakulā pabbajito’’ti idaṃ uccākulā pabbajitabhāvaparidīpanameva siyā tadatthasseva viññāyamānattā, na saddhāpabbajitabhāvaparidīpanaṃ tadatthassa aviññāyamānattāti?
Surely, ‘‘sakyakulā pabbajito’’ (gone forth from the Sakya clan) would only demonstrate the fact of his having gone forth from a high clan, as that meaning alone is understood, and not the fact of his having gone forth out of faith, as that meaning is not understood?
Nhưng câu “sakyakulā pabbajito” (xuất gia từ dòng Sakya) chỉ có thể là để thể hiện việc xuất gia từ một dòng dõi cao quý, vì ý nghĩa đó được hiểu rõ, chứ không phải để thể hiện việc xuất gia do đức tin, vì ý nghĩa đó không được hiểu rõ, phải không?
Na kho panevaṃ daṭṭhabbaṃ mahantaṃ ñātiparivaṭṭaṃ, mahantañca bhogakkhandhaṃ pahāya saddhāpabbajitabhāvassa atthato siddhattā.
However, this should not be viewed that way, because the fact of his having gone forth out of faith is established by the very fact of having abandoned a large circle of relatives and a great mass of wealth.
Tuy nhiên, không nên hiểu như vậy, vì việc từ bỏ một vòng tròn bà con lớn và một khối tài sản lớn để xuất gia do đức tin đã được chứng minh bằng ý nghĩa.
Tathā hi lokanāthassa abhijātiyaṃ tassa kulassa na kiñci pārijuññaṃ, atha kho vuḍḍhiyeva, tato tassa samiddhatamabhāvo loke pākaṭo paññāto hoti, tasmā ‘‘sakyakulā pabbajito’’ti ettakeyeva vutte tathā samiddhatamaṃ kulaṃ pahāya saddhāpabbajitabhāvo siddhoyevāti, imaṃ parihāraṃ ‘‘kenaci pārijuññenā’’tiādinā vibhāvetīti daṭṭhabbaṃ.
Thus, at the birth of the Lord of the world, there was no decline whatsoever in his clan, but only prosperity; therefore, his unsurpassed opulence was evident and well-known in the world. Thus, it is said that by merely stating ‘‘sakyakulā pabbajito’’ (gone forth from the Sakya clan), the fact of his having gone forth out of faith, abandoning such an exceedingly prosperous clan, is already established. It should be understood that this explanation is clarified by ‘‘kenaci pārijuññenā’’ and so on.
Thật vậy, vào thời điểm sinh ra của Đấng Cứu Thế, dòng dõi của Ngài không hề có bất kỳ sự suy yếu nào, mà chỉ có sự thịnh vượng. Do đó, sự thịnh vượng tột độ của dòng dõi Ngài đã trở nên nổi tiếng và được biết đến trong thế gian. Vì vậy, khi chỉ nói “sakyakulā pabbajito”, việc xuất gia do đức tin sau khi từ bỏ một dòng dõi thịnh vượng như vậy đã được chứng minh. Nên hiểu rằng sự biện minh này được giải thích bằng “kenaci pārijuññenā” v.v.
Tato paranti ‘‘kosalesu cārikaṃ caramāno’’tiādivacanaṃ.
Tato paraṃ refers to the statement beginning with ‘‘kosalesu cārikaṃ caramāno’’ (wandering in the Khasala lands).
Tato paraṃ (sau đó) là câu “kosalesu cārikaṃ caramāno” (đi hành hương ở Kosala) v.v.
583
‘‘Sādhu dhammaruci rājā, sādhu paññāṇavā naro;
Just as in verses such as:
“Vua Dhammaruci là tốt, người có trí tuệ là tốt;
584
Sādhu mittānamadubbho, pāpassākaraṇaṃ sukha’’nti.
‘‘Good is King Dhammaruci, good is a person endowed with wisdom; good is not harming friends, joyful is not doing evil.’’
Không làm hại bạn bè là tốt, không làm điều ác là hạnh phúc.”
ādīsu –
—and so on—
Trong các câu như vậy –
585
Viya sādhusaddo idha sundaratthoti āha ‘‘sundaraṃ kho panā’’ti.
the word sādhu here has the meaning of beautiful, so it is said: ‘‘But it is beautiful…’’
Giống như từ sādhu ở đây có nghĩa là đẹp, nên có câu: “sundaraṃ kho panā” (thật là đẹp).
Khoti avadhāraṇatthe nipāto, panāti pakkhantaratthe.
Kho is a particle indicating affirmation, and pana is for a different aspect.
Kho là một tiểu từ dùng để nhấn mạnh, panā là để chỉ một ý nghĩa khác.
Evaṃ sātthakatāviññāpanatthañhi saṃvaṇṇanāyametesaṃ gahaṇaṃ.
Indeed, these are included in the commentary to show their meaningfulness.
Việc sử dụng các từ này trong phần chú giải là để làm rõ tính hữu ích của chúng.
Sundaranti ca bhaddakaṃ, bhaddakatā ca passantānaṃ hitasukhāvahabhāvenāti vuttaṃ ‘‘atthāvahaṃ sukhāvaha’’nti.
And sundaraṃ means good, and its goodness lies in bringing benefit and happiness to those who see it, hence it is said: ‘‘atthāvahaṃ sukhāvahaṃ’’ (bringing benefit, bringing happiness).
Sundaraṃ (đẹp) nghĩa là tốt lành, và sự tốt lành đó là mang lại lợi ích và hạnh phúc cho những người nhìn thấy, nên có câu “atthāvahaṃ sukhāvahaṃ” (mang lại lợi ích, mang lại hạnh phúc).
Attho cettha diṭṭhadhammikasamparāyikaparamatthavasena tividhaṃ hitaṃ sukhampi tatheva tividhaṃ sukhaṃ.
Here, attha (benefit) is threefold, according to present life, future lives, and ultimate truth; and sukhaṃ (happiness) is also threefold, in the same way.
Ở đây, attho (lợi ích) là lợi ích ba loại theo hiện tại, vị lai và tối thượng. Sukhaṃ (hạnh phúc) cũng là hạnh phúc ba loại như vậy.
586
Tathārūpānanti tādisānaṃ, ayaṃ saddato attho.
Tathārūpānaṃ means of such a nature; this is the literal meaning.
Tathārūpānaṃ (những người như vậy) nghĩa là những người có hình thái như vậy. Đây là ý nghĩa theo từ ngữ.
Atthamattaṃ pana dassetuṃ ‘‘evarūpāna’’nti vuttaṃ.
However, to show merely the meaning, it is said ‘‘evarūpānaṃ’’ (of this kind).
Tuy nhiên, để chỉ ra ý nghĩa thực sự, có nói “evarūpānaṃ” (những người có hình thái như thế này).
Yādisehi ca guṇehi bhagavā samannāgato catuppamāṇikassa lokassa sabbakālampi-accantāya-saddhāya-pasādanīyo tesaṃ yathābhūtasabhāvattā, tādisehi guṇehi samannāgatabhāvaṃ sandhāya ‘‘tathārūpānaṃ arahata’’nti vuttanti dassento ‘‘yathārūpo’’tiādimāha.
The Teacher says ‘‘yathārūpo’’ and so on, to show that the statement ‘‘tathārūpānaṃ arahataṃ’’ (of such Arahants) is made with reference to the Blessed One being endowed with such qualities by which he is worthy of confidence and devotion to the entire fourfold world at all times, because of the true nature of those qualities.
Đức Thế Tôn được phú bẩm những phẩm chất nào khiến Ngài được tất cả chúng sinh trong bốn phương kính trọng và tin tưởng tuyệt đối vào mọi thời điểm, vì bản chất thực sự của những phẩm chất đó. Để chỉ ra rằng câu “tathārūpānaṃ arahataṃ” (những bậc A-la-hán như vậy) được nói để ám chỉ trạng thái được phú bẩm những phẩm chất như vậy, nên có câu “yathārūpo” v.v.
Laddhasaddhānanti laddhasaddahānaṃ, parajanassa saddhaṃ paṭilabhantānanti vuttaṃ hoti.
Laddhasaddhānaṃ means those who have obtained faith, that is to say, those who have gained the faith of others.
Laddhasaddhānaṃ (những người đã có đức tin) nghĩa là những người đã có đức tin, tức là những người đã đạt được đức tin của người khác.
Laddhasaddānanti vā paṭiladdhakittisaddānaṃ, etena ‘‘arahata’’nti padassa arahantānanti attho, arahantasamaññāya ca pākaṭabhāvo dassito, apica ‘‘yathārūpo so bhavaṃ gotamo’’ti iminā ‘‘tathārūpāna’’nti padassa aniyamavasena atthaṃ dassetvā sarūpaniyamavasenapi dassetuṃ ‘‘yathābhuccaguṇādhigamena loke arahantoti laddhasaddhāna’’nti vuttaṃ, idampi hi ‘‘tathārūpāna’’nti padasseva atthadassanaṃ, ayameva ca nayo ācariyehi adhippeto idha ṭīkāyaṃ, (dī. ni. ṭī. 1.255) sāratthadīpaniyañca tatheva vuttattā.
Laddhasaddānaṃ means those who have gained faith, or those who have attained fame. By this, the meaning of the word “arahata” (arahantānaṃ) is given as “of the Arahants,” and the fame of the designation “Arahant” is shown. Furthermore, after showing the meaning of the word “tathārūpānaṃ” in a non-specific way by “as that venerable Gotama is,” it is also said in a specific way by “ those who have gained faith in the world as Arahants through the attainment of genuine qualities” to show its essence. This is also a demonstration of the meaning of the word “tathārūpānaṃ,” and this very method is intended by the teachers in this ṭīkā and is stated in the Sāratthadīpanī in the same way.
Laddhasaddāna có nghĩa là những người đã đạt được danh tiếng tốt. Với điều này, ý nghĩa của từ "arahata" là "arahantānam" (của các bậc A-la-hán), và sự nổi tiếng của danh hiệu A-la-hán cũng được chỉ ra. Hơn nữa, để chỉ ra ý nghĩa của từ "tathārūpānaṃ" không theo quy định bằng câu "yathārūpo so bhavaṃ gotamo" và cũng để chỉ ra ý nghĩa theo quy định về bản chất, người ta đã nói: "đã đạt được danh tiếng là A-la-hán trên thế gian bằng sự thành tựu những phẩm chất chân thực". Điều này cũng là sự chỉ ra ý nghĩa của từ "tathārūpānaṃ". Đây cũng là phương pháp mà các vị thầy đã chấp nhận ở đây trong Ṭīkā và trong Sāratthadīpanī cũng được nói như vậy.
‘‘Yathārūpā te bhavanto arahanto’’ti avatvā ‘‘yathārūpo so bhavaṃ gotamo’’ti vacanaṃ bhagavatiyeva garugāravavasena ‘‘tathārūpānaṃ arahata’’nti puthuvacananiddiṭṭhabhāvaviññāpanatthaṃ.
The statement “as that venerable Gotama is,” instead of “as those venerable Arahants are,” is to indicate that “tathārūpānaṃ arahataṃ” is expressed in the plural due to profound respect for the Blessed One alone.
Việc nói "yathārūpo so bhavaṃ gotamo" thay vì "yathārūpā te bhavanto arahanto" là để cho biết rằng từ "tathārūpānaṃ arahata" được dùng ở số nhiều là do sự tôn kính đối với Thế Tôn.
Attani, garūsu ca hi bahuvacanaṃ icchanti saddavidū.
Indeed, grammarians desire the plural form for oneself and for revered ones.
Các nhà ngữ pháp học mong muốn dùng số nhiều cho chính mình và cho các bậc tôn kính.
‘‘Yathābhucca…pe… arahata’’nti iminā ca dhammappamāṇānaṃ, lūkhappamāṇānañca sattānaṃ bhagavato pasādāvahataṃ yathārutato dasseti arahantabhāvassa tesaññeva yathārahaṃ visayattā, taṃdassanena pana itaresampi rūpappamāṇaghosappamāṇānaṃ pasādāvahatā dassitāyeva tadavinābhāvatoti daṭṭhabbaṃ.
By “ yathābhucca…pe… arahataṃ,” it directly shows that the Blessed One inspires confidence in beings who judge by the Dhamma and those who judge by harshness, because the state of Arahantship is appropriately within the scope of these very beings. By showing this, it is understood that the Blessed One's ability to inspire confidence in others who judge by appearance and those who judge by praise is also shown, as it is inseparable from these qualities.
Với câu "yathābhucca...pe... arahata", nó chỉ ra một cách trực tiếp rằng Thế Tôn là đối tượng của sự hoan hỷ đối với những chúng sinh lấy pháp làm chuẩn mực và những chúng sinh lấy sự khắc khổ làm chuẩn mực, vì trạng thái A-la-hán là đối tượng thích hợp của chính những chúng sinh đó. Tuy nhiên, bằng cách chỉ ra điều đó, sự hoan hỷ của những chúng sinh khác, những người lấy hình tướng làm chuẩn mực và những người lấy âm thanh làm chuẩn mực, cũng đã được chỉ ra, vì điều đó không thể tách rời.
587
Pasādasommānīti pasannāni, sītalāni ca, pasādavasena vā sītalāni, anena pasannamanataṃ dasseti.
Pasādasommāni means pure and calm, or calm by virtue of purity. By this, a serene mind is shown.
Pasādasommānī có nghĩa là trong sáng và mát mẻ, hoặc mát mẻ do trong sáng. Với điều này, nó chỉ ra tâm trong sáng.
‘‘Dassana’’nti vuttepi taduttari kattabbatāsambhavato ayaṃ sambhāvanattho labbhatīti āha ‘‘dassanamattampi sādhu hotī’’ti.
Even though “dassanaṃ” (seeing) is stated, since no further action is possible, this sense of commendation is obtained. Therefore, it is said: “ even merely seeing is good.
Mặc dù đã nói "dassana" (sự thấy), nhưng vì không thể làm gì hơn thế, nên ý nghĩa có thể này được hiểu, do đó nói "dassanamattampi sādhu hotī" (chỉ cần thấy thôi cũng là tốt rồi).
Itarathā hi ‘‘dassanaññeva sādhu, na taduttari karaṇa’’nti anadhippetattho āpajjati, sambhāvanattho cettha pi-saddo, api-saddo vā luttaniddiṭṭho.
Otherwise, if it were understood differently, it would imply the unintended meaning that “only seeing is good, and no further action is to be done.” Here, the word pi (also) has the sense of commendation, or the word api is expressed as omitted.
Nếu không, thì ý nghĩa không mong muốn sẽ xảy ra: "chỉ thấy mới tốt, không cần làm gì thêm". Ở đây, từ "pi" (cũng) có ý nghĩa khả năng, hoặc từ "api" (cũng) bị lược bỏ.
‘‘Brahmacariyaṃ pakāsetī’’ti ettha iti-saddo ‘‘abbhuggato’’ti iminā sambandhamupagato, tasmā ayaṃ ‘‘sādhu hotī’’ti idha iti-saddo ‘‘brāhmaṇo pokkharasātī ambaṭṭhaṃ māṇavaṃ āmantesī’’ti iminā sambajjhitabbo, ‘‘ajjhāsayaṃ katvā’’ti ca pāṭhaseso tadatthassa viññāyamānattā.
In “brahmacariyaṃ pakāseti” (proclaims the holy life), the word iti (thus) is connected with “abbhuggato” (risen). Therefore, this word iti in “sādhu hoti” (is good) should be connected with “the brahmin Pokkharasāti addressed the young man Ambaṭṭha,” and “ajjhāsayaṃ katvā” (having intended) is a remaining part of the text, as its meaning is understood.
Ở đây, từ "iti" trong "brahmacariyaṃ pakāsetī" được liên kết với "abbhuggato". Do đó, từ "iti" ở đây trong "sādhu hotī" phải được liên kết với "brāhmaṇo pokkharasātī ambaṭṭhaṃ māṇavaṃ āmantesī", và "ajjhāsayaṃ katvā" là phần còn lại của văn bản vì ý nghĩa của nó đã được hiểu.
Yassa hi attho viññāyati, saddo na payujjati, so ‘‘pāṭhaseso’’ti vuccati, imamatthaṃ vibhāvento āha ‘‘dassanamattampi sādhu hotīti evaṃ ajjhāsayaṃ katvā’’ti.
Indeed, a word whose meaning is understood but is not pronounced is called a “remaining part of the text.” Explaining this meaning, he says: “ Having intended thus: ‘even merely seeing is good.’
Thật vậy, khi ý nghĩa được hiểu mà từ ngữ không được dùng, thì đó được gọi là "pāṭhaseso" (phần còn lại của văn bản). Để làm rõ ý nghĩa này, người ta nói: "dassanamattampi sādhu hotīti evaṃ ajjhāsayaṃ katvā" (chỉ cần thấy thôi cũng là tốt rồi, với ý định như vậy).
Mūlapaṇṇāsake cūḷasīhanādasuttaṭṭhakathāya (ma. ni. aṭṭha. 1.144) āgataṃ kosiyasakuṇavatthu cettha kathetabbaṃ.
The story of the Kosiya bird, found in the commentary to the Cūḷasīhanāda Sutta in the Mūlapaṇṇāsaka, should be recounted here.
Câu chuyện về chim kosiya (kosiyasakuṇavatthu) được kể trong Mūlapaṇṇāsake Cūḷasīhanādasuttaṭṭhakathā nên được kể ở đây.
588
Ambaṭṭhamāṇavakathāvaṇṇanā
Account of Ambaṭṭha the Young Man
Chú giải về câu chuyện của thanh niên Ambaṭṭha
589
256. ‘‘Ajjhāyako’’ti idaṃ paṭhamapakatiyā garahāvacanameva, dutiyapakatiyā pasaṃsāvacanaṃ katvā voharanti yathā taṃ ‘‘puriso naro’’ti dassetuṃ aggaññasuttapada (dī. ni. 3.132) mudāhaṭaṃ.
256. The word “Ajjhāyako” (reciter) is primarily a term of reproach, but secondarily, they use it as a term of praise, just as “puriso naro” (man, male) is used. To show this, the passage from the Aggañña Sutta is cited as an example.
256. Từ "Ajjhāyako" ban đầu là một từ chê bai, nhưng sau đó được dùng như một từ khen ngợi, giống như cách người ta dùng "puriso naro" (người đàn ông) để chỉ ra điều đó, nên câu trong Aggaññasutta đã được trích dẫn.
Tattha imeti jhāyakanāmena samaññitā janā.
There, ime refers to these people who are called jhāyaka (meditators).
Ở đó, ime là những người được gọi bằng tên jhāyaka.
Na jhāyantīti paṇṇakuṭīsu jhānaṃ na appenti na nipphādenti, gāmanigamasāmantaṃ osaritvā vedaganthe karontāva acchantīti attho.
Na jhāyanti means they do not apply themselves to jhāna or achieve jhāna in leaf huts; rather, they stay near villages and towns, composing Vedic texts. This is the meaning.
Na jhāyantī có nghĩa là họ không thực hành thiền định trong các túp lều lá, không hoàn thành thiền định, mà chỉ ở gần làng mạc, thị trấn và làm các kinh điển Veda.
Taṃ panetesaṃ brāhmaṇajhāyakasaṅkhātaṃ paṭhamadutiyanāmaṃ upādāya tatiyameva jātanti āha ‘‘ajjhāyakātveva tatiyaṃ akkharaṃ upanibbatta’’nti, akkharanti ca nirutti samaññā.
That name, the third (ajjhāyaka), arose for these Brahmin jhāyakas from their first and second names, as he says: “ the third letter, ajjhāyaka, was produced.” Akkhara (letter) is a designation in grammar.
Vì tên thứ nhất và thứ hai của những Bà-la-môn jhāyaka đó đã dẫn đến tên thứ ba, nên người ta nói: "ajjhāyakātveva tatiyaṃ akkharaṃ upanibbatta" (chỉ có từ thứ ba là ajjhāyaka được tạo ra), và akkhara có nghĩa là thuật ngữ ngữ pháp.
Sā hi tasmiṃyeva niruḷhabhāvena aññattha asañcaraṇato ‘‘akkhara’’nti vuccati.
Indeed, since it is firmly established in that very context and does not apply elsewhere, it is called akkhara.
Thật vậy, thuật ngữ đó được gọi là "akkhara" vì nó đã trở nên phổ biến ở đó và không được dùng ở nơi khác.
Mante parivattetīti vede sajjhāyati, pariyāpuṇātīti attho.
Mante parivatteti means he recites the Vedas, or he learns them. This is the meaning.
Mante parivattetī có nghĩa là tụng đọc hoặc học thuộc lòng các kinh Veda.
Idha hi adhiāpubbai-saddavasena padasandhi, itarattha pana jhe-saddavasena.
Here, the word combination (padasandhi) is formed by the prefix adhi and the root i, but in the other case (jhāyaka), it is formed by the root jhe.
Ở đây, sự kết nối từ là do từ "adhiāpubbai", còn ở nơi khác là do từ "jhe".
Mante dhāretīti yathāadhīte mante asammūḷhe katvā hadaye ṭhapeti.
Mante dhāreti means he keeps the mantras he has learned in his heart without forgetting them.
Mante dhāretī có nghĩa là giữ những gì đã học trong tâm mà không quên.
590
Āthabbaṇavedo parūpaghātakarattā sādhūnamaparibhogoti katvā ‘‘iruvedayajuvedasāmavedāna’’nti vuttaṃ.
The Atharva Veda is shunned by good people because it promotes harm to others. Therefore, it is stated: “ Iru Veda, Yaju Veda, and Sāma Veda.
Āthabbaṇavedo (kinh Atharva) không được người thiện dùng vì nó gây hại cho người khác, nên người ta nói "iruvedayajuvedasāmavedānaṃ" (kinh Ṛgveda, Yajurveda và Sāmaveda).
Tattha iccante thomīyante devā etāyāti iru ica-dhātuvasena ca-kārassa ra-kāraṃ katvā, itthiliṅgoyaṃ.
Among these, Iru is that by which the deities are praised and glorified. This is derived from the root ica by changing ca to ra. This word is in the feminine gender.
Trong đó, iru là do các vị thần được ca ngợi trong kinh này, và do căn "ica" biến "ca" thành "ra". Đây là từ giống cái.
Yajjante pujjante devā anenāti yaju punnapuṃsakaliṅgavasena.
Yaju is that by which the deities are worshipped and honored. This is in the neuter gender.
Yaju là do các vị thần được cúng dường trong kinh này. Đây là từ giống trung.
Soyanti antaṃ karonti, sāyanti vā tanuṃ karonti pāpamanenāti sāmaṃ so-dhātupakkhe o-kārassa ā-kāraṃ katvā.
Sāmaṃ is that by which they end or diminish evil deeds. This is derived from the root so by changing o to ā.
Sāmaṃ là do kinh này chấm dứt hoặc làm suy yếu tội lỗi. Đây là do biến "o" thành "ā" trong căn "so".
Vidanti dhammaṃ, kammaṃ vā etehīti vedā, te eva mantā ‘‘sugatiyopi munanti, suyyanti ca etehī’’ti katvā.
Vedā are those by which one knows Dhamma or kamma. And these are also Mantā because by them good destinations are known and heard.
Vedā là do người ta hiểu pháp hoặc nghiệp qua chúng, và chúng cũng là mantā vì người ta biết được các cảnh giới tốt đẹp và nghe thấy qua chúng.
Paharaṇaṃ saṅghaṭṭanaṃ pahataṃ, oṭṭhānaṃ pahataṃ tathā, tassa karaṇavasena, oṭṭhāni cāletvā paguṇabhāvakaraṇavasena pāraṃ gato, na atthavibhāvanavasenāti vuttaṃ hoti.
Pahataṃ refers to striking or clashing, such as the striking of the lips. By performing this, by moving the lips and making them skillful, he has reached the other shore, meaning he has not reached it through understanding the meaning. This is what is said.
Pahataṃ là sự va chạm, sự va chạm của môi. Bằng cách thực hiện điều đó, bằng cách di chuyển môi và làm cho chúng thành thạo, người ta đã đến bờ bên kia, không phải bằng cách làm rõ ý nghĩa.
Pāragūti ca niccasāpekkhatāya kitantasamāso.
And pāragū is a kitanta compound (a compound formed with a participle) due to its constant dependence.
pāragū là một hợp chất kitanta do sự phụ thuộc thường xuyên.
591
‘‘Saha nighaṇṭunā’’tiādinā yathāvākyaṃ vibhatyantavasena nibbacanadassanaṃ.
“Saha nighaṇṭunā” and so on refer to showing the derivation of words (nibbacanadassanaṃ) according to the sentence structure and case endings.
Với "saha nighaṇṭunā" và các từ khác, sự giải thích được trình bày theo cách kết thúc bằng biến cách.
Nighaṇṭurukkhādīnanti nighaṇṭu nāma rukkhaviseso, tadādikānamatthānanti attho, etena nighaṇṭurukkhapariyāyaṃ ādiṃ katvā tappamukhena sesapariyāyānaṃ tattha dassitattā so gantho nighaṇṭu nāma yathā taṃ ‘‘pārājikakaṇḍo, kusalattiko’’ti ayamattho dassito iminā yathārutameva tadatthassa adhigatattā.
Nighaṇṭurukkhādīnaṃ means nighaṇṭu is a particular kind of tree, and the meaning is “of meanings beginning with that.” This shows that the text is called nighaṇṭu because it begins with the synonym for the nighaṇṭu tree and then presents the remaining synonyms, just as one says “the Pārājika section” or “the Kusalattika.” This meaning is conveyed by the word itself as it is directly understood.
Nighaṇṭurukkhādīna có nghĩa là nighaṇṭu là một loại cây đặc biệt, và ý nghĩa là các ý nghĩa của những từ bắt đầu bằng từ đó. Với điều này, người ta chỉ ra rằng cuốn sách đó được gọi là Nighaṇṭu vì nó bắt đầu bằng từ đồng nghĩa Nighaṇṭurukkha và sau đó trình bày các từ đồng nghĩa còn lại, giống như "Pārājikakaṇḍa" và "Kusalattika", vì ý nghĩa đó được hiểu một cách trực tiếp.
Ācariyā pana evaṃ vadanti ‘‘vacanīyavācakabhāvena atthaṃ, saddañca nikhaḍati bhindati vibhajja dassetīti nikhaṇḍu, so eva kha-kārassa gha-kāraṃ katvā ‘nighaṇḍū’ti vutto’’ti (dī. ni. ṭī. 1.256), tadetaṃ aṭṭhakathānayato aññanayadassananti gahetabbaṃ.
However, the teachers say thus: “A book that extracts, breaks down, and analyzes meaning and words by way of being the expressed and the expresser is called nikhaṇḍu; that very nikhaṇḍu is called ‘nighaṇḍu’ by changing the letter kha to gha.” This should be understood as showing a different method from that of the Aṭṭhakathā.
Tuy nhiên, các vị thầy nói như sau: "Cuốn sách phân tích và trình bày ý nghĩa và từ ngữ theo mối quan hệ giữa từ được nói và từ nói, nên nó được gọi là nikhaṇḍu, và chính nó được gọi là 'nighaṇḍu' bằng cách biến 'kha' thành 'gha'". Điều này phải được hiểu là một cách giải thích khác với phương pháp của Aṭṭhakathā.
Itarathā hi so aṭṭhakathāya virodho siyā, vicāretabbametaṃ.
Otherwise, there would be a contradiction with the Aṭṭhakathā. This matter should be investigated.
Nếu không, điều đó sẽ mâu thuẫn với Aṭṭhakathā. Điều này cần được xem xét.
Akkharacintakā pana evamicchanti ‘‘tattha tatthāgatāni nāmāni nissesato ghaṭenti rāsiṃ karonti etthāti nighaṇṭu niggahitāgamenā’’ti.
However, the phoneticians (akkharacintaka) desire thus: “It is called nighaṇṭu according to the usage of niggahita because it comprehensively collects and compiles names found here and there within it.”
Tuy nhiên, các nhà ngữ pháp học mong muốn điều này: "Các tên gọi xuất hiện ở đó được gom lại và tập hợp đầy đủ trong cuốn sách này, nên nó được gọi là nighaṇṭu theo ngữ pháp".
Vevacanappakāsakanti pariyāyasaddadīpakaṃ, ekekassa atthassa anekapariyāyavacanavibhāvakanti attho.
Vevacanappakāsakaṃ means that which clarifies synonyms, meaning that which reveals many synonymous expressions for each meaning.
Vevacanappakāsaka có nghĩa là làm sáng tỏ các từ đồng nghĩa, chỉ ra nhiều từ đồng nghĩa cho mỗi ý nghĩa.
Nidassanamattañcetaṃ anekesampi atthānaṃ ekasaddavacanīyatāvibhāvanavasenapi tassa ganthassa pavattattā.
This is merely an example, as that text also serves to clarify that many meanings can be expressed by a single word.
Và đây chỉ là một ví dụ, vì cuốn sách đó cũng được dùng để chỉ ra rằng nhiều ý nghĩa có thể được diễn đạt bằng một từ.
Ko panesoti?
And who is this?
Vậy đó là gì?
Etarahi nāmaliṅgānusāsanaratanamālābhidhānappadīpikādi.
It is the Nāmaliṅgānusāsana, Ratanamālā, Abhidhānappadīpikā, and so forth, in the present time.
Hiện nay là Nāmaliṅgānusāsana, Ratanamālā, Abhidhānappadīpikā, v.v.
Vacībhedādilakkhaṇā kiriyā kappīyati etenāti kiriyākappo, tatheva vividhaṃ kappīyati etenāti vikappo, kiriyākappo ca so vikappo cāti kiriyākappavikappo. So hi vaṇṇapadasambandhapadatthādivibhāgato bahuvikappoti katvā ‘‘kiriyākappavikappo’’ti vuccati, so ca ganthavisesoyevāti vuttaṃ ‘‘kavīnaṃ upakārāvahaṃ sattha’’nti, catunnampi kavīnaṃ kavibhāvasampadābhogasampadādipayojanavasena upakārāvaho ganthoti attho.
Action characterized by speech divisions, and so on, is conceived by this, therefore it is called kiriyākappo (science of action). In the same way, various things are conceived by this, therefore it is called vikappo (variation/option). And that is a kiriyākappo and it is also a vikappo, thus it is kiriyākappavikappo. Indeed, it is said to be ‘‘kiriyākappavikappo’’ because it is a manifold variation, due to its divisions such as character, word-connection, and word-meaning. And that text is indeed a specific kind of treatise, thus it is said ‘‘a treatise beneficial to poets,’’ meaning a treatise that is beneficial to all four kinds of poets, for the purpose of their attainment of poetic skill and abundant enjoyment.
Hành động mang đặc tính chia lời nói, v.v., được thiết lập bởi nó, nên gọi là kiriyākappo (phép tắc hành động). Tương tự, nhiều điều khác nhau được thiết lập bởi nó, nên gọi là vikappo (sự phân loại). Đó vừa là kiriyākappo vừa là vikappo, nên gọi là kiriyākappavikappo (phép tắc hành động và sự phân loại). Bởi vì nó có nhiều sự phân loại khác nhau dựa trên sự phân chia về chữ, từ, mối quan hệ và ý nghĩa của từ, v.v., nên nó được gọi là ‘‘kiriyākappavikappo’’. Và vì đó là một loại sách đặc biệt, nên đã nói ‘‘ bộ luận mang lại lợi ích cho các nhà thơ’’. Có nghĩa là, đó là một bộ luận mang lại lợi ích cho cả bốn loại nhà thơ, tùy theo mục đích như sự thành tựu về phẩm chất nhà thơ và sự thành tựu về sự hưởng thụ.
Ko panesoti?
What is this, then?
Vậy đó là gì?
Kabyabandhanavidhividhāyako kabyālaṅkāragītāsubodhālaṅkārādi.
It is the arranger of the methods of poetic composition, such as Kabyālaṅkāra, Gītā, and Subodhālaṅkāra.
Đó là bộ luận Kabyālaṅkāra, Gītāsubodhālaṅkāra, v.v., hướng dẫn các phương pháp sáng tác thi ca.
Idaṃ pana mūlakiriyākappaganthaṃ sandhāya vuttaṃ.
This, however, was said with reference to the original Kiriyākappa treatise.
Tuy nhiên, điều này được nói đến dựa trên bộ luận Kiriyākappo gốc.
So hi mahāvisayo satasahassagāthāparimāṇo, yaṃ ‘‘nayacariyādipakaraṇa’’ntipi vadanti.
Indeed, that treatise has a vast scope, comprising a hundred thousand verses, which some also call ‘‘Nayacariyādipakaraṇa’’ (treatise on methods and conduct, etc.).
Bộ luận đó có phạm vi rất rộng, với số lượng một trăm ngàn bài kệ, mà người ta còn gọi là ‘‘Nayakariyādipakaraṇa’’ (bộ luận về phương pháp hành trì, v.v.).
Vacanatthato pana kiṭayati gameti ñāpeti kiriyādivibhāganti keṭubhaṃ kiṭa-dhātuto abhapaccayavasena, a-kārassa ca ukāro.
But from the etymological sense, it is called keṭubhaṃ because it signifies, leads, or makes known the divisions of action, etc., derived from the root kiṭa with the suffix abha, and the conversion of the letter ‘a’ to ‘u’.
Tuy nhiên, theo nghĩa của từ, cái gì phân chia các hành động, v.v., làm cho chúng được biết đến, được hiểu rõ, thì gọi là keṭubhaṃ. Từ căn kiṭa- (biết, hiểu), thêm hậu tố abha, và nguyên âm a- biến thành u-.
Atha vā kiriyādivibhāgaṃ anavasesapariyādānato kiṭento gamanto obheti pūretīti keṭubhaṃ kiṭa-saddūpapadaubhadhātuvasena.
Alternatively, it is called keṭubhaṃ because, by completely encompassing the divisions of action, etc., as it leads them, it fills them up, derived from the root ubha preceded by the word kiṭa.
Hoặc nữa, cái gì làm cho sự phân chia các hành động, v.v., được biết đến một cách trọn vẹn không sót, làm cho nó đầy đủ, thì gọi là keṭubhaṃ, theo nghĩa từ kiṭa- (biết) và căn ubha- (đầy đủ).
Apica kiṭanti gacchanti kavayo bandhesu kosallametenāti keṭubhaṃ, purimanayenevettha padasiddhi.
Furthermore, poets go towards skill in composition by means of this, therefore it is called keṭubhaṃ. The formation of the word here is in the same manner as before.
Hơn nữa, các nhà thơ đạt được sự khéo léo trong việc sáng tác nhờ vào nó, nên gọi là keṭubhaṃ. Ở đây, sự thành lập từ cũng theo cách trước.
Ṭhānakaraṇādivibhāgato, nibbacanavibhāgato ca akkharā pabhedīyanti etenāti akkharappabhedo, taṃ pana chasu vedaṅgesu pariyāpannaṃ pakaraṇadvayamevāti vuttaṃ ‘‘sikkhā ca nirutti cā’’ti.
Letters are distinguished by this through the divisions of articulation-place, articulation-effort, etc., and through the divisions of etymology, therefore it is akkharappabhedo (distinction of letters). And that refers to two treatises included in the six Vedāṅgas, thus it is said ‘‘sikkhā and nirutti.’’
Các chữ cái được phân loại bởi nó theo sự phân chia về vị trí phát âm (ṭhāna), cách phát âm (karaṇa), v.v., và sự phân chia về giải thích từ nguyên (nibbacanavibhāga), nên gọi là akkharappabhedo (sự phân loại chữ cái). Tuy nhiên, đó chỉ là hai bộ luận được bao gồm trong sáu chi của Veda, nên đã nói ‘‘ sikkhā ca nirutti cā’’ (phép học và từ nguyên).
Tattha sikkhanti akkharasamayametāyāti sikkhā, akārādivaṇṇānaṃ ṭhānakaraṇapayatanapaṭipādakasatthaṃ.
Among them, it is called sikkhā (phonetics) because the system of letters is learned through it, meaning the treatise that teaches the articulation-place, articulation-effort, and pronunciation of letters such as ‘a’ and so on.
Trong đó, cái gì được học về hệ thống chữ cái thì gọi là sikkhā (phép học). Đó là bộ luận trình bày về vị trí phát âm, cách phát âm và nỗ lực phát âm của các chữ cái như a, v.v.
Nicchayena, nissesato vā utti nirutti, vaṇṇāgamavaṇṇavipariyāyādilakkhaṇaṃ.
Nirutti (etymology) is the explanation (utti) by way of certainty or completely, characterized by vowel insertion, vowel metathesis, and so on.
Sự giải thích một cách chắc chắn hoặc một cách trọn vẹn là nirutti (từ nguyên), mang đặc tính thêm chữ, đổi chữ, v.v.
Vuttañca –
And it is said:
Và đã nói:
592
‘‘Vaṇṇāgamo vaṇṇavipariyāyo,
‘‘Vowel insertion, vowel metathesis,
‘‘Thêm chữ, đổi vị trí chữ,
593
Dve cāpare vaṇṇavikāranāsā;
And two others: vowel modification and deletion;
Hai sự biến đổi và mất chữ;
594
Dhātussa atthātisayena yogo,
And the connection of a root with an extended meaning—
Sự kết hợp với ý nghĩa vượt trội của căn,
595
Taduccate pañcavidhā niruttī’’ti.(pārā. aṭṭha. 1.verañjakaṇḍavaṇṇanā; visuddhi. 1.144; mahāni. aṭṭha. 1.50);
This is called the fivefold nirutti.’’
Đó được gọi là năm loại từ nguyên.’’
596
Idha pana tabbasena anekadhā nibbacanaparidīpakaṃ satthaṃ uttarapadalopena ‘‘niruttī’’ti adhippetaṃ nibbacanavibhāgatopi akkharapabhedabhāvassa ācariyehi (dī. ni. ṭī. 1.256) vuttattā, tamantarena nibbacanavibhāgassa ca byākaraṇaṅgena saṅgahitattā.
Here, however, the treatise that explains etymology in many ways, according to the powers mentioned above, is intended as ‘‘nirutti’’ by eliding the latter part of the compound (paridīpakaṃ), because the masters have stated that the distinction of letters also arises from the division of etymology, and without that (the distinction of letters), the division of etymology would be included in the grammar component.
Ở đây, tuy nhiên, bộ luận giải thích từ nguyên theo nhiều cách khác nhau dựa trên những điều đã nói, được gọi là ‘‘nirutti’’ bằng cách lược bỏ hậu tố, bởi vì các vị thầy (Dī. Nī. Ṭī. 1.256) đã nói rằng sự phân loại chữ cái cũng bao gồm sự phân chia từ nguyên, và nếu không có điều đó, sự phân chia từ nguyên sẽ được bao gồm trong chi ngữ pháp.
Byākaraṇaṃ, nirutti ca hi paccekameva vedaṅgaṃ yathāhu –
Indeed, grammar and nirutti are each a distinct Vedāṅga, as it is said:
Ngữ pháp và từ nguyên, mỗi cái đều là một chi của Veda, như đã nói:
597
‘‘Kappo byākaraṇaṃ joti-satthaṃ sikkhā nirutti ca;
‘‘Kappo, Vyākaraṇaṃ, Jyotiśāstra, Sikkhā, and Nirutti;
‘‘Phép tắc, ngữ pháp, thiên văn học,
598
Chandoviciti cetāni, vedaṅgāni vadanti chā’’ti.
And Chandoviciti—these six are called Vedāṅgas.’’
Phép học và từ nguyên;
599
Tasmā byākaraṇaṅgena asaṅkarabhūtameva niruttinayena nibbacanamidhādhippetaṃ, na chasu byañjanapadesu viya tadubhayasādhāraṇanibbacanaṃ vedaṅgavisayattāti veditabbaṃ.
Therefore, etymology as intended here, in the sense of nirutti, is indeed distinct from the grammar component, and not a common etymology for both, as in the case of the six consonant places, because it belongs to the domain of the Vedāṅgas; this should be understood.
Và phép đo vần điệu—đó là sáu chi của Veda.’’
Ayaṃ panettha mahāniddesaṭṭhakathāya (mahāni. aṭṭha. 50) āgataniruttinayavinicchayo.
Here follows the determination of the method of nirutti as found in the Mahāniddesaṭṭhakathā:
Do đó, ở đây, ý nghĩa của từ nguyên được hiểu là không lẫn lộn với chi ngữ pháp, mà là một sự giải thích từ nguyên theo phương pháp riêng, không phải là một giải thích chung cho cả hai như trong sáu vị trí phụ âm, bởi vì nó thuộc về phạm vi của các chi Veda.
Tattha hi ‘‘nakkhattarājāriva tārakāna’’nti (jā. 1.1.11, 25) ettha ra-kārāgamo viya avijjamānassa akkharassa āgamo vaṇṇāgamo nāma.
In that text, the insertion of a non-existent letter, like the insertion of the letter ‘ra’ in ‘‘nakkhattarājāriva tārakānaṃ’’ (like the king of stars for the stars), is called vaṇṇāgamo (vowel insertion).
Đây là sự xác định phương pháp từ nguyên được đề cập trong Mahāniddesaṭṭhakathā (Mahāni. Aṭṭha. 50).
Hiṃsanattā ‘‘hiṃso’’ti vattabbe ‘‘sīho’’ti parivattanaṃ viya vijjamānānamakkharānaṃ heṭṭhupariyavasena parivattanaṃ vaṇṇavipariyāyo nāma.
The transposition of existing letters from bottom to top, like changing ‘‘hiṃso’’ to ‘‘sīho’’ when it should be ‘‘hiṃso’’ due to its meaning of harming, is called vaṇṇavipariyāyo (vowel metathesis).
Trong đó, sự thêm một chữ cái không có sẵn, như sự thêm chữ r trong ‘‘nakkhattarājāriva tārakānaṃ’’ (Jā. 1.1.11, 25), được gọi là vaṇṇāgamo (thêm chữ).
‘‘Navachannakedāni diyyatī’’ti (jā. 1.6.88) ettha a-kārassa e-kārāpajjanaṃ viya aññakkharassa aññakkharāpajjanaṃ vaṇṇavikāro nāma.
The modification of one letter into another, like the letter ‘a’ becoming ‘e’ in ‘‘navachannakedoṇi diyyatī’’ (a new trough is given for pigs), is called vaṇṇavikāro (vowel modification).
Sự đổi vị trí các chữ cái có sẵn, như sự thay đổi từ ‘‘hiṃso’’ (kẻ làm hại) thành ‘‘sīho’’ (sư tử) khi đáng lẽ phải nói ‘‘hiṃsanattā hiṃso’’ (vì có tính làm hại, nên là kẻ làm hại), được gọi là vaṇṇavipariyāyo (đổi vị trí chữ).
‘‘Jīvanassa mūto jīvanamūto’’ti vattabbe ‘‘jīmūto’’ti va-kāra na-kārānaṃ vināso viya vijjamānakkharānaṃ vināso vaṇṇavināso nāma.
The deletion of existing letters, like the deletion of the letters ‘va’ and ‘na’ in ‘‘jīmūto’’ when it should be ‘‘jīvanamūto’’ (root of life), is called vaṇṇavināso (vowel deletion).
Sự biến đổi một chữ cái thành một chữ cái khác, như sự biến đổi nguyên âm a thành e trong ‘‘navachannakedāni diyyatī’’ (Jā. 1.6.88), được gọi là vaṇṇavikāro (biến đổi chữ).
‘‘Pharusāhi vācāhi pakubbamāno, āsajja maṃ tvaṃ vadase kumārā’’ti (jā. 1.10.85) ettha ‘‘pakubbamāno’’ti padassa abhibhavamānoti atthapaṭipādanaṃ viya tattha tattha yathāyogaṃ visesatthapaṭipādanaṃ dhātūnamatthātisayena yogo nāmāti.
And the elucidation of a special meaning as appropriate in each context, like explaining the word ‘‘pakubbamāno’’ (acting aggressively) in ‘‘Pharusāhi vācāhi pakubbamāno, āsajja maṃ tvaṃ vadase kumārā’’ (O prince, you assail me and speak with harsh words, acting aggressively) as meaning ‘overpowering,’ is called dhātūnamatthātisayena yogo (connection of roots with an extended meaning).
Sự mất đi các chữ cái có sẵn, như sự mất đi chữ v và n trong ‘‘jīmūto’’ khi đáng lẽ phải nói ‘‘jīvanassa mūto jīvanamūto’’ (cái chết của sự sống, cái chết sự sống), được gọi là vaṇṇavināso (mất chữ).
600
Yathāvuttappabhedānaṃ tiṇṇaṃ vedānaṃ ayaṃ catutthoyeva siyā, atha kena saddhiṃ pañcamoti āha ‘‘āthabbaṇavedaṃ catutthaṃ katvā’’ti.
This (Itihāsa) would be the fourth of the three Vedas classified as described. But with what other is it the fifth? To this, he says, ‘‘by making the Atharvaveda the fourth.’’
Sự kết hợp với ý nghĩa vượt trội của căn, như sự giải thích từ ‘‘pakubbamāno’’ là ‘‘abhibhavamāno’’ (áp đảo) trong câu ‘‘Pharusāhi vācāhi pakubbamāno, āsajja maṃ tvaṃ vadase kumārā’’ (Jā. 1.10.85), được gọi là dhātūnamatthātisayena yogo (kết hợp với ý nghĩa vượt trội của căn).
Āthabbaṇavedo nāma āthabbaṇavedikehi vihito parūpaghātakaro manto, so pana itihāsapañcamabhāvappakāsanatthaṃ gaṇitatāmattena gahito, na sarūpavasena, evañca katvā ‘‘etesa’’nti padassa tesaṃ tiṇṇaṃ vedānantveva attho gahetabbo.
Atharvaveda means the destructive mantra composed by those skilled in the Atharvaveda. This, however, is included merely by counting to indicate the fivefold nature of Itihāsa, not by its intrinsic nature. Thus, the meaning of ‘‘etesānaṃ’’ (of these) should be taken as referring only to those three Vedas.
Nếu đây là thứ tư trong ba Veda đã nói trên, vậy nó là thứ năm với cái nào? Câu trả lời là ‘‘ lấy Āthabbaṇaveda làm thứ tư’’.
Tañhi ‘‘tiṇṇaṃ vedāna’’nti etassa visesananti.
For that word is an adjective of ‘‘tiṇṇaṃ vedānaṃ’’ (of the three Vedas).
Āthabbaṇavedo là những thần chú gây hại cho người khác được các học giả Āthabbaṇa chế định. Nó được tính vào chỉ để làm rõ vị trí thứ năm của Itihāsa, chứ không phải theo bản chất thực sự của nó. Vì vậy, ý nghĩa của từ ‘‘ etesaṃ’’ chỉ nên được hiểu là ‘‘của ba Veda đó’’.
Itiha asāti evaṃ idha loke ahosi ‘‘āsā’’tipi katthaci pāṭho, soyevattho.
Itiha asā (thus it was here) means: thus it happened in this world. In some places, the reading is ‘‘āsā’’; the meaning is the same.
Bởi vì nó là một tính từ bổ nghĩa cho ‘‘tiṇṇaṃ vedānaṃ’’.
Iha ṭhāne iti evaṃ, idaṃ vā kammaṃ, vatthuṃ vā āsa icchāhītipi attho.
Alternatively, it means: iha (in this place) iti (thus), or this action, or this matter, āsa (wish for).
Itiha asā có nghĩa là ‘‘nó đã xảy ra như vậy ở thế gian này’’. Ở một số bản, cũng có cách đọc ‘‘ āsā’’, có cùng ý nghĩa.
Tassa ganthassa mahāvisayatādīpanatthañcettha vicchāvacanaṃ, iminā ‘‘itihāsā’’ti vacanena paṭisaṃyutto itihāso taddhitavasenāti atthaṃ dasseti.
And the repetition of the word here is to illustrate the vastness of that treatise. By this word ‘‘itihāsā,’’ it shows the meaning that itihāso (history) is connected with this saying by way of a taddhita suffix.
Hoặc nữa, ‘‘ở nơi này, hãy mong muốn điều này (hành động hoặc sự vật) như vậy’’. Đây cũng là một ý nghĩa.
Itiha āsa, itiha āsā’’ti īdisavacanapaṭisaṃyutto itihāso niruttinayenāti atthadassanantipi vadanti.
Some say that itihāso means a treatise connected with such sayings as ‘‘itiha āsa, itiha āsā’’ (thus it was, thus it desired) according to the method of nirutti.
Ở đây, việc thêm từ ‘‘vicchāvacanaṃ’’ (lời giải thích) là để làm rõ phạm vi rộng lớn của bộ luận đó. Bằng từ ‘‘itihāsā’’ này, nó chỉ ra ý nghĩa rằng itihāso là một bộ luận có liên quan đến những lời nói ‘‘itihāsa’’ theo cách thức của taddhita (hậu tố).
Akkharacintakā pana evamicchanti ‘‘itiha-saddo pārampariyopadese ekova nipāto, asati vijjatīti aso, itiha aso etasminti itihāso samāsavasenā’’ti, tesaṃ mate ‘‘itiha asā’’ti ettha evaṃ pārampariyopadeso asa vijjamāno ahosīti attho.
But grammarians desire it thus: ‘‘The word itiha is a single particle indicating traditional teaching. Asa means exists (vijjati). Therefore, itihāso is that in which itiha asa exists, by way of a compound.’’ According to their view, in ‘‘itiha asā,’’ the meaning is: thus, the traditional teaching was existent.
Người ta cũng nói rằng itihāso là một bộ luận có liên quan đến những lời nói như ‘‘itiha āsa, itiha āsā’’ theo phương pháp từ nguyên.
‘‘Purāṇakathāsaṅkhāto’’ti iminā tassa ganthavisesabhāvamāha, bhāratanāmakānaṃ dvebhātikarājūnaṃ yuddhakathā, rāmarañño sītāharaṇakathā, narasīharājuppattikathāti evamādipurāṇakathāsaṅkhāto bhāratapurāṇarāmapurāṇanarasīhapurāṇādigantho itihāso nāmāti vuttaṃ hoti.
By ‘‘purāṇakathāsaṅkhāto’’ (reckoned as ancient tales), it states that it is a specific type of treatise. It means that treatises such as the Bhārata-purāṇa, Rāmā-purāṇa, Narasiṃha-purāṇa, etc., which consist of ancient tales like the war stories of the two royal brothers named Bhārata, the story of King Rāma’s abduction of Sītā, and the story of the birth of King Narasiṃha, are called Itihāsa.
Tuy nhiên, các nhà ngữ pháp (akkharacintakā) mong muốn như sau: ‘‘Từ ‘itiha’ là một tiểu từ duy nhất trong lời dạy truyền thống, ‘aso’ có nghĩa là ‘tồn tại’, ‘itihāso’ là một từ ghép có nghĩa là ‘trong đó có sự tồn tại của lời dạy truyền thống’.’’ Theo quan điểm của họ, trong ‘‘ itiha asā’’, ý nghĩa là ‘‘lời dạy truyền thống này đã tồn tại’’.
‘‘Tesaṃ itihāsapañcamānaṃ vedāna’’nti iminā yathāvākyaṃ ‘‘tiṇṇaṃ vedāna’’nti ettha visesanabhāvaṃ dasseti.
By ‘‘tesaṃ itihāsapañcamānaṃ vedānaṃ’’ (of those five Vedas including Itihāsa), it indicates that it is an adjective for ‘‘tiṇṇaṃ vedānaṃ’’ (of the three Vedas) according to the sentence structure.
Bằng cách nói ‘‘ Purāṇakathāsaṅkhāto’’ (được gọi là những câu chuyện cổ), người ta nói về tính chất đặc biệt của bộ luận đó. Có nghĩa là, những bộ luận như Bhāratapurāṇa, Rāmapurāṇa, Narasīhapurāṇa, v.v., được gọi là Itihāsa, bao gồm những câu chuyện cổ như câu chuyện về cuộc chiến của hai vị vua anh em tên Bhārata, câu chuyện về việc vua Rāma bắt cóc Sītā, câu chuyện về sự ra đời của vua Narasīha, v.v.
601
Pajjati attho etenāti padaṃ, nāmākhyātopasagganipātādivasena anekavibhāgaṃ vibhattiyantapadaṃ.
Meaning is obtained by this, thus it is padaṃ (a word); a word ending in a declension, with many divisions such as noun, verb, prefix, and particle.
Bằng cách nói ‘‘ Tesaṃ itihāsapañcamānaṃ vedānaṃ’’ (của những Veda thứ năm là Itihāsa đó), nó chỉ ra tính chất bổ nghĩa cho ‘‘tiṇṇaṃ vedānaṃ’’ (của ba Veda) theo đúng câu.
Tadapi byākaraṇe āgatamevāti vuttaṃ ‘‘tadavasesa’’nti, padato avasesaṃ pakatipaccayādisaddalakkhaṇabhūtanti attho.
And that too is found in grammar, thus it is said ‘‘tadavasesaṃ’’ (the remainder of that), meaning what remains of a word, being the root, suffix, and other characteristics of a sound.
Ý nghĩa được hiểu bởi nó, nên gọi là padaṃ (từ). Từ có tận cùng là vibhatti (biến cách), được phân loại thành nhiều loại như danh từ, động từ, tiền tố, tiểu từ, v.v.
Taṃ taṃ saddaṃ, tadatthañca byākaroti byācikkhati etenāti byākaraṇaṃ, visesena vā ākarīyante pakatipaccayādayo abhinipphādīyante ettha, anenāti vā byākaraṇaṃ, sādhusaddānamanvākhyāyakaṃ muddhabodhabyākaraṇa sārassatabyākaraṇa pāṇinībyākaraṇacandrabyākaraṇādi adhunāpi vijjamānasatthaṃ.
That treatise by which those various words and their meanings are analyzed and explained, or in which or by which roots, suffixes, etc., are specifically formed and brought forth, is byākaraṇaṃ (grammar), a science that expounds correct words, such as Muddhabodha-vyākaraṇa, Sārassata-vyākaraṇa, Pāṇinī-vyākaraṇa, Candra-vyākaraṇa, and so on, which are still extant today.
Điều đó cũng được đề cập trong ngữ pháp, nên đã nói ‘‘ tadavasesa’’ (phần còn lại của nó). Có nghĩa là, phần còn lại từ từ là những đặc tính của từ như căn và hậu tố, v.v.
Adhīyatīti ajjhāyati.
Adhīyati means recites.
Cái gì giải thích, phân tích những từ đó và ý nghĩa của chúng, thì gọi là byākaraṇaṃ (ngữ pháp). Hoặc nữa, cái gì mà trong đó các căn, hậu tố, v.v., được hình thành một cách đặc biệt, hoặc cái gì mà nhờ đó chúng được hình thành, thì gọi là byākaraṇaṃ. Đó là những bộ luận ngữ pháp vẫn còn tồn tại ngày nay như Muddhabodhabyākaraṇa, Sārassatabyākaraṇa, Pāṇinībyākaraṇa, Candrabyākaraṇa, v.v., giải thích các từ đúng đắn.
Vedetīti paresaṃ vāceti.
Vedeti means teaches others.
Adhīyatī có nghĩa là ‘‘tụng đọc’’.
Ca-saddo atthadvayasamuccinanattho, vikappanattho vā atthantarassa vikappitattā.
The particle ca has the meaning of combining two meanings, or it has the meaning of alternative, because another meaning is chosen as an alternative.
Từ Ca có nghĩa là gom góp hai ý nghĩa, hoặc có nghĩa là lựa chọn, vì một ý nghĩa khác được lựa chọn.
Vicitrā hi taddhitavutti.
Indeed, the usage of taddhita is varied.
Thật vậy, cách dùng taddhita rất đa dạng.
Padakoti byākaraṇesu āgatapadakosallaṃ sandhāya vuttaṃ, veyyākaraṇoti tadavasiṭṭhapakatipaccayādisaddavidhikosallanti imassatthassa viññāpanatthaṃ padadvayassa ekato atthavacanaṃ.
The word Padako is said with reference to skill in words found in grammar texts, and veyyākaraṇo means skill in grammatical rules of root and suffix, etc., which remain apart from words. This is a single explanation of the meaning of the two terms to make this meaning known.
Từ Padako được nói đến để chỉ sự khéo léo trong các từ ngữ đã xuất hiện trong ngữ pháp; còn veyyākaraṇo là sự khéo léo trong các quy tắc ngữ pháp như gốc từ, hậu tố... còn lại sau đó. Đây là cách giải thích ý nghĩa của hai từ này cùng lúc để làm rõ nghĩa.
Esā hi ācariyānaṃ pakati, yadidaṃ yena kenaci pakārena atthantaraviññāpanaṃ.
This is indeed the nature of the teachers, namely, to make another meaning known by any means whatsoever.
Thật vậy, đây là thói quen của các bậc đạo sư, đó là làm cho một ý nghĩa khác được hiểu bằng bất kỳ cách nào.
Ayaṃ aṭṭhakathāto aparo nayo – te eva vede padaso kāyatīti padakoti.
This is another method from the Aṭṭhakathā: he chants those very Vedas by individual words, hence padako.
Đây là một cách giải thích khác từ Aṭṭhakathā: " Padako" là người thuyết giảng các bộ Veda đó theo từng từ.
Tattha padasoti gajjabandhapajjabandhapadena.
There, padaso means by prose and verse passages.
Trong đó, padaso có nghĩa là theo từng câu văn xuôi và từng câu thơ.
Kāyatīti katheti yathā ‘‘jātaka’’nti, iminā vedakārakasamatthataṃ dasseti.
Kāyatī means he recites, as in "jātaka." By this, it shows his ability to interpret the Vedas.
Kāyatī có nghĩa là thuyết giảng, như trong "jātaka" (tiểu sử). Bằng cách này, nó cho thấy khả năng của người biên soạn Veda.
Evañhi ‘‘ajjhāyako’’tiādīhi imassa viseso pākaṭo hotīti.
Thus, the distinction of this from ajjhāyako, etc., becomes clear.
Như vậy, sự khác biệt của từ này so với các từ như "ajjhāyako" (người học thuộc lòng) sẽ trở nên rõ ràng.
602
Āyatiṃ hitaṃ bālajanasaṅkhāto loko na yatati na īhati anenāti lokāyataṃ. Tañhi ganthaṃ nissāya sattā puññakiriyāya cittampi na uppādenti, lokā vā bālajanā āyatanti ussahanti vādassādena etthāti lokāyataṃ. Aññamaññaviruddhaṃ, saggamokkhaviruddhaṃ vā tanonti etthāti vitaṇḍo ḍa-paccayavasena, na-kārassa ca ṇa-kāraṃ katvā, viruddhena vādadaṇḍena tāḷenti vādino etthāti vitaṇḍo taḍi-dhātuvasena, niggahītāgamañca katvā.
That by which the world, consisting of foolish people, does not strive for or exert itself for future welfare is lokāyataṃ. Relying on that text, beings do not even generate the thought of performing meritorious deeds. Or, in this text, foolish people strive and exert themselves with the delight of argumentation, hence lokāyataṃ. They spread conflicting views, or views conflicting with heaven and liberation, hence vitaṇḍo by the ḍa suffix, and by changing the na sound to ṇa. Or, by means of the taḍi root, arguers strike with a contradictory stick of argument in this, hence vitaṇḍo, having also added the niggahīta.
Thế gian, tức là những người ngu si, không nỗ lực, không cố gắng vì lợi ích trong tương lai bằng điều này, nên gọi là lokāyataṃ. Bởi vì nương vào bộ sách đó, chúng sinh không khởi lên ý nghĩ làm việc thiện; hoặc những người ngu si trên thế gian nỗ lực, cố gắng trong đó với sự say mê tranh luận, nên gọi là lokāyataṃ. Trong đó, họ đưa ra những lời lẽ mâu thuẫn lẫn nhau, hoặc mâu thuẫn với thiên giới và giải thoát, nên gọi là vitaṇḍo theo tiếp vĩ ngữ ḍa, và biến đổi âm n thành ṇ; hoặc trong đó, những người tranh luận dùng gậy tranh luận đối nghịch để đánh đập, nên gọi là vitaṇḍo theo căn taḍi, và thêm âm niggahīta.
Adesampi yaṃ nissāya vādīnaṃ vādo pavatto, taṃ tesaṃ desatopi upacāravasena vuccati yathā ‘‘cakkhuṃ loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā pahīyamānā pahīyati, ettha nirujjhamānā nirujjhatī’’ti, (dī. ni. 2.401; ma. ni. 1.133; vibha. 204) visesena vā paṇḍitānaṃ manaṃ taḍenti cālenti etenāti vitaṇḍo, taṃ vadanti, so vādo vā etesanti vitaṇḍavādā, tesaṃ satthaṃ tathā.
Even a non-place, by relying on which the argument of arguers arose, is metaphorically called a place of theirs, as it is said: "The eye in the world is of a lovely nature, of a delightful nature. Here, craving is abandoned when it is being abandoned, it ceases when it is ceasing." Or, vitaṇḍo means that by which the minds of the wise are especially stirred and agitated. They say that, or that argument belongs to them, hence vitaṇḍavādā; their treatise is likewise.
Mặc dù không phải là nơi chốn, nhưng điều mà các luận sư nương vào để tranh luận được gọi là nơi chốn của họ theo cách ẩn dụ, ví dụ như: "Mắt là hình thái đáng yêu, hình thái đáng thích trong thế gian; ở đây, ái này được đoạn trừ khi đang được đoạn trừ, ở đây nó diệt khi đang diệt"; hoặc đặc biệt, bằng điều này, họ đánh động tâm trí của những người trí thức, nên gọi là vitaṇḍo. Họ nói về điều đó, hoặc đó là lời tranh luận của những người này, nên gọi là vitaṇḍavādā, và bộ sách của họ cũng như vậy.
Lakkhaṇadīpakasatthaṃ uttarapadalopena, taddhitavasena vā lakkhaṇanti dasseti ‘‘lakkhaṇadīpaka’’ntiādinā.
The "Treatise on the Exposition of Characteristics" is indicated as lakkhaṇa by the elision of the latter word or by means of the taddhita suffix, as in "lakkhaṇadīpaka," etc.
Bộ sách giải thích các tướng được gọi là lakkhaṇaṃ bằng cách lược bỏ hậu tố hoặc theo cách dùng taddhita, như trong "lakkhaṇadīpaka".
Lakkhīyati buddhabhāvādi anenāti lakkhaṇaṃ, nigrodhabimbatādi.
That by which Buddhahood, etc., is marked, is lakkhaṇaṃ, such as the banyan-tree body.
Điều mà nhờ đó trạng thái Phật, v.v. được nhận biết, nên gọi là lakkhaṇaṃ, ví dụ như thân hình cây đa.
Tenāha ‘‘yesaṃ vasenā’’tiādi.
Therefore, it is said: "yesaṃ vasenā," etc.
Do đó, có câu "yesaṃ vasenā" và tiếp theo.
Dvādasasahassaganthapamāṇanti ettha bhāṇavārappamāṇādīsu viya bāttiṃsakkharaganthova adhippeto.
Regarding "dvādasasahassaganthapamāṇaṃ," here, as in the measures of recital sections (bhāṇavāra), etc., only a text of thirty-two syllables is intended.
Trong cụm từ dvādasasahassaganthapamāṇaṃ, giống như trong các số lượng bhāṇavāra, v.v., chỉ có văn bản 32 chữ cái được đề cập.
Vuttañhi –
For it is said:
Đã nói rằng:
603
‘‘Aṭṭhakkharā ekapadaṃ, ekā gāthā catuppadaṃ;
"Eight syllables are one word, four words are one stanza;
“Tám chữ là một từ, một kệ có bốn từ;
604
Gāthā cekā mato gantho, gantho bāttiṃsatakkharo’’ti.
One stanza is considered a gantha, a gantha is thirty-two syllables."
Một kệ được xem là một đoạn, một đoạn có ba mươi hai chữ.”
605
Dvādasahi guṇitasahassabāttiṃsakkharaganthappamāṇanti attho.
The meaning is: a gantha of thirty-two syllables, multiplied by twelve thousand.
Có nghĩa là số lượng văn bản có ba mươi hai chữ cái nhân với mười hai nghìn.
Yatthāti yasmiṃ lakkhaṇasatthe, ādhāre cetaṃ bhummaṃ yathā ‘‘rukkhe sākhā’’ti.
Yatthā means "in which treatise on characteristics," and this is the locative case indicating a basis, as in "branches on a tree."
Yatthā có nghĩa là trong bộ sách tướng đó, và đây là cách dùng địa cách chỉ nơi chốn, như trong "rukkhe sākhā" (cành cây trên cây).
Soḷasa ca sahassañca soḷasasahassaṃ, soḷasādhikasahassagāthāparimāṇāti attho.
Sixteen and a thousand is soḷasasahassaṃ; the meaning is, the measure is a thousand stanzas with sixteen more.
Mười sáu và một nghìn là soḷasasahassaṃ, có nghĩa là một nghìn kệ và mười sáu kệ phụ trội.
Evañhi ādhārādheyyavacanaṃ sūpapannaṃ hotīti.
Thus, the statement of the container and the contained becomes well-established.
Như vậy, cách nói về nơi chốn và vật chứa đựng sẽ hợp lý.
Padhānavasena buddhānaṃ lakkhaṇadīpanato buddhamantā nāma. Paccekabuddhādīnampi hi lakkhaṇaṃ tattha dīpitameva.
They are called buddhamantā (Buddha-mantras) because they illuminate the characteristics of Buddhas primarily. Indeed, the characteristics of Paccekabuddhas, etc., are also illuminated therein.
Vì sự giải thích các tướng của chư Phật là chính yếu, nên gọi là buddhamantā. Thật vậy, các tướng của chư Phật Độc Giác, v.v., cũng được giải thích trong đó.
Tena vuttaṃ ‘‘yesaṃ vasenā’’tiādi.
Therefore, "yesaṃ vasenā," etc., is said.
Do đó, có câu "yesaṃ vasenā" và tiếp theo.
606
‘‘Anūno paripūrakārī’’ti atthamattadassanaṃ, saddato pana adhigatamatthaṃ dassetuṃ ‘‘avayo na hotī’’ti vuttaṃ.
"Anūno paripūrakārī" is merely an exposition of meaning, but to show the meaning derived from the word, "avayo na hotī" is said.
"Anūno paripūrakārī" chỉ là cách trình bày ý nghĩa, nhưng để trình bày ý nghĩa đã được hiểu từ ngữ pháp, thì đã nói "avayo na hotī".
Ko panesa avayoti anuyogamapaneti ‘‘avayo nāmā’’tiādinā.
Who then is this avayo? He removes the question by "avayo nāmā," etc.
Vậy ai là người không thiếu sót đó? Để loại bỏ câu hỏi đó, đã nói "avayo nāmā" và tiếp theo.
Ayamettādhippāyo – yo tāni sandhāretuṃ sakkoti, so ‘‘vayo’’ti vuccati.
This is the intention here: the one who is able to retain those (texts) is called vayo.
Ý chính ở đây là: người nào có thể ghi nhớ những điều đó thì được gọi là "vayo".
Yo pana na sakkoti, so avayo nāma.
But the one who is not able, is called avayo.
Còn người nào không thể, thì được gọi là avayo.
Yo ca avayo na hoti, so ‘‘dve paṭisedhā pakatiyatthagamakā’’ti ñāyena vayo evāti.
And the one who is not avayo is, by the rule "two negations convey the positive meaning," certainly vayo.
Và người nào không phải là avayo, thì theo quy tắc "hai phủ định tạo thành một khẳng định", người đó chính là vayo.
Vayatīti hi vayo, ādimajjhapariyosānesu katthacipi aparikilamanto avitthāyanto te ganthe santāne paṇeti byavaharatīti attho.
For vayati means vayo; it means that one recites and masters those texts in a continuous manner, without becoming exhausted or distracted at any point—beginning, middle, or end.
Vì người đó ghi nhớ, nên gọi là vayo. Có nghĩa là người đó thuyết giảng và thực hành những bộ sách đó một cách liên tục, không mệt mỏi hay chán nản ở bất kỳ phần nào: đầu, giữa hay cuối.
Ayaṃ pana vinayaṭṭhakathānayo (pārā. 84) – anavayoti anu avayo, sandhivasena u-kāralopo, anu anu avayo anūno, paripuṇṇasippoti attho.
This, however, is the approach of the Vinaya Commentary: anavayo is anu avayo; by sandhi, the u vowel is elided, anu anu avayo is anūno, meaning one possessing complete skill.
Tuy nhiên, đây là cách giải thích theo Vinaya-aṭṭhakathā: anavayo là anu avayo, âm u bị lược bỏ do sandhi, anu anu avayo anūno, có nghĩa là người có kỹ năng hoàn hảo.
Vayoti hi hāni ‘‘āyavayo’’tiādīsu viya, natthi etassa yathāvuttaganthesu vayo ūnatāti avayo, anu anu avayo anavayoti.
For vayo means diminution, as in "āyavayo," etc. This person has no vayo or deficiency in the aforementioned texts, hence avayo; anu anu avayo means anavayo.
vayo có nghĩa là sự hao hụt, như trong "āyavayo" (thu nhập và chi tiêu), nên người này không có sự hao hụt hay thiếu sót trong các bộ sách đã nói, nên gọi là avayo, và anu anu avayo là anavayo.
607
‘‘Anuññāto’’ti padassa kammasādhanavasena, ‘‘paṭiññāto’’ti padassa ca kattusādhanavasena atthaṃ dassento ‘‘ācariyenā’’tiādimāha.
Explaining the meaning of the word anuññāto in the passive sense, and of the word paṭiññāto in the active sense, he says "ācariyenā," etc.
Để trình bày ý nghĩa của từ "Anuññāto" theo nghĩa bị động, và từ "paṭiññāto" theo nghĩa chủ động, đã nói "ācariyenā" và tiếp theo.
Assāti ambaṭṭhassa.
Assā refers to Ambaṭṭha.
Assā là của Ambhaṭṭha.
Pāḷiyaṃ ‘‘yamahaṃ jānāmi, taṃ tvaṃ jānāsī’’ti idaṃ anujānanākāradassanaṃ, ‘‘yaṃ tvaṃ jānāsi, tamahaṃ jānāmī’’ti idaṃ pana paṭijānanākāradassananti dasseti ‘‘yaṃ aha’’ntiādinā.
In the Pali, "yamahaṃ jānāmi, taṃ tvaṃ jānāsi" shows the manner of granting permission, while "yaṃ tvaṃ jānāsi, tamahaṃ jānāmi" shows the manner of acknowledging, as explained by "yaṃ aha," etc.
Trong Pāḷi, câu "yamahaṃ jānāmi, taṃ tvaṃ jānāsī" là cách thể hiện sự cho phép, còn câu "yaṃ tvaṃ jānāsi, tamahaṃ jānāmī" là cách thể hiện sự thừa nhận, điều này được giải thích bằng "yaṃ aha" và tiếp theo.
‘‘Āma ācariyā’’ti hi yathāgataṃ paṭijānanavacanameva atthavasena vuttaṃ.
Indeed, "āma ācariyā" is merely an affirmative statement given in accordance with the meaning.
Thật vậy, "Āma ācariyā" chỉ là lời thừa nhận được nói theo ý nghĩa của văn bản gốc.
Yanti tevijjakaṃ pāvacanaṃ.
Yaṃ refers to the tevijjaka teaching.
Yaṃ là giáo lý ba Veda.
Tassāti ācariyassa.
Tassā refers to the teacher.
Tassā là của vị đạo sư.
Paṭivacanadānameva paṭiññā tathā, tāya sayameva paṭiññātoti attho.
Giving a reply itself is paṭiññā, and thus, he himself is paṭiññāto (one who has affirmed).
Việc đưa ra lời đáp lại chính là sự thừa nhận, và nhờ đó, người đó tự mình paṭiññāto (được thừa nhận).
‘‘Sake’’tiādi anujānanapaṭijānanādhikāradassanaṃ.
"Sake," etc., indicates the authority of granting permission and acknowledging.
"Sake" và tiếp theo là cách thể hiện quyền hạn của sự cho phép và thừa nhận.
Adesassapi desamiva kappanāmattenāti vuttaṃ ‘‘katarasmi’’ntiādi.
Even though it is not a place, it is said "katarasmi," etc., as merely conceived to be like a place.
Đã nói "katarasmi" và tiếp theo, có nghĩa là chỉ là sự giả định một nơi chốn, ngay cả khi không phải là nơi chốn thực sự.
Sassa attano santakaṃ sakaṃ.
What belongs to oneself is sakaṃ.
Cái gì thuộc về mình, cái đó là sakaṃ.
Ācariyānaṃ paramparato, paramparabhūtehi vā ācariyehi āgataṃ ācariyakaṃ. Tisso vijjā, tāsaṃ samūho tevijjakaṃ, vedattayaṃ.
That which has come down from the succession of teachers, or from teachers who are in succession, is ācariyakaṃ. The three knowledges; the collection of them is tevijjakaṃ, the three Vedas.
Điều gì được truyền lại từ truyền thống của các vị đạo sư, hoặc từ các vị đạo sư trong truyền thống, thì gọi là ācariyakaṃ. Ba tri kiến, tập hợp của chúng là tevijjakaṃ, ba bộ Veda.
Padhānaṃ vacanaṃ, pakaṭṭhānaṃ vā aṭṭhakādīnaṃ vacanaṃ pāvacanaṃ.
The principal saying, or the saying of excellent sages such as Aṭṭhaka, is pāvacanaṃ.
Lời nói chính yếu, hoặc lời nói của các vị Aṭṭhaka, v.v., là pāvacanaṃ.
608
257. Idāni yenādhippāyena brāhmaṇo pokkharasātī ambaṭṭhaṃ māṇavaṃ āmantetvā ‘‘ayaṃ tātā’’tiādivacanamabrvi, tadadhippāyaṃ vibhāvento ‘‘esa kirā’’tiādimāha.
Now, wishing to elaborate the intention with which the brahmin Pokkharasāti addressed the young man Ambaṭṭha and spoke the words "ayaṃ tātā," etc., he says "esa kirā," etc.
Bây giờ, để làm rõ ý định mà vị Bà-la-môn Pokkharasāti đã triệu tập thanh niên Ambhaṭṭha và nói những lời như "này con", thì đã nói "esa kirā" và tiếp theo.
Tattha uggatassāti pubbe pākaṭassa kittimato porāṇajanassa.
There, uggatassā refers to the ancient person who was previously well-known and renowned.
Trong đó, uggatassā là của người xưa đã nổi tiếng và có danh tiếng.
Bahū janāti pūraṇakassapādayo sandhāya vuttaṃ.
Bahū janā is said with reference to Pūraṇa Kassapa, etc.
Bahū janā được nói đến để chỉ Pūraṇa Kassapa, v.v.
Ekaccanti khattiyādijātimantaṃ, lokasammataṃ vā janaṃ.
Ekaccaṃ refers to a person of Khattiya, etc., caste, or a person respected by the world.
Ekaccaṃ là người thuộc dòng dõi khattiya, v.v., hoặc là janaṃ được thế gian tôn kính.
Garūti bhāriyaṃ, attānaṃ tato mocetvā apagamanamattampi dukkaraṃ hoti, pageva taduttari karaṇanti vuttaṃ hoti.
Garū means heavy, weighty; it means that even merely going away by extricating oneself from it is difficult, let alone doing more than that.
Garū có nghĩa là nặng nề, việc tự giải thoát khỏi đó và rời đi cũng khó khăn, huống chi là làm những điều cao hơn thế.
Anattho nāma tathāpagamanādinā nindābyārosaupārambhādi.
Anattho means reproach, malice, blame, etc., arising from such departure.
Anattho là những điều bất lợi như bị chỉ trích, bị quở trách, bị khiển trách, v.v., do việc rời đi như vậy.
609
‘‘Abbhuggato’’ti ettha abhisaddayogena itthambhūtākhyānatthavaseneva ‘‘gotama’’nti upayogavacanaṃ.
In "Abbhuggato," due to the conjunction with the prefix abhi, the use of "gotama" is solely in the sense of describing the state of being so.
Trong từ "Abbhuggato", do sự kết hợp với tiền tố abhi-, từ " gotama" được sử dụng theo nghĩa itthambhūtākhyāna (chỉ sự hiện hữu của một trạng thái đặc biệt).
‘‘Taṃ bhavantaṃ, tathā santaṃyevā’’ti padesupi tassa anupayogattā tadatthavasenevāti dasseti ‘‘tassa bhoto’’tiādinā.
And even in the phrases "taṃ bhavantaṃ, tathā santaṃyevā," since the prefix has no application there, it shows that it is used solely in that sense by "tassa bhoto," etc.
Để chỉ rằng ngay cả trong các từ "taṃ bhavantaṃ" và "tathā santaṃyevā", tiền tố đó không được sử dụng theo nghĩa đó, nên đã nói "tassa bhoto" và tiếp theo.
Tenāha ‘‘idhāpī’’tiādi.
Therefore, it is said, "idhāpī," etc.
Do đó, đã nói "idhāpī" và tiếp theo.
Tathā satoyevāti yenākārena arahatādinā saddo abbhuggato, tenākārena santassa bhūtassa eva tassa bhavato gotamassa saddo yadi vā abbhuggatoti attho.
Tathā satoyevā means: if the report of that venerable Gotama, who exists in the state in which he is exalted, i.e., with arahantship, etc., is indeed exalted.
Tathā satoyevā có nghĩa là: nếu danh tiếng của Đức Gotama đó đã nổi lên theo cách mà Ngài là bậc A-la-hán, v.v., thì danh tiếng của Ngài, người thực sự hiện hữu theo cách đó, đã nổi lên.
Apica taṃ bhavantaṃ gotamaṃ tathā santaṃyevāti ekassapi atthassa dvikkhattuṃ sambandhabhāvena vacanaṃ sāmaññavisiṭṭhatāparikappanena atthavisesaviññāpanatthaṃ, tasmā ‘‘tassa bhoto gotamassā’’ti sāmaññasambandhabhāvena vicchinditvā ‘‘tathā satoyevā’’ti visesasambandhabhāvena yojetabbaṃ.
Moreover, the statement, "that Venerable Gotama, being truly so", is made by connecting one and the same meaning twice, with the intention of clarifying a specific meaning by conceiving a distinction from the general. Therefore, it should be construed as "of that Venerable Gotama" in a general relational sense, and then separated and linked as "being truly so" in a specific relational sense.
Hơn nữa, việc nói “Đức Gotama, vị Tôn giả như vậy” (taṃ bhavantaṃ gotamaṃ tathā santaṃyevā) với một ý nghĩa được liên kết hai lần là để làm rõ ý nghĩa đặc biệt bằng cách hình dung sự đặc thù của cái chung. Do đó, nên liên kết bằng cách tách rời theo cách liên kết chung là ‘‘của Đức Gotama, vị Tôn giả đó’’ (tassa bhoto gotamassā) và liên kết theo cách liên kết đặc biệt là ‘‘chỉ là bậc hiện hữu như vậy’’ (tathā satoyevā).
Yadi-saddo cettha saṃsayattho dvinnampi atthānaṃ saṃsayitabbattā.
And here the word "yadi" means doubt, because both meanings are to be doubted.
Ở đây, từ yadi mang ý nghĩa nghi ngờ, vì cả hai ý nghĩa đều có thể nghi ngờ.
-saddo ca vikappanattho tesu ekassa vikappetabbattā.
And the word "vā" means alternative, because one of them is to be taken as an alternative.
Và từ mang ý nghĩa lựa chọn, vì một trong số đó có thể được lựa chọn.
Saddavidū pana evaṃ vadanti – ‘‘imassa vacanaṃ saccaṃ vā yadi vā musā’’tiādīsu viya yadi-saddo vā-saddo ca ubhopi vikappatthāyeva.
However, grammarians say thus: "The words yadi and vā both mean alternative, as in phrases like 'whether his statement is true or false'."
Tuy nhiên, các nhà ngữ pháp học nói rằng: “Trong các trường hợp như ‘lời nói của người này là thật hay dối’ (imassa vacanaṃ saccaṃ vā yadi vā musā), cả từ yadi và vā đều mang ý nghĩa lựa chọn.”
Yadi-saddopi hi ‘‘yaṃ yadeva parisaṃ upasaṅkamati yadi khattiyaparisaṃ yadi brāhmaṇaparisa’’ntiādīsu (a. ni. 5.34) vā-saddattho dissati.
Indeed, the meaning of the word vā is seen in the word yadi, as in phrases like "whatever assembly he approaches, whether an assembly of Khattiyas or an assembly of brahmins".
Thật vậy, ý nghĩa của từ vā cũng được thấy trong các trường hợp như ‘‘vị ấy đến bất cứ hội chúng nào, dù là hội chúng Sát-đế-lỵ hay hội chúng Bà-la-môn’’ (yaṃ yadeva parisaṃ upasaṅkamati yadi khattiyaparisaṃ yadi brāhmaṇaparisaṃ), v.v.
‘‘Appaṃ vassasataṃ āyu, idānetarahi vijjatī’’tiādīsu viya ca idha samānatthasaddapayogoti.
And here, as in phrases like "The lifespan is a short hundred years; it exists now, at this time", there is the usage of words with similar meanings.
Và ở đây, việc sử dụng các từ đồng nghĩa giống như trong các trường hợp như ‘‘Tuổi thọ chỉ có một trăm năm, hiện nay đang tồn tại’’ (appaṃ vassasataṃ āyu, idānetarahi vijjatī).
Pāḷiyaṃ ‘‘yadi vā no tathā’’ti idampi ‘‘santaṃyeva saddo abbhuggato’’ti iminā sambajjhitvā yathāvuttanayeneva yojetabbaṃ.
In the Pali, "or not so"—this also should be connected with "the sound has arisen as 'truly so'" and construed in the manner already stated.
Trong Pāḷi, cụm từ ‘‘yadi vā no tathā’’ cũng nên được liên kết với ‘‘lời nói đã xuất hiện là chân thật’’ (santaṃyeva saddo abbhuggato) và được giải thích theo cách đã nói.
Nanu ‘‘gotama’’nti padeyeva upayogavacanaṃ siyā, na etthāti codanāya ‘‘idhāpī’’tiādi vuttaṃ, tassa anupayogattā, vicchinditvā sambandhavisesabhāvena yojetabbattā vā idhāpi itthambhūtākhyānatthavaseneva upayogavacanaṃ nāmāti vuttaṃ hoti.
Now, might not the accusative case be only in the word "Gotama" and not here? To this objection, it is said, "here also" and so on. Because it is not directly applicable, or because it must be separated and linked in a specific relational sense, it is said that here too, it is indeed an accusative case used to denote the state of being so.
Để giải đáp thắc mắc rằng: “Chẳng phải từ upayogavacanaṃ chỉ nên dùng cho từ Gotama thôi sao, không phải ở đây sao?”, thì đã nói ‘‘ở đây cũng vậy’’ (idhāpī), v.v., vì nó không thích hợp, hoặc vì nó phải được tách ra và liên kết theo cách liên kết đặc biệt, nên ở đây cũng có nghĩa là từ upayogavacanaṃ chỉ mang ý nghĩa là một cách diễn đạt trạng thái hiện hữu như vậy.
Itthambhūtākhyānaṃ attho yassa tathā, abhisaddo, itthambhūtākhyānameva vā attho tathā, soyevattho.
That which has the meaning of "state of being so," that is "so"; or rather, the "state of being so" is the meaning, that is the meaning.
Itthambhūtākhyānaṃ là ý nghĩa của từ đó, hoặc itthambhūtākhyānaṃ chính là ý nghĩa đó, đó là ý nghĩa.
Yadaggena hi saddayogo hoti, tadaggena atthayogopīti.
For by whatever extent a word is connected, to that extent is the meaning connected.
Thật vậy, sự kết hợp của từ ngữ ở mức độ nào thì sự kết hợp của ý nghĩa cũng ở mức độ đó.
610
258. Bhoti attano ācariyaṃ ālapati.
258. By "Bho", one addresses one's teacher.
258. Bho là cách xưng hô với vị thầy của mình.
Yathā-saddaṃ sātthakaṃ katvā saha pāṭhasesena yojetuṃ ‘‘yathā sakkā’’tiādi vuttaṃ.
To make the word yathā meaningful and to connect it with the rest of the text, "yathā sakkā" and so on is stated.
Để làm cho từ yathā có ý nghĩa và liên kết với phần còn lại của văn bản, đã nói ‘‘yathā sakkā’’ (như có thể), v.v.
Soti bhagavā.
"So" means the Blessed One.
So (vị ấy) là Đức Thế Tôn.
Purimanaye ākāratthajotanayathā-saddayogyato kathanti pucchāmattaṃ, idha pana tadayogyato ‘‘ākārapucchā’’ti vuttaṃ.
In the former method, it was merely a question of how the word yathā denoted a mode; here, however, since it does not denote that, it is said to be "a question of mode".
Trong cách giải thích trước, chỉ là một câu hỏi về cách từ yathā có thể biểu thị ý nghĩa của một trạng thái, nhưng ở đây, vì nó không phù hợp với điều đó, nên được gọi là ‘‘câu hỏi về trạng thái’’ (ākārapucchā).
Bāhirakasamaye ācariyamhi upajjhāyasamudācāroti āha ‘‘atha naṃ upajjhāyo’’ti, upajjhāyasaññito ācariyabrāhmaṇoti attho.
He says "then his preceptor" because in external religions, the etiquette towards a teacher is that of a preceptor; the meaning is, the brahmin teacher designated as preceptor.
Trong các giáo phái ngoại đạo, việc xưng hô với thầy như upajjhāya là một phong tục, nên đã nói ‘‘atha naṃ upajjhāyo’’ (rồi vị upajjhāya của người ấy), có nghĩa là vị Bà-la-môn thầy được gọi là upajjhāya.
611
Kāmañca manto, brahmaṃ, kappoti tibbidho vedo, tathāpi aṭṭhakādi vuttaṃ padhānabhūtaṃ mūlaṃ manto, tadatthavivaraṇamatthaṃ brahmaṃ, tattha vuttanayena yaññakiriyāvidhānaṃ kappoti mantasseva padhānabhāvato, itaresañca tannissayeneva jātattā mantaggahaṇena brahmakappānampi gahaṇaṃ siddhamevāti dasseti ‘‘tīsu vedesū’’ti iminā.
Although the Veda is threefold: mantra, brahma, and kappa, nevertheless, the fundamental root, which is primary, spoken of by Aṭṭhaka and others, is called Mantra; the explanation of its meaning is called Brahma; the prescription of sacrificial rites according to what is stated therein is called Kappa. Due to the primacy of the Mantra and the fact that the others depend on it, it is demonstrated by "in the three Vedas" that the inclusion of Brahma and Kappa is also established.
Mặc dù kinh Veda có ba loại là mantra, brahma và kappa, nhưng vì mantra là gốc chính được các vị tiên như Aṭṭhaka nói đến, brahma là phần giải thích ý nghĩa của nó, và kappa là quy tắc thực hành nghi lễ hy sinh theo cách đã nói trong đó, và vì mantra là chính yếu, còn các loại khác phát sinh dựa vào mantra, nên việc bao gồm brahma và kappa trong việc gọi là mantra đã được chứng minh, điều này được thể hiện qua cụm từ ‘‘trong ba kinh Veda’’ (tīsu vedesū).
Mantoti hi aṭṭhakādīhi isīhi vuttamūlavedasseva nāmaṃ, vedoti sabbassa, tasmā ‘‘vedesū’’ti vutte sabbesampi gahaṇaṃ sijjhatīti veditabbaṃ.
For the word Mantra is the name of the root Veda spoken by the sages such as Aṭṭhaka, while Veda is the name for all. Therefore, it should be understood that when "Vedas" is mentioned, all of them are included.
Thật vậy, mantra là tên của kinh Veda gốc được các vị tiên như Aṭṭhaka nói đến, còn veda là tên của tất cả. Do đó, khi nói ‘‘vedesū’’ (trong các kinh Veda), cần hiểu rằng tất cả đều được bao gồm.
Lakkhaṇānīti lakkhaṇadīpakāni mantapadāni.
Lakkhaṇāni are the Vedic verses that illuminate the characteristics.
Lakkhaṇāni là các từ mantra chỉ rõ tướng.
Pajjagajjabandhapavesanavasena pakkhipitvā.
Pakkhipitvā means inserting them by way of poetic and prosaic composition.
Pakkhipitvā (đã đặt vào) theo cách đưa vào các bài kệ (pajja) và văn xuôi (gajja).
Brāhmaṇavesenevāti vedavācakabrāhmaṇaliṅgeneva.
Brāhmaṇaveseneva means only in the guise of a brahmin reciter of the Vedas.
Brāhmaṇavesenevā (chỉ với hình dạng Bà-la-môn) là chỉ với hình tướng của Bà-la-môn giảng kinh Veda.
Vedeti mahāpurisalakkhaṇamante.
Vede refers to the Mantra describing the characteristics of a Great Being.
Vede (trong kinh Veda) là trong các mantra về tướng đại nhân.
Mahesakkhā sattāti mahāpuññavanto paṇḍitasattā.
Mahesakkhā sattā means beings of great merit, wise beings.
Mahesakkhā sattā (các chúng sanh có uy lực lớn) là các chúng sanh có phước báu lớn, các chúng sanh trí tuệ.
Jānissanti iti manasi katvā vācentīti sambandho.
The connection is: "They recite, thinking that* will know."
Mối liên hệ là họ tụng đọc với ý nghĩ rằng họ sẽ hiểu.
Tenāti tathā vācanato.
Tenā means by reciting thus.
Tenā (do đó) là do việc tụng đọc như vậy.
Pubbeti ‘‘tathāgato uppajjissatī’’ti vattabbakālato pabhuti tathāgatassa dharamānakāle.
Pubbe means from the time when it was to be said "the Tathāgata will arise" onwards, during the lifetime of the Tathāgata.
Pubbe (trước đây) là từ thời điểm cần nói ‘‘Đức Như Lai sẽ xuất hiện’’ cho đến thời Đức Như Lai còn tại thế.
Ajjhāyitabbavācetabbabhāvena āgacchanti pākaṭā bhavanti.
Āgacchanti means they become manifest by being recited and taught.
Āgacchanti (chúng xuất hiện) là chúng trở nên rõ ràng bằng cách được học và được giảng dạy.
Ekagāthādvigāthādivasena anukkamena antaradhāyanti. Na kevalaṃ lakkhaṇamantāyeva, atha kho aññepi vedā brāhmaṇānaṃ aññāṇabhāvena anukkamena antaradhāyanti evāti ācariyena (dī. ni. ṭī. 1.258) vuttaṃ.
Anukkamena antaradhāyanti means they gradually disappear, one verse, two verses, and so on. It is stated by the teacher that not only the Lakkhaṇa Mantras, but also other Vedas gradually disappear due to the ignorance of the brahmins.
Anukkamena antaradhāyanti (dần dần biến mất) theo cách một bài kệ, hai bài kệ, v.v. Không chỉ các mantra về tướng, mà cả các kinh Veda khác cũng dần dần biến mất do sự thiếu hiểu biết của các Bà-la-môn, điều này đã được vị thầy nói.
612
Buddhabhāvapatthanā paṇidhi, pāramīsambharaṇaṃ samādānaṃ, kammassakatādipaññā ñāṇaṃ. ‘‘Paṇidhimahato samādānamahatotiādinā paccekaṃ mahantasaddo yojetabbo’’ti (dī. ni. ṭī. 1.258) ācariyena vuttaṃ.
The aspiration for Buddhahood is paṇidhi; the accumulation of perfections is samādāna; the wisdom regarding kamma and its ownership (kammassakatā) is ñāṇa. The teacher stated: "The word 'mahanta' (great) should be connected individually, as in 'great by aspiration', 'great by undertaking', and so on."
Paṇidhi là sự ước nguyện thành Phật, samādāna là sự tích lũy pāramī, ñāṇa là trí tuệ về nghiệp sở hữu, v.v. Vị thầy đã nói: ‘‘Từ mahanta (vĩ đại) nên được liên kết riêng lẻ với ‘paṇidhi mahato samādāna mahato’, v.v.’’.
Evañca sati karuṇā ādi yesaṃ saddhāsīlādīnaṃ te karuṇādayo, te eva guṇā karuṇādiguṇā, paṇidhi ca samādānañca ñāṇañca karuṇādiguṇā ca, tehi mahanto paṇidhisamādānañāṇakaruṇādiguṇamahantoti nibbacanaṃ kātabbaṃ.
Thus, karuṇādayo are those whose qualities like faith and morality have compassion as their beginning; those very qualities are karuṇādiguṇā. And the aspiration, and the undertaking, and the wisdom, and the qualities beginning with compassion—great by these—this is how the analysis paṇidhisamādānañāṇakaruṇādiguṇamahanto should be made.
Và như vậy, các phẩm chất như từ bi, v.v. mà niềm tin, giới hạnh, v.v. là khởi đầu của chúng, đó chính là karuṇādayo (các phẩm chất từ bi, v.v.), chúng chính là các phẩm chất karuṇādiguṇā (các phẩm chất từ bi, v.v.). Paṇidhi, samādāna, ñāṇa và các phẩm chất từ bi, v.v. hợp lại thành paṇidhisamādānañāṇakaruṇādiguṇamahanto (vĩ đại bởi các phẩm chất như ước nguyện, sự thọ trì, trí tuệ và từ bi, v.v.).
Evañhi dvandatoparattā mahantasaddo paccekaṃ yojīyatīti.
For in this way, being subsequent to a dvanda compound, the word mahanta is connected to each individual element.
Thật vậy, khi đó, từ mahanta được liên kết riêng lẻ vì nó đứng sau từ kép (dvanda).
Apica paṇidhi ca samādānañca ñāṇañca karuṇā ca, tamādi yesaṃ te tathā, teyeva guṇā, tehi mahantoti nibbacanenapi attho sūpapanno hoti, paṇidhimahantatādi cassa buddhavaṃsa (bu. vaṃ. 9 ādayo) cariyāpiṭakādi (cariyā. 1 ādayo) vasena veditabbo.
Moreover, the meaning is also well-established by an alternative analysis: the aspiration, and the undertaking, and the wisdom, and compassion, these are their beginning, and these are the very qualities, and great by these. And his greatness by aspiration and so on should be understood according to the Buddhavaṃsa, Cariyāpiṭaka, and other texts.
Hơn nữa, ý nghĩa cũng được giải thích rõ ràng bằng cách diễn giải rằng paṇidhi, samādāna, ñāṇa và karuṇā là khởi đầu của các phẩm chất đó, và chính các phẩm chất đó là vĩ đại. Và sự vĩ đại của paṇidhi, v.v. của vị ấy nên được hiểu theo Buddhavaṃsa (Bu. vaṃ. 9, v.v.) và Cariyāpiṭaka (Cariyā. 1, v.v.).
Mahāpadānasuttaṭṭhakathāyaṃ pana ‘‘mahāpurisassāti jātigottakulapadesādivasena mahantassa purisassā’’ti (dī. ni. aṭṭha. 2.33) vuttaṃ.
However, in the Mahāpadānasuttaṭṭhakathā, it is said: "mahāpurisassa means of a great person by birth, lineage, family region, and so on."
Tuy nhiên, trong Mahāpadānasuttaṭṭhakathā đã nói: ‘‘Mahāpurisassa (của đại nhân) là của một người vĩ đại theo chủng tộc, dòng dõi, vùng đất gia đình, v.v.’’.
Tattha ‘‘khattiyo, brāhmaṇo’’ti evamādi jāti. ‘‘Koṇḍañño, gotamo’’ti evamādi gottaṃ. ‘‘Poṇikā, cikkhallikā, sākiyā, koliyā’’ti evamādi kulapadeso, tadetaṃ sabbampi idha ādisaddena saṅgahitanti daṭṭhabbaṃ.
Therein, "Khattiya, brahmin" and so forth is jāti (birth). "Koṇḍañña, Gotama" and so forth is gotta (lineage). "Poṇikā, Cikkhallikā, Sākiyā, Koliyā" and so forth is kulapadesa (family region), and all of this is included here by the word "ādi" (and so on).
Trong đó, ‘‘Sát-đế-lỵ, Bà-la-môn’’, v.v. là chủng tộc (jāti). ‘‘Koṇḍañña, Gotama’’, v.v. là dòng dõi (gottaṃ). ‘‘Poṇikā, Cikkhallikā, Sākiyā, Koliyā’’, v.v. là vùng đất gia đình (kulapadeso). Tất cả những điều này đều được bao gồm bởi từ ādi (v.v.) ở đây.
Evañhi sati ‘‘dveyeva gatiyo bhavantī’’ti ubhinnaṃ sādhāraṇavacanaṃ samatthitaṃ hotīti.
In this way, the common statement "there are only two destinations" becomes justified.
Và như vậy, lời nói chung ‘‘chỉ có hai con đường’’ (dveyeva gatiyo bhavantī) cho cả hai đã được chứng minh là đúng.
613
Niṭṭhāti nipphattiyo siddhiyo.
Niṭṭhā refers to completions, attainments.
Niṭṭhā là sự hoàn thành, sự thành tựu.
Nanvāyaṃ gati-saddo anekattho, kasmā niṭṭhāyameva vuttoti āha‘‘ kāmañcāya’’ntiādi.
"But this word 'gati' has many meanings, why is it used only for 'niṭṭhā'?"—to this question, he says "kāmañcāyaṃ" and so on.
Chẳng phải từ gati này có nhiều nghĩa sao, tại sao nó chỉ được nói về niṭṭhā? Để trả lời câu hỏi này, đã nói ‘‘kāmañcāya’’ (mặc dù điều này), v.v.
Bhavabhedeti nirayādibhavavisese.
Bhavabhede means in specific existences such as hell.
Bhavabhede là trong các loại hữu khác nhau như địa ngục, v.v.
So hi sucaritaduccaritakammena sattehi upapajjanavasena gantabbāti gati. Gacchati pavattati etthāti gati, nivāsaṭṭhānaṃ.
For that* is gati because it is to be reached by beings by means of good and bad conduct, by way of rebirth. That in which one goes or proceeds is gati, a dwelling place.
Nó là gati (cõi đi) vì chúng sanh đi đến đó bằng nghiệp thiện và ác. Nó là gati (sự diễn tiến) vì nó diễn ra ở đó, tức là nơi cư trú.
Gamati yathāsabhāvaṃ jānātīti gati. Paññā, gamanaṃ byāpanaṃ gati, vissaṭabhāvo, so pana ito ca etto ca byāpetvā ṭhitatāva.
That which knows according to its true nature is gati, wisdom. Gati is also movement, pervasion, which is merely the state of being diffused here and there.
Nó là gati (trí tuệ) vì nó biết bản chất như nó vốn có, tức là trí tuệ. Gati (sự lan rộng) là sự lan rộng, tức là trạng thái lan tỏa, và trạng thái lan tỏa đó là sự tồn tại lan rộng từ đây đến đó.
Gamanaṃ nipphattanaṃ gati, niṭṭhā, ajjhāsayapaṭisaraṇatthāpi nidassananayena gahitā.
Movement, completion, is gati, an end. Also, the meanings of intention and refuge are taken by way of illustration.
Gati (sự hoàn thành) là sự hoàn thành, tức là niṭṭhā. Các ý nghĩa về xu hướng (ajjhāsaya) và nơi nương tựa (paṭisaraṇa) cũng được bao gồm theo cách ví dụ.
Tathā hesa ‘‘imesaṃ kho ahaṃ bhikkhūnaṃ sīlavantānaṃ kalyāṇadhammānaṃ neva jānāmi āgatiṃ vā gatiṃ vā’’ti (ma. ni. 1.508) ettha ajjhāsaye vattati, ‘‘nibbānaṃ arahato gatī’’ti (pari. 339) ettha paṭisaraṇe, parāyaṇe apassayeti attho.
For example, this word is used in the sense of intention in "I do not know the coming or going of these bhikkhus who are virtuous and of noble character", and in the sense of refuge or support in "Nibbāna is the refuge of the Arahants," meaning the ultimate resort, the support.
Thật vậy, từ này được dùng với ý nghĩa xu hướng trong câu ‘‘Ta không biết sự đến hay đi của những Tỳ-kheo có giới hạnh, có pháp lành này’’ (imesaṃ kho ahaṃ bhikkhūnaṃ sīlavantānaṃ kalyāṇadhammānaṃ neva jānāmi āgatiṃ vā gatiṃ vā). Trong câu ‘‘Nibbāna là nơi nương tựa của bậc A-la-hán’’ (nibbānaṃ arahato gatī), nó có nghĩa là nơi nương tựa, nơi ẩn náu, nơi dựa dẫm.
Gacchati yathāruci pavattatīti gati, ajjhāsayo.
That which goes and proceeds as one wishes is gati, intention.
Nó là gati (xu hướng) vì nó diễn ra theo ý muốn, tức là xu hướng.
Gacchati avacarati, avacaraṇavasena vā pavattati etthāti gati, paṭisaraṇaṃ.
That in which one goes and wanders, or proceeds by way of wandering, is gati, refuge.
Nó là gati (nơi nương tựa) vì nó đi vào, tức là diễn tiến theo cách đi vào, tức là nơi nương tựa.
Sabbasaṅkhatavisaññuttassa hi arahato nibbānameva paṭisaraṇaṃ, idha pana niṭṭhāyaṃ vattatīti veditabbo tadaññesamavisayattā.
For indeed, Nibbāna alone is the refuge for an Arahant, who is disassociated from all conditioned things. Here, however, it should be understood that it refers to completion, as other meanings are not applicable.
Thật vậy, Nibbāna chính là nơi nương tựa của bậc A-la-hán, người đã thoát khỏi mọi pháp hữu vi. Ở đây, cần hiểu rằng nó được dùng với ý nghĩa niṭṭhā (sự hoàn thành) vì các ý nghĩa khác không phải là đối tượng của nó.
614
Nanu dvinnaṃ nipphattīnaṃ nimittabhūtāni lakkhaṇāni visadisāneva, atha kasmā ‘‘yehi samannāgatassā’’tiādinā tesaṃ sadisabhāvo vuttoti codanālesaṃ dassetvā sodhento ‘‘tattha kiñcāpī’’tiādimāha.
Are not the characteristics, which are the signs of the two fulfillments, indeed dissimilar? Why then is their similarity spoken of with "endowed with which" and so forth? Having thus shown a trace of objection, the commentator, wishing to clarify, says "Regarding that, although..." and so on.
Há chẳng phải các tướng làm nhân duyên cho sự thành tựu của hai bậc là khác nhau sao? Vậy tại sao với câu ‘người có đầy đủ những tướng này’ v.v… lại nói rằng chúng giống nhau?” Sau khi trình bày một chút chất vấn như vậy, bậc chú giải sư muốn làm sáng tỏ nên nói “ở đây, mặc dù…” v.v…
Samānepi nigrodhabimbatādilakkhaṇabhāve attheva koci nesaṃ visesoti dassetuṃ ‘‘na teheva buddho hotī’’ti vuttaṃ.
To show that even when the characteristics such as the Banyan-tree-like bodily form are similar, there is still some distinction among them, it is said, "one does not become a Buddha merely by those (characteristics)."
Để chỉ ra rằng mặc dù các tướng như thân cây bàng (nigrodhabimbatā) v.v… là giống nhau, nhưng vẫn có một số điểm khác biệt giữa chúng, nên đã nói “không phải chỉ với những tướng ấy mà thành Phật”.
‘‘Yathā hi buddhānaṃ lakkhaṇāni suvisadāni, suparibyattāni, paripuṇṇāni ca honti, na evaṃ cakkavattīna’’nti ayaṃ pana viseso ācariyadhammapālattherena (dī. ni. ṭī. 1.258) pakāsito.
This distinction, that "Just as the characteristics of Buddhas are exceedingly clear, exceedingly manifest, and complete, not so are those of Cakkavattī kings," was explained by Acariya Dhammapāla Thera.
Tuy nhiên, sự khác biệt này đã được Trưởng lão Sư Dhamma-pāla (Dī. Nī. Ṭī. 1.258) làm sáng tỏ rằng: “Quả thật, các tướng của chư Phật là rất rõ ràng, rất minh bạch và đầy đủ, không giống như của các bậc Chuyển Luân Vương.”
Jāyanti bhinnesupi atthesu abhinnadhīsaddā etāyāti jāti, lakkhaṇabhāvamattaṃ.
That by which words signifying a non-distinct concept arise even in distinct things is called jāti, which is merely the state of being a characteristic.
Nơi mà các từ ngữ mang ý nghĩa không khác biệt xuất hiện dù các đối tượng là khác biệt, đó là jāti (loài, chủng loại), chỉ là trạng thái của tướng.
Vuttañhi –
For it is said:
Như đã nói:
615
‘‘Sabalādīsu bhinnesu, yāya vattantubhinnadhī;
"That word by which a non-distinct concept occurs in distinct things like variegated (cows) and so forth—
“Nơi các đối tượng khác biệt như đốm v.v… mà từ ngữ mang ý nghĩa không khác biệt xuất hiện,
616
Saddā sā jātiresā ca, mālāsuttamivanvitā’’ti.
That is jāti, and this (jāti) is connected like a string of flowers."
Thì đó là jāti, jāti này liên kết như sợi dây xâu chuỗi.”
617
Tasmā lakkhaṇatāmattena samānabhāvato visadisānipi tāniyeva cakkavattinipphattinimittabhūtāni lakkhaṇāni sadisāni viya katvā tāni buddhanipphattinimittabhūtāni lakkhaṇāni nāmāti idaṃ vacanaṃ vuccatīti attho.
Therefore, due to their similarity merely as characteristics, the meaning is that this statement — "those characteristics which are the signs of a Buddha's attainment" — is made as if those very characteristics, which are the signs of a Cakkavattī's attainment, though dissimilar, were similar.
Do đó, vì chúng giống nhau chỉ ở khía cạnh là tướng, nên mặc dù các tướng làm nhân duyên cho sự thành tựu của Chuyển Luân Vương là khác nhau, nhưng chúng được xem như là giống nhau, và lời nói này được nói rằng đó là các tướng làm nhân duyên cho sự thành tựu của chư Phật. Đó là ý nghĩa.
Adhiāpubbavasayoge bhummatthe upayogavacananti āha ‘‘agāre vasatī’’ti catūhi acchariyadhammehīti abhirūpatā, dīghāyukatā, appābādhatā, brāhmaṇagahapatikānaṃ piyamanāpatāti imehi catūhi acchariyasabhāvabhūtāhi iddhīhi.
He says "resides in a house" meaning the locative case with the preposition adhi- + ā- + vasa- indicating residence. By "four astonishing qualities" means by these four astonishing qualities: beauty, longevity, freedom from illness, and being dear and agreeable to Brahmins and householders.
Khi động từ vasa (ở) đi kèm với tiền tố adhiā, nó được dùng với ý nghĩa chỉ nơi chốn trong trường hợp định sở cách, nên nói “ở trong nhà”. Với “bốn pháp kỳ diệu” là: sắc đẹp, tuổi thọ dài, ít bệnh tật, và được các hàng Bà-la-môn, gia chủ yêu mến và hài lòng. Đó là bốn loại thần thông có bản chất kỳ diệu.
Yathāha –
As it is said:
Như đã nói:
618
‘‘Rājā ānanda, mahāsudassano catūhi iddhīhi samannāgato ahosi.
"King Mahāsudassana, Ananda, was endowed with four psychic powers.
“Này Ānanda, Đại Chuyển Luân Vương Mahāsudassana có đầy đủ bốn thần thông.
Katamāhi catūhi iddhīhi?
With which four psychic powers?
Bốn thần thông nào?
Idhānanda, rājā mahāsudassano abhirūpo ahosi dassanīyo pāsādiko’’tiādi (dī. ni. 2.252).
Here, Ananda, King Mahāsudassana was handsome, comely, and delightful," and so on.
Này Ānanda, ở đây, Đại Chuyển Luân Vương Mahāsudassana có sắc đẹp, đáng chiêm ngưỡng, và khả ái” v.v… (Dī. Nī. 2.252).
619
Cetiyajātake (jā. aṭṭha. 3.8.44) āgatanayaṃ gahetvāpi evaṃ vadanti ‘‘sarīrato candanagandho vāyati, ayaṃ ekā iddhi.
Taking the method found in the Cetiyajātaka, some also say thus: "The scent of sandalwood emanates from the body; this is one psychic power.
Lấy theo cách thức được đề cập trong Cetiyajātaka (Jā. Aṭṭha. 3.8.44), họ cũng nói như vậy: “Từ thân tỏa ra mùi hương chiên đàn, đây là một thần thông.
Mukhato uppalagandho vāyati, ayaṃ dutiyā.
The scent of a blue water lily emanates from the mouth; this is the second.
Từ miệng tỏa ra mùi hương hoa sen xanh (uppala), đây là thần thông thứ hai.
Cattāro devaputtā catūsu disāsu sabbakālaṃ khaggahatthā ārakkhaṃ gaṇhanti, ayaṃ tatiyā.
Four devaputtas, sword in hand, always maintain guard in the four directions; this is the third.
Bốn thiên tử luôn cầm gươm bảo vệ ở bốn phương, đây là thần thông thứ ba.
Ākāsena vicarati, ayaṃ catutthī’’ti.
He travels through the sky; this is the fourth."
Đi lại trên không trung, đây là thần thông thứ tư.”
Anāgatavaṃsasaṃvaṇṇanāyaṃ pana ‘‘abhirūpabhāvo ekā iddhi, samavepākiniyā gahaṇiyā samannāgatabhāvo dutiyā, yāvatāyukampi sakalalokassa dassanātittikabhāvo tatiyā, ākāsacāribhāvo catutthī’’ti vuttaṃ.
However, in the Anāgatavaṃsa Commentary, it is stated: "The state of being beautiful is one psychic power; being endowed with a well-digesting stomach is the second; the state of being inexhaustible to the sight of all the world for as long as one lives is the third; the ability to travel through the air is the fourth."
Tuy nhiên, trong Anāgatavaṃsasaṃvaṇṇanā, đã nói rằng: “Sắc đẹp là một thần thông, có đầy đủ hệ tiêu hóa hoạt động đều đặn là thứ hai, được toàn thể thế gian không bao giờ chán ngán khi chiêm ngưỡng suốt đời là thứ ba, khả năng đi lại trên không trung là thứ tư.”
Tattha samavepākiniyā gahaṇiyā samannāgatabhāvoti samavipācaniyā kammajatejodhātuyā sampannatā.
There, "being endowed with a well-digesting stomach" means being endowed with the tejodhātu, the fire element produced by kamma, which digests evenly.
Ở đó, “có đầy đủ hệ tiêu hóa hoạt động đều đặn” có nghĩa là có đầy đủ yếu tố lửa (tejodhātu) do nghiệp sinh ra, có khả năng tiêu hóa đều đặn.
Yassa hi bhuttamattova āhāro jīrati, yassa vā pana puṭabhattaṃ viya tatheva tiṭṭhati, ubhopete na samavepākiniyā samannāgatā.
Indeed, one whose food is digested immediately upon eating, or one whose food remains as it was, like wrapped rice, neither of these is endowed with a well-digesting stomach.
Quả thật, thức ăn của người nào tiêu hóa ngay sau khi ăn, hoặc thức ăn của người nào vẫn còn nguyên như gói cơm, cả hai người này đều không có hệ tiêu hóa hoạt động đều đặn.
Yassa pana puna bhattakāle bhattacchando uppajjateva, ayaṃ samavepākiniyā samannāgato nāma, tathārūpatāti attho.
But one for whom the desire for food arises again at mealtime is said to be endowed with a well-digesting stomach; such is the meaning.
Tuy nhiên, người nào khi đến bữa ăn lại có ý muốn ăn, người đó được gọi là có hệ tiêu hóa hoạt động đều đặn, tức là có bản chất như vậy.
Saṅgahavatthūhīti dānaṃ, piyavacanaṃ, atthacariyā, samānattatāti imehi saṅgahopāyehi.
By "saṅgahavatthus" means by these means of integration: dāna, pleasant speech, beneficial conduct, and impartiality.
Với “các pháp nhiếp” là: bố thí (dāna), lời nói hòa ái (piyavacana), lợi hành (atthacariyā), và đồng lợi (samānattatā).
Yathāha –
As it is said:
Như đã nói:
620
‘‘Dānañca peyyavajjañca, atthacariyā ca yā idha;
"Giving, and pleasant speech, and beneficial conduct here;
“Bố thí và lời nói hòa ái, và lợi hành ở đời này;
621
Samānattatā ca dhammesu, tattha tattha yathārahaṃ;
And impartiality in various matters, as is appropriate;
Và đồng lợi trong các pháp, ở mỗi nơi tùy theo sự thích hợp;
622
Ete kho saṅgahā loke, rathassāṇīva yāyato.
These indeed are the bonds in the world, like the linchpin of a moving chariot.
Đây chính là các pháp nhiếp trong đời, như chốt trục bánh xe của cỗ xe đang lăn.
623
Ete ca saṅgahā nāssu, na mātā puttakāraṇā;
If these bonds were not, then a mother for the sake of a son,
Nếu không có các pháp nhiếp này, thì mẹ sẽ không vì con;
624
Labhetha mānaṃ pūjaṃ vā, pitā vā puttakāraṇā.
Would not receive honor or respect, nor a father for the sake of a son.
Mà nhận được sự tôn trọng hay cúng dường, và cha cũng không vì con.
625
Yasmā ca saṅgahā ete, samapekkhanti paṇḍitā;
Because wise people look to these bonds,
Vì các bậc hiền trí mong đợi các pháp nhiếp này;
626
Tasmā mahattaṃ papponti, pāsaṃsā ca bhavanti te’’ti.(dī. ni. 3.273);
Therefore they attain greatness, and they become praiseworthy."
Do đó, họ đạt được sự vĩ đại, và họ trở thành người đáng ca ngợi.” (Dī. Nī. 3.273);
627
Rañjanatoti pītisomanassavasena rañjanato, na rāgavasena, pītisomanassānaṃ jananatoti vuttaṃ hoti.
By "rañjanato" means by delighting through joy and gladness, not through passion; it means generating joy and gladness.
“Do làm vui lòng” có nghĩa là do làm phát sinh sự hoan hỷ và hân hoan, không phải do ái dục; ý muốn nói là do làm phát sinh sự hoan hỷ và hân hoan.
Catūhi saṅgahavatthūhi rañjanaṭṭhena rājāti pana sabbesaṃ rājūnaṃ samaññā tathā akarontānampi vilīvabījanādīsu tālavaṇṭavohāro viya ruḷhivasena pavattito, tasmā ‘‘acchariyadhammehī’’ti asādhāraṇanibbacanaṃ vuttanti daṭṭhabbaṃ.
However, the appellation "Rājā" (king) for all kings, by the meaning of delighting through the four saṅgahavatthus, has come into usage through common parlance, like the term "tālavaṇṭa" for a fan made of split bamboo and so forth, even for those who do not act in that way. Therefore, it should be understood that the extraordinary derivation is stated by "acchariyadhammehī".
Tuy nhiên, danh xưng “rājā” (vua) do làm vui lòng bằng bốn pháp nhiếp là danh xưng chung cho tất cả các vị vua, ngay cả những người không làm như vậy cũng được gọi như vậy theo cách dùng thông thường, giống như việc gọi quạt làm từ nan tre v.v… là quạt lá cọ. Do đó, cần hiểu rằng cách giải thích không phổ biến “bằng các pháp kỳ diệu” đã được nói.
628
Saddasāmatthiyato anekadhā cakkavattīsaddassa vacanatthaṃ dassento padhānabhūtaṃ vacanatthaṃ paṭhamaṃ dassetuṃ ‘‘cakkaratana’’ntiādimāha.
Showing the meaning of the word cakkavattī in various ways according to the power of the word, he first states the primary meaning of the word by saying "cakkaratanaṃ" (wheel-gem) and so on.
Để trình bày nhiều ý nghĩa của từ Chuyển Luân Vương (Cakkavattī) theo sức mạnh của từ ngữ, trước tiên, bậc chú giải sư nói “luân bảo” v.v… để trình bày ý nghĩa chính.
Idameva hi padhānaṃ cakkaratanassa pavattanamantarena cakkavattibhāvānāpattito.
For this indeed is primary, as one cannot attain the state of a cakkavattī without the turning of the wheel-gem.
Quả thật, đây là ý nghĩa chính, vì nếu không có sự vận hành của luân bảo thì không thể trở thành Chuyển Luân Vương.
Tathā hi aṭṭhakathāsu vuttaṃ ‘‘kittāvatā cakkavattī hotīti?
Thus, it is said in the commentaries: "By how much does one become a cakkavattī?
Như đã nói trong các bản Chú giải: “Chuyển Luân Vương trở thành như thế nào?”
Ekaṅguladvaṅgulamattampi cakkaratane ākāsaṃ abbhuggantvā pavatte’’ti (dī. ni. aṭṭha. 2.243; ma. ni. aṭṭha. 3.256).
When the wheel-gem ascends into the sky even for an inch or two and turns."
“Khi luân bảo bay lên không trung dù chỉ một hoặc hai ngón tay và vận hành,” (Dī. Nī. Aṭṭha. 2.243; Ma. Nī. Aṭṭha. 3.256).
Yasmā pana rājā cakkavattī ekaṃsaṃ uttarāsaṅgaṃ karitvā vāmahatthena hatthisoṇḍasadisapanāḷiṃ suvaṇṇabhiṅkāraṃ ukkhipitvā dakkhiṇahatthena cakkaratanaṃ udakena abbhukkiritvā ‘‘pavattatu bhavaṃ cakkaratanaṃ, abhivijinātu bhavaṃ cakkaratana’’nti (dī. ni. 2.244) vacanena cakkaratanaṃ vehāsaṃ abbhuggantvā pavattesi, tasmā tādisaṃ pavattāpanaṃ sandhāya ‘‘cakkaratanaṃ vattetī’’ti vuttaṃ.
Because the cakkavattī king, having adjusted his upper robe over one shoulder, lifted a golden ewer resembling an elephant's trunk with his left hand, sprinkled water on the wheel-gem with his right hand, and with the words, "May the venerable wheel-gem turn, may the venerable wheel-gem conquer," caused the wheel-gem to ascend into the air and turn, therefore, referring to such a turning, it is said, "turns the wheel-gem."
Vì vị Chuyển Luân Vương đã vận hành luân bảo bằng cách khoác y một bên vai, cầm bình vàng có vòi giống vòi voi bằng tay trái, tưới nước lên luân bảo bằng tay phải và nói: “Xin luân bảo hãy vận hành, xin luân bảo hãy chinh phục!” (Dī. Nī. 2.244), khiến luân bảo bay lên không trung và vận hành, nên câu “vận hành luân bảo” đã được nói với ý nghĩa chỉ sự vận hành như vậy.
Yathāha ‘‘atha kho ānanda rājā mahāsudassano uṭṭhāyāsanā…pe… cakkaratanaṃ abbhukkiri ‘pavattatu bhavaṃ cakkaratana’nti’’ādi (dī. ni. 2.244).
As it is said: "Then, Ananda, King Mahāsudassana rose from his seat…and so on… sprinkled the wheel-gem (saying) ‘May the venerable wheel-gem turn’" and so on.
Như đã nói: “Này Ānanda, rồi Đại Chuyển Luân Vương Mahāsudassana đứng dậy khỏi chỗ ngồi… v.v… tưới nước lên luân bảo và nói ‘Xin luân bảo hãy vận hành’” v.v… (Dī. Nī. 2.244).
Na kevalañca cakkasaddo cakkarataneyeva vattati atha kho sampatticakkādīsupi, tasmā taṃtadatthavācakasaddasāmatthiyatopi vacanatthaṃ dasseti ‘‘sampatticakkehī’’tiādinā.
And not only does the word cakka refer to the wheel-gem, but it also refers to the wheels of attainment (sampatticakka) and so forth. Therefore, he also shows the meaning of the word based on the power of the word signifying those respective meanings by "sampatticakkehī" and so on.
Không chỉ từ cakka (bánh xe) được dùng cho luân bảo, mà còn cho các bánh xe thành tựu (sampatticakka) v.v… Do đó, bậc chú giải sư cũng trình bày ý nghĩa của từ theo sức mạnh của từ ngữ chỉ từng ý nghĩa đó, với câu “bằng các bánh xe thành tựu” v.v…
Tattha sampatticakkehīti –
There, "by the wheels of attainment" means:
Ở đó, “bằng các bánh xe thành tựu” là –
629
‘‘Patirūpe vase dese, ariyamittakaro siyā;
"One should reside in a suitable country, and acquire noble friends;
“Nơi xứ sở thích hợp, kết bạn với bậc hiền trí;
630
Sammāpaṇidhisampanno, pubbe puññakato naro;
A person endowed with right aspiration, having performed merit in the past;
Người đã tạo phước báu từ trước, có sự phát nguyện chân chính;
631
Dhaññaṃ dhanaṃ yaso kitti, sukhañcetaṃdhivattatī’’ti.(a. ni. 4.31) –
Grain, wealth, fame, glory, and happiness, these attend upon him."—
Phát triển tài sản, danh tiếng, vinh quang, và hạnh phúc.” (A. Nī. 4.31) –
632
Vuttehi patirūpadesavāsādisampatticakkehi.
by the wheels of attainment such as residing in a suitable country, as stated.
Bằng bốn bánh xe thành tựu được nói đến, như sống ở xứ sở thích hợp v.v…
Vattatīti pavattati sampajjati, uparūpari kusaladhammaṃ vā paṭipajjati.
"Vattatī" means it proceeds, it is accomplished, or it practices wholesome Dhamma increasingly.
“Vattatī” có nghĩa là vận hành, thành tựu, hoặc tu tập các pháp thiện cao hơn.
Tehīti sampatticakkehi.
"Tehī" means by the wheels of attainment.
“Tehī” có nghĩa là bằng các bánh xe thành tựu.
Paranti sattanikāyaṃ, yathā sayaṃsaddo suddhakattutthassa jotako, tathā paraṃsaddopi hetukattutthassāti veditabbaṃ.
"Paraṃ" means the multitude of beings; just as the word sayaṃ denotes the agent, so too the word paraṃ should be understood as denoting the causal agent.
“Paraṃ” có nghĩa là chúng sinh. Cần biết rằng cũng như từ sayaṃ (tự mình) chỉ chủ ngữ thuần túy, thì từ paraṃ (người khác) cũng chỉ chủ ngữ nguyên nhân.
Vattetīti pavatteti sampādeti, uparūpari kusaladhammaṃ vā paṭipajjāpeti.
"Vattetī" means he causes to proceed, he causes to be accomplished, or he causes to practice wholesome Dhamma increasingly.
“Vattetī” có nghĩa là khiến vận hành, khiến thành tựu, hoặc khiến tu tập các pháp thiện cao hơn.
Yathāha –
As it is said:
Như đã nói:
633
‘‘Rājā mahāsudassano evamāha ‘pāṇo na hantabbo, adinnaṃ na ādātabbaṃ, kāmesu micchā na caritabbā, musā na bhaṇitabbā, majjaṃ na pātabbaṃ, yathābhuttañca bhuñjathā’ti.
"King Mahāsudassana spoke thus: 'No living being is to be killed, what is not given is not to be taken, wrong conduct in sensual pleasures is not to be practiced, falsehood is not to be spoken, intoxicating drinks are not to be consumed, and you are to consume only what is regularly eaten.' "
“Đại Chuyển Luân Vương Mahāsudassana đã nói như vầy: ‘Không được sát sinh, không được lấy của không cho, không được tà dâm, không được nói dối, không được uống rượu, và các ngươi hãy hưởng thuế má như đã quy định.’
Ye kho panānanda puratthimāya disāya paṭirājāno, te rañño mahāsudassanassa anuyantā ahesu’’ntiādi (dī. ni. 2.244).
"And, Ananda, those rival kings in the eastern direction became followers of King Mahāsudassana," and so on.
Này Ānanda, những vị tiểu vương ở phương đông đã trở thành tùy tùng của Đại Chuyển Luân Vương Mahāsudassana” v.v… (Dī. Nī. 2.244).
634
Iriyāpathacakkānanti iriyāpathabhūtānaṃ cakkānaṃ.
"Iriyāpathacakkānaṃ" means of the wheels that are postures.
“Iriyāpathacakkānaṃ” có nghĩa là của các bánh xe là oai nghi.
Iriyāpathopi hi ‘‘cakka’’nti vuccati ‘‘catucakkaṃ navadvāra’’ntiādīsu (saṃ. ni. 1.29, 109).
Indeed, even posture is called a "cakka" in passages such as "four wheels, nine doors" and so on.
Oai nghi cũng được gọi là “cakka” (bánh xe) trong các câu như “bốn bánh xe, chín cửa” v.v… (Saṃ. Nī. 1.29, 109).
Yathāha –
As it is said:
Như đã nói:
635
‘‘Rathaṅge lakkhaṇe dhammo-racakkesviriyāpathe;
"In a chariot-limb, in a characteristic, in Dhamma, in a wheel, in a posture..."
“Trong bánh xe của cỗ xe, trong tướng, trong pháp, trong các bánh xe, trong oai nghi;
636
Cakkaṃ sampattiyaṃ cakka-ratane maṇḍale bale;
‘The word cakka is used for attainment, the wheel-gem, a circle, strength;
“Cakka (bánh xe) có nghĩa là sự thành tựu, bánh xe báu, vòng tròn, sức mạnh;
637
Kulālabhaṇḍe āṇāya-māyudhe dānarāsisū’’ti.
a potter’s wheel, authority, a weapon, and heaps of gifts.’
Đồ gốm, mệnh lệnh, vũ khí, các đống bố thí.”
638
Vattoti pavattanaṃ uppajjanaṃ, imināva iriyāpathacakkaṃ vatteti parahitāya uppādetīti nibbacanampi dasseti atthato samānattā.
Movement means causing to proceed, arising; by this very*, it also shows the etymology that it causes the wheel of postures to proceed, to arise for the welfare of others, because the meaning is the same.
Vatto có nghĩa là sự vận hành, sự phát sinh. Với từ này, nó cũng chỉ ra ý nghĩa rằng “vận hành bánh xe oai nghi (iriyāpathacakkaṃ) vì lợi ích của người khác” bởi vì chúng có cùng ý nghĩa.
Tathā cāha –
And thus it is said:
Như đã nói:
639
‘‘Atha kho taṃ ānanda cakkaratanaṃ puratthimaṃ disaṃ pavatti, anvadeva rājā mahāsudassano saddhiṃ caturaṅginiyā senāya.
‘‘Then, Ānanda, that wheel-gem rolled towards the eastern direction, and King Mahāsudassana followed it with his fourfold army.
“Này Ānanda, bánh xe báu ấy đã lăn về phía đông, và Đại vương Mahāsudassana cùng với quân đội bốn binh chủng cũng đi theo sau. Này Ānanda, ở nơi nào bánh xe báu dừng lại, ở đó Đại vương Mahāsudassana cùng với quân đội bốn binh chủng đã an trú” v.v.
Yasmiṃ kho panānanda, padese cakkaratanaṃ patiṭṭhāsi, tattha rājā mahāsudassano vāsaṃ upagacchi saddhiṃ caturaṅginiyā senāyā’’tiādi (dī. ni. 2.244).
And, Ānanda, in whatever region the wheel-gem stood still, there King Mahāsudassana settled down with his fourfold army.’’
Đây là một phương pháp khác từ chú giải: “Người vận hành bánh xe quyền lực không bị cản trở được gọi là Cakkavattī (Chuyển Luân Vương).” Như đã nói:
640
Ayaṃ aṭṭhakathāto aparo nayo – appaṭihataṃ āṇāsaṅkhātaṃ cakkaṃ vattetīti cakkavattī. Tathā hi vuttaṃ –
This is another method from the Aṭṭhakathā: one who causes the wheel, which is called authority, to proceed unimpeded, is a Cakkavatti. Thus it is said:
“Này các Tỳ-khưu, vị vua Cakkavattī (Chuyển Luân Vương) nào có đầy đủ năm pháp, vị ấy vận hành bánh xe quyền lực một cách đúng Pháp, bánh xe ấy không thể bị bất kỳ kẻ thù nào là con người hay chúng sinh nào khác cản trở.
641
‘‘Pañcahi bhikkhave dhammehi samannāgato rājā cakkavattī dhammeneva cakkaṃ vatteti, taṃ hoti cakkaṃ appaṭivattiyaṃ kenaci manussabhūtena paccatthikena pāṇinā.
‘‘Monks, a Cakkavatti king endowed with five qualities causes the wheel to proceed righteously, and that wheel is not to be turned back by any human enemy being.
Năm pháp nào?
Katamehi pañcahi?
With which five?
Này các Tỳ-khưu, ở đây, vị vua Cakkavattī (Chuyển Luân Vương) biết lợi ích, biết Pháp, biết chừng mực, biết thời gian và biết hội chúng.
Idha bhikkhave rājā cakkavattī atthaññū ca hoti, dhammaññū ca mattaññū, ca kālaññū ca parisaññū ca.
Here, monks, a Cakkavatti king is one who knows what is beneficial, knows the Dhamma, knows moderation, knows the proper time, and knows the assembly.
Này các Tỳ-khưu, với năm pháp này… (câu trên được lặp lại)… chúng sinh nào khác” v.v.
Imehi kho…pe… pāṇinā’’tiādi (a. ni. 5.131).
Indeed, with these… that cannot be turned back by any human enemy being.’’
“Người vận hành và làm cho vòng tròn các vương quốc (khattiyamaṇḍalādisaññitaṃ cakkaṃ samūhaṃ) theo ý mình được gọi là Cakkavattī.” Như đã nói: “Này Ānanda, tất cả các vị vua chư hầu ở phía đông đều đi theo Đại vương Mahāsudassana” v.v.
642
Khattiyamaṇḍalādisaññitaṃ cakkaṃ samūhaṃ attano vase vatteti anuvattetītipi cakkavattī. Vuttañhi ‘‘ye kho panānanda puratthimāya disāya paṭirājāno, te rañño mahāsudassanassa anuyantā ahesu’’ntiādi (dī. ni. 2.244).
One who causes the circle, called the assembly of khattiyas and so forth, to proceed under his control is also a Cakkavatti. For it is said, ‘‘Indeed, Ānanda, the hostile kings in the eastern direction became followers of King Mahāsudassana,’’ and so on.
“Người có dấu hiệu bánh xe (cakkalakkhaṇaṃ) trên thân được gọi là Cakkavattī.” Do đó đã nói: “Thưa Đại vương, dưới lòng bàn chân của vị hoàng tử này có các dấu hiệu bánh xe, với một ngàn căm, có vành, có trục, hoàn hảo về mọi mặt” v.v.
Cakkalakkhaṇaṃ vattati etassātipi cakkavattī. Tenāha ‘‘imassa deva kumārassa heṭṭhā pādatalesu cakkāni jātāni sahassārāni sanemikāni sanābhikāni sabbākāraparipūrānī’’tiādi (dī. ni. 2.35).
One who has the mark of a wheel proceeding on him is also a Cakkavatti. Therefore, it is said, ‘‘O king, at the soles of this prince’s feet, wheels have appeared, with a thousand spokes, with felloes, with naves, perfect in all aspects,’’ and so on.
“Người có sức mạnh thân thể vĩ đại (mahantaṃ kāyabalaṃ) như một bánh xe được gọi là Cakkavattī.” Điều này đã được nói: “Thưa Đại vương, vị hoàng tử này có bảy chỗ đầy đặn… (câu trên được lặp lại)… vị hoàng tử này có thân hình nửa trên như sư tử” v.v.
Cakkaṃ mahantaṃ kāyabalaṃ vattati etassātipi cakkavattī. Vuttañhetaṃ ‘‘ayañhi deva kumāro sattussado…pe… ayañhi deva kumāro sīhapubbaddhakāyo’’tiādi (dī. ni. 2.35).
One who has great bodily strength, like a wheel, proceeding on him is also a Cakkavatti. For it is said, ‘‘Indeed, O king, this prince has seven prominent features… indeed, O king, this prince has the forepart of a lion’s body,’’ and so on.
Với dấu hiệu đó, sự cường tráng của vị ấy được hiểu rõ.
Tena hissa lakkhaṇena mahabbalabhāvo viññāyati.
By that characteristic of his, his great strength is understood.
“Người thực hành mười loại hoặc mười hai loại Pháp vận hành (vattadhammaṃ) như một bánh xe được gọi là Cakkavattī.” Do đó đã nói: “Này con, bánh xe báu thiêng liêng ấy không phải là tài sản thừa kế của cha con. Này con, hãy thực hành các giới luật của Chuyển Luân Vương cao quý” v.v.
Cakkaṃ dasavidhaṃ, dvādasavidhaṃ vā vattadhammaṃ vattati paṭipajjatīti cakkavattī. Tena vuttaṃ ‘‘na hi te tāta dibbaṃ cakkaratanaṃ pettikaṃ dāyajjaṃ, iṅgha tvaṃ tāta ariye cakkavattivatte vattāhī’’tiādi (dī. ni. 3.83).
One who causes the wheel, which is the ten-fold or twelve-fold practice of duty, to proceed, to undertake it, is a Cakkavatti. Therefore, it is said, ‘‘Indeed, my dear, the divine wheel-gem is not your paternal inheritance; come, my dear, practise the noble Cakkavatti duties,’’ and so on.
“Người vận hành và phát khởi sự bố thí lớn lao như một bánh xe được gọi là Cakkavattī.” Và đã nói:
Cakkaṃ mahantaṃ dānaṃ vatteti pavattetītipi cakkavattī. Vuttañca –
The king who causes a great wheel of generosity to turn is also called a Cakkavattī. And it is said:
“Này Ānanda, Đại vương Mahāsudassana đã thiết lập một sự bố thí như sau bên bờ các hồ nước ấy: thức ăn cho người cần thức ăn, đồ uống cho người cần đồ uống, y phục cho người cần y phục, xe cộ cho người cần xe cộ, giường nằm cho người cần giường nằm, phụ nữ cho người cần phụ nữ, vàng bạc cho người cần vàng bạc, vàng ròng cho người cần vàng ròng” v.v.
643
‘‘Paṭṭhapesi kho ānanda rājā mahāsudassano tāsaṃ pokkharaṇīnaṃ tīre evarūpaṃ dānaṃ annaṃ annatthikassa, pānaṃ pānatthikassa, vatthaṃ vatthatthikassa, yānaṃ yānatthikassa, sayanaṃ sayanatthikassa, itthiṃ itthitthikassa, hiraññaṃ hiraññatthikassa, suvaṇṇaṃ suvaṇṇatthikassā’’tiādi (dī. ni. 2.254).
“King Mahāsudassana, Ānanda, established such a donation on the banks of those ponds: food for those who desired food, drink for those who desired drink, clothing for those who desired clothing, conveyances for those who desired conveyances, bedding for those who desired bedding, women for those who desired women, silver for those who desired silver, gold for those who desired gold,” and so on.
Rājā (vua) là một thuật ngữ chung, vì nó được chia sẻ với những người khác.
644
Rājāti sāmaññaṃ tadaññasādhāraṇato.
The term Rājā is general, because it is common to other kings.
Cakkavattī (Chuyển Luân Vương) là một thuật ngữ đặc biệt, vì nó không được chia sẻ với những người khác.
Cakkavattīti visesaṃ anaññasādhāraṇato.
The term Cakkavattī is specific, because it is not common to others.
Từ Dhamma có nghĩa là sự công bằng, và sự công bằng chính là sự bình đẳng, do đó đã nói “ñāyena samenā” (bằng sự công bằng, bằng sự bình đẳng).
Dhammasaddo ñāye, samo eva ca ñāyo nāmāti āha ‘‘ñāyena samenā’’ti.
The word Dhamma refers to justice, and justice is indeed fairness, so it says “by justice, by fairness.”
Vatta có nghĩa là phát sinh, hoặc thực hành.
Vattati uppajjati, paṭipajjatīti vā attho.
Vattati means arises, or alternatively, practices.
Mặc dù không nói “điều này đang diễn ra”, nhưng để làm nổi bật tính tổng quát, nó được đặt trong một trường hợp đặc biệt, và vì người muốn có ý nghĩa đặc biệt nên sử dụng ý nghĩa đặc biệt, nên nó được kết hợp với “sadatthaparatthe” (vì lợi ích của mình và người khác).
‘‘Idaṃ nāma caratī’’ti avuttepi sāmaññajotanāya visese avaṭṭhānato, visesatthinā ca visesassa payujjitabbattā ‘‘sadatthaparatthe’’ti yojīyati.
Even without saying “this particular thing operates,” because it is established in the specific to make the general manifest, and because the specific must be used by one who desires the specific, it is construed as “for one’s own benefit and the benefit of others.”
Nếu không có sự nắm bắt một phần, sự không có phần của điều cần nắm bắt sẽ được hiểu, như trong câu “người đã thọ giới không bố thí”.
Padesaggahaṇe hi asati gahetabbassa nippadesatā viññāyati yathā ‘‘dikkhito na dadātī’’ti.
For if there were no grasping of a part, the partless nature of what is to be grasped would be understood, just as in “one who is consecrated does not give.”
Vì vị vua Cakkavattī (Chuyển Luân Vương) đạt được vương quốc bằng Pháp, chứ không phải bằng phi Pháp như làm hại người khác.
Yasmā cakkavattirājā dhammeneva rajjamadhigacchati, na adhammena parūpaghātādinā.
Because a Cakkavattī king obtains kingship by Dhamma alone, not by unrighteousness such as harming others.
Do đó đã nói “dhammena rajjaṃ labhitvā” (đã đạt được vương quốc bằng Pháp) v.v., và dhammena (bằng Pháp) có nghĩa là bằng sự công bằng, hoặc bằng các thiện pháp.
Tasmā vuttaṃ ‘‘dhammena rajjaṃ labhitvā’’tiādi, dhammenāti ca ñāyena, kusaladhammena vā.
Therefore, it is said “having obtained kingship by Dhamma,” and so on. Dhammena means by justice, or by wholesome Dhamma.
Trạng thái của vua là rajjaṃ (vương quốc), tức là quyền lực tối cao.
Rañño bhāvo rajjaṃ, issariyaṃ.
The state of a king is rajjaṃ, sovereignty.
“Người thực hành hoặc thực hiện Pháp là phương tiện mang lại lợi ích cho người khác được gọi là dhammiko (người có Pháp). Vị vua là người thực hiện hoặc thực hành Pháp là phương tiện mang lại lợi ích cho chính mình được gọi là dhammarājā (vua Pháp).” Ý nghĩa đặc biệt này được giải thích bằng “parahitadhammakaraṇena vā” (hoặc bằng việc thực hành Pháp vì lợi ích của người khác) v.v.
645
Paresaṃ hitopāyabhūtaṃ dhammaṃ karoti, caratīti vā dhammiko. Attano hitopāyabhūtassa dhammassa kārako, carako vā rājāti dhammarājāti imaṃ savisesaṃ atthaṃ dasseti ‘‘parahitadhammakaraṇena vā’’tiādinā.
He performs or practices Dhamma which is a means for the welfare of others, so he is dhammiko. Or, the king who is the doer or practitioner of Dhamma which is a means for his own welfare is dhammarājā. The teacher shows this specific meaning with “or by performing Dhamma for the welfare of others,” and so on.
Tuy nhiên, đây là phương pháp của chú giải Mahāpadāna: “Người được giao phó mười thiện pháp, hoặc các pháp vương không có bốn loại thiên vị (agati), được gọi là dhammiko; và vị vua làm cho thế giới vui lòng bằng chính Pháp đó được gọi là dhammarājā. Thật vậy, hai từ này chỉ là những từ đồng nghĩa.”
Ayaṃ pana mahāpadānaṭṭhakathānayo – dasavidhe kusaladhamme, agatirahite vā rājadhamme niyuttoti dhammiko; teneva dhammena lokaṃ rañjetīti dhammarājā. Pariyāyavacanameva hi idaṃ padadvayanti.
This, however, is the method of the Mahāpadāna Aṭṭhakathā: He is engaged in the ten kinds of wholesome Dhamma, or in the royal Dhamma free from the four agati, so he is dhammiko; and by that very Dhamma, he delights the world, so he is dhammarājā. Indeed, these two terms are merely synonyms.
Tuy nhiên, Ācariya đã nói như sau: “Người thực hành Pháp được gọi là các giới luật của Chuyển Luân Vương, hoặc Pháp được gọi là các giới luật của Chuyển Luân Vương thuộc về vị ấy, hoặc có trong vị ấy, được gọi là dhammiko; và vì không xa rời Pháp, nên Pháp đó là vua theo nghĩa làm cho vui lòng, do đó được gọi là dhammarājā” (Dī. Nī. Ṭī. 1.258).
Ācariyena pana evaṃ vuttaṃ ‘‘cakkavattivattasaṅkhātaṃ dhammaṃ carati, cakkavattivattasaṅkhāto vā dhammo etassa, etasmiṃ vā atthīti dhammiko, dhammato anapetattā dhammo ca so rañjanaṭṭhena rājā cāti dhammarājā’’ti (dī. ni. ṭī. 1.258).
But the teacher has said thus: “He practices the Dhamma known as the practice of a Cakkavattī, or the Dhamma known as the practice of a Cakkavattī belongs to him or is in him, so he is dhammiko; and because he is not separated from Dhamma, he is Dhamma, and he is Rājā by the meaning of delighting, so he is dhammarājā.”
Từ câu “Rājā hoti cakkavattī” (Vua là Chuyển Luân Vương), từ “cāturanto” (bốn bờ cõi) này làm rõ sự cai trị bốn châu lục, do đó đã nói “cāturantāyā” (đối với bốn bờ cõi) v.v.
‘‘Rājā hoti cakkavattī’’ti vacanato ‘‘cāturanto’’ti idaṃ catudīpissarataṃ vibhāvetīti āha ‘‘cāturantāyā’’tiādi.
Since it is said “the king is a Cakkavattī,” the word cāturanto clarifies that he is sovereign over the four continents, so it says “cāturantāyā” and so on.
Trái đất có bốn đại dương là ranh giới cuối cùng, được gọi là cāturantā.
Cattāro samuddā antā pariyosānā etissāti cāturantā, pathavī.
That which has the four oceans as its ends or boundaries is cāturantā, the earth.
Thật vậy, nó được gọi như vậy vì nó có bốn đại dương ở bốn phương, bắt đầu từ đại dương phía đông, là ranh giới cuối cùng.
Sā hi catūsu disāsu puratthimasamuddādicatusamuddapariyosānattā evaṃ vuccati.
Indeed, it is called thus because it has the four oceans, starting with the eastern ocean, as its boundaries in the four directions.
Do đó đã nói “catusamudda antāyā” (đối với trái đất có bốn đại dương là ranh giới), và nó được trang hoàng bởi bốn loại châu lục cấu thành, là một phần của một thế giới, do đó đã nói “catubbidhadīpavibhūsitāya pathaviyā” (bởi trái đất được trang hoàng bởi bốn loại châu lục).
Tena vuttaṃ ‘‘catusamudda antāyā’’ti, sā pana avayavabhūtehi catubbidhehi dīpehi vibhūsitā ekalokadhātupariyāpannā pathavīyevāti dasseti ‘‘catubbidhadīpavibhūsitāya pathaviyā’’ti iminā.
Therefore, it is said “catusamudda antāyā” (having the four oceans as its ends). And it shows that this earth, adorned with the four kinds of continents which are its parts, is indeed the earth included within one world-system, by this phrase “catubbidhadīpavibhūsitāya pathaviyā” (by the earth adorned with the four kinds of continents).
Như đã nói:
Yathāha –
As it is said:
“Chừng nào mặt trăng và mặt trời còn đi khắp các phương, chiếu sáng và rực rỡ;
646
‘‘Yāvatā candimasūriyā, pariharanti disā bhanti virocanā;
“As far as the moon and sun revolve, illuminating and shining in the directions;
Tất cả chúng sinh trên trái đất đều là nô lệ của Mandhātu.”
647
Sabbeva dāsā mandhātu, ye ca pāṇā pathavissitā’’ti.
All beings that dwell on earth are servants of Mandhātu.”
Ở đây, thay vì nói “catudīpavibhūsitāyā” (được trang hoàng bởi bốn châu lục), việc sử dụng từ “vidha” trong catubbidhadīpavibhūsitāyā (được trang hoàng bởi bốn loại châu lục) là để bao gồm cả năm trăm hòn đảo nhỏ riêng lẻ trong bốn châu lục lớn, vì ý nghĩa bổ sung được hiểu từ từ ngữ bổ sung, hoặc vì từ “vidha” chỉ phần đã bao gồm các phần tương tự.
648
Ettha ca ‘‘catudīpavibhūsitāyā’’ti avatvā catubbidhadīpavibhūsitāyāti vidhasaddaggahaṇaṃ paccekaṃ pañcasataparittadīpānampi mahādīpeyeva saṅgahaṇatthaṃ saddātirittena atthātirittassa viññāyamānattā, koṭṭhāsavācakena vā vidhasaddena samānabhāgānaṃ gahitattāti daṭṭhabbaṃ.
And here, instead of saying “catudīpavibhūsitāyā” (adorned with four continents), the inclusion of the word vidha in catubbidhadīpavibhūsitāyā (adorned with four kinds of continents) should be understood as for the purpose of including the five hundred smaller islands in each of the great continents, because an excess in meaning is understood from an excess in wording, or because equal parts are taken by the word vidha which denotes a part.
Trong kopādipaccatthike (kẻ thù như sự giận dữ, v.v.), từ ādi (v.v.) bao gồm các dục vọng, si mê, kiêu mạn, say đắm, v.v.
Kopādipaccatthiketi ettha ādisaddena kāmamohamānamadādike saṅgaṇhāti.
In kopādipaccatthike (enemies such as anger), the word ādi (etc.) includes desire, delusion, conceit, intoxication, and so on.
Vijetī (chiến thắng) là một động từ ở thì hiện tại theo thời điểm đó, có nghĩa là đã chiến thắng.
Vijetīti taṃkālāpekkhāya vattamānavacanaṃ, vijitavāti attho.
Vijetī (he conquers) is a present tense verb referring to that time; the meaning is “he conquered.”
Các nhà ngữ pháp mong muốn có tiền tố “tāvi” ở thì quá khứ.
Saddavidū hi atīte tāvīsaddamicchanti.
Indeed, grammarians desire the past participle in the past tense.
Khi nói “Sabbarājāno vijetī” (chiến thắng tất cả các vị vua), điều đó cho thấy rằng mặc dù một vị Chuyển Luân Vương không có chiến tranh, nhưng vì sự thành công của chiến thắng đạt được bằng chiến tranh, nên chỉ nói “vijitasaṅgāmo” (người đã chiến thắng trong trận chiến).
‘‘Sabbarājāno vijetī’’ti vadanto kāmaṃ cakkavattino kenaci yuddhaṃ nāma natthi, yuddhena pana sādhetabbassa vijayassa siddhiyā ‘‘vijitasaṅgāmo’’ tveva vuttoti dasseti.
By saying “he conquers all kings,” it shows that although a Cakkavattī certainly has no battle with anyone, yet because the victory to be achieved by battle is accomplished, it is said “he has conquered the battle.”
Trạng thái ổn định, vĩnh cửu là thāvariyaṃ (sự ổn định), như việc đạt được sự ổn định trong một quốc gia. Để chỉ điều đó, đã nói “na sakkā kenacī” (không ai có thể) v.v. Với điều này, nó chỉ ra một tappurisasamāsa (hợp chất sở hữu) rằng quốc gia đã đạt được sự ổn định bởi vì không ai có thể lay chuyển nó. Và với điều kia, nó chỉ ra một aññapadatthasamāsa (hợp chất chỉ một vật khác) rằng quốc gia đã đạt được sự ổn định trong vị vua này do lòng trung thành vững chắc.
649
Thāvarassa dhuvassa bhāvo thāvariyaṃ, yathā janapade thāvariyaṃ patto, taṃ dassetuṃ ‘‘na sakkā kenacī’’tiādi vuttaṃ, iminā kenaci akampiyaṭṭhena janapade thāvariyappattoti tappurisasamāsaṃ dasseti, itarena ca daḷhabhattibhāvato janapado thāvariyappatto etasminti aññapadatthasamāsaṃ.
The state of being permanent, of being stable, is thāvariyaṃ. To show how the country has attained stability, the phrase “na sakkā kenaci” (it is not possible by anyone) and so on, is stated. By this, it shows the tatpurisa compound, meaning that the country has attained stability due to being unshakeable by anyone; and by the other (interpretation), it shows the aññapadattha (bahuvrīhi) compound, meaning that the country has attained stability in this king due to firm devotion.
Tamhī (trong đó) có nghĩa là trong vị vua này.
Tamhīti asmiṃ rājini.
Tamhīti: in that king.
Tamhīti nghĩa là nơi vị vua ấy.
Yathā janapado tasmiṃ thāvariyaṃ patto, tadāvikaronto ‘‘anuyutto’’tiādimāha.
In the way that the kingdom had attained stability in that (king), intending to make that clear, the teacher said ‘anuyutto’ and so forth.
Bằng cách nào quốc độ đạt đến sự vững chắc nơi vị vua ấy, để làm rõ điều đó, ngài đã nói ‘‘anuyutto’’ (chuyên cần) v.v...
Tattha anuyuttoti niccapayutto.
Therein, anuyutto means constantly engaged.
Trong đó, anuyutto nghĩa là luôn luôn chuyên cần.
Sakammaniratoti cakkavattino rajjakamme sadā pavatto.
Sakammanirato means always devoted to the sovereign's royal duties.
Sakammanirato nghĩa là luôn luôn thực hành công việc cai trị của một vị Chuyển Luân Vương.
Acalo asampavedhīti pariyāyavacanametaṃ, corānaṃ vā vilopanamattena acalo, dāmarikattena asampavedhī. Corehi vā acalo, paṭirājūhi asampavedhī. Anatimudubhāvena vā acalo, anaticaṇḍabhāvena asampavedhī. Tathā hi aticaṇḍassa rañño balikhaṇḍādīhi lokaṃ pīḷayato manussā majjhimajanapadaṃ chaḍḍetvā pabbatasamuddatīrādīni nissāya paccante vāsaṃ kappenti, atimudukassa ca rañño corasāhasikajanavilopapīḷitā manussā paccantaṃ pahāya janapadamajjhe vāsaṃ kappenti, iti evarūpe rājini janapado thāvarabhāvaṃ na pāpuṇāti.
Acalo asampavedhī—this is a synonym. Or, acalo (unshaken) by merely being plundered by thieves, asampavedhī (unperturbed) by being violently ravaged. Or, acalo by thieves, asampavedhī by rival kings. Or, acalo by being not too gentle, asampavedhī by being not too harsh. For indeed, when a king is too harsh, oppressing the people with taxes, fines, and so forth, people abandon the central provinces and settle in frontier regions, relying on mountains, sea-coasts, and so on. And when a king is too gentle, people, oppressed by the plunder and violence of robbers and ruffians, abandon the frontier regions and settle in the middle of the kingdom. Thus, in such a king, the kingdom does not attain stability.
Acalo asampavedhī (không lay động, không rung chuyển) là những từ đồng nghĩa. Hoặc, acalo là không lay động chỉ bởi sự cướp bóc của kẻ trộm, asampavedhī là không rung chuyển bởi hành vi bạo ngược. Hoặc, acalo là không lay động bởi kẻ trộm, asampavedhī là không rung chuyển bởi các vua thù địch. Hoặc, acalo là do không quá nhu nhược, asampavedhī là do không quá tàn bạo. Thật vậy, khi một vị vua quá tàn bạo áp bức dân chúng bằng thuế má, hình phạt v.v..., người dân rời bỏ trung tâm quốc độ, nương náu ở núi non, ven biển v.v... và sinh sống ở vùng biên địa. Còn khi một vị vua quá nhu nhược, người dân bị áp bức bởi sự cướp bóc của những kẻ trộm cắp và bạo ngược, họ rời bỏ vùng biên địa và đến sống ở trung tâm quốc độ. Vì vậy, dưới sự cai trị của một vị vua như thế, quốc độ không thể đạt đến sự vững chắc.
Etasmiṃ pana tadubhayavirahite suvaṇṇatulā viya samabhāvappatte rājini rajjaṃ kārayamāne janapado pāsāṇapiṭṭhiyaṃ ṭhapetvā ayopaṭṭena parikkhitto viya acalo asampavedhī thāvariyappattoti.
But in this king, who is free from both (extremes) and has attained a balanced state like a gold scale, when he rules the kingdom, the land becomes stable, unshaken, and unperturbed, as if it were placed on a rock slab and surrounded by an iron plate.
Nhưng khi vị vua này, người không có cả hai thái cực đó, đạt đến trạng thái cân bằng như cán cân vàng, cai trị vương quốc, thì quốc độ trở nên không lay động, không rung chuyển, đạt đến sự vững chắc, giống như được đặt trên một tảng đá và được bao bọc bởi một tấm sắt.
650
Seyyathidanti ekova nipāto, ‘‘so katamo, taṃ katamaṃ, sā katamā’’tiādinā yathārahaṃ liṅgavibhattivacanavasena payojiyamānova hoti, idha tāni katamānīti payuttoti āha ‘‘tassa cetānī’’tiādi.
Seyyathidaṃ is a single particle; it is used with appropriate gender, case, and number, as in "so katamo," "taṃ katamaṃ," "sā katamā," and so on. Here, it is used as "tāni katamānīti" (which are these?), so it says "tassa cetāni" and so forth.
Seyyathidaṃ là một bất biến từ duy nhất. Nó được sử dụng tùy theo giới, cách và số thích hợp qua các cách nói như "so katamo" (pháp ấy là gì?), "taṃ katamaṃ" (tâm ấy là gì?), "sā katamā" (tuệ ấy là gì?) v.v... Ở đây, nó được dùng với nghĩa "tāni katamāni" (những điều ấy là gì?), do đó ngài nói ‘‘tassa cetāni’’ (đó là những điều này của vị ấy) v.v...
Cacati cakkavattino yathāruci ākāsādigamanāya paribbhamatīti cakkaṃ. Cakkaratanañhi antosamuṭṭhitavāyodhātuvasena rañño cakkavattissa vacanasamanantarameva pavattati, na candasūriyavimānādi viya bahisamuṭṭhitavāyodhātuvasenāti vimānaṭṭhakathāyaṃ (vi. va. aṭṭha. 1.paṭhamapīṭhavimānavaṇṇanā) vuttaṃ.
Cakkaṃ (wheel) means that it (the Wheel-gem) moves according to the will of the Wheel-turning Monarch, for traveling in the sky and so forth. Indeed, the Wheel-gem, by means of the wind-element arisen internally, moves immediately upon the monarch's command, not by means of the wind-element arisen externally, like the mansions of the moon and sun, and so on—this is stated in the Vimānatthakathā.
Vì nó quay tròn (cacati) để đi đến không gian v.v... theo ý muốn của vị Chuyển Luân Vương, nên được gọi là cakka (bánh xe). Thật vậy, bánh xe báu (cakkaratana) vận hành ngay sau lời nói của vua Chuyển Luân Vương nhờ vào giới gió phát sinh từ bên trong, chứ không phải nhờ vào giới gió phát sinh từ bên ngoài như các thiên cung của mặt trăng, mặt trời v.v... Điều này đã được nói trong Vimānaṭṭhakathā (Chú giải Kinh Thiên Cung).
Ratijananaṭṭhenāti pītisomanassuppādanaṭṭhena.
Ratijananaṭṭhenāti means by way of causing joy and happiness.
Ratijananaṭṭhena (với ý nghĩa làm phát sinh sự hoan hỷ) nghĩa là với ý nghĩa làm phát sinh hỷ và ưu.
Tañhi passantassa, suṇantassa ca anappakaṃ pītisomanassaṃ uppajjati acchariyadhammattā.
For to one who sees or hears it, considerable joy and happiness arise because of its wondrous nature.
Thật vậy, đối với người nhìn thấy và nghe thấy nó, hỷ và ưu không nhỏ sẽ phát sinh, vì nó là một pháp kỳ diệu.
Vacanatthato pana rameti ratiṃ karotīti ratanaṃ, ramanaṃ vā rataṃ, taṃ netīti ratanaṃ, rataṃ vā janetīti ratanaṃ ja-kāralopavasenātipi neruttikā.
But from the etymological perspective, it is ratanaṃ (gem) because it delights, it causes delight; or ratanaṃ because it carries delight (ramanaṃ vā rataṃ, taṃ netīti); or ratanaṃ because it produces delight (rataṃ vā janetīti), by way of the elision of the 'ja' sound—so say the etymologists.
Còn theo từ nguyên, nó làm cho hoan hỷ (rameti), tạo ra sự thích thú (ratiṃ karoti), nên được gọi là ratana (báu vật). Hoặc, sự hoan hỷ (ramanaṃ) là rataṃ, nó mang lại (neti) điều đó, nên là ratana. Hoặc, nó làm phát sinh (janeti) sự thích thú (rataṃ), nên là ratana do sự lược bỏ chữ 'ja', các nhà từ nguyên học cũng nói như vậy.
Sabbatthāti hatthiratanādīsu.
Sabbatthāti means in the elephant-gem, and so forth.
Sabbatthā (trong tất cả) nghĩa là trong voi báu v.v...
651
Cittīkatabhāvādināpi cakkassa ratanaṭṭho veditabbo, so pana ratijananaṭṭheneva ekasaṅgahatāya visuṃ na gahito.
The meaning of "gem" for the Wheel is also to be understood from its "esteemed nature" (cittīkatabhāva), etc. But it is not taken separately because it is included under the aspect of "causing delight."
Ý nghĩa ratana (báu vật) của bánh xe cũng nên được hiểu qua việc nó được trân trọng v.v... Nhưng điều đó không được đề cập riêng vì đã được bao gồm trong ý nghĩa "làm phát sinh sự hoan hỷ".
Kasmā ekasaṅgahoti ce?
Why is it included in one aspect?
Nếu hỏi tại sao lại được bao gồm?
Cittīkatādibhāvassapi ratinimittattā.
Because the state of being esteemed, etc., is also a cause of delight.
Vì trạng thái được trân trọng v.v... cũng là nhân của sự hoan hỷ.
Atha vā ganthabyāsaṃ pariharitukāmena cittīkatādibhāvo na gahitoti veditabbaṃ.
Alternatively, it should be understood that the state of being esteemed, etc., was not taken in order to avoid prolixity in the text.
Hoặc, nên hiểu rằng trạng thái được trân trọng v.v... không được đề cập vì muốn tránh sự dài dòng của văn bản.
Aññāsu pana aṭṭhakathāsu (dī. ni. aṭṭha. 2.33; saṃ. ni. aṭṭha. 3.5.223; khu. pā. aṭṭha. 6.3.yānīdhātigāthāvaṇṇanā; su. ni. aṭṭha. 1.226; mahāni. aṭṭha. 156) evaṃ vuttaṃ –
However, in other Aṭṭhakathās, it is stated thus—
Lại nữa, trong các chú giải khác, có nói như sau –
652
‘‘Ratijananaṭṭhena ratanaṃ.
"It is a ratanaṃ (gem) by virtue of causing delight.
“Do ý nghĩa làm phát sinh sự vui thích nên gọi là ratana.
Apica –
Moreover—
Hơn nữa –
653
Cittīkataṃ mahagghañca, atulaṃ dullabhadassanaṃ;
"It is esteemed, very valuable, incomparable, difficult to see;
Được trân trọng trong tâm, vô cùng giá trị, không gì sánh bằng, và hiếm khi được thấy;
654
Anomasattaparibhogaṃ, ratanaṃ tena vuccati.
Enjoyed by beings of noble nature, therefore it is called a gem.
Là vật thọ dụng của chúng sinh cao thượng, do đó được gọi là ratana.
655
‘‘Cakkaratanassa ca nibbattakālato paṭṭhāya aññaṃ devaṭṭhānaṃ nāma na hoti, sabbepi gandhapupphādīhi tasseva pūjañca abhivādanādīni ca karontīti cittīkataṭṭhena ratanaṃ.
"Furthermore, from the time of the Wheel-gem's arising, there is no other shrine (devaṭṭhāna) worthy of worship; all people perform offerings of perfumes, flowers, etc., and salutations only to it—thus, it is a gem by virtue of its esteemed nature.
“Kể từ khi luân bảo (cakkaratana) xuất hiện, không có nơi nào khác được tôn thờ; tất cả mọi người đều dùng hương, hoa, v.v. để cúng dường và đảnh lễ, v.v. chỉ riêng luân bảo ấy, vì vậy, do ý nghĩa được trân trọng trong tâm (cittīkataṭṭhena), nên gọi là ratana.
Cakkaratanassa ca ettakaṃ nāma dhanaṃ agghatīti aggho natthi, iti mahagghaṭṭhenapi ratanaṃ.
And there is no limit to the value of the Wheel-gem, no amount of wealth can be said to equal its worth—thus, it is a gem also by virtue of its great value.
Lại nữa, không thể định giá được luân bảo đáng giá bao nhiêu tiền của, vì vậy, do ý nghĩa vô cùng giá trị (mahagghaṭṭhena), nên cũng gọi là ratana.
Cakkaratanañca aññehi loke vijjamānaratanehi asadisanti atulaṭṭhena ratanaṃ.
And the Wheel-gem is incomparable to other gems existing in the world—thus, it is a gem by virtue of its incomparable nature.
Lại nữa, luân bảo không giống với các báu vật khác có mặt trên đời, vì vậy, do ý nghĩa không gì sánh bằng (atulaṭṭhena), nên gọi là ratana.
Yasmā pana yasmiṃ kappe buddhā uppajjanti, tasmiṃyeva cakkavattino uppajjanti, buddhā ca kadāci karahaci uppajjanti, tasmā dullabhadassanaṭṭhenapi ratanaṃ.
But since Buddhas arise in whichever eon, and Wheel-turning Monarchs arise in that same eon, and Buddhas arise only occasionally and rarely, therefore it is a gem also by virtue of its rarity of sight.
Lại nữa, vì rằng trong kiếp nào có các vị Phật xuất hiện, thì trong kiếp đó mới có các vị Chuyển Luân Vương xuất hiện, mà các vị Phật thì thỉnh thoảng hiếm hoi mới xuất hiện, vì vậy, do ý nghĩa hiếm khi được thấy (dullabhadassanaṭṭhena), nên cũng gọi là ratana.
Tadetaṃ jātirūpakulaissariyādīhi anomassa uḷārasattasseva uppajjati, na aññassāti anomasattaparibhogaṭṭhenapi ratanaṃ.
And this (Wheel-gem) arises only for noble beings who are exalted in birth, appearance, family, sovereignty, and so on, and not for others—thus, it is a gem also by virtue of being enjoyed by beings of noble nature.
Báu vật này chỉ xuất hiện cho chúng sinh cao quý, bậc thượng nhân không thấp kém về dòng dõi, dung sắc, gia tộc, quyền uy, v.v., chứ không xuất hiện cho người khác, vì vậy, do ý nghĩa là vật thọ dụng của chúng sinh cao thượng (anomasattaparibhogaṭṭhena), nên cũng gọi là ratana.
Yathā ca cakkaratanaṃ, evaṃ sesānipī’’ti.
And as is the Wheel-gem, so are the others."
Như luân bảo thế nào, các báu vật còn lại cũng như vậy.”
656
Tatrāyaṃ taṭṭīkāya, aññattha ca vuttanayena atthavibhāvanā – idañhi ‘‘cittīkata’’ntiādivacanaṃ nibbacanatthavasena vuttaṃ na hoti, atha kinti ce?
Herein, this is the exposition of the meaning, according to what is stated in the ṭīkā and elsewhere: indeed, this statement "cittīkataṃ" and so forth, is not stated in the sense of an etymological explanation. If so, then what?
Trong đó, đây là phần giải thích ý nghĩa theo phương pháp đã được trình bày trong phụ chú giải của nó và ở nơi khác – Lời nói bắt đầu bằng “cittīkata” này không phải được nói theo nghĩa phân tích từ ngữ, vậy thì thế nào?
Loke ‘‘ratana’’nti sammatassa vatthuno garukātabbabhāvena vuttaṃ.
It is stated with respect to the venerability of an object that is conventionally considered a "gem" in the world.
Nó được nói lên để chỉ tính chất đáng được tôn quý của một vật được xem là “ratana” trong thế gian.
Sarūpato panetaṃ lokiyamahājanena sammataṃ hiraññasuvaṇṇādikaṃ, cakkavattirañño uppannaṃ cakkaratanādikaṃ, kataññukatavedipuggalādikaṃ, sabbukkaṭṭhaparicchedavasena buddhādisaraṇattayañca daṭṭhabbaṃ.
In its essence, this gem should be seen as gold and silver, etc., revered by the common people, or the Wheel-gem, etc., which has arisen for a Wheel-turning Monarch, or a person who is grateful and acknowledges kindness, etc., and also the Three Refuges (Buddha, Dhamma, Saṅgha) as the supreme standard.
Về bản chất, nên hiểu rằng đây là vàng bạc, v.v. được thế gian công nhận; là luân bảo, v.v. xuất hiện cho vua Chuyển Luân; là người biết ơn và đền ơn, v.v.; và theo cách phân định cao tột nhất, đó là Tam Bảo quy y gồm Đức Phật, v.v.
‘‘Aho manohara’’nti citte kattabbatāya cittīkataṃ, svāyaṃ cittīkāro tassa pūjanīyatāyāti katvā pūjanīyanti atthaṃ vadanti.
Cittīkataṃ means something to be placed in the mind with the thought: "Oh, how delightful!" Thus, they say that this "placing in the mind" is due to its worthiness of veneration, meaning it is venerable.
Vì phải được ghi nhận trong tâm rằng “Ôi, thật đẹp lòng!”, nên gọi là cittīkata. Việc ghi nhận trong tâm này là do tính chất đáng được cúng dường của vật đó, vì thế các vị thầy giải thích ý nghĩa là “đáng được cúng dường”.
Keci pana ‘‘vicitrakataṭṭhena cittīkata’’nti bhaṇanti, taṃ na gahetabbaṃ idha cittasaddassa hadayavācakattā ‘‘cittīkatvā suṇātha me’’ti (bu. vaṃ. 1.80) āhaccabhāsitapāḷiyaṃ viya.
Some, however, say that cittīkataṃ means "made beautiful." That should not be accepted, because here the word "citta" refers to the heart, as in the directly quoted Pāḷi text: "cittīkatvā suṇātha me" (listen to me with your hearts).
Tuy nhiên, một số vị nói rằng “cittīkata là do ý nghĩa được làm cho tinh xảo”, điều này không nên chấp nhận, vì ở đây từ citta có nghĩa là trái tim (hadaya), giống như trong đoạn Pāḷi được trích dẫn: “cittīkatvā suṇātha me” (Hãy đặt tâm vào mà nghe lời ta).
Tathā cāhu ‘‘yathārahamivaṇṇāgamo bhūkaresū’’ti.
And so it is said, "As appropriate, the augment 'i' comes in bhū and kar."
Và cũng có câu nói rằng “sự thêm vào của nguyên âm ‘i’ là thích hợp trong các trường hợp liên quan đến gốc từ bhū và kar”.
‘‘Passa cittīkataṃ rūpaṃ, maṇinā kuṇḍalena cā’’tiādīsu (ma. ni. 2.302) pana pubbe avicitraṃ idāni vicitraṃ katanti cittīkatanti attho gahetabbo tattha cittasaddassa vicitravācakattā.
But in "Passa cittīkataṃ rūpaṃ, maṇinā kuṇḍalena cā" and so on, the meaning of cittīkataṃ should be taken as "that which was not beautiful before, but is now made beautiful," for there the word "citta" refers to beauty.
Còn trong các câu như “Passa cittīkataṃ rūpaṃ, maṇinā kuṇḍalena cā”ti (Hãy nhìn hình tượng được trang hoàng tinh xảo bằng ngọc và hoa tai), nên hiểu ý nghĩa của cittīkata là “trước kia không tinh xảo, nay được làm cho tinh xảo”, vì ở đó từ citta có nghĩa là tinh xảo.
Mahantaṃ vipulaṃ aparimitaṃ agghatīti mahagghaṃ. Natthi etassa tulā upamā, tulaṃ vā sadisanti atulaṃ. Kadācideva uppajjanato dukkhena laddhabbadassanattā dullabhadassanaṃ. Anomehi uḷāraguṇeheva sattehi paribhuñjitabbato anomasattaparibhogaṃ.
Mahagghaṃ (very valuable) means that which is great, extensive, immeasurably valuable. Atulaṃ (incomparable) means that for which there is no comparison, no simile, or no equal. Dullabhadassanaṃ (difficult to see) means that which is difficult to behold because it arises only rarely. Anomasattaparibhogaṃ (enjoyed by beings of noble nature) means that which is enjoyed by beings of noble qualities, not by ignoble ones.
Vật gì đáng giá lớn lao, rộng rãi, vô lượng, vật ấy là mahagghaṃ (vô giá). Vật này không có gì để cân đo, so sánh, hay tương đương, nên gọi là atulaṃ (vô song). Do chỉ thỉnh thoảng mới xuất hiện, do việc thấy được là điều khó khăn đạt được, nên gọi là dullabhadassanaṃ (hiếm thấy). Do chỉ được các chúng sanh có những phẩm chất cao thượng, không thấp kém, thọ dụng, nên gọi là anomasattaparibhogaṃ (vật thọ dụng của các bậc phi phàm).
657
Idāni nesaṃ cittīkatādiatthānaṃ savisesaṃ cakkaratane labbhamānataṃ dassetvā itaresupi te atidisituṃ ‘‘yathā ca cakkaratana’’ntiādi āraddhaṃ.
Now, in order to show the specific obtainability of these meanings of "esteemed," etc., in the Wheel-gem, and to extend them to the others, the passage "yathā ca cakkaratanaṃ" and so forth, was commenced.
Bây giờ, để trình bày rằng các ý nghĩa như cittīkata v.v... được tìm thấy một cách đặc biệt nơi bánh xe báu, và để áp dụng chúng cho các báu vật khác, đoạn văn bắt đầu bằng ‘‘yathā ca cakkaratana’’ (như bánh xe báu) v.v...
Tattha aññaṃ devaṭṭhānaṃ nāma na hoti rañño anaññasādhāraṇissariyādisampattipaṭilābhahetuto, aññesaṃ sattānaṃ yathicchitatthapaṭilābhahetuto ca.
Therein, "aññaṃ devaṭṭhānaṃ nāma na hoti" means there is no other object of veneration, due to the monarch's attainment of unique sovereignty and other excellences, and due to its being the cause of other beings obtaining their desired benefits.
Trong đó, aññaṃ devaṭṭhānaṃ nāma na hoti (không có nơi tôn thờ nào khác) là vì nó là nguyên nhân giúp nhà vua đạt được tài sản như quyền lực không chung đụng với ai khác, và cũng là nguyên nhân giúp các chúng sanh khác đạt được những lợi ích mong muốn.
Aggho natthi ativiya uḷārasamujjalaratanattā, acchariyabbhutadhammatāya ca.
"Aggho natthi" means there is no (fixed) value, due to its being an exceedingly magnificent and resplendent gem, and due to its wondrous and marvelous nature.
Aggho natthi (không có giá trị*) là vì nó là một báu vật vô cùng cao quý và rực rỡ, và cũng vì bản chất kỳ diệu, phi thường của nó.
Yadaggena ca mahagghaṃ, tadaggena atulaṃ.
And that by which it is very valuable, by that it is incomparable.
Theo phương diện nào nó là vô giá (mahagghaṃ), thì theo phương diện đó nó là vô song (atulaṃ).
Sattānaṃ pāpajigucchanena vigatakāḷako puññapasutatāya maṇḍabhūto yādiso kālo buddhuppādāraho, tādise eva cakkavattīnampi sambhavoti āha ‘‘yasmā panā’’tiādi.
Since such a time, pure and bright, worthy of the Buddha's appearance, when beings shrink from evil and are devoted to merit, is also the time when Wheel-turning Monarchs appear, therefore it is said "yasmā panā" and so forth.
Do các chúng sanh ghê tởm điều ác nên không còn ô uế, do chuyên tâm vào công đức nên trở nên trong sạch, thời kỳ như vậy thích hợp cho sự xuất hiện của chư Phật. Chính trong thời kỳ như vậy, các vị Chuyển Luân Vương cũng xuất hiện. Vì vậy, ngài nói ‘‘yasmā panā’’ (bởi vì) v.v...
Kadāci karahacīti pariyāyavacanaṃ, ‘‘kadācī’’ti vā yathāvuttakālaṃ sandhāya vuttaṃ, ‘‘karahacī’’ti jambusiridīpasaṅkhātaṃ desaṃ.
Kadāci karahacī is a synonymous phrase. Or, "kadācī" is said referring to the aforementioned time, and "karahacī" refers to the country called Jambusiridīpa.
Kadāci karahaci là những từ đồng nghĩa; hoặc ‘‘kadāci’’ được nói để chỉ thời kỳ đã được đề cập, còn ‘‘karahaci’’ để chỉ nơi chốn được gọi là jambusiridīpa (đảo Diêm-phù-đề danh tiếng).
Tenāha –
Therefore it is said—
Vì thế, ngài nói –
658
‘‘Kālaṃ dīpañca desañca, kulaṃ mātarameva ca;
"Having surveyed these five—time, island, region, family, and mother—
“Thời gian, châu lục, xứ sở, dòng dõi, và cả người mẹ;
659
Ime pañca viloketvā, uppajjati mahāyaso’’ti.(dha. pa. aṭṭha. 1.1.10);
The greatly glorious one arises."
Sau khi xem xét năm điều này, đại danh tiếng sẽ phát sinh.”
660
Upamāvasena cetaṃ vuttaṃ.
And this is stated by way of simile.
Lời này được nói theo cách ví dụ.
Upamopameyyānañca na accantameva sadisatā, tasmā yathā buddhā kadāci karahaci uppajjanti, na tathā cakkavattino, cakkavattino pana anekadāpi buddhuppādakappe uppajjantīti attho gahetabbo.
There is no absolute similarity between the simile and the object of comparison. Therefore, just as Buddhas arise occasionally and rarely, so do not Cakkavattīs. However, Cakkavattīs arise many times even in a Buddha-era, this meaning should be understood.
Và sự tương đồng giữa ví dụ và điều được ví dụ không phải là hoàn toàn tuyệt đối. Do đó, cần phải hiểu rằng các vị Phật chỉ xuất hiện đôi khi, nhưng các vị Chakkavatti không như vậy; các vị Chakkavatti có thể xuất hiện nhiều lần trong một kiếp mà chư Phật xuất hiện.
Evaṃ santepi cakkavattivattapūraṇassa dukkarabhāvato dullabhuppādoyevāti iminā dullabhuppādatāsāmaññena tesaṃ dullabhadassanatā vuttāti veditabbaṃ.
Even so, due to the difficulty of fulfilling the duties of a Cakkavattī, their arising is indeed rare. It should be understood that by this commonality of rare arising, their rare appearance is stated.
Mặc dù vậy, việc hoàn thành các bổn phận của một vị Chakkavatti là khó khăn, nên sự xuất hiện của họ là hiếm có. Vì vậy, cần phải hiểu rằng sự hiếm thấy của họ được nói đến bằng sự tương đồng với sự hiếm có của sự xuất hiện.
Kāmaṃ cakkaratanānubhāvena samijjhamāno guṇo cakkavattiparivārajanasādhāraṇo, tathāpi cakkavattī eva naṃ sāmibhāvena visavitāya paribhuñjatīti vattabbataṃ arahati tadatthameva uppajjanatoti dassento ‘‘tadeta’’ntiādimāha.
Although the quality that prospers by the power of the Cakka-ratana is common to the Cakkavattī’s retinue, the Cakkavattī alone enjoys it by way of ownership and intimacy. To show that it is worthy of being spoken of as arising for that very purpose, the text says “tadeta” (this is that) and so on.
Mặc dù phẩm chất được thành tựu nhờ oai lực của bánh xe báu là chung cho dân chúng tùy tùng của vị Chakkavatti, nhưng chính vị Chakkavatti mới là người hưởng thụ nó với tư cách là chủ nhân, do đó xứng đáng được nói là nó xuất hiện chỉ vì lợi ích của vị ấy. Để chỉ ra điều này,* đã nói “tadetaṃ” (đó là điều này) và tiếp theo.
Yathāvuttānaṃ pañcannaṃ, channampi vā atthānaṃ sesaratanesupi labbhanato ‘‘evaṃ sesānipī’’ti vuttaṃ.
The phrase “evaṃ sesānipī” (thus also the others) is stated because the aforementioned five, or even six, benefits are also found in the other jewels.
Vì những lợi ích đã nêu của năm, hoặc thậm chí sáu, cũng có thể tìm thấy trong các báu vật khác, nên đã nói “evaṃ sesānipi” (tương tự như vậy với những thứ còn lại).
661
Imehi pana ratanehi rājā cakkavattī kimatthaṃ paccanubhoti, nanu vināpi tesu kenaci raññā cakkavattinā bhavitabbanti codanāya tassa tehi hathārahamatthapaccanubhavanadassanena kenacipi avinābhāvitaṃ vibhāvetuṃ ‘‘imesu panā’’tiādi āraddhaṃ.
Now, to the question of why the Cakkavattī king experiences these jewels—is it not possible for any king to be a Cakkavattī without them?—the section “imesu panā” (but among these) and so on, is begun to clarify that the king's experience of these benefits is inseparable from them, by showing his appropriate experience of benefits through them.
Bây giờ, để làm rõ rằng một vị vua Chakkavatti hưởng thụ những báu vật này vì mục đích gì, và để chứng minh rằng không có báu vật nào có thể thiếu được đối với vị ấy bằng cách chỉ ra sự hưởng thụ lợi ích thích đáng của vị ấy với những báu vật đó,* đã bắt đầu với “imesu panā” (trong số này thì) và tiếp theo.
Ajitaṃ puratthimādidisāya khattiyamaṇḍalaṃ jināti mahesakkhatāsaṃvattaniyakammanissandabhāvato.
He conquers the unconquered sphere of Khattiyas in the eastern and other directions, because it is the result of karma that leads to great power.
Vị ấy chinh phục các vương quốc chưa bị chinh phục ở phương Đông và các phương khác, vì đó là kết quả của nghiệp tạo ra quyền lực lớn lao.
Yathāsukhaṃ anuvicarati hatthiratanaṃ, assaratanañca abhiruhitvā tesaṃ ānubhāvena antopātarāsaṃyeva samuddapariyantaṃ pathaviṃ anupariyāyitvā rājadhāniyā eva paccāgamanato.
He travels as he pleases by mounting the elephant jewel and the horse jewel, and by their power, he traverses the earth up to the ocean within the morning mealtime and returns to the royal capital itself.
Vị ấy du hành khắp nơi tùy thích bằng cách cưỡi voi báu và ngựa báu, và nhờ oai lực của chúng, vị ấy có thể đi khắp trái đất đến tận biển cả và trở về kinh đô ngay trong buổi sáng.
Pariṇāyakaratanena vijitamanurakkhati tattha tattha kattabbakiccasaṃvidahanato.
He protects the conquered land with the chief minister jewel by arranging the necessary tasks here and there.
Với vị cận thần báu, vị ấy bảo vệ vương quốc đã chinh phục bằng cách sắp đặt các công việc cần làm ở từng nơi.
Avasesehi maṇiratanaitthiratanagahapatiratanehi upabhuñjanena pavattaṃ upabhogasukhaṃ anubhavati yathārahaṃ tehi tathānubhavanasiddhito.
He experiences the pleasure of enjoyment arising from consumption with the remaining jewels—the gem jewel, the queen jewel, and the householder jewel—as the enjoyment through them is appropriately accomplished.
Với các báu vật còn lại – ngọc báu, nữ báu và gia chủ báu – vị ấy hưởng thụ hạnh phúc tiêu dùng phát sinh từ việc sử dụng chúng.
So hi maṇiratanena yojanappamāṇe padese andhakāraṃ vidhametvā ālokadassanādinā sukhamanubhavati, itthiratanena atikkantamānusakarūpadassanādivasena, gahapatiratanena icchiticchitamaṇikanakarajatādidhanapaṭilābhavasena sukhamanubhavati.
Indeed, with the gem jewel, he experiences pleasure by dispelling darkness in an area of one yojana and seeing light, etc.; with the queen jewel, by seeing a form surpassing human beauty, etc.; and with the householder jewel, by obtaining desired gems, gold, silver, and other wealth as he wishes.
Vị ấy hưởng thụ hạnh phúc với ngọc báu bằng cách xua tan bóng tối trong một vùng rộng một dojun, nhìn thấy ánh sáng, v.v.; với nữ báu bằng cách ngắm nhìn vẻ đẹp vượt trội hơn con người, v.v.; và với gia chủ báu bằng cách đạt được của cải như ngọc, vàng, bạc, v.v., tùy theo ý muốn.
662
Idāni sattiyā, sattiphalena ca yathāvuttamatthaṃ vibhāvetuṃ ‘‘paṭhamenā’’tiādi vuttaṃ.
Now, to clarify the meaning stated regarding the powers and their results, the phrase “paṭhamenā” (by the first) and so on, is stated.
Bây giờ, để làm rõ ý nghĩa đã nói bằng quyền lực (satti) và thành quả của quyền lực (sattiphala),* đã nói “paṭhamenā” (với cái thứ nhất) và tiếp theo.
Tividhā hi sattiyo ‘‘sakkonti samatthenti rājāno etāyā’’ti katvā.
There are three kinds of powers (sattiyo), so called because "kings are able and capable by means of them."
Có ba loại quyền lực (satti), được gọi như vậy vì “các vị vua có thể làm được, có khả năng làm được nhờ chúng.”
Yathāhu –
As it is said:
Như đã nói:
663
‘‘Pabhāvussāhamantānaṃ, vasā tisso hi sattiyo;
“Indeed, there are three royal powers: that of might, energy, and counsel;
“Có ba loại quyền lực tùy thuộc vào oai lực, nhiệt huyết và mưu lược;
664
Pabhāvo daṇḍajo tejo, patāpo tu ca kosajo.
Might is the splendor born of punishment, while glory is born of wealth.
Oai lực là uy quyền từ việc thi hành hình phạt, uy danh là từ kho tàng.
665
Manto ca mantanaṃ so tu, catukkaṇṇo dvigocaro;
Counsel is consultation, which is two-sided when two are involved;
Mưu lược là sự bàn bạc, đó là bốn tai khi có hai người bàn;
666
Tigocaro tu chakkaṇṇo, rahassaṃ guyhamuccate’’ti.
It is six-eared when three are involved; secrecy is called 'guyha'.”
Sáu tai khi có ba người bàn, bí mật được gọi là guyha.”
667
Tattha vīriyabalaṃ ussāhasatti. Paṭhamena cassa cakkaratanena tadanuyogo paripuṇṇo hoti.
Among these, the strength of effort is ussāhasatti (power of energy). And his application of it is perfected by his first jewel, the Cakka-ratana.
Trong số đó, sức mạnh của tinh tấn là ussāhasatti (quyền lực của nhiệt huyết). Và sự tương ứng của vị ấy với bánh xe báu đầu tiên là hoàn toàn trọn vẹn.
Kasmāti ce?
Why, if it be asked?
Tại sao?
Tena ussāhasattiyā pavattetabbassa appaṭihatāṇācakkabhāvassa siddhito.
Because thereby the state of having an unhindered wheel of command, which is to be set in motion by the power of energy, is accomplished.
Vì nhờ nó, sự tồn tại của một bánh xe quyền lực không bị cản trở, điều cần được thực hiện bởi ussāhasatti, được thành tựu.
Paññābalaṃ mantasatti.
The strength of wisdom is mantasatti (power of counsel).
Sức mạnh của trí tuệ là mantasatti (quyền lực của mưu lược).
Pacchimena cassa pariṇāyakaratanena tadanuyogo.
And his application of it is perfected by his last jewel, the chief minister jewel.
Và sự tương ứng của vị ấy với vị cận thần báu cuối cùng.
Kasmāti ce?
Why, if it be asked?
Tại sao?
Tassa sabbarājakiccesu kusalabhāvena mantasattiyā viya avirajjhanapayogattā.
Because of its unfailing application, like the power of counsel, due to his skill in all royal affairs.
Vì vị ấy khéo léo trong mọi công việc của vương quốc, và sự ứng dụng của vị ấy không sai lầm như mantasatti.
Damanena, dhanena ca pabhuttaṃ pabhūsatti.
Sovereignty through discipline and wealth is pabhūsatti (power of might).
Quyền lực thống trị nhờ sự chế ngự và của cải là pabhūsatti (quyền lực của sự thống trị).
Hatthiassagahapatiratanehi cassa tadanuyogo paripuṇṇo hoti.
And his application of it is perfected by his elephant, horse, and householder jewels.
Và sự tương ứng của vị ấy với voi báu, ngựa báu và gia chủ báu là hoàn toàn trọn vẹn.
Kasmāti ce?
Why, if it be asked?
Tại sao?
Hatthiassaratanānaṃ mahānubhāvatāya, gahapatiratanato paṭiladdhakosasampattiyā ca pabhāvasattiyā viya pabhāvasamiddhisiddhito.
Because of the great power of the elephant and horse jewels, and the attainment of abundant wealth from the householder jewel, the perfection of might is accomplished, as if by the power of might itself.
Vì oai lực vĩ đại của voi báu và ngựa báu, và sự giàu có về kho tàng đạt được từ gia chủ báu, sự thành tựu của quyền lực thống trị như pabhāvasatti được thành tựu.
Itthimaṇiratanehi tividhasattiyogaphalaṃ paripuṇṇaṃ hotīti sambandho, yathāvuttāhi tividhāhi sattīhi payujjanato yaṃ phalaṃ laddhabbaṃ.
The connection is that the fruit of the three kinds of power (pabhusatti, ussāhasatti, mantasatti) is perfected by the woman-gem and the jewel-gem, meaning whatever fruit is to be obtained through the exercise of the aforementioned three powers.
Sự liên kết là: thành quả của ba loại quyền lực được hoàn thành nhờ nữ báu và ngọc báu, tức là thành quả có được từ việc sử dụng ba loại quyền lực đã nói.
Taṃ sabbaṃ tehi paripuṇṇaṃ hotīti attho.
All that fruit is perfected by those three powers; this is the meaning.
Tất cả những thành quả đó được hoàn thành nhờ chúng, đó là ý nghĩa.
Kasmāti ce?
Why, if it is asked?
Tại sao?
Teheva upabhogasukhassa sijjhanato.
Because the happiness of enjoyment is accomplished solely through them.
Vì hạnh phúc tiêu dùng được thành tựu chỉ nhờ chúng.
668
Duvidhasukhavasenapi yathāvuttamatthaṃ vibhāvetuṃ ‘‘so itthimaṇiratanehī’’tiādi kathitaṃ.
To explain the aforementioned meaning in terms of the two kinds of happiness, the passage beginning with "He, by the woman-gem and jewel-gem" was stated.
Bây giờ, để làm rõ ý nghĩa đã nói bằng hai loại hạnh phúc,* đã nói “so itthimaṇiratanehī” (vị ấy với nữ báu và ngọc báu) và tiếp theo.
Bhogasukhanti samīpe katvā paribhogavasena pavattasukhaṃ.
Bhogasukha means happiness that arises from enjoyment when it is close at hand.
Bhogasukha (hạnh phúc tiêu dùng) là hạnh phúc phát sinh từ việc sử dụng gần gũi.
Sesehīti tadavasesehi cakkādipañcaratanehi.
By the others means by the remaining five gems, such as the wheel-gem.
Sesehī (với những cái còn lại) là với năm báu vật còn lại, bắt đầu từ bánh xe báu.
Apaccatthikatāvasena pavattasukhaṃ issariyasukhaṃ. Idāni tesaṃ sampannahetuvasenapi kenaci avinābhāvitameva vibhāvetuṃ ‘‘visesato’’tiādimāha.
The happiness that arises from having no adversaries is issariyasukha. Now, to explain that they are inseparably connected to a certain extent even in terms of their causes for perfection, it is stated, "especially" and so on.
Hạnh phúc phát sinh từ việc không có kẻ thù là issariyasukha (hạnh phúc quyền lực). Bây giờ, để làm rõ rằng chúng không thể thiếu được đối với bất kỳ ai, ngay cả theo cách nguyên nhân hoàn hảo của chúng,* đã nói “visesato” (đặc biệt là) và tiếp theo.
Adosakusalamūlajanitakammānubhāvenāti adosasaṅkhātena kusalamūlena sahajātādipaccayavasena uppāditakammassa ānubhāvena sampajjanti sommatararatanajātikattā.
By the power of kamma generated by the root of wholesome non-hatred means by the power of kamma produced through conditions such as co-arising with the root of wholesome non-hatred, they are perfected because they are of a very pleasant gem-species.
Các báu vật đầu tiên (bánh xe báu, voi báu, ngựa báu) được thành tựu nhờ oai lực của nghiệp được tạo ra bởi căn thiện không sân hận (adosakusalamūla), vì chúng thuộc loại báu vật cao quý nhất.
Kammaphalañhi yebhuyyena kammasarikkhakaṃ.
Indeed, the fruit of kamma is mostly similar to the kamma itself.
Quả của nghiệp thường giống với nghiệp.
Majjhimāni maṇiitthigahapatiratanāni alobhakusalamūlajanitakammānubhāvena sampajjanti uḷāradhanassa, uḷāradhanapaṭilābhakāraṇassa ca pariccāgasampadāhetukattā.
The middle gems, the woman-gem, the jewel-gem, and the householder-gem, are perfected by the power of kamma generated by the root of wholesome non-greed, because they are the cause of abundant wealth and the perfection of generosity, which is the cause for obtaining abundant wealth.
Các báu vật giữa (ngọc báu, nữ báu, gia chủ báu) được thành tựu nhờ oai lực của nghiệp được tạo ra bởi căn thiện không tham lam (alobhakusalamūla), vì chúng là nguyên nhân của sự giàu có lớn lao và sự đạt được của cải lớn lao thông qua sự hoàn hảo của sự bố thí.
Pacchimaṃ pariṇāyakaratanaṃ amohakusalamūlajanitakammānubhāvena sampajjati mahāpaññeneva cakkavattirājakiccassa parinetabbattā, mahāpaññabhāvassa ca amohakusalamūlajanitakammanissandabhāvato.
The last gem, the adviser-gem, is perfected by the power of kamma generated by the root of wholesome non-delusion, because the duties of a universal monarch must be led by one of great wisdom, and the state of great wisdom is a result of kamma generated by the root of wholesome non-delusion.
Báu vật cuối cùng (vị cận thần báu) được thành tựu nhờ oai lực của nghiệp được tạo ra bởi căn thiện không si mê (amohakusalamūla), vì công việc của một vị vua Chakkavatti cần phải được dẫn dắt bởi một người có trí tuệ vĩ đại, và sự tồn tại của trí tuệ vĩ đại là kết quả của nghiệp được tạo ra bởi căn thiện không si mê.
Bojjhaṅgasaṃyutteti mahāvagge dutiye bojjhaṅgasaṃyutte (saṃ. ni. 5.223).
In the Bojjhaṅgasaṃyutta means in the second Bojjhaṅgasaṃyutta in the Mahāvagga.
Trong Bojjhaṅgasaṃyutta (Tương Ưng Giác Chi) là ở Dutiya Bojjhaṅgasaṃyutta (Tương Ưng Giác Chi thứ hai) trong Mahāvagga (Đại Phẩm).
Ratanasuttassāti tattha pañcamavagge saṅgītassa dutiyassa ratanasuttassa (saṃ. ni. 5.223).
Of the Ratana Sutta means of the second Ratana Sutta, recited in the fifth section there.
Ratanasutta (Kinh Châu Báu) là Dutiya Ratanasutta (Kinh Châu Báu thứ hai) được tụng trong Pañcamavagga (Phẩm thứ năm) ở đó.
Upadeso nāma savisesaṃ sattannaṃ ratanānaṃ vicāraṇavasena pavatto nayo.
Upadesa is the method that proceeds by way of a detailed examination of the seven gems.
Upadesa (giáo huấn) là phương pháp được trình bày thông qua việc xem xét bảy báu vật một cách chi tiết.
669
Saraṇato paṭipakkhavidhamanato sūrā sattivanto, nibbhayāvahāti attho.
They are sūrā (heroes), possessing power, and bringing fearlessness, because they protect and destroy adversaries.
Vì họ là nơi nương tựa và tiêu diệt kẻ thù, nên họ là sūra (dũng mãnh), có sức mạnh, không sợ hãi, đó là ý nghĩa.
Tenāha ‘‘abhīrukajātikā’’ti.
Therefore, it is said, "of fearless nature."
Vì vậy,* đã nói “abhīrukajātikā” (có bản chất không sợ hãi).
Asure vijinitvā ṭhitattā sakko devānamindo dhīro nāma, tassa senaṅgabhāvato devaputto ‘‘aṅga’’nti vuccati, dhīrassa aṅgaṃ, tassa rūpamiva rūpaṃ yesaṃ te dhīraṅgarūpā, tena vuttaṃ ‘‘devaputtasadisakāyā’’ti.
Sakka, the king of devas, is called dhīra (wise) because he stands having conquered the asuras; a devaputta is called "aṅga" because he is a limb of Sakka. Those whose form is like the form of that limb of the dhīra are dhīraṅgarūpā (having forms like the limbs of the wise), hence it is said, "having bodies like devaputtas."
Sakka, vua của các vị trời, được gọi là dhīra (anh hùng) vì đã chiến thắng các Asura và đứng vững; các vị thiên tử được gọi là “aṅga” (thành phần) vì là thành phần của quân đội của vị ấy. Những ai có hình dáng giống như hình dáng của thành phần của vị anh hùng đó thì là dhīraṅgarūpā. Vì vậy, đã nói “devaputtasadisakāyā” (có thân hình giống như thiên tử).
Eketi sārasamāsanāmakā ācariyā, tadakkhamanto āha ‘‘ayaṃ panetthā’’tiādi.
Some refers to the teachers named Sārasamāsa; not accepting that, he says, "But here this..." and so on.
Eke (một số) là các vị thầy có tên là Sārasamāsa. Không chấp nhận điều đó,* đã nói “ayaṃ panetthā” (nhưng ở đây) và tiếp theo.
Sabhāvoti sabhāvabhūto attho.
Sabhāva means the inherent meaning.
Sabhāvo (bản chất) là ý nghĩa thực sự.
Uttamasūrāti uttamayodhā.
Uttamasūrā means excellent warriors.
Uttamasūrā (những người dũng mãnh tối thượng) là những chiến binh tối thượng.
Sūrasaddo hi idha yodhattho.
Indeed, the word sūra here means warrior.
Từ sūra ở đây có nghĩa là chiến binh.
Evañhi purimanayato imassa visesatā hoti, ‘‘uttamattho sūrasaddo’’tipi vadanti, ‘‘uttamā sūrā vuccantī’’tipi hi pāṭho dissati.
In this way, there is a distinction of this method from the former method. Some also say, "the word sūra means excellent," for the reading "uttamā sūrā vuccanti" (excellent heroes are called) is also seen.
Theo cách này, nó có sự đặc biệt so với cách giải thích trước đó. Một số người cũng nói rằng từ sūra có nghĩa là "tối thượng", và cũng có một bản đọc là "uttamā sūrā vuccantī" (những người dũng mãnh tối thượng được gọi là).
Vīrānanti vīriyavantānaṃ.
Of the vīrā means of those who are energetic.
Vīrānaṃ (của những người anh hùng) là của những người có tinh tấn.
Aṅganti kāraṇaṃ ‘‘aṅgīyati ñāyati phalametenā’’ti katvā.
Aṅga means a cause, because a result is understood or known through it.
Aṅga (thành phần) là nguyên nhân, được gọi như vậy vì “quả được biết đến, được nhận ra nhờ nó.”
Yena vīriyena ‘‘dhīrā’’ti vuccanti, tadeva dhīraṅgaṃ nāmāti āha ‘‘vīriyanti vuttaṃ hotī’’ti.
He says, "it is said to be energy," meaning that the very energy by which they are called "dhīrā" is called dhīraṅga.
Chính tinh tấn mà nhờ đó họ được gọi là “anh hùng” thì được gọi là dhīraṅga, vì vậy đã nói “vīriyanti vuttaṃ hotī” (có nghĩa là tinh tấn).
Rūpanti sarīraṃ.
Rūpa means body.
Rūpa (hình dáng) là thân thể.
Tena vuttaṃ ‘‘vīriyamayasarīrā viyā’’ti.
Therefore, it is said, "as if having bodies made of energy."
Vì vậy, đã nói “vīriyamayasarīrā viyā” (như thể có thân thể làm bằng tinh tấn).
Vīriyameva vīriyamayaṃ yathā ‘‘dānamaya’’nti, (dī. ni. 3.305; itivu. 60; netti. 34) tasmā vīriyasaṅkhātasarīrā viyāti attho.
Energy itself is vīriyamayaṃ (made of energy), just as "dānamayaṃ" (made of giving); therefore, it means as if having bodies consisting of energy.
Chính tinh tấn là vīriyamayaṃ (làm bằng tinh tấn), giống như “dānamaya” (làm bằng bố thí). Do đó, ý nghĩa là như thể có thân thể được gọi là tinh tấn.
Vīriyaṃ pana na ekantarūpanti viya-saddaggahaṇaṃ kataṃ.
Since effort (vīriya) is not a true form (rūpa), the particle 'viya' (like) has been used.
Tuy nhiên, từ "ví như" (viya) được dùng vì tinh tấn (vīriya) không phải là một sắc (rūpa) thực thể.
Apica dhīraṅgena nibbattaṃ dhīraṅganti atthaṃ dassetuṃ ‘‘vīriyamayasarīrā viyā’’ti vuttaṃ, evampi vīriyato rūpaṃ na ekantaṃ nibbattanti viya-saddena dasseti.
Furthermore, to show the meaning that "dhīraṅga" is that which is produced by dhīraṅga (effort), it is said, "as if their bodies were made of effort" (vīriyamayasarīrā viyā); even so, the word 'viya' shows that form is not necessarily produced from effort.
Hơn nữa, để chỉ rõ nghĩa ‘dhīraṅga’ (thành phần của người dũng mãnh) là ‘được sinh ra bởi sự tinh tấn (vīriya)’, nên đã nói “ví như thân thể làm bằng tinh tấn”. Ngay cả như vậy, từ “ví như” (viya) cũng cho thấy rằng sắc (rūpa) không hoàn toàn được sinh ra từ tinh tấn.
Atha vā rūpaṃ sarīrabhūtaṃ dhīraṅgaṃ vīriyametesanti yojetabbaṃ, tathāpi vīriyaṃ nāma kiñci saviggahaṃ na hotīti dīpeti ‘‘vīriyamayasarīrā viyā’’ti iminā, idhāpi mayasaddo sakattheyeva daṭṭhabbo, tasmā saviggahavīriyasadisāti attho.
Alternatively, it should be construed as: "The quality of dhīraṅga (valor/effort) that is embodied form belongs to these (sons)"; even then, it is shown by the phrase "as if their bodies were made of effort" (vīriyamayasarīrā viyā) that effort itself does not possess a body. Here too, the word 'maya' should be understood in its own sense. Therefore, the meaning is "similar to embodied effort".
Hoặc giả, nên giải thích rằng “dhīraṅga” là tinh tấn (vīriya) là thân thể của họ. Dù vậy, điều này cũng làm sáng tỏ rằng tinh tấn (vīriya) không phải là một thứ có hình hài, bằng cách nói “ví như thân thể làm bằng tinh tấn”. Ở đây, từ “mayā” (làm bằng) cũng nên được hiểu theo nghĩa sở hữu (sakattha) của nó. Do đó, nghĩa là “giống như tinh tấn có hình hài”.
Idaṃ vuttaṃ hoti – saviggahaṃ ce vīriyaṃ nāma siyā, te cassa puttā taṃsadisāyeva bhaveyyunti ayameva cattho ācariyena (dī. ni. ṭī. 1.258) anumato.
This is what is meant: if effort were a corporeal thing, then his sons would indeed be similar to it. This very meaning is approved by the Acariya.
Điều này có nghĩa là: nếu tinh tấn (vīriya) có hình hài, thì các con trai của vị ấy cũng sẽ giống như tinh tấn đó. Chính nghĩa này đã được vị Thầy (Dī. Ni. Ṭī. 1.258) chấp thuận.
Mahāpadānaṭṭhakathāyaṃ pana evaṃ vuttaṃ ‘‘dhīraṅgaṃ rūpametesanti dhīraṅgarūpā, vīriyajātikā vīriyasabhāvā vīriyamayā akilāsuno ahesuṃ, divasampi yujjhantā na kilamantīti vuttaṃ hotī’’ti, (dī. ni. aṭṭha. 2.34) tadetaṃ rūpasaddassa sabhāvatthataṃ sandhāya vuttanti daṭṭhabbaṃ.
However, in the Mahāpadānaṭṭhakathā, it is stated thus: "Because the form of valor (dhīraṅga rūpa) belongs to them, they are dhīraṅgarūpā (of valiant form); they were of the nature of effort, of the characteristic of effort, full of effort (vīriyamayā), indefatigable. This means that even if they fought all day, they would not get tired." This, it should be understood, was stated with reference to the word 'rūpa' meaning nature.
Trong Mahāpadānaṭṭhakathā (Dī. Ni. Aṭṭha. 2.34) thì được nói như sau: “Sắc (rūpa) là bản chất của họ, nên họ là dhīraṅgarūpā (có hình tướng của người dũng mãnh). Họ là những người có bản chất tinh tấn, không mệt mỏi, nghĩa là họ không mệt mỏi dù chiến đấu suốt cả ngày.” Điều này nên được hiểu là đã được nói đến khi đề cập đến nghĩa bản chất của từ “rūpa”.
Idha ceva aññattha katthaci ‘‘dhitaṅgarūpā’’ti pāṭho dissati.
Here and elsewhere, the reading "dhitaṅgarūpā" is seen in some texts.
Ở đây và ở một số nơi khác, có một bản văn là “dhitaṅgarūpā”.
Vīriyatthopi hi dhitisaddo hoti ‘‘saccaṃ dhammo dhiti cāgo, diṭṭhaṃ so ativattatī’’tiādīsu (jā. 1.1.57) dhitisaddo viya.
Indeed, the word 'dhiti' also means effort, like the word 'dhiti' in phrases such as "Truth, Dhamma, dhiti, and generosity; he surpasses what is seen."
Thật vậy, từ “dhiti” cũng có nghĩa là tinh tấn (vīriya), giống như từ “dhiti” trong các câu như “Sự thật, Dhamma, dhiti (kiên trì), cāga (bố thí) – người ấy vượt qua những gì đã thấy” (Jā. 1.1.57).
Katthaci pana ‘‘vīraṅga’’nti pāṭhova diṭṭho.
In some places, however, only the reading "vīraṅga" is seen.
Tuy nhiên, ở một số nơi, chỉ thấy bản văn “vīraṅga”.
Yathā ruccati, tathā gahetabbaṃ.
One should take it as one prefers.
Nên chấp nhận tùy theo điều mình thích.
670
Nanu ca rañño cakkavattissa paṭisenā nāma natthi, ya’massa puttā pamaddeyyuṃ, atha kasmā ‘‘parasenappamaddanā’’ti vuttanti codanaṃ sodhento ‘‘sace’’tiādimāha, parasenā hotu vā, mā vā, ‘‘sace pana bhaveyyā’’ti parikappanāmattena tesaṃ evamānubhāvataṃ dassetuṃ tathā vuttanti adhippāyo, ‘‘parasenappamaddanā’’ti vuttepi parasenaṃ pamaddituṃ samatthāti attho gahetabbo pakaraṇatopi atthantarassa viññāyamānattā, yathā ‘‘sikkhamānena bhikkhave bhikkhunā aññātabbaṃ paripucchitabbaṃ paripañhitabba’’nti (pāci. 434) etassa padabhājanīye (pāci. 436) ‘‘sikkhitukāmenā’’ti atthaggahaṇanti imamatthaṃ dassetuṃ ‘‘taṃ parimaddituṃ samatthā’’ti vuttaṃ.
Addressing the question, "The universal monarch has no opposing army for his sons to crush, so why is it said 'crushers of opposing armies' (parasenappamaddanā)?", he states, "sace" (if) and so on. The intention is that whether there is an opposing army or not, by merely supposing, "if there were such an army," their great power is shown. Even when "parasenappamaddanā" is said, the meaning "capable of crushing an opposing army" should be taken, because a different meaning can be understood from the context, just as in the analysis of the word "A bhikkhu who is in training, O bhikkhus, should know, should question, should inquire" (sikkhamānena bhikkhave bhikkhunā aññātabbaṃ paripucchitabbaṃ paripañhitabbaṃ), the meaning "wishing to train" (sikkhitukāmena) is taken. Thus, the phrase "taṃ parimaddituṃ samatthā" (capable of crushing them) is stated to illustrate this meaning.
Để giải đáp câu hỏi: “Chẳng phải một vị Chuyển Luân Vương không có quân địch để các con trai của ngài có thể tiêu diệt sao? Vậy tại sao lại nói ‘parasenappamaddanā’ (người tiêu diệt quân địch)?” vị Thầy đã nói “sace” (nếu) và tiếp theo. Ý nghĩa là: dù có quân địch hay không, việc nói như vậy là để chỉ rõ uy lực của họ bằng cách giả định rằng “nếu có quân địch”. Ngay cả khi nói “parasenappamaddanā”, nghĩa nên được hiểu là “có khả năng tiêu diệt quân địch”, vì từ ngữ này cũng có thể hiểu theo nghĩa khác trong ngữ cảnh. Giống như trong phần phân tích từ (padabhājanīya) của câu “Này các tỳ khưu, một tỳ khưu đang học cần phải biết, cần phải hỏi, cần phải tra vấn” (Pāci. 434), nghĩa được hiểu là “người muốn học” (Pāci. 436). Để chỉ rõ ý nghĩa này, đã nói “có khả năng tiêu diệt quân địch đó”.
Na hi te parasenaṃ pamaddantā tiṭṭhanti, atha kho pamaddanasamatthā eva honti.
For they do not stand crushing an opposing army, but rather they are merely capable of crushing it.
Thật vậy, các con trai ấy không đứng yên tiêu diệt quân địch, mà họ chỉ có khả năng tiêu diệt.
Evamaññatrapi yathārahaṃ.
Similarly, elsewhere, as appropriate.
Cũng vậy ở những nơi khác, tùy theo trường hợp.
Parasenaṃ pamaddanāya samatthentīti parasenappamaddanāti atthaṃ dassetītipi vadanti.
They also say it shows the meaning that "parasenappamaddanā" means those who are capable of crushing an opposing army.
Một số vị cũng nói rằng ý nghĩa là “họ có khả năng tiêu diệt quân địch, nên họ là parasenappamaddanā (người tiêu diệt quân địch)”.
671
Pubbe katūpacitassa etarahi vipaccamānakassa puññadhammassa cirataraṃ vipaccituṃ paccayabhūtaṃ cakkavattivattasamudāgataṃ payogasampattisaṅkhātaṃ dhammaṃ dassetuṃ ‘‘dhammenā’’ti padassa ‘‘pāṇo na hantabbotiādinā pañcasīladhammenā’’ti atthamāha.
To show the Dhamma, which is called the perfection of effort (payogasampatti) arising from the practice of a universal monarch (cakkavattivatta), which serves as a condition for the long-lasting maturation of wholesome kammas accumulated in the past and now ripening, the Acariya explains the word "dhammena" as "by the Dhamma of the Five Precepts, such as 'No living being should be killed'."
Để chỉ rõ pháp (dhamma) là “sự thành tựu trong việc thực hành” (payogasampatti), tức là sự thực hành các bổn phận của Chuyển Luân Vương (cakkavattivatta) đã là nhân duyên cho các thiện pháp (puññadhamma) đã tích lũy từ trước và đang cho quả hiện tại được cho quả lâu dài hơn, vị Thầy đã giải thích từ “dhammena” (bằng pháp) là “bằng pháp ngũ giới, bắt đầu từ ‘không sát hại sinh vật’”.
Ayañhi attho ‘‘ye kho panānanda puratthimāya disāya paṭirājāno, te rājānaṃ mahāsudassanaṃ upasaṅkamitvā evamāhaṃsu ‘ehi kho mahārāja, svāgataṃ te mahārāja, sakaṃ te mahārāja, anusāsa mahārājā’ti.
This meaning is stated with reference to the instruction of Dhamma given by the king, as found in the Mahāsudassana Sutta: "Ananda, those rival kings to the east approached King Mahāsudassana and said, 'Come, Your Majesty! Welcome, Your Majesty! This is your country, Your Majesty. Rule, Your Majesty!'"
Thật vậy, ý nghĩa này được nói đến khi đề cập đến pháp giáo huấn của vị vua, được trình bày trong câu “Này Ānanda, các vị vua đối nghịch ở phương đông đã đến gặp vua Mahāsudassana và nói như vậy: ‘Tâu Đại Vương, xin mời Đại Vương, xin chào mừng Đại Vương, đây là của Đại Vương, xin Đại Vương hãy giáo huấn!’”
Rājā mahāsudassano evamāha ‘pāṇo na hantabbo, adinnaṃ na ādātabbaṃ, kāmesu micchā na caritabbā, musā na bhaṇitabbā, majjaṃ na pātabbaṃ, yathābhuttañca bhuñjathā’ti.
"King Mahāsudassana then said, 'No living being should be killed, what is not given should not be taken, wrong conduct in sensual pleasures should not be practiced, no falsehood should be spoken, no intoxicating drink should be consumed, and you should consume (taxes) as they have been consumed (before).'"
Vua Mahāsudassana đã nói như vậy: ‘Không được sát hại sinh vật, không được lấy của không cho, không được tà hạnh trong các dục, không được nói dối, không được uống rượu say, và hãy hưởng thụ những gì đã được hưởng thụ’.”
Ye kho panānanda puratthimāya disāya paṭirājāno, te rañño mahāsudassanassa anuyantā ahesu’’ntiādinā (dī. ni. 2.244) āgataṃ rañño ovādadhammaṃ sandhāya vutto.
"Ananda, those rival kings to the east became followers of King Mahāsudassana."
“Này Ānanda, các vị vua đối nghịch ở phương đông đã trở thành những người tuân theo vua Mahāsudassana” và tiếp theo (Dī. Ni. 2.244).
Evañhi ‘‘adaṇḍena asatthenā’’ti idampi visesanavacanaṃ susamatthitaṃ hoti.
In this way, the descriptive phrase "without rod, without weapon" (adaṇḍena asatthena) is also well-supported.
Như vậy, lời đặc tả “không dùng gậy, không dùng kiếm” này cũng được giải thích hoàn hảo.
Aññāsupi suttanipātaṭṭhakathādīsu (su. ni. aṭṭha. 226; khu. pā. aṭṭha. 6.3; dī. ni. aṭṭha. 2.33; saṃ. ni. aṭṭha. 3.223) ayamevattho vutto.
In other commentaries like the Suttanipātaṭṭhakathā, this same meaning is given.
Trong các chú giải khác như Suttanipātaṭṭhakathā (Su. Ni. Aṭṭha. 226; Khu. Pā. Aṭṭha. 6.3; Dī. Ni. Aṭṭha. 2.33; Saṃ. Ni. Aṭṭha. 3.223) cũng nói cùng ý nghĩa này.
672
Mahāpadānaṭṭhakathāyaṃ pana ‘‘adaṇḍenāti ye katāparādhe satte satampi sahassampi gaṇhanti, te dhanadaṇḍena rajjaṃ kārenti nāma, ye chejjabhejjaṃ anusāsanti, te satthadaṇḍena.
However, in the Mahāpadānaṭṭhakathā, it is said: "adaṇḍena" (without rod) refers to kings who capture hundreds or thousands of offenders and rule by imposing financial penalties. Those who enforce mutilation and dismemberment rule by wielding the rod of punishment. However, this one abandons both types of punishment and rules without such a rod.
Tuy nhiên, trong Mahāpadānaṭṭhakathā thì nói: “Adaṇḍena” (không dùng gậy) là những vị vua bắt giữ hàng trăm, hàng ngàn sinh vật phạm lỗi và trị quốc bằng hình phạt tài sản (dhanadaṇḍa); những vị vua ra lệnh cắt xẻo, đập phá thì trị quốc bằng hình phạt vũ khí (satthadaṇḍa).
Ayaṃ pana duvidhampi daṇḍaṃ pahāya adaṇḍena ajjhāvasati.
This one, however, abandoning both kinds of punishment, dwells without rod or weapon.
Nhưng vị vua này thì từ bỏ cả hai loại hình phạt đó, và trị quốc mà không dùng gậy.
Asatthenāti ye ekatodhārādinā satthena paraṃ vihesanti, te satthena rajjaṃ kārenti nāma.
"Asatthena" (without weapon) refers to kings who harm others with a weapon, such as a single-edged sword; they are said to rule by wielding weapons.
“Asatthena” (không dùng kiếm) là những vị vua làm hại người khác bằng vũ khí như gươm một lưỡi thì trị quốc bằng vũ khí.
Ayaṃ pana satthena khuddakamakkhikāyapi pivanamattaṃ lohitaṃ kassaci anuppādetvā dhammeneva, ‘ehi kho mahārājā’ti evaṃ paṭirājūhi sampaṭicchitāgamano vuttappakāraṃ pathaviṃ abhivijinitvā ajjhāvasati abhibhavitvā sāmī hutvā vasatīti attho’’ti (dī. ni. aṭṭha. 2.34) vuttaṃ, tadetaṃ ‘‘dhammenā’’ti padassa ‘‘pubbe katūpacitena etarahi vipaccamānakena yena kenaci puññadhammenā’’ti atthaṃ sandhāya vuttaṃ.
This one, however, without causing even a small fly to shed a drop of blood with a weapon, rules by Dhamma alone, having been welcomed by rival kings with "Come, Your Majesty!", and having conquered the earth of the aforesaid kind, he dwells, he lives as master, having subdued it. This, it should be understood, was stated with reference to the word "dhammena" meaning "by any wholesome kamma, accumulated in the past and ripening now."
Nhưng vị vua này, không làm cho một giọt máu nhỏ nào của bất kỳ ai, kể cả một con ruồi nhỏ, phải đổ ra bằng vũ khí, mà chỉ bằng Dhamma, đã được các vị vua đối nghịch chào đón bằng câu “Tâu Đại Vương, xin mời Đại Vương” và tiếp theo, đã chinh phục và trị vì trái đất như đã nói. Nghĩa là, đã chinh phục và trở thành chủ nhân. Điều này đã được nói đến khi đề cập đến ý nghĩa của từ “dhammena” là “bằng bất kỳ thiện pháp nào đã tích lũy từ trước và đang cho quả hiện tại”.
Teneva hi ‘‘dhammena paṭirājūhi sampaṭicchitāgamano vuttappakāraṃ pathaviṃ abhivijinitvā ajjhāvasatī’’ti.
For by that very Dhamma, he, having been welcomed by the rival kings and having conquered the earth of the aforesaid kind, dwells.
Chính vì vậy mà nói rằng “bằng Dhamma, được các vị vua đối nghịch chào đón, đã chinh phục và trị vì trái đất như đã nói”.
Ācariyenapi (dī. ni. ṭī. 1.258) vuttaṃ dhammenāti katūpacitena attano puññadhammena.
It was also stated by the Acariya: dhammena (by Dhamma) means by one's own wholesome kamma accumulated in the past.
Vị Thầy (Dī. Ni. Ṭī. 1.258) cũng đã nói “dhammena” (bằng pháp) là bằng thiện pháp (puññadhamma) của chính mình đã tích lũy từ trước.
Tena hi sañcoditā pathaviyaṃ sabbarājāno paccuggantvā ‘‘svāgataṃ te mahārājā’’tiādīni vatvā attano rajjaṃ rañño cakkavattissa niyyātenti.
For by that very Dhamma, all the kings on earth, being urged, would go forth to meet him, and saying "Welcome, Your Majesty!" and so forth, would surrender their kingdoms to the universal monarch.
Vì vậy, được thúc đẩy bởi thiện pháp đó, tất cả các vị vua trên trái đất đã ra đón và nói “Tâu Đại Vương, xin chào mừng Đại Vương” và tiếp theo, rồi giao vương quốc của mình cho vị Chuyển Luân Vương.
Tena vuttaṃ ‘‘so imaṃ pathaviṃ sāgarapariyantaṃ adaṇḍena asatthena dhammena abhivijiya ajjhāvasatī’’ti, tenapi yathāvuttamevatthaṃ dasseti, tasmā ubhayathāpi ettha attho yutto evāti daṭṭhabbaṃ.
Therefore, it is said, "He, having conquered this earth extending to the ocean, rules without rod, without weapon, by Dhamma." By this, too, the meaning described above is shown. Therefore, it should be understood that in this case, the meaning is appropriate in both ways.
Vì vậy, đã nói “Vị ấy đã chinh phục và trị vì trái đất này, cho đến tận biển, bằng Dhamma, không dùng gậy, không dùng kiếm”. Điều đó cũng chỉ rõ ý nghĩa như đã nói. Do đó, nên hiểu rằng ở đây, cả hai cách giải thích đều hợp lý.
Cakkavattivattapūraṇādipayogasampattimantarena hi pubbe katūpacitakammeneva evamajjhāvasanaṃ na sambhavati, tathā pubbe katūpacitakammamantarena cakkavattivattapūraṇādipayogasampattiyā evāti.
For without the perfection of effort such as fulfilling the practices of a universal monarch, such a ruling would not be possible merely by kamma accumulated in the past; likewise, without kamma accumulated in the past, it would not be possible merely by the perfection of effort such as fulfilling the practices of a universal monarch.
Thật vậy, việc trị vì như vậy không thể xảy ra chỉ bằng nghiệp đã tích lũy từ trước mà không có sự thành tựu trong việc thực hành các bổn phận của Chuyển Luân Vương và tiếp theo. Cũng vậy, không thể xảy ra chỉ bằng sự thành tựu trong việc thực hành các bổn phận của Chuyển Luân Vương và tiếp theo mà không có nghiệp đã tích lũy từ trước.
673
Evaṃ ekaṃ nipphattiṃ kathetvā dutiyaṃ nipphattiṃ kathetuṃ yadetaṃ ‘‘sace kho panā’’tiādivacanaṃ vuttaṃ, tattha anuttānamatthaṃ dassento ‘‘arahaṃ…pe… vivaṭṭacchadoti etthā’’tiādimāha.
Having thus explained one accomplishment, to explain the second accomplishment, when the statement, "sace kho panā" (but if) and so on was made, the Acariya states "arahaṃ...pe... vivaṭṭacchado" (an Arahant...pe... with the coverings removed) and so on, to explain the obscure meaning there.
Sau khi giải thích một thành quả như vậy, để giải thích thành quả thứ hai, vị Thầy đã nói “arahaṃ…pe… vivaṭṭacchado” và tiếp theo, để làm sáng tỏ ý nghĩa không rõ ràng trong câu “sace kho panā” (nếu, này).
Yasmā rāgādayo satta pāpadhammā loke uppajjanti, uppajjamānā ca te sattasantānaṃ chādetvā pariyonandhitvā kusalappavattiṃ nivārenti, tasmā te idha chadasaddena vuttāti dasseti ‘‘rāgadosā’’tiādinā.
Since the seven evil qualities, such as greed (rāga), arise in the world, and when they arise, they obscure and envelop the continuity of beings, thereby hindering the progression of wholesome actions, he states "rāgadosā" (greed, hatred) and so on, to show that these are referred to here by the word 'chada' (covering).
Vì bảy ác pháp (pāpadhamma) như tham (rāga) và sân (dosa) phát sinh trên thế gian, và khi phát sinh, chúng che đậy và trói buộc dòng tâm thức của chúng sinh, ngăn cản sự phát triển của thiện pháp (kusala), nên ở đây chúng được gọi bằng từ “chada” (vật che đậy), được chỉ rõ bằng “tham, sân” và tiếp theo.
Duccaritanti micchādiṭṭhito aññena manoduccaritena saha tīṇi duccaritāni, micchādiṭṭhi pana visesena sattānaṃ chadanato, paramasāvajjattā ca visuṃ gahitā.
Duccarita (misconduct) refers to the three misdeeds, along with mental misconduct other than wrong view; wrong view, however, is taken separately due to its specific ability to obscure beings and its extreme blameworthiness.
Duccarita (ác hạnh) là ba ác hạnh (duccarita) cùng với ác hạnh ý (manoduccarita) khác ngoài tà kiến (micchādiṭṭhi). Tuy nhiên, tà kiến được nêu riêng vì nó đặc biệt che đậy chúng sinh và vì nó là tội lỗi nghiêm trọng nhất.
Vuttañca ‘‘sabbe te imeheva dvāsaṭṭhiyā vatthūhi antojālīkatā, ettha sitāva ummujjamānā ummujjantī’’tiādi (dī. ni. 1.146).
And it was said: ‘‘All those are caught within the net of these sixty-two views; being immersed herein, they emerge only after being immersed herein,’’ and so on.
Cũng đã được nói rằng: “Tất cả các Sa-môn, Bà-la-môn ấy, chỉ với sáu mươi hai quan điểm này mà bị mắc kẹt trong lưới giáo pháp của Ta. Họ chỉ có thể nổi lên trong lưới này thôi” (Dī. Ni. 1.146).
Tathā muyhanaṭṭhena moho, aviditakaraṇaṭṭhena avijjāti pavattiākārabhedena aññāṇameva dvidhā vuttaṃ.
Similarly, moha is so called by the meaning of bewilderment, and avijjā by the meaning of causing to be unknown; thus, ignorance alone is stated in two ways, based on the difference in the mode of occurrence.
Tương tự, moha (si mê) được nói đến với ý nghĩa là sự mê mờ, và avijjā (vô minh) với ý nghĩa là sự không biết (không thấy rõ ý nghĩa chân thật của các sự thật), như vậy, sự vô minh (aññāṇa) này được nói đến theo hai cách, dựa trên sự khác biệt về hình thái biểu hiện.
Tathā hissa dvidhāpi chadanattho kathito ‘‘andhatamaṃ tadā hoti, yaṃ moho sahate nara’’nti, (mahāni. 5, 156, 195) ‘‘avijjāya nivuto loko, vevicchā pamādā nappakāsatī’’ti (su. ni. 1039; cūḷani. pārāyanavagga.2) ca.
Indeed, the meaning of covering for both aspects of it was declared by the Blessed One: ‘‘It is then profound darkness when moha overpowers a man,’’ and ‘‘The world is shrouded by avijjā, not shining forth due to vacillation and heedlessness.’’
Vì cả hai dạng này đều được nói đến với ý nghĩa che đậy, như trong câu: “Khi si mê chế ngự con người, lúc ấy là bóng tối mịt mùng” (Mahāni. 5, 156, 195) và “Thế gian bị vô minh che lấp, do nghi ngờ và phóng dật mà không tỏa sáng” (Su. Ni. 1039; Cūḷani. Pārāyanavagga.2).
Evaṃ rāgadosādīnampi chadanattho vattabbo.
In this way, the meaning of covering for rāga, dosa, and so on should also be stated.
Tương tự, ý nghĩa che đậy của tham (rāga), sân (dosa), v.v. cũng cần được nói đến.
Mahāpadānaṭṭhakathāyaṃ (dī. ni. aṭṭha. 2.33) pana rāgadosamohamānadiṭṭhikilesataṇhāvasena satta pāpadhammā gahitā.
However, in the Mahāpadānaṭṭhakathā, seven evil qualities—rāga, dosa, moha, māna, diṭṭhi, kilesa, and taṇhā—are taken.
Trong Mahāpadānaṭṭhakathā (Dī. Ni. Aṭṭha. 2.33), bảy ác pháp được đề cập là tham (rāga), sân (dosa), si (moha), kiêu mạn (māna), tà kiến (diṭṭhi), phiền não (kilesa) và ái (taṇhā).
Tatra rañjanaṭṭhena rāgo, taṇhāyanaṭṭhena taṇhāti pavattiākārabhedena lobho eva dvidhā vutto.
Among these, rāga is so called by the meaning of delighting, and taṇhā by the meaning of craving; thus, greed alone is stated in two ways, based on the difference in the mode of occurrence.
Trong số đó, tham (lobha) được nói đến theo hai cách, dựa trên sự khác biệt về hình thái biểu hiện: rāga (tham ái) với ý nghĩa là sự thích thú, và taṇhā (ái dục) với ý nghĩa là sự khát khao.
Tathā hissa dvidhāpi chadanattho ekantikova.
Indeed, the meaning of covering for both aspects of it is certainly absolute.
Thật vậy, ý nghĩa che đậy của cả hai dạng này là tuyệt đối.
Yathāha ‘‘andhatamaṃ tadā hoti, yaṃ rāgo sahate nara’’nti, ‘‘kāmandhā jālasañchannā, taṇhāchadanachāditā’’ti (udā. 94) ca, kilesaggahaṇena ca vuttāvasiṭṭhā vicikicchādayo vuttā.
As it was said: ‘‘It is then profound darkness when rāga overpowers a man,’’ and ‘‘Blind with craving, enveloped by the net, covered by the cover of craving.’’ And by the inclusion of kilesa, the remaining vicikicchā (skeptical doubt) and so on are mentioned.
Như đã nói: “Khi tham ái chế ngự con người, lúc ấy là bóng tối mịt mùng”, và “Những kẻ mù quáng vì dục lạc, bị lưới ái dục giăng mắc, bị màn ái dục che phủ” (Udā. 94). Với việc đề cập đến các phiền não (kilesa), các phiền não còn lại như hoài nghi (vicikicchā), v.v. cũng được bao gồm.
674
Sattahi paṭicchanneti hetugabbhavacanaṃ, sattahi pāpadhammehi paṭicchannattā kilesavasena andhakāre loketi attho.
Sattahi paṭicchanne is a causative expression, meaning that the world is in darkness due to kilesas, being covered by the seven evil qualities.
Bị bảy thứ che lấp (Sattahi paṭicchanne) là một từ ngữ mang ý nghĩa nguyên nhân, có nghĩa là thế gian bị bóng tối bao phủ do các phiền não, vì bị bảy ác pháp che lấp.
Taṃ chadananti sattapāpadhammasaṅkhātaṃ chadanaṃ.
That covering refers to the covering called the seven evil qualities.
Sự che lấp đó (Taṃ chadanaṃ) là sự che lấp được gọi là bảy ác pháp.
Vivaṭṭetvāti vivaṭṭaṃ katvā vigametvā.
Vivaṭṭetvā means having opened or having removed.
Mở ra (Vivaṭṭetvā) có nghĩa là làm cho mở ra, loại bỏ.
Tadeva pariyāyantarena vuttaṃ ‘‘samantato sañjātāloko hutvā’’ti.
That same meaning is stated in another way as ‘‘having become light on all sides.’’
Điều đó được nói đến bằng một cách khác: “Trở nên có ánh sáng khắp mọi phía”.
Kilesachadanavigamo eva hi āloko, etena vivaṭṭayitabbo vigametabboti vivaṭṭo, chādeti paṭicchādetīti chado, vivaṭṭo chado anenāti vivaṭṭacchadā, vivaṭṭacchado vāti atthaṃ dasseti.
Indeed, the removal of the covering of kilesas is light; by this, what is to be uncovered, what is to be removed, is vivaṭṭa (uncovered). What covers or conceals is chada. The one by whom the covering has been removed is vivaṭṭacchadā or vivaṭṭacchado; this is the meaning shown.
Sự loại bỏ màn che phiền não chính là ánh sáng. Với điều này, cái cần được mở ra, cần được loại bỏ, là vivaṭṭa. Cái che đậy, cái bao phủ, là chada. Cái mà nhờ đó màn che được mở ra là vivaṭṭacchadā, hoặc vivaṭṭacchado, diễn giải ý nghĩa.
Ayañhi vivaṭṭacchadasaddo daḷhadhammapaccakkhadhammasaddādayo viya pulliṅgavasena ākāranto, okāranto ca hoti.
This word vivaṭṭacchada is indeed of masculine gender, ending in a or o, like the words daḷhadhamma and paccakkhadhamma.
Từ vivaṭṭacchada này, giống như các từ daḷhadhamma, paccakkhadhamma, v.v., có thể có tận cùng là ā hoặc o theo giống đực.
Tathā hi mahāpadānaṭṭhakathāyaṃ vuttaṃ ‘‘rāgadosamohamānadiṭṭhikilesataṇhāsaṅkhātaṃ chadanaṃ āvaraṇaṃ vivaṭaṃ viddhaṃsitaṃ vivaṭakaṃ etenāti vivaṭacchado, ‘vivaṭṭacchadā’tipi pāṭho, ayamevattho’’ti, (dī. ni. aṭṭha. 2.33) tassā līnatthappakāsaniyampi vuttaṃ ‘‘vivaṭṭacchadāti okārassa ākāraṃ katvā niddeso’’ti.
Thus, it is said in the Mahāpadānaṭṭhakathā: ‘‘That by which the covering and veil, called rāga, dosa, moha, māna, diṭṭhi, kilesa, taṇhā, has been uncovered and destroyed is vivaṭṭacchado. There is also the reading ‘vivaṭṭacchadā’; the meaning is the same.’’ And in its Līnatthappakāsanī it is also said: ‘‘Vivaṭṭacchadā is an instruction made by changing o to a.’’
Thật vậy, trong Mahāpadānaṭṭhakathā đã nói: “Cái mà nhờ đó màn che, sự che chắn, được gọi là tham, sân, si, mạn, tà kiến, phiền não, ái, được mở ra, được phá hủy, được làm cho mở ra, thì đó là vivaṭṭacchado. Cũng có bản đọc là vivaṭṭacchadā, ý nghĩa là như vậy.” (Dī. Ni. Aṭṭha. 2.33). Trong Līnatthappakāsanī của nó cũng nói: “vivaṭṭacchadā là sự chỉ định bằng cách biến o thành ā.”
Saddavidū pana ‘‘ādhanvāditoti lakkhaṇena samāsantagatehi dhanusaddādīhi kvaci āpaccayo’’ti vatvā ‘‘kaṇḍivadhanvā, paccakkhadhammā, vivaṭṭacchadā’’ti payogamudāharanti.
However, grammarians, stating ‘‘in some instances, the suffix ā occurs after words like dhanu that end a compound, according to the rule ādhanvādito,’’ cite examples such as kaṇḍivadhanvā, paccakkhadhammā, and vivaṭṭacchadā.
Các nhà ngữ pháp thì nói rằng: “Theo quy tắc ādhanvāditoti, đôi khi có hậu tố ā sau các từ như dhanu v.v. ở cuối hợp chất”, và họ đưa ra các ví dụ như kaṇḍivadhanvā, paccakkhadhammā, vivaṭṭacchadā.
675
Kasmā padattayametaṃ vuttanti anuyogaṃ hetālaṅkāranayena pariharanto ‘‘tatthā’’tiādimāha, tatthāti ca tīsu padesūti attho.
Addressing the question, ‘‘Why are these three terms stated?’’ and resolving it by way of the figure of speech hetālaṅkāra, he states ‘‘tatthā’’ and so on. And tatthā means in these three terms.
Để giải đáp câu hỏi “Tại sao ba từ này lại được nói đến?”, vị thầy đã nói: “Trong đó” v.v. theo cách trang sức bằng nguyên nhân. Và trong đó có nghĩa là trong ba từ.
Pūjāvisesaṃ paṭiggaṇhituṃ arahatīti arahanti atthena pūjārahatā vuttā.
Pūjārahatā (worthiness of homage) is stated by the meaning that he is worthy of receiving special reverence, thus arahaṃ.
Sự xứng đáng được cúng dường (pūjārahatā) được nói đến với ý nghĩa là Bậc A-la-hán (arahaṃ), vì Ngài xứng đáng thọ nhận sự cúng dường đặc biệt.
Yasmā sammāsambuddho, tasmā pūjārahatāti tassā pūjārahatāya hetu vutto.
Because he is a Sammāsambuddha, therefore he is worthy of homage; thus, the reason for his worthiness of homage is stated.
Vì Ngài là Bậc Chánh Đẳng Giác (sammāsambuddho), nên Ngài xứng đáng được cúng dường. Do đó, nguyên nhân của sự xứng đáng được cúng dường đã được nói đến.
Savāsanasabbakilesappahānapubbakattā buddhabhāvassa buddhattahetubhūtā vivaṭṭacchadatā vuttā. Kammādivasena tividhaṃ vaṭṭañca rāgādivasena sattavidho chado ca vaṭṭacchadā, vaṭṭacchadehi vigato, vigatā vā vaṭṭacchadā yassāti vivaṭṭacchado, vivaṭṭacchadā vā, dvandapubbago pana vi-saddo ubhayattha yojetabboti imamatthaṃ dassetuṃ ‘‘vivaṭṭo ca vicchado cā’’ti vuttaṃ.
The state of vivaṭṭacchadatā (having the covering uncovered), which is the cause of Buddhahood, is stated because Buddhahood is preceded by the complete eradication of all kilesas together with their latent tendencies (vāsanas). The three kinds of rounds (vaṭṭa) based on karma and so on, and the seven kinds of coverings (chada) based on rāga and so on, are vaṭṭacchadā. One who is free from the rounds and coverings, or for whom the rounds and coverings are gone, is vivaṭṭacchado or vivaṭṭacchadā. The prefix vi- preceding the compound should be applied to both terms; to show this meaning, it is said ‘‘vivaṭṭo ca vicchado cā’’.
Trạng thái Vivaṭṭacchadatā (không còn màn che) được nói đến như là nguyên nhân của Phật quả (buddhattahetubhūtā), vì Phật quả có trước sự đoạn trừ tất cả phiền não cùng với khuynh hướng tiềm ẩn (savāsanasabbakilesappahānapubbakattā). Vòng luân hồi (vaṭṭa) có ba loại theo nghiệp, v.v., và màn che (chada) có bảy loại theo tham, v.v., được gọi là vaṭṭacchadā (màn che của luân hồi). Vivaṭṭacchado (không còn màn che của luân hồi) là người đã thoát khỏi các màn che của luân hồi (vaṭṭacchadehi vigato), hoặc là người mà các màn che của luân hồi (vaṭṭacchadā) đã biến mất (vigatā). Từ vi- đứng trước hợp từ kép (dvanda) phải được liên kết với cả hai phần, để chỉ rõ ý nghĩa này, đã nói: “Vừa thoát khỏi luân hồi (vivaṭṭo) vừa không còn màn che (vicchado)”.
Evampi vadanti ‘‘vivaṭṭo ca so vicchado cāti vivaṭṭacchado, uttarapade pubbapadalopoti atthaṃ dassetī’’ti.
Some also say thus: ‘‘ Vivaṭṭacchado means he is free from the rounds (vivaṭṭa) and free from coverings (vicchada); this shows the meaning of the elision of the first word in the latter word.’’
Họ cũng nói: “Vivaṭṭo ca so vicchado cā nghĩa là vivaṭṭacchado, chỉ ra rằng có sự lược bỏ từ ở phần đầu trong từ ghép.”
‘‘Arahaṃ vaṭṭābhāvenā’’ti idaṃ kilesehi ārakattā, kilesārīnaṃ saṃsāracakkassārānañca hatattā, pāpakaraṇe ca rahābhāvāti atthaṃ sandhāya vuttaṃ.
The statement ‘‘Arahaṃ vaṭṭābhāvenā’’ (Arahat by the absence of the rounds) is made with reference to the meaning that he is far from kilesas, has destroyed the enemies that are kilesas, has destroyed the spokes of the wheel of saṃsāra, and there is no hidden place for him to commit evil.
Câu “Bậc A-la-hán vì không còn luân hồi” (Arahaṃ vaṭṭābhāvena) được nói đến với ý nghĩa là Ngài xa lìa các phiền não, đã tiêu diệt kẻ thù phiền não và các nan đề của bánh xe luân hồi, và không có nơi ẩn náu để làm điều ác.
Idañhi phalena hetānumānadassanaṃ – yathā taṃ dhūmena aggissa, udakoghena upari vuṭṭhiyā, etena ca atthena arahabhāvo hetu, vaṭṭābhāvo phalanti ayaṃ ācariyamati.
This indeed is showing the inference of the cause from the effect—just as the fire from smoke, or rain from a flood. By this meaning, the state of Arahat is the cause, and the absence of rounds is the effect; this is the opinion of the teacher.
Đây là sự suy luận nguyên nhân từ kết quả — như khói cho lửa, như lũ lụt cho mưa lớn. Với ý nghĩa này, trạng thái A-la-hán là nguyên nhân, và sự không còn luân hồi là kết quả; đây là ý kiến của các vị thầy.
‘‘Paccayādīnaṃ, pūjāvisesassa ca arahattā’’ti pana hetunā phalānumānadassanampi siyā yathā taṃ agginā dhūmassa, upari vuṭṭhiyā udakoghassa.
However, showing the inference of the effect from the cause, such as the smoke from fire or a flood from rain, could also be due to his worthiness of requisites and special veneration.
Cũng có thể là sự suy luận kết quả từ nguyên nhân, như lửa cho khói, mưa lớn cho lũ lụt, vì Ngài xứng đáng được cúng dường đặc biệt và các vật phẩm, v.v.
‘‘Sammāsambuddho chadanābhāvenā’’ti idaṃ pana hetunā phalānumānadassanaṃ savāsanasabbakilesacchadanābhāvapubbakattā sammāsambuddhabhāvassa.
The statement ‘‘Sammāsambuddho chadanābhāvenā’’ (Sammāsambuddha by the absence of coverings) is indeed showing the inference of the effect from the cause, because the state of Sammāsambuddha is preceded by the absence of all kilesa-coverings together with their latent tendencies.
Câu “Bậc Chánh Đẳng Giác vì không còn màn che” (Sammāsambuddho chadanābhāvena) là sự suy luận kết quả từ nguyên nhân, vì trạng thái Chánh Đẳng Giác có trước sự không còn tất cả màn che phiền não cùng với khuynh hướng tiềm ẩn.
Arahattamaggena hi vicchadatā, sabbaññutaññāṇena sammāsambuddhabhāvo.
Indeed, the state of being free from coverings (vicchadatā) is by the path of Arahatship, and the state of a Sammāsambuddha is by Omniscience.
Thật vậy, sự không còn màn che là do đạo A-la-hán, và trạng thái Chánh Đẳng Giác là do trí Tuệ Toàn Tri.
‘‘Vivaṭṭo ca vicchado cā’’ti idaṃ hetudvayaṃ.
‘‘Vivaṭṭo ca vicchado cā’’ refers to these two causes.
Hai từ “Vừa thoát khỏi luân hồi (vivaṭṭo) vừa không còn màn che (vicchado)” này là hai nguyên nhân.
Kāmañca ācariyamatiyā phalena hetuanumānadassane vivaṭṭatā phalameva hoti, hetuanumānadassanassa, pana tathāñāṇassa ca hetubhāvato hetuyeva nāmāti veditabbaṃ.
Although, in the teacher’s opinion, in showing the inference of the cause from the effect, the state of being free from rounds (vivaṭṭatā) is indeed the effect, it should be understood that it is called a cause because it is the cause of showing the inference of the cause and of that knowledge.
Mặc dù theo ý kiến của các vị thầy, trong sự suy luận nguyên nhân từ kết quả, trạng thái thoát khỏi luân hồi (vivaṭṭatā) chỉ là kết quả, nhưng cần phải hiểu rằng nó cũng là nguyên nhân vì nó là nguyên nhân của sự suy luận nguyên nhân và của trí tuệ như vậy.
676
Evaṃ padattayavacane hetālaṅkāranayena payojanaṃ dassetvā idāni catuvesārajjavasenapi dassento ‘‘dutiyenā’’tiādimāha.
Having thus shown the purpose of stating the three terms by way of the figure of speech hetālaṅkāra, he now states ‘‘dutiyenā’’ and so on, showing it by way of the four kinds of confidence.
Sau khi trình bày mục đích của việc nói ba từ này theo cách trang sức bằng nguyên nhân, bây giờ, để trình bày theo cách bốn sự tự tin (cattāri vesārajjāni), vị thầy nói: “Với thứ hai” v.v.
Tattha dutiyena vesārajjenāti ‘‘cattārimāni bhikkhave tathāgatassa vesārajjāni, yehi vesārajjehi samannāgato tathāgato āsabhaṃ ṭhānaṃ paṭijānāti, parisāsu sīhanādaṃ nadati, brahmacakkaṃ pavattetī’’tiādinā (a. ni. 4.8; ma. ni. 1.150) bhagavatā vuttakkamena dutiyabhūtena ‘‘khīṇāsavassa te paṭijānato ‘ime āsavā aparikkhīṇā’ti, tatra vata maṃ samaṇo vā brāhmaṇo vā devo vā māro vā brahmā vā koci vā lokasmiṃ saha dhammena paṭicodessatīti nimittametaṃ bhikkhave na samanupassāmi, etamahaṃ bhikkhave nimittaṃ asamanupassanto khemappatto abhayappatto vesārajjappatto viharāmī’’ti paridīpitena vesārajjena.
There, dutiyena vesārajjena refers to the second of the four kinds of confidence (fearlessness), which is described by the Blessed One in the manner stated as: ‘‘Bhikkhus, these are the four kinds of confidence of the Tathāgata, by being endowed with which the Tathāgata claims the foremost state, roars a lion’s roar in assemblies, and sets rolling the supreme Wheel of Dhamma.’’ The second is elucidated as: ‘‘When I declare myself to be one whose āsavas are destroyed, no ascetic or brahman, no god, Māra, Brahmā, or anyone else in the world would, with good reason, reproach me saying, ‘These āsavas of yours are not destroyed.’ Bhikkhus, I do not see any occasion for such a reproach. Not seeing such an occasion, bhikkhus, I dwell having attained security, having attained fearlessness, having attained confidence.’’
Trong đó, với sự tự tin thứ hai (dutiyena vesārajjena) là sự tự tin được Đức Thế Tôn giải thích theo trình tự đã nói: “Này các Tỳ-kheo, có bốn sự tự tin của Như Lai. Với những sự tự tin này, Như Lai tự nhận mình là bậc tối thượng, rống lên tiếng rống sư tử giữa các hội chúng, và chuyển bánh xe Pháp.” (A. Ni. 4.8; Ma. Ni. 1.150). Sự tự tin thứ hai này là: “Khi Ta tự nhận mình là bậc đã đoạn tận các lậu hoặc, không một Sa-môn, Bà-la-môn, chư thiên, Ma vương, Phạm thiên, hay bất kỳ ai trên thế gian này có thể chỉ trích Ta một cách hợp lý rằng: ‘Các lậu hoặc này của Ngài chưa được đoạn tận.’ Này các Tỳ-kheo, Ta không thấy bất kỳ cơ sở nào cho sự chỉ trích như vậy. Này các Tỳ-kheo, không thấy cơ sở đó, Ta sống an toàn, không sợ hãi, và đầy tự tin.”
Purimasiddhīti purimassa ‘‘araha’’nti padassa atthasiddhi arahattasiddhi, dutiyavesārajjassa tadatthabhāvato tena vesārajjena tadatthasiddhīti vuttaṃ hoti.
Purimasiddhi refers to the accomplishment of the meaning of the preceding word ‘‘Arahaṃ,’’ meaning the accomplishment of Arahatship. Since the second kind of confidence has that meaning, it is said that the accomplishment of that meaning is by that confidence.
Thành tựu của từ trước (Purimasiddhi) có nghĩa là sự thành tựu ý nghĩa của từ “A-la-hán” (arahaṃ) trước đó, tức là sự thành tựu A-la-hán. Vì sự tự tin thứ hai có ý nghĩa đó, nên đã nói rằng với sự tự tin đó, ý nghĩa đó được thành tựu.
‘‘Khīṇāsavassa te paṭijānato ‘ime āsavā aparikkhīṇā’ ti’’ādinā vuttameva hi dutiyavesārajjaṃ ‘‘kilesehi ārakattā’’tiādinā vutto ‘‘araha’’nti padassa atthoti.
Indeed, the second kind of confidence, stated as ‘‘When I declare myself to be one whose āsavas are destroyed, ‘These āsavas of yours are not destroyed,’’’ and so on, is the meaning of the word ‘‘Arahaṃ,’’ which is stated as ‘‘being far from kilesas,’’ and so on.
Thật vậy, sự tự tin thứ hai được nói đến bằng câu “Khi Ta tự nhận mình là bậc đã đoạn tận các lậu hoặc, các lậu hoặc này của Ngài chưa được đoạn tận” v.v. chính là ý nghĩa của từ “A-la-hán” được nói đến bằng câu “vì xa lìa các phiền não” v.v.
Tato ca viññāyati ‘‘yathā dutiyena vesārajjena purimasiddhi, evaṃ purimenapi atthena dutiyavesārajjasiddhī’’ti.
From that, it is understood that ‘‘just as the accomplishment of the preceding term is by the second kind of confidence, so too the accomplishment of the second kind of confidence is by the preceding meaning.’’
Từ đó có thể hiểu rằng: “Cũng như sự thành tựu của từ trước là do sự tự tin thứ hai, thì sự thành tựu của sự tự tin thứ hai cũng là do ý nghĩa của từ trước.”
Evañca katvā iminā nayena catuvesārajjavasena padattayavacane payojanadassanaṃ upapannaṃ hoti.
Having done so, the showing of the purpose in stating the three terms by way of this method, according to the four kinds of confidence, becomes well-established.
Như vậy, việc trình bày mục đích của việc nói ba từ này theo cách bốn sự tự tin là hợp lý.
Itarathā hi kiñcipayojanābhāvato idaṃyeva vacanaṃ idha avattabbaṃ siyāti.
Otherwise, if it were taken differently, this very statement would not be said here, due to the absence of any purpose.
Nếu không, vì không có mục đích nào, thì lời nói này không nên được nói ở đây.
Esa nayo sesesupi.
This method applies to the remaining cases as well.
Quy tắc này cũng áp dụng cho các trường hợp còn lại.
677
Paṭhamenāti vuttanayena paṭhamabhūtena ‘‘sammāsambuddhassa te paṭijānato ‘ime dhammā anabhisambuddhā’ti, tatra…pe… viharāmī’’ti paridīpitena vesārajjena.
By the first means by the clarity (vesārajja) declared in the manner stated as the first (clarity): “‘If anyone were to assert of me, the Perfectly Enlightened One (Sammāsambuddha), that these teachings are not fully understood (by me), then...pe...I dwell (unperturbed by such a challenge).’”
Paṭhamenā (thứ nhất) là sự tự tín đã được trình bày theo cách đã nói, là cái thứ nhất, bằng câu: “Nếu có ai nói rằng: ‘Đối với Đức Chánh Đẳng Giác, những pháp này chưa được Ngài tự chứng ngộ hoàn toàn’, thì tôi không thấy có cơ sở để nói như vậy; tôi an trú trong sự không sợ hãi.”
Dutiyasiddhīti dutiyassa ‘‘sammāsambuddho’’ti padassa atthasiddhi buddhattasiddhi tassa tadatthabhāvato.
Dutiyasiddhi means the fulfillment of the meaning of the second term, “Sammāsambuddha,” which is the attainment of Buddhahood, because that (term) has that meaning.
Dutiyasiddhī (sự thành tựu thứ hai) là sự thành tựu ý nghĩa của từ “Sammāsambuddho” (Chánh Đẳng Giác), tức là sự thành tựu Phật tính, vì từ đó có ý nghĩa như vậy.
Tatiyacatutthehīti vuttanayeneva tatiyacatutthabhūtehi ‘‘ye kho pana te antarāyikā dhammā vuttā, te paṭisevato nālaṃ antarāyāyāti, tatra…pe… viharāmī’’ti ca ‘‘yassa kho pana te atthāya dhammo desito, so na niyyāti takkarassa sammā dukkhakkhayāyāti, tatra…pe… viharāmī’’ti (a. ni. 4.8; ma. ni. 1.150) ca paridīpitehi vesārajjehi.
By the third and fourth means by the clarities (vesārajja) declared in the same manner as the third and fourth (clarities): “‘If anyone were to assert that these obstructing phenomena which have been taught are not sufficient to obstruct one who practices them, then...pe...I dwell (unperturbed by such a challenge),’ and ‘If anyone were to assert that this Dhamma, taught for your benefit, does not lead to the complete cessation of suffering for one who practices it, then...pe...I dwell (unperturbed by such a challenge).’”
Tatiyacatutthehī (bằng thứ ba và thứ tư) là bằng những sự tự tín thứ ba và thứ tư đã được trình bày theo cách đã nói, bằng câu: “Nếu có ai nói rằng: ‘Những pháp chướng ngại đã được Ngài nói ra, khi thực hành chúng thì không đủ để gây chướng ngại’, thì tôi không thấy có cơ sở để nói như vậy; tôi an trú trong sự không sợ hãi.” và “Nếu có ai nói rằng: ‘Pháp mà Ngài đã thuyết vì mục đích đó, thì đối với người thực hành, pháp đó không dẫn đến sự diệt khổ hoàn toàn’, thì tôi không thấy có cơ sở để nói như vậy; tôi an trú trong sự không sợ hãi.”
Tatiyasiddhīti tatiyassa ‘‘vivaṭṭacchadā’’ti padassa atthasiddhi vivaṭṭacchadatthasiddhi tehi tassa pākaṭabhāvatoti attho.
Tatiyasiddhi means the fulfillment of the meaning of the third term, “vivaṭṭacchadā” (one whose coverings are removed), which is the fulfillment of the meaning of being one whose coverings are removed, because by these (clarities), that (meaning) becomes evident.
Tatiyasiddhī (sự thành tựu thứ ba) là sự thành tựu ý nghĩa của từ “vivaṭṭacchadā” (đã cởi bỏ mọi che chướng), tức là sự thành tựu ý nghĩa của việc đã cởi bỏ mọi che chướng, vì nhờ những sự tự tín đó mà Ngài trở nên hiển lộ. Đó là ý nghĩa.
‘‘Yāthāvato antarāyikaniyyānikadhammāpadesena hi satthu vivaṭṭacchadabhāvo loke pākaṭo ahosī’’ti (dī. ni. ṭī. 1.258) ācariyena vuttaṃ, vivaṭṭacchadabhāveneva antarāyikaniyyānikadhammadesanāsiddhito ‘‘tatiyena tatiyacatutthasiddhī’’tipi vattuṃ yujjati.
As the teacher has said, “By the declaration of truly obstructing and emancipating phenomena, the Lord’s state of being ‘one whose coverings are removed’ became evident in the world,” it is also proper to say “by the third, the fulfillment of the third and fourth” because the declaration of obstructing and emancipating phenomena is accomplished by the state of being ‘one whose coverings are removed’.
Như bậc Đạo sư đã nói: “Thật vậy, bằng sự thuyết giảng các pháp chướng ngại và các pháp dẫn đến giải thoát chân thật, sự việc bậc Đạo sư đã cởi bỏ mọi che chướng đã trở nên hiển lộ trong thế gian.” Vì sự thuyết giảng các pháp chướng ngại và các pháp dẫn đến giải thoát đã thành tựu chính nhờ việc đã cởi bỏ mọi che chướng, nên cũng có thể nói rằng “bằng thứ ba, sự thành tựu thứ ba và thứ tư”.
678
Evaṃ padattayavacane catuvesārajjavasena payojanaṃ dassetvā idāni cakkhuttayavasenapi dassento ‘‘purimañcā’’tiādimāha.
Thus, having shown the purpose of the three terms in relation to the four clarities, he now says “purimañca” (and the first) and so on, also showing it in relation to the three eyes (cakkhu).
Sau khi trình bày sự liên kết trong việc thuyết giảng ba từ này theo bốn sự tự tín, bây giờ, để trình bày theo ba loại nhãn, bậc Đạo sư đã nói câu “purimañcā” (và cái trước) v.v.
Tattha ca-saddo upanyāsattho.
Here, the particle ca has the meaning of introduction.
Trong đó, từ ca có nghĩa là sự trình bày.
Purimaṃ ‘‘araha’’nti padaṃ bhagavato heṭṭhimamaggaphalattayañāṇasaṅkhātaṃ dhammacakkhuṃ sādheti kilesārīnaṃ, saṃsāracakkassa arānañca hatabhāvadīpanato.
The first term, “Arahaṃ,” establishes the Dhammacakkhu of the Blessed One, which is the knowledge of the three lower paths and their fruits, because it signifies the destruction of the enemies of defilements (kilesā) and the spokes (arā) of the wheel of saṃsāra.
Từ đầu tiên, purimaṃ (cái trước) là “Arahaṃ” (Bậc A-la-hán), thành tựu dhammacakkhu (Pháp nhãn) của Đức Thế Tôn, tức là trí tuệ về ba quả và đạo thấp hơn, vì nó biểu thị sự diệt trừ các kẻ thù phiền não và các nan đề của vòng luân hồi.
Dutiyaṃ ‘‘sammāsambuddho’’ti padaṃ āsayānusayaindriyaparopariyattañāṇasaṅkhātaṃ buddhacakkhuṃ sādheti sammāsambuddhasseva taṃsambhavato.
The second term, “Sammāsambuddho,” establishes the Buddhacakkhu, which is the knowledge of inclinations (āsayānusaya) and the faculties of others (indriyaparopariyatta), because it is only possible for a Sammāsambuddha.
Từ thứ hai, dutiyaṃ (cái thứ hai) là “Sammāsambuddho” (Chánh Đẳng Giác), thành tựu buddhacakkhu (Phật nhãn), tức là trí tuệ về khuynh hướng, tiềm ẩn và căn cơ của chúng sinh, vì trí tuệ đó chỉ có thể xuất hiện ở một vị Chánh Đẳng Giác.
Tadetañhi ñāṇadvayaṃ sāvakapaccekabuddhānaṃ na sambhavati.
Indeed, these two kinds of knowledge are not possible for disciples (sāvaka) or Paccekabuddhas.
Thật vậy, hai loại trí tuệ này không thể có ở các đệ tử và Phật Độc Giác.
Tatiyaṃ ‘‘vivaṭṭacchadā’’ti padaṃ sabbaññutaññāṇasaṅkhātaṃ samantacakkhuṃ sādheti savāsanasabbakilesappahānadīpanato.
The third term, “vivaṭṭacchadā,” establishes the Samantacakkhu (all-seeing eye), which is omniscient knowledge (sabbaññutañāṇa), because it signifies the abandonment of all defilements together with their latent tendencies (vāsana).
Từ thứ ba, tatiyaṃ (cái thứ ba) là “vivaṭṭacchadā” (đã cởi bỏ mọi che chướng), thành tựu samantacakkhu (Toàn giác nhãn), tức là trí tuệ Toàn tri, vì nó biểu thị sự đoạn trừ tất cả phiền não cùng với các khuynh hướng tiềm ẩn.
‘‘Sammāsambuddho’’ti hi vatvā ‘‘vivaṭṭacchadā’’ti vacanaṃ sammāsambuddhabhāvāya savāsanasabbakilesappahānaṃ vibhāvetīti.
Indeed, to say “vivaṭṭacchadā” after having said “Sammāsambuddho” demonstrates the abandonment of all defilements together with their latent tendencies for the state of being a Sammāsambuddha.
Thật vậy, việc nói “vivaṭṭacchadā” sau khi nói “Sammāsambuddho” làm rõ sự đoạn trừ tất cả phiền não cùng với các khuynh hướng tiềm ẩn để đạt được Phật tính Chánh Đẳng Giác.
‘‘Ahaṃ kho pana tāta ambaṭṭha mantānaṃ dātā’’ti idaṃ appadhānaṃ, ‘‘tvaṃ mantānaṃ paṭiggahetā’’ti idameva padhānaṃ samuttejanāvacananti sandhāya ‘‘tvaṃ mantānaṃ paṭiggahetāti iminā’ssa mantesu sūrabhāvaṃ janetī’’ti vuttaṃ, lakkhaṇavibhāvane visadañāṇatāsaṅkhātaṃ sūrabhāvaṃ janetīti attho.
Referring to the statement “‘Indeed, dear Ambaṭṭha, I am the giver of the mantras,’ this is secondary, and ‘you are the receiver of the mantras’ this is the primary encouraging statement,” it is said “tvaṃ mantānaṃ paṭiggahetāti iminā’ssa mantesu sūrabhāvaṃ janetī” (by this, ‘you are the receiver of the mantras,’ he inspires courage in him regarding the mantras), meaning he inspires the courage that consists of clear knowledge in discerning the characteristics (of the Buddha).
Để ám chỉ rằng câu “Này Ambaṭṭha, ta là người ban tặng các bộ Veda” là phụ, và câu “Ngươi là người tiếp nhận các bộ Veda” mới là câu khuyến khích chính, bậc Đạo sư đã nói: “bằng câu ‘Ngươi là người tiếp nhận các bộ Veda’, Ngài đã tạo ra sự dũng mãnh trong các bộ Veda của người ấy”, ý nghĩa là tạo ra sự dũng mãnh, tức là sự minh mẫn trong việc trình bày các tướng tốt.
679
259. Evaṃ bhoti ettha evaṃ-saddo vacanasampaṭicchane nipāto, vacanasampaṭicchanañcettha tathā mayaṃ taṃ bhavantaṃ gotamaṃ vedissāma, tvaṃ mantānaṃ paṭiggahetāti ca evaṃ pavattassa pokkharasātino vacanassa sampaṭiggaho.
At evaṃ bho (yes, sir), the word evaṃ is a particle indicating acceptance of a statement; and here, acceptance of a statement refers to the acceptance of Pokkharasāti’s words, such as “thus we shall know that reverend Gotama, and you are indeed a recipient of the mantras.”
259. Trong câu Evaṃ bho (Vâng, thưa Ngài), từ evaṃ là một giới từ biểu thị sự chấp nhận lời nói. Ở đây, sự chấp nhận lời nói là việc chấp nhận lời của Bà-la-môn Pokkharasāti đã nói như sau: “Chúng tôi sẽ biết về Tôn giả Gotama như vậy, và Ngài là người tiếp nhận các bộ Veda.”
‘‘Tassattho’’tiādināpi hi tadevatthaṃ dasseti.
Indeed, by “Tassattho” (its meaning) and so on, he also demonstrates that very meaning.
Thật vậy, bằng câu “Tassattho” (ý nghĩa của nó) v.v., bậc Đạo sư cũng trình bày ý nghĩa đó.
Tathā ca vuttaṃ ‘‘brāhmaṇassa pokkharasātissa paṭissutvā’’ti, taṃ panesa ācariyassa samuttejanāya lakkhaṇesu vigatasammohabhāvena buddhamante sampassamānattā vadatīti dassento ‘‘sopī’’tiādimāha.
And it is said: “Having assented to the brahmin Pokkharasāti.” The teacher, however, wishing to show that this (Ambaṭṭha) said it due to his teacher’s encouragement and because he clearly perceived the Buddha’s mantras, being free from delusion regarding the characteristics, says “sopī” (he also) and so on.
Và như đã nói: “Sau khi chấp thuận lời của Bà-la-môn Pokkharasāti”, để trình bày rằng Ambaṭṭha nói điều đó vì sự khuyến khích của bậc Đạo sư và vì anh ta đã không còn lầm lẫn về các tướng tốt, nên đã thấy rõ các bộ Veda của Đức Phật, bậc Đạo sư đã nói câu “sopī” (anh ta cũng) v.v.
Tattha ‘‘tāyāti tāya yathāvuttāya samuttejanāyā’’ti (dī. ni. ṭī. 1.259) ācariyena vuttaṃ, adhunā pana potthakesu ‘‘tāya ācariyakathāyā’’ti pāṭho dissati.
In that (passage), it is stated by the teacher “tāyāti tāya yathāvuttāya samuttejanāyā” (by that means by that encouragement as stated), but nowadays, the reading “tāya ācariyakathāyā” (by that teacher’s discourse) is found in the texts.
Trong đó, bậc Đạo sư đã nói: “tāyā (bằng điều đó) là bằng sự khuyến khích đã nói như vậy.” Tuy nhiên, hiện nay trong các bản kinh có đoạn văn “tāya ācariyakathāyā” (bằng lời nói của bậc thầy đó).
Atthato cesa aviruddhoyeva.
And in terms of meaning, this is not contradictory at all.
Và về ý nghĩa, điều này không mâu thuẫn.
Mantesu satisamuppādikā hi kathā samuttejanāti.
Indeed, a discourse that gives rise to mindfulness (sati) regarding mantras is encouragement.
Thật vậy, lời nói tạo ra sự chú tâm trong các lời khuyên là sự khuyến khích.
680
Ayānabhūminti yānassa abhūmiṃ, yānena yātumasakkuṇeyyaṭṭhānabhūtaṃ, dvārakoṭṭhakasamīpaṃ gantvāti attho.
Ayānabhūmiṃ means a place unsuitable for a vehicle, a place that cannot be reached by a vehicle; the meaning is having gone to the vicinity of the gatehouse.
Ayānabhūmiṃ (nơi không thể đi) nghĩa là một nơi không thích hợp để đi bằng xe, một nơi không thể đi bằng xe, tức là đã đến gần cổng chính.
681
Avisesena vuttassapi vacanassa attho aṭṭhakathāpamāṇato visesena gahetabboti āha ‘‘ṭhitamajjhanhikasamaye’’ti.
He says “ṭhitamajjhanhikasamaye” (at midday) because the meaning of a statement, even if expressed generally, should be understood specifically according to the authority of the Aṭṭhakathā.
Bậc Đạo sư nói: “ṭhitamajjhanhikasamaye” (vào giữa trưa đứng bóng) để chỉ ra rằng ý nghĩa của một lời nói được nói chung chung cũng phải được hiểu một cách đặc biệt theo tiêu chuẩn của Chú giải.
Sabbesamāciṇṇavasena paṭhamanayaṃ vatvā padhānikānameva āveṇikāciṇṇavasena dutiyanayo vutto.
Having stated the first method based on the general practice of all, the second method is stated based on the exclusive practice of those who are primarily engaged in meditation.
Sau khi nói về cách thứ nhất theo thói quen của tất cả mọi người, cách thứ hai được nói theo thói quen đặc biệt của những người chuyên tu.
Divāpadhānikāti divāpadhānānuyuñjanakā, divasabhāge samaṇadhammakaraṇatthaṃ te evaṃ caṅkamantīti vuttaṃ hoti.
Divāpadhānikā means those who earnestly practice meditation during the day; it is said that they walk thus in the daytime for the purpose of practicing the Dhamma of recluses.
Divāpadhānikā (những người chuyên tu ban ngày) là những người chuyên tu thiền định vào ban ngày, nghĩa là họ đi kinh hành như vậy để thực hành pháp Sa-môn vào ban ngày.
Tenāha ‘‘tādisānañhī’’tiādi.
Therefore, he says “tādisānañhī” (indeed, for such ones) and so on.
Vì vậy, bậc Đạo sư đã nói: “tādisānañhī” (thật vậy, đối với những người như vậy) v.v.
‘‘Pariveṇato pariveṇamāgacchanto papañco hoti, pucchitvāva pavisissāmī’’ti ambaṭṭhassa tadupasaṅkamanādhippāyaṃ vibhāvento ‘‘so kirā’’tiādimāha.
Wishing to explain Ambaṭṭha’s intention in approaching, thinking, “Going from one residence to another causes delay; I will enter only after asking,” he says “so kirā” (it is said that he) and so on.
Để trình bày ý định của Ambaṭṭha khi đến gần đó, rằng “Nếu đi từ tu viện này sang tu viện khác thì sẽ mất thời gian, ta sẽ hỏi rồi mới vào,” bậc Đạo sư đã nói câu “so kirā” (nghe nói anh ta) v.v.
682
260. Abhiññātakule jāto abhiññātakolañño. Kāmañca vakkhamānanayena pubbe ambaṭṭhakulamapaññātaṃ, tadā pana paññātanti āha ‘‘tadā kirā’’tiādi.
Born into a well-known family, he is abhiññātakolañño (of well-known lineage). Although Ambaṭṭha’s family was previously unknown in the manner to be explained, it was known then, and so he says “tadā kirā” (indeed, then) and so on.
260. Sinh ra trong một gia đình nổi tiếng, đó là abhiññātakolañño (người thuộc dòng dõi nổi tiếng). Mặc dù trước đây dòng dõi Ambaṭṭha không nổi tiếng theo cách sẽ được nói đến, nhưng lúc đó nó đã nổi tiếng, vì vậy bậc Đạo sư đã nói câu “tadā kirā” (nghe nói lúc đó) v.v.
Rūpajātimantakulāpadesehīti ‘‘ayamīdiso’’ti apadisanahetubhūtehi catūhi rūpajātimantakulehi.
Rūpajātimantakulāpadesehī means by the four (categories) of appearance (rūpa), birth (jāti), mantras, and family (kula), which are the grounds for referring to someone as “such and such.”
Rūpajātimantakulāpadesehī (bởi các chỉ dẫn về hình tướng, dòng dõi, Veda và gia tộc) là bởi bốn yếu tố này, là nguyên nhân để chỉ ra rằng “người này là như vậy”, tức là bởi hình tướng, dòng dõi, Veda và gia tộc.
Yena te bhikkhū cintayiṃsu, tadadhippāyaṃ āvi kātuṃ ‘‘yo hī’’tiādi vuttaṃ.
The statement “yo hī” (indeed, one who) and so on is made to reveal the intention with which those bhikkhus thought.
Để làm rõ ý định mà các tỳ khưu đã suy nghĩ, bậc Đạo sư đã nói câu “yo hī” (thật vậy, ai) v.v.
Avisesato vuttampi visesato viññāyamānatthaṃ sandhāya bhāsitavacananti dasseti ‘‘gandhakuṭiṃ sandhāyā’’ti iminā.
He shows by “gandhakuṭiṃ sandhāyā” (referring to the Gandhakūṭi) that even a generally stated word has a meaning that is specifically understood.
Bậc Đạo sư trình bày rằng lời nói được nói chung chung cũng có ý nghĩa được hiểu một cách đặc biệt, bằng câu “gandhakuṭiṃ sandhāyā” (ám chỉ đến Gandhakuti).
Evamīdisesu.
In similar cases like this.
Tương tự như vậy trong những trường hợp như thế này.
683
Aturitoti avegāyanto, ‘‘aturanto’’tipi pāṭho, soyevattho.
Aturito means not hurrying, “aturanto” is also a reading, and it has the same meaning.
Aturito (không vội vàng) là không hấp tấp. Cũng có đoạn văn “aturanto” (không vội vàng), ý nghĩa cũng vậy.
Kathaṃ pavisanto ataramāno pavisati nāmāti āha ‘‘saṇika’’ntiādi.
How does one enter without hurrying? He says “saṇika” (slowly) and so on.
Bậc Đạo sư nói: “saṇika” (từ từ) v.v. để giải thích làm thế nào mà một người vào mà không vội vàng.
Tattha padappamāṇaṭṭhāneti dvinnaṃ padānaṃ antare muṭṭhiratanapamāṇaṭṭhāne.
Here, padappamāṇaṭṭhāne means at a distance of one fist-span between the two feet.
Trong đó, padappamāṇaṭṭhāne (tại chỗ có kích thước của một bước chân) là tại chỗ có kích thước bằng một nắm tay giữa hai bước chân.
Sinduvāro nāma eko pupphūpagarukkho, yassa setaṃ pupphaṃ hoti, yo ‘‘nigguṇḍī’’ tipi vuccati.
Sinduvāro is a flowering tree that has white flowers and is also called “nigguṇḍī.”
Sinduvāro là tên một loại cây có hoa, hoa của nó màu trắng, còn được gọi là “nigguṇḍī”.
Pamukhanti gandhakuṭigabbhapamukhaṃ.
Pamukhaṃ means the entrance to the Gandhakūṭi chamber.
Pamukhaṃ (lối vào) là lối vào của phòng Gandhakuti.
‘‘Kuñcikacchiddasamīpe’’ti vuttavacanaṃ samatthetuṃ ‘‘dvāraṃ kirā’’tiādi vuttaṃ.
The statement “near the keyhole” is made to support the statement “dvāraṃ kirā” (indeed, the door) and so on.
Để xác nhận lời nói “gần lỗ khóa”, bậc Đạo sư đã nói câu “dvāraṃ kirā” (nghe nói cánh cửa) v.v.
684
261. ‘‘Dānaṃ dadamānehī’’ti iminā pāramitānubhāvena sayameva dvāravivaraṇaṃ dasseti.
By “dānaṃ dadamānehī” (as they gave gifts), it shows the door opening by itself due to the power of the perfections (pāramī).
261. Bằng câu “Dānaṃ dadamānehī” (bởi những người đang bố thí), bậc Đạo sư trình bày rằng cánh cửa tự động mở ra nhờ năng lực của các Ba-la-mật.
685
Bhagavatā saddhiṃ sammodiṃsūti ettha samatthena saṃ-saddena viññāyamānaṃ bhagavato tehi saddhiṃ paṭhamaṃ pavattamodatāsaṅkhātaṃ neyyatthaṃ dassento ‘‘yathā’’tiādimāha.
In Bhagavatā saddhiṃ sammodiṃsu (they exchanged courteous greetings with the Blessed One), wishing to show the implied meaning, which is the Blessed One’s initial expression of joy, understood by the particle saṃ (sam-), he says “yathā” (as) and so on.
Trong câu Bhagavatā saddhiṃ sammodiṃsu (họ đã trò chuyện thân mật với Đức Thế Tôn), để trình bày ý nghĩa ẩn chứa (neyyattha) được hiểu qua từ saṃ (cùng nhau) có nghĩa là sự vui vẻ ban đầu của Đức Thế Tôn với họ, bậc Đạo sư đã nói câu “yathā” (như) v.v.
Bhagavāpi hi ‘‘kacci bho māṇavā khamanīyaṃ, kacci yāpanīya’’ntiādīni pucchanto tehi māṇavehi saddhiṃ pubbabhāsitāya paṭhamaññeva pavattamodo ahosi.
Indeed, the Blessed One, asking “Are you well, young men? Are you comfortable?” and so on, first exchanged pleasantries with those young men through words spoken earlier.
Thật vậy, Đức Thế Tôn cũng đã vui vẻ trò chuyện thân mật với các thanh niên đó ngay từ đầu bằng cách hỏi những câu như “Này các thanh niên, các ông có khỏe không? Các ông có sống được không?” v.v.
Samappavattamodāti bhagavato tadanukaraṇena samaṃ pavattasaṃsandanā.
Samappavattamodā means their harmonious conversation, occurring in imitation of the Blessed One.
Samappavattamodā (sự vui vẻ đồng đều) là sự hòa hợp đồng đều được thực hiện theo sự tương ứng của Đức Thế Tôn.
Tadatthaṃ saha upamāya dassetuṃ ‘‘sītodakaṃ viyā’’tiādi vuttaṃ.
To show that meaning along with an analogy, “sītodakaṃ viyā” (like cool water) and so on is stated.
Để trình bày ý nghĩa đó cùng với ví dụ, bậc Đạo sư đã nói câu “sītodakaṃ viyā” (như nước lạnh) v.v.
Tattha paramanibbutakilesadarathatāya bhagavato sītodakasadisatā, anibbutakilesadarathatāya ca māṇavānaṃ uṇhodakasadisatā daṭṭhabbā.
Here, the Blessed One’s similarity to cool water should be seen in His being completely extinguished of the fever of defilements, and the young men’s similarity to hot water in their not yet having extinguished the fever of defilements.
Trong đó, cần thấy rằng Đức Thế Tôn giống như nước lạnh vì Ngài đã dập tắt hoàn toàn mọi phiền não, và các thanh niên giống như nước nóng vì họ chưa dập tắt được mọi phiền não.
Sammoditanti saṃsanditaṃ.
Sammoditaṃ means conversed harmoniously.
Sammoditaṃ (trò chuyện thân mật) là sự hòa hợp.
Mudasaddo hettha saṃsandaneyeva, na pāmojje, evañhi yathāvuttaupamāvacanaṃ samatthitaṃ hoti.
Here, the word muda means concord (saṃsandana), not joy (pāmojja). For thus, the simile statement that has been stated becomes suitable.
Ở đây, từ muda chỉ có nghĩa là hòa hợp, không phải là hoan hỷ, vì như vậy thì lời ví dụ đã được nói mới có ý nghĩa trọn vẹn.
Tathā hi vuttaṃ ‘‘ekībhāva’’nti, sammodanakiriyāya samānataṃ ekarūpatanti attho.
And so it is said, "oneness," meaning sameness, uniformity, with the act of friendly converse.
Do đó, đã nói “nhất thể” (ekībhāvaṃ), nghĩa là sự đồng nhất, một hình thái trong hành động hòa hợp.
686
Khamanīyanti ‘‘catucakkaṃ navadvāraṃ sarīrayantaṃ dukkhabahulatāya sabhāvato dussahaṃ kacci khamituṃ sakkuṇeyya’’nti pucchanti, yāpanīyanti āhārādipaccayapaṭibaddhavuttikaṃ cirappabandhasaṅkhātāya yāpanāya kacci yāpetuṃ sakkuṇeyyaṃ, sīsarogādiābādhābhāvena kacci appābādhaṃ, dukkhajīvikābhāvena kacci appātaṅkaṃ, taṃtaṃkiccakaraṇe uṭṭhānasukhatāya kacci lahuṭṭhānaṃ, tadanurūpabalayogato kacci balaṃ, sukhavihāraphalasabbhāvena kacciphāsuvihāro atthīti sabbattha kacci-saddaṃ yojetvā attho veditabbo.
Khamanīya means asking, "Is this body-machine, with its four wheels and nine doors, which is naturally hard to endure due to its abundance of suffering, able to be endured?" Yāpanīya means, "Is it able to be sustained by sustenance dependent on food and other requisites, a long-lasting sustenance?" Kacci appābādhaṃ means, "Is there no illness like a headache?" Kacci appātaṅkaṃ means, "Is there no affliction due to a miserable livelihood?" Kacci lahuṭṭhānaṃ means, "Is there ease in rising for various duties?" Kacci balaṃ means, "Is there strength commensurate with that?" And kacci phāsuvihāro means, "Is there a comfortable dwelling, the fruit of living happily?" In all these instances, the meaning should be understood by connecting the word kacci.
Khamanīya có nghĩa là hỏi: “Cái cỗ máy thân thể bốn bánh, chín cửa, vốn dĩ khó chịu đựng vì đầy rẫy khổ đau, có thể chịu đựng được không?” Yāpanīya có nghĩa là hỏi: “Có thể duy trì sự sống được không, tức là sự duy trì lâu dài phụ thuộc vào các yếu tố như thức ăn?” Kacci appābādhaṃ có nghĩa là hỏi: “Có ít bệnh tật không, không có các bệnh như đau đầu?” Kacci appātaṅkaṃ có nghĩa là hỏi: “Có ít tai ương không, không có cuộc sống khổ sở?” Kacci lahuṭṭhānaṃ có nghĩa là hỏi: “Có dễ dàng đứng dậy không, dễ dàng thực hiện các công việc cần làm?” Kacci balaṃ có nghĩa là hỏi: “Có sức mạnh không, do có năng lực phù hợp?” Kacciphāsuvihāro atthīti có nghĩa là hỏi: “Có sự an lạc không, do có kết quả của sự sống an lành?” Tất cả những điều này phải được hiểu bằng cách thêm từ "kacci" vào mỗi câu hỏi.
Balappattā pīti pītiyeva. Taruṇā pīti pāmojjaṃ. Sammodanaṃ janeti karotīti sammodanikaṃ, tadeva sammodaniyaṃ ka-kārassa ya-kāraṃ katvā.
Pīti that has attained strength is pīti itself. Young pīti is pāmojja. That which generates or causes friendly converse (sammodana) is sammodanikaṃ; by changing the 'ka' to 'ya', it becomes sammodaniyaṃ.
Pīti đạt đến sức mạnh là pīti (hỷ) thuần túy. Pīti non trẻ là pāmojjaṃ (hoan hỷ). Tạo ra sự hòa hợp, làm cho sự hòa hợp được gọi là sammodanikaṃ, chính nó là sammodaniyaṃ khi chữ "ka" được đổi thành "ya".
Sammodetabbato sammodanīyanti imamatthaṃ dasseti ‘‘sammodituṃ yuttabhāvato’’ti iminā.
The meaning, "It is sammodanīya because it is fit to be conversed with," is shown by this phrase: "sammodituṃ yuttabhāvato" (because it is fit to converse).
Để chỉ ý nghĩa này, tức là đáng được hòa hợp, đã nói “sammodituṃ yuttabhāvato” (vì đáng được hòa hợp).
Evaṃ ācariyehi vuttaṃ.
Thus it has been stated by the teachers.
Lời này được các bậc đạo sư nói.
Sammodituṃ arahatīti sammodanikaṃ, tadeva sammodaniyaṃ yathāvuttanayenāti imamatthampi dassetīti daṭṭhabbaṃ.
It should be understood that this also shows the meaning that that which is fit to be conversed with (sammodituṃ arahati) is sammodanikaṃ, and that same, by the aforementioned method, is sammodaniyaṃ.
Điều đáng được hòa hợp là sammodanikaṃ, chính nó là sammodaniyaṃ theo cách đã nói, ý nghĩa này cũng phải được hiểu là đã được chỉ ra.
‘‘Sāretu’’nti etassa ‘‘nirantaraṃ pavattetu’’nti atthavacanaṃ.
"Sāretuṃ" has the meaning: "to keep continuously active."
Từ “sāretuṃ” có nghĩa là “tiếp tục không ngừng nghỉ.”
Saritabbabhāvatoti anussaritabbabhāvato.
Saritabbabhāvato means "from the state of being worthy of remembrance (anussaritabbabhāvato)."
Saritabbabhāvato có nghĩa là vì đáng được nhớ lại.
‘‘Sāretuṃ arahatī’’ti atthe yathāpadaṃ dīghena ‘‘sāraṇīya’’nti vuttaṃ.
In the sense of "fit to be kept in mind" (sāretuṃ arahatīti), it is said "sāraṇīya" with a long vowel, according to the word form.
Trong ý nghĩa “đáng được nhớ lại,” từ “sāraṇīya” được nói với nguyên âm dài theo đúng từ ngữ.
‘‘Saritabba’’nti atthe pana ‘‘saraṇīya’’nti vattabbe dīghaṃ katvā ‘‘sāraṇīya’’nti vuttanti veditabbaṃ.
However, in the sense of "to be remembered" (saritabbaṃ), although it should be said "saraṇīya," it is understood that it is said "sāraṇīya" by making the vowel long.
Tuy nhiên, trong ý nghĩa “đáng được nhớ,” đáng lẽ phải nói “saraṇīya,” nhưng lại được nói là “sāraṇīya” với nguyên âm dài. Điều này cần được hiểu rõ.
Evaṃ saddato atthaṃ dassetvā idāni atthamattato dassetuṃ ‘‘suyyamānasukhato’’tiādi vuttaṃ.
Thus having shown the meaning from the perspective of sound, now to show it purely from the perspective of meaning, "suyyamānasukhato" and so on is stated.
Sau khi giải thích ý nghĩa từ ngữ như vậy, bây giờ để giải thích ý nghĩa thuần túy, đã nói “suyyamānasukhato” và các từ tương tự.
Tattha suyyamānasukhatoti āpāthamadhurattamāha, anussariyamānasukhatoti vimaddaramaṇīyattaṃ.
There, suyyamānasukhato refers to the sweetness when heard, and anussariyamānasukhato refers to the delightfulness when reflected upon.
Trong đó, suyyamānasukhato chỉ sự ngọt ngào ngay khi nghe, còn anussariyamānasukhato chỉ sự thích thú khi suy ngẫm.
Byañjanaparisuddhatāyāti sabhāvaniruttibhāvena tassā kathāya vacanacāturiyaṃ, atthaparisuddhatāyāti atthassa nirupakkilesattaṃ.
Byañjanaparisuddhatāyā refers to the articulateness (vacanacāturiyaṃ) of that speech, by reason of its inherent grammatical correctness; atthaparisuddhatāyā refers to the purity of the meaning, being free from defilements.
Byañjanaparisuddhatāya chỉ sự khéo léo trong lời nói của bài thuyết pháp đó, do bản chất ngôn ngữ thuần khiết; atthaparisuddhatāya chỉ sự không ô nhiễm của ý nghĩa.
Anekehi pariyāyehīti anekehi kāraṇehi.
Anekehi pariyāhehīti means by many reasons.
Anekehi pariyāyehi có nghĩa là bằng nhiều lý do.
687
Apasādessāmīti maṅkuṃ karissāmi.
Apasādessāmīti means, "I will put him to shame."
Apasādessāmī có nghĩa là ta sẽ làm cho xấu hổ.
Ubhosu khandhesu sāṭakaṃ āsajjetvā kaṇṭhe olambanaṃ sandhāya ‘‘kaṇṭhe olambitvā’’ti vuttaṃ.
"Kaṇṭhe olambitvā" is stated with reference to hanging the outer robe (sāṭakaṃ) over both shoulders, letting it dangle around the neck.
“Kaṇṭhe olambitvā” được nói để chỉ việc vắt tấm vải lên hai vai và buông thõng xuống cổ.
Dussakaṇṇaṃ gahetvāti nivatthasāṭakassa koṭiṃ ekena hatthena gahetvā.
Dussakaṇṇaṃ gahetvā means taking the corner of the worn robe with one hand.
Dussakaṇṇaṃ gahetvā có nghĩa là nắm một góc của tấm vải đang mặc bằng một tay.
Caṅkamitumāruhanaṃ sandhāya ‘‘caṅkamaṃ abhiruhitvā’’ti āha.
"Caṅkamaṃ abhiruhitvā" is said with reference to ascending to the cloister to walk.
“Caṅkamaṃ abhiruhitvā” được nói để chỉ việc bước lên chỗ kinh hành.
Dhātusamatāti rasādidhātūnaṃ samāvatthatā, arogatāti attho.
Dhātusamatā means the equilibrium of the elements such as humours, which is freedom from illness.
Dhātusamatā có nghĩa là sự cân bằng của các yếu tố như tinh chất, tức là không bệnh tật.
Pāsādikatthanti pasādajananatthaṃ ‘‘gatagataṭṭhāne’’ti iminā sambandho.
The word pāsādikatthaṃ (for pleasantness) is to be connected with "gatagataṭṭhāne" (in every place one goes), meaning "for generating confidence."
Pāsādikatthaṃ có nghĩa là để tạo sự hoan hỷ, có liên quan đến “gatagataṭṭhāne” (ở mỗi nơi đến).
‘‘Pāsādikattā’’tipi pāṭho, tassattho – aṅgapaccaṅgānaṃ pasādāvahattāti, ‘‘uppannabahumānā’’ti iminā sambandho.
There is also the reading "pāsādikattā," the meaning of which is: "due to the pleasing nature of the limbs and sub-limbs," and this is to be connected with "uppannabahumānā" (having arisen with great reverence).
Cũng có bản đọc là “pāsādikattā,” nghĩa là vì sự hoan hỷ của các bộ phận cơ thể, có liên quan đến “uppannabahumānā” (tạo ra nhiều sự tôn kính).
Uppaṇḍanakathanti avahasitabbatāyuttakathaṃ.
Uppaṇḍanakathaṃ means speech fit for derision.
Uppaṇḍanakathaṃ có nghĩa là lời nói đáng bị chế giễu.
‘‘Anācārabhāvasāraṇīya’’nti tassa visesanaṃ, anācārabhāvena sāraṇīyaṃ ‘‘anācāro vatāya’’nti saritabbakanti attho.
"Anācārabhāvasāraṇīyaṃ" is an epithet of that, meaning that it is to be remembered due to its improper conduct, i.e., "this is indeed improper conduct" (anācāro vatāyaṃ), thus to be remembered.
“Anācārabhāvasāraṇīyaṃ” là một tính từ của nó, có nghĩa là đáng được nhớ đến vì hành vi bất chính, tức là “Thật là một hành vi bất chính!”
688
262. Kātuṃ dukkaramasakkuṇeyyaṃ kiccamayaṃ ārabhīti dassetuṃ ‘‘bhavaggaṃ gahetukāmo viyā’’tiādi vuttaṃ.
To show that he was undertaking a difficult and impossible task, it is said, "as if he desired to grasp the highest realm of existence (bhavaggaṃ gahetukāmo viya)," and so on.
262. Để chỉ rằng ông ta đã bắt đầu một việc khó làm và không thể thực hiện được, đã nói “bhavaggaṃ gahetukāmo viyā” và các từ tương tự.
Asakkuṇeyyañhetaṃ sadevakenapi lokena, yadidaṃ bhagavato apasādanaṃ.
For it is impossible, even for the world with its devas, to bring disrespect upon the Blessed One.
Thật vậy, việc làm cho Thế Tôn mất lòng tin là điều mà ngay cả thế gian cùng chư thiên cũng không thể làm được.
Tenāha ‘‘aṭṭhāne vāyamatī’’ti.
Therefore, he said, "aṭṭhāne vāyamatī" (he strives in vain).
Vì vậy, đã nói “aṭṭhāne vāyamati” (ông ta nỗ lực một cách vô ích).
Handa tena saddhiṃ mantemīti evaṃ aṭṭhāne vāyamantopi ayaṃ bālo ‘‘mayi kiñci akathente mayā saddhiṃ uttari kathetumpi na visahatī’’ti mānameva paggaṇhissati, kathente pana kathāpasaṅgenassa jātigotte vibhāvite mānaniggaho bhavissati, ‘‘handa tena saddhiṃ mantemī’’ti bhagavā ambaṭṭhaṃ māṇavaṃ etadavocāti attho.
"Handa tena saddhiṃ mantemī" (Well then, I shall converse with him) means: "Though this foolish youth strives in vain, if I say nothing, he will only increase his pride, thinking, 'He cannot even speak further with me.' But if I speak, and his birth and lineage are revealed in the course of the conversation, his pride will be humbled. Therefore, the Blessed One said this to the brahmin student Ambaṭṭha."
Handa tena saddhiṃ mantemī (Vậy thì, ta hãy nói chuyện với hắn): Nếu ta không nói gì, kẻ ngu này sẽ càng kiêu ngạo, nghĩ rằng “Nếu ta không nói gì, hắn sẽ không dám nói chuyện với ta nữa.” Nhưng nếu ta nói chuyện, nhân dịp cuộc nói chuyện, khi dòng dõi và gia tộc của hắn được tiết lộ, sự kiêu ngạo của hắn sẽ bị dập tắt. Ý nghĩa là Thế Tôn đã nói điều này với thanh niên Ambhaṭṭha.
Ācārasamācārasikkhāpanena ācariyā, tesaṃ pana ācariyānaṃ pakaṭṭhā ācariyāti pācariyā yathā ‘‘papitāmaho’’ti imamatthaṃ dassetuṃ ‘‘ācariyehi ca tesaṃ ācariyehi cā’’ti vuttaṃ.
Those who teach good conduct are ācariyā (teachers); and the excellent teachers of those teachers are pācariyā (great teachers), just as in "papitāmaho" (great-grandfather). To show this meaning, it is said: "ācariyehi ca tesaṃ ācariyehi cā" (by teachers and their teachers).
Những người dạy dỗ về hạnh kiểm và hành vi đúng đắn là ācariyā (thầy giáo). Những người thầy cao cả hơn các vị thầy đó là pācariyā, giống như từ “papitāmaho” (ông nội). Để chỉ ý nghĩa này, đã nói “ācariyehi ca tesaṃ ācariyehi cā” (từ các vị thầy và từ các vị thầy của họ).
689
Paṭhamaibbhavādavaṇṇanā
First Explanation of Ibbha
Giải thích về Ibbhavāda thứ nhất
690
263. Kiñcāpi ‘‘sayāno vā’’tiādivacanaṃ na vattabbaṃ, mānavasena pana yugaggāhaṃ karonto vadatīti dassento ‘‘kāmaṃ tīsū’’tiādimāha.
Although the statement "sayāno vā" (or lying down) and so on should not be made, the teacher states "kāmaṃ tīsu" (indeed, in three) and so on, to show that he speaks out of pride, taking a challenging stance.
263. Mặc dù không nên nói những lời như “sayāno vā” (hoặc đang nằm), nhưng để chỉ rằng ông ta nói như vậy do sự kiêu ngạo và muốn đối đầu, đã nói “kāmaṃ tīsu” (dù sao thì trong ba) và các từ tương tự.
Tattha tīsu iriyāpathesūti ṭhānagamananisajjāsu.
There, tīsu iriyāpathesu means in the three postures: standing, walking, and sitting.
Trong đó, tīsu iriyāpathesu có nghĩa là trong ba oai nghi: đứng, đi, ngồi.
Tesveva hi ācariyena saddhiṃ sallapitumarahati, na tu sayane garukaraṇīyānaṃ sayānānampi sammukhā garukārehi sayanassa akattabbabhāvato.
For it is only in these that one should converse with a teacher, not while lying down, as lying down is not to be done by those who show respect in the presence of revered individuals who are also lying down.
Thật vậy, chỉ trong những oai nghi đó mới nên nói chuyện với thầy, chứ không phải khi nằm, vì việc nằm đối diện với những người đáng kính đang nằm là điều không nên làm đối với những người trò kính trọng.
Kathāsallāpanti kathāvasena yugaggāhakaraṇatthaṃ sallapanaṃ.
Kathāsallāpaṃ means a conversation for the purpose of challenging, by way of speech.
Kathāsallāpaṃ có nghĩa là nói chuyện để đối đầu bằng lời nói.
Sayānena hi ācariyena saddhiṃ sayānassa kathā nāma ācāro na hoti, tathāpetaṃ itarehi sadisaṃ katvā kathanaṃ idha kathāsallāpo.
Indeed, to converse with a lying teacher while one is also lying down is not proper conduct. Nevertheless, calling such a conversation a kathāsallāpa here is done by treating it as similar to the others.
Thật vậy, việc một đệ tử đang nằm nói chuyện với một vị thầy đang nằm không phải là hành vi đúng đắn. Tuy nhiên, ở đây, việc nói chuyện đó được coi là tương đương với những hành vi khác.
691
Yaṃ panetaṃ ‘‘sayāno vā hi bho gotama brāhmaṇo sayānena brāhmaṇena saddhiṃ sallapitumarahatī’’ti vuttassa sallāpassa anācārabhāvavibhāvanaṃ satthārā ambaṭṭhena saddhiṃ kathentena kataṃ, taṃ pāḷivasena saṅgītimanāruḷhampi agarahitāya ācariyaparamparāya yāvajjatanā samābhatanti ‘‘ye ca kho te bho gotamā’’tiādikāya uparipāḷiyā sambandhabhāvena dassento ‘‘tato kirā’’tiādimāha.
Now, regarding the statement "sayāno vā hi bho gotama brāhmaṇo sayānena brāhmaṇena saddhiṃ sallapitumarahatī" (Indeed, Reverend Gotama, a brahmin lying down may converse with a brahmin lying down), the Buddha, while conversing with Ambaṭṭha, clarified that such conversation is improper. Even though this clarification was not included in the recensions (saṅgīti) in the form of a Pali text, it has been handed down through an unblamed lineage of teachers up to the present day. The teacher states "tato kirā" (from that, it is said) and so on, to show its connection with the subsequent Pali passage beginning with "ye ca kho te bho gotamā" (and indeed, Reverend Gotama, those who).
Điều mà Đức Đạo Sư đã làm khi nói chuyện với Ambhaṭṭha, tức là việc làm rõ rằng cuộc nói chuyện được nói là “này Gotama, một Bà-la-môn đang nằm có thể nói chuyện với một Bà-la-môn đang nằm” là một hành vi bất chính, điều đó, mặc dù không được đưa vào kinh điển (Pāḷi), nhưng đã được truyền lại qua các thế hệ thầy tổ không bị chỉ trích cho đến ngày nay. Để chỉ sự liên hệ của điều đó với đoạn kinh trên bắt đầu bằng “ye ca kho te bho gotamā,” đã nói “tato kirā” và các từ tương tự.
Gorūpanti go nūna rūpakavasena vuttattā, rūpasaddassa ca tabbhāvavuttito.
Gorūpaṃ means "Is it a cow, indeed?" This is said by way of metaphor (rūpaka) because the word rūpa is used here in the sense of being like that.
Gorūpaṃ (hình dáng bò) được nói theo nghĩa ẩn dụ, vì từ rūpa cũng có nghĩa là bản chất của nó.
Yadi ahīḷento bhaveyya, ‘‘muṇḍā samaṇā’’ti vadeyya, hīḷento pana garahatthena ka-saddena padaṃ vaḍḍhetvā ‘‘muṇḍakā samaṇakā’’ti vadatīti dassetuṃ ‘‘muṇḍe muṇḍā’’tiādi vuttaṃ.
If he had not intended to scorn, he would have said "muṇḍā samaṇā" (shaven recluses). But intending to scorn, he added the particle 'ka' with a contemptuous sense, increasing the word, and said "muṇḍakā samaṇakā" (shaven little recluses). The phrase "muṇḍe muṇḍā" (shaven, shaven ones) and so on is stated to show that this is what he said.
Nếu không muốn chế giễu, ông ta sẽ nói “muṇḍā samaṇā” (các Sa-môn đầu trọc). Nhưng vì muốn chế giễu, ông ta đã thêm tiếp vị ngữ “ka” mang ý nghĩa chế giễu vào từ, nói “muṇḍakā samaṇakā” (các Sa-môn đầu trọc con). Để chỉ điều này, đã nói “muṇḍe muṇḍā” và các từ tương tự.
Ibbhāti gahapatikāti atthamattavacanaṃ, saddato pana ibhassa payogo ibho uttarapadalopena, taṃ ibhaṃ arahantīti ibbhā dvittaṃ katvā.
Ibbhāti gahapatikā is merely an explanation of the meaning. From the grammatical perspective, the application of ibha is ibho by ellipsis of the latter part of the compound. Those who are worthy of that ibha are ibbhā, by duplication (dvittaṃ) of the consonant.
Ibbhāti gahapatikā là lời giải thích ý nghĩa. Về mặt ngữ pháp, từ ibha được dùng cho con voi, và khi hậu tố bị lược bỏ, nó trở thành ibho. Những người xứng đáng với con voi đó được gọi là ibbhā khi được nhân đôi.
Kiṃ vuttaṃ hoti – yathā sobhanaṃ gamanato ibhasaṅkhāto hatthivāhanabhūto parassa vasena pavattati, na attano, evametepi brāhmaṇānaṃ sussūsakā suddā parassa vasena pavattanti, na attano, tasmā ibhasadisapayogatāya ibbhāti.
What is meant? Just as an elephant (ibha), which is a beautiful conveyance, moves according to another's will, not its own, so too these Suddas, who are subservient to brahmins, move according to another's will, not their own. Therefore, they are ibbhā due to their being used like elephants.
Điều muốn nói là gì? Giống như một con voi được gọi là ibha, một phương tiện vận chuyển tốt, hoạt động theo ý người khác chứ không theo ý mình, những người Śūdra phục vụ các Bà-la-môn này cũng hoạt động theo ý người khác chứ không theo ý mình. Do đó, vì việc sử dụng giống như con voi, họ được gọi là ibbhā.
Te pana kuṭumbikatāya gharavāsino gharasāmikā hontīti atthamattaṃ dasseti ‘‘gahapatikā’’ti iminā.
The meaning that these ibbhā are householders (gharavāsino) and masters of households (gharasāmikā) due to their domesticity (kuṭumbikatāya) is shown by the word "gahapatikā."
Những người này, vì là chủ gia đình và sống trong nhà do có tài sản, được gọi là “gahapatikā” (gia chủ), điều này chỉ ra ý nghĩa thuần túy.
692
Kaṇhāti kaṇhajātikā.
Kaṇhā means of a dark caste.
Kaṇhā có nghĩa là thuộc chủng tộc đen.
Dvijā eva hi suddhajātikā, na itareti tassādhippāyo.
His intention is that only brahmins (dvijā) are of a pure caste, not others.
Ý của ông ta là chỉ có dvija (người sinh hai lần) mới thuộc chủng tộc thuần khiết, còn những người khác thì không.
Tenāha ‘‘kāḷakā’’ti.
Therefore, he said, "kāḷakā" (dark-skinned ones).
Vì vậy, đã nói “kāḷakā” (da đen).
Pitāmahabhāvena ñātibandhavattā bandhu. Tenāha ‘‘pitāmahoti voharantī’’ti.
Bandhu refers to kinsmen and relatives by being a grandfather. Therefore, it is said, "pitāmahoti voharantī" (they are called grandfathers).
Vì là người thân do là ông nội, nên được gọi là bandhu (người thân). Vì vậy, đã nói “pitāmahoti voharantī” (gọi là ông nội).
Apaccāti puttā.
Apaccā means sons.
Apaccā có nghĩa là con cái.
Mukhato nikkhantāti brāhmaṇānaṃ pubbapurisā brahmuno mukhato nikkhantā, ayaṃ tesaṃ paṭhamuppattīti adhippāyo.
"Emerged from the mouth" means that the brahmins' ancestors emerged from the mouth of Brahmā; this is the meaning that this was their first origin.
Mukhato nikkhantā (từ miệng mà ra) nghĩa là: Tổ tiên của các Bà-la-môn đã từ miệng của Phạm Thiên mà ra. Ý muốn nói đây là sự xuất hiện đầu tiên của họ.
Sesapadesupi eseva nayo.
In the remaining passages, the same method should be understood.
Trong các đoạn còn lại cũng theo cách này.
Ayaṃ panettha viseso – ‘‘ibbhā kaṇhā’’ti vatvā ‘‘bandhupādāpaccā’’ti vadanto kulavasena samaṇā vessakulapariyāpannā, paṭhamuppattivasena pana brahmuno piṭṭhipādato nikkhantā, na pakativessā viya nābhitoti dassetīti, idaṃ panassa ‘‘mukhato nikkhantā’’tiādivacanatopi ativiya asamavekkhitapubbavacanaṃ catuvaṇṇapariyāpannasseva samaṇabhāvasambhavato.
Herein, this is the distinction: stating "commoners are dark-skinned" and then "descendants from the feet of Brahmā," the young brahmin Ambaṭṭha indicates that by lineage, ascetics are included in the merchant class, but in terms of their first origin, they emerged from Brahmā's feet, not from his navel like ordinary merchants. This statement of his, however, "descendants from the feet," is even more inconsistent than his previous statement, "emerged from the mouth," because the state of being an ascetic is possible only for one belonging to any of the four castes.
Điểm đặc biệt ở đây là: Khi nói ‘‘ibbhā kaṇhā’’ (giàu có và đen tối), và rồi nói ‘‘bandhupādāpaccā’’ (con cháu của những người thân thuộc và nô lệ), Ambaṭṭha muốn chỉ ra rằng, theo dòng dõi, các Sa-môn thuộc về giai cấp thương gia; nhưng theo sự xuất hiện ban đầu, họ từ gót chân của Phạm Thiên mà ra, không phải từ rốn như những thương gia bình thường. Tuy nhiên, lời nói này của Ambaṭṭha, so với lời ‘‘mukhato nikkhantā’’ (từ miệng mà ra) và những lời tương tự, lại là một lời nói hoàn toàn thiếu cân nhắc trước, vì sự xuất hiện của Sa-môn chỉ có thể xảy ra trong bốn giai cấp.
Aniyametvāti avisesetvā, anuddesikabhāvenāti attho.
"Undetermined" means without distinction; it means by way of being unspecified.
Aniyametvā (không quy định) nghĩa là: không phân biệt, tức là theo cách không chỉ định cụ thể.
693
Mānameva nissāya kathesīti mānamevāpassayaṃ katvā attānaṃ ukkaṃsento, pare ca vambhento ‘‘muṇḍakā samaṇakā’’tiādivacanaṃ kathesi.
"He spoke relying on conceit" means that he spoke with words like "shavelings, wretched ascetics," exalting himself and disparaging others by taking conceit as his sole support.
Mānameva nissāya kathesī (nương vào kiêu mạn mà nói) nghĩa là: nương vào sự kiêu mạn, tự tán dương mình và khinh miệt người khác, mà nói những lời như ‘‘những kẻ đầu trọc, những Sa-môn thấp kém’’.
Jānāpessāmīti attano gottapamāṇaṃ yāthāvato vibhāvanena viññāpessāmi.
"I will make him know" means, "I will make him understand by revealing the true measure of his lineage."
Jānāpessāmī (sẽ cho biết) nghĩa là: sẽ làm cho biết rõ về dòng dõi và địa vị của mình một cách chân thật.
Atthoti hitaṃ, icchitavatthu vā, taṃ pana kattabbakiccamevāti vuttaṃ ‘‘āgantvā kattabbakiccasaṅkhāto attho’’ti, so etassa atthīti atthikaṃ yathā ‘‘daṇḍiko’’ti.
"Benefit" means well-being, or a desired object; that desired object is simply the task to be done, as stated in "the benefit, meaning the task to be done upon arrival." If this (benefit) exists for it (the mind), then it is "attendant with benefit," just as "one with a staff" is called "daṇḍika."
Attho (mục đích) nghĩa là: điều lợi ích, hoặc điều mong muốn. Điều đó được nói là công việc cần phải làm, như trong câu ‘‘āgantvā kattabbakiccasaṅkhāto attho’’ (mục đích là công việc cần phải đến và làm). Vì điều đó có ở anh ta, nên gọi là atthikaṃ (có mục đích), giống như ‘‘daṇḍiko’’ (người có gậy).
Dutiyassapi puggalavācakassa tadassatthipaccayassa vijjamānattā paṭhamena tadārammaṇikacittameva viññāyatīti āha ‘‘tassa māṇavassa citta’’nti.
Since the second possessive suffix, referring to a person, also exists for the meaning of "one who has it," it is understood that the first (suffix) refers only to the mind focused on that, hence it says, "the mind of that youth."
Vì từ chỉ người thứ hai cũng có hậu tố sở hữu, nên từ đầu tiên chỉ tâm thức có đối tượng đó, và Ngài nói ‘‘tassa māṇavassa citta’’ (tâm của thanh niên đó).
Atthikamassa atthīti atthikavā yathā ‘‘guṇavā’’ti.
"If he has a purpose, he is purposeful," just as "one with qualities" is "guṇavā."
Atthikamassa atthīti atthikavā (người có mục đích) giống như ‘‘guṇavā’’ (người có đức tính).
694
‘‘Yāyeva kho panatthāyā’’ti liṅgavipallāsavasena vuttanti dasseti ‘‘yeneva kho panatthenā’’ti iminā.
The Teacher shows that the phrase "for whatever purpose" is stated by way of a gender reversal, with the word "for whatever purpose (masculine)."
‘‘Yāyeva kho panatthāyā’’ được nói theo cách đảo ngược giống cái, được chỉ ra bởi ‘‘yeneva kho panatthenā’’.
Tenevāha ‘‘tameva atthanti idaṃ purisaliṅgavaseneva vutta’’nti.
Therefore, he says, "That very purpose — this is stated by way of the masculine gender."
Do đó, Ngài nói ‘‘tameva atthanti idaṃ purisaliṅgavaseneva vutta’’ (từ này được nói theo giống đực).
Tattha hi sābhāvikaliṅgatādassanena idha asābhāvikaliṅgatāsiddhīti.
For in that statement, by showing the natural gender, the unnatural gender is established here.
Vì ở đó, sự hiển thị giống tự nhiên chứng minh sự bất tự nhiên của giống ở đây.
Ayaṃ panettha aṭṭhakathāto aparo nayo – yāya atthāyāti pulliṅgavaseneva tadatthe sampadānavacanaṃ, yassa kattabbakiccasaṅkhātassa atthassa atthāyāti atthoti.
Herein, this is another method from the Commentary: "for whatever purpose" is a dative word in the masculine gender for that meaning, meaning "for the purpose of whatever task to be done."
Đây là một cách diễn giải khác ngoài Aṭṭhakathā: yāya atthāyā là từ chỉ cách cách sở hữu trong ý nghĩa đó theo giống đực, nghĩa là vì mục đích của công việc cần làm.
Assāti ambaṭṭhassa dassetvāti sambandho.
"His," meaning Ambaṭṭha's. The connection is "having shown."
Assā (của Ambaṭṭha) được liên kết với ‘‘dassetvā’’ (sau khi chỉ ra).
Aññesaṃ santikaṃ āgatānanti garuṭṭhāniyānaṃ santikamupagatānaṃ sādhurūpānaṃ.
"To those who have come to others" means to worthy individuals who have approached venerable persons.
Aññesaṃ santikaṃ āgatāna (những người đã đến gần những người khác) nghĩa là: những người tốt lành đã đến gần những người đáng kính.
Vattanti tesaṃ samāciṇṇaṃ.
"Practice" means their customary conduct.
Vatta (phép tắc) nghĩa là: những hành vi mà họ đã thực hành.
Pakaraṇatoyeva ‘‘ācariyakule’’ti attho viññāyati, ‘‘avusitavā’’ti ca asikkhitabhāvoyeva vohāravasena vutto yathā taṃ cīvaradānaṃ ticīvarena acchādesīti.
From the context itself, the meaning "in the teacher's household" is understood, and "avusitavā" is said by way of common usage to mean merely "unlearned," just as that robe-giving covered with three robes is expressed.
Từ ngữ cảnh, ý nghĩa ‘‘trong nhà thầy’’ được hiểu, và ‘‘avusitavā’’ (chưa từng sống) được nói theo cách thông thường như ‘‘chưa học’’, giống như việc ‘‘cúng dường y phục đó bằng ba y phục’’.
Tenāha ‘‘ācariyakule avusitavā asikkhito’’ti.
Therefore, he said, "one who has not resided in the teacher's household, unlearned."
Do đó, Ngài nói ‘‘ācariyakule avusitavā asikkhito’’ (chưa từng sống trong nhà thầy, chưa học).
Asikkhitattā eva appassuto, ‘‘vusitamānī’’ti ca padāpekkhāya apariyositavacanattā samānoti pāṭhasesoti dasseti ‘‘appassutova samāno’’ti iminā.
Because of being unlearned, he is "one of little learning." The word "samāno" is a remaining part of the text, referring to the preceding word "vusitamānī" because of its incomplete phrasing, as indicated by "being one of little learning."
Chính vì chưa học nên appassuto (ít nghe), và vì ‘‘vusitamānī’’ (người kiêu mạn vì đã học) là một từ chưa hoàn chỉnh khi xét về ngữ pháp, nên samāno (đang là) là phần còn lại của câu, được chỉ ra bởi ‘‘appassutova samāno’’ (chỉ là người ít nghe).
Bāhusaccañhi nāma yāvadeva upasamatthaṃ icchitabbaṃ, tadabhāvato panāyaṃ ambaṭṭho avusitavā asikkhito appassutoti viññāyatīti evampi atthāpattito kāraṇaṃ vibhāvento āha ‘‘kimaññatra avusitattā’’ti.
Great learning, indeed, should be desired only for the purpose of calming (defilements). Since that is absent, this Ambaṭṭha is understood as "one who has not resided (with a teacher), unlearned, and of little learning." Thus, clarifying the cause through implication, he said, "What else besides being unlearned?"
Thật vậy, sự học rộng chỉ nên mong muốn đến mức độ an tịnh; vì thiếu điều đó, Ambaṭṭha này được hiểu là chưa từng sống (trong nhà thầy), chưa học, ít nghe. Khi giải thích nguyên nhân theo cách suy luận này, Ngài nói ‘‘kimaññatra avusitattā’’ (còn điều gì khác ngoài việc chưa từng sống?).
Imampi sambandhaṃ dīpeti ‘‘etassa hī’’tiādinā.
He also clarifies this connection with the phrase "for this (reason), indeed," and so on.
Ngài cũng chỉ ra mối liên hệ này bằng câu ‘‘etassa hī’’ (thật vậy, của người này) và các từ tiếp theo.
Yathārutato pana pharusavacanasamudācārena anupasamakāraṇadassanametaṃ.
However, taken literally, this is a demonstration of the cause of his lack of tranquility, due to his coarse speech.
Tuy nhiên, theo nghĩa đen, đây là sự chỉ ra nguyên nhân của sự bất an tịnh thông qua hành vi nói lời thô lỗ.
Tatrāyaṃ yojanā – ‘‘kimaññatra avusitattā’’ti idaṃ kāraṇaṃ etassa ambaṭṭhassa pharusavacanasamudācāre kāraṇanti.
Herein, this is the application: the reason "what else besides being unlearned?" is the cause for this Ambaṭṭha's coarse speech.
Cách liên kết ở đây là: ‘‘kimaññatra avusitattā’’ (còn điều gì khác ngoài việc chưa từng sống?) là nguyên nhân của hành vi nói lời thô lỗ của Ambaṭṭha này.
‘‘Pharusavacanasamudācārenā’’tipi pāṭho, tathā samudācāravasena vuttaṃ kāraṇanti attho.
"By way of coarse speech" is also a reading, meaning that the cause is stated by way of conduct.
Cũng có bản đọc là ‘‘pharusavacanasamudācārenā’’ (bằng hành vi nói lời thô lỗ), nghĩa là nguyên nhân được nói theo cách hành vi.
Evampi yojenti – avusitattā avusitabhāvaṃ aññatra ṭhapetvā etassa evaṃ pharusavacanasamudācāre kāraṇaṃ kimaññaṃ atthīti.
They also apply it thus: setting aside the state of being unlearned, what other cause is there for this Ambaṭṭha's coarse speech?
Cũng có người liên kết như sau: ngoài việc chưa từng sống (trong nhà thầy), còn nguyên nhân nào khác cho hành vi nói lời thô lỗ của người này?
Purimayojanāvettha yuttatarā yathāpāṭhaṃ yojetabbato.
The former application is more appropriate here, as it should be applied according to the text.
Tuy nhiên, cách liên kết đầu tiên ở đây hợp lý hơn vì nó được liên kết theo đúng bản văn.
‘‘Aññatrā’’ti nipātayogato avusitattāti upayogatthe nissakkavacanaṃ.
"Aññatra" (apart from) being an indeclinable particle, "avusitattā" (from being unlearned) is a word in the ablative case expressing the meaning of utilization.
Vì sự kết hợp với giới từ ‘‘aññatrā’’ (ngoài), avusitattā là từ cách ly trong ý nghĩa sử dụng.
Tadeva kāraṇaṃ samattheti ‘‘ācariyakule’’tiādinā.
He establishes that very cause with "in the teacher's household," and so on.
Ngài xác nhận chính nguyên nhân đó bằng câu ‘‘ācariyakule’’ (trong nhà thầy) và các từ tiếp theo.
695
264. Kodhasaṅkhātassa parassa vasānugatacittatāya asakamano.
264. "Not his own mind" means that his mind is subservient to another, in the form of anger.
264. Asakamano (tâm không tự chủ) là vì tâm bị điều khiển bởi người khác, tức là bởi sự sân hận.
Mānanimmadanatthanti mānassa nimmadanatthaṃ abhimaddanatthaṃ, amadanatthaṃ vā, mānamadavirahatthanti attho.
"For the suppression of conceit" means for the suppression or crushing of conceit, or for the non-intoxication, meaning for the absence of conceit's intoxication.
Mānanimmadanattha (vì mục đích đè bẹp kiêu mạn) nghĩa là: vì mục đích đè bẹp, nghiền nát sự kiêu mạn, hoặc vì không còn kiêu mạn, tức là không còn sự say sưa kiêu mạn.
Dosaṃ uggiletvāti sinehapānena kilinnaṃ vātapittasemhadosaṃ ubbamanaṃ katvā.
"Having vomited the defilement" means having vomited the wind-bile-phlegm defilement that was moistened by drinking the sticky substance.
Dosaṃ uggiletvā (nhổ bỏ độc tố) nghĩa là: sau khi nôn mửa ra những độc tố của gió, mật, đàm đã bị nhiễm bẩn do uống chất lỏng.
Gottena gottanti ambaṭṭheneva bhagavatā puṭṭhena vuttena sāvajjena purātanagottena adhunā anavajjasaññitaṃ gottaṃ.
"Lineage with lineage" means the ancient lineage of Ambaṭṭha, mentioned by the Blessed One when questioned, which was faulty, as opposed to the lineage considered faultless now.
Gottena gotta (dòng dõi này với dòng dõi kia) nghĩa là: dòng dõi hiện tại không có lỗi lầm được đặt tên theo dòng dõi cổ xưa có lỗi lầm, được Ambaṭṭha nói ra khi được Đức Thế Tôn hỏi.
Kulāpadesena kulāpadesanti etthāpi eseva nayo.
In "designation of clan with designation of clan," the same method applies.
Trong kulāpadesena kulāpadesa (giai cấp này với giai cấp kia) cũng theo cách tương tự.
Uṭṭhāpetvāti sāvajjato uṭṭhahanaṃ katvā, uddharitvāti vuttaṃ hoti.
"Having raised up" means having risen from what is faulty; it means having uplifted.
Uṭṭhāpetvā (làm cho đứng dậy) nghĩa là: làm cho đứng dậy từ sự có lỗi, tức là giải thoát.
Gottañcettha ādipurisavasena, kulāpadeso pana tadanvaye uppannābhiññātapurisavasena gahetabbo yathā ‘‘ādicco māghavo’’ti.
Here, "lineage" should be taken by way of the first man, and "designation of clan" by way of a famous man born in that lineage, as in "Ādicca and Māghava."
Ở đây, dòng dõi (gotta) nên được hiểu theo nghĩa tổ tiên đầu tiên, còn sự chỉ định giai cấp (kulāpadesa) nên được hiểu theo nghĩa những người nổi tiếng sinh ra trong dòng dõi đó, như ‘‘Ādicco Māghavo’’ (người thuộc dòng dõi Mặt Trời, thuộc gia tộc Māghava).
Sākiyānañhi ādiccagottaṃ aditiyā nāma devadhītāya puttabhūtaṃ ādipurisaṃ pati hoti, taṃ ‘‘gotamagotta’’ntipi vadanti.
For the "Ādicca clan" of the Sakyas is named after the first man, who was the son of a celestial nymph named Aditi; they also call it the "Gotama clan."
Thật vậy, dòng dõi Ādicca của dòng Sākiya là tổ tiên đầu tiên, là con trai của nữ thần tên Aditi. Dòng dõi đó cũng được gọi là ‘‘dòng dõi Gotama’’.
Yathāha pabbajjāsutte
As it is said in the Pabbajjā Sutta—
Như đã nói trong Pabbajjāsutta (Kinh Xuất Gia):
696
‘‘Ādiccā nāma gottena, sākiyā nāma jātiyā;
"By lineage, I am called Ādicca; by birth, I am called Sakya.
‘‘Dòng dõi chúng ta tên Ādicca, chủng tộc chúng ta tên Sākiya;
697
Tamhā kulā pabbajitomhi, na kāme abhipatthaya’’nti.(su. ni. 425);
From that family, I have gone forth; I do not desire sensual pleasures."
Ta đã xuất gia từ gia tộc đó, không còn ước muốn các dục lạc.’’
698
Māghavakulaṃ pana tadanvaye abhiññātaṃ macalagāmikapurisaṃ pati hotīti.
However, the Māghava clan is named after a renowned man, Macalāgāmika, born in that lineage.
Còn gia tộc Māghava thì liên quan đến một người đàn ông nổi tiếng tên Macala-gāmika trong dòng dõi đó.
Gottamūlassa gārayhatāya amānavatthubhāvapavedanato ‘‘mānaddhajaṃ mūle chetvā nipātessāmī’’ti vuttaṃ.
"I will cut down the banner of conceit at its root and cast it down," was stated to proclaim that the root of lineage, due to its blameworthiness, is not a cause for conceit.
Vì gốc rễ của dòng dõi là đáng chê trách và được tuyên bố là không phải đối tượng của kiêu mạn, nên đã nói ‘‘mānaddhajaṃ mūle chetvā nipātessāmī’’ (ta sẽ chặt gốc cờ kiêu mạn và quật ngã nó).
Ghaṭṭentoti jātigottavasena omasanto.
"Harassing" means disparaging by way of birth and lineage.
Ghaṭṭento (chạm vào) nghĩa là: xúc phạm theo dòng tộc và dòng dõi.
Hīḷentoti hīḷanaṃ garahaṃ karonto.
"Scolding" means making criticism or blame.
Hīḷento (chê bai) nghĩa là: thực hiện sự chê bai, quở trách.
‘‘Caṇḍā bho gotama sakyajātī’’tiādinā sākiyesu caṇḍabhāvādidosaṃ pāpitesu samaṇopi gotamo pāpito bhavissatīti adhippāyo.
The meaning is that when the Sakyans are imputed with faults like harshness, as in "The Sakya clan, O Gotama, is harsh," the ascetic Gotama will also be imputed with faults.
Ý muốn nói là: khi các lỗi lầm như sự thô bạo được gán cho dòng Sākiya bằng câu ‘‘Caṇḍā bho Gotama Sakyajātī’’ (Ôi Gotama, dòng Sākiya thật thô bạo), thì Sa-môn Gotama cũng sẽ bị gán lỗi.
699
Yasmiṃ mānussayakodhussayā aññamaññūpatthaddhā, so ‘‘caṇḍo’’ti vuccatīti dasseti ‘‘mānanissitakodhayuttā’’ti iminā, pakatūpanissayārammaṇavasena cettha nissitabhāvo, na sahajātādivasena.
The Teacher shows that a family in which people of haughty conceit and angry resentment are mutually stubborn is called "harsh," with the phrase "endowed with anger rooted in conceit." Here, the state of being rooted is by way of natural condition and object, not by way of conascence and so on.
Ngài chỉ ra rằng gia tộc nào mà trong đó những người có nhiều kiêu mạn và sân hận tự cao tự đại lẫn nhau, thì gia tộc đó được gọi là ‘‘caṇḍo’’ (thô bạo), bằng câu ‘‘mānanissitakodhayuttā’’ (những người có sân hận dựa trên kiêu mạn). Ở đây, sự dựa dẫm là theo duyên cận y tự nhiên và duyên cảnh, chứ không phải theo duyên đồng sinh, v.v.
Kharāti cittena, vācāya ca kakkhaḷā.
"Harsh" means rough in mind and speech.
Kharā (thô cứng) nghĩa là: thô cứng trong tâm và lời nói.
Lahukāti taruṇā avuddhakammā.
"Frivolous" means young and without mature actions.
Lahukā (nhẹ nhàng) nghĩa là: trẻ tuổi, không có hành động trưởng thành.
Tenāha ‘‘appakenevā’’tiādi.
Therefore, he said, "with just a little," and so on.
Do đó, Ngài nói ‘‘appakenevā’’ (chỉ một chút) và các từ tiếp theo.
Alābukaṭāhanti lābuphalassa abhejjakapālaṃ.
"Gourd-shell" means the unbreakable shell of a gourd fruit.
Alābukaṭāha (vỏ bầu) nghĩa là: vỏ của quả bầu không thể phá vỡ.
Aṭṭhakathāmuttakanayaṃ dassetuṃ ‘‘bhassāti sāhasikāti keci vadanti, sārambhakāti apare’’ti (dī. ni. ṭī. 1.264) ācariyena vuttaṃ.
To show the method outside of the commentary, the Teacher said, "'Bhassa' means reckless, some say; others say quarrelsome."
Để chỉ ra cách diễn giải không thuộc Aṭṭhakathā, Ngài nói ‘‘bhassā (những kẻ liều lĩnh) là điều một số người nói, sārambhakā (những kẻ hung hăng) là điều những người khác nói’’.
Samānāti hontā bhavamānāti asasaddavasenatthoti āha ‘‘santāti purimapadasseva vevacana’’nti.
"Being" means existing, occurring; this is the meaning by way of the word "asasaddā," and therefore he said, "santā is merely a synonym of the preceding word."
Samānā (đang là) nghĩa là: đang là, đang tồn tại, được hiểu theo nghĩa không có từ ‘‘as’’ (là). Do đó, Ngài nói ‘‘santāti purimapadasseva vevacana’’ (là từ đồng nghĩa của từ trước).
Na sakkarontīti sakkāraṃ na karontīti atthameva viññāpeti ‘‘na brāhmaṇāna’’ntiādinā.
"They do not respect" means they do not show respect; he explains this meaning with "not to brahmins," and so on.
Na sakkarontī (không tôn kính) nghĩa là: không thực hiện sự tôn kính, được chỉ rõ bằng câu ‘‘na brāhmaṇāna’’ (không đối với Bà-la-môn) và các từ tiếp theo.
Apacitikammanti paṇipātakammaṃ.
"Act of homage" means an act of bowing down.
Apacitikamma (hành động tôn kính) nghĩa là: hành động cúi lạy.
‘‘Yadime sakyā’’ti pacchimavākye ya-saddassa kiriyāparāmasanassa aniyamassa ‘‘tayidaṃ bho gotamā’’ti purimavākye ta-saddena niyamanaṃ veditabbanti āha ‘‘yaṃ ime sakyā’’tiādi.
He said, "that which these Sakyans," and so on, meaning that the indefinite reference of the word "ya" in the latter clause "what these Sakyans" in relation to the verb is determined by the word "ta" in the former clause "that, O Gotama," which should be understood.
Ngài nói rằng sự không quy định của từ ‘‘ya’’ trong câu cuối ‘‘Yadime Sakyā’’ (những người Sākiya này) khi liên quan đến hành động, phải được quy định bởi từ ‘‘ta’’ trong câu đầu ‘‘Tayidaṃ bho Gotamā’’ (này Gotama, điều này), bằng câu ‘‘yaṃ ime Sakyā’’ (điều mà những người Sākiya này) và các từ tiếp theo.
Nānulomanti attano jātiyā na anucchavikaṃ.
Nānuloma means 'not suitable for one's birth'.
Nānuloma có nghĩa là không phù hợp với dòng dõi của mình.
700
Dutiyaibbhavādavaṇṇanā
Explanation of the Second Impertinent Utterance
Giải thích về lời nói thứ hai về dòng dõi
701
265. Sandhāgārapadanibbacanaṃ heṭṭhā vuttameva.
265. The explanation of the term sandhāgāra has already been given below.
265. Sự giải thích từ “sandhāgāra” đã được nói ở dưới.
Tadā abhisittasakyarājūnampi bahutaṃ sandhāyāha ‘‘abhisittasakyarājāno’’ti.
Considering the multitude of Sakyan kings who had been consecrated at that time, he said, “abhisittasakyarājāno” (consecrated Sakyan kings).
Khi đó, vì số lượng các vị vua Sakya đã đăng quang là đông đảo, nên Ngài nói “các vị vua Sakya đã đăng quang”.
Kāmañhi sakyarājakule yo sabbesaṃ vuddhataro, samattho ca, so eva abhisekaṃ labhati.
Indeed, in the royal Sakyan family, whoever is the eldest of all and capable, he alone receives the consecration.
Thật vậy, trong dòng dõi vua Sakya, người nào lớn tuổi nhất và có khả năng nhất trong tất cả, thì người đó mới được đăng quang.
Ekacco pana abhisitto samāno ‘‘idaṃ rajjaṃ nāma bahukiccaṃ bahubyāpāra’’nti tato nibbijja rajjaṃ vayasā anantarassa niyyāteti, kadāci sopi aññassāti evaṃ paramparāniyyātanavasena tadā bahū abhisittapubbā sakyarājāno hontīti idaṃ ācariyassābhimataṃ (dī. ni. ṭī. 1.265).
However, sometimes a consecrated king, considering that “this kingship is indeed of many duties and many involvements,” becomes disgusted with it and relinquishes the kingdom to the one next in age, and at times that one also relinquishes it to another. Thus, by means of such successive relinquishments, there were many Sakyan kings who had previously been consecrated at that time. This is the opinion of the Teacher.
Nhưng có người, sau khi đăng quang, lại chán ghét vương quyền vì nghĩ rằng “vương quyền này có nhiều việc phải làm, nhiều trách nhiệm”, rồi nhường lại vương quyền cho người kế cận về tuổi tác; đôi khi người đó lại nhường cho người khác nữa, cứ thế mà truyền ngôi. Do đó, vào thời điểm đó, có nhiều vị vua Sakya đã từng đăng quang trước đây. Đây là ý kiến của vị Thầy (Dī. Ni. Ṭī. 1.265).
Apica yathārahaṃ ṭhānantaresu abhisittasakyarājūnampi bahutaṃ sandhāya evamāhātipi yujjati.
Furthermore, it is also fitting to say that the Teacher spoke thus with reference to the multitude of Sakyan kings consecrated in various appropriate positions.
Hơn nữa, cũng hợp lý khi nói rằng Ngài nói như vậy là vì số lượng các vị vua Sakya đã đăng quang ở các vị trí khác nhau là đông đảo.
Te hi ‘‘rājāno’’ti vuccanti.
For they are called “kings.”
Vì họ được gọi là “vua”.
Yathāha –
As it is said:
Như lời đã nói:
702
‘‘Rājāno nāma pathabyārājā, padesarājā, maṇḍalikā, antarabhogikā, akkhadassā, mahāmattā, ye vā pana chejjabhejjaṃ karontā anusāsanti, ete rājāno nāmā’’ti (pārā. 92).
“Kings are those who rule over the earth, provincial kings, district rulers, border officials, judges, chief ministers, or any others who administer by ordering amputation and cutting; these are called kings.”
“Vua là những vị vua cai trị trái đất, vua cai trị một vùng, các vị vua địa phương, các vị vua cai trị vùng đất giữa các vương quốc, các quan tòa, các đại thần, hoặc bất cứ ai cai trị bằng cách ra lệnh chặt chém, những người đó được gọi là vua” (Pārā. 92).
703
Saṃhārimehi vāḷarūpehi kato pallaṅko, bhaddapīṭhaṃ vettāsanaṃ. Mihitamattaṃ hasitamattaṃ.
A pallaṅka (couch) is made with fierce animal figures, a bhaddapīṭha (royal seat) is a vettāsana (wicker chair). A mere smile is a hasitamatta.
Pallaṅka là ngai vàng được làm bằng hình thù các loài thú có thể di chuyển được. Vettāsana là chiếc ghế mây. Hasitamattaṃ là chỉ một nụ cười.
Anuhasantī ti mamuddesikaṃ mahāhasitaṃ karonti, idañhi ‘‘anujagghantā’’ti etassa saṃvaṇṇanāpadaṃ.
Anuhasanti means they burst into loud laughter, directed at me. This is indeed an explanatory word for “anujagghantā.”
Anuhasantī có nghĩa là họ cười lớn nhắm vào tôi. Đây là từ giải thích cho từ “anujagghantā”.
Jagghasaddo ca mahāhasane pavattati ‘‘na ujjagghikāya antaraghare gamissāmī’’tiādīsu (pāci. 586) viya.
The word jaggha is used for loud laughter, as in “I will not enter a dwelling making loud laughter” and so on.
Và từ jaggha được dùng để chỉ tiếng cười lớn, như trong các câu “na ujjagghikāya antaraghare gamissāmī” (Pāci. 586) và các câu tương tự.
704
Kaṇhāyanato paṭṭhāya paramparāgataṃ kulavaṃsaṃ anussavavasena jānanti.
They know the lineage, passed down from Kaṇhāyana, by tradition.
Họ biết dòng dõi gia tộc được truyền từ đời Kaṇhāyana trở đi, thông qua lời truyền miệng.
Kulābhimānino hi yebhuyyena paresaṃ uccāvacaṃ kulaṃ tathā tathā udāharanti, attano ca kulavaṃsaṃ jānanti, evaṃ ambaṭṭhopi, tathā hesa parato bhagavatā pucchito vajirapāṇi bhayena attano kulavaṃsaṃ yāthāvato kathesīti.
Those proud of their lineage generally speak of the high and low families of others in various ways, and they know their own lineage. It was thus for Ambaṭṭha also, for when he was later questioned by the Bhagavā, out of fear of Vajirapāṇi, he truthfully recounted his own lineage.
Những người kiêu hãnh về dòng dõi thường hay nói về các dòng dõi cao thấp của người khác theo cách này cách khác, và họ cũng biết rõ dòng dõi của mình. Ambaṭṭha cũng vậy. Thật vậy, sau đó, khi được Đức Thế Tôn hỏi, Ambaṭṭha đã kể đúng dòng dõi của mình vì sợ Vajirapāṇi.
Olambetvāti hatthisoṇḍasaṇṭhānādinā sāṭakaṃ avalambetvā.
Olambetvā means hanging down his outer cloak in the manner of an elephant's trunk and so on.
Olambetvā có nghĩa là buông chiếc áo choàng xuống như hình vòi voi.
Tatoti tathājānanato, gamanato ca.
Tato means from that knowing, and from that going.
Tato có nghĩa là từ sự hiểu biết đó và từ sự đi đến đó.
Mamaññeva maññeti mamameva anujagghantā maññe.
Mamaññeva maññe means "They seem to be laughing at me alone."
Mamaññeva maññe có nghĩa là tôi nghĩ rằng họ đang cười nhạo chính tôi.
705
Tatiyaibbhavādavaṇṇanā
Explanation of the Third Impertinent Utterance
Giải thích về lời nói thứ ba về dòng dõi
706
266. Khettaleḍḍūnanti khette kasanavasena uṭṭhāpitamattikākhaṇḍānaṃ.
266. Khettaleḍḍūnaṃ means clods of earth raised in the field by plowing.
266. Khettaleḍḍūna có nghĩa là những cục đất được xới lên trong ruộng do việc cày bừa.
Leḍḍukānamantare nivāsitattā ‘‘leḍḍukikā’’ icceva (dī. ni. ṭī. 1.266) saññātā khuddakasakuṇikā.
Khuddakasakuṇikā are small birds, known as “leḍḍukikā” because they reside among the clods.
Khuddakasakuṇikā được gọi là “leḍḍukikā” (Dī. Ni. Ṭī. 1.266) vì chúng sống giữa các cục đất.
Majjhimapaṇṇāsake leḍḍukikopamasuttavaṇṇanāyaṃ ‘‘cātakasakuṇikā’’ti (ma. ni. aṭṭha. 3.150) vuttā, nighaṇṭusatthesu pana taṃ ‘‘lāpasakuṇikā’’ti vadanti.
In the explanation of the Leḍḍukikopama Sutta in the Majjhimapaṇṇāsaka, they are called “cātakasakuṇikā”, but in the lexicons, they are called “lāpasakuṇikā”.
Trong phần giải thích về Tương Ưng Leḍḍukikopama (Ma. Ni. Aṭṭha. 3.150) thuộc Majjhima-paṇṇāsaka, chúng được gọi là “cātakasakuṇikā”, nhưng trong các từ điển, chúng được gọi là “lāpasakuṇikā”.
Kodhavasena laggitunti upanayhituṃ, āghātaṃ bandhitunti attho.
Kodhavasena laggituṃ means to harbor resentment, or to bear ill will.
Kodhavasena laggitu có nghĩa là ôm ấp sự thù hận, tức là nuôi dưỡng sự oán ghét.
707
‘‘Amhe haṃsakoñcamorasame karotī’’ti vadanto heṭṭhā gahitaṃ ‘‘na taṃ koci haṃso vā koñco vā moro vā āgantvā kiṃ tvaṃ lapasīti nisedhetī’’ti idampi vacanaṃ saṅgītimanāruḷhaṃ tadā bhagavatā vuttamevāti dasseti.
The statement “He makes us like swans, cranes, and peacocks” — the Teacher implies that the earlier statement, “No swan, crane, or peacock comes and forbids you, saying, ‘Why do you chirp?’” was also spoken by the Bhagavā at that time, though it was not included in the recension.
Khi nói “Amhe haṃsakoñcamorasame karotī” (Ngài ấy biến chúng ta thành ngang hàng với thiên nga, sếu và công), điều này cho thấy rằng câu “na taṃ koci haṃso vā koñco vā moro vā āgantvā kiṃ tvaṃ lapasīti nisedhetī” (không một con thiên nga, sếu hay công nào đến và cấm cản ngươi, nói rằng ‘ngươi đang nói gì vậy?’) đã được Đức Thế Tôn nói vào thời điểm đó, mặc dù nó không được đưa vào trong các kỳ kết tập.
Tadā vadantoyeva hi evaṃ karotīti vattumarahati.
For only by speaking at that time can he be said to have done so.
Thật vậy, chỉ khi nói vào thời điểm đó, Ngài mới có thể nói như vậy.
‘‘Evaṃ nu te’’tiādivacanaṃ, ‘‘avusitavāyevā’’tiādivacanañca mānavasena samaṇena gotamena vuttanti ambaṭṭho maññatīti adhippāyenāha ‘‘nimmāno dāni jātoti maññamāno’’ti.
The words “Evaṃ nu te” and so on, and “avusitavāyevā” and so on, were spoken by the ascetic Gotama out of conceit. It is with this intention that Ambaṭṭha thinks this. Thus, the Teacher says, “maññamāno nimmāno dāni jātoti” (thinking, "Now he has become free from conceit").
Ambaṭṭha nghĩ rằng những lời như “Evaṃ nu te” và “avusitavāyevā” đã được Sa-môn Gotama nói ra do sự kiêu mạn. Với ý định đó, Ngài nói “nimmāno dāni jātoti maññamāno” (nghĩ rằng bây giờ đã trở nên vô ngã).
708
Dāsiputtavādavaṇṇanā
Explanation of the Son of a Slave Girl
Giải thích về lời nói về con trai của nữ tì
709
267. Nimmādetīti a-kārassa ā-kāraṃ katvā niddeso ummāde madasaddena nipphannattāti dasseti ‘‘nimmadetī’’ti iminā.
267. Nimmādetī signifies that the ‘a’ vowel is changed to ‘ā’ in the derivation, indicating that the word is formed from mada (intoxication) in the sense of 'madness'. This is shown by the word “nimmadetī.”
267. Nimmādetī là một cách diễn đạt bằng cách biến âm ‘a’ thành ‘ā’, cho thấy rằng từ này có nguồn gốc từ ‘mada’ (kiêu mạn) trong ý nghĩa ‘ummāda’ (điên rồ). Điều này được giải thích bằng từ “nimmadetī”.
Nimmāneti vigatamāne.
Nimmāne means free from conceit.
Nimmāne có nghĩa là không còn kiêu mạn.
Yadi panāhaṃ gottaṃ puccheyyaṃ sādhu vatāti attho.
It means, if I were to ask about the clan, it would indeed be good.
Nếu tôi hỏi về dòng họ, thì thật tốt. Đó là ý nghĩa.
Pākaṭaṃ kātukamyatāya tikkhattuṃ mahāsaddena avoca.
Wishing to make it manifest, he spoke three times in a loud voice.
Với mong muốn làm cho rõ ràng, Ngài nói lớn ba lần.
Kasmā avocāti pana asuddhabhāvaṃ jānantassāpi tathāvacane kāraṇapucchā.
But why did he speak? This is a question about the reason for speaking that way, even while knowing the impurity.
Tuy nhiên, câu hỏi “Kasmā avocā” (Tại sao Ngài nói vậy?) là câu hỏi về lý do cho việc nói như vậy, ngay cả khi biết sự không trong sạch.
Gottabhūtaṃ nāmameva adhippetaṃ, na visuṃ gottanti āha ‘‘mātāpettikanti mātāpitūnaṃ santaka’’nti.
Only the name that constitutes the clan is intended, not a separate clan. Thus, it is said, “Mātāpettikanti mātāpitūnaṃ santakaṃ” (Mātāpettika means that which belongs to parents).
Chỉ có tên gọi thuộc về dòng họ mới được đề cập, không phải dòng họ riêng biệt. Do đó, Ngài nói “mātāpettikanti mātāpitūnaṃ santaka” (có nghĩa là thuộc về cha mẹ).
Gottañhi pitito laddhabbaṃ pettikameva, na mātāpettikaṃ.
Indeed, a clan obtained from the father is pettika (paternal), not mātāpettika (maternal-paternal).
Dòng họ (gotta) được nhận từ cha, nên nó là của cha (pettika), chứ không phải của cha mẹ (mātāpettika).
Na hi brāhmaṇānaṃ sagottāya eva āvāhavivāho icchito, gottanāmaṃ pana jātisiddhaṃ, na kittimaṃ, na guṇanāmaṃ vā, jāti ca ubhayasambandhinīti mātāpettikameva, na pettikamattaṃ.
It is not desired for Brahmins to have marriage and intermarriage only within their own clan. The clan name, however, is established by birth, not artificial, nor a quality-name; and birth is related to both parents. Thus, it is mātāpettika only, not merely pettika.
Thật vậy, đối với Bà-la-môn, hôn nhân không được mong muốn chỉ trong cùng dòng họ. Tuy nhiên, tên dòng họ (gotta-nāma) là tự nhiên, không phải nhân tạo, cũng không phải tên phẩm chất. Và dòng dõi liên quan đến cả hai (cha và mẹ), nên nó là của cha mẹ (mātāpettika), không chỉ riêng của cha (pettikamattaṃ).
Nāmagottanti gottabhūtaṃ nāmaṃ, na kittimaṃ, na guṇanāmaṃ vā visesanaparanipātavasena vuttattā yathā ‘‘agyāhito’’ti.
Nāmagotta means the name that is the clan, not artificial, nor a quality-name, because it is stated with the attribute as a secondary word, just like “agyāhito.”
Nāmagotta có nghĩa là tên thuộc về dòng họ, không phải tên nhân tạo, cũng không phải tên phẩm chất, vì nó được nói theo cách tính từ bổ nghĩa, giống như “agyāhito”.
Nāmañca tadeva paveṇīvasena pavattattā gottañcāti hi nāmagottaṃ. Tattha yā ‘‘kaṇhāyano’’ti nāmapaṇṇatti niruḷhā, taṃ sandhāyāha ‘‘paṇṇattivasena nāma’’nti.
And that name, being transmitted through tradition, is also the clan. So it is nāmagotta. Therefore, with reference to the established appellation "Kaṇhāyano," he said, "paññattivasena nāma" (name by way of designation).
Và cái tên đó, vì được truyền theo dòng dõi, nên cũng là dòng họ. Do đó, nó là nāmagotta. Trong đó, cái tên “Kaṇhāyano” đã được thiết lập, Ngài nói “paṇṇattivasena nāma” (tên theo cách quy ước).
Taṃ panetaṃ nāmaṃ kaṇhaisito paṭṭhāya tasmiṃ kulaparamparāvasena āgataṃ, na etasmiṃyeva niruḷhanti vuttaṃ ‘‘paveṇīvasena gotta’’nti.
That name, however, has come down through the family lineage in that clan, starting from Kaṇha. It is not established in this one alone. Thus, it is said, "paveṇīvasena gotta" (clan by way of tradition).
Tuy nhiên, cái tên này đã được truyền theo dòng dõi gia tộc đó từ Kaṇha trở đi, chứ không phải chỉ được thiết lập trong dòng dõi này. Do đó, Ngài nói “paveṇīvasena gotta” (dòng họ theo dòng truyền thừa).
Gottapadassa vacanattho heṭṭhā vuttoyeva.
The etymological meaning of the word gotta has already been given below.
Ý nghĩa của từ gotta đã được nói ở dưới.
710
‘‘Anussarato’’ti ettha na kevalaṃ anussaraṇamattaṃ adhippetaṃ, atha kho kulasuddhivīmaṃsanavasenevāti āha ‘‘kulakoṭiṃ sodhentassā’’ti, kulaggaṃ visodhentassāti attho.
In "Anussarato", not merely recollecting is intended, but rather by way of investigating the purity of the family. Thus, it is said, "kulakoṭiṃ sodhentassā" (for one purifying the pinnacle of the family), meaning for one purifying the apex of the family.
Ở đây, trong từ “Anussarato” (nhớ lại), không chỉ có ý nghĩa đơn thuần là nhớ lại, mà còn có ý nghĩa là kiểm tra sự trong sạch của dòng dõi. Do đó, Ngài nói “kulakoṭiṃ sodhentassā” (khi làm sạch dòng dõi), có nghĩa là khi làm sạch đỉnh cao của dòng dõi.
‘‘Ayyaputtā’’ti ettha ayyasaddo ayyiraketi vuttaṃ ‘‘sāmino puttā’’ti.
In "Ayyaputtā", the word ayya is said to be for ayyiraka (master). Thus, "sāmino puttā" (sons of the master) is said.
Trong từ “Ayyaputtā”, từ ‘ayya’ có nghĩa là ‘ayyirake’ (chủ nhân). Do đó, Ngài nói “sāmino puttā” (con trai của chủ nhân).
Catūsu dāsīsu disā okkākarañño antojātadāsī.
Among the four types of female slaves, Disā was a slave born within King Okkāka’s household.
Trong bốn loại nữ tì, Disā là nữ tì sinh ra trong nhà của vua Okkāka.
Tenāha ‘‘gharadāsiyā putto’’ti.
Therefore, it is said, "gharadāsiyā putto" (son of a household slave).
Do đó, Ngài nói “gharadāsiyā putto” (con trai của nữ tì trong nhà).
Ettha ca yasmā ambaṭṭho jātiṃ nissāya mānathaddho, na ca tassa yāthāvato jātiyā avibhāvitāya mānaniggaho karīyati, akate ca mānaniggahe mānavasena ratanattayaṃ aparajjhissati, kate pana mānaniggahe aparabhāge ratanattaye pasīdissati, na cedisī vācā pharusavācā nāma hoti cittassa saṇhabhāvato.
Here, since Ambaṭṭha was conceited due to his birth, and his conceit could not be subdued without clarifying his true birth, and if his conceit were not subdued, he would offend the Triple Gem out of conceit, but if his conceit were subdued, he would later become devoted to the Triple Gem, and such speech is not harsh speech due to the gentleness of the mind.
Ở đây, vì Ambaṭṭha kiêu hãnh dựa vào dòng dõi, và nếu dòng dõi thực sự của hắn không được làm rõ, sự kiêu mạn của hắn sẽ không bị chế ngự. Nếu sự kiêu mạn không bị chế ngự, hắn sẽ xúc phạm Tam Bảo do sự kiêu mạn. Nhưng nếu sự kiêu mạn bị chế ngự, về sau hắn sẽ có niềm tin vào Tam Bảo. Và lời nói như vậy không phải là lời nói thô tục vì tâm ý là mềm mỏng.
Majjhimapaṇṇāsake abhayasuttañca (ma. ni. 2.83) ettha nidassanaṃ.
The Abhaya Sutta in the Majjhimapaṇṇāsaka is an example here.
Kinh Abhayasutta (Ma. Ni. 2.83) trong Majjhima-paṇṇāsaka cũng là một ví dụ ở đây.
Keci ca janā kakkhaḷāya vācāya vuttā agginā viya lohādayo mudubhāvaṃ gacchanti, tasmā bhagavā ambaṭṭhaṃ nibbisevanaṃ kattukāmo ‘‘ayyaputtā sakyā bhavanti, dāsiputto tvamasi sakyāna’’nti avoca.
And some people, when spoken to with harsh words, become softened like iron and other metals by fire. Therefore, desiring to make Ambaṭṭha free from conceit, the Bhagavā said, “The Sakyas are sons of noblemen, but you are the son of a Sakyan slave girl.”
Và một số người, khi bị nói bằng lời lẽ gay gắt, trở nên mềm mỏng như kim loại bị lửa nung chảy. Do đó, Đức Thế Tôn, muốn làm cho Ambaṭṭha không còn kiêu mạn, đã nói: “Này con trai, các vị Sakya là những người cao quý, ngươi là con trai của nữ tì của các vị Sakya.”
711
‘‘Idhekacco pāpabhikkhu tathāgatappaveditaṃ dhammavinayaṃ pariyāpuṇitvā attano dahatī’’tiādīsu (pārā. 195) viya dahasaddo dhāraṇattho, dhāraṇañcettha pubbapurisavasena saññāpananti āha ‘‘okkāko no pubbapuriso’’tiādi.
The word daha, as in “idhekacco pāpabhikkhu tathāgatappaveditaṃ dhammavinayaṃ pariyāpuṇitvā attano dahati” (here, some wicked monk, having learned the Dhamma and Vinaya proclaimed by the Tathāgata, retains it within himself), means 'to retain'. And retention here means to make known through ancestral lineage. Thus, it is said, "okkāko no pubbapuriso" and so on.
Trong các câu như “Idhekacco pāpabhikkhu tathāgatappaveditaṃ dhammavinayaṃ pariyāpuṇitvā attano dahatī” (Pārā. 195) (Ở đây, một số tỳ-khưu xấu ác, sau khi học thuộc Pháp và Luật do Đức Như Lai thuyết giảng, giữ lấy cho mình), từ ‘daha’ có nghĩa là ‘giữ’. Và ở đây, việc giữ có nghĩa là làm cho người khác biết thông qua các bậc tiền nhân. Do đó, Ngài nói “okkāko no pubbapuriso” (Okkāka là tổ tiên của chúng ta) và các câu tương tự.
Dahasaddañhi bhasmīkaraṇe, dhāraṇe ca icchanti saddavidū.
Indeed, etymologists understand the word daha to mean both 'to burn to ashes' and 'to retain'.
Các nhà ngữ pháp học chấp nhận từ ‘daha’ có nghĩa là ‘đốt thành tro’ và ‘giữ’.
Pabhā niccharatīti pabhassaraṃ hutvā nikkhamati tathārūpena puññakammena dantānaṃ pabhassarabhāvato.
Pabhā niccharatī means light shines forth, becoming radiant, due to the radiance of the teeth caused by such meritorious deeds.
Pabhā niccharatī có nghĩa là ánh sáng phát ra rực rỡ, vì răng phát sáng do nghiệp phước lành như vậy.
712
Teti jeṭṭhakumāre.
Te refers to the elder princes.
Te có nghĩa là các hoàng tử lớn.
Paṭhamakappikānanti paṭhamakappassa ādikāle nibbattānaṃ.
Paṭhamakappikānaṃ means those who arose in the beginning period of the first eon.
Paṭhamakappikāna có nghĩa là những người sinh ra vào thời kỳ đầu của kiếp đầu tiên.
Kirasaddena cettha anussavatthena, yo vuccamānāya rājaparamparāya kesañci matibhedo, taṃ ulliṅgeti.
Here, the word 'kira' (indeed), meaning 'hearsay' (anussavatthena), indicates the different views held by some teachers regarding the royal lineage to be recounted, thus overriding them.
Ở đây, từ “kira” với ý nghĩa “nghe nói”, ám chỉ sự khác biệt ý kiến của một số vị về dòng dõi vua chúa sẽ được trình bày.
Anussavavacaneneva hi ananussuto uttaravihāravāsiādīnaṃ matibhedo nirākarīyatīti.
For, by merely stating hearsay, the differing views of the residents of Uttara Vihāra and others, which are not based on hearsay, are refuted.
Chính vì lời nói “nghe nói” mà sự khác biệt ý kiến của những người sống ở Uttaravihāra và những người khác, vốn chưa từng được nghe nói đến, bị bác bỏ.
Mahāsammatassāti aggaññasutte vakkhamānanayena ‘‘ayaṃ no rājā’’ti mahājanena sammannitvā ṭhapitattā ‘‘mahāsammato’’ti evaṃ sammatassa.
Mahāsammata means "the Great Elect," so-called because he was established by the people after they had elected him, saying, "This one is our king," in the manner to be expounded in the Aggañña Sutta.
Mahāsammato (Đại Thống Lĩnh) là người được đại chúng nhất trí tôn lập làm vua, như sẽ được nói đến trong kinh Aggañña: “Đây là vua của chúng ta.”
Yaṃ sandhāya vadanti –
With reference to him, they say:
Liên quan đến điều đó, họ nói:
713
‘‘Ādiccakulasambhūto, suvisuddhaguṇākaro;
“Born of the solar lineage, a source of utterly pure virtues,
“Sinh ra từ dòng dõi mặt trời, là kho báu của những đức tính thanh tịnh;
714
Mahānubhāvo rājāsi, mahāsammatanāmako.
A king of great majesty, named Mahāsammata.
Vua có uy lực lớn, tên là Mahāsammata.
715
Yo cakkhubhūto lokassa, guṇaraṃsisamujjalo;
He, who was an eye to the world, shining with rays of virtue,
Ngài là con mắt của thế gian, rực rỡ bởi ánh sáng của đức hạnh;
716
Tamonudo virocittha, dutiyo viya bhāṇumā.
Dispelled darkness and shone forth like a second sun.
Xua tan bóng tối, ngài tỏa sáng như vầng thái dương thứ hai.
717
Ṭhapitā yena mariyādā, loke lokahitesinā;
By him, who sought the welfare of the world, a boundary was established in the world;
Giới hạn đã được thiết lập bởi ngài, người mong muốn lợi ích cho thế gian;
718
Vavatthitā sakkuṇanti, na vilaṅghayitu janā.
People, thus constrained, cannot transgress it.
Người dân không thể vượt qua những giới hạn đã được quy định.
719
Yasassinaṃ tejassinaṃ, lokasīmānurakkhakaṃ;
That glorious, radiant, protector of the world's boundaries,
Vị anh hùng vĩ đại, đầy vinh quang, đầy uy lực, người bảo vệ ranh giới thế gian;
720
Ādibhūtaṃ mahāvīraṃ, kathayanti ‘manū’ti ya’’nti.(dī. ni. ṭī. 1.267);
The primordial great hero, is called ‘Manu’ by people.”
Là vị vua đầu tiên, người ta gọi ngài là ‘Manu’.”
721
Tassa ca puttapaputtaparamparaṃ sandhāya evaṃ vadanti –
And concerning his lineage of sons and grandsons, they speak thus:
Và liên quan đến dòng dõi con cháu của ngài, họ nói như sau:
722
‘‘Tassa putto mahātejo, rojo nāma mahīpati;
“His son, of great splendor, was the king named Roja;
“Con của ngài là vị vua Rojo, có uy lực lớn;
723
Tassa putto vararojo, pavaro rājamaṇḍale.
His son was Vararoja, supreme in the royal court.
Con của ngài là Vararojo, vị vua tối thượng trong vòng các vua.
724
Tassāsi kalyāṇaguṇo, kalyāṇo nāma atrajo;
His son, of excellent virtues, was named Kalyāṇa;
Ngài có một người con trai tên là Kalyāṇa, có những đức tính tốt lành;
725
Rājā tassāsi tanayo, varakalyāṇanāmako.
His son was the king named Varakalyāṇa.
Con trai của ngài là vị vua tên là Varakalyāṇa.
726
Tassa putto mahāvīro, mandhātā kāmabhoginaṃ;
His son, the great hero Mandhātā, foremost among enjoyers of sensual pleasures,
Con của ngài là Mandhātā, vị anh hùng vĩ đại, người hưởng thụ dục lạc;
727
Aggabhūto mahindena, aḍḍharajjena pūjito.
Was honored by the king of the gods (Mahendra) with half of his kingdom.
Là vị đứng đầu, được vua Indra tôn kính bằng nửa vương quốc.
728
Tassa sūnu mahātejo, varamandhātunāmako;
His son, of great splendor, was named Varamandhātā;
Con trai của ngài là Varamandhātā, có uy lực lớn;
729
‘Uposatho’ti nāmena, tassa putto mahāyaso.
His son, of great renown, was named Uposatha.
Con trai của ngài là Uposatha, có danh tiếng lớn.
730
Varo nāma mahātejo, tassa putto mahāvaro;
His son, of great splendor, was named Vara, a great chief;
Con của ngài là Varo, có uy lực lớn, là vị tối thượng;
731
Tassāsi upavaroti, putto rājā mahābalo.
His son was Upavara, a king of great might.
Con của ngài là Upavaro, vị vua có sức mạnh lớn.
732
Tassa putto maghadevo, devatulyo mahīpati;
His son was Maghadeva, a king like a deity;
Con của ngài là Maghadeva, vị vua thần thánh, chúa tể của trái đất;
733
Caturāsīti sahassāni, tassa puttaparamparā.
His lineage of sons numbered eighty-four thousand.
Dòng dõi con cháu của ngài có tám vạn bốn ngàn vị.
734
Tesaṃ pacchimako rājā, ‘okkāko’iti vissuto;
The last king among them was known as Okkāka;
Vị vua cuối cùng trong số đó là Okkāka, nổi tiếng;
735
Mahāyaso mahātejo, akhuddo rājamaṇḍale’’ti.(dī. ni. ṭī. 1.267);
Of great renown, great splendor, and not inferior in the royal court.”
Có danh tiếng lớn, uy lực lớn, không hèn kém trong vòng các vua.”
736
Idaṃ aṭṭhakathānuparodhavacanaṃ.
This statement is not contrary to the Aṭṭhakathā.
Đây là lời không mâu thuẫn với các bản Chú giải.
Yaṃ pana dīpavaṃse vuttaṃ –
However, what is stated in the Dīpavaṃsa is:
Tuy nhiên, những gì được nói trong Dīpavaṃsa:
737
‘‘Paṭhamābhisitto rājā, bhūmipālo jutindharo;
“The first consecrated king, a protector of the earth, radiant,
“Vị vua đầu tiên được tấn phong, là chúa tể của trái đất, mang vinh quang;
738
Mahāsammato nāmena, rajjaṃ kāresi khattiyo.
A khattiya named Mahāsammata, ruled the kingdom.
Là vị vua Khattiya tên là Mahāsammata, đã trị vì vương quốc.
739
Tassa putto rojo nāma, vararojo ca khattiyo;
His son was Roja, and Vararoja, a khattiya;
Con của ngài là Rojo, và Vararojo, vị Khattiya;
740
Kalyāṇo varakalyāṇo, uposatho mahissaro.
Kalyāṇa, Varakalyāṇa, Uposatha, the great lord.
Kalyāṇa, Varakalyāṇa, Uposatha, vị chúa tể vĩ đại.
741
Mandhātā sattamo tesaṃ, catudīpamhi issaro;
Mandhātā, the seventh among them, was lord of the four continents;
Mandhātā là người thứ bảy trong số họ, chúa tể của bốn châu lục;
742
Varo upavaro rājā, cetiyo ca mahissaro’’tiādi.
Vara, Upavara, king Cetiyo, the great lord,” and so on.
Varo, Upavaro, và Cetiyo, vị chúa tể vĩ đại.” và v.v.
743
Yañca mahāvaṃsādīsu vuttaṃ –
And what is stated in the Mahāvaṃsa and other texts is:
Và những gì được nói trong Mahāvaṃsa và các bộ khác:
744
‘‘Mahāsammatarājassa, vaṃsajo hi mahāmuni;
“Indeed, the Great Sage was descended from King Mahāsammata;
“Đức Đại Tiên là hậu duệ của vua Mahāsammata;
745
Kappādismiṃ rājāsi, mahāsammatanāmako.
At the beginning of the aeon, there was a king named Mahāsammata.
Vào buổi đầu của kiếp, có vị vua tên là Mahāsammata.
746
Rojo ca vararojo ca, tathā kalyāṇakā duve;
And Roja, and Vararoja, and likewise the two Kalyāṇas;
Rojo và Vararojo, cũng như hai vị Kalyāṇaka;
747
Uposatho ca mandhātā, varako pavarā duve’’tiādi.
And Uposatha, and Mandhātā, and the two Vara and Pavara,” and so on.
Uposatha và Mandhātā, hai vị Varaka và Pavara.” và v.v.
748
Sabbametaṃ yebhuyyato aṭṭhakathāvirodhavacanaṃ.
All of this is, for the most part, contrary to the Aṭṭhakathā.
Tất cả những điều này phần lớn là lời mâu thuẫn với các bản Chú giải.
Aṭṭhakathāyañhi mandhāturājā chaṭṭho vutto, maghadevarājā ekādasamo, tassa ca puttaparamparāya caturāsītisahassarājūnaṃ pacchimako okkākarājā, tesu pana mandhāturājā sattamo vutto, maghadevarājā anekesaṃ rājasahassānaṃ pacchimako, tassa ca puttaparamparāya anekarājasahassānaṃ pacchimako okkākarājāti evamādinā anekadhā virodhavacanaṃ aṭṭhakathāyaṃ nirākaroti.
For in the Aṭṭhakathā, King Mandhātā is mentioned as the sixth, King Maghadeva as the eleventh, and King Okkāka is mentioned as the last of the eighty-four thousand kings in his lineage of sons. However, in those other texts, King Mandhātā is mentioned as the seventh, King Maghadeva is mentioned as the last of many thousands of kings, and King Okkāka is mentioned as the last of many thousands of kings in his lineage of sons, and so on. Thus, it refutes the many kinds of conflicting statements found in the Aṭṭhakathā.
Trong Chú giải, vua Mandhātā được nói là người thứ sáu, vua Maghadeva là người thứ mười một, và vua Okkāka là người cuối cùng trong số tám vạn bốn ngàn vị vua thuộc dòng dõi con cháu của ngài. Nhưng trong những bản kia, vua Mandhātā được nói là người thứ bảy, vua Maghadeva là người cuối cùng trong số hàng ngàn vị vua, và vua Okkāka là người cuối cùng trong số hàng ngàn vị vua thuộc dòng dõi con cháu của ngài. Bằng cách này, Chú giải bác bỏ những lời mâu thuẫn theo nhiều cách.
Nanu avocumha ‘‘kirasaddena cettha anussavatthena, yo vuccamānāya rājaparamparāya kesañci matibhedo, taṃ ulliṅgetī’’ti.
Did we not say, “Here, the word 'kira', meaning 'hearsay', indicates the difference of opinion held by some regarding the royal lineage being recounted, thus overriding it”?
Há chẳng phải chúng ta đã nói rằng: “Ở đây, từ ‘kira’ với ý nghĩa ‘nghe nói’, ám chỉ sự khác biệt ý kiến của một số vị về dòng dõi vua chúa sẽ được trình bày” ư?
Tesaṃ pacchatoti maghadevaparamparābhūtānaṃ kaḷārajanakapariyosānānaṃ caturāsītikhattiyasahassānaṃ aparabhāgeti yathānussutaṃ ācariyena vuttaṃ.
After them means after the eighty-four thousand khattiyas belonging to the lineage of Maghadeva, ending with Kaḷārajanaka, as recounted by the teacher in accordance with hearsay.
Tesaṃ pacchato (Sau những vị đó) có nghĩa là sau tám vạn bốn ngàn vị Khattiya thuộc dòng dõi Maghadeva, kết thúc bằng Kaḷārajanaka, như được các vị thầy nói theo truyền thuyết.
Dīpavaṃsādīsu pana ‘‘kaḷārajanakarañño puttaparamparāya anekakhattiyasahassānaṃ pacchimako rājā sujāto nāma, tassa putto okkāko rājā’’ti vuttaṃ.
However, in the Dīpavaṃsa and other texts, it is said, "The last king among the many thousands of khattiyas in the lineage of King Kaḷārajanaka was named Sujāta, and his son was King Okkāka."
Tuy nhiên, trong Dīpavaṃsa và các bộ khác, có nói rằng: “Vị vua cuối cùng trong số hàng ngàn vị Khattiya thuộc dòng dõi con cháu của vua Kaḷārajanaka là Sujāta, và con của ngài là vua Okkāka.”
Maghadevaparamparāya anekasahassarājūnaṃ aparabhāge paṭhamo okkāko nāma rājā ahosi, tassa paramparābhūtānaṃ pana anekasahassarājūnaṃ aparabhāge dutiyo okkāko nāma rājā ahosi, tassapi paramparāya anekasahassarājūnaṃ aparabhāge tatiyo okkāko nāma rājā ahosi.
After many thousands of kings in Maghadeva's lineage, the first king named Okkāka appeared. After many thousands of kings in his lineage, a second king named Okkāka appeared. And after many thousands of kings in his lineage, a third king named Okkāka appeared.
Sau hàng ngàn vị vua thuộc dòng dõi Maghadeva, vị vua đầu tiên tên là Okkāka đã xuất hiện, và sau hàng ngàn vị vua thuộc dòng dõi của ngài, vị vua thứ hai tên là Okkāka đã xuất hiện, và sau hàng ngàn vị vua thuộc dòng dõi của vị đó, vị vua thứ ba tên là Okkāka đã xuất hiện.
Taṃ sandhāyāha ‘‘tayo okkākavaṃsā ahesu’’ntiādi.
Referring to this, it states, "There were three Okkāka lineages," and so on.
Liên quan đến điều đó, có nói: “Đã có ba dòng dõi Okkāka” và v.v.
749
Jātiyā pañcamadivase nāmakammādimaṅgalaṃ lokāciṇṇanti vuttaṃ ‘‘pañcamadivase alaṅkaritvā’’ti.
The naming ceremony and other auspicious rites on the fifth day after birth are customary in the world; hence it is stated, "having adorned on the fifth day."
Việc đặt tên và các nghi lễ khác vào ngày thứ năm sau khi sinh là phong tục của thế gian, như đã nói “vào ngày thứ năm, sau khi trang điểm”.
Sahasā varaṃ adāsinti puttadassanena balavasomanassappatto turitaṃ avīmaṃsitvā tuṭṭhidāyavasena varaṃ adāsiṃ ‘‘yaṃ icchasi, taṃ gaṇhāhī’’ti.
He hastily granted a boon means that, filled with great joy at seeing his son, he quickly granted a boon without deliberation, as a gift of satisfaction, saying, "Take whatever you wish."
Sahasā varaṃ adāsi (Ngài vội vàng ban một điều ước) có nghĩa là, do niềm vui lớn khi thấy con trai, ngài đã vội vàng ban một điều ước mà không suy xét, theo cách ban tặng niềm vui, rằng: “Con muốn gì, hãy lấy đó.”
ti jantukumāramātā.
She refers to the mother of Prince Jantu.
(Bà ấy) là mẹ của hoàng tử Jantu.
Rajjaṃ pariṇāmetuṃ icchatīti mama varadānaṃ antaraṃ katvā imaṃ rajjaṃ pariṇāmetuṃ icchati.
Desires to bestow the kingdom means she desires to bestow this kingdom by making my granting of a boon an intervening factor.
Rajjaṃ pariṇāmetuṃ icchatī (Bà ấy muốn chuyển giao vương quốc) có nghĩa là bà ấy muốn dùng điều ước của tôi làm cớ để chuyển giao vương quốc này.
750
Rajjaṃ kāressantīti rājabhāvaṃ mahājanena mahājanaṃ vā kārāpessanti.
They will cause to rule means they will cause the people to become king or cause the people to rule.
Rajjaṃ kāressantī (Họ sẽ khiến vương quốc được cai trị) có nghĩa là họ sẽ khiến đại chúng trở thành vua hoặc khiến đại chúng cai trị.
Nappasaheyyāti nivāsatthāya pariyatto na bhaveyya.
Would not suffice means it would not be sufficient for residence.
Nappasaheyyā (Sẽ không đủ) có nghĩa là sẽ không đủ chỗ ở.
751
Kaḷāravaṇṇatāya kapilabrāhmaṇo nāma ahosi.
Due to his dark complexion, he was named Kapila the brahmin.
Do có màu sắc lốm đốm, ngài được gọi là Kapilabrāhmaṇa (Bà-la-môn Kapila).
Nikkhammāti gharāvāsato kāmehi ca nikkhamitvā.
Having gone forth means having gone forth from household life and from sensual pleasures.
Nikkhammā (Sau khi rời bỏ) có nghĩa là sau khi rời bỏ cuộc sống gia đình và các dục vọng.
Sāko nāma sabbasāramayo rukkhaviseso, yena pāsādādi karīyate, taṃsamudāyabhūte vanasaṇḍeti attho.
Sāka refers to a particular type of tree, entirely composed of heartwood, used for constructing palaces and the like; the meaning is a forest grove consisting of such trees.
Sāko là một loại cây đặc biệt làm từ toàn bộ lõi gỗ, dùng để xây dựng cung điện và các công trình khác; ý nghĩa là khu rừng được tạo thành từ loại cây đó.
Bhūmiyā pavattaṃ bhummaṃ, taṃ guṇadosaṃ jāleti joteti, taṃ vā jalati jotati pākaṭaṃ bhavati etāyāti bhummajālā.
Bhammajālā is that which occurs on the ground, revealing or illuminating its good and bad qualities, or by which those qualities are revealed or become manifest.
Bhummaṃ là những gì xảy ra trên đất, bhummajālā là thứ làm sáng tỏ, làm hiển lộ những ưu điểm và khuyết điểm của nó, hoặc thứ mà nhờ nó những ưu điểm và khuyết điểm đó trở nên rõ ràng.
Heṭṭhā cā ti ettha ca-saddena ‘‘asītihatthe’’ti idamanukaḍḍhati.
In "Heṭṭhā ca" (and below), the word ca (and) here carries over the phrase "asītihatthe" (eighty cubits).
Ở đây, với từ ca trong heṭṭhā ca, nó kéo theo cụm từ “asītihatthe” (tám mươi cubit).
Etasmiṃ padeseti sākavanasaṇḍamāha.
In this area refers to the Sāka forest grove.
Etasmiṃ padese (Tại nơi này) ám chỉ khu rừng Sāka.
Khandhapantivasena dakkhiṇāvaṭṭā. Sākhāpantivasena pācīnābhimukhā.
They were dakkhiṇāvaṭṭā (curving to the right) in terms of their trunk rows. They were pācīnābhimukhā (facing east) in terms of their branch rows.
Dakkhiṇāvaṭṭā (xoay về phía nam) theo hàng thân cây. Pācīnābhimukhā (hướng về phía đông) theo hàng cành cây.
Tehīti migasūkarehi, maṇḍūkamūsikehi ca.
By them refers to the deer and boars, and the frogs and mice.
Tehī (Bởi những loài đó) là bởi hươu, lợn rừng, và ếch, chuột.
Teti sīhabyagghādayo sappabiḷārā ca.
They refers to the lions, tigers, and so on, and the snakes and cats.
Te (Chúng) là sư tử, hổ, và rắn, mèo.
752
Etthāti evaṃ māpiyamāne nagare.
Here means in such a city being measured out.
Etthā (Ở đây) có nghĩa là trong thành phố đang được xây dựng như vậy.
Tumhākaṃ purisesu pariyāpannaṃ ekekampi purisaṃ paccatthikabhūtaṃ aññaṃ purisasatampi purisasahassampi abhibhavituṃ na sakkhissatīti yojanā.
The construction is: not even one man among your men, if he were an enemy, would be able to overcome a hundred or a thousand other men.
Ý nghĩa là: “Dù là một người đàn ông trong số những người của quý vị, cũng sẽ không thể đánh bại hàng trăm hay hàng ngàn kẻ thù khác.”
Cakkavattibalenāti cakkavattibalabhāvena.
By the power of a Cakkavatti means by having the power of a Cakkavatti.
Cakkavattibalenā (Với sức mạnh của một vị Chuyển Luân Vương) có nghĩa là với tư cách là một vị Chuyển Luân Vương.
Atiseyyoti ativiya uttamo bhaveyya.
Very excellent means he would be exceedingly supreme.
Atiseyyo (Rất ưu việt) có nghĩa là sẽ trở nên cực kỳ cao quý.
Kapilassa isino vasanaṭṭhānattā kapilavatthu.
Kapilavatthu was so named because it was the dwelling place of the sage Kapila.
Kapilavatthu (Ca-tỳ-la-vệ) được gọi như vậy vì đó là nơi ở của đạo sĩ Kapila.
753
Nesaṃ santike bhaveyyāti sambandho.
The connection is: "would be in their presence."
Có sự liên kết rằng: “nên ở gần họ.”
Asadisasaṃyogeti jātiyā asadisānaṃ gharāvāsapayoge hetubhūte.
In an unequal union refers to a household union that was a cause for those of unequal birth.
Asadisasaṃyoge (Trong sự kết hợp không tương xứng) là do sự kết hợp gia đình không tương xứng về dòng dõi.
Avasesāhi attano attano kaṇiṭṭhāhi.
The remaining ones refers to their own younger sisters.
Avasesāhi (Với những người còn lại) là với những người em gái của riêng họ.
754
Vaḍḍhamānānanti anādare sāmivacanaṃ, anantarāyikāya puttadhītuvaḍḍhanāya vaḍḍhamānesu eva udapādīti attho.
Of those growing is a genitive of disregard, meaning that it arose only when they were growing in an unhindered increase of sons and daughters.
Vaḍḍhamānānaṃ (của những người đang lớn lên) là một từ thuộc cách sở hữu trong ý nghĩa không tôn trọng, có nghĩa là bệnh phong đã phát sinh ở người chị cả trong khi họ đang lớn lên mà không gặp trở ngại nào trong việc sinh con trai và con gái.
Lohitakatāya koviḷārapupphasadisāni. Kuṭṭharogo nāma sāsamasūrīrogā viya yebhuyyena saṅkamanasabhāvoti vuttaṃ ‘‘ayaṃ rogo saṅkamatī’’ti.
Due to being red, they were like koviḷāra flowers. Leprosy (kuṭṭharogo), like skin rash or smallpox, is usually contagious; hence, it is said, "This disease is contagious."
Do có màu đỏ như máu, nên chúng kovilārapupphasadisāni (giống như hoa Kovilāra). Bệnh phong, giống như bệnh sởi hoặc đậu mùa, thường có tính chất lây lan, nên có nói: “Căn bệnh này lây lan.”
Upari padarena paṭicchādetvā paṃsuṃ rāsikaraṇena datvā.
Having covered from above with planks and given by piling up earth.
Upari (Phía trên) có nghĩa là sau khi che phủ bằng ván gỗ và paṃsuṃ datvā (đổ đất) bằng cách chất thành đống.
Nāṭakitthiyo nāma naccantiyo.
Nāṭakitthiyo are dancing women.
Nāṭakitthiyo (Những người phụ nữ diễn viên) là những người phụ nữ nhảy múa.
Rājabhariyāyo orodhā nāma.
Royal consorts are called orodhas.
Các hoàng hậu được gọi là orodha.
Tassāti susirassa.
Of that refers to the hollow tree.
Tassā nghĩa là của cây rỗng ruột.
Migasakuṇādīnanti ettha ādisaddena vanacarakapetādike saṅgaṇhāti.
In the phrase migasakuṇādīnaṃ, the word ādi (etc.) includes forest-dwelling spirits and the like.
Trong từ Migasakuṇādīna (linh dương, chim, v.v.), từ ādi (v.v.) bao gồm các loài như quỷ đói (peta) sống trong rừng.
755
Tasmiṃ rāmaraññe nisinneti sambandho.
The connection is "when King Rāma was dwelling in that forest."
Có liên hệ là: khi vị vua Rāma đó đang ngồi.
Padareti dāruphalake.
Padare means on a wooden plank.
Padare có nghĩa là trên tấm ván gỗ.
Khattiyamāyārocanena attano khattiyabhāvaṃ jānāpetvā.
By revealing the royal trickery, causing him to know his own royal status.
Bằng cách tiết lộ mưu mẹo của vị vua, khiến cho biết được thân phận Sát-đế-lỵ của mình.
756
Mātikanti mātito āgataṃ.
Mātikaṃ means that which comes from the mother.
Mātika có nghĩa là đến từ mẹ.
Pābhatanti mūlabhaṇḍaṃ, paṇṇākāro vā.
Pābhataṃ means capital wealth, or a present.
Pābhata có nghĩa là tài sản gốc, hoặc là lễ vật.
Raññoti rāmarājassa jeṭṭhaputtabhūtassa bārāṇasirañño.
Rañño means to the King of Bārāṇasī, who was the eldest son of King Rāma.
Rañño có nghĩa là của vua Bārāṇasī, người là con trai trưởng của vua Rāma.
Tatthāti bārāṇasiyaṃ.
Tatthā means in Bārāṇasī.
Tatthā có nghĩa là ở Bārāṇasī.
Idhevāti himavantapasseyeva.
Idhevā means only in the vicinity of the Himalayas.
Idhevā có nghĩa là ngay tại sườn núi Hy-mã-lạp-sơn.
Nagaranti rājadhānībhūtaṃ mahānagaraṃ.
Nagaraṃ means the great city that was the royal capital.
Nagara có nghĩa là thành phố lớn, tức là thủ đô.
Kolarukkho nāma kuṭṭhabhesajjupago eko rukkhaviseso.
The kolarukkha is a specific type of tree used in medicine for leprosy.
Cây Kola là một loại cây đặc biệt được dùng làm thuốc chữa bệnh phong.
Byagghapatheti byagghamagge.
Byagghapathe means on a tiger's path.
Byagghapathe có nghĩa là trên đường đi của hổ.
757
Mātulāti mātu bhātaro.
Mātulā means mother's brothers.
Mātulā có nghĩa là anh em trai của mẹ (cậu).
Kesaggahaṇanti kesaveṇibandhanaṃ.
Kesaggahaṇaṃ means tying the hair into a topknot.
Kesaggahaṇa có nghĩa là búi tóc.
Dussaggahaṇanti vatthassa nivasanākāro.
Dussaggahaṇaṃ means the manner of wearing a cloth.
Dussaggahaṇa có nghĩa là cách mặc y phục.
Nhānatitthanti yathāvuttāya pokkharaṇiyā udakanhānatitthaṃ.
Nhānatitthaṃ means the bathing place for water in the aforementioned pond.
Nhānatittha có nghĩa là nơi tắm rửa bằng nước của hồ sen đã nói.
Idānipi tesaṃ jātisambhedābhāvaṃ dassento ‘‘evaṃ tesa’’ntiādimāha.
Now, to show the absence of mixed lineage among them, the master said, "Thus of those..." and so on.
Để chỉ ra rằng ngay cả bây giờ cũng không có sự pha trộn chủng tộc giữa họ, nên đã nói "evaṃ tesaṃ" (như vậy của họ), v.v.
Āvāho dārikāharaṇaṃ.
Āvāho is the taking of a daughter.
Āvāho là việc cưới con gái.
Vivāho dārikādānaṃ.
Vivāho is the giving of a daughter.
Vivāho là việc gả con gái.
Tatthāti tesu sakyakoliyesu.
Tatthā means among those Sakyans and Koliyans.
Tatthā có nghĩa là trong số những người Sakya và Koliya đó.
Dhātusaddānamanekatthattā samusaddo nivāsatthoti vuttaṃ ‘‘vasantī’’ti.
Since verbal roots have many meanings, the word saṃ is said to have the meaning of dwelling, as in "they dwell."
Vì các từ gốc (dhātu) có nhiều nghĩa, nên từ sam có nghĩa là cư trú, như đã nói "vasantī" (cư trú).
Aggeti upayogatthe bhummavacanaṃ, ādyatthe ca aggasaddo, kiriyāvisesoti ca dasseti ‘‘taṃ agga’’ntiādinā.
Agge is the locative case used in the sense of 'use', and the word agga in the sense of 'beginning'; it also indicates a special kind of action by "that beginning" and so on.
Agge là một từ ở vị trí địa phương cách (bhummavacana) theo nghĩa sử dụng, và từ agga cũng có nghĩa là ban đầu, và cũng chỉ ra rằng đó là một trạng từ bằng cách nói "taṃ agga" (điều đó là đầu tiên), v.v.
Yadettha bhagavatā vuttaṃ ‘‘atha kho ambaṭṭha rājā okkāko udānaṃ udānesi ‘sakyā vata bho kumārā, paramasakyā vata bho kumārā’ti, tadagge kho pana ambaṭṭha sakyā paññāyantī’’ti, tadetaṃ saddato, atthato ca sābhāvikanibbacananidassanaṃ ‘‘sakāhi bhaginīhipi saddhiṃ saṃvāsavasena jātisambhedamakatvā kulavaṃsaṃ anurakkhituṃ sakkuṇanti samatthentīti sakyā’’ti teyeva saddaracanāvisesena sākiyā. Yaṃ panetaṃ sakkatanighaṇṭusatthesu vuttaṃ –
Here, what was said by the Blessed One, "Then, Ambaṭṭha, King Okkāka uttered an inspired utterance: 'Indeed, sirs, the Sakyan princes! Indeed, sirs, the supreme Sakyan princes!' From that time on, Ambaṭṭha, the Sakyans became known," this is a natural derivation illustrating both the sound and the meaning: "Those who are able to preserve their family lineage without mixing their lineage by dwelling with their own sisters are called Sakyā." By a special arrangement of the word, they are called Sākiyā. And what is said in the Sanskrit dictionaries and lexicons:
Lời Đức Phật đã nói ở đây: "Này Ambaṭṭha, khi ấy, vua Okkāka đã thốt lên lời cảm thán: ‘Ôi, các vương tử Sakya thật là có khả năng! Ôi, các vương tử Sakya thật là vô cùng có khả năng!’ Này Ambaṭṭha, từ đó trở đi, các Sakya được biết đến." Lời này là một minh họa cho sự giải thích tự nhiên, cả về từ ngữ và ý nghĩa: "Những vương tử nào có khả năng (sakkuṇanti) duy trì dòng dõi hoàng tộc mà không pha trộn chủng tộc bằng cách sống chung với chính các chị em gái của mình, vì thế họ được gọi là Sakya." Và chính những người đó, với một cấu trúc từ ngữ đặc biệt, được gọi là Sākiya. Còn điều đã được nói trong các kinh điển từ điển tiếng Phạn (Sanskrit) –
758
‘‘Sākarukkhapaṭicchannaṃ, vāsaṃ yasmā purākaṃsu;
“Because they dwelt in ancient times, concealed by sāla trees,
“Vì xưa kia họ đã cư trú trong một nơi được che phủ bởi cây sāla;
759
Tasmā diṭṭhā vaṃsajāte, bhuvi ‘sakyā’ti vissutā’’ti.
Therefore, those born of that lineage are known on earth as ‘Sakyā’.”
Vì thế, những người sinh ra trong dòng dõi đó được biết đến trên thế gian là ‘Sakya’.”
760
Tadetaṃ saddamattaṃ pati asābhāvikanibbacananidassanaṃ ‘‘kapilamunino vasanaṭṭhāne sākavane vasantīti sakyā, sākiyā’’ti ca.
This is an unnatural derivation based solely on the word, as in "those who dwell in the sāla forest, the dwelling place of the sage Kapila, are Sakyā, and Sākiyā."
Điều này là một minh họa cho sự giải thích không tự nhiên chỉ dựa vào từ ngữ: "Vì họ cư trú trong rừng sāla, nơi vị đạo sĩ Kapila cư trú, nên họ được gọi là Sakya, và Sākiya."
761
Kāḷavaṇṇatāya kaṇho nāmāti vuttaṃ ‘‘kāḷavaṇṇa’’ntiādi.
He is called Kaṇha because of his dark color, hence the expression "dark-colored" and so on.
Vì có màu đen, nên được gọi là Kaṇha (đen), như đã nói "kāḷavaṇṇa" (màu đen), v.v.
Hanuyaṃ jātā massū, uttaroṭṭhassa ubhosu passesu dāṭhākārena jātā dāṭhikā. Idañca atthamattena vuttaṃ, taddhitavasena pana yathā etarahi yakkhe ‘‘pisāco’’ti samaññā, evaṃ tadā ‘‘kaṇho’’ti, tasmā jātamatteyeva sabyāharaṇena pisācasadisatāya kaṇhoti.
Massū are hairs growing on the jaw; dāṭhikā are hairs growing on both sides of the upper lip in the shape of tusks. This is said in terms of meaning alone, but in terms of derivation, just as yakkhas are now called "pisāca," so then they were called "kaṇha." Therefore, immediately upon birth, by uttering a word, because he was like a pisāca, he was called Kaṇha.
Lông mọc ở cằm là massū (râu cằm), lông mọc ở hai bên môi trên giống như răng nanh là dāṭhikā (râu mép). Điều này được nói theo nghĩa, nhưng theo nghĩa taddhita, giống như bây giờ người ta gọi yêu quái (yakkha) là "pisāca" (quỷ ăn thịt), thì khi đó họ gọi yêu quái là "kaṇha". Vì vậy, ngay khi sinh ra, vì giống như quỷ ăn thịt do cách nói, nên được gọi là Kaṇha.
Tathāhi vuttaṃ ‘‘yathā kho pana ambaṭṭha etarahi manussā pisāce disvā ‘pisācā’ti sañjānanti, evameva kho ambaṭṭha tena kho pana samayena manussā pisāce ‘kaṇhā’ti sañjānantī’’tiādi.
Thus it is said: "Just as, Ambaṭṭha, people now, seeing pisācas, recognize them as 'pisācas,' even so, Ambaṭṭha, at that time people recognized pisācas as 'kaṇhā'."
Như đã nói: "Này Ambaṭṭha, giống như bây giờ mọi người nhận ra yêu quái khi nhìn thấy chúng là 'pisāca', thì cũng vậy, này Ambaṭṭha, vào thời đó, mọi người nhận ra yêu quái là 'kaṇha'."
Tattha pisāco jātoti idāni pākaṭanāmena suviññāpanatthaṃ purimapadasseva vevacanaṃ vuttaṃ.
In that context, "a pisāca was born" is said as a synonym for the previous term, to make it easily understandable by its currently known name.
Ở đây, "pisāco jāto" (quỷ ăn thịt đã sinh ra) được nói là từ đồng nghĩa của từ trước để dễ hiểu hơn với tên gọi phổ biến hiện nay.
‘‘Na sakabaḷena mukhena byāharissāmī’’tiādīsu (pāci. 619) viya upasaggavasena saddakaraṇattho harasaddo, puna dutiyopasaggena yutto uccāsaddakaraṇe vattatīti vuttaṃ ‘‘uccāsaddamakāsī’’ti.
As in "I will not speak with a mouth full of food," etc., the word hara is used in the sense of making a sound through a prefix, and when combined with a second prefix, it means making a loud sound, thus it is said uccāsaddamakāsī (made a loud sound).
Từ har có nghĩa là tạo ra âm thanh theo nghĩa tiền tố, như trong "Na sakabaḷena mukhena byāharissāmī" (Tôi sẽ không nói bằng miệng đầy thức ăn), v.v. Và khi kết hợp với tiền tố thứ hai, nó có nghĩa là tạo ra âm thanh lớn, như đã nói "uccāsaddamakāsī" (đã tạo ra âm thanh lớn).
762
268. Attano upārambhamocanatthāyāti ācariyena, ambaṭṭhena ca attano attano upari pāpetabbopavādassa apanayanatthaṃ.
268. Attano upārambhamocanatthāyā means for the purpose of removing the blame that would fall upon oneself, both for the teacher and for Ambaṭṭha.
268. Để giải thoát khỏi sự chỉ trích của mình, có nghĩa là để loại bỏ lời buộc tội mà vị thầy và Ambaṭṭha sẽ gán cho nhau.
‘‘Attano’’ti hetaṃ vicchālopavacanaṃ.
The word "attano" here is an example of ellipsis.
Từ "attanoti" ở đây là một từ chỉ sự lược bỏ.
Paribhindissatīti anatthakāmatāpavedanena paribhedaṃ karissati, pesuññaṃ upasaṃharissatīti vuttaṃ hoti.
Paribhindissatī means he will cause division by revealing ill-will; it means he will bring about slander.
Paribhindissatī (sẽ chia rẽ) có nghĩa là sẽ gây chia rẽ bằng cách tiết lộ ý muốn làm hại, sẽ mang lời gièm pha đến.
Atthaviññāpane sādhanatāya vācā eva karaṇaṃ vākkaraṇaṃ niruttinayena, taṃ kalyāṇamassāti kalyāṇavākkaraṇo.
Speech itself is the means, vākkaraṇaṃ, for understanding the meaning, according to the science of etymology. If that speech is good for him, he is kalyāṇavākkaraṇo.
Trong việc làm cho ý nghĩa được hiểu, lời nói là phương tiện (karaṇaṃ), đó là vākkaraṇaṃ (hành động nói) theo quy tắc ngữ pháp. Nếu điều đó là tốt đẹp cho người ấy, thì người ấy là kalyāṇavākkaraṇo (người có lời nói tốt đẹp).
Asmiṃ vacane ti ettha tasaddena kāmaṃ ‘‘cattārome bho gotama vaṇṇā’’tiādinā (dī. ni. 1.266) ambaṭṭhena heṭṭhā vutto jātivādo parāmasitabbo hoti, tathāpesa jātivādo vede vuttavidhināyeva tena paṭimantetabbo, tasmā paṭimantanahetubhāvena pasiddhaṃ vedattayavacanameva parāmasitabbanti dassetuṃ vuttaṃ ‘‘attanā uggahite vedattayavacane’’ti.
In the phrase asmiṃ vacane, the word taṃ could refer to the caste-distinction mentioned earlier by Ambaṭṭha, such as "There are, Gotama, these four castes." However, that caste-distinction should be refuted by him according to the method stated in the Vedas; therefore, to show that only the statements of the three Vedas, famous as the cause of refutation, should be referred to, it is said, "in the words of the three Vedas learned by oneself."
Trong câu asmiṃ vacane (trong lời này), từ ta có thể ám chỉ lời tranh luận về đẳng cấp mà Ambaṭṭha đã nói trước đó bằng cách nói "cattārome bho gotama vaṇṇā" (Này Gotama, có bốn đẳng cấp này), v.v. Tuy nhiên, lời tranh luận về đẳng cấp đó phải được ông ta bác bỏ theo phương pháp đã nói trong kinh Veda. Do đó, để chỉ ra rằng chỉ nên ám chỉ lời nói của ba kinh Veda đã được biết đến như là nguyên nhân của sự bác bỏ, nên đã nói "attanā uggahite vedattayavacane" (trong lời nói của ba kinh Veda đã được chính ông ta học).
Idāni ‘‘porāṇaṃ kho pana te ambaṭṭha mātāpettika’’ntiādinā bhagavatā vuttavacanassapi parāmasanaṃ dassento ‘‘etasmiṃ vā dāsiputtavacane’’ti āha.
Now, to show that the words spoken by the Blessed One, such as "Indeed, Ambaṭṭha, that is ancient, pertaining to your mother and father," etc., are also referred to, it is said, "or in that saying about the son of a slave woman."
Bây giờ, để chỉ ra sự ám chỉ đến lời nói của Đức Phật đã nói bằng cách "porāṇaṃ kho pana te ambaṭṭha mātāpettika" (Này Ambaṭṭha, điều đó là của mẹ và cha ngươi từ thời xa xưa), v.v., nên đã nói "etasmiṃ vā dāsiputtavacane" (hoặc trong lời nói về con trai của người hầu gái này).
Apica paṭimantetunti ettha paṭimantanā nāma pañhāvissajjanā, uttarikathanā vā, tasmā atthadvayānurūpaṃ tabbisayassa ta-saddena parāmasanaṃ dassetīti daṭṭhabbaṃ.
Furthermore, in paṭimantetuṃ, paṭimantanā means answering a question or giving a further explanation. Therefore, it should be understood that the word ta refers to the subject in a way that is appropriate to both meanings.
Hơn nữa, trong từ paṭimantetuṃ (để bác bỏ), paṭimantanā có nghĩa là trả lời câu hỏi, hoặc là nói thêm. Do đó, cần phải hiểu rằng nó chỉ ra sự ám chỉ của từ ta đến đối tượng của cả hai nghĩa đó.
763
269. Tāvāti mantanāya paṭhamameva, akatāya eva mantanāyāti vuttaṃ hoti.
269. Tāvā means even before the consultation, meaning before any consultation has taken place.
269. Tāvā (cho đến khi đó) có nghĩa là ngay trước khi tranh luận, hoặc khi cuộc tranh luận chưa diễn ra.
Dujjānāti dubbiññeyyā, paṭhamameva sīsamukkhipituṃ asamatthanato, jātiyā ca dubbiññeyyattā, aṭṭassa ca dukkaraṇato ambaṭṭho sayameva mocetūti adhippāyo.
Dujjānā means difficult to know, because he was unable to lift his head at first, and because his caste was difficult to ascertain, and because his distress was hard to bear; the intention is that Ambaṭṭha should free himself.
Dujjānā (khó biết) có nghĩa là khó hiểu, vì không thể ngẩng đầu lên ngay từ đầu, và vì đẳng cấp khó biết, và vì việc làm khó khăn. Ý nghĩa là Ambaṭṭha nên tự giải thoát mình.
Attanāva sakyesu ibbhavādanipātanena attano upari pāpuṇanaṃ sandhāya ‘‘attanā baddhaṃ puṭaka’’nti vuttaṃ, attanāva baddhaṃ puṭoḷinti attho.
The phrase attanā baddhaṃ puṭakaṃ is said with reference to the consequence of having brought the accusation of low birth upon himself among the Sakyans; it means "the bundle tied by oneself."
"Attanā baddhaṃ puṭakaṃ" (cái gói do chính mình buộc) được nói để ám chỉ việc tự mình gán cho Sakya lời nói về đẳng cấp thấp kém, khiến lời đó rơi vào chính mình. Ý nghĩa là cái gói do chính mình buộc.
764
270. Dhammo nāma kāraṇaṃ ‘‘dhammapaṭisambhidā’’tiādīsu (vibha. 718 ādayo) viya, dhammena saha vattatīti sahadhammo, so eva sahadhammikoti āha ‘‘sahetuko’’tiādi, pariyāyavacanametaṃ.
270. Dhammo means a cause, as in "analytical knowledge of phenomena," etc. That which exists with a cause is sahadhammo, and that alone is sahadhammiko, thus he says "with a cause," etc. This is a synonymous term.
270. Dhammo (pháp) có nghĩa là nguyên nhân, giống như trong "dhammapaṭisambhidā" (phân tích về pháp), v.v. Điều gì diễn ra cùng với nguyên nhân là sahadhammo (pháp có nguyên nhân), và chính điều đó là sahadhammiko (người có pháp có nguyên nhân), như đã nói "sahetuko" (có nguyên nhân), v.v. Đây là một từ đồng nghĩa.
Janako vā hetu, upatthambhako kāraṇaṃ.
Or hetu is the generator, kāraṇaṃ is the supporter.
Hoặc là, điều tạo ra là hetu (nguyên nhân), điều hỗ trợ là kāraṇaṃ (điều kiện).
Aññena aṭṭhānagatena aññaṃ aṭṭhānagataṃ vacanaṃ. Tenāha ‘‘yo hī’’tiādi.
Aññena means by another statement that is out of place, aññaṃ vacanaṃ refers to a statement that is out of place. Therefore, he says "for indeed," etc.
Lời nói aññaṃ (khác) không đúng chỗ bởi aññena (một điều khác) không đúng chỗ. Vì thế đã nói "yo hī" (vì ai), v.v.
765
Tatoti dvikkhattuṃ codanāto paraṃ, tatiyacodanāya anāgatāya eva pakkamissāmīti vuttaṃ hoti.
Tato means after being urged twice; it means "I will depart before the third urging comes."
Tato (từ đó) có nghĩa là sau hai lần quở trách, tức là sẽ rời đi ngay cả khi lời quở trách thứ ba chưa đến.
766
271. Pūjitabbato sakko devarājā yakkho nāma.
271. Sakka, the king of devas, is called a yakkha because he is worthy of veneration.
271. Vua trời Sakka được gọi là yakkha (dạ-xoa) vì đáng được tôn kính.
Yo aggissa pakativaṇṇo, tena samannāgatanti vuttaṃ ‘‘ādittanti aggivaṇṇa’’nti.
Ādittaṃ aggivaṇṇaṃ means endowed with the natural color of fire, which is bright.
Đã nói "ādittanti aggivaṇṇa" (chói sáng như màu lửa) có nghĩa là được phú cho màu sắc tự nhiên của lửa.
Kandalo nāma pupphūpagarukkhaviseso, yassa setaṃ pupphaṃ pupphati, makuḷampissa setavaṇṇaṃ dāṭhākāraṃ hoti.
Kandalo is a specific flowering tree, whose flowers are white, and whose bud is also white and tusk-shaped.
Cây Kandala là một loại cây đặc biệt có hoa, hoa của nó màu trắng, và nụ của nó cũng có màu trắng và hình dạng giống như răng nanh.
Virūparūpanti viparītarūpasaṇṭhānaṃ.
Virūparūpaṃ means a distorted appearance or form.
Virūparūpa có nghĩa là hình dạng biến đổi, kỳ dị.
767
Aṭṭhamasattāhe ajapālanigrodhamūle nisinnassa sabbabuddhassa āciṇṇasamāciṇṇaṃ appossukkataṃ sandhāya ‘‘ahañcevā’’tiādi vuttaṃ.
The phrase "I myself" etc. is said with reference to the habitual practice of all Buddhas, who sat at the root of the Ajapāla-nigrodha tree during the eighth week, which is to be unconcerned with teaching.
"Ahañcevā" (chỉ có tôi), v.v., được nói để ám chỉ sự vô ưu (appossukkata) là một thói quen đã được thực hành của tất cả các vị Phật khi ngồi dưới gốc cây Ajapālanigrodha vào tuần thứ tám.
Avattamāneti appaṭipajjamāne, ananuvattamāne vā.
Avattamāne means if one does not practice, or if one does not follow.
Avattamāne có nghĩa là không thực hành, hoặc không tuân theo.
Tasmāti tadā tathāpaṭiññātattā.
Tasmā means because of having made such a vow at that time.
Tasmā (vì vậy) có nghĩa là vì đã hứa như vậy vào lúc đó.
Tāsetvā pañhaṃ vissajjāpessāmīti āgato yathā taṃ mūlapaṇṇāsake āgatassa saccakaparibbājakassa samāgame (ma. ni. 1.357).
He āgato (came) with the thought, "I will make him answer the question by terrifying him," just as the yakkha came at the gathering of the ascetic Saccaka in the Mūlapaṇṇāsaka.
Tāsetvā pañhaṃ vissajjāpessāmīti āgato (đến để dọa và buộc phải trả lời câu hỏi) giống như trong cuộc gặp gỡ với du sĩ Saccaka đã được nói đến trong Mūlapaṇṇāsaka (Trung Bộ Kinh, 1.357).
768
‘‘Bhagavā ceva passati ambaṭṭho cā’’ti ettha itaresamadassane duvidhampi kāraṇaṃ dassento ‘‘yadi hī’’tiādimāha.
In* “‘The Blessed One sees and Ambaṭṭha*,’” showing the two kinds of reasons for the lack of perception by others, he said, “ yadi hī” and so on.
Trong câu ‘‘Đức Thế Tôn thấy và Ambaṭṭha cũng thấy’’, khi trình bày hai loại lý do về việc những người khác không thấy, vị luận sư đã nói bắt đầu bằng ‘‘yadi hī’’ (nếu quả thật).
Hi-saddo kāraṇatthe nipāto.
The word hi is a particle in the sense of a reason.
Từ Hi là một giới từ biểu thị ý nghĩa lý do.
Yasmā agaru, yasmā ca vadeyyuṃ, tasmāti sambandho.
The connection is: “Because it is not difficult, and because they would say so.”
Mối liên hệ là: bởi vì không khó khăn, và bởi vì họ sẽ nói như vậy.
Aññesampi sādhāraṇato agaru abhāriyaṃ.
Because it is common to others, agaru means not burdensome, not heavy.
Do phổ biến cho những người khác, agaru (không khó khăn) là không nặng nề.
Āvāhetvāti mantabalena avhānaṃ katvā.
Āvāhetvā means having made an invocation through the power of a mantra.
Āvāhetvā (sau khi triệu thỉnh) có nghĩa là sau khi triệu thỉnh bằng năng lực thần chú.
Tassāti ambaṭṭhassa.
Tassā means Ambaṭṭha’s.
Tassā (của người ấy) là của Ambaṭṭha.
Antokucchi antaantaguṇādiko.
Antokucchi means the inside of the belly, such as intestines and gut.
Antokucchi (bên trong bụng) là ruột già, ruột non, v.v.
Vādasaṅghaṭṭeti vācāsaṅghaṭṭane.
Vādasaṅghaṭṭe means in the clash of words.
Vādasaṅghaṭṭe (trong sự tranh luận) có nghĩa là trong sự va chạm lời nói.
Maññamānoti maññanato.
Maññamāno means through thinking.
Maññamāno (tưởng rằng) có nghĩa là do tưởng.
Sambandhadassanañhetaṃ.
This is for showing connection.
Đây là sự trình bày về mối liên hệ.
769
272. Tāṇaṃ gavesamānoti ‘‘ayameva samaṇo gotamo ito bhayato mama tāyako’’ti bhagavantaṃyeva ‘‘tāṇa’’nti pariyesanto, upagacchantoti vuttaṃ hoti.
272. Tāṇaṃ gavesamāno means seeking the Blessed One alone as a refuge, thinking, “This recluse Gotama is my protector from this fear,” which is to say, approaching Him.
272. Tāṇaṃ gavesamāno (tìm kiếm nơi nương tựa) có nghĩa là: ‘‘Vị Sa-môn Gotama này chính là người bảo vệ tôi khỏi nỗi sợ hãi này’’, do tìm kiếm Đức Thế Tôn như là ‘‘nơi nương tựa’’, tức là đến gần Ngài.
Sesapadadvayepi eseva nayo.
The same method applies to the other two terms.
Cũng vậy đối với hai từ còn lại.
Tāyatīti yathūpaṭṭhitabhayato pāleti.
Tāyatī means protects from the present fear.
Tāyatī (bảo vệ) có nghĩa là bảo vệ khỏi nỗi sợ hãi hiện hữu.
Tenāha ‘‘rakkhatī’’ti, kattusādhanametaṃ.
Therefore, it is said ‘‘rakkhatī’’ (protects); this is an agentive derivation.
Vì vậy, vị luận sư đã nói ‘‘rakkhatī’’ (bảo vệ), đây là một từ ngữ có chủ cách.
Nilīyatīti yathūpaṭṭhiteneva bhayena upadduto nilīno hoti, adhikaraṇasādhanametaṃ.
Nilīyatī means afflicted by the present fear, one hides; this is a locative derivation.
Nilīyatī (ẩn náu) có nghĩa là bị quấy rầy bởi nỗi sợ hãi hiện hữu mà ẩn mình, đây là một từ ngữ có sở cách.
Sarasaddo hiṃsane, tañca viddhaṃsanameva adhippetanti vuttaṃ ‘‘bhayaṃ hiṃsati viddhaṃsetī’’ti, kattusādhanametaṃ.
The word sara is in the sense of harming, and it is understood to mean destruction, as stated: ‘‘bhayaṃ hiṃsati viddhaṃsetī’’ (fear harms, destroys); this is an agentive derivation.
Từ Sara (nơi nương tựa) có nghĩa là làm hại, và ý nghĩa được ngụ ý là sự hủy diệt, vì vậy vị luận sư đã nói ‘‘bhayaṃ hiṃsati viddhaṃsetī’’ (nỗi sợ hãi làm hại, hủy diệt), đây là một từ ngữ có chủ cách.
770
Ambaṭṭhavaṃsakathāvaṇṇanā
The Description of the Ambaṭṭha Lineage
Lời giải thích về câu chuyện dòng dõi Ambaṭṭha
771
274. Gaṅgāya dakkhiṇatoti gaṅgāya nāma nadiyā dakkhiṇadisābhāge.
274. Gaṅgāya dakkhiṇato means on the southern side of the river named Gaṅgā.
274. Gaṅgāya dakkhiṇato (phía nam sông Gaṅgā) có nghĩa là ở phía nam con sông tên là Gaṅgā.
Brāhmaṇatāpasāti brahmakulino tāpasā.
Brāhmaṇatāpasā means Brahmins who are ascetics.
Brāhmaṇatāpasā (các đạo sĩ Bà-la-môn) có nghĩa là các đạo sĩ thuộc dòng dõi Bà-la-môn.
Saraṃ vā sattiādayo vā parassa upari khipitukāmassa mantānubhāvena hatthaṃ na parivattati, hatthe pana aparivattante kuto āvudhaṃ parivattissatīti tathā aparivattanaṃ sandhāya ‘‘āvudhaṃ na parivattatī’’ti vuttaṃ.
It is said ‘‘āvudhaṃ na parivattatī’’ (the weapon does not turn back) with reference to the hand not turning back due to the power of the mantra when one desires to hurl an arrow or a spear, etc., at another. If the hand does not turn back, how could the weapon turn back?
Đối với người muốn phóng mũi tên hoặc giáo mác, v.v., vào người khác, nhờ năng lực thần chú mà cánh tay không thể xoay chuyển. Khi cánh tay không xoay chuyển, làm sao vũ khí có thể xoay chuyển? Do đó, để chỉ sự không xoay chuyển như vậy, vị luận sư đã nói ‘‘āvudhaṃ na parivattatī’’ (vũ khí không xoay chuyển).
Bhadraṃ bhoti sampaṭicchanaṃ, sādhūti attho.
Bhadraṃ bho is an acceptance, meaning “it is good.”
Bhadraṃ bho (thưa ngài tốt lành) là sự chấp nhận, có nghĩa là ‘‘tốt lành’’.
Dhanunā khittasarena agamanīyaṃ sasambhārakathānayena ‘‘dhanu agamanīya’’nti vuttaṃ yathā ‘‘dhanunā vijjhati, cakkhunā passatī’’ti.
‘‘Dhanu agamanīya’’ (the bow is not to be gone with) is said in the manner of sasambhāra kathā for an arrow shot from a bow that cannot be reached, just as one says, “He shoots with a bow, he sees with an eye.”
Do mũi tên bắn từ cung không thể đi tới, theo cách nói về sự chuẩn bị, vị luận sư đã nói ‘‘dhanu agamanīya’’ (cung không thể đi tới), giống như ‘‘bắn bằng cung, thấy bằng mắt’’.
Ambaṭṭhaṃ nāma vijjanti sattānaṃ sarīre abbhaṅgaṃ ṭhapetīti ambaṭṭhā niruttinayena, evaṃladdhanāmaṃ mantavijjanti attho.
Ambaṭṭhaṃ nāma vijja means a mantra-science named Ambaṭṭha, which by etymology is called ambaṭṭhā because it applies ointment to the bodies of beings.
Ambaṭṭhaṃ nāma vijja (thần chú tên là Ambaṭṭha) có nghĩa là: theo cách giải thích từ nguyên, ambaṭṭhā là những mũi tên, v.v., đến thẳng thân thể chúng sinh. Từ đó, có nghĩa là thần chú được gọi tên như vậy.
Yato ambaṭṭhā vijjā etasmiṃ atthīti katvā kaṇho isi ‘‘ambaṭṭho’’ti paññāyittha, tabbaṃsajātatāya panāyaṃ māṇavo ‘‘ambaṭṭho’’ti voharīyati.
Because the Ambaṭṭha mantra-science existed in him, the sage Kaṇha became known as “Ambaṭṭha.” And this young man is called “Ambaṭṭha” because he was born into that lineage.
Vì vị đạo sĩ Kaṇha có thần chú Ambaṭṭha, nên ngài được biết đến với tên ‘‘Ambaṭṭha’’, và do sinh ra trong dòng dõi đó, vị thanh niên này được gọi là ‘‘Ambaṭṭha’’.
So kira ‘‘kathaṃ nāmāhaṃ disāya dāsiyā kucchimhi nibbatto’’ti taṃ hīnaṃ jātiṃ jigucchanto ‘‘handāhaṃ yathā tathā imaṃ jātiṃ sodhessāmī’’ti niggato.
It is said that he, disliking that low birth, thinking, “How was I born in the womb of a female slave from Disā?” departed, intending, “Well, I shall somehow purify this birth.”
Nghe nói, ông ta đã rời đi vì ghê tởm dòng dõi thấp kém đó, nghĩ rằng: ‘‘Làm sao ta lại sinh ra trong bụng một người nữ tớ gái của phương hướng? Thôi được, ta sẽ thanh lọc dòng dõi này bằng mọi cách có thể’’.
Tena vuttaṃ ‘‘idāni me manorathaṃ pūressāmī’’ti.
Therefore, it is said ‘‘idāni me manorathaṃ pūressāmī’’ (Now I shall fulfill my wish).
Vì vậy, vị luận sư đã nói ‘‘idāni me manorathaṃ pūressāmī’’ (bây giờ ta sẽ hoàn thành ước nguyện của mình).
Ayañhissa manoratho – vijjābalena rājānaṃ tāsetvā tassa dhītaraṃ laddhakālato paṭṭhāya myāyaṃ dāsajāti sodhitā bhavissatīti.
This was his wish: that by the power of his knowledge, by terrifying the king and obtaining his daughter, his slave birth would be purified from that time onwards.
Ước nguyện của ông ta là: ‘‘Khi ta đã làm cho nhà vua sợ hãi bằng năng lực thần chú và cưới được con gái của ông ta, thì dòng dõi nô lệ này của ta sẽ được thanh lọc’’.
772
Seṭṭhamanteti seṭṭhabhūte vedamante.
Seṭṭhamante means among the supreme Vedic mantras.
Seṭṭhamante (những thần chú tối thượng) có nghĩa là những thần chú Veda tối thượng.
Ko nu kiṃ kāraṇā dāsiputto samāno maddarūpiṃ dhītaraṃ yācatīti attho.
Ko nu means for what reason, what is the cause, that being the son of a female slave, he asks for a daughter with a beautiful form? This is the meaning.
Ko nu (ai) là vì lý do gì mà dāsiputto (con trai của người tớ gái), lại xin con gái của vua, người có sắc đẹp tuyệt trần? Đó là ý nghĩa.
Khurati chindati, khuraṃ vā pāti pivatīti khurappo, khuramassa agge appīyati ṭhapīyatīti vā khurappo, saro.
It cuts, hence khurappo (barbed arrow). Or, it drinks a razor (khuraṃ pāti pivatīti), so khurappo. Or, a razor is fixed (khuramassa agge appīyati ṭhapīyatīti) at its tip, so khurappo, meaning an arrow.
Khurati (cắt), chindati (chặt), hoặc khuraṃ vā pāti (uống lưỡi dao) là khurappo (mũi tên). Hoặc mũi dao được đặt ở đầu mũi tên nên gọi là khurappo, tức là mũi tên.
Mantānubhāvena rañño bāhukkhambhamattaṃ jātaṃ, tena pana bāhukkhambhena ‘‘ko jānāti, kiṃ bhavissatī’’ti rājā bhīto ussaṅkī utrasto ahosi.
Mantānubhāvena means by the power of the mantra, the king's arm became stiff. Because of that stiff arm, the king became afraid, suspicious, and terrified, thinking, “Who knows what will happen?”
Mantānubhāvena (nhờ năng lực thần chú) mà cánh tay của nhà vua trở nên cứng đờ. Vì cánh tay cứng đờ đó, nhà vua sợ hãi, nghi ngờ và kinh hoàng, nghĩ rằng: ‘‘Ai biết được, điều gì sẽ xảy ra?’’
Tathā ca vuttaṃ ‘‘bhayena vedhamāno aṭṭhāsī’’ti.
Thus, it is said ‘‘bhayena vedhamāno aṭṭhāsī’’ (stood trembling with fear).
Và như vậy, vị luận sư đã nói ‘‘bhayena vedhamāno aṭṭhāsī’’ (đứng run rẩy vì sợ hãi).
773
Sarabhaṅgajātake (jā. 2.17.52) āgatānaṃ daṇḍakīrājādīnaṃ pacchā okkākarājā ahosi, tesaṃ pavatti ca sabbattha cirakālaṃ pākaṭāti āha ‘‘daṇḍakīrañño’’tiādi.
Sarabhaṅgajātake (Jā. 2.17.52), King Okkāka came after the kings like Daṇḍakī. Their history was well-known everywhere for a long time, so it is said ‘‘daṇḍakīrañño’’ and so on.
Trong Sarabhaṅgajātaka (Jā. 2.17.52), sau các vị vua như vua Daṇḍakī, v.v., đã xuất hiện, có vua Okkāka. Do câu chuyện về họ đã nổi tiếng khắp nơi từ lâu, vị luận sư đã nói ‘‘daṇḍakīrañño’’ (vua Daṇḍakī), v.v.
Aparaddhassa daṇḍakīrañño, aparaddho nāḷikero, ajjuno cāti sambandho.
It is to be connected as: "Of King Daṇḍakī who offended, of Nāḷikera who offended, and of Arjuna who offended."
Vua Daṇḍakī đã phạm lỗi, Nāḷikera đã phạm lỗi, và Arjuna cũng đã phạm lỗi. Đó là mối liên hệ.
Satipi vālukādivasse āvudhavasseneva vināsoti vuttaṃ ‘‘āvudhavuṭṭhiyā’’ti.
Even if there was a rain of sand and so on, the destruction was only by a rain of weapons, so it is said ‘‘āvudhavuṭṭhiyā’’.
Mặc dù có mưa cát, v.v., sự hủy diệt chỉ xảy ra do mưa vũ khí, vì vậy vị luận sư đã nói ‘‘āvudhavuṭṭhiyā’’ (do mưa vũ khí).
‘‘Ayampi īdiso mahānubhāvo’’ti maññamānā evaṃ cintayantā bhayena avocunti daṭṭhabbaṃ.
It should be understood that they, thinking, “This one too has such great power,” cintayantā bhayena avocuṃ (thought thus and spoke out of fear).
Cần hiểu rằng họ đã cintayantā bhayena avocuṃ (suy nghĩ và nói trong sợ hãi), nghĩ rằng: ‘‘Vị này cũng có đại thần thông như vậy’’.
774
Undriyissatīti bhindiyissati.
Undriyissatī means it will be broken, shattered.
Undriyissatī (sẽ bị phá vỡ) có nghĩa là sẽ bị vỡ nát.
Kammarūpañhetaṃ ‘‘pathavī’’ti kammakattuvasena vuttattā yathā ‘‘kusulo bhijjatī’’ti.
This is a karmarūpa, meaning an agentive passive construction, because “earth” is mentioned as an agentive passive, like “the granary breaks.”
Đây là một hình thức bị động, vì ‘‘đất’’ được nói theo cách bị động, giống như ‘‘kho lúa bị vỡ’’.
Tenāha ‘‘bhijjissatī’’ti.
Therefore, it is said ‘‘bhijjissatī’’ (it will be broken).
Vì vậy, vị luận sư đã nói ‘‘bhijjissatī’’ (sẽ bị vỡ).
Thusamuṭṭhīti palāsamuṭṭhi, bhusamuṭṭhi vā.
Thusamuṭṭhī means a handful of straw, or a handful of husk.
Thusamuṭṭhī (nắm vỏ trấu) có nghĩa là nắm rơm, hoặc nắm vỏ trấu.
Kasmāti āha ‘‘sarasanthambhanamatte’’tiādi.
Why? He says, ‘‘sarasanthambhanamatte’’ (merely by stiffening the arrow) and so on.
Tại sao? Vị luận sư đã nói ‘‘sarasanthambhanamatte’’ (chỉ cần làm cứng mũi tên), v.v.
775
Bhītatasitā bhayavasena chambhitasarīrā uddhaggalomā honti haṭṭhalomā, abhītatasitā pana bhayupaddavābhāvato acchambhitasarīrā patitalomā honti ahaṭṭhalomā, khemena sotthinā tiṭṭhanti, tāya pana patitalomatāya tassa sotthibhāvo pākaṭo hotīti phalena kāraṇaṃ vibhāvetuṃ pāḷiyaṃ ‘‘pallomo’ti vuttanti dasseti ‘‘pannalomo’’tiādinā.
Those who are afraid and terrified have bodies trembling with fear, their hairs standing on end, bristling; but those who are not afraid and terrified, due to the absence of danger and fear, have untrembling bodies and fallen hairs, not bristling. They stand in security and safety. To show the reason by its effect, that his safety is evident from that fallen hair, the Pāli says pallomo, which is explained by ‘‘pannalomo’’ (fallen hair) and so on.
Những người sợ hãi và kinh hoàng thì thân thể run rẩy, lông dựng đứng, tức là haṭṭhalomā. Còn những người không sợ hãi và kinh hoàng, do không có sự quấy rầy của nỗi sợ hãi, thì thân thể không run rẩy, lông rụng xuống, tức là ahaṭṭhalomā. Họ đứng yên ổn và an toàn. Vị luận sư trình bày rằng sự an toàn của người đó trở nên rõ ràng nhờ sự rụng lông đó, và để làm rõ nguyên nhân bằng kết quả, trong Pāḷi đã nói ‘‘pallomo’’, v.v., để chỉ ‘‘pannalomo’’ (lông rụng xuống).
Niruttinayena padasiddhi yathā taṃ bhayabheravasutte ‘‘bhiyyo pallomamāpādiṃ araññe vihārāyā’’ti (ma. ni. 1.36 ādayo).
The etymological derivation of the word is as in the Bhayabherava Sutta: ‘‘bhiyyo pallomamāpādiṃ araññe vihārāyā’’ti (MN 1.36 and so on).
Sự thành lập từ theo cách giải thích từ nguyên giống như trong Bhayabheravasutta (Ma. Ni. 1.36, v.v.): ‘‘bhiyyo pallomamāpādiṃ araññe vihārāyā’’ (ta đã trở nên bình tĩnh hơn khi sống trong rừng).
Idanti osānavacanaṃ.
Idaṃ is the concluding statement.
Idaṃ (điều này) là lời kết thúc.
‘‘Sace me rājā taṃ dārikaṃ dasseti, kumāro sotthi pallomo bhavissatī’’ti paṭiññākaraṇaṃ pakaraṇatoyeva pākaṭaṃ.
The making of the promise, “If the king gives me that girl, the prince will be well and have his hair fallen,” is evident from the context itself.
Việc hứa hẹn rằng ‘‘Nếu nhà vua gả con gái cho tôi, thì vị hoàng tử sẽ an toàn và bình yên’’ là rõ ràng từ bối cảnh.
Tenāti kaṇhena.
Tenā means by Kaṇha.
Tena (do đó) là do Kaṇha.
Manteti bāhukkhambhakamantassa paṭippassambhakavijjāsaṅkhāte mante.
Mante refers to the mantra, specifically the mantra that is a counter-spell (vijjāsaṅkhāta) to the arm-stiffening mantra.
Mante (thần chú) là thần chú có tên là vijjā (trí tuệ) có khả năng làm dịu thần chú làm cứng cánh tay.
Evarūpānañhi bhayupaddavakarānaṃ mantānaṃ ekaṃseneva paṭippassambhakamantāhonti yathā taṃ kusumārakavijjādīnaṃ.
Indeed, for such terrifying and troublesome mantras, there are always counter-spells, just as there are for kusumārakavijjā (the mantra that makes flowers bloom) and so on.
Thật vậy, đối với những thần chú gây ra nỗi sợ hãi và quấy rầy như vậy, luôn có những thần chú làm dịu, giống như những thần chú làm dịu các phép thuật như Kusumāraka, v.v.
Parivattiteti pajappite.
Parivattite means recited, muttered.
Parivattite (khi được đọc) có nghĩa là khi được niệm.
Attano dhītuyā apavādamocanatthaṃ taṃ adāsaṃ bhujissaṃ karoti.
To free his daughter from blame, he made that one (Kaṇha) not a slave, but a freeman.
Để giải thoát con gái mình khỏi sự chỉ trích, nhà vua đã giải phóng ông ta khỏi thân phận nô lệ.
Tassā anurūpe issariye ṭhapanatthaṃ uḷāre ca naṃ ṭhāne ṭhapesi.
To place her in a fitting position of authority, he placed her in a great position.
Để đặt cô ấy vào một vị trí quyền lực phù hợp với cô ấy, nhà vua uḷāre ca naṃ ṭhāne ṭhapesi (và đặt cô ấy vào một vị trí cao quý).
Ekena pakkhenāti mātupakkhena.
Ekena pakkhenā means from the mother’s side.
Ekena pakkhenā (về một phía) là về phía mẹ.
Karuṇāyanto samassāsanatthaṃ āha, na pana uccākulīnabhāvadassanatthaṃ.
Feeling compassion, he spoke to reassure, not to show high lineage.
Đức Thế Tôn đã nói để an ủi, vì lòng bi mẫn, chứ không phải để thể hiện dòng dõi cao quý.
Tenāha ‘‘atha kho bhagavā’’tiādi.
Therefore, it is said ‘‘atha kho bhagavā’’ and so on.
Vì vậy, vị luận sư đã nói ‘‘atha kho bhagavā’’ (rồi Đức Thế Tôn), v.v.
776
Khattiyaseṭṭhabhāvavaṇṇanā
The Description of the Nobility of the Khattiyas
Lời giải thích về sự tối thượng của dòng dõi Sát-đế-lợi
777
275. Brāhmaṇesūti vohāramattaṃ, brāhmaṇānaṃ samīpe brāhmaṇehi laddhabbāni āsanādīni labhethāti vuttaṃ hoti.
275. Brāhmaṇesu is merely a conventional expression, meaning that one should obtain the seats and other honors due to Brahmins in the presence of Brahmins.
275. Brāhmaṇesū (trong số các Bà-la-môn) chỉ là một cách gọi thông thường, có nghĩa là người ta sẽ nhận được chỗ ngồi, v.v., mà các Bà-la-môn nhận được gần các Bà-la-môn.
Tena vuttaṃ ‘‘brāhmaṇānaṃ antare’’ti.
Therefore, it is said ‘‘brāhmaṇānaṃ antare’’ (among Brahmins).
Vì vậy, vị luận sư đã nói ‘‘brāhmaṇānaṃ antare’’ (giữa các Bà-la-môn).
Kevalaṃ vedasatthānurūpaṃ paralokagate saddhāya eva kātabbaṃ, na tadaññaṃ kiñci abhipatthentenāti saddhanti nibbacanaṃ dassetuṃ ‘‘matake uddissa katabhatte’’ti vuttaṃ.
Saddha (faith) is explained as ‘‘matake uddissa katabhatte’’ (a meal offered in dedication to the deceased) to show that it is only to be done according to the Vedic scriptures for those who have gone to the other world, with faith, and not desiring anything else.
Để giải thích từ saddha (lễ cúng dường cho người chết) rằng: chỉ nên làm theo kinh sách Veda cho những người đã qua đời với lòng tin, chứ không nên mong cầu bất cứ điều gì khác, vị luận sư đã nói ‘‘matake uddissa katabhatte’’ (bữa ăn được chuẩn bị để tưởng nhớ người chết).
Maṅgalādibhatteti ettha ādisaddena ussavadevatārādhanādibhatte saṅgaṇhāti.
In Maṅgalādibhatte, the word ādi (etc.) includes meals offered for festivals, propitiating deities, and so on.
Trong Maṅgalādibhatte (bữa ăn nghi lễ, v.v.), từ ādi (v.v.) bao gồm các bữa ăn cúng dường thần linh trong lễ hội, v.v.
Yaññabhatteti pāpasaññamādivasena katabhatte.
Yaññabhatte refers to meals prepared as an act of restraint from evil, and so on.
Yaññabhatte (bữa ăn cúng tế) có nghĩa là bữa ăn được chuẩn bị để giữ giới không làm ác, v.v.
‘‘Pāpasaññamādibhatto bhavissatī’’tiādinā hi aggihomo idha yaññaṃ.
Indeed, in this context, aggihoma (fire oblation) is a sacrifice, by means of such phrases as “it will be a meal prepared as restraint from evil and so on.”
Thật vậy, ở đây, việc cúng dường lửa là một lễ cúng tế, bắt đầu bằng ‘‘bữa ăn cúng dường để giữ giới không làm ác’’, v.v.
Pāhunakānanti atithīnaṃ.
Pāhunakānaṃ means for guests.
Pāhunakānaṃ (của khách) là của những vị khách.
Anāgantukānampi pāheṇakabhattaṃ ‘‘pāhuna’’ntveva vuccatīti āha ‘‘paṇṇākārabhatte vā’’ti.
It is said that even a meal sent as a gift to non-visitors is called pāhuna, so he states ‘‘paṇṇākārabhatte vā’’ (or a gift meal).
Ngay cả bữa ăn được gửi cho những người không phải là khách cũng được gọi là ‘‘pāhuna’’ (quà tặng), vì vậy vị luận sư đã nói ‘‘paṇṇākārabhatte vā’’ (hoặc bữa ăn quà tặng).
Āvaṭaṃ nivāraṇaṃ.
Āvaṭaṃ means restriction.
Āvaṭaṃ (bị che chắn) là sự ngăn cản.
Anāvaṭaṃ anivāraṇaṃ.
Anāvaṭaṃ means unrestricted.
Anāvaṭaṃ (không bị che chắn) là không bị ngăn cản.
Khattiyabhāvaṃ appatto ubhatosujātābhāvato.
Khattiyabhāvaṃ appatto means not having attained the status of a Khattiya due to not being well-born on both sides.
Khattiyabhāvaṃ appatto (không đạt được địa vị Sát-đế-lợi) là do không có dòng dõi thuần khiết từ cả hai phía.
Tenāha ‘‘aparisuddho’’ti.
Therefore, it is said ‘‘aparisuddho’’ (impure).
Vì vậy, vị luận sư đã nói ‘‘aparisuddho’’ (không thanh tịnh).
778
276. Itthiyā vā itthiṃ karitvāti ettha karaṇaṃ nāma kiriyāsāmaññavisayaṃ karabhūdhātūnaṃ atthavasena sabbadhātvantogadhattāti āha ‘‘pariyesitvā’’ti.
276. Here, regarding "Itthiyā vā itthiṃ karitvā" (having made a woman into a woman or by a woman into a woman), karaṇaṃ (making) refers to the general domain of action, because due to the meaning of the roots kar and bhū, it is included within all roots. Therefore, it is said, "pariyesitvā" (having sought out).
276. Ở đây, cụm từ Itthiyā vā itthiṃ karitvā (hoặc đã làm một người nữ thành người nữ) thì karaṇa (làm) là một từ thuộc phạm vi chung của hành động, vì theo nghĩa của các động từ kar (làm) và bhū (là), nó bao hàm tất cả các động từ. Do đó, (Vị Luận sư) nói pariyesitvā (sau khi tìm kiếm).
Khattiyakumārassa bhariyābhūtaṃ brāhmaṇakaññaṃ itthiṃ pariyesitvā gahetvā brāhmaṇānaṃ itthiyā vā khattiyāva seṭṭhā, ‘‘hīnā brāhmaṇā’’ti pāḷimudāharitvā yojetabbaṃ.
One should illustrate this by quoting the Pali, "Khattiyas are superior to Brahmins by their women, and Brahmins are inferior," having sought out and taken a Brahmin maiden, who was the wife of a Khattiya prince, as a woman.
Cần phải kết nối bằng cách dẫn ra đoạn Pāḷi: “Sau khi tìm kiếm và lấy một người nữ là một cô gái Bà-la-môn, người đã trở thành vợ của một hoàng tử Sát-đế-lỵ, thì trong số những người nữ của Bà-la-môn, Sát-đế-lỵ là ưu việt, Bà-la-môn là kém cỏi.”
‘‘Purisena vā purisaṃ karitvāti etthāpi eseva nayo’’ti (dī. ni. ṭī. 1.276) ācariyena vuttaṃ.
The teacher also stated, "The same method applies to 'Purisena vā purisaṃ karitvā' (having made a man into a man or by a man into a man)."
Vị Luận sư đã nói: “Ở đây cũng vậy, đối với Purisena vā purisaṃ karitvā (hoặc đã làm một người nam thành người nam), cũng theo cách tương tự.”
Tatthāpi hi khattiyakaññāya patibhūtaṃ brāhmaṇakumāraṃ purisaṃ pariyesitvā gahetvā brāhmaṇānaṃ purisena vā khattiyāva seṭṭhā, hīnā brāhmaṇāti yojanā.
There too, the explanation is: Khattiyas are superior, and Brahmins are inferior, by their men; having sought out and taken a Brahmin youth, who was the husband of a Khattiya maiden, as a man.
Ở đó cũng vậy, cách kết nối là: “Sau khi tìm kiếm và lấy một người nam là một hoàng tử Bà-la-môn, người đã trở thành chồng của một công chúa Sát-đế-lỵ, thì trong số những người nam của Bà-la-môn, Sát-đế-lỵ là ưu việt, Bà-la-môn là kém cỏi.”
Kismiñcideva pakaraṇeti ettha pakaraṇaṃ nāma kāraṇaṃ ‘‘etasmiṃ nidāne etasmiṃ pakaraṇe’’tiādīsu (pāci. 42, 90) viya, tasmā rāgādivasena pakkhalite ṭhāne hetubhūteti attho, taṃ pana atthato aparādhova, so ca akattabbakaraṇanti āha ‘‘kismiñcideva dose’’tiādi.
Here, pakaraṇaṃ (occasion/matter) is a cause, as in "etasmiṃ nidāne etasmiṃ pakaraṇe" (on this ground, on this occasion). Therefore, it means a causal situation where one has slipped up due to lust, etc. In essence, it is an offense, and that is an unwholesome action, thus it is stated as "kismiñcideva dose" (in some fault) and so forth.
Trong cụm từ Kismiñcideva pakaraṇe (trong một trường hợp nào đó), pakaraṇa (trường hợp) có nghĩa là nguyên nhân, như trong các đoạn “trong nhân duyên này, trong trường hợp này” v.v. Do đó, có nghĩa là một nhân tố gây ra sự sa ngã do tham ái v.v. Về mặt ý nghĩa, đó chính là một lỗi lầm, và lỗi lầm đó là việc làm không nên làm. Vì vậy, (Vị Luận sư) nói kismiñcideva dose (trong một lỗi lầm nào đó) v.v.
Bhassasaddo bhasmapariyāyo.
The word bhassa is a synonym for bhasma (ash).
Từ bhassa là một từ đồng nghĩa với bhasma (tro).
Bhasīyati niratthakabhāvena khipīyatīti hi bhassaṃ, chārikā.
For it is bhassaṃ (something useless/ash), chārikā (ash) that is thrown away due to its uselessness.
Quả thật, cái bị vứt bỏ vì vô ích được gọi là bhassa, tức là tro tàn.
‘‘Vadhitvā’’ti etassa atthavacanaṃ ‘‘okiritvā’’ti.
‘‘Okiritvā’’ (having scattered) is an explanation of the meaning of ‘‘vadhitvā’’ (having killed/struck down).
Từ okiritvā (vứt bỏ) là từ diễn giải nghĩa của vadhitvā (đã đánh đập).
779
277. Kammakilesehi janetabbo, tehi vā jāyatīti janito, sveva janeto, manussova.
277. That which is to be produced by kamma and defilements, or that which arises from them, is janita (generated); that same janita is janeta, meaning a human being.
277. Cái được sinh ra bởi nghiệp và phiền não, hoặc cái sinh ra từ chúng, được gọi là janito, chính nó là janeto, tức là con người.
Tathā hi vuttaṃ ‘‘ye gottapaṭisārino’’ti.
Thus it is stated, "those who are dependent on their lineage (gotta-paṭisārino)."
Như đã nói: “Những ai truy nguyên dòng dõi.”
Tadetaṃ pajāvacanaṃ viya jātisaddavasena bahumhi ekavacananti āha ‘‘pajāyāti attho’’ti.
This word janeta (parent/progenitor), like the word pajā (offspring), is a singular term used for many based on its generic meaning. Therefore, it means "offspring."
Từ janeta này, giống như từ pajā (con cháu), là số ít nhưng có nghĩa số nhiều xét theo từ chỉ chủng loại. Do đó, (Vị Luận sư) nói: “Có nghĩa là con cháu.”
Etasmiṃ janetipi yujjati.
It also applies to janeti (begets).
Nó cũng phù hợp với ý nghĩa jane (người).
Paṭisarantīti gottaṃ paṭicca ‘‘ahaṃ gotamo, ahaṃ kassapo’’tiādinā saraṇaṃ karonti vicinanti.
Paṭisarantī means they refer to their lineage, considering, "I am of Gotama clan, I am of Kassapa clan," and so on.
Paṭisarantī (họ truy nguyên): Họ ghi nhớ hoặc xem xét dòng dõi bằng cách nói: “Tôi là Gotama, tôi là Kassapa” v.v.
780
Paṭhamabhāṇavāravaṇṇanā niṭṭhitā.
The explanation of the first recitation section is concluded.
Phần chú giải về chương tụng thứ nhất đã hoàn tất.
781
Vijjācaraṇakathāvaṇṇanā
Explanation of Knowledge and Conduct
Chú giải về câu chuyện Vijjācaraṇa (Minh và Hạnh)
782
278. Imasmiṃ pana siloke āhariyamāne brahmagarukā saddheyyataṃ āpajjissanti, ambaṭṭho ca ‘‘vijjācaraṇasampanno’’ti padaṃ sutvā vijjācaraṇaṃ pucchissati, evamayaṃ vijjācaraṇaparidīpanī desanā mahājanassa sātthikā bhavissatīti passitvā lokanātho imaṃ silokaṃ sanaṅkumārabhāsitaṃ āharīti imamatthampi vibhāvento ‘‘imāya pana gāthāyā’’tiādimāha.
278. Seeing that by reciting this verse, those who revere Brahmā will attain faith, and Ambaṭṭha, upon hearing the phrase "endowed with knowledge and conduct," will inquire about knowledge and conduct, and thus this discourse explaining knowledge and conduct will be beneficial to the multitude, the Lord of the world recited this verse spoken by Sanaṅkumāra; so the teacher explains this matter by beginning with "By this verse."
278. Đức Thế Tôn, khi thấy rằng nếu tụng đọc bài kệ này, những người tôn kính Phạm thiên sẽ trở nên tin tưởng, và Ambaṭṭha sẽ hỏi về vijjācaraṇa (minh và hạnh) khi nghe cụm từ “người đầy đủ minh và hạnh”, và như vậy, bài pháp này giải thích về minh và hạnh sẽ có lợi ích cho đại chúng, nên đã dẫn ra bài kệ này do Sanankumāra Phạm thiên nói. Để làm rõ ý này, (Vị Luận sư) đã nói imāya pana gāthāyā (nhưng với bài kệ này) v.v.
Itarathā hi bhagavāpi asabbaññū parāvassayo bhaveyya, na ca yujjati bhagavato parāvassayatā sammāsambuddhabhāvato.
Otherwise, the Blessed One would also be not omniscient and dependent on others, and it is not fitting for the Blessed One to be dependent on others, due to His being a Perfectly Self-Enlightened One.
Nếu không, Đức Thế Tôn cũng sẽ là người không Toàn Giác, phải nương tựa vào người khác, nhưng việc Đức Thế Tôn phải nương tựa vào người khác là không hợp lý, vì Ngài là bậc Chánh Đẳng Giác.
Tenāha ‘‘ahampi hi, ambaṭṭha, evaṃ vadāmī’’tiādi.
Therefore, it is said, "Even I, Ambaṭṭha, say so," and so forth.
Vì vậy, (Đức Thế Tôn) nói: “Này Ambaṭṭha, Ta cũng nói như vậy” v.v.
Brāhmaṇasamaye siddhanti brāhmaṇaladdhiyā pākaṭaṃ.
"Siddhaṃ in the Brahmin tradition" means well-known in the Brahmin doctrine.
Brāhmaṇasamaye siddhaṃ có nghĩa là rõ ràng theo giáo lý của Bà-la-môn.
Vakkhamānanayena jātivādādipaṭisaṃyuttaṃ. ‘‘Saṃsanditvāti ghaṭetvā, aviruddhaṃ katvāti attho’’ti (dī. ni. ṭī. 1.277) ācariyenavuttaṃ.
It is "jātivādādi-paṭisaṃyuttaṃ" (connected with theories of birth, etc.) in the manner to be explained. The teacher stated, ‘‘Saṃsanditvā’’ (having connected) means having joined, having made it consistent.
Theo cách sẽ được giải thích, nó jātivādādipaṭisaṃyuttaṃ (liên quan đến thuyết dòng dõi v.v.). Vị Luận sư đã nói: “Saṃsanditvā (sau khi kết hợp) có nghĩa là sau khi ghép lại, sau khi làm cho không mâu thuẫn.”
Idāni pana potthakesu ‘‘paṭikkhipitvā’’ti pāṭho dissati, so ayuttova.
However, in present texts, the reading ‘‘paṭikkhipitvā’’ (having rejected) is found, which is inappropriate.
Hiện nay, trong các bản kinh, có một bản đọc là paṭikkhipitvā (sau khi bác bỏ), nhưng điều đó không hợp lý.
Kasmāti ce?
Why so?
Tại sao vậy?
Na hi pāḷiyaṃ brāhmaṇasamayasiddhaṃ vijjācaraṇaṃ paṭikkhipati, tadeva ambaṭṭhena cintitaṃ vijjācaraṇaṃ ghaṭetvā aviruddhaṃ katvā anuttaraṃ vijjācaraṇaṃ desetīti.
For the Blessed One does not reject the knowledge and conduct established in the Brahmin tradition in the Pali. Rather, He elucidates the unsurpassed knowledge and conduct by harmonizing it with the knowledge and conduct conceived by Ambaṭṭha, rendering it consistent.
Vì trong Pāḷi, Đức Thế Tôn không bác bỏ minh và hạnh đã được thiết lập theo truyền thống Bà-la-môn, mà Ngài chỉ kết hợp minh và hạnh mà Ambaṭṭha đã nghĩ đến, làm cho chúng không mâu thuẫn, và giảng về minh và hạnh vô thượng.
783
Vādoti laddhi, vacībhedo vā.
Vāda means doctrine or a kind of speech.
Vādo (thuyết) có nghĩa là giáo lý, hoặc sự khác biệt trong lời nói.
Tenāha ‘‘brāhmaṇa…pe…ādivacana’’nti.
Therefore, it is stated, "brāhmaṇa…and so forth…speech."
Vì vậy, (Vị Luận sư) nói brāhmaṇa…pe…ādivacana (lời nói của Bà-la-môn v.v.).
Laddhipi hi vattabbattā vacanameva.
Indeed, a doctrine is also speech, because it is something to be spoken.
Giáo lý cũng là lời nói vì nó được nói ra.
Idanti ajjhenajjhāpanayajanayājanādikammaṃ, na vessassa, na khattiyassa, na tadaññesanti atthaṃ ādisaddena saṅgaṇhāti.
"Idaṃ" (this) refers to actions such as teaching and being taught, sacrificing and causing sacrifices to be made, etc.; it implies that these are not for a merchant, not for a warrior, nor for others, which is encompassed by the term "ādi" (and so forth).
Idaṃ (điều này) bao gồm các hành động như học Veda, dạy Veda, cúng tế, làm cho người khác cúng tế v.v., và từ ādi (v.v.) bao gồm ý nghĩa rằng những điều này không phù hợp với người Vaisya, không phù hợp với người Kṣatriya, và không phù hợp với những người khác.
Sabbatthāti gottavādamānavādesu.
"Sabbatthā" (in all respects) refers to lineage-theories and pride-theories.
Sabbatthā (trong tất cả) có nghĩa là trong các thuyết về dòng dõi và kiêu mạn.
Tatthāpi hi gottavādoti gottaṃ ārabbha vādo, kassapassevidaṃ vaṭṭati, na kosiyassātiādivacananti attho.
There too, gottavādo (lineage-theory) means a theory concerning lineage, implying, "This is suitable only for those of the Kassapa clan, not for those of the Kosiyan clan," and so forth.
Ở đó cũng vậy, gottavādo (thuyết dòng dõi) có nghĩa là lời nói liên quan đến dòng dõi, như “điều này chỉ phù hợp với dòng dõi Kassapa, không phù hợp với dòng dõi Kosiya” v.v.
Mānavādoti mānaṃ ārabbha attukkaṃsanaparavambhanavasena vādo, brāhmaṇassevidaṃ vaṭṭati, na suddassātiādivacananti attho.
Mānavādo (pride-theory) means a theory based on pride, involving self-exaltation and denigration of others, implying, "This is suitable only for Brahmins, not for Sudras," and so forth.
Mānavādo (thuyết kiêu mạn) có nghĩa là lời nói liên quan đến sự kiêu mạn, theo cách tự tán dương và khinh miệt người khác, như “điều này chỉ phù hợp với Bà-la-môn, không phù hợp với người Sūdra” v.v.
Jātivāde vinibaddhāti jātisannissitavāde paṭibaddhā.
Jātivāde vinibaddhā (bound up in birth-theories) means bound up in theories based on birth.
Jātivāde vinibaddhā (bị ràng buộc bởi thuyết dòng dõi) có nghĩa là bị ràng buộc bởi thuyết dựa vào dòng dõi.
Sabbatthāti gottavādavinibaddhādīsu.
"Sabbatthā" (in all respects) refers to being bound up in lineage-theories, and so on.
Sabbatthā (trong tất cả) có nghĩa là trong những điều bị ràng buộc bởi thuyết dòng dõi v.v.
Gottavādavinibaddhāti hi gottavāde vinibaddhā.
Gottavādavinibaddhā means bound up in lineage-theories.
Thật vậy, Gottavādavinibaddhā (bị ràng buộc bởi thuyết dòng dõi) có nghĩa là bị ràng buộc bởi thuyết về dòng dõi.
Mānavādavinibaddhāti mānavāde vinibaddhā, ye hi brāhmaṇasseva ajjhenajjhāpanayajanayājanādayoti evaṃ attukkaṃsanaparavambhanavasena pavattā, te mānavādavinibaddhā ca honti.
Mānavādavinibaddhā means bound up in pride-theories, for those practices that proceed by way of self-exaltation and denigration of others, such as "teaching and being taught, sacrificing and causing sacrifices to be made, are only for Brahmins," these are also bound up in pride-theories.
Mānavādavinibaddhā (bị ràng buộc bởi thuyết kiêu mạn) có nghĩa là bị ràng buộc bởi thuyết kiêu mạn. Thật vậy, những lời nói phát sinh theo cách tự tán dương và khinh miệt người khác, như “chỉ Bà-la-môn mới được học Veda, dạy Veda, cúng tế, làm cho người khác cúng tế v.v.”, thì những lời nói đó cũng bị ràng buộc bởi thuyết kiêu mạn.
Āvāhavivāhavinibaddhāti āvāhavivāhesu vinibaddhā.
Āvāhavivāhavinibaddhā means bound up in marriage and giving in marriage.
Āvāhavivāhavinibaddhā (bị ràng buộc bởi hôn nhân) có nghĩa là bị ràng buộc trong các cuộc hôn nhân.
Ye hi vinibaddhattayavasena ‘‘arahasi vā maṃ tvaṃ, na vā maṃ tvaṃ arahasī’’ti evaṃ pavattanakā, te āvāhavivāhavinibaddhā ca hontīti imamatthasesaṃ sandhāya ‘‘esa nayo’’ti vuttaṃ.
The phrase ‘‘esa nayo’’ (this is the method) is stated with reference to the remaining meaning, that those who act by these three bonds, saying, "Are you worthy of me, or are you not worthy of me?", are also bound up in marriage and giving in marriage.
Thật vậy, những người hành động theo ba loại ràng buộc, nói rằng “ông có xứng đáng với tôi không, hay ông không xứng đáng với tôi”, thì những người đó cũng bị ràng buộc bởi hôn nhân. Để làm rõ phần ý nghĩa còn lại này, (Vị Luận sư) đã nói esa nayo (cách này cũng vậy).
Āvāhavivāhavinibaddhabhāvavibhāvanatthañhi ‘‘arahasi vā maṃ tvaṃ, na vā maṃ tvaṃ arahasī’’ti pāḷiyaṃ vuttaṃ, tadetaṃ jātivādādīhi tīhi padehi yojetabbaṃ.
Indeed, the statement "Are you worthy of me, or are you not worthy of me?" is found in the Pali to demonstrate the state of being bound up in marriage and giving in marriage. This should be connected with the three terms: theories of birth, and so on.
Thật vậy, để làm rõ việc bị ràng buộc bởi hôn nhân, trong Pāḷi đã nói: “Ông có xứng đáng với tôi không, hay ông không xứng đáng với tôi.” Điều này cần được kết nối với ba từ jātivāda (thuyết dòng dõi) v.v.
Āvuttiādinayena hi jātivādādayo dvikkhattumatthadīpakā.
For, by the method of repetition, etc., the theories of birth, etc., indicate the meaning twice.
Thật vậy, theo cách lặp lại v.v., các thuyết về dòng dõi v.v. giải thích ý nghĩa hai lần.
Tathā hi ācariyena vuttaṃ ‘‘ye pana āvāhavivāhavinibaddhā, te eva sambandhattayavasena ‘arahasi vā maṃ tvaṃ, na vā maṃ tvaṃ arahasī’ti evaṃ pavattanakā’’ti (dī. ni. ṭī. 1.278).
Thus, the teacher stated, "Those who are bound up in marriage and giving in marriage are indeed those who act in this way, by virtue of three types of connection: 'Are you worthy of me, or are you not worthy of me?'"
Như vậy, Vị Luận sư đã nói: “Những ai bị ràng buộc bởi hôn nhân, thì chính những người đó, theo ba mối quan hệ, mới hành động theo cách ‘ông có xứng đáng với tôi không, hay ông không xứng đáng với tôi’.”
784
Nanu pubbe vijjācaraṇaṃ puṭṭhaṃ, kasmā taṃ puna pucchatīti codanaṃ sodhento ‘‘tato ambaṭṭho’’tiādimāha.
Addressing the question of why Ambaṭṭha asks about knowledge and conduct again when it was already asked before, the teacher states "Then Ambaṭṭha," and so forth.
Để giải quyết câu hỏi “Minh và Hạnh đã được hỏi trước đó rồi, tại sao lại hỏi lại lần nữa?”, (Vị Luận sư) nói tato ambaṭṭho (sau đó Ambaṭṭha) v.v.
Tattha yatthāti yassaṃ vijjācaraṇasampattiyaṃ.
There, yatthā (where) refers to in which accomplishment of knowledge and conduct.
Ở đó, yatthā (ở đâu) có nghĩa là trong sự thành tựu minh và hạnh nào.
Brāhmaṇasamayasiddhaṃ sandhāya vuttaṃ.
This is stated with reference to what is established in the Brahmin tradition.
Điều này được nói đến liên quan đến những gì được thiết lập theo truyền thống Bà-la-môn.
Laggissāmāti olaggā antogadhā bhavissāma.
Laggissāmā (we shall cling) means we shall become entangled, we shall be included within.
Laggissāmā (chúng ta sẽ bị ràng buộc) có nghĩa là chúng ta sẽ bị vướng mắc, chúng ta sẽ bị bao hàm.
Tatoti tāya vijjācaraṇasampadāya.
Tato (from that) means from that accomplishment of knowledge and conduct.
Tato (từ đó) có nghĩa là từ sự thành tựu minh và hạnh đó.
Avakkhipīti avacāsi.
Avakkhipī (he cast down) means he spoke contemptuously.
Avakkhipī (ông ta đã bác bỏ) có nghĩa là ông ta đã nói ra.
Paramatthato avijjācaraṇāniyeva ‘‘vijjācaraṇānī’’ti gahetvā ṭhito hi paramatthato vijjācaraṇesu vibhajiyamānesu so tato dūrato apanīto nāma hoti.
For one who takes what are actually ignorance and misconduct to be "knowledge and conduct," when the true knowledge and conduct are analyzed, he is indeed removed far from them.
Thật vậy, một người đã chấp nhận những điều không phải minh và hạnh là “minh và hạnh” theo nghĩa tối hậu, thì khi minh và hạnh tối hậu được phân tích, người đó được coi là bị loại bỏ xa khỏi chúng.
Yatthāti yassaṃ pana vijjācaraṇasampattiyaṃ.
Yatthā (where) refers to in which accomplishment of knowledge and conduct.
Yatthā (ở đâu) có nghĩa là trong sự thành tựu minh và hạnh nào.
Anuttaravijjācaraṇaṃ sandhāya vuttaṃ.
This is stated with reference to the unsurpassed knowledge and conduct.
Điều này được nói đến liên quan đến minh và hạnh vô thượng.
Jānanakiriyāyoge kammampi yujjanakiriyāyoge kattāyeva upapanno.
Even if kamma (object) is suitable in the context of the knowing action, kattā (agent) is appropriate in the context of the joining action.
Trong việc kết hợp hành động biết, tân ngữ cũng phù hợp với chủ ngữ trong việc kết hợp hành động kết nối.
Padhānakiriyāpekkhā hi kārakāti vuttaṃ ‘‘ayaṃ no vijjācaraṇasampadā ñātuṃ vaṭṭatī’’ti.
For agents are dependent on the principal action, thus it is stated, "This accomplishment of knowledge and conduct is worthy for us to know."
Thật vậy, các tác nhân phụ thuộc vào hành động chính. Vì vậy, (Vị Luận sư) đã nói: “Sự thành tựu minh và hạnh này của chúng ta đáng được biết.”
Evamīdisesu.
And in such cases.
Và trong những trường hợp tương tự như vậy.
Samudāgamatoti ādisamuṭṭhānato.
Samudāgamato (from its arising) means from its initial origin.
Samudāgamato (từ sự phát sinh) có nghĩa là từ sự phát sinh ban đầu.
785
279. Kāmaṃ caraṇapariyāpannattā caraṇavasena niyyātetuṃ vaṭṭati, ambaṭṭhassa pana asamapathagamanaṃ nivārento sīlavaseneva niyyātetīti imamatthaṃ vibhāvetuṃ ‘‘caraṇapariyāpannampī’’ti vuttaṃ.
279. Although it is fitting to conclude it in terms of caraṇa (conduct) because it is included in caraṇa, the teacher concludes it in terms of sīla (virtue) in order to restrain Ambaṭṭha's deviation from the right path. To clarify this point, the phrase "caraṇapariyāpannampī" (even that which is included in conduct) is used.
279. Mặc dù điều đó đáng được hoàn thành theo cách của hạnh (caraṇa) vì nó thuộc về hạnh, nhưng để làm rõ ý nghĩa rằng Đức Thế Tôn đã hoàn thành nó theo cách của giới (sīla) để ngăn chặn Ambaṭṭha đi sai đường, (Vị Luận sư) đã nói caraṇapariyāpannampī (mặc dù nó thuộc về hạnh).
Brahmajāle (dī. ni. 1.7, 11, 21) vuttanayena khuddakādibhedaṃ tividhaṃ sīlaṃ.
"Tividhaṃ sīlaṃ" (threefold virtue) of minor and other divisions, as stated in the Brahmajāla Sutta.
Sīla (giới) có ba loại, bao gồm khuddaka (giới nhỏ) v.v., theo cách đã nói trong Brahmajāla.
Sīlavasenevāti sīlapariyāyavaseneva.
Sīlavasenevā (only by way of virtue) means only by way of the terms for virtue.
Sīlavasenevā (chỉ theo cách của giới) có nghĩa là chỉ theo cách diễn giải của giới.
Kiñci kiñci sīlanti brāhmaṇānaṃ jātisiddhaṃ ahiṃsanādiyamaniyamalakkhaṇaṃ appamattakaṃ sīlaṃ.
Kiñci kiñci sīlaṃ (some virtue) refers to the small amount of virtue, characterized by non-harming, etc., which is inherent by birth to Brahmins, and which is an obligatory practice.
Kiñci kiñci sīlaṃ (một chút giới nào đó) có nghĩa là một chút giới nhỏ nhặt của Bà-la-môn, được thiết lập theo dòng dõi, có đặc tính là không làm hại v.v., tức là những điều nên làm và không nên làm.
Tasmāti tathā vijjamānattā, attani vijjamānaṃ sīlamattampi nissāya laggeyyāti adhippāyo.
Tasmā means "because it exists in that way." The intention is that one should cling even to the mere morality existing in oneself.
Tasmā (Do đó) có nghĩa là: vì sự hiện hữu như vậy, ý muốn nói rằng, người ấy có thể bám víu ngay cả vào giới hạnh hiện hữu trong tự thân.
‘‘Tattha tattheva laggeyyāti tasmiṃ tasmiṃyeva brāhmaṇasamayasiddhe sīlamatte ‘caraṇa’nti laggeyyā’’ti (dī. ni. ṭī. 1.279) ācariyena vuttaṃ, tadetaṃ aṭṭhakathāyameva sākāravacanassa vuttattā vicāretabbaṃ, adhippāyamattadassanaṃ vā etaṃ.
" One should cling to it in those very places" means "one should cling to that very morality, established by the brahmins' customs, saying 'this is good conduct (caraṇa)'." This was stated by the teacher; however, this statement should be considered, as it is expressed with reasons in the Commentary itself; or it is merely a showing of the intention.
“Tattha tattheva laggeyyā” (Người ấy nên bám víu vào đó, vào đó) có nghĩa là: “người ấy nên bám víu vào giới hạnh đã được xác lập theo thời của Bà-la-môn đó, đó, như là ‘caraṇa’ (hạnh kiểm)”, điều này đã được vị đạo sư nói đến. Lời nói đó cần được xem xét vì nó đã được nói đến trong chính bộ Chú giải với lời lẽ có hình thức, hoặc đó chỉ là sự trình bày ý nghĩa.
Ayaṃ panettha attho – tattha tattheva laggeyyāti tasmiṃ tasmiṃyeva attani vijjamānasīlamattapaṭisaṃyuttaṭṭhāne ‘‘mayampi caraṇasampannā’’ti laggeyya, tasmā sīlavaseneva niyyātetīti sambandho.
Herein, this is the meaning: one should cling to it in those very places means one should cling, saying "we too are endowed with good conduct (caraṇa)," in those very places connected with the mere morality existing in oneself. Therefore, the connection is that it leads to deliverance only by means of morality.
Ý nghĩa ở đây là: tattha tattheva laggeyyā (người ấy nên bám víu vào đó, vào đó) có nghĩa là: người ấy nên bám víu vào chỗ liên quan đến giới hạnh đang hiện hữu trong tự thân đó, đó, rằng “chúng tôi cũng đầy đủ hạnh kiểm (caraṇa)”, do đó có sự liên kết rằng người ấy giải thoát chỉ bằng giới hạnh (sīla).
Tathāpasaṅgābhāvato pana upari caraṇavaseneva niyyātetīti dassento ‘‘yaṃ panā’’tiādimāha.
But because there is no such connection, to show that it leads to deliverance only by means of good conduct (caraṇa) higher up, it states "as for that which…" and so forth.
Tuy nhiên, vì không có sự liên quan như vậy, nên để chỉ rõ rằng ở trên người ấy giải thoát chỉ bằng hạnh kiểm (caraṇa), vị đạo sư đã nói “yaṃ panā” (còn điều gì).
Rūpāvacaracatutthajjhānaniddeseneva arūpāvacarajjhānānampi niddiṭṭhabhāvāpattito ‘‘aṭṭhapi samāpattiyo ‘caraṇa’nti niyyātitā’’ti vuttaṃ.
It is said that " the eight attainments (samāpatti) are designated as good conduct (caraṇa)" because the formless jhāna attainments are also designated by the designation of the fourth rūpāvacara jhāna.
Vì các thiền vô sắc giới (arūpāvacarajjhāna) cũng được chỉ rõ thông qua sự chỉ rõ thiền thứ tư sắc giới (rūpāvacaracatutthajjhāna), nên đã nói “tám thiền chứng (samāpatti) cũng được giải thoát như là ‘hạnh kiểm’ (caraṇa)”.
Tānipi hi aṅgasamatāya catutthajjhānānevāti.
For they too are merely fourth jhāna attainments in terms of their factors being equal.
Vì những thiền đó cũng là thiền thứ tư do sự đồng nhất về chi phần.
Niyyātitāti ca asesato nīharitvā gahitā, nidassitāti attho.
Niyyātitā means they are completely taken out and seized, meaning they are demonstrated.
niyyātitā có nghĩa là đã được loại bỏ hoàn toàn, đã được chấp nhận, đã được chỉ ra.
Vipassanāñāṇato panāti ‘‘so evaṃ samāhite citte parisuddhe pariyodāte anaṅgaṇe vigatūpakkilese mudubhūte kammanīye ṭhite āneñjappatte ñāṇadassanāya cittaṃ abhinīharati abhininnāmetī’’tiādinā nayena vipassanāñāṇato paṭṭhāya.
"As for insight-knowledge (vipassanāñāṇa)…" means starting from insight-knowledge, in the manner of "when his mind is thus concentrated, purified, cleansed, unblemished, rid of defilements, malleable, wieldy, steady, attained to imperturbability, he directs and inclines his mind to the knowledge and vision (ñāṇadassana)."
Vipassanāñāṇato pana (còn từ tuệ quán) có nghĩa là: bắt đầu từ tuệ quán (vipassanāñāṇa) theo cách như “vị ấy hướng tâm, dẫn tâm đến tuệ tri (ñāṇadassana) khi tâm đã định, thanh tịnh, trong sáng, không cấu uế, không phiền não, mềm dẻo, dễ sử dụng, đạt đến bất động”.
786
Catuapāyamukhakathāvaṇṇanā
Explanation of the Four Causes of Ruin
Phần Giải Thích Về Bốn Cửa Ngõ Dẫn Đến Khổ Cảnh (Catuapāyamukhakathāvaṇṇanā)
787
280. Asampāpuṇantoti ārabhitvāpi sampajjitumasakkonto.
Asampāpuṇanto means being unable to achieve even after attempting.
Asampāpuṇanto (Không đạt được) có nghĩa là: không thể thành tựu ngay cả khi đã bắt đầu.
Avisahamānoti ārabhitumeva asakkonto.
Avisahamāno means being unable to even attempt.
Avisahamāno (Không thể chịu đựng) có nghĩa là: không thể bắt đầu.
‘‘Khārī’’ti tāpasaparikkhārassetaṃ adhivacanaṃ, so ca anekabhedoti vibhajitvā dassetuṃ ‘‘araṇī’’tiādi vuttaṃ.
"Khārī" is a term for the ascetic's paraphernalia. And because it is of many kinds, to show it by differentiating, "araṇī" and so forth are stated.
“Khārī” là tên gọi của vật dụng của đạo sĩ. Và vì nó có nhiều loại, nên để phân loại và chỉ ra, đã nói “araṇī” (cây cọ lửa) v.v.
Tattha araṇīti heṭṭhimuparimavasena aggidhamanakaṃ araṇīdvayaṃ.
Therein, araṇī refers to the two fire-kindling sticks, the upper and lower.
Trong đó, araṇī là hai cây cọ lửa dùng để tạo lửa, một cái ở dưới và một cái ở trên.
Kamaṇḍalūti kuṇḍikā.
Kamaṇḍalū means a water-pot (kuṇḍikā).
Kamaṇḍalū là bình nước.
Sujāti homadabbi.
Sujā means a ladle for oblations.
Sujā là muỗng cúng dường.
Sujāsaddo hi homakammani habyannādīnamuddharaṇatthaṃ katadabbiyaṃ vattati yathā taṃ kūṭadantasutte ‘‘paṭhamo vā dutiyo vā sujaṃ paggaṇhantāna’’nti (dī. ni. 1.341).
The word sujā is used for a ladle made for lifting up sacrificial food and the like in the act of offering oblations, as in the Kūṭadanta Sutta: "among those holding the sujā, the first or the second."
Quả thật, từ sujā được dùng để chỉ cái muỗng được làm ra để lấy các vật cúng dường như cơm cúng trong nghi lễ tế lửa, như trong kinh Kūṭadanta: “trong số những người cầm suja, người thứ nhất hoặc người thứ hai” (Dī. Ni. 1.341).
Tathā hi imasmiṃyeva ṭhāne ācariyena vuttaṃ ‘‘sujāti dabbī’’ti (dī. ni. ṭī. 1.280).
Thus, in this very place, the teacher stated: "Sujā means a ladle."
Quả thật, chính tại chỗ này, vị đạo sư đã nói: “sujā là cái muỗng” (Dī. Ni. Ṭī. 1.280).
Habyannādīnaṃ sukhaggahaṇatthaṃ jāyatīti hi sujā. Keci pana imamatthamavicāretvā tunnatthameva gahetvā ‘‘sūcī’’ti paṭhanti, tadayuttameva ācariyena tathā avaṇṇitattā.
For it is called sujā because it arises for the easy taking of sacrificial food and the like. Some, however, without considering this meaning, take it as referring to a needle and read "sūcī," but that is improper, as the teacher did not explain it that way.
Quả thật, nó được sinh ra để dễ dàng lấy các vật cúng dường v.v. nên gọi là sujā. Một số người, không xem xét ý nghĩa này, chỉ lấy nghĩa là kim và đọc là “sūcī”, điều đó không phù hợp vì vị đạo sư đã không giải thích như vậy.
Camati adatīti camaro, migaviseso, tassa vālena katā bījanī cāmarā.
Camaro means one that eats or devours, a kind of deer. The fan made from its tail is a cāmarā.
Ăn hay nhai nên gọi là camaro, một loại hươu đặc biệt, bījanī cāmarā là cái quạt được làm từ lông đuôi của nó.
Ādisaddena tidaṇḍatighaṭikādīni saṅgaṇhāti.
The word ādi includes items such as a three-pronged spear and triple pots.
Với từ ādi (v.v.), bao gồm gậy ba chạc (tidaṇḍa), bình ba cái (tighaṭikā) v.v.
Kucchitena vaṅkākārena jāyatīti kājo yathā ‘‘kālavaṇa’’nti; kacati bhāraṃ bandhati etthāti vā kāco. Duvidhampi hi padamicchanti saddavidū.
Kājo means something that arises in an ugly, crooked shape, like "kālavaṇaṃ" (a dark mark); or kāco means that in which a burden is bound. Grammarians prefer both usages.
Sinh ra với hình dáng cong vẹo xấu xí nên gọi là kājo, giống như “kālavaṇa” (màu đen); hoặc kāco vì nó dùng để buộc gánh nặng. Các nhà ngữ pháp học đều chấp nhận cả hai từ.
Khāribharitanti khārīhi paripuṇṇaṃ.
Khāribharitaṃ means filled with ascetic's paraphernalia.
Khāribharitaṃ là đầy đủ các vật dụng của đạo sĩ (khārī).
Ekena vi-kārena padaṃ vaḍḍhetvā ‘‘khārivividha’’nti paṭhantānaṃ vāde samuccayasamāsena atthaṃ dassento ‘‘ye panā’’tiādimāha.
Showing the meaning by a copulative compound for those who read "khārivividhaṃ" by extending the word with one variant, he says " ye panā" and so forth.
Và để chỉ rõ ý nghĩa bằng cách dùng lối hợp từ tập hợp (samuccayasamāsa) trong quan điểm của những người đọc “khārivividhaṃ” (nhiều loại vật dụng của đạo sĩ) bằng cách thêm một biến thể của từ, vị đạo sư đã nói “ye panā” (còn những ai) v.v.
788
Nanu upasampannassa bhikkhuno sāsanikopi yo koci anupasampanno atthato paricārakova hoti api khīṇāsavasāmaṇero, kimaṅgaṃ pana bāhirakapabbajiteti anuyogaṃ pati tattha visesaṃ dassetuṃ ‘‘kāmañcā’’tiādi vuttaṃ.
To answer the question, "Is not any unordained person, even a lay follower in the Sāsana, a mere attendant to an ordained bhikkhu, even if he is an Arahant sāmaṇera, what then of an external wanderer?", and to show a distinction there, " kāmañcā" and so forth were stated.
Này, một tỳ-khưu đã thọ Cụ túc giới, bất kỳ ai chưa thọ Cụ túc giới trong giáo pháp, về bản chất đều là người hầu hạ, ngay cả một sa-di đã diệt tận các lậu hoặc (khīṇāsavasāmaṇera), huống chi là một người xuất gia ngoại đạo? Để chỉ ra sự khác biệt trong câu hỏi này, đã nói “kāmañcā” (dù cho) v.v.
Vuttanayenāti ‘‘kappiya…pe… vattakaraṇavasenā’’ti evaṃ vuttanayena.
By the method stated means by the method stated thus: "by means of what is allowable... and by means of performing duties."
Vuttanayenā (Theo cách đã nói) có nghĩa là: theo cách đã nói như “kappiya…pe… vattakaraṇavasenā” (phù hợp… v.v… bằng cách thực hiện các bổn phận).
Anekasatasahassasaṃvaravinayasamādānavasena upasampannabhāvassa visiṭṭhabhāvato khīṇāsavasāmaṇeropi puthujjanabhikkhuno paricārakoti vutto.
Because the state of being ordained is distinguished by undertaking hundreds of thousands of precepts (saṃvara) and disciplinary rules (vinaya), even an Arahant sāmaṇera is said to be an attendant to a puthujjana bhikkhu.
Vì trạng thái Cụ túc giới (upasampannabhāva) là thù thắng do sự thọ trì giới luật (saṃvaravinaya) hàng trăm ngàn, nên ngay cả một sa-di đã diệt tận các lậu hoặc cũng được gọi là người hầu hạ của một tỳ-khưu phàm phu.
789
‘‘Navakoṭisahassāni, asītisatakoṭiyo;
“Nine thousand koṭis, one hundred eighty koṭis;
“Chín ngàn vạn, một trăm tám mươi vạn;
790
Paññāsasatasahassāni, chattiṃsa ca punāpare;
Fifty hundred thousand, and again thirty-six*;
Năm mươi vạn, và ba mươi sáu ngàn nữa;
791
Ete saṃvaravinayā, sambuddhena pakāsitā;
These precepts (saṃvara) and disciplinary rules (vinaya) were proclaimed by the Fully Enlightened One;
Những giới luật này đã được Đức Phật Toàn Giác tuyên bố;
792
Peyyālamukhena niddiṭṭhā, sikkhā vinayasaṃvare’’ti.(visuddhi. 1.20; apa. aṭṭha. 2.55; paṭi. ma. aṭṭha. 1.2.37);
The trainings in the precepts (saṃvara) and disciplinary rules (vinaya) were indicated by way of abridgement.”
Được chỉ rõ một cách tóm tắt (peyyālamukhena) trong giới luật về sự phòng hộ (vinayasaṃvara)”.
793
Evaṃ vuttappabhedānaṃ anekasatasahassānaṃ saṃvaravinayānaṃ samādāya sikkhanena uparibhūtā aggabhūtā sampadāti hi upasampadā, tāya cesa upasampadāya puthujjanabhikkhu upasampannoti.
Indeed, upasampadā means the supreme, excellent accomplishment through undertaking and practicing these hundreds of thousands of precepts (saṃvara) and disciplinary rules (vinaya) of the types thus stated. And by this upasampadā, a puthujjana bhikkhu is one who is ordained.
Quả thật, upasampadā (Cụ túc giới) là sự thành tựu tối thượng, cao quý, do sự thọ trì và tu học hàng trăm ngàn giới luật đã được phân loại như đã nói. Và do Cụ túc giới này, một tỳ-khưu phàm phu được gọi là đã thọ Cụ túc giới.
794
Ayaṃ panāti yathāvuttalakkhaṇo tāpaso.
Ayaṃ pana refers to the ascetic (tāpaso) with the aforementioned characteristics.
Ayaṃ panā (Còn vị này) là vị đạo sĩ có đặc điểm như đã nói.
Tāpasā hi kammavādikiriyavādino, na sāsanassa paṭāṇībhūtā, yato nesaṃ pabbajitumāgatānaṃ vināva titthiyaparivāsena khandhake pabbajjā anuññātā.
Ascetics are indeed kammavādī and kiriyavādī, not opposed to the Sāsana. This is why, for those who come to ordain from among them, ordination is allowed in the Khandhaka without the need for the titthiyaparivāsa.
Quả thật, các đạo sĩ là những người theo thuyết nghiệp (kammavādī) và thuyết hành động (kiriyavādī), không phải là những người chống đối giáo pháp, bởi vì khi họ đến để xuất gia, sự xuất gia đã được cho phép trong Khandhaka mà không cần đến titthiyaparivāsa (thời gian thử thách cho người ngoại đạo).
Tapo etesamatthīti tāpasā ta-kārassa dīghaṃ katvā.
They are called tāpasā by lengthening the 'ta' sound, because they have austerity (tapo).
Vì họ có sự khổ hạnh (tapo), nên gọi là tāpasā (đạo sĩ) bằng cách kéo dài âm ta.
‘‘Lomasā’’tiādīsu viya hi sa-paccayamicchanti saddavidū.
For grammarians prefer the suffix 'sa' in the sense of 'having', as in 'lomasā' and so on.
Quả thật, các nhà ngữ pháp học muốn có tiếp vĩ ngữ sa trong ý nghĩa sở hữu, như trong “lomasā” (có lông) v.v.
Idaṃ vuttaṃ hoti – kāmaṃ khīṇāsavopi sāmaṇero puthujjanassa bhikkhuno atthato paricārakova hoti, so pana vattakaraṇamatteneva paricārako, na lāmakabhāvena.
This is what is meant: Even if an Arahant sāmaṇera is truly an attendant to a puthujjana bhikkhu, he is an attendant merely by performing duties, not by being inferior.
Điều này có nghĩa là: dù cho một sa-di đã diệt tận các lậu hoặc (khīṇāsava) về bản chất cũng là người hầu hạ của một tỳ-khưu phàm phu, nhưng vị sa-di đó chỉ là người hầu hạ bằng cách thực hiện các bổn phận (vatta), chứ không phải bằng sự thấp kém.
Tāpaso tu guṇavasena ceva veyyāvaccakaraṇavasena ca lāmakabhāveneva paricārako, na vattakaraṇamattena, evamimesaṃ nānākaraṇaṃ sandhāya tāpasasseva paricārakatā vuttāti.
However, an ascetic is an attendant only by way of being inferior, both in terms of qualities and in terms of performing services, not merely by performing duties. Thus, with reference to this difference between them, the subservience of the ascetic alone is stated.
Còn đạo sĩ thì là người hầu hạ bằng sự thấp kém, cả về mặt phẩm chất lẫn việc làm các công việc phục vụ, chứ không phải chỉ bằng việc thực hiện các bổn phận. Như vậy, để chỉ ra sự khác biệt giữa họ, đã nói rằng chỉ có đạo sĩ là người hầu hạ.
795
‘‘Kasmā’’tiādinā codako kāraṇaṃ codeti.
With " Kasmā" and so forth, the challenger questions the reason.
Với “Kasmā” (Tại sao) v.v., người chất vấn hỏi về lý do.
‘‘Yasmā’’tiādinā ācariyo kāraṇaṃ dassetvā pariharati.
With " Yasmā" and so forth, the teacher gives the reason and refutes.
Với “Yasmā” (Vì) v.v., vị đạo sư trình bày lý do và giải thích.
Evaṃ saṅkhepato pariharitamatthaṃ vivarituṃ ‘‘imasmiñhī’’tiādi vuttaṃ.
To elaborate on the meaning thus briefly refuted, " Imasmiñhi" and so forth are stated.
Để giải thích ý nghĩa đã được giải thích một cách tóm tắt như vậy, đã nói “imasmiñhī” (quả thật trong điều này) v.v.
Asakkontanti asamatthanena vippaṭipajjantaṃ alajjiṃ.
Asakkontaṃ means one who practices wrongly due to incompetence, a shameless one.
Asakkontaṃ (Không thể) là người vô liêm sỉ (alajji) hành động sai trái vì không có khả năng.
Khuradhārūpamanti khuradhārānaṃ matthakeneva akkamitvā gamanūpamaṃ.
Khuradhārūpamaṃ means similar to walking by stepping only on the edge of razor blades.
Khuradhārūpamaṃ (Giống như lưỡi dao cạo) có nghĩa là: giống như đi trên đỉnh của lưỡi dao cạo.
Bahujanasammatāti mahājanena seṭṭhasammatā.
Bahujanasammatā means considered best by the common people.
Bahujanasammatā (Được nhiều người chấp nhận) có nghĩa là: được đại chúng xem là cao quý.
Aññeti apare bhikkhū.
Aññe means other bhikkhus.
Aññe (Những người khác) là các tỳ-khưu khác.
Idhāti tāpasapabbajjāya.
Idha means in the ascetic's way of life.
Idhā (Ở đây) là trong sự xuất gia của đạo sĩ (tāpasapabbajjā).
Chandena saha carantīti sachandacārino, yathākāmaṃ paṭipannakāti vuttaṃ hoti.
They who act according to their own desire are sachandacārino, meaning those who act as they please.
Hành động theo ý muốn nên gọi là sachandacārino, có nghĩa là những người thực hành theo ý muốn của mình.
Anusikkhantoti diṭṭhānugatiyā sikkhanto.
Anusikkhanto means one who learns by following what he has seen.
Anusikkhanto (Học theo) có nghĩa là: học theo sự thấy biết.
Tāpasāva bahukā honti, na bhikkhū.
There are many ascetics, not bhikkhus.
Tāpasāva bahukā honti (Chỉ có các đạo sĩ là nhiều), chứ không phải các tỳ-khưu.
796
Kudālapiṭakānaṃ nibbacanaṃ heṭṭhā vuttameva.
The etymology of kudālapiṭaka has been stated earlier.
Giải thích về cuốc và giỏ đã được nói ở phần dưới.
Bahujanakuhāpanatthanti bahuno janassa vimhāpanatthaṃ.
Bahujanakuhāpanatthaṃ means for the purpose of astonishing many people.
Bahujanakuhāpanatthaṃ (Để lừa dối nhiều người) có nghĩa là: để làm cho nhiều người ngạc nhiên.
Aggisālanti aggihuttasālaṃ.
Aggisālaṃ means the hall for fire-worship (aggihuttasālaṃ).
Aggisālaṃ (Nhà lửa) là nhà tế lửa (aggihuttasāla).
Nānādārūhīti palāsarukkhadaṇḍādīhi nānāvidhasamidhādārūhi.
Nānādārūhi means with various kinds of sacrificial firewood, such as straw, tree branches, sticks, and the like.
Nānādārūhī (Với nhiều loại gỗ) có nghĩa là: với nhiều loại củi tế lễ khác nhau như rơm, cành cây v.v.
Homakaraṇavasenāti yaññakaraṇavasena.
Homakaraṇavasena means by way of performing sacrifices.
Homakaraṇavasenā (Bằng cách thực hiện tế lễ) có nghĩa là: bằng cách thực hiện lễ hiến tế (yañña).
797
Udakavasenettha pānāgāraṃ. Tenāha ‘‘pānīyaṃ upaṭṭhapetvā’’tiādi.
Here, pānāgāraṃ means a water-house. Therefore, it is said, " having prepared water" and so forth.
Ở đây, pānāgāraṃ (nhà uống nước) là nơi chứa nước (udakavasena). Do đó đã nói “pānīyaṃ upaṭṭhapetvā” (sau khi chuẩn bị nước uống) v.v.
Yaṃ bhattapuṭaṃ vā yāni taṇḍulādīni vāti sambandho.
The connection is: "whatever packet of food or whatever rice, etc."
Có sự liên kết rằng đó là gói cơm (bhattapuṭa) hoặc các loại gạo (taṇḍulādīni) v.v.
Ambilayāgu nāma takkādiambilasaṃyuttā yāgu.
Ambilayāgu is gruel mixed with sour ingredients like buttermilk.
Ambilayāgu là cháo chua được pha với sữa chua (takka) v.v.
Taṇhādīhi āmasitabbato cīvarādi āmisaṃ nāma.
Āmisaṃ (material thing) refers to robes and other items, because they are to be grasped by craving and the like.
Y phục (cīvara) v.v. được gọi là āmisaṃ (mồi nhử) vì chúng bị tham ái (taṇhā) v.v. chạm đến.
Vaḍḍhiyāti diguṇatiguṇādivaḍḍhiyā.
Vaḍḍhiyā means with interest, such as double or triple interest.
Vaḍḍhiyā (Với lãi suất) có nghĩa là: với lãi suất gấp đôi, gấp ba v.v.
Kuṭumbaṃ saṇṭhapetīti dhanaṃ patiṭṭhāpeti.
Kuṭumbaṃ saṇṭhapeti means one establishes wealth.
Kuṭumbaṃ saṇṭhapetī (Thiết lập gia đình) có nghĩa là: thiết lập tài sản (dhana).
Yathāvuttamatthaṃ pāḷiyaṃ nidassanamattena vuttanti āha ‘‘idaṃ panassa paṭipattimukha’’nti, idaṃ pana pāḷivacanaṃ assa catutthassa puggalassa kohaññapaṭipattiyā mukhamattanti attho.
He says, "This is the gateway to his practice," meaning that this Pali passage is merely the gateway to the practice of deceit (kohaññapaṭipatti) for that fourth person, in the sense that the aforementioned meaning was stated in the Pali as a mere example.
Vì điều đã được nói đến như vậy trong Pāḷi chỉ là một sự minh họa, nên (vị thầy) nói: “Đây là cửa ngõ cho hành vi của người đó.” Ý nghĩa là, lời Pāḷi này chỉ là một cửa ngõ cho hành vi lừa dối của người thứ tư đó.
Kasmāti ce?
If (one asks) why?
Nếu hỏi: “Vì sao?”
So hi nānāvidhena kohaññena lokaṃ vimhāpayanto tattha acchati.
For that person dwells there astounding the world with various kinds of deceit.
Bởi vì người đó sống ở đó, làm cho thế gian kinh ngạc bằng nhiều loại hành vi lừa dối.
Tenāha ‘‘iminā hī’’tiādi.
Therefore, he said, "Indeed, by this..." and so on.
Do đó (vị thầy) nói: “Thật vậy, bằng cách này…” và tiếp tục.
Evanti ‘‘tattha pānīyaṃ upaṭṭhapetvā’’tiādinā vuttanayena.
"Thus" means in the manner stated by "having placed drinking water there," and so on.
Như vậy là theo cách đã được nói đến bằng cụm từ “đặt nước uống ở đó” và tiếp tục.
798
‘‘Sabbāpi tāpasapabbajjā niddiṭṭhā’’ti dhammādhiṭṭhānanayena dassitameva puggalādhiṭṭhānanayena vivarituṃ ‘‘aṭṭhavidhā hī’’tiādi vuttaṃ.
The phrase "there are eight kinds" and so on, was said to clarify, from the perspective of individuals, what was already shown from the perspective of Dhamma, namely, "All ascetic practices have been described."
Để giải thích “tất cả các lối sống khổ hạnh đã được chỉ rõ” theo cách cá nhân, điều đã được trình bày theo cách dựa trên Dhamma, nên đã nói: “Thật vậy, có tám loại…” và tiếp tục.
Khalādīsu manussānaṃ santike upatiṭṭhitvā vīhimuggamāsatilādīni bhikkhācariyaniyāmena saṅkaḍḍhitvā uñchanaṃ uñchā, sā eva cariyā vutti etesanti uñchācariyā. Aggipakkikāya bhattabhikkhāya jīvantīti aggipakkikā, na aggipakkikā anaggipakkikā, taṇḍulabhikkhāya eva jīvikāti vuttaṃ hoti.
Uñchā is gleaning, collecting grains such as paddy, mung beans, black gram, and sesame in the manner of a mendicant by standing near people in threshing floors and so forth; those whose livelihood is such a practice are uñchācariyā. Those who live on alms-food cooked with fire are aggipakkikā; those who do not live on alms-food cooked with fire are anaggipakkikā, meaning their livelihood is solely on alms of raw rice.
Uñchā là việc đi khất thực, thu nhặt lúa, đậu xanh, đậu đen, mè, v.v., bằng cách đứng gần người dân ở các sân đập lúa, v.v. Uñchācariyā là những người có lối sống như vậy. Aggipakkikā là những người sống bằng cách khất thực thức ăn đã được nấu bằng lửa. Anaggipakkikā là những người không sống bằng thức ăn đã được nấu bằng lửa; có nghĩa là họ chỉ sống bằng cách khất thực gạo.
Uñchācariyā hi khalādīni gantvā upatiṭṭhitvā manussehi diyyamānaṃ khalaggaṃ nāma dhaññaṃ paṭiggaṇhanti, anaggipakkikā pana tādisamapaṭiggaṇhitvā taṇḍulameva paṭiggaṇhantīti ayametesaṃ viseso.
The difference between them is that the uñchācariyā go to threshing floors and such, stand there, and receive grain, which is called 'threshing-floor-head', given by people; while the anaggipakkikā do not receive such (grain), but receive only raw rice.
Thật vậy, những người Uñchācariyā đi đến các sân đập lúa, v.v., đứng gần và nhận lúa từ người dân, gọi là khalaggaṃ (lúa trên sân đập). Còn những người Anaggipakkikā thì không nhận những thứ như vậy, mà chỉ nhận gạo. Đây là sự khác biệt giữa họ.
Na sayaṃ pacantīti asāmapākā, pakkabhikkhāya eva jīvikā.
Those who do not cook themselves are asāmapākā; their livelihood is only cooked alms-food.
Asāmapākā là những người không tự nấu ăn; họ chỉ sống bằng cách khất thực thức ăn đã nấu chín.
Ayo viya kaṭṭhino muṭṭhippamāṇo pāsāṇo ayamuṭṭhi nāma, tena vattantīti ayamuṭṭhikā. Dantena uppāṭitaṃ vakkalaṃ rukkhattaco dantavakkalaṃ, tena vattantīti dantavakkalikā. Pavattaṃ rukkhādito pātāpitaṃ phalaṃ bhuñjanti sīlenāti pavattaphalabhojino. Paṇḍupalāsasaddassa ekasesanayena dvidhā attho, jiṇṇatāya paṇḍubhūtaṃ palāsañceva jiṇṇapakkabhāvena taṃsadisaṃ pupphaphalādi cāti.
A stone as hard as iron, the size of a fist, is called an ayamuṭṭhi; those who subsist by it are ayamuṭṭhikā. Bark (vakkala), the tree-bark peeled off with the teeth, is dantavakkalaṃ; those who subsist by it are dantavakkalikā. Those whose practice is to eat fruit that has fallen from trees and so forth are pavattaphalabhojino. The word 'paṇḍupalāsa' has two meanings according to the principle of eka-sesa: aged, yellowed leaves, and also flowers, fruits, etc., that are similar due to being old and ripened.
Một tảng đá cứng như sắt, kích thước bằng nắm tay, gọi là ayamuṭṭhi. Những người sống bằng cách đó gọi là ayamuṭṭhikā. Vỏ cây được bóc bằng răng, gọi là dantavakkalaṃ. Những người sống bằng cách đó gọi là dantavakkalikā. Pavattaphalabhojino là những người có thói quen ăn trái cây tự rụng từ cây, v.v. Từ paṇḍupalāsa có hai nghĩa theo cách ekasesa: lá vàng úa do già cỗi, và hoa, quả, v.v., tương tự như vậy do già và chín.
Tena vakkhati ‘‘sayaṃ patitāneva pupphaphalapaṇḍupalāsādīni khādantā yāpentī’’ti, (dī. ni. aṭṭha. 1.280) tena vattantīti paṇḍupalāsikā, sayaṃpatitapaṇṇapupphaphalabhojino.
Therefore, it will be said, "They sustain themselves by eating only fallen flowers, fruits, and yellowed leaves, and so on." Those who subsist by them are paṇḍupalāsikā, meaning those who eat leaves, flowers, and fruits that have fallen by themselves.
Do đó, (vị thầy) sẽ nói: “Họ sống bằng cách ăn hoa, quả, lá vàng úa, v.v., tự rụng.” Những người sống bằng cách đó gọi là paṇḍupalāsikā, tức là những người ăn lá, hoa, quả tự rụng.
Idāni te aṭṭhavidhepi sarūpato dassetuṃ ‘‘tatthā’’tiādi vuttaṃ.
Now, to show the intrinsic nature of these eight types, the phrase "therein" and so on, was stated.
Bây giờ, để trình bày bản chất của cả tám loại này, nên đã nói: “Trong số đó…” và tiếp tục.
Keṇiyajaṭilavatthu khandhakavaṇṇanāya (mahāva. aṭṭha. 300) gahetabbaṃ.
The story of Keṇiya the Ascetic (Keṇiyajaṭilavatthu) should be understood from the description in the Khandhaka.
Câu chuyện về Keniya Jaṭila nên được lấy từ phần giải thích về Khandhaka (Mahāva. Aṭṭha. 300).
799
Saṅkaḍḍhitvāti bhikkhācariyāvasena ekajjhaṃ katvā.
Having collected means having gathered together for alms-begging.
Saṅkaḍḍhitvā có nghĩa là thu thập lại thành một chỗ bằng cách đi khất thực.
800
Taṇḍulabhikkhanti taṇḍulameva bhikkhaṃ.
Alms of raw rice means only raw rice as alms.
Taṇḍulabhikkhaṃ có nghĩa là chỉ khất thực gạo.
Bhikkhitabbā yācitabbā, bhikkhūnaṃ ayanti vā bhikkhāti hi bhikkhāsaddo taṇḍulādīsupi niruḷho.
Indeed, the word bhikkhā (alms) is used for what is to be begged or requested, or what belongs to mendicants, and is established even for raw rice and so on.
Thật vậy, từ bhikkhā có nghĩa là "cần được khất thực, cần được xin," hoặc "đây là của các tỳ-khưu," và từ này cũng được dùng để chỉ gạo, v.v.
Tena vuttaṃ ‘‘pacitvā paribhuñjantī’’ti.
Therefore, it is said, "having cooked, they partake."
Do đó, đã nói: “nấu rồi dùng.”
801
Bhikkhāpariyeṭṭhi nāma dukkhāti paresaṃ gehato gehaṃ gantvā bhikkhāya pariyesanā nāma dīnavuttibhāvena dukkhā.
"The search for alms is indeed suffering" means that seeking alms by going from house to house is suffering due to the state of destitution.
Bhikkhāpariyeṭṭhi nāma dukkhā có nghĩa là việc đi từ nhà này sang nhà khác để khất thực là khổ sở vì lối sống khốn khó.
802
Ye pana ‘‘pāsāṇassa pariggaho nāma dukkho pabbajitassā’’ti danteheva uppāṭetvā khādanti, te dantavakkalikā nāmāti ayaṃ aṭṭhakathāmuttakanayo.
As for those who think, "Holding a stone is painful for an ascetic," and therefore peel and eat with their teeth, these are called dantavakkalikā; this is a tradition from outside the commentaries.
Còn những người nghĩ rằng “việc cầm đá là khổ sở đối với người xuất gia” và chỉ dùng răng để bóc vỏ cây và ăn, thì họ được gọi là dantavakkalikā. Đây là cách giải thích ngoài Aṭṭhakathā.
803
Paṇḍupalāsasaddo pupphaphalavisayopi sadisatākappanenāti dasseti ‘‘pupphaphalapaṇḍupalāsādīnī’’ti iminā.
The word 'paṇḍupalāsa' also applies to flowers and fruits by way of analogy, as shown by the phrase "flowers, fruits, and withered leaves, and so on."
Để chỉ ra rằng từ paṇḍupalāsa cũng áp dụng cho hoa và quả bằng cách so sánh, nên đã nói: “hoa, quả, lá vàng úa, v.v.”
804
Teti paṇḍupalāsikā.
Those refers to the paṇḍupalāsikā.
Te là những người paṇḍupalāsikā.
Nidassanamattametaṃ aññesampi tathā bhedasambhavato.
This is merely an example, as such distinctions are possible for others as well.
Đây chỉ là một ví dụ, vì những sự khác biệt tương tự cũng có thể xảy ra ở những người khác.
Pāpuṇanaṭṭhāneti gahetuṃ sampāpuṇanaṭṭhāne.
"In a place where one can reach" means in a place where one can reach to take.
Pāpuṇanaṭṭhāne có nghĩa là nơi có thể chạm tới để lấy.
Ekarukkhatoti paṭhamaṃ upagatarukkhato.
"From one tree" means from the tree first approached.
Ekarukkhato có nghĩa là từ cây đầu tiên được tiếp cận.
805
Kathamettāvatā sabbāpi tāpasapabbajjā niddiṭṭhāti codanā na tāva visodhitāti āha ‘‘imā panā’’tiādi.
The objection, "How have all ascetic practices been described with just these (four)?" is not yet clarified, so he says, "These, however," and so on.
Vì câu hỏi "Làm sao tất cả các lối sống khổ hạnh đã được chỉ rõ chỉ bằng chừng đó?" vẫn chưa được giải đáp, nên (vị thầy) nói: "Những điều này thì..." và tiếp tục.
Catūhiyevāti ‘‘khārividhamādāyā’’tiādinā vuttāhi pavattaphalabhojanikā, kandamūlaphalabhojanikā, agyāgārikā, āgārikā ceti catūhi eva tāpasapabbajjāhi.
"Only by four" means only by these four ascetic practices mentioned by "taking a carrying-pole" and so on: those who eat fallen fruits (pavattaphalabhojanikā), those who eat roots, tubers, and fruits (kandamūlaphalabhojanikā), those who tend a fire-house (agyāgārikā), and house-dwellers (āgārikā).
Catūhiyevā có nghĩa là chỉ bởi bốn lối sống khổ hạnh đã được nói đến bằng cụm từ "mang theo gánh nặng," v.v., đó là: những người ăn quả tự rụng, những người ăn củ, rễ, quả, những người thờ lửa (agyāgārikā), và những người sống trong nhà (āgārikā).
Agāraṃ bhajantīti agāraṃ nivāsabhāvena upagacchanti.
"They resort to a house" means they approach a house as a dwelling.
Agāraṃ bhajantī có nghĩa là họ tiếp cận ngôi nhà như một nơi cư trú.
Iminā hi ‘‘catudvāraṃ agāraṃ karitvā acchatī’’tiādinā idha vuttāya catutthāya tāpasapabbajjāya tesamavarodhataṃ dasseti.
By this, he shows that these (first four) are subsumed under the fourth ascetic practice, "making a four-gated house, he dwells," as stated here.
Thật vậy, bằng cách này, (vị thầy) chỉ ra sự bao gồm của họ trong lối sống khổ hạnh thứ tư đã được nói đến ở đây bằng cụm từ "xây một ngôi nhà bốn cửa và sống ở đó," v.v.
Evamitaresupi paṭilomato yojanā veditabbā.
Similarly, the connection for the others should be understood in reverse order.
Tương tự, cách áp dụng ngược lại cũng nên được hiểu cho những người khác.
Aggiparicaraṇavasena agyāgāraṃ bhajanti.
They resort to a fire-house (agyāgāra) for tending the fire.
Họ agyāgāraṃ bhajanti theo cách thờ lửa.
Evaṃ pana tesamavarodhataṃ vadanto tadanurūpaṃ imesampi paccekaṃ duvidhataṃ dassetīti daṭṭhabbaṃ.
In thus stating their inclusion, it should be understood that he also shows the twofold nature of each of these in accordance (with the former classification).
Và nên hiểu rằng khi nói về sự bao gồm của họ như vậy, (vị thầy) cũng chỉ ra rằng mỗi người trong số này có hai loại tương ứng.
806
281. Ācariyena pokkharasātinā saha pavattatīti sācariyako, tassa.
281. Sācariyako means "with a teacher," referring to that person who associates with the teacher Pokkharasāti.
281. Sācariyako là người đi cùng với thầy Pokkharasāti; của người đó.
Apāyamukhampīti vināsakāraṇampi.
"Even a gateway to ruin" means even a cause of destruction.
Apāyamukhampi cũng là nguyên nhân của sự hủy diệt.
Pageva vijjācaraṇasampadāya sandissaneti pi-saddo garahāyaṃ.
How much more so concerning the attainment of knowledge and conduct? The particle 'pi' here is for censure.
Từ pi là để chỉ sự khiển trách, có nghĩa là "làm sao có thể được nhìn thấy với sự thành tựu về trí tuệ và hạnh kiểm?"
Tena vuttaṃ ‘‘api nu tvaṃ imāya anuttarāya vijjācaraṇasampadāya sandissasi sācariyako’’tiādi.
Therefore, it is said, "Do you, along with your teacher, manifest this unsurpassed accomplishment in knowledge and conduct?" and so on.
Do đó, đã nói: “Ngươi và thầy của ngươi có được nhìn thấy với sự thành tựu về trí tuệ và hạnh kiểm vô thượng này không?” và tiếp tục.
Tatrāyamaṭṭhakathāmuttakanayo – ‘‘no hidaṃ bho gotamā’’ti sandissanaṃ paṭikkhipitvā asandissanākārameva vibhāvetuṃ ‘‘ko cāha’’ntiādi vuttaṃ.
Herein, this is the commentary-independent explanation: To repudiate the manifestation with "No indeed, good Gotama," and to fully explain the non-manifestation, the phrase "Who am I?" and so on, was spoken.
Theo cách giải thích ngoài Aṭṭhakathā ở đây: Để bác bỏ việc được nhìn thấy bằng cách nói “Không, thưa Tôn giả Gotama,” và để trình bày trạng thái không được nhìn thấy, nên đã nói: “Ta là ai…” và tiếp tục.
Sācariyako ahaṃ ko ca kīdiso hutvā anuttarāya vijjācaraṇasampadāya sandissāmi, anuttarā vijjācaraṇasampadā kā ca kīdisā hutvā sācariyake mayi sandissati, ārakā ahaṃ…pe… sācariyakoti saha pāṭhasesena yojanā.
"Who am I, and of what kind, along with my teacher, to manifest the unsurpassed accomplishment in knowledge and conduct? What kind is the unsurpassed accomplishment in knowledge and conduct to manifest in me, along with my teacher? I am far removed... and so on." This connection is to be made with the remaining part of the text.
Ta, cùng với thầy, là ai và loại người nào mà có thể được nhìn thấy với sự thành tựu về trí tuệ và hạnh kiểm vô thượng? Sự thành tựu về trí tuệ và hạnh kiểm vô thượng là gì và loại nào mà có thể được nhìn thấy ở ta, cùng với thầy? Ta ở xa… (phần còn lại của đoạn văn) …cùng với thầy. Đây là cách kết nối với phần còn lại của văn bản.
807
282. Apāye vināsanupāye niyutto āpāyiko. Tabbhāvaṃ na paripūreti paripūretuṃ na sakkotīti aparipūramāno, tabbhāvena aparipuṇṇoti attho.
282. Āpāyiko means "inclined to ruin," engaged in the means of destruction. Aparipūramāno means "not fulfilling that state," "unable to fulfill it," meaning incomplete in that state.
282. Āpāyiko là người dấn thân vào con đường hủy diệt. Aparipūramāno có nghĩa là không hoàn thành được trạng thái đó, không thể hoàn thành; ý nghĩa là không hoàn hảo với trạng thái đó.
Attanā āpāyikena hontenāpi tabbhāvaṃ aparipūramānena pokkharasātinā esā vācā bhāsitāti atthato sambandhattā katvatthe cetaṃ paccattavacananti āha ‘‘āpāyikenāpi aparipūramānenā’’ti.
Since it is connected by meaning that this statement was spoken by Pokkharasāti, who, being himself inclined to ruin, was unable to fulfill that state, this (word 'āpāyikena') is in the agentive case (nominative in sense) and he says, "by him, who, though inclined to ruin, was not fulfilling."
Vì có mối liên hệ về ý nghĩa rằng lời này được nói bởi Pokkharasāti, người dù là người dấn thân vào con đường hủy diệt nhưng lại không hoàn thành được trạng thái đó, và đây là một từ ở cách chủ cách trong nghĩa chủ thể, nên (vị thầy) nói: “người dấn thân vào con đường hủy diệt nhưng không hoàn thành.”
Apica attanā aparipūramānena āpāyikenāpi sayaṃ aparipūramānāpāyikena hutvāpi pokkharasātinā esā vācā bhāsitāti atthayuttito itthambhūtalakkhaṇe cetaṃ paccattavacanantipi evaṃ vuttaṃ.
Furthermore, it is also stated thus: This statement was spoken by Pokkharasāti, who was himself 'aparipūramānāpāyika,' i.e., not fulfilling and inclined to ruin, due to the meaningful connection, and therefore this (word 'āpāyikena') is in the locative case (locative of characteristic) if the word refers to the brahmin, or else in the agentive case (nominative in sense) if it is connected as a characteristic of himself.
Hơn nữa, lời này cũng được nói như vậy vì có sự hợp lý về ý nghĩa rằng lời này được nói bởi Pokkharasāti, người dù không hoàn thành được và dấn thân vào con đường hủy diệt, tức là tự mình không hoàn thành được và dấn thân vào con đường hủy diệt, và đây là một từ ở cách chủ cách trong nghĩa itthambhūtalakkhaṇa (chỉ trạng thái hiện tại).
Añño hi saddakkamo, añño atthakkamoti.
For the sequence of words is one thing, and the sequence of meaning is another.
Thật vậy, trình tự từ ngữ khác với trình tự ý nghĩa.
Keci pana ‘‘karaṇatthameva dassetuṃ evaṃ vutta’’nti vadanti, tadayuttameva padadvayassa kattupadena samānatthattā, samānatthānañca padānaṃ aññamaññaṃ karaṇabhāvānupapattito, alamatipapañcena.
Some say, "It was said thus only to show the instrumental meaning," but that is improper, because the two words (āpāyikena, aparipūramānena) have the same meaning as the agentive word, and it is impossible for words with the same meaning to be in an instrumental relationship to each other. Enough with excessive elaboration.
Một số người nói rằng “điều này được nói chỉ để chỉ nghĩa công cụ,” nhưng điều đó không hợp lý vì hai từ này có cùng nghĩa với từ chủ thể, và các từ có cùng nghĩa không thể là công cụ của nhau. Đủ rồi với sự mở rộng quá mức.
808
Pubbakaisibhāvānuyogavaṇṇanā
Description of the Practice of Former Ascetics
Giải thích về sự tu tập của các đạo sĩ thời xưa
809
283. Dīyateti datti, sā eva dattikanti āha ‘‘dinnaka’’nti.
283. That which is given is datti; that itself is dattikaṃ, he says, "given."
283. Datti là thứ được cho, và chính nó là dattikaṃ, nên (vị thầy) nói: “dinnakaṃ” (thứ đã được cho).
Adātukāmampi dātukāmaṃ katvā sammukhā paramāvaṭṭeti sammūḷhaṃ karoti etāyāti sammukhāvaṭṭanī. Tenāha ‘‘na demīti vattuṃ na sakkotī’’ti.
That by which one makes another, even unwilling to give, willing to give, and bewilders him directly, is sammukhāvaṭṭanī. Therefore, he says, "one cannot say, 'I will not give.'"
Sammukhāvaṭṭanī là thứ mà nhờ đó người ta làm cho người khác bối rối ngay trước mặt, khiến họ muốn cho dù không muốn. Do đó, đã nói: “không thể nói ‘tôi không cho’.”
Puna tassāti brāhmaṇassa.
Again, "his" refers to the brahmin's.
Lại nữa, tassā có nghĩa là của vị Bà-la-môn.
Kāraṇānurūpaṃ rājūnaṃ puṇṇapattanti āha ‘‘kasmā me dinno’’ti.
In accordance with the cause, it refers to the complete bowl of kings; he says, "Why was it given to me?"
Theo lý do, đó là một món quà đầy đủ của các vị vua, nên (vị thầy) nói: “Tại sao nó được trao cho tôi?”
Saṅkhapalitakuṭṭhanti dhotasaṅkhamiva setakuṭṭhaṃ.
"Leprosy white as a conch" means white leprosy like a washed conch shell.
Saṅkhapalitakuṭṭhaṃ là bệnh phong trắng như vỏ ốc đã được rửa sạch.
Setapokkhararajatato guṇasamānakāyattā evamāha.
He says this because its body is similar in quality to white lotuses and silver.
Nói như vậy vì nó có thân hình tương tự như hoa sen trắng và bạc.
Anugacchatīti paramanubandhati.
"It follows" means it continues to follow another (person).
Anugacchati có nghĩa là bám theo người khác.
810
Yadi duvidhenapi kāraṇena rājā brāhmaṇassa sammukhābhāvaṃ na deti, atha kasmā tadupasaṅkamanaṃ na paṭikkhittanti āha ‘‘yasmā panā’’tiādi.
If the king does not grant the brāhmaṇa an audience for both reasons, then why is his approach not rejected? The Teacher says, " Because..." and so on.
Nếu nhà vua không cho vị Bà-la-môn diện kiến vì hai lý do, vậy tại sao việc đến gần đó không bị cấm cản?" - câu hỏi này được nói để giải thích "yasmā panā" (vì lẽ đó) và những điều tương tự.
‘‘Khettavijjāyāti nītisatthe’’ti (dī. ni. ṭī. 1.283) ācariyena vuttaṃ.
The Teacher states, " Khettavijjā means the science of polity."
Vị đạo sư đã nói "khettavijjāyā" (trong các khoa học về đất đai) là "trong các khoa học về chính trị" (nītisatthe).
Heṭṭhāpi brahmajālavaṇṇanāyaṃ evaṃ vuttaṃ ‘‘khettavijjāti abbheyyamāsurakkharājasatthādinītisattha’’nti.(Dī. ni. aṭṭha. 1.21) dussamettha tirokaraṇiyaṃ.
Below, in the Brahmajāla Commentary, it is also stated thus: "Khettavijjā means the science of polity, such as the Abheyyā, Māsurakkha, and Rāja treatises." Here, dussa refers to a screen or curtain.
Ở dưới, trong phần Brahmajāla-vaṇṇanā, cũng đã nói rằng: "khettavijjā là các khoa học về chính trị như Abbheyyā, Māsurakkha, Rāja, v.v." Ở đây, dussa là bức màn che.
Tenāha ‘‘sāṇipākārassa anto ṭhatvā’’ti.
Therefore, it is said, " standing inside the screen-wall."
Do đó, có lời nói "sāṇipākārassa anto ṭhatvā" (đứng bên trong bức tường vải).
Antasaddena pana tabbhāvena pade vaḍḍhiyamāne dussantaṃ yathā ‘‘vananto’’ti.
When the word anta is appended to a noun in that sense, it becomes dussantaṃ, like "vananto."
Tuy nhiên, khi từ dussa được kéo dài thành dussantaṃ với hậu tố anta, nó giống như "vananto" (rìa rừng).
‘‘Payātanti saddhaṃ, sassatikaṃ vā.
Payātaṃ means food given out of faith, or permanent food.
"Payātaṃ" (được ban cho) có nghĩa là cơm cúng người chết (saddhaṃ) hoặc cơm thường xuyên (sassatikaṃ).
Tenāha abhiharitvā dinna’’nti ācariyena vuttaṃ, tasmā matakabhattasaṅkhepena vā niccabhattasaṅkhepena vā abhiharitvā dinnaṃ bhikkhanti attho veditabbo.
Therefore, the Teacher states, "given having brought." Hence, the meaning should be understood as food brought and given, either in the form of food for the deceased or regular food.
Do đó, vị đạo sư đã nói "được mang đến và ban cho" (abhiharitvā dinnaṃ), vậy nên cần hiểu ý nghĩa là "cơm được mang đến và ban cho, dưới dạng cơm cúng người chết hoặc cơm thường xuyên, được thọ nhận".
‘‘Ayaṃ panā’’tiādi atthāpattivacanaṃ.
" Ayaṃ pana" and so on, is an expression of inferential meaning.
"Ayaṃ panā" (nhưng điều này) và những điều tương tự là một câu nói hàm ý.
Niṭṭhanti nicchayaṃ.
Niṭṭhaṃ means certainty.
Niṭṭhaṃ (sự kết thúc) có nghĩa là sự quyết định.
Kasmā pana bhagavā brāhmaṇassa evarūpaṃ amanāpaṃ mammavacanaṃ avocāti codanaṃ kāraṇaṃ dassetvā sodhetuṃ ‘‘idaṃ panā’’tiādi vuttaṃ.
Why did the Blessed One utter such unpleasant and hurtful words to the brāhmaṇa? To clear this query by showing the reason, the statement " idaṃ pana" and so on was made.
Để làm rõ câu hỏi "Tại sao Đức Thế Tôn lại nói những lời khó chịu, xúc phạm như vậy với vị Bà-la-môn?", "idaṃ panā" (nhưng điều này) và những điều tương tự đã được nói để trình bày lý do và làm sáng tỏ.
Rahassampi paṭicchannampi mammavacanaṃ pakāsesīti sambandho.
The connection is that the Blessed One revealed the hurtful words, even if they were secret or concealed.
Liên hệ là: Đức Thế Tôn đã tiết lộ lời xúc phạm, dù là bí mật hay che giấu.
811
284. Rājāsanaṃ nāma hatthikkhandhapadesaṃ sandhāya ‘‘hatthigīvāya vā nisinno’’ti pāḷiyaṃ vuttaṃ.
284. The term "royal seat" in the Pāli, " seated on an elephant's neck, refers to the region of an elephant's shoulder.
284. Chỗ ngồi của vua (Rājāsanaṃ) trong kinh điển (pāḷiyaṃ) được nói là "hatthigīvāya vā nisinno" (ngồi trên cổ voi), đề cập đến vùng cổ của voi.
Rathūpatthareti rathassa upari attharitapadese.
Rathūpatthare means on the place spread over the chariot.
Rathūpatthare (trên sàn xe) có nghĩa là trên phần được trải trên xe ngựa.
Tenāha ‘‘rathamhī’’tiādi.
Therefore, it is said, " rathaṃhi" and so on.
Do đó, có lời nói "rathamhī" (trên xe ngựa) và những điều tương tự.
Uggatuggatehīti uggatānamatisayena uggatehi.
Uggatuggatehi means "by those who are exceedingly eminent among the eminent."
Uggatuggatehī (bởi những người cao quý nhất trong số những người cao quý) có nghĩa là bởi những người cực kỳ cao quý trong số những người cao quý.
Na hi vicchāsamāso lokikehi abhimatoti.
Indeed, a vicchāsamāsa (distributive compound) is not accepted by worldly grammarians.
Thật vậy, sự kết hợp lặp lại (vicchāsamāso) không được chấp nhận bởi những người thế tục.
Rañño apaccaṃ rājañño, bahukattaṃ pati, ekasesanayena vā ‘‘rājaññehī’’ti vuttaṃ.
Rājañño is a descendant of a king; the plural form " rājaññehi" is used either by referring to many, or by way of ekasesa (retention of one term).
Con cháu của vua (Rañño apaccaṃ) là rājañño (hoàng tộc). Lời nói "rājaññehī" (bởi các hoàng tộc) được nói theo cách số nhiều hoặc theo quy tắc ekasesa.
Pākaṭamantananti pakāsabhūtaṃ mantanaṃ.
Pākaṭamantanaṃ means open consultation.
Pākaṭamantanaṃ (cuộc thảo luận công khai) là một cuộc thảo luận được công bố rõ ràng.
Tadevidhādhippetaṃ, na rahassamantanaṃ suddādīhipi suyyamānassa icchitattā.
This is what is intended here, not secret consultation, as it is desired that even sūdras and others may hear it.
Điều này được ngụ ý ở đây, chứ không phải là một cuộc thảo luận bí mật, vì nó được mong muốn là có thể nghe được bởi cả những người thấp kém (sudda) và những người khác.
Tena vuttaṃ ‘‘atha āgaccheyya suddo vā suddadāso vā’’tiādi.
Therefore, it is stated, " Then a sūdra or a sūdra's servant may come" and so on.
Do đó, có lời nói "atha āgaccheyya suddo vā suddadāso vā" (nếu một người thấp kém hoặc một nô lệ thấp kém đến) và những điều tương tự.
Tādisehiyevāti rañño ākārasadiseheva.
Tādisehiyevā means "by those exactly resembling the king's manner."
Tādisehiyevā (chỉ bởi những người như vậy) có nghĩa là chỉ bởi những người có phẩm chất tương tự như nhà vua.
Tassatthassa sādhanasamatthaṃ vacanaṃ raññā bhaṇitaṃ yathā, tathā sopi tassatthassa sādhanasamatthameva bhaṇitaṃ vacanaṃ apinu bhaṇatīti yojetabbaṃ.
Just as the king spoke words capable of achieving that goal, so too must it be connected that this poor man also speaks words capable of achieving that very goal.
Cần phải kết nối như sau: giống như nhà vua đã nói những lời có khả năng chứng minh ý nghĩa đó, thì người đó (người thấp kém) cũng nói những lời có khả năng chứng minh ý nghĩa đó.
812
285. ‘‘Pavattāro’’ti etassa pāvacanabhāvena vattāroti saddato attho.
285. The literal meaning of pavattāro is "speakers," in the sense of expounding that mantra.
285. Đối với "Pavattāro" (những người truyền dạy), ý nghĩa theo từ nguyên là "những người nói" theo nghĩa là những người truyền dạy giáo lý.
Yasmā pana te tathābhūtā mantānaṃ pavattakā nāma, tasmā adhippāyato atthaṃ dassetuṃ ‘‘pavattayitāro’’ti vuttaṃ.
However, since those sages are indeed promulgators of mantras, the term " pavattayitāro" is used to show the intended meaning.
Nhưng vì họ là những người khởi xướng các thần chú (mantānaṃ pavattakā), nên để trình bày ý nghĩa theo mục đích, đã nói "pavattayitāro" (những người khởi xướng).
Vadasaddena, hi tupaccayena ca ‘‘vattāro’’ti padasiddhi, tathā vatusaddena ‘‘pavattayitāro’’ti.
The word vattāro is derived from the root vad and the suffix tu, and similarly, pavattayitāro from the root vatu.
Thật vậy, sự hình thành của từ "vattāro" là từ gốc "vad" và hậu tố "tu", và tương tự, "pavattayitāro" là từ gốc "vattu".
Idaṃ ācariyassa (dī. ni. ṭī. 1.285) ca ācariyasāriputtattherassa ca mataṃ.
This is the view of the Teacher and of the Elder Sāriputta, the Teacher.
Đây là quan điểm của vị đạo sư (Dī. Ni. Ṭī. 1.285) và vị trưởng lão Sāriputta.
Vatusaddeneva ‘‘pavattāro’’ti padasiddhiṃ dassetītipi keci vadanti.
Some say that the word pavattāro is derived solely from the root vatu.
Một số người cũng nói rằng sự hình thành của từ "pavattāro" được thể hiện chỉ bằng gốc "vattu".
Padadvayassa tulyādhikaraṇattā ‘‘mantamevā’’ti vuttaṃ.
" Mantamevā" is stated due to the coreferentiality of the two terms.
Vì hai từ có cùng một cơ sở (tulyādhikaraṇattā), nên đã nói "mantamevā" (chỉ là thần chú).
‘‘Sudde bahi katvā raho bhāsitabbaṭṭhena mantā eva taṃ taṃ atthapaṭipattihetutāya pada’’nti hi tulyādhikaraṇaṃ hoti, anupanītāsādhāraṇatāya rahassabhāvena vattabbāya mantanakiriyāya padamadhigamupāyantipi mantapadanti aṭṭhakathāmuttako nayo.
Indeed, "Mantā are called pada (means) because they are to be recited in private, excluding sūdras, and because they are the cause for the attainment of various benefits" is coreferential. Another explanation from the commentaries is that mantapada means a means of attainment for the act of consultation, which is to be spoken secretly because it is not common to the uninitiated.
Thật vậy, "thần chú" (mantā eva) trở thành đồng nghĩa (tulyādhikaraṇaṃ) với "lời" (padaṃ) vì chúng được nói riêng tư sau khi loại bỏ những người thấp kém (sudde bahi katvā raho bhāsitabbaṭṭhena), và vì chúng là nguyên nhân dẫn đến việc đạt được các mục đích khác nhau (taṃ taṃ atthapaṭipattihetutāya). Một cách giải thích khác từ Aṭṭhakathā là mantapada (lời thần chú) cũng có nghĩa là phương tiện để đạt được hành động thần chú, vì nó được nói một cách bí mật do tính không phổ biến của nó đối với những người chưa được thụ phong.
Gītanti gāyanavasena sajjhāyitaṃ, gāyanampidha udattānudattādisarasampādanavaseneva adhippetanti vuttaṃ ‘‘sarasampattivasenā’’ti.
Gītaṃ means recited by chanting, and chanting here is intended in the sense of producing tones such as udātta (raised) and anudātta (lowered), as stated by " sarasampattivasenā."
Gītaṃ (được hát) là được tụng đọc theo cách hát. Ở đây, việc hát cũng được ngụ ý là việc tạo ra các âm điệu cao (udatta), thấp (anudatta), v.v., do đó đã nói "sarasampattivasenā" (theo cách tạo ra sự hài hòa của âm thanh).
Pāvacanabhāvena aññesaṃ vuttaṃ. Tamaññesaṃ vādāpanavasena vācitaṃ. Saṅgahetvā uparūpari saññūḷhāvasena samupabyūḷhaṃ. Iruvedayajuvedasāmavedādivasena, tatthāpi paccekaṃ mantabrahmādivasena, ajjhāyānuvākādivasena ca rāsikataṃ. Yathāvuttanayeneva piṇḍaṃ katvā ṭhapitaṃ.
Aññesaṃ vuttaṃ means taught to others in the sense of authoritative teaching. Vācitaṃ means caused to be spoken to others. Samupabyūḷhaṃ means systematically arranged by gathering and superimposing. Rāsikataṃ means grouped according to the Iruveda, Yajuveda, Sāmaveda, and so on, and within each, individually by mantra-brāhmaṇas and so forth, and by chapters and recitations. Piṇḍaṃ katvā ṭhapitaṃ means collected and kept in the aforementioned manner.
Aññesaṃ vuttaṃ (được nói cho người khác) theo nghĩa là giáo lý. Vācitaṃ (được đọc) là được khiến người khác đọc. Samupabyūḷhaṃ (được tổng hợp) là được thu thập và sắp xếp theo từng lớp. Rāsikataṃ (được phân loại) là được phân loại theo các Veda như Ṛgveda, Yajurveda, Sāmaveda, và trong đó, theo từng thần chú (mantabrahmādivasena), từng chương (ajjhāyānuvākādivasena), v.v. Piṇḍaṃ katvā ṭhapitaṃ (được tổng hợp và đặt xuống) theo cách đã nói.
Aññesaṃ vācitaṃ anuvācentīti aññesaṃ kammabhūtānaṃ tehi vācāpitaṃ mantapadaṃ etarahi brāhmaṇā aññesaṃ anuvācāpenti.
Aññesaṃ vācitaṃ anuvācentī means that the brāhmaṇas now cause others to recite the mantra-texts that were caused to be recited by those sages to others, who were the objects of their action.
Aññesaṃ vācitaṃ anuvācentī (họ khiến người khác đọc lại những gì đã được đọc cho người khác) có nghĩa là các Bà-la-môn ngày nay khiến người khác đọc lại những lời thần chú đã được các vị ẩn sĩ đó khiến người khác đọc hoặc dạy.
813
Tesanti mantakattūnaṃ.
Tesaṃ refers to the composers of the mantras.
Tesaṃ (của những người đó) là của các nhà soạn thần chú.
Dibbacakkhuparibhaṇḍaṃ yathākammūpagañāṇaṃ, paccakkhato dassanaṭṭhena dibbacakkhusadisañca pubbenivāsānussatiñāṇaṃ sandhāya ‘‘dibbena cakkhunā’’ti vuttaṃ.
" Dibbena cakkhunā" is stated with reference to the knowledge of karma-based destinations, which is endowed with the divine eye, and the knowledge of past lives, which is like a divine eye in that it sees directly.
Lời nói "dibbena cakkhunā" (bằng thiên nhãn) được nói để đề cập đến tri kiến về nghiệp (yathākammūpagañāṇaṃ) được trang bị thiên nhãn, và tri kiến về các đời quá khứ (pubbenivāsānussatiñāṇaṃ) tương tự như thiên nhãn vì khả năng thấy trực tiếp.
Ato dibbacakkhuparibhaṇḍena yathākammūpagañāṇena sattānaṃ kammassakatādīni ceva dibbacakkhusadisena pubbenivāsānussatiñāṇena atītakappe brāhmaṇānaṃ mantajjhenavidhiñca oloketvāti attho gahetabbo.
Therefore, the meaning should be understood as seeing the karmic ownership of beings, and so forth, with the knowledge of karma-based destinations endowed with the divine eye, and looking at the method of mantra-recitation of the brāhmaṇas in past eons with the knowledge of past lives, which is like a divine eye.
Do đó, cần hiểu ý nghĩa là: "sau khi quán sát các hành vi của chúng sinh, v.v., bằng tri kiến về nghiệp được trang bị thiên nhãn, và nghi thức tụng thần chú của các Bà-la-môn trong các kiếp quá khứ bằng tri kiến về các đời quá khứ tương tự như thiên nhãn".
Rūpameva hi paccuppannaṃ dibbacakkhussa ārammaṇanti tamidha aṭṭhānagataṃ hoti.
For indeed, only present rūpa (form) is the object of the divine eye, so that is not applicable here.
Thật vậy, sắc pháp hiện tại là đối tượng của thiên nhãn, nhưng ở đây điều đó không phù hợp.
Pāvacanena saha saṃsanditvāti yaṃ kassapasammāsambuddhena vuttaṃ vaṭṭasannissitaṃ vacanaṃ, tena saha saṃsanditvā aviruddhaṃ katvā.
Pāvacanena saha saṃsanditvā means having compared and made it consistent with the teaching spoken by Kassapa Sammāsambuddha, which was connected with the round of existence (saṃsāra).
Pāvacanena saha saṃsanditvā (sau khi so sánh với giáo lý) có nghĩa là sau khi so sánh với lời giáo huấn liên quan đến vòng luân hồi (vaṭṭasannissitaṃ vacanaṃ) đã được Đức Phật Chánh Đẳng Giác Kassapa nói, và làm cho nó không mâu thuẫn.
Na hi tesaṃ vivaṭṭasannissito attho paccakkhato hoti.
Indeed, the meaning connected with the cessation of the round of existence (nibbāna) was not directly experienced by them.
Thật vậy, ý nghĩa liên quan đến sự thoát khỏi vòng luân hồi (vivaṭṭasannissito attho) không phải là điều họ có thể thấy trực tiếp.
Ganthiṃsūti pajjagajjabandhavasena sakkatabhāsāya bandhiṃsu.
Ganthiṃsu means they composed it in the Sanskrit language in the form of poetry and prose.
Ganthiṃsu (họ đã biên soạn) có nghĩa là họ đã biên soạn bằng tiếng Phạn theo cách thơ (pajjagajjabandhavasena).
Aparā pareti aṭṭhakādīhi aparā aññepi pare pacchimā okkākarājakālādīsu uppannā.
Aparā pare means other later ones, distinct from Aṭṭhaka and others, who arose during the time of King Okkāka and so forth.
Aparā pare (những người khác sau đó) là những Bà-la-môn khác (aññepi pare) sau các vị ẩn sĩ Aṭṭhaka, v.v., những người đã xuất hiện trong thời kỳ vua Okkāka, v.v.
Pāṇātipātādīni pakkhipitvāti aṭṭhakādīhi ganthitamantapadesveva pāṇātipātādikilesasannissitapadānaṃ tattha tattha pakkhipanaṃ katvā.
Pāṇātipātādīni pakkhipitvā means having inserted words connected with defilements such as taking life into those very mantra-texts composed by Aṭṭhaka and others, here and there.
Pāṇātipātādīni pakkhipitvā (sau khi thêm vào các điều như sát sinh) có nghĩa là sau khi thêm vào các từ liên quan đến các phiền não như sát sinh, v.v., vào các lời thần chú đã được các vị ẩn sĩ Aṭṭhaka, v.v., biên soạn.
Viruddhe akaṃsūti suttanipāte brāhmaṇadhammikasuttādīsu (su. ni. brāhmaṇadhammikasutta) āgatanayena saṃkilesikatthadīpanato paccanīkabhūte akaṃsu.
Viruddhe akaṃsu means they made them contradictory by expounding meanings associated with defilement, in a manner contrary to what is found in the Brāhmaṇadhammika Sutta and other suttas of the Suttanipāta.
Viruddhe akaṃsu (họ đã làm cho chúng trở nên mâu thuẫn) có nghĩa là họ đã làm cho chúng trở nên đối lập bằng cách trình bày các ý nghĩa ô nhiễm theo cách được nói trong các kinh như Brāhmaṇadhammika Sutta trong Suttanipāta.
Isīti nidassanamattaṃ.
Isī is merely an illustration.
Isī (ẩn sĩ) chỉ là một ví dụ.
‘‘Isi vā isitthāya paṭipanno vā’’ti hi vattabbaṃ.
For indeed, it should be said, "either a sage or one practicing for sagehood."
Thật vậy, đáng lẽ phải nói "ẩn sĩ hoặc người đang thực hành để trở thành ẩn sĩ".
Kasmā panettha paṭiññāgahaṇavasena desanāsotapatitaṃ na karotīti āha ‘‘idha bhagavā’’tiādi.
Why, then, does the Blessed One not make the discourse fall into the stream of acceptance in the form of a declaration here? It is stated, " Idha bhagavā" and so on.
Tại sao ở đây Đức Thế Tôn không làm cho giáo lý rơi vào dòng chảy của việc chấp nhận một lời tuyên bố? Điều này được nói trong "idha bhagavā" (ở đây Đức Thế Tôn) và những điều tương tự.
Idhāti ‘‘tyāhaṃ mante adhīyāmi, ‘sācariyako’ti tvaṃ maññasī’’ti vuttaṭṭhāne.
Idha refers to the passage where it is stated, "You think, 'I am learning these mantras, together with my teacher.'"
Idhā (ở đây) là ở chỗ đã nói "Ta học các thần chú đó, ngươi nghĩ ta là có thầy".
Paṭiññaṃ aggahetvāti yathā heṭṭhā paṭiññā gahitā, tathā ‘‘taṃ kiṃ maññasi ambaṭṭha, tāvatā tvaṃ bhavissasi isi vā isitthāya vā paṭipanno sācariyakoti, no hidaṃ bho gotamā’’ti evaṃ idha paṭiññaṃ aggahetvā.
Paṭiññaṃ aggahetvā means without taking a declaration here, just as a declaration was taken below, for example, "What do you think, Ambaṭṭha, will you by that become a sage, or one practicing for sagehood, together with your teacher? No, Reverend Gotama."
Paṭiññaṃ aggahetvā (không chấp nhận một lời tuyên bố) có nghĩa là không chấp nhận một lời tuyên bố ở đây như đã được chấp nhận ở trên, tức là "Này Ambaṭṭha, ngươi nghĩ gì? Ngươi sẽ là một ẩn sĩ hoặc một người đang thực hành để trở thành ẩn sĩ có thầy như vậy sao? Không phải vậy, này Tôn giả Gotama".
814
286. Nirāmagandhāti kilesāsucivasena vissagandharahitā.
286. Nirāmagandhā means free from the stench of raw flesh, in the sense of being free from the foul odor of defilements.
286. Nirāmagandhā (không có mùi thô tục) có nghĩa là không có mùi hôi thối do sự ô uế của các phiền não.
Anitthigandhāti itthīnaṃ gandhamattassapi avisahanena itthigandharahitā.
Anitthigandhā means free from the scent of women, as they cannot tolerate even the slightest scent of women.
Anitthigandhā (không có mùi phụ nữ) có nghĩa là không có mùi phụ nữ, vì không thể chịu đựng được dù chỉ một chút mùi phụ nữ.
Rajojalladharāti pakatirajasedādijalladharā.
Rajojalladharā means bearing the natural dirt and grime of dust and sweat.
Rajojalladharā (mang bụi bẩn và cáu bẩn) có nghĩa là mang bụi bẩn và cáu bẩn tự nhiên như bụi và mồ hôi.
Pākārapurisaguttīti pākārāvaraṇaṃ, purisāvaraṇañca.
Pākārapurisaguttī means the protection of a wall and the protection of men.
Pākārapurisaguttī (sự bảo vệ bằng tường và người) có nghĩa là sự che chắn bằng tường và sự che chắn bằng người.
Ettha pana ‘‘nirāmagandhā’’ti etena tesaṃ dasannaṃ brāhmaṇānaṃ vikkhambhitakilesataṃ dasseti, ‘‘anitthigandhā, brahmacārino’’ti ca etena ekavihāritaṃ, ‘‘rajojalladharā’’ti etena maṇḍanavibhūsanābhāvaṃ, ‘‘araññāyatane pabbatapādesu vasiṃsū’’ti etena manussūpacāraṃ pahāya vivittavāsaṃ, ‘‘vanamūlaphalāhārā vasiṃsū’’ti etena sālimaṃsodanādipaṇītāhāra paṭikkhepaṃ, ‘‘yadā’’tiādinā yānavāhanapaṭikkhepaṃ, ‘‘sabbadisāsū’’tiādinā rakkhāvaraṇapaṭikkhepaṃ.
Here, by “nirāmagandhā”, the Lord shows the Brahmins' klesas to be suppressed; by “anitthigandhā, brahmacārino”, their solitary living; by “rajojalladharā”, their lack of adornment and embellishment; by “araññāyatane pabbatapādesu vasiṃsū”, their abandoning human habitation and dwelling in seclusion; by “vanamūlaphalāhārā vasiṃsū”, their rejection of fine foods like rice and meat; by “yadā” and so on, their rejection of carriages and vehicles; and by “sabbadisāsū” and so on, their rejection of defenses and coverings.
Ở đây, với từ “nirāmagandhā”, Ngài chỉ ra rằng mười vị Bà-la-môn ấy đã trấn áp được các phiền não; với từ “anitthigandhā, brahmacārino”, Ngài chỉ ra sự sống độc cư; với từ “rajojalladharā”, Ngài chỉ ra sự không trang điểm, không tô điểm; với từ “araññāyatane pabbatapādesu vasiṃsū”, Ngài chỉ ra sự sống viễn ly, từ bỏ sự giao du với loài người; với từ “vanamūlaphalāhārā vasiṃsū”, Ngài chỉ ra sự từ bỏ các món ăn cao cấp như cơm gạo lức trộn thịt; với từ “yadā” và các từ tiếp theo, Ngài chỉ ra sự từ bỏ các phương tiện xe cộ; và với từ “sabbadisāsū” và các từ tiếp theo, Ngài chỉ ra sự từ bỏ các sự bảo vệ, che chở.
Evañca dassento micchāpaṭipadāpakkhikaṃ sācariyakassa ambaṭṭhassa vuttiṃ upādāya sammāpaṭipadāpakkhikāpi tesaṃ brāhmaṇānaṃ vutti ariyavinaye sammāpaṭipattiṃ upādāya micchāpaṭipadāyeva.
And in showing this, while taking as a basis the wrongful practice of Ambaṭṭha and his teacher, it is shown that even the practice of those Brahmins, which outwardly appears as right practice, is actually wrong practice in the noble discipline (ariyavinaya) when considered against true right practice.
Và khi chỉ ra như vậy, dựa trên lối sống sai lầm của Ambaṭṭha cùng với vị thầy của mình, thì lối sống của mười vị Bà-la-môn kia, dù thuộc về sự thực hành chân chính, nhưng nếu xét theo Vinaya của bậc Thánh, dựa trên sự thực hành chân chính, thì đó vẫn là một sự thực hành sai lầm.
Kathañhi nāma te bhavissati sallekhapaṭipattiyuttatāti.
How indeed could they possess the practice of frugality and detachment (sallekhapaṭipatti)?
Làm sao mà họ có thể được gọi là những người thực hành hạnh thiểu dục được chứ?
‘‘Evaṃ su te’’tiādinā bhagavā ambaṭṭhaṃ santajjento niggaṇhātītipi vibhāveti.
Furthermore, it reveals that the Blessed One, by “Evaṃ su te” and so on, admonishes and rebukes Ambaṭṭha.
Với từ “Evaṃ su te” và các từ tiếp theo, Ngài cũng giải thích rằng Đức Thế Tôn đã quở trách và chế ngự Ambaṭṭha.
Idañhi vakkhamānāya pāḷiyā piṇḍatthadassananti.
This is indeed a summary of the meaning of the Pali text that will be spoken.
Đây là sự trình bày ý nghĩa tổng quát của đoạn Paḷi sẽ được nói đến sau.
815
Dussapaṭṭikā dussapaṭṭaṃ. Dussakalāpo dussaveṇī.
A dussapaṭṭikā is a dussapaṭṭa (cloth strip). A dussakalāpa is a dussaveṇī (cloth braid).
Dussapaṭṭikādussapaṭṭaṃ (tấm vải). Dussakalāpodussaveṇī (búi vải).
Veṭhakehīti veṭhakapaṭṭakehi, dussehi saṃveṭhetvā katanamitaphāsukāhīti vuttaṃ hoti.
Veṭhakehī means with wrapped cloth strips; it is said to be with ribs made flexible by wrapping them with cloths.
Veṭhakehīti có nghĩa là “bằng những tấm vải quấn, bằng những tấm vải đã được quấn lại để tạo thành những xương sườn cong”.
Kappetunti kattarikāya chindituṃ.
Kappetuṃ means to cut with scissors.
Kappetuṃ có nghĩa là cắt bằng kéo.
Kappitavālehīti etthāpi eseva nayo.
The same method applies to kappitavālehī here.
Trong Kappitavālehīti cũng theo cách tương tự.
‘‘Na bhikkhave massu kappāpetabba’’ntiādīsu (cūḷava. 275) viya hi kapusaddo chedane vattati.
Indeed, the word kapu is used in the sense of cutting, as in "Monks, a beard should not be allowed to be cut" and so on.
Thật vậy, từ kapu được dùng với nghĩa cắt, như trong các đoạn “Na bhikkhave massu kappāpetabbaṃ” và các từ tiếp theo.
Yuttaṭṭhānesūti gīvāsīsavāladhīsu.
Yuttaṭṭhanesu refers to the neck, head, and tail.
Yuttaṭṭhānesu là ở cổ, đầu và đuôi.
Vālāti tesu ṭhānesu jāyamānā lomā.
Vālā are the hairs growing in those places.
Vālā là những sợi lông mọc ở những chỗ đó.
Sahacaraṇavasena, ṭhānīnāmena vā ‘‘kuttavālā’’ti vuttā.
They are called “kuttavālā” either by way of association or by the name of the locality.
Do sự đồng hành, hoặc do tên của nơi chốn, chúng được gọi là “kuttavālā”.
Keci pana ‘‘vāḷayuttattā’’ti pāṭhaṃ kappetvā vāḷarūpayuttattāti atthaṃ vadanti, pāḷiyānapekkhanameva tesaṃ doso.
Some, however, construct the reading "vāḷayuttattā" and say the meaning is "because they are endowed with animal-like forms"; their fault is merely not looking at the Pāḷi.
Một số người lại tạo ra câu “vāḷayuttattā” và giải thích là “do có hình dáng như loài thú dữ”, nhưng lỗi của họ là không xem xét bản Paḷi.
‘‘Kuttavālehi vaḷavārathehī’’ti pāḷiyaṃ vuttaṃ.
In the Pali, it is stated: "with chariots drawn by well-groomed mares".
Trong bản Paḷi có nói “kuttavālehi vaḷavārathehī”.
Samantānagaranti nagarassa samantato.
Samantānagaraṃ means all around the city.
Samantānagaraṃ là xung quanh thành phố.
Pākārassa adhobhāge katasudhākammaṃ ṭhānaṃ nagarassa samīpe kattabbato, upakārakaraṇato ca ‘‘upakārikā’’ti vuccati. Nagarassa upakārikā etāsanti nagarūpakārikāyo, rājadhānīapekkhāya itthiliṅganiddeso.
The place where plaster work is done at the base of the wall is called “upakārikā” because it is to be done near the city and because it is beneficial. The feminine gender is used with reference to the capital.
Nơi được trát vôi ở phía dưới tường thành, do được làm gần thành phố và có tác dụng hỗ trợ, được gọi là “upakārikā”. Những thứ hỗ trợ cho thành phố này được gọi là nagarūpakārikāyo, sự chỉ định giống cái là do liên quan đến thủ đô.
Tenāha ‘‘idha panā’’tiādi.
Therefore, it is said, “idha panā” and so on.
Vì vậy, Ngài nói “idha panā” và các từ tiếp theo.
Matīti vicikicchāvasena anekaṃsikajānanā.
Matī is knowing something indecisively due to doubt (vicikicchā).
Matī là sự hiểu biết không chắc chắn do nghi ngờ.
Upari desanāya avaḍḍhakāraṇaṃ dassento ‘‘idaṃ bhagavā’’tiādimāha.
Showing the reason for the lack of growth in the teaching further on, he says “idaṃ bhagavā” and so on.
Để chỉ ra lý do không phát triển giáo pháp ở trên, Ngài nói “idaṃ bhagavā” và các từ tiếp theo.
Pāḷiyaṃ so maṃ pañhenāti so jano maṃ pucchāvasena sodheyya.
In the Pali, so maṃ pañhenā means, "that person might purify me by questioning."
Trong bản Paḷi, so maṃ pañhenā có nghĩa là người đó sẽ thanh lọc tôi bằng cách hỏi.
Ahaṃ veyyākaraṇena sodhessāmīti ahampimaṃ vissajjanāvasena sodhessāmīti yathārahamadhikāravasena attho veditabbo.
Ahaṃ veyyākaraṇena sodhessāmī means, "I too will purify him by answering," and so the meaning should be understood according to the appropriate context.
Ahaṃ veyyākaraṇena sodhessāmīti có nghĩa là tôi cũng sẽ thanh lọc mình bằng cách trả lời, ý nghĩa này nên được hiểu tùy theo ngữ cảnh.
816
Dvelakkhaṇadassanavaṇṇanā
Description of the display of the two marks
Dvelakkhaṇadassanavaṇṇanā
817
287. ‘‘Nisinnāna’’ntiādi anādare sāmivacanaṃ, visesanaṃ vā.
287. “Nisinnāna” and so on, is the possessive case (sāmivacana) in the sense of disrespect, or it is an adjective.
“Nisinnānaṃ” và các từ tiếp theo là cách dùng sở thuộc cách trong trường hợp không tôn trọng, hoặc là một tính từ.
Saṅkucite iriyāpathe anavasesato lakkhaṇānaṃ dubbibhāvanato ‘‘na sakkotī’’ti vuttaṃ, tathā suvibhāvanato pana ‘‘sakkotī’’ti.
It is said “na sakkotī” (cannot) because it is difficult to clearly discern all the marks in a restricted posture; but it is said “sakkotī” (can) because they can be clearly discerned in an open posture.
Vì các tướng không thể được nhận biết hoàn toàn trong tư thế co rút, nên mới nói “na sakkotī”; còn vì có thể nhận biết rõ ràng, nên mới nói “sakkotī”.
Pariyesanasukhatthameva tadāciṇṇatā daṭṭhabbā.
His practice of walking at that time should be understood as for the ease of observation (of the marks).
Sự thực hành đó nên được xem là chỉ nhằm mục đích dễ dàng tìm kiếm.
Tenāti duvidhenapi kāraṇena.
Tena means by both reasons.
Tena là do cả hai nguyên nhân.
818
Gavesīti ñāṇena pariyesanamakāsi.
Gavesī means he searched with knowledge.
Gavesī nghĩa là tìm kiếm bằng trí tuệ.
Gaṇayantoti ñāṇeneva saṅkalayanto.
Gaṇayanto means counting only with knowledge.
Gaṇayanto nghĩa là tính toán bằng trí tuệ.
Samānayīti sammā ānayi samāhari.
Samānayī means he brought together well, he collected.
Samānayī nghĩa là đã tập hợp lại một cách đúng đắn.
‘‘Kaṅkhatī’’ti padassa ākaṅkhatīti atthoti āha ‘‘aho vatā’’tiādi.
The meaning of the word “Kaṅkhatī” is “wishes,” so it says “aho vatā” and so on.
Từ “kaṅkhatī” có nghĩa là ākaṅkhati (mong muốn), nên Ngài nói “aho vatā” và các từ tiếp theo.
Anupasaggampi hi padaṃ katthaci saupasaggamiva atthavisesavācakaṃ yathā ‘‘gotrabhū’’ti.
Indeed, even a word without a prefix (upasarga) sometimes expresses a special meaning as if it had a prefix, like "gotrabhū."
Thật vậy, một từ không có tiền tố đôi khi cũng biểu thị một ý nghĩa đặc biệt như thể có tiền tố, ví dụ như “gotrabhū”.
Tato tato sarīrappadesato.
Tato tato refers to from various parts of the body.
Tato tato là từ các bộ phận khác nhau của cơ thể.
Kicchatīti kilamati.
Kicchatī means he toils.
Kicchatī là mệt mỏi.
Tenāha ‘‘na sakkoti daṭṭhu’’nti.
Therefore, it says “na sakkoti daṭṭhuṃ”.
Vì vậy, Ngài nói “na sakkoti daṭṭhuṃ”.
Tāyāti ‘‘vicinanto kicchatī’’ti vuttāya vicikicchāya.
Tāyā means by that vicikicchā (doubt) that was described as "searching, he toils."
Tāyā là do sự vicikicchā (nghi ngờ) đã nói, tức là “người tìm kiếm mệt mỏi”.
Tatoti sanniṭṭhānaṃ agamanato.
Tato means from not reaching a conclusion.
Tato là do không đi đến kết luận.
Evaṃ ‘‘kaṅkhatī’’ti padassa āsisanatthataṃ dassetvā idāni saṃsayatthataṃ dassento ‘‘kaṅkhāya vā’’tiādimāha.
Having thus shown the meaning of "wishing" for the word "kaṅkhatī," he now shows the meaning of "doubt," saying “kaṅkhāya vā” and so on.
Như vậy, sau khi chỉ ra rằng từ “kaṅkhatī” có nghĩa là mong muốn, bây giờ Ngài nói “kaṅkhāya vā” và các từ tiếp theo để chỉ ra nghĩa nghi ngờ.
Tattha kaṅkhāyāti ‘‘kaṅkhatī’’ti padena vuttāya kaṅkhāya.
There, kaṅkhāyā means by the doubt expressed by the word "kaṅkhatī."
Trong đó, kaṅkhāyā là sự nghi ngờ được diễn tả bằng từ “kaṅkhatī”.
Asatvapadhānañhi ākhyātikaṃ.
Indeed, a verb (ākhyātika) is primarily non-substantive.
Thật vậy, động từ thì không có chủ ngữ là vật chất.
Esa nayo sesesupi.
This method applies to the remaining ones as well.
Điều này cũng tương tự với các phần còn lại.
Avatthāpabhedagatā vimati eva ‘‘tīhi dhammehī’’ti vuttā, tippakārehi saṃsayadhammehīti attho.
The uncertainty (vimati) arising from different states is precisely what is meant by “tīhi dhammehī”, which means by the three kinds of doubtful mental states.
Sự hoài nghi, được phân loại theo từng trạng thái, được gọi là “tīhi dhammehī”, có nghĩa là ba loại pháp nghi ngờ.
Kālusiyabhāvoti appasannatāya hetubhūto āvilabhāvo.
Kālusiyabhāvo is the turbid state that is the cause of lack of clarity.
Kālusiyabhāvo là trạng thái vẩn đục, là nguyên nhân của sự không thanh tịnh.
819
Vatthikosenāti nābhiyā adhobhāgasaṅkhāte vatthimhi jātena liṅgapasibbakena.
Vatthikosena means by the sheath of the penis (liṅgapasibbakena) located in the lower part of the navel, which is called the pelvis (vatthi).
Vatthikosena là bằng túi đựng bộ phận sinh dục, nằm ở phần dưới rốn, được gọi là bàng quang.
‘‘Aṇḍakoso’’tiādīsu (ma. ni. 1.152, 189; 2.27; a. ni. 7.71; pārā. 11) viya hi kosasaddo pariveṭhakapasibbake vattati.
Indeed, the word kosa is used for an enveloping sheath, as in aṇḍakoso and so on.
Thật vậy, từ kosa được dùng để chỉ cái túi bao bọc, như trong các đoạn “aṇḍakoso” và các từ tiếp theo.
Vatthena guhitabbattā vatthaguyhaṃ. Yasmā bhagavato kosohitaṃ vatthaguyhaṃ sabbabuddhāveṇikaṃ aññehi asādhāraṇaṃ suvisuddhakañcanamaṇḍalasannibhaṃ, attano saṇṭhānasannivesasundaratāya ājāneyyagandhahatthino varaṅgaparamacārubhāvaṃ, vikasamānatapaniyāravindasamujjalakesarāvattavilāsaṃ, sañjhāpabhānurañjitajalavanantarābhilakkhitasampuṇṇacandamaṇḍalasobhañca attano siriyā abhibhuyya virājati, yaṃ bāhirabbhantaramalehi anupakkiliṭṭhatāya, cirakālaparicitabrahmacariyādhikāratāya, saṇṭhitasaṇṭhānasampattiyā ca kopīnampi samānaṃ akopīnameva jātaṃ.
Vatthaguyhaṃ means "to be concealed by clothing." Because the Blessed One's kosohitaṃ vatthaguyhaṃ (private part concealed by a sheath) is unique to all Buddhas, not common to others, resembling a perfectly pure golden disc, it outshines by its own beauty of form and structure the supreme charm of a noble, fragrant elephant's excellent limb, the splendor of bright stamens and filaments of a blossoming golden lotus, and the beauty of a full moon disc marked by the twilight's glow within a forest of water plants, and because it is undefiled by external and internal impurities, by the merit of a long-practiced brahmacariya, and by the perfection of its established form, that private part, though small, has become as if not small at all.
Vatthaguyhaṃ là bộ phận kín đáo cần được che giấu bằng vải. Vì bộ phận kín đáo của Đức Thế Tôn, được che giấu trong túi, là độc nhất vô nhị đối với tất cả chư Phật, không ai sánh bằng, rực rỡ như một vòng tròn vàng ròng tinh khiết, vượt trội về vẻ đẹp của hình dáng và sự sắp đặt, giống như vẻ đẹp thanh nhã của nhụy hoa sen vàng rực rỡ đang nở, và vẻ đẹp của vầng trăng tròn được tô điểm bởi ánh sáng hoàng hôn giữa rừng nước, vượt xa vẻ đẹp của chính Ngài, và vì nó không bị vấy bẩn bởi các tạp chất bên ngoài và bên trong, do công đức của việc thực hành Phạm hạnh lâu dài, và do sự hoàn hảo của hình dáng đã được thiết lập, nên ngay cả một bộ phận kín đáo cũng trở nên không còn kín đáo nữa.
Tena vuttaṃ ‘‘bhagavato hī’’tiādi.
Therefore, it is said “bhagavato hī” and so on.
Vì vậy, Ngài nói “bhagavato hī” và các từ tiếp theo.
Varavāraṇassevāti varagandhahatthino iva.
Varavāraṇassevā means like a noble fragrant elephant.
Varavāraṇassevā là như một con voi chúa có mùi thơm.
Pahūtabhāvanti puthulabhāvaṃ.
Pahūtabhāvaṃ means the quality of being ample or broad.
Pahūtabhāvaṃ là sự rộng lớn.
Ettheva hi tassa saṃsayo.
Indeed, his doubt was only concerning this.
Nghi ngờ của ông ta chỉ nằm ở điểm này.
Tanumudusukumārādīsu panassa guṇesu vicāraṇā eva nāhosi.
But there was no deliberation on his qualities such as being subtle, soft, or delicate.
Còn về những phẩm chất như mỏng, mềm, tế nhị, thì ông ta không hề có sự suy xét nào.
820
288. ‘‘Tathārūpa’’nti idaṃ samāsapadanti āha ‘‘taṃrūpa’’nti.
288. The word “Tathārūpaṃ” is a compound word, so it says “taṃ rūpaṃ”.
“Tathārūpaṃ” là một từ ghép, nên Ngài nói “taṃrūpaṃ”.
Etthāti yathā ambaṭṭho kosohitaṃ vatthaguyhamaddassa, tathā iddhābhisaṅkhāramabhisaṅkharaṇe.
Ettha means, just as Ambaṭṭha saw the private part (vatthaguyha) concealed in a sheath, so too in manifesting the psychic power.
Ettha là ở đây, cũng như Ambaṭṭha đã thấy bộ phận kín đáo được che giấu trong túi, thì ở đây là trong việc tạo ra thần thông.
Iminā hi ‘‘tathārūpaṃ iddhābhisaṅkhāraṃ abhisaṅkharī’’tiādipāḷiparāmasanaṃ, ato cettha saha iddhābhisaṅkhāranayena vatthaguyhadassanakāraṇaṃ milindapañhāpāṭhena (mi. pa. 3.3) vibhāvitaṃ hoti.
Indeed, by this, the Pali text "tathārūpaṃ iddhābhisaṅkhāraṃ abhisaṅkharī" (he manifested such a psychic power) and so on is referenced, and therefore, here, the reason for showing the private part through the method of psychic manifestation is clarified by the passage from the Milindapañhā.
Với điều này, sự tham chiếu đến bản Paḷi “tathārūpaṃ iddhābhisaṅkhāraṃ abhisaṅkharī” và các từ tiếp theo, và do đó, ở đây, lý do chỉ ra bộ phận kín đáo cùng với phương pháp tạo ra thần thông được giải thích bằng đoạn Milindapañhā.
Keci pana ‘‘vatthaguyhadassane’’ti parāmasanti, tadayuttameva.
Some, however, refer to "vatthaguyhadassane" (in showing the private part), but that is incorrect.
Một số người lại tham chiếu đến “vatthaguyhadassane”, điều đó hoàn toàn không phù hợp.
Na hi taṃ pāḷiyaṃ, aṭṭhakathāyañca atthi, yaṃ evaṃ parāmasitabbaṃ siyā, iddhābhisaṅkhāranayo ca avibhāvito hoti.
For it is not found in the Pali or the Aṭṭhakathā such that it should be referenced this way, and the method of psychic manifestation would remain unexplained.
Thật vậy, điều đó không có trong bản Paḷi và cũng không có trong các bản chú giải, điều gì có thể được tham chiếu như vậy, và phương pháp tạo ra thần thông cũng không được giải thích rõ ràng.
Kimettha aññena vattabbaṃ catupaṭisambhidāpattena chaḷabhiññena vādīvarena bhadantanāgasenattherena vuttanayeneva sampaṭicchitabbattā.
Kimettha aññena vattabbaṃ? What else needs to be said here? It should be accepted according to the method explained by the Venerable Nāgasena Thera, who attained the four analytical knowledges (paṭisambhidā) and the six higher knowledges (abhiññā), and was supreme among debaters.
Kimettha aññena vattabbaṃ (cần nói gì thêm ở đây?) bởi vì điều đó cần được chấp nhận theo cách đã được nói bởi Đại Trưởng lão Bhaddanta Nāgasena, một bậc luận sư tối thượng, người đã đạt được Tứ Vô Ngại Giải và Lục Thông.
Hirī karīyate etthāti hirikaraṇaṃ, tadeva okāso tathā, hiriyitabbaṭṭhānaṃ.
Hirikaraṇaṃ is where shame is made; that very place is the occasion, a place to be ashamed of.
Hirikaraṇaṃ là nơi mà sự hổ thẹn được tạo ra, đó chính là cơ hội, là nơi cần phải hổ thẹn.
Uttarassāti suttanipāte āgatassa uttaramāṇavassa (ma. ni. 2.384).
Uttarassā refers to Uttarāmāṇava, mentioned in the Suttanipāta.
Uttarassā là của thanh niên Uttara, người được đề cập trong Suttanipāta.
Sabbesampi cetesaṃ vatthu suttanipātato gahetabbaṃ.
The story of all of them should be taken from the Suttanipāta.
Câu chuyện về tất cả những người này nên được lấy từ Suttanipāta.
821
Chāyanti paṭibimbaṃ.
Chāyaṃ means a reflection.
Chāyaṃ là hình ảnh phản chiếu.
Kathaṃ dassesi, kīdisaṃ vāti āha ‘‘iddhiyā’’tiādi.
How did he show it, and what kind of thing? He says, "by psychic power," and so on.
Làm thế nào Ngài đã thể hiện, hay là loại hình dáng nào, đã được nói đến bắt đầu bằng “iddhiyā” (thần thông).
Chāyārūpakamattanti bhagavato paṭibimbarūpakameva, na pakativatthaguyhaṃ, tañca buddhasantānato vinimuttattā rūpakamattaṃ bhagavatā sadisavaṇṇasaṇṭhānāvayavaṃ iddhimayaṃ bimbakameva hoti, evañca katvā appakatthena ka-kārena visesitavacanaṃ upapannaṃ hoti.
Chāyārūpakamattaṃ means merely a reflection-image of the Blessed One, not a natural, hidden object; and because it is distinct from the Buddha's continuum, it is merely an image, a magically created likeness of the Blessed One, similar in color, form, and features. And having done so, the word qualified by the suffix -ka, indicating smallness, becomes appropriate.
Chāyārūpakamatta (chỉ là một hình bóng) là chỉ hình ảnh phản chiếu của Đức Thế Tôn, không phải bộ phận kín đáo tự nhiên. Và hình bóng đó, do tách rời khỏi dòng dõi của Đức Phật, chỉ là một hình ảnh giống Đức Thế Tôn về màu sắc, hình dạng và các bộ phận, là một pho tượng được tạo ra bằng thần thông. Và khi làm như vậy, từ ngữ được đặc biệt hóa bằng âm tiết ‘ka’ với nghĩa nhỏ bé trở nên hợp lý.
Chāyārūpakamattaṃ iddhiyā abhisaṅkharitvā dassesīti sambandho.
The connection is that he created merely a reflection-image by psychic power and showed it.
Sự liên kết là: Ngài đã tạo ra và thể hiện một hình bóng bằng thần thông.
‘‘Taṃ pana dassento bhagavā yathā attano buddharūpaṃ na dissati, tathā katvā dassetī’’ti (dī. ni. ṭī. 1.288) ācariyā vadanti.
"However, in showing it, the Blessed One showed it in such a way that his own Buddha-form was not seen," say the teachers.
Các bậc thầy nói rằng: “Đức Thế Tôn khi thể hiện điều đó, Ngài đã làm cho hình tướng Phật của chính mình không bị nhìn thấy, và đã thể hiện như vậy.”
Tadetaṃ bhadantanāgasenattherena vuttena iddhābhisaṅkhatachāyārūpakamattadassanavacanena saṃsandati ceva sameti ca yathā taṃ ‘‘khīrena khīraṃ, gaṅgodakena yamunodaka’’nti daṭṭhabbaṃ.
This statement of the teachers corresponds and agrees with the venerable Nāgasena Thera's saying about showing merely an illusory form created by psychic power, just as milk with milk, or the water of the Gaṅgā with the water of the Yamunā. This should be understood.
Điều này tương ứng và phù hợp với lời nói của Trưởng lão Bhaddanta Nāgasena về việc thể hiện một hình bóng được tạo ra bằng thần thông, giống như “sữa với sữa, nước sông Hằng với nước sông Yamunā” vậy.
Tathāvacaneneva hi sesabuddharūpassa taṅkhaṇe adassitabhāvo atthato āpanno hoti.
For by that very statement, the non-display of the remaining parts of the Buddha's body at that moment is implied in meaning.
Thật vậy, chỉ bằng lời nói đó, việc không thể hiện các hình tướng Phật còn lại vào lúc đó đã được ngụ ý.
Nivāsananivatthatādivacanena panettha buddhasantānato vinimuttassapi chāyārūpakassa nivāsanādiabahigatabhāvo dassito, na ca codetabbaṃ ‘‘kathaṃ nivāsanādiantaragataṃ chāyārūpakaṃ bhagavā dasseti, kathañca ambaṭṭho passatī’’ti.
Here, by the statement concerning the wearing of the lower robe, etc., it is shown that the illusory form, even though separate from the Buddha's continuum, was not outside the lower robe, etc. And one should not ask, "How did the Blessed One show an illusory form that was within the lower robe, etc., and how did Ambaṭṭha see it?"
Ở đây, bằng lời nói về y phục đã mặc, v.v., đã chỉ ra rằng hình bóng, dù tách rời khỏi dòng dõi của Đức Phật, vẫn có y phục, v.v., và không nên thắc mắc rằng: “Làm thế nào Đức Thế Tôn thể hiện hình bóng có y phục, v.v., và làm thế nào Ambaṭṭha thấy được?”
Acinteyyo hi iddhivisayoti.
For the domain of psychic power is inconceivable.
Vì lĩnh vực thần thông là không thể nghĩ bàn.
Chāyaṃ diṭṭheti chāyāya diṭṭhāya.
Chāyaṃ diṭṭheti means, when the illusory form was seen.
Chāyaṃ diṭṭhe có nghĩa là khi hình bóng được thấy.
Etanti chāyārūpakaṃ.
Etanti refers to the illusory form.
Etaṃ (này) là hình bóng.
Bujjhanake sati jīvitanimittampi hadayamaṃsaṃ dasseyyāti adhippāyo.
The intention is that if there is one to be awakened, he would even show the heart-flesh, which is a sign of life.
Ý nghĩa là: nếu có người có thể giác ngộ, Ngài sẽ thể hiện cả trái tim (hadayamaṃsaṃ), là dấu hiệu của sự sống.
Ninnetvāti nīharitvā.
Ninnetvāti means, having drawn out.
Ninnetvā có nghĩa là rút ra.
Ayameva vā pāṭho.
Or this is the reading itself.
Hoặc đây là một cách đọc khác.
Kallosīti vissajjane tvaṃ kusalo cheko asi, yathāvutto vā vissajjanāmaggo upapanno yutto asīti attho.
Kallosīti means, "You are skillful and adept in answering," or "the method of answering as stated is appropriate and fitting."
Kallosī có nghĩa là ngươi khéo léo, thành thạo trong việc giải đáp, hoặc con đường giải đáp đã nói là hợp lý, thích đáng.
‘‘Kusalo’’ti keci paṭhanti, ayuttametaṃ.
Some read "kusalo" (skillful), but this is inappropriate.
Một số người đọc là “kusalo” (khéo léo), điều này không phù hợp.
Milindapañhe hi sabbattha vissajjanāvasāne ‘‘kallo’’ icceva diṭṭhoti.
For in the Milindapañha, "kallo" is seen everywhere at the end of an answer.
Vì trong Milindapañha, ở cuối mỗi câu trả lời, luôn thấy chữ “kallo” (khéo léo) mà thôi.
822
Ninnāmetvāti mukhato nīharaṇavasena kaṇṇasotādiabhimukhaṃ paṇāmetvā, adhippāyameva dassetuṃ ‘‘nīharitvā’’ti vuttaṃ.
Ninnāmetvāti means, having extended it forth from the mouth towards the ear-canal, etc. The word "nīharitvā" was said merely to show the intention.
Ninnāmetvā có nghĩa là đưa ra khỏi miệng và hướng về phía tai, v.v. Để chỉ rõ ý nghĩa, đã nói “nīharitvā” (rút ra).
Kathinasūciṃ viyāti ghanasukhumabhāvāpādanena kakkhaḷasūcimiva katvā.
Kathinasūciṃ viyāti means, having made it like a hard needle by making it dense and fine.
Kathinasūciṃ viyā (như một cây kim cứng) là làm cho nó trở nên cứng rắn như một cây kim cứng bằng cách làm cho nó dày đặc và tinh tế.
Tathākaraṇenāti kathinasūciṃ viya karaṇena.
Tathākaraṇenāti means, by making it like a hard needle.
Tathākaraṇenā (bằng cách làm như vậy) là bằng cách làm cho nó như một cây kim cứng.
Etthāti pahūtajivhāya.
Etthāti refers to the abundant tongue.
Etthā (ở đây) là trên cái lưỡi rộng lớn.
Mudubhāvo, dīghabhāvo, tanubhāvo ca dassito amuduno ghanasukhumabhāvāpādanatthamasakkuṇeyyattāti ācariyena (dī. ni. ṭī. 1.288) vuttaṃ.
The teacher has stated that softness, length, and thinness are shown because a non-soft tongue cannot be made dense and fine.
Các bậc thầy nói rằng (dī. ni. ṭī. 1.288): “ Tính mềm mại, tính dài, và tính mỏng đã được thể hiện, vì lưỡi không mềm mại thì không thể làm cho nó dày đặc và tinh tế.”
Tatrāyamadhippāyo – yasmā mudumeva ghanasukhumabhāvāpādanatthaṃ sakkoti, tasmā tathākaraṇena mudubhāvo dassito aggi viya dhūmena.
The intention here is this: since only a soft tongue can be made dense and fine, its softness is shown by making it so, like fire by smoke.
Ở đây, ý nghĩa là: bởi vì chỉ có cái mềm mại mới có thể làm cho nó dày đặc và tinh tế, nên bằng cách làm như vậy, tính mềm mại đã được thể hiện, giống như lửa được thể hiện qua khói.
Yasmā ca muduyeva ghanasukhumabhāvāpajjanena dīghagāmi, tasmā kaṇṇasotānumasanena dīghabhāvo dassito.
And since only a soft tongue becomes long by becoming dense and fine, its length is shown by touching the ear-canal.
Và bởi vì chỉ có cái mềm mại, khi trở nên dày đặc và tinh tế, mới có thể kéo dài, nên bằng cách chạm vào lỗ tai, tính dài đã được thể hiện.
Yasmā pana mudu eva ghanasukhumabhāvāpajjanena tanu hoti, tasmā nāsikāsotānumasanena tanubhāvo dassitoti.
However, since only a soft tongue becomes thin by becoming dense and fine, its thinness is shown by touching the nostril.
Tuy nhiên, bởi vì chỉ có cái mềm mại, khi trở nên dày đặc và tinh tế, mới trở nên mỏng, nên bằng cách chạm vào lỗ mũi, tính mỏng đã được thể hiện.
Aputhulassa tathāpaṭicchādanatthamasakkuṇeyyattā nalāṭacchādanena puthulabhāvo dassito.
Its breadth is shown by covering the forehead because a non-broad tongue cannot cover it in that manner.
Tính rộng lớn đã được thể hiện bằng cách che trán, vì cái không rộng lớn thì không thể che như vậy.
823
289. Patthento hutvā udikkhantoti yojetabbaṃ.
289. It should be construed as "having desired, having looked on."
289. Phải kết hợp là: mong muốn và nhìn.
824
290. Mūlavacanaṃ kathā. Paṭivacanaṃ sallāpo.
290. The original word is kathā. The reply is sallāpo.
290. Từ gốc là kathā (câu chuyện). Câu trả lời là sallāpo (đối thoại).
825
291. ‘‘Uddhumātaka’’ntiādīsu (saṃ. ni. 5.242; visuddhi. 1.102) viya ka-saddo jigucchanatthoti vuttaṃ ‘‘tameva jigucchanto’’ti.
291. As in "uddhumātaka" and so on, the particle "ka" implies disgust, as stated in "tameva jigucchanto".
291. Như trong “uddhumātaka” (saṃ. ni. 5.242; visuddhi. 1.102), v.v., âm tiết ‘ka’ có nghĩa là ghê tởm, nên đã nói “tameva jigucchanto” (ghê tởm chính điều đó).
Tamevāti paṇḍitabhāvameva, ambaṭṭhamevātipi attho.
Tamevāti means, only his wisdom; it also means, only Ambaṭṭha.
Tamevā (chính điều đó) là chính sự thông thái, hoặc cũng có nghĩa là chính Ambaṭṭha.
Ambaṭṭhañhi sandhāya evamāha.
For he spoke thus referring to Ambaṭṭha.
Thật vậy, Ngài đã nói như vậy để chỉ Ambaṭṭha.
Tathā hi pāḷiyaṃ vuttaṃ ‘‘evaṃ…pe… ambaṭṭhaṃ māṇavaṃ etadavocā’’ti.
Indeed, it is said in the Pāḷi: "Thus...pe... he said this to the brahmin Ambaṭṭha."
Như trong kinh đã nói: “Như vậy…pe… đã nói điều này với thanh niên Ambaṭṭha.”
Kāmañca ambaṭṭhaṃ sandhāya evaṃ vuttaṃ, nāmagottavasena pana aniyamaṃ katvā garahanto puthuvacanena vadatīti veditabbaṃ.
Although it was said thus referring to Ambaṭṭha, it should be understood that he spoke with a plural word, intending to rebuke without specifying by name or lineage.
Mặc dù đã nói như vậy để chỉ Ambaṭṭha, nhưng cần phải hiểu rằng Ngài đã quở trách bằng cách dùng từ số nhiều, không cố định theo tên hay dòng họ.
‘‘Yadeva kho tva’’nti etassa aniyamavacanassa ‘‘evarūpenā’’ti idaṃ niyamavacananti dasseti ‘‘yādiso’’tiādinā.
He shows that the indefinite statement "yadeva kho tvaṃ" is made definite by "evarūpenā" through "yādiso" and so on.
Để chỉ ra rằng “evarūpenā” (với hình thức như vậy) là từ cố định của từ không cố định “yadeva kho tvaṃ” (chính điều mà ngươi), đã nói “yādiso” (loại nào), v.v.
Bhāvenabhāvalakkhaṇe bhummavacanatthe karaṇavacananti vuttaṃ ‘‘edise atthacarake’’ti.
It is stated that the instrumental case is used in the sense of the locative case, denoting a characteristic of the action (bhāvenabhāvalakkhaṇa), in "edise atthacarake".
Đã nói rằng trong trường hợp của bhāvenabhāvalakkhaṇe (dấu hiệu của trạng thái bằng trạng thái), karaṇavacanaṃ (từ chỉ công cụ) có nghĩa là bhummavacana (từ chỉ vị trí), tức là “edise atthacarake” (trong hành vi có lợi như vậy).
Na aññatrāti na aññattha sugatiyaṃ.
Na aññatrāti means, not elsewhere in a good destination.
Na aññatrā (không ở nơi khác) là không đi đến nơi tốt lành khác.
Ettha pana ‘‘atthacarakenā’’ti iminā byatirekamukhena anatthacarakataṃyeva vibhāvetīti daṭṭhabbaṃ.
Here, however, it should be understood that by "atthacarakenā," he clarifies the state of not being a benefactor through the method of exclusion.
Tuy nhiên, ở đây, bằng từ “atthacarakenā” (bằng hành vi có lợi), chỉ rõ sự không có lợi ích thông qua phương pháp phủ định.
‘‘Upaneyya upaneyyā’’ti idaṃ tvādyantaṃ vicchāvacananti āha ‘‘brāhmaṇo kho panā’’tiādi.
He says that "upaneyya upaneyyā" is a repetitive word ending in -tvā, as in "brāhmaṇo kho panā" and so on.
“Upaneyya upaneyyā” (đưa tới, đưa tới) là một từ lặp lại có đuôi tvā, nên đã nói “brāhmaṇo kho panā” (nhưng này, Bà-la-môn), v.v.
Evaṃ upanetvā upanetvāti taṃ taṃ dosaṃ upanīya upanīya.
Evaṃ upanetvā upanetvāti means, repeatedly bringing up this and that fault.
Evaṃ upanetvā upanetvā (cứ đưa tới như vậy) là cứ đưa tới từng lỗi lầm.
Tenāha ‘‘suṭṭhu dāsādibhāvaṃ āropetvā’’ti.
Therefore, he says, "suṭṭhu dāsādibhāvaṃ āropetvā".
Do đó đã nói “suṭṭhu dāsādibhāvaṃ āropetvā” (đã đặt vào tình trạng nô lệ một cách triệt để).
Pātesīti pavaṭṭanavasena pātesi.
Pātesīti means, caused to fall by rolling.
Pātesī có nghĩa là làm cho rơi xuống bằng cách khiến nó lăn đi.
Yañca agamāsi, tampi assa tathāgamanasaṅkhātaṃ ṭhānaṃ acchinditvāti yojanā.
And the place he went to, that place of his going, was also not taken away from him; this is the construction.
Và nơi mà ông ấy đã đi đến, cũng là nơi được gọi là sự đi đến như vậy của ông ấy, không bị cắt đứt. Đó là cách kết nối câu.
826
Pokkharasātibuddhūpasaṅkamanavaṇṇanā
Description of Pokkharasāti's Approach to the Buddha
Pokkharasātibuddhūpasaṅkamanavaṇṇanā
827
292-3-6. Kittako pana soti vuttaṃ ‘‘sammodanīyakathāyapi kālo natthī’’ti.
292-3-6. "How much time is there?" was said, "There is no time even for agreeable conversation."
292-3-6. Thời gian đó là bao lâu, đã được nói đến trong “sammodanīyakathāyapi kālo natthī” (ngay cả thời gian để nói chuyện xã giao cũng không có).
Āgamā nūti āgato nu.
"Āgamā nu" means, "Has he come?"
Āgamā nū (có đến không) là đã đến chưa.
Khoti nipātamattaṃ.
"Kho" is merely a particle.
Kho chỉ là một tiểu từ.
Idhāti ettha, tumhākaṃ santikanti attho.
"Idha" means "here," that is, "to you."
Idhā (ở đây) là ở đây, nghĩa là đến chỗ của quý vị.
Adhivāsetūti sādiyatu, taṃ pana sādiyanaṃ idha manasāva sampaṭiggaho, na kāyavācāhīti āha ‘‘sampaṭicchatū’’ti.
"Adhivāsetu" means "may he consent." That consent here is acceptance by mind only, not by body or speech, therefore it says "sampaṭicchatu" (may he accept).
Adhivāsetū (xin chấp thuận) là xin vui lòng chấp nhận. Sự chấp nhận đó ở đây là sự chấp nhận trong tâm, không phải bằng thân hay lời nói, nên đã nói “sampaṭicchatū” (xin chấp nhận).
Ajja pavattamānaṃ ajjatanaṃ, puññaṃ, pītipāmojjañca, imamatthaṃ dassetuṃ ‘‘yaṃ me’’tiādi vuttaṃ.
That which occurs today is "ajjatanaṃ" (today's), referring to merit and joy. To show this meaning, "yaṃ me" and so on was said.
Ajjatanaṃ (hôm nay) là điều xảy ra hôm nay, công đức và niềm hoan hỷ. Để chỉ rõ ý nghĩa này, đã nói “yaṃ me” (điều của tôi), v.v.
Kāranti upakāraṃ, sakkāraṃ vā.
"Kāraṃ" means help or respect.
Kāraṃ (sự làm) là sự giúp đỡ, hoặc sự tôn kính.
Acopetvāti acāletvā.
"Acopetvā" means "without disturbing."
Acopetvā (không lay chuyển) là không làm lay động.
828
297. ‘‘Sahatthā’’ti idaṃ karaṇatthe nissakkavacanaṃ.
297. "Sahatthā" is a word in the ablative case signifying the instrument.
297. “Sahatthā” (bằng tay mình) là một từ chỉ công cụ có nghĩa là xuất xứ.
Tenāha ‘‘sahatthenā’’ti.
Therefore, it says "sahatthena" (with his own hand).
Do đó đã nói “sahatthenā” (bằng tay mình).
Suhitanti dhātaṃ, jighacchādukkhābhāvena vā sukhitaṃ.
"Suhitaṃ" means satisfied, or happy due to the absence of the suffering of hunger.
Suhitaṃ (đã no đủ) là đã được nuôi dưỡng, hoặc đã được an lạc do không còn khổ đau của đói khát.
Yāvadatthanti yāva attho, tāva bhojanena tadā kataṃ.
"Yāvadatthaṃ" means "as much as desired," that is, it was done with food to that extent at that time.
Yāvadatthaṃ (đủ theo ý muốn) là đã ăn đủ theo ý muốn vào lúc đó.
Paṭikkhepapavāraṇāvettha adhippetā, na nimantanapavāraṇāti āha ‘‘ala’’ntiādi.
Here, refusal-invitation is intended, not invitation-invitation, therefore it says "alaṃ" and so on.
Ở đây, ý muốn nói đến sự từ chối, không phải sự mời gọi, nên đã nói “ala” (đủ rồi), v.v.
‘‘Hatthasaññāyā’’ti nidassanamattaṃ aññattha mukhavikārena, vacībhedena ca paṭikkhepassa vuttattā, ekakkhaṇepi ca tathāpaṭikkhepassa labbhanato.
"Hatthasaññāya" is merely an illustration, because refusal is stated elsewhere as being by facial expression and vocal utterance, and because such refusal can be obtained even in a single moment.
“Hatthasaññāyā” (bằng cử chỉ tay) chỉ là một ví dụ, vì ở nơi khác, sự từ chối đã được nói đến bằng cách thay đổi nét mặt và lời nói, và cũng có thể từ chối như vậy trong một khoảnh khắc.
Onītā pattato pāṇi etassāti onītapattapāṇīti bhinnādhikaraṇavisayo tipado bāhiratthasamāso.
"He whose hand is removed from the bowl" is "onītapattapāṇī", a three-word compound with a separate referent, an external meaning compound.
Onītapattapāṇī (người đã rửa tay và bát) là một từ ghép ba từ có đối tượng khác nhau, có nghĩa là: tay của người ấy đã được lấy ra khỏi bát. Đó là một bāhiratthasamāsa (từ ghép chỉ ý nghĩa bên ngoài).
Muddhajaṇa-kārena, pana saññogata-kārena ca oṇittasaddo vinābhūteti dasseti ‘‘oṇittapattapāṇintipi pāṭho’’tiādinā.
It shows that the word "oṇitta" is without the palatal 'ṇa' and the conjunct 'tta' by saying "oṇittapattapāṇinti pi pāṭho" (the reading is also oṇittapattapāṇi) and so on.
Tuy nhiên, để chỉ ra rằng từ oṇitta không có âm mũi ṇa và âm kép tta, đã nói “oṇittapattapāṇintipi pāṭho” (cũng có cách đọc oṇittapattapāṇi), v.v.
Sucikaraṇatthe vā oṇittasaddo.
Or the word "oṇitta" is used in the sense of purifying.
Hoặc từ oṇitta có nghĩa là làm sạch.
Oṇittaṃ āmisāpanayanena sucikataṃ pattaṃ pāṇi ca assāti hi oṇittapattapāṇi. Tenāha ‘‘hatthe ca pattañca dhovitvā’’ti.
For it is "oṇittapattapāṇi" because his bowl and hand are purified by the removal of food. Therefore, it says "hatthe ca pattañca dhovitvā" (having washed the hand and the bowl).
Vì người ấy có bát và tay đã được làm sạch bằng cách loại bỏ thức ăn, nên gọi là oṇittapattapāṇi. Do đó đã nói “hatthe ca pattañca dhovitvā” (đã rửa tay và bát).
‘‘Oṇittaṃ nānābhūtaṃ vinābhūtaṃ, āmisāpanayanena vā sucikataṃ pattaṃ pāṇito assāti oṇittapattapāṇī’’ti (sārattha. ṭī. 1.23) sāratthadīpaniyaṃ vuttaṃ.
In the Sāratthadīpanī it is said: "oṇittaṃ nānābhūtaṃ vinābhūtaṃ, āmisāpanayanena vā sucikataṃ pattaṃ pāṇito assāti oṇittapattapāṇī" (oṇitta means separated, detached, or his bowl is purified by the removal of food from his hand, hence oṇittapattapāṇī).
Trong Sāratthadīpanī đã nói: “Oṇittaṃ (đã được lấy ra) là khác biệt, tách rời, hoặc bát đã được làm sạch bằng cách loại bỏ thức ăn, và tay của người ấy đã được lấy ra khỏi bát, nên gọi là oṇittapattapāṇī.”
Tattha pacchimavacanaṃ ‘‘hatthe ca pattañca dhovitvā’’ti iminā asaṃsandanato vicāretabbaṃ.
There, the latter statement ("having purified the bowl by the removal of food") should be considered, as it does not correspond with "having washed the hand and the bowl."
Trong đó, câu cuối cùng cần được xem xét vì nó không khớp với “hatthe ca pattañca dhovitvā” (đã rửa tay và bát).
Evaṃbhūtanti ‘‘bhuttāviṃ onītapattapāṇi’’nti vuttappakārena bhūtaṃ.
"Evaṃbhūtaṃ" means "being of the kind described as 'bhuttāviṃ onītapattapāṇi'" (having eaten, with hand removed from the bowl).
Evaṃbhūtaṃ (như vậy) là đã trở thành như đã nói: “đã ăn xong, đã rửa tay và bát.”
829
298. Anupubbiṃ kathanti anupubbaṃ kathetabbaṃ kathaṃ.
298. "Anupubbiṃ kathā" refers to a discourse that is to be spoken in due order.
298. Anupubbiṃ katha có nghĩa là bài pháp thoại cần được thuyết giảng theo thứ tự.
Tenāha ‘‘anupaṭipāṭikatha’’nti.
Therefore, he said, "sequential discourse."
Do đó,* đã nói “anupaṭipāṭikatha” (bài pháp thoại theo thứ tự).
Kā pana sāti āha ‘‘dānānantaraṃ sīla’’ntiādi, tenāyamattho bodhito hoti – dānakathā tāva pacurajanesupi pavattiyā sabbasādhāraṇattā, sukarattā, sīle patiṭṭhānassa upāyabhāvato ca ādito kathetabbā.
When asked what that is, he said, "After generosity, morality," and so on. By this, the following meaning is understood: First, the discourse on generosity (dānakathā) should be taught because it is common to all people, even those with limited intelligence, due to its prevalence and ease of practice, and because it is a means for establishing oneself in morality.
“Đó là gì?” –* đã nói “sau bố thí là giới luật” v.v., do đó ý nghĩa này được hiểu là: bài pháp thoại về bố thí (dānakathā) cần được thuyết giảng trước tiên, vì nó phổ biến đối với nhiều người, dễ thực hành, và là phương tiện để thiết lập giới luật.
Pariccāgasīlo hi puggalo pariggahavatthūsu vinissaṭabhāvato sukheneva sīlāni samādiyati, tattha ca suppatiṭṭhito hoti, sīlena dāyakapaṭiggāhakasuddhito parānuggahaṃ vatvā parapīḷānivattivacanato, kiriyadhammaṃ vatvā akiriyadhammavacanato, bhogasampattihetuṃ vatvā bhavasampattihetuvacanato ca dānakathānantaraṃ sīlakathā kathetabbā.
Indeed, a person endowed with the virtue of relinquishing possessions, being detached from objects of attachment, easily undertakes the moral precepts (sīlāni) and is well-established in them. Therefore, after the discourse on generosity, the discourse on morality (sīlakathā) should be taught, by speaking of benefiting others through the purity of the giver and the recipient, by speaking of desisting from harming others, by speaking of active wholesome kamma while speaking of inactive unwholesome kamma, and by speaking of the cause of prosperity in this life while speaking of the cause of prosperity in future existences.
Một người có giới hạnh bố thí (pariccāgasīlo) dễ dàng thọ trì giới luật vì họ đã thoát ly khỏi những vật sở hữu, và họ được thiết lập vững chắc trong giới luật. Sau bài pháp thoại về bố thí, bài pháp thoại về giới luật cần được thuyết giảng, vì giới luật giúp thanh tịnh cả người cho và người nhận, đề cập đến việc không làm hại người khác, nói về pháp hành (kiriyadhamma) thay vì pháp bất hành (akiriyadhamma), và nói về nguyên nhân của sự giàu sang (bhogasampattihetu) thay vì nguyên nhân của sự thành tựu trong các cõi giới (bhavasampattihetu).
Tañce dānasīlaṃ vaṭṭanissitaṃ, ayaṃ bhavasampatti tassa phalanti dassanatthaṃ sīlakathānantaraṃ saggakathā. Tāya hi evaṃ dassitaṃ hoti ‘‘imehi dānasīlamayehi, paṇītapaṇītatarādibhedabhinnehi ca puññakiriyavatthūhi etā cātumahārājikādīsu paṇītapaṇītatarādibhedabhinnā aparimeyyā dibbasampattiyo laddhabbā’’ti.
If that generosity and morality are rooted in saṃsāra, and this prosperity in existence is their fruit, then to show this, after the discourse on morality, the discourse on heaven (saggakathā)*. Through this, it is shown that "by these meritorious deeds consisting of generosity and morality, and by these various kinds of meritorious actions, such as those that are excellent and extremely excellent, these immeasurable divine prosperities, excellent and extremely excellent, in the Cātumahārājika heavens and so forth, are to be attained."
Nếu sự bố thí và giới luật đó liên quan đến vòng luân hồi (vaṭṭanissitaṃ), và sự thành tựu trong các cõi giới này là quả của nó, để chỉ ra điều đó, sau bài pháp thoại về giới luật là bài pháp thoại về cõi trời (saggakathā). Qua đó, điều này được chỉ ra: “Với những việc làm phước thiện như bố thí và giữ giới, và những việc làm phước thiện khác thuộc các loại cao thượng hơn, vô số những sự giàu sang của chư thiên (dibbasampattiyo) thuộc các cõi Tứ Đại Thiên Vương (Cātumahārājika) v.v., thuộc các loại cao thượng hơn, sẽ đạt được.”
Svāyaṃ saggo rāgādīhi upakkiliṭṭho, sabbathā pana tehi anupakkiliṭṭho ariyamaggoti dassanatthaṃ saggakathānantaraṃ maggakathā. Maggañca kathentena tadadhigamupāyadassanatthaṃ kāmānaṃ ādīnavo, okāro, saṃkileso, nekkhamme ānisaṃso ca kathetabbo.
This heaven is defiled by lust (rāga) and other defilements. However, the Noble Path (ariyamagga) is entirely undefiled by them; to show this, after the discourse on heaven, the discourse on the Path (maggakathā)*. And in expounding the Path, to demonstrate the means of its attainment, the dangers (ādīnava), degradation (okāra), and defilement (saṃkilesa) of sensual pleasures (kāma), and the benefit (ānisaṃsa) of renunciation (nekkhamma) should be explained.
Cõi trời đó bị ô nhiễm bởi tham ái (rāga) v.v., nhưng Bát Chánh Đạo (ariyamagga) thì hoàn toàn không bị ô nhiễm bởi chúng, để chỉ ra điều đó, sau bài pháp thoại về cõi trời là bài pháp thoại về Đạo (maggakathā). Khi thuyết giảng về Đạo, cần phải nói về sự nguy hiểm (ādīnava), sự thấp kém (okāra), sự ô nhiễm (saṃkilesa) của các dục lạc (kāmānaṃ), và lợi ích (ānisaṃso) của sự xuất ly (nekkhamme) để chỉ ra phương tiện đạt được Đạo.
Saggapariyāpannāpi hi sabbe kāmā nāma bahvādīnavā aniccā addhuvā vipariṇāmadhammā, pageva itareti ādīnavo, sabbepi kāmā hīnā gammā pothujjanikā anariyā anatthasaṃhitāti lāmakabhāvo okāro, sabbepi bhavā kilesānaṃ vatthubhūtāti saṃkileso, sabbasaṃkilesavippayuttaṃ nibbānanti nekkhamme ānisaṃso ca kathetabboti.
Indeed, all sensual pleasures, even those included in heavenly realms, are fraught with many dangers, impermanent, transient, and subject to change—how much more so are other (lower) sensual pleasures! This is the danger (ādīnava). All sensual pleasures are base, vulgar, common, ignoble, and conducive to harm; this lowliness is the degradation (okāra). All existences are the basis for defilements; this is the defilement (saṃkilesa). Nibbāna is completely disassociated from all defilements; this is the benefit of renunciation (nekkhamma). These should be taught.
Tất cả các dục lạc, dù thuộc về cõi trời, đều có nhiều nguy hiểm, vô thường, không bền vững, và có bản chất biến đổi – huống chi những dục lạc khác! – đó là sự nguy hiểm (ādīnava). Tất cả các dục lạc đều thấp kém, thô tục, thuộc về phàm phu, không cao thượng, không mang lại lợi ích – đó là sự thấp kém (okāra). Tất cả các cõi hữu đều là nền tảng của các phiền não – đó là sự ô nhiễm (saṃkileso). Niết Bàn là thoát ly khỏi mọi ô nhiễm – đó là lợi ích của sự xuất ly (nekkhamme ānisaṃso) – điều này cần được thuyết giảng.
Ayampi attho bodhitoti veditabbo.
It should be understood that this meaning is also made clear.
Ý nghĩa này cũng cần được hiểu.
Maggoti hi ettha iti-saddena ādyatthena kāmādīnavādīnampi saṅgahoti ayamatthavaṇṇanā katā.
Here, in "maggo", the particle "iti" with the meaning of "beginning with" implies the inclusion of the dangers of sensual pleasures and so forth; thus, this explanation of the meaning has been made.
Ở đây, trong từ Maggo (Đạo), với từ iti (như vậy) mang ý nghĩa khởi đầu, sự tập hợp các nguy hiểm của dục lạc v.v. cũng được bao gồm, do đó sự giải thích ý nghĩa này đã được thực hiện.
Tenāha ‘‘seyyathidaṃ – dānakathaṃ sīlakathaṃ saggakathaṃ kāmānaṃ ādīnavaṃ okāraṃ saṃkilesaṃ nekkhamme ānisaṃsaṃ pakāsetī’’ti.
Therefore, he said, "He reveals the discourse on generosity, the discourse on morality, the discourse on heaven, the dangers of sensual pleasures, their degradation, their defilement, and the benefit of renunciation."
Do đó,* đã nói: “Đó là,* thuyết giảng về bài pháp thoại bố thí, bài pháp thoại giới luật, bài pháp thoại cõi trời, sự nguy hiểm của các dục lạc, sự thấp kém, sự ô nhiễm, và lợi ích của sự xuất ly.”
Vitthāro sāratthadīpaniyaṃ (sārattha. ṭī. 3.26) gahetabbo.
The extensive explanation should be taken from the Sāratthadīpanī.
Chi tiết có thể tìm thấy trong Sāratthadīpanī.
830
Kasi-saddo ñāṇena gahaṇeti āha ‘‘gahitā’’tiādi.
The word kasi means grasping with knowledge; therefore, he said, "understood," and so on.
Từ kasi (cày cấy) có nghĩa là nắm bắt bằng trí tuệ, nên* nói “gahitā” (đã nắm bắt) v.v.
Sāmaṃsaddena nivattetabbamatthaṃ dasseti ‘‘asādhāraṇā aññesa’’nti iminā, lokuttaradhammādhigame parūpadesavigatattā, ekeneva loke paṭhamaṃ anuttarāya sammāsambodhiyā abhisambuddhattā ca aññesamasādhāraṇāti vuttaṃ hoti.
By the word sāmaṃ (by oneself), the meaning to be negated is shown by "not common to others," which means that in the attainment of supramundane qualities, being devoid of instruction from others, and having first fully awakened to unsurpassed perfect enlightenment by oneself in the world, these are not common to others.
Với từ sāmaṃ (tự mình),* chỉ ra ý nghĩa cần được loại bỏ bằng câu “không phổ biến đối với người khác”; điều này có nghĩa là sự chứng đắc các pháp siêu thế (lokuttaradhamma) không cần sự chỉ dạy của người khác, và vì chỉ có một mình* đã tự mình giác ngộ Vô Thượng Chánh Đẳng Chánh Giác (anuttarāya sammāsambodhiyā) đầu tiên trên thế gian, nên nó không phổ biến đối với người khác.
Dhammacakkhunti ettha sotāpattimaggova adhippeto, na brahmāyusutte (ma. ni. 2.383 ādayo) viya heṭṭhimā tayo maggā, na ca cūḷarāhulovādasutte (ma. ni. 3.416) viya āsavakkhayo.
Here, dhammacakkhu means the Sotāpatti-magga itself, not the lower three paths as in the Brahmāyu Sutta, nor the destruction of the taints (āsavakkhaya) as in the Cūḷarāhulovāda Sutta.
Trong cụm từ Dhammacakkhu (Pháp nhãn) ở đây, chỉ có Sơ quả Đạo (Sotāpattimagga) được đề cập, không phải ba Đạo thấp hơn như trong kinh Brahmāyu (Ma. Ni. 2.383 v.v.), cũng không phải sự đoạn trừ các lậu hoặc (āsavakkhayo) như trong kinh Cūḷarāhulovāda (Ma. Ni. 3.416).
‘‘Tassa uppattiākāradassanattha’’nti kasmā vuttaṃ, nanu maggañāṇaṃ asaṅkhatadhammārammaṇameva, na saṅkhatadhammārammaṇanti codanaṃ sodhento ‘‘tañhī’’tiādimāha.
Why was it said, "to show the manner of its arising"? Is not Path-knowledge solely concerned with the unconditioned Dhamma, and not with the conditioned Dhamma? Resolving this question, he says, "For that indeed," and so on.
Tại sao lại nói “để chỉ ra cách thức phát sinh của nó”? Chẳng lẽ trí tuệ Đạo (maggañāṇaṃ) chỉ lấy pháp vô vi (asaṅkhatadhamma) làm đối tượng, chứ không lấy pháp hữu vi (saṅkhatadhamma) làm đối tượng hay sao? Để giải quyết câu hỏi này,* nói “tañhi” (vì điều đó) v.v.
Kiccavasenāti asammohapaṭivedhakiccavasena.
"Kiccavasena" means in the sense of the function of unimpeded penetration.
Kiccavasenā (theo chức năng) có nghĩa là theo chức năng của sự thấu hiểu không lầm lạc (asammohapaṭivedhakiccavasena).
Next Page →