Table of Contents

Mahāvagga-aṭṭhakathā

Edit
27
Bodhiparicchedavaṇṇanā
Description of the Enlightenment Division
Giải thích về sự phân định Bồ-đề
28
8. Bodhiparicchede pana pāṭaliyā mūleti pāṭalirukkhassa heṭṭhā.
8. In the section on enlightenment, " at the root of the Pāṭalī tree" means beneath the Pāṭalī tree.
8. Trong phần phân định Bồ-đề, pāṭaliyā mūle có nghĩa là dưới gốc cây pāṭali.
Tassā pana pāṭaliyā khandho taṃ divasaṃ paṇṇāsaratano hutvā abbhuggato, sākhā paṇṇāsaratanāti ubbedhena ratanasataṃ ahosi.
The trunk of that Pāṭalī tree had risen fifty cubits on that day, and its branches were fifty cubits, making its total height one hundred cubits.
Thân cây pāṭali đó vào ngày ấy đã vươn cao năm mươi ratana, các cành cũng năm mươi ratana, tổng cộng chiều cao là một trăm ratana.
Taṃ divasañca sā pāṭali kaṇṇikābaddhehi viya pupphehi mūlato paṭṭhāya ekasañchannā ahosi, dibbagandhaṃ vāyati.
And on that day, that Pāṭalī was entirely covered with flowers, as if strung on a garland, from its root upwards, emitting a divine fragrance.
Vào ngày đó, cây pāṭali ấy được bao phủ hoàn toàn bởi hoa từ gốc lên, như thể được kết bằng những bông hoa cài vào tai, và tỏa ra hương thơm của chư thiên.
Na kevalañca tadā ayameva pupphitā, dasasahassacakkavāḷe sabbapāṭaliyo pupphitā.
And it was not only this tree that bloomed then; all Pāṭalī trees in the ten-thousand-world system bloomed.
Không chỉ riêng cây này nở hoa vào lúc đó, mà tất cả các cây pāṭali trong mười ngàn thế giới cũng đều nở hoa.
Na kevalañca pāṭaliyo, dasasahassacakkavāḷe sabbarukkhānaṃ khandhesu khandhapadumāni, sākhāsu sākhāpadumāni, latāsu latāpadumāni, ākāse ākāsapadumāni pupphitāni, pathavitalaṃ bhinditvāpi mahāpadumāni uṭṭhitāni.
And not only the Pāṭalī trees, but in the ten-thousand-world system, lotus flowers bloomed on the trunks of all trees (khandhapadumāni), lotus flowers on their branches (sākhāpadumāni), lotus flowers on creepers (latāpadumāni), and lotus flowers in the sky (ākāsapadumāni). Great lotus flowers also sprang up, piercing the surface of the earth.
Không chỉ riêng cây pāṭali, mà trong mười ngàn thế giới, trên thân của tất cả các cây đều có hoa sen thân cây, trên cành có hoa sen cành cây, trên dây leo có hoa sen dây leo, trên không trung có hoa sen không trung, và những bông hoa sen lớn cũng mọc lên xuyên qua mặt đất.
Mahāsamuddopi pañcavaṇṇehi padumehi nīluppalarattuppalehi ca sañchanno ahosi.
The great ocean also became completely covered with five-colored lotuses, and blue and red water lilies.
Đại dương cũng được bao phủ hoàn toàn bởi những đóa sen paduma năm màu, cùng với sen xanh (nīluppala) và sen đỏ (rattuppala).
Sakaladasasahassacakkavāḷaṃ dhajamālākulaṃ tattha tattha nibaddhapupphadāmavissaṭṭhamālāguḷavippakiṇṇaṃ nānāvaṇṇakusumasamujjalaṃ nandanavanacittalatāvanamissakavanaphārusakavanasadisaṃ ahosi.
The entire ten-thousandfold world-system was confused with rows of banners and flags, here and there hanging, adorned with flower garlands, scattered balls of flowers of various kinds, shining brilliantly with flowers of diverse colors, and was like the Nandanavana, Cittalatāvana, Missakavana, and Phārusakavana forests.
Toàn bộ mười nghìn thế giới (cakkavāḷa) trở nên hỗn loạn với những chuỗi cờ và biểu ngữ; ở đây và ở đó, những vòng hoa được kết, những bó hoa được ném ra, trộn lẫn với nhiều loại hoa rực rỡ sắc màu khác nhau, tỏa sáng rực rỡ, giống như khu vườn Nandanavana, khu rừng Cittalatāvana, khu rừng Missakavana và khu rừng Phārusakavana.
Puratthimacakkavāḷamukhavaṭṭiyaṃ ussitaddhajā pacchimacakkavāḷamukhavaṭṭiṃ abhihananti.
At the eastern world-system's rim, the raised banners and flags touched the western world-system's rim.
Những lá cờ được dựng lên ở vành ngoài của thế giới phía Đông đập vào vành ngoài của thế giới phía Tây.
Pacchimadakkhiṇauttaracakkavāḷamukhavaṭṭiyaṃ ussitaddhajā dakkhiṇacakkavāḷamukhavaṭṭiṃ abhihananti.
At the western, southern, and northern world-system's rims, the raised banners and flags touched the southern world-system's rim.
Những lá cờ được dựng lên ở vành ngoài của thế giới phía Tây, phía Nam và phía Bắc đập vào vành ngoài của thế giới phía Nam.
Evaṃ aññamaññasirīsampattāni cakkavāḷāni ahesuṃ.
Thus, the world-systems possessed mutual splendor.
Như vậy, các thế giới (cakkavāḷa) đã đạt được vẻ đẹp lộng lẫy lẫn nhau.
Abhisambuddhoti sakalaṃ buddhaguṇavibhavasiriṃ paṭivijjhamāno cattāri saccāni abhisambuddho.
Abhisambuddho: having fully comprehended the entire splendor of the Buddha-qualities, he fully comprehended the Four Noble Truths.
Abhisambuddho (Giác ngộ hoàn toàn) có nghĩa là đã giác ngộ hoàn toàn Tứ Diệu Đế, thấu suốt toàn bộ sự huy hoàng của các phẩm chất của một vị Phật.
29
‘‘Sikhī, bhikkhave, bhagavā arahaṃ sammāsambuddho puṇḍarīkassa mūle abhisambuddho’’tiādīsupi imināva nayena padavaṇṇanā veditabbā.
In passages like, "Sikhī, bhikkhus, the Blessed One, Arahant, Perfectly Self-Awakened One, was fully awakened at the root of a Puṇḍarīka tree," the explanation of terms should be understood in the same manner.
Trong các đoạn kinh như: ‘‘Này các Tỳ-khưu, Thế Tôn Sikhī, bậc A-la-hán, Chánh Đẳng Giác, đã giác ngộ hoàn toàn dưới gốc cây puṇḍarīka’’, thì sự giải thích từ ngữ cũng nên được hiểu theo cách này.
Ettha pana puṇḍarīkoti setambarukkho.
Here, however, Puṇḍarīka means a white mango tree.
Ở đây, puṇḍarīka là cây xoài trắng.
Tassāpi tadeva parimāṇaṃ.
Its measure was also the same.
Kích thước của nó cũng vậy.
Taṃ divasañca sopi dibbagandhehi pupphehi susañchanno ahosi.
And on that day, it too was well-covered with divine fragrant flowers.
Vào ngày đó, cây ấy cũng được bao phủ hoàn toàn bởi những bông hoa có hương thơm thần thánh.
Na kevalañca pupphehi, phalehipi sañchanno ahosi.
Not only with flowers, but also with fruits it was covered.
Không chỉ có hoa, mà cây ấy còn được bao phủ bởi những quả.
Tassa ekato taruṇāni phalāni, ekato majjhimāni phalāni, ekato nātipakkāni phalāni, ekato supakkāni pakkhittadibbojāni viya surasāni olambanti.
On one side of it hung tender fruits, on another side medium fruits, on another side not-yet-ripe fruits, and on another side well-ripened fruits, delicious as if divine essence had been placed within them.
Ở một bên của cây, những quả non; ở một bên, những quả vừa; ở một bên, những quả chưa chín hẳn; ở một bên, những quả đã chín hoàn toàn, treo lủng lẳng với vị ngọt như đã được thêm tinh chất thần thánh.
Yathā so, evaṃ sakaladasasahassacakkavāḷesu pupphūpagarukkhā pupphehi, phalūpagarukkhā phalehi paṭimaṇḍitā ahesuṃ.
Just as that tree, so too throughout all ten thousand world-systems, the flowering trees were adorned with flowers, and the fruit-bearing trees were adorned with fruits.
Như cây ấy, tất cả các cây ra hoa trong mười nghìn thế giới (cakkavāḷa) đều được trang hoàng bằng hoa, và các cây ra quả đều được trang hoàng bằng quả.
30
Sāloti sālarukkho.
Sālo means a Sal tree.
Sālo là cây sāla.
Tassāpi tadeva parimāṇaṃ, tatheva pupphasirīvibhavo veditabbo.
Its measure was also the same, and its splendor of flowers should be understood in the same way.
Kích thước của nó cũng vậy, sự huy hoàng của hoa cũng nên được hiểu tương tự.
Sirīsarukkhepi eseva nayo.
The same method applies to the Sirīsa tree.
Đối với cây sirīsa cũng theo cách này.
Udumbararukkhe pupphāni nāhesuṃ, phalavibhūti panettha ambe vuttanayāva, tathā nigrodhe, tathā assatthe.
In the Udumbara tree, there were no flowers, but the abundance of fruits here is as described for the mango tree; similarly for the Nigrodha and similarly for the Assattha.
Trên cây udumbara không có hoa, nhưng sự phong phú của quả ở đây cũng giống như đã nói về cây xoài, và tương tự đối với cây nigrodha, và tương tự đối với cây assattha.
Iti sabbabuddhānaṃ ekova pallaṅko, rukkhā pana aññepi honti.
Thus, there is only one seat for all Buddhas, but the trees may be different.
Như vậy, tất cả các vị Phật đều có cùng một bồ đoàn (pallaṅka), nhưng cây thì có thể khác nhau.
Tesu yassa yassa rukkhassa mūle catumaggañāṇasaṅkhātabodhiṃ buddhā paṭivijjhanti, so so bodhīti vuccati.
Among these, the root of whichever tree the Buddhas fully comprehend the Bodhi, consisting of the knowledge of the four paths, that tree is called Bodhi.
Trong số đó, cây nào mà các vị Phật giác ngộ Bodhi, tức là Tứ Đạo Trí, dưới gốc cây ấy, thì cây ấy được gọi là Bodhi.
Ayaṃ bodhiparicchedo nāma.
This is the section on the Bodhi tree.
Đây gọi là phần phân loại cây Bodhi.
31
Sāvakayugaparicchedavaṇṇanā
Section on the Pairs of Chief Disciples
Giải thích phần cặp đệ tử
32
9. Sāvakayugaparicchede pana khaṇḍatissanti khaṇḍo ca tisso ca.
In the section on the pairs of chief disciples, Khaṇḍa and Tissa means Khaṇḍa and Tissa.
9. Trong phần phân loại các cặp đệ tử (sāvakayugapariccheda), Khaṇḍatissa là Khaṇḍa và Tissa.
Tesu khaṇḍo ekapitiko kaniṭṭhabhātā, tisso purohitaputto.
Among them, Khaṇḍa was the younger brother with the same father, and Tissa was the son of the chaplain.
Trong số đó, Khaṇḍa là em trai cùng cha, còn Tissa là con trai của vị cố vấn hoàng gia.
Khaṇḍo paññāpāramiyā matthakaṃ patto, tisso samādhipāramiyā matthakaṃ patto.
Khaṇḍa had reached the pinnacle of perfection in wisdom (paññāpāramī), and Tissa had reached the pinnacle of perfection in concentration (samādhipāramī).
Khaṇḍa đã đạt đến đỉnh cao của ba-la-mật về trí tuệ (paññāpāramī), còn Tissa đã đạt đến đỉnh cao của ba-la-mật về định (samādhipāramī).
Agganti ṭhapetvā vipassiṃ bhagavantaṃ avasesehi saddhiṃ asadisaguṇatāya uttamaṃ.
Agga means supreme due to their unparalleled qualities compared to all other disciples, except for Vipassī Bhagavā.
Agga (tối thượng) có nghĩa là tối thượng do có những phẩm chất vô song so với tất cả các vị khác, ngoại trừ Thế Tôn Vipassī.
Bhaddayuganti aggattāyeva bhaddayugaṃ.
Bhaddayuga means an auspicious pair just by virtue of their supremacy.
Bhaddayuga (cặp xuất sắc) là cặp xuất sắc vì sự tối thượng của họ.
Abhibhūsambhavanti abhibhū ca sambhavo ca.
Abhibhū and Sambhava means Abhibhū and Sambhava.
Abhibhūsambhava là Abhibhū và Sambhava.
Tesu abhibhū paññāpāramiyā matthakaṃ patto.
Among them, Abhibhū had reached the pinnacle of perfection in wisdom (paññāpāramī).
Trong số đó, Abhibhū đã đạt đến đỉnh cao của ba-la-mật về trí tuệ.
Sikhinā bhagavatā saddhiṃ aruṇavatito brahmalokaṃ gantvā brahmaparisāya vividhāni pāṭihāriyāni dassento dhammaṃ desetvā dasasahassilokadhātuṃ andhakārena pharitvā – ‘‘kiṃ ida’’nti sañjātasaṃvegānaṃ obhāsaṃ pharitvā – ‘‘sabbe me rūpañca passantu, saddañca suṇantū’’ti adhiṭṭhahitvā – ‘‘ārambhathā’’ti gāthādvayaṃ (saṃ. ni. 1.185) bhaṇanto saddaṃ sāvesi.
Together with Sikhī Bhagavā, he went from Aruṇavatī to the Brahma-world, demonstrating various psychic powers to the assembly of Brahmās, taught the Dhamma, then filled the ten-thousandfold world-system with darkness, and when beings became greatly agitated, wondering, "What is this?", he emitted a radiance, then resolved, "May all see my form and hear my voice," and recited two verses, thereby making his voice heard.
Cùng với Thế Tôn Sikhī, ngài đã đi từ Aruṇavatī đến cõi Phạm thiên, trình bày nhiều phép lạ khác nhau trong hội chúng Phạm thiên, thuyết pháp, rồi bao phủ mười nghìn thế giới bằng bóng tối—sau đó, khi chúng sinh trở nên sợ hãi, ngài tỏa ra ánh sáng—và với quyết định: ‘‘Mong tất cả thấy hình tướng của ta và nghe tiếng của ta’’, ngài đã đọc hai câu kệ (Saṃ. Ni. 1.185) ‘‘ārambhathā’’ (Hãy bắt đầu) và làm cho tiếng nói của mình được nghe thấy.
Sambhavo samādhipāramiyā matthakaṃ patto ahosi.
Sambhava had reached the pinnacle of perfection in concentration (samādhipāramī).
Sambhava đã đạt đến đỉnh cao của ba-la-mật về định.
33
Soṇuttaranti soṇo ca uttaro ca.
Soṇa and Uttara means Soṇa and Uttara.
Soṇuttara là Soṇa và Uttara.
Tesupi soṇo paññāpāramiṃ patto, uttaro samādhipāramiṃ patto ahosi.
Among them, Soṇa had attained perfection in wisdom (paññāpāramī), and Uttara had attained perfection in concentration (samādhipāramī).
Trong số đó, Soṇa đã đạt đến ba-la-mật về trí tuệ, còn Uttara đã đạt đến ba-la-mật về định.
Vidhurasañjīvanti vidhuro ca sañjīvo ca.
Vidhura and Sañjīva means Vidhura and Sañjīva.
Vidhurasañjīva là Vidhura và Sañjīva.
Tesu vidhuro paññāpāramiṃ patto ahosi, sañjīvo samādhipāramiṃ patto.
Among them, Vidhura had attained perfection in wisdom (paññāpāramī), and Sañjīva had attained perfection in concentration (samādhipāramī).
Trong số đó, Vidhura đã đạt đến ba-la-mật về trí tuệ, còn Sañjīva đã đạt đến ba-la-mật về định.
Samāpajjanabahulo rattiṭṭhānadivāṭṭhānakuṭileṇamaṇḍapādīsu samāpattibalena jhāyanto ekadivasaṃ araññe nirodhaṃ samāpajji, atha naṃ vanakammikādayo ‘‘mato’’ti sallakkhetvā jhāpesuṃ.
Being frequent in attaining jhāna, he practiced jhāna by the power of attainment in night-abodes, day-abodes, huts, caves, pavilions, and one day, in the forest, he attained the cessation of perception and feeling (nirodha-samāpatti). Then, forest workers and others, thinking he was dead, cremated him.
Ngài là người thường xuyên nhập định, một ngày nọ, trong khi thiền định bằng sức mạnh của sự thành tựu thiền định ở những nơi trú ẩn ban đêm và ban ngày như tịnh xá, hang động, lều, v.v., ngài đã nhập diệt tận định (nirodhasamāpatti) trong rừng. Sau đó, những người làm việc trong rừng và những người khác đã nghĩ rằng ngài đã chết và hỏa táng ngài.
So yathāparicchedena samāpattito uṭṭhāya cīvarāni papphoṭetvā gāmaṃ piṇḍāya pāvisi.
He arose from that attainment after the prescribed period, shook out his robes, and entered the village for alms.
Ngài đã xuất định theo thời gian đã định, phủi y phục và đi vào làng để khất thực.
Tadupādāyeva ca naṃ ‘‘sañjīvo’’ti sañjāniṃsu.
From that time onwards, they came to know him as "Sañjīva" (the Revived).
Từ đó, mọi người biết ngài là ‘‘Sañjīva’’ (người sống lại).
Bhiyyosuttaranti bhiyyoso ca uttaro ca.
Bhiyyo and Uttara means Bhiyyo and Uttara.
Bhiyyosuttara là Bhiyyosa và Uttara.
Tesu bhiyyoso paññāya uttaro, uttaro samādhinā aggo ahosi.
Among them, Bhiyyo was supreme in wisdom, and Uttara was supreme in concentration.
Trong số đó, Bhiyyosa là tối thượng về trí tuệ, còn Uttara là tối thượng về định.
Tissabhāradvājanti tisso ca bhāradvājo ca.
Tissa and Bhāradvāja means Tissa and Bhāradvāja.
Tissabhāradvāja là Tissa và Bhāradvāja.
Tesu tisso paññāpāramiṃ patto, bhāradvājo samādhipāramiṃ patto ahosi.
Among them, Tissa had attained perfection in wisdom (paññāpāramī), and Bhāradvāja had attained perfection in concentration (samādhipāramī).
Trong số đó, Tissa đã đạt đến ba-la-mật về trí tuệ, còn Bhāradvāja đã đạt đến ba-la-mật về định.
Sāriputtamoggallānanti sāriputto ca moggallāno ca.
Sāriputta and Moggallāna means Sāriputta and Moggallāna.
Sāriputtamoggallāna là Sāriputta và Moggallāna.
Tesu sāriputto paññāvisaye, moggallāno samādhivisaye aggo ahosi.
Among them, Sāriputta was supreme in the sphere of wisdom, and Moggallāna was supreme in the sphere of concentration.
Trong số đó, Sāriputta là tối thượng trong lĩnh vực trí tuệ, còn Moggallāna là tối thượng trong lĩnh vực định.
Ayaṃ sāvakayugaparicchedo nāma.
This is the section on the pairs of chief disciples.
Đây gọi là phần phân loại các cặp đệ tử.
34
Sāvakasannipātaparicchedavaṇṇanā
Section on the Assemblies of Disciples
Giải thích phần hội chúng đệ tử
35
10. Sāvakasannipātaparicchede vipassissa bhagavato paṭhamasannipāto caturaṅgiko ahosi, sabbe ehibhikkhū, sabbe iddhiyā nibbattapattacīvarā, sabbe anāmantitāva āgatā, iti te ca kho pannarase uposathadivase.
In the section on the assemblies of disciples, the first assembly of Vipassī Bhagavā was endowed with four factors: all were "Come-bhikkhus" (Ehibhikkhu), all had their bowls and robes created by psychic power, and all came without being invited; moreover, it was on the full moon day of Uposatha.
10. Trong phần phân loại hội chúng đệ tử (sāvakasannipātapariccheda), hội chúng đầu tiên của Thế Tôn Vipassī có bốn yếu tố: tất cả đều là các Tỳ-khưu ‘‘Ehibhikkhū’’ (Hãy đến, Tỳ-khưu), tất cả đều có bát và y phục được tạo ra bằng thần thông, tất cả đều đến mà không được mời, và họ đã đến vào ngày Rằm Uposatha.
Atha satthā bījaniṃ gahetvā nisinno uposathaṃ osāresi.
Then, the Teacher sat down, took a fan, and presided over the Uposatha ceremony.
Sau đó, Đức Phật cầm quạt ngồi xuống và cử hành lễ Uposatha (tụng giới pātimokkha).
Dutiyatatiyesupi eseva nayo.
The same method applies to the second and third assemblies.
Đối với hội chúng thứ hai và thứ ba cũng theo cách này.
Tathā sesabuddhānaṃ sabbasannipātesu.
Similarly, for all assemblies of the remaining Buddhas.
Tương tự, đối với tất cả các hội chúng của các vị Phật còn lại.
Yasmā pana amhākaṃ bhagavato paṭhamabodhiyāva sannipāto ahosi, idañca suttaṃ aparabhāge vuttaṃ, tasmā ‘‘mayhaṃ, bhikkhave, etarahi eko sāvakānaṃ sannipāto’’ti aniṭṭhapetvā ‘‘ahosī’’ti vuttaṃ.
However, since for our Bhagavā, there was an assembly only at the time of his first awakening, and this Sutta was taught later, it is said "there was" (ahosīti) rather than "there is" (etarahi eko sāvakānaṃ sannipāto) for "Bhikkhus, there is now an assembly of disciples for me."
Tuy nhiên, vì hội chúng đệ tử của Đức Phật chúng ta chỉ diễn ra vào lúc giác ngộ đầu tiên, và kinh này được thuyết vào giai đoạn sau, nên không nói ‘‘Này các Tỳ-khưu, hiện nay ta có một hội chúng đệ tử’’, mà nói ‘‘đã có’’.
36
Tattha aḍḍhateḷasāni bhikkhusatānīti purāṇajaṭilānaṃ sahassaṃ, dvinnaṃ aggasāvakānaṃ parivārāni aḍḍhateyyasatānīti aḍḍhateḷasāni bhikkhusatāni.
There, twelve and a half hundreds of bhikkhus refers to a thousand of the former ascetics (jaṭilas), and two and a half hundreds (250) of the retinues of the two chief disciples, totaling twelve and a half hundreds of bhikkhus.
Ở đây, aḍḍhateḷasāni bhikkhusatāni (mười hai trăm năm mươi Tỳ-khưu) là một nghìn vị ẩn sĩ (jaṭila) cũ và hai trăm năm mươi vị tùy tùng của hai vị Thượng thủ đệ tử, tức là một nghìn hai trăm năm mươi Tỳ-khưu.
Tattha dvinnaṃ aggasāvakānaṃ abhinīhārato paṭṭhāya vatthuṃ kathetvā pabbajjā dīpetabbā.
There, the story should be recounted starting from the resolution of the two chief disciples, and their ordination should be explained.
Ở đây, cần kể câu chuyện từ khi hai vị Thượng thủ đệ tử phát nguyện và trình bày về sự xuất gia của họ.
Pabbajitānaṃ pana tesaṃ mahāmoggallāno sattame divase arahattaṃ patto.
Among those who were ordained, Mahāmoggallāna attained Arahantship on the seventh day.
Trong số những vị đã xuất gia đó, Đại Moggallāna đã đạt A-la-hán vào ngày thứ bảy.
Dhammasenāpati pannarasame divase gijjhakūṭapabbatamajjhe sūkarakhataleṇapabbhāre bhāgineyyassa dīghanakhaparibbājakassa sajjite dhammayāge vedanāpariggahasuttante (ma. ni. 2.201) desiyamāne desanaṃ anubujjhamānaṃ ñāṇaṃ pesetvā sāvakapāramiñāṇaṃ patto.
On the fifteenth day, the General of the Dhamma (Dhammasenāpati), in the midst of Gijjhakūṭa Mountain, in the Sūkarakhata cave, while the Vedanāpariggaha Sutta was being taught in the Dhamma-sacrifice arranged for his nephew, the wanderer Dīghanakha, he directed his knowledge to comprehend the teaching and attained the knowledge of a chief disciple's perfection.
Đại Pháp Tướng (Dhammasenāpati), tức Tôn giả Sāriputta, vào ngày thứ mười lăm, giữa núi Gijjhakūṭa, trong hang Sūkarakhata, khi bài kinh Vedanāpariggahasutta được thuyết cho cháu trai của ngài, du sĩ Dīghanakha, ngài đã đạt được trí tuệ Ba-la-mật của đệ tử bằng cách hướng tâm đến bài thuyết pháp và thấu hiểu nó.
Bhagavā therassa arahattappattiṃ ñatvā vehāsaṃ abbhuggantvā veḷuvaneyeva paccuṭṭhāsi.
Bhagavā, knowing the Elder's attainment of Arahantship, rose into the air and reappeared right in Veḷuvana.
Đức Thế Tôn, biết về sự thành tựu A-la-hán của vị Trưởng lão, đã bay lên không trung và xuất hiện trở lại tại Veḷuvana.
Thero – ‘‘kuhiṃ nu kho bhagavā gato’’ti āvajjanto veḷuvane patiṭṭhitabhāvaṃ ñatvā sayampi vehāsaṃ abbhuggantvā veḷuvaneyeva paccuṭṭhāsi.
The Elder, reflecting "Where has Bhagavā gone?", knew that he had settled in Veḷuvana, and he himself also rose into the air and reappeared right in Veḷuvana.
Vị Trưởng lão (Sāriputta) suy nghĩ: ‘‘Thế Tôn đã đi đâu rồi?’’, và khi biết rằng Đức Thế Tôn đang an trú tại Veḷuvana, ngài cũng bay lên không trung và xuất hiện trở lại tại Veḷuvana.
Atha bhagavā pātimokkhaṃ osāresi.
Then Bhagavā recited the Pātimokkha.
Sau đó, Đức Thế Tôn đã cử hành lễ pātimokkha.
Taṃ sannipātaṃ sandhāya bhagavā – ‘‘aḍḍhateḷasāni bhikkhusatānī’’ti āha.
Referring to that assembly, Bhagavā said, " twelve and a half hundreds of bhikkhus."
Đức Thế Tôn đã nói ‘‘aḍḍhateḷasāni bhikkhusatāni’’ (một nghìn hai trăm năm mươi Tỳ-khưu) là để chỉ hội chúng đó.
Ayaṃ sāvakasannipātaparicchedo nāma.
This is the section on the assemblies of disciples.
Đây gọi là phần phân loại hội chúng đệ tử.
37
Upaṭṭhākaparicchedavaṇṇanā
Section on the Attendants
Giải thích phần các thị giả
38
11. Upaṭṭhākaparicchede pana ānandoti nibaddhupaṭṭhākabhāvaṃ sandhāya vuttaṃ.
In the section on the attendants, Ānanda is mentioned with reference to his continuous attendance.
11. Trong phần phân loại các thị giả (upaṭṭhākapariccheda), Ānando được nói đến để chỉ sự thường xuyên làm thị giả.
Bhagavato hi paṭhamabodhiyaṃ anibaddhā upaṭṭhākā ahesuṃ.
Indeed, in the early period of Bhagavā's awakening, there were no fixed attendants.
Vào thời kỳ giác ngộ đầu tiên của Đức Thế Tôn, có những thị giả không thường xuyên.
Ekadā nāgasamālo pattacīvaraṃ gahetvā vicari, ekadā nāgito, ekadā upavāno, ekadā sunakkhatto, ekadā cundo samaṇuddeso, ekadā sāgato, ekadā meghiyo.
Once, Thera Nāgasamāla, taking his bowl and robe, wandered; once, Nāgita; once, Upavāṇa; once, Sunakkhatta; once, Cunda the novice; once, Sāgata; once, Meghiya.
Một lần, Tôn giả Nāgasamāla mang bát y đi khất thực; một lần là Nāgita; một lần là Upavāna; một lần là Sunakkhatta; một lần là Sa-di Cunda; một lần là Sāgata; một lần là Meghiya.
Tattha ekadā bhagavā nāgasamālattherena saddhiṃ addhānamaggapaṭipanno dvedhāpathaṃ patto.
Among those, once the Blessed One, while traveling along a road with Thera Nāgasamāla, came to a fork in the path.
Trong số đó, một lần Thế Tôn cùng Trưởng lão Nāgasamāla đang đi trên đường thì đến một ngã ba.
Thero maggā okkamma – ‘‘bhagavā, ahaṃ iminā maggena gacchāmī’’ti āha.
The Thera, turning aside from the path, said, “Blessed One, I will go by this path.”
Vị Trưởng lão rời khỏi con đường chính và nói: “Bạch Thế Tôn, con sẽ đi con đường này.”
Atha naṃ bhagavā – ‘‘ehi bhikkhu, iminā maggena gacchāmā’’ti āha.
Then the Blessed One said to him, “Come, bhikkhu, let us go by this path.”
Rồi Thế Tôn nói với ông: “Này Tỳ-khưu, hãy đến đây, chúng ta hãy đi con đường này.”
So – ‘‘handa, bhagavā, tumhākaṃ pattacīvaraṃ gaṇhatha, ahaṃ iminā maggena gacchāmī’’ti vatvā pattacīvaraṃ chamāyaṃ ṭhapetuṃ āraddho.
He said, “Here, Blessed One, please take your bowl and robe; I will go by this path,” and began to place the bowl and robe on the ground.
Ông nói: “Bạch Thế Tôn, xin Thế Tôn hãy nhận lấy bát y của mình, con sẽ đi con đường này,” rồi bắt đầu đặt bát y xuống đất.
Atha naṃ bhagavā – ‘‘āhara, bhikkhū’’ti vatvā pattacīvaraṃ gahetvā gato.
Then the Blessed One said to him, “Bring it here, bhikkhu,” and taking the bowl and robe Himself, went on.
Rồi Thế Tôn nói với ông: “Này Tỳ-khưu, hãy mang lại đây,” rồi tự mình nhận lấy bát y và đi.
Tassapi bhikkhuno itarena maggena gacchato corā pattacīvarañceva hariṃsu, sīsañca bhindiṃsu.
That bhikkhu, going by the other path, had his bowl and robe stolen by robbers, and his head was split open.
Vị Tỳ-khưu ấy đi con đường khác thì bị bọn cướp lấy mất bát y và bị chém vỡ đầu.
So – ‘‘bhagavā idāni me paṭisaraṇaṃ, na añño’’ti cintetvā lohitena gaḷitena bhagavato santikaṃ agamāsi.
He thought, “Now the Blessed One is my refuge, no other,” and with blood flowing, he came to the Blessed One.
Ông nghĩ: “Giờ đây Thế Tôn là nơi nương tựa của ta, không còn ai khác,” rồi với máu chảy đầm đìa, ông đi đến chỗ Thế Tôn.
‘‘Kimidaṃ bhikkhū’’ti ca vutte taṃ pavattiṃ ārocesi.
When asked, “What is this, bhikkhu?” he reported the incident.
Khi được hỏi: “Này Tỳ-khưu, việc gì thế này?”, ông đã kể lại sự việc.
Atha naṃ bhagavā – ‘‘mā cintayi, bhikkhu, etaṃyeva te kāraṇaṃ sallakkhetvā nivārayimhā’’ti vatvā naṃ samassāsesi.
Then the Blessed One comforted him, saying, “Do not worry, bhikkhu; knowing this very reason, we tried to stop you.”
Rồi Thế Tôn nói với ông: “Này Tỳ-khưu, đừng lo lắng, chúng ta đã nhận ra lý do này và ngăn cản con,” rồi an ủi ông.
39
Ekadā pana bhagavā meghiyattherena saddhiṃ pācīnavaṃsamigadāye jantugāmaṃ agamāsi.
Another time, the Blessed One went to the village of Jantu, in the Pācīnavaṁsamigadāya, with Thera Meghiya.
Lại một lần khác, Thế Tôn cùng Trưởng lão Meghiya đi đến làng Jantu trong rừng Nai Pācīnavamsa.
Tatrāpi meghiyo jantugāme piṇḍāya caritvā nadītīre pāsādikaṃ ambavanaṃ disvā – ‘‘bhagavā, tumhākaṃ pattacīvaraṃ gaṇhatha, ahaṃ tasmiṃ ambavane samaṇadhammaṃ karomī’’ti vatvā bhagavatā tikkhattuṃ nivāriyamānopi gantvā akusalavitakkehi upadduto anvāsatto (a. ni. 9.3; udāna paricchedo 31 daṭṭhabbo).
There too, Meghiya, after going for alms in Jantu village, saw a charming mango grove by the riverbank and said, “Blessed One, please take your bowl and robe; I will practice the monastic life in that mango grove.” Although the Blessed One prevented him three times, he went anyway and was troubled and afflicted by unwholesome thoughts (A.N. 9.3; see Udāna, chapter 31).
Tại đó, Tôn giả Meghiya sau khi khất thực ở làng Jantu, thấy một khu vườn xoài đẹp đẽ bên bờ sông, liền nói: “Bạch Thế Tôn, xin Thế Tôn hãy nhận lấy bát y của mình, con sẽ thực hành pháp Sa-môn trong khu vườn xoài đó.” Dù bị Thế Tôn ngăn cản ba lần, ông vẫn đi và bị các ác tầm quấy nhiễu, đeo bám.
Paccāgantvā taṃ pavattiṃ ārocesi.
Returning, he reported the incident.
Trở về, ông kể lại sự việc.
Tampi bhagavā – ‘‘idameva te kāraṇaṃ sallakkhetvā nivārayimhā’’ti vatvā anupubbena sāvatthiṃ agamāsi.
The Blessed One, saying to him, “It was for this very reason that we tried to stop you,” then gradually proceeded to Sāvatthi.
Thế Tôn cũng nói với ông: “Chúng ta đã nhận ra lý do này và ngăn cản con,” rồi tuần tự đi đến Sāvatthī.
Tattha gandhakuṭipariveṇe paññattavarabuddhāsane nisinno bhikkhusaṅghaparivuto bhikkhū āmantesi – ‘‘bhikkhave, idānimhi mahallako, ‘ekacce bhikkhū iminā maggena gacchāmā’ti vutte aññena gacchanti, ekacce mayhaṃ pattacīvaraṃ nikkhipanti, mayhaṃ nibaddhupaṭṭhākaṃ ekaṃ bhikkhuṃ jānāthā’’ti.
There, in the Gandhakuti precinct, seated on the excellent Buddha-seat that had been prepared, surrounded by the assembly of bhikkhus, he addressed the bhikkhus: “Bhikkhus, I am now old. When some bhikkhus are told, ‘Let us go by this path,’ they go by another. Some put down my bowl and robe. Know one bhikkhu to be my constant attendant.”
Tại đó, trong khu vực tịnh xá Gandhakuti, Thế Tôn ngồi trên Phật tòa cao quý đã được sắp đặt, được Tăng chúng vây quanh, gọi các Tỳ-khưu và nói: “Này các Tỳ-khưu, giờ đây Ta đã già. Một số Tỳ-khưu khi được bảo ‘chúng ta hãy đi con đường này’ thì lại đi con đường khác. Một số Tỳ-khưu lại đặt bát y của Ta xuống. Các con hãy tìm một Tỳ-khưu làm thị giả thường xuyên cho Ta.”
Bhikkhūnaṃ dhammasaṃvego udapādi.
A sense of urgency concerning the Dhamma arose in the bhikkhus.
Sự xúc động về Pháp khởi lên trong các Tỳ-khưu.
Athāyasmā sāriputto uṭṭhāyāsanā bhagavantaṃ vanditvā – ‘‘ahaṃ, bhante, tumheyeva patthayamāno satasahassakappādhikaṃ asaṅkhyeyyaṃ pāramiyo pūrayiṃ, nanu mādiso mahāpañño upaṭṭhāko nāma vaṭṭati, ahaṃ upaṭṭhahissāmī’’ti āha.
Then the Venerable Sāriputta rose from his seat, paid homage to the Blessed One, and said, “Venerable Sir, it was for the sake of desiring you alone that I fulfilled perfections for one hundred thousand aeons and one asaṅkhyeyya. Is it not fitting that one as wise as I should be an attendant? I will attend upon you.”
Rồi Tôn giả Sāriputta đứng dậy khỏi chỗ ngồi, đảnh lễ Thế Tôn và nói: “Bạch Thế Tôn, con đã viên mãn các Ba-la-mật trong một A-tăng-kỳ và một trăm ngàn đại kiếp vì mong cầu chính Thế Tôn. Chẳng lẽ một người có đại trí tuệ như con không xứng đáng làm thị giả sao? Con sẽ làm thị giả.”
Taṃ bhagavā – ‘‘alaṃ sāriputta, yassaṃ disāyaṃ tvaṃ viharasi, asuññāyeva me sā disā, tava ovādo buddhānaṃ ovādasadiso, na me tayā upaṭṭhākakiccaṃ atthī’’ti paṭikkhipi.
The Blessed One refused him, saying, “Enough, Sāriputta. The direction in which you dwell is not empty for me. Your counsel is like the counsel of Buddhas. I have no need for your service as an attendant.”
Thế Tôn từ chối ông: “Đủ rồi, Sāriputta. Phương hướng nào con trú ngụ, phương hướng đó đối với Ta không trống vắng. Lời khuyên của con giống như lời khuyên của các vị Phật. Ta không cần con làm thị giả.”
Etenevupāyena mahāmoggallānaṃ ādiṃ katvā asītimahāsāvakā uṭṭhahiṃsu.
By this same method, starting with Mahāmoggallāna, eighty great disciples arose.
Theo cách này, tám mươi vị Đại Thanh văn, bắt đầu từ Đại Mục-kiền-liên, đều đứng dậy (xin làm thị giả).
Te sabbepi bhagavā paṭikkhipi.
The Blessed One refused all of them.
Thế Tôn đều từ chối tất cả các vị ấy.
40
Ānandatthero pana tuṇhīyeva nisīdi.
However, Thera Ānanda remained silent.
Tuy nhiên, Trưởng lão Ānanda vẫn im lặng ngồi đó.
Atha naṃ bhikkhū evamāhaṃsu – ‘‘āvuso, ānanda, bhikkhusaṅgho upaṭṭhākaṭṭhānaṃ yācati, tvampi yācāhī’’ti.
Then the bhikkhus said to him, “Friend Ānanda, the assembly of bhikkhus asks for the position of attendant. You too should ask!”
Rồi các Tỳ-khưu nói với ông: “Này Hiền giả Ānanda, Tăng chúng đang thỉnh cầu vị trí thị giả, Hiền giả cũng hãy thỉnh cầu đi.”
So āha – ‘‘yācitvā laddhupaṭṭhānaṃ nāma āvuso kīdisaṃ hoti, kiṃ maṃ satthā na passati, sace rocissati, ānando maṃ upaṭṭhātūti vakkhatī’’ti.
He said, “Friends, what kind of attendance is it that is obtained by asking? Does the Teacher not see me? If it pleases Him, He will say, ‘Let Ānanda attend upon me.’”
Ông nói: “Này các Hiền giả, vị trí thị giả mà phải thỉnh cầu mới được thì có ý nghĩa gì? Chẳng lẽ Đức Đạo Sư không thấy con sao? Nếu Ngài hài lòng, Ngài sẽ nói: ‘Ānanda hãy làm thị giả cho Ta’.”
Atha bhagavā – ‘‘na, bhikkhave, ānando aññena ussāhetabbo, sayameva jānitvā maṃ upaṭṭhahissatī’’ti āha.
Then the Blessed One said, “Bhikkhus, Ānanda need not be encouraged by another; he will know by himself and attend upon me.”
Rồi Thế Tôn nói: “Này các Tỳ-khưu, Ānanda không cần ai khuyến khích. Tự ông ấy sẽ biết và làm thị giả cho Ta.”
Tato bhikkhū – ‘‘uṭṭhehi, āvuso ānanda, uṭṭhehi āvuso ānanda, dasabalaṃ upaṭṭhākaṭṭhānaṃ yācāhī’’ti āhaṃsu.
Thereupon the bhikkhus said, “Arise, friend Ānanda! Arise, friend Ānanda! Ask the Dasabala for the position of attendant!”
Sau đó, các Tỳ-khưu nói: “Hãy đứng dậy, này Hiền giả Ānanda! Hãy đứng dậy, này Hiền giả Ānanda! Hãy thỉnh cầu vị trí thị giả cho Đức Thập Lực!”
Thero uṭṭhahitvā cattāro paṭikkhepe, catasso ca āyācanāti aṭṭha vare yāci.
The Thera arose and asked for eight boons: four rejections and four requests.
Vị Trưởng lão đứng dậy và thỉnh cầu tám điều ước: bốn điều từ chối và bốn điều thỉnh cầu.
41
Cattāro paṭikkhepā nāma – ‘‘sace me, bhante, bhagavā attanā laddhaṃ paṇītaṃ cīvaraṃ na dassati, piṇḍapātaṃ na dassati, ekagandhakuṭiyaṃ vasituṃ na dassati, nimantanaṃ gahetvā na gamissati, evāhaṃ bhagavantaṃ upaṭṭhahissāmī’’ti vatvā – ‘‘kiṃ panettha, ānanda, ādīnavaṃ passasī’’ti vutte – ‘‘sacāhaṃ, bhante, imāni vatthūni labhissāmi, bhavissanti vattāro – ‘ānando dasabalena laddhaṃ paṇītaṃ cīvaraṃ paribhuñjati, piṇḍapātaṃ paribhuñjati, ekagandhakuṭiyaṃ vasati, ekato nimantanaṃ gacchati, etaṃ lābhaṃ labhanto tathāgataṃ upaṭṭhāti, ko evaṃ upaṭṭhahato bhāro’ti’’ ime cattāro paṭikkhepe yāci.
The four rejections were: “Venerable Sir, if the Blessed One does not give me a fine robe received by himself, does not give me almsfood, does not allow me to dwell in a private perfumed chamber, and does not go to an invitation taken by me, even so, I will attend upon the Blessed One.” When asked, “What fault do you see in this, Ānanda?” he replied, “Venerable Sir, if I were to receive these things, there would be those who would say: ‘Ānanda enjoys a fine robe received by the Dasabala, he enjoys almsfood, he dwells in a private perfumed chamber, he goes to an invitation together*. Attending the Tathāgata while receiving such gains, what burden is it for such an attendant?’ ” Thus, he asked for these four rejections.
Bốn điều từ chối là: “Bạch Thế Tôn, nếu Thế Tôn không ban cho con y phục tốt đẹp do Ngài nhận được, không ban cho con thức ăn khất thực, không cho con ở trong một hương thất (Gandhakuti) riêng, và không đi nhận lời mời mà con đã nhận, thì con sẽ làm thị giả cho Thế Tôn.” Khi được hỏi: “Này Ānanda, con thấy điều bất lợi gì trong những điều này?”, ông đáp: “Bạch Thế Tôn, nếu con nhận được những vật này, sẽ có những người nói: ‘Ānanda thọ dụng y phục tốt đẹp do Đức Thập Lực nhận được, thọ dụng thức ăn khất thực, ở trong một hương thất riêng, cùng đi nhận lời mời. Người làm thị giả như vậy, được những lợi lộc này, thì trách nhiệm gì mà nặng nề?’.” Ông đã thỉnh cầu bốn điều từ chối này.
42
Catasso āyācanā nāma – ‘‘sace, bhante, bhagavā mayā gahitanimantanaṃ gamissati, sacāhaṃ tiroraṭṭhā tirojanapadā bhagavantaṃ daṭṭhuṃ āgataṃ parisaṃ āgatakkhaṇe eva bhagavantaṃ dassetuṃ lacchāmi, yadā me kaṅkhā uppajjati, tasmiṃyeva khaṇe bhagavantaṃ upasaṅkamituṃ lacchāmi, yaṃ bhagavā mayhaṃ parammukhā dhammaṃ deseti, taṃ āgantvā mayhaṃ kathessati, evāhaṃ bhagavantaṃ upaṭṭhahissāmī’’ti vatvā – ‘‘kaṃ panettha, ānanda, ānisaṃsaṃ passasī’’ti vutte – ‘‘idha, bhante, saddhā kulaputtā bhagavato okāsaṃ alabhantā maṃ evaṃ vadanti – ‘sve, bhante ānanda, bhagavatā saddhiṃ amhākaṃ ghare bhikkhaṃ gaṇheyyāthā’ti, sace bhante bhagavā tattha na gamissati, icchitakkhaṇeyeva parisaṃ dassetuṃ, kaṅkhañca vinodetuṃ okāsaṃ na lacchāmi, bhavissanti vattāro – ‘kiṃ ānando dasabalaṃ upaṭṭhāti, ettakampissa anuggahaṃ bhagavā na karotī’ti.
The four requests were: “Venerable Sir, if the Blessed One will go to an invitation that I have accepted; if I may be able to show the Blessed One immediately to an assembly that has come from other districts and regions to see him; if I may be able to approach the Blessed One at the very moment doubt arises in me; and if the Blessed One will tell me again the Dhamma he has taught in my absence, then I will attend upon the Blessed One.” When asked, “What benefit do you see in this, Ānanda?” he replied, “Here, Venerable Sir, faithful laymen, not finding an opportunity with the Blessed One, say to me: ‘Venerable Ānanda, tomorrow may you receive alms in our house with the Blessed One.’ If, Venerable Sir, the Blessed One does not go there, and I do not get the opportunity to show the assembly or to dispel doubts at the desired moment, there will be those who say: ‘Why does Ānanda attend upon the Dasabala? The Blessed One does not even grant him such a favor.’
Bốn điều thỉnh cầu là: “Bạch Thế Tôn, nếu Thế Tôn đi nhận lời mời mà con đã nhận; nếu con có thể cho hội chúng đến từ các quốc độ, các vùng đất khác để gặp Thế Tôn ngay khi họ đến; nếu con có thể đến gặp Thế Tôn ngay khi có nghi ngờ phát sinh; và nếu Thế Tôn thuyết Pháp sau lưng con, Ngài sẽ trở lại và nói lại cho con nghe, thì con sẽ làm thị giả cho Thế Tôn.” Khi được hỏi: “Này Ānanda, con thấy lợi ích gì trong những điều này?”, ông đáp: “Bạch Thế Tôn, ở đây, các thiện nam tín nữ không thể gặp Thế Tôn, họ sẽ nói với con như thế này: ‘Bạch Tôn giả Ānanda, ngày mai xin Thế Tôn cùng Tôn giả đến nhà chúng con thọ thực.’ Nếu Thế Tôn không đến đó, hoặc nếu con không có cơ hội cho hội chúng gặp Ngài vào lúc họ muốn, hoặc không thể giải tỏa nghi ngờ, sẽ có những người nói: ‘Ānanda làm thị giả cho Đức Thập Lực để làm gì? Thế Tôn còn không ban cho ông ấy sự ưu ái nhỏ nhặt như vậy’.”
Bhagavato ca parammukhā maṃ pucchissanti – ‘ayaṃ, āvuso ānanda, gāthā, idaṃ suttaṃ, idaṃ jātakaṃ, kattha desita’nti.
Moreover, in the absence of the Blessed One, they will ask me: ‘Friend Ānanda, where was this stanza, this Sutta, this Jātaka taught?’
Và họ sẽ hỏi con sau lưng Thế Tôn: “Này Hiền giả Ānanda, bài kệ này, bài kinh này, câu chuyện Jātaka này, đã được thuyết ở đâu?”
Sacāhaṃ taṃ na sampādayissāmi, bhavissanti vattāro – ‘ettakampi, āvuso, na jānāsi, kasmā tvaṃ chāyā viya bhagavantaṃ avijahanto dīgharattaṃ vicarasī’ti.
If I cannot provide that, there will be those who say: ‘Friend, you do not even know this much! Why do you wander for so long, not abandoning the Blessed One like a shadow?’
Nếu con không thể đáp ứng được điều đó, sẽ có những người nói: “Này Hiền giả, ông còn không biết điều nhỏ nhặt như vậy, tại sao ông lại đi theo Thế Tôn như cái bóng không rời trong một thời gian dài?”
Tenāhaṃ parammukhā desitassapi dhammassa puna kathanaṃ icchāmī’’ti imā catasso āyācanā yāci.
Therefore, I wish for the Dhamma taught in my absence to be recounted to me again.” Thus, he asked for these four requests.
Vì vậy, con mong muốn được nghe lại Pháp đã được thuyết sau lưng con.” Ông đã thỉnh cầu bốn điều thỉnh cầu này.
Bhagavāpissa adāsi.
The Blessed One also granted them to him.
Thế Tôn cũng đã ban cho ông.
43
Evaṃ ime aṭṭha vare gahetvā nibaddhupaṭṭhāko ahosi.
Thus, having received these eight boons, he became the constant attendant.
Vì vậy, ông đã nhận tám điều ước này và trở thành thị giả thường xuyên.
Tasseva ṭhānantarassatthāya kappasatasahassaṃ pūritānaṃ pāramīnaṃ phalaṃ pāpuṇīti imassa nibaddhupaṭṭhākabhāvaṃ sandhāya – ‘‘mayhaṃ, bhikkhave, etarahi ānando bhikkhu upaṭṭhāko aggupaṭṭhāko’’ti āha.
Referring to this constant attendance, which was the result of the perfections he had fulfilled for one hundred thousand aeons for that very position, the Blessed One said: “Bhikkhus, currently, bhikkhu Ānanda is my attendant, the foremost attendant.”
Và để đạt được vị trí thị giả đó, ông đã viên mãn các Ba-la-mật trong một trăm ngàn đại kiếp, đạt được quả vị đó. Do đó, Thế Tôn đã nói: “Này các Tỳ-khưu, hiện nay Tỳ-khưu Ānanda là thị giả của Ta, là thị giả tối thượng.”
Ayaṃ upaṭṭhākaparicchedo nāma.
This is called the chapter on attendants.
Đây là phần về các vị thị giả.
44
12. Pitiparicchedo uttānatthoyeva.
The chapter on Pīti is self-explanatory.
12. Phần về cha chỉ có nghĩa rõ ràng.
45
Vihāraṃ pāvisīti kasmā vihāraṃ pāvisi?
"He entered the monastery"—why did he enter the monastery?
Vào tịnh xá nghĩa là tại sao Ngài lại vào tịnh xá?
Bhagavā kira ettakaṃ kathetvā cintesi – ‘‘na tāva mayā sattannaṃ buddhānaṃ vaṃso nirantaraṃ matthakaṃ pāpetvā kathito, ajja mayi pana vihāraṃ paviṭṭhe ime bhikkhū bhiyyoso mattāya pubbenivāsañāṇaṃ ārabbha vaṇṇaṃ kathayissanti.
It is said that the Blessed One, having taught this much, reflected, "I have not yet continuously completed the lineage of the seven Buddhas. Today, when I enter the monastery, these bhikkhus will praise the past abodes even more.
Quả thật, Đức Thế Tôn sau khi thuyết giảng đến đây, Ngài suy nghĩ: “Ta chưa thuyết giảng liên tục về dòng dõi của bảy vị Phật cho đến cùng. Hôm nay, khi ta vào tịnh xá, những Tỳ-kheo này sẽ ca ngợi về Túc mạng trí (pubbenivāsañāṇa) của ta một cách quá mức.”
Athāhaṃ āgantvā nirantaraṃ buddhavaṃsaṃ kathetvā matthakaṃ pāpetvā dassāmī’’ti bhikkhūnaṃ kathāvārassa okāsaṃ datvā uṭṭhāyāsanā vihāraṃ pāvisi.
Then I will come and teach the unbroken lineage of the Buddhas to completion and present it." Having given the bhikkhus an opportunity for conversation, he rose from his seat and entered the monastery.
Rồi Ngài nghĩ: “Khi đó ta sẽ đến và thuyết giảng liên tục về dòng dõi các vị Phật cho đến cùng.” Sau khi cho các Tỳ-kheo cơ hội nói chuyện, Ngài đứng dậy rời chỗ ngồi và đi vào tịnh xá.
46
Yañcetaṃ bhagavā tantiṃ kathesi, tattha kappaparicchedo, jātiparicchedo, gottaparicchedo, āyuparicchedo, bodhiparicchedo, sāvakayugaparicchedo, sāvakasannipātaparicchedo, upaṭṭhākaparicchedo, pitiparicchedoti navime vārā āgatā, sambahulavāro anāgato, ānetvā pana dīpetabbo.
In the tradition which the Blessed One taught, the section on kalpas, the section on births, the section on clans, the section on lifespans, the section on enlightenment, the section on pairs of chief disciples, the section on assemblies of disciples, the section on chief attendants, and the section on fathers – these nine categories are included, but the section on children (sambahulavāra) is not yet included and should be brought forth and elucidated.
Và trong giáo lý mà Đức Thế Tôn đã thuyết giảng, có chín phần đã được đề cập: phần phân loại kiếp, phần phân loại chủng tộc, phần phân loại dòng họ, phần phân loại tuổi thọ, phần phân loại giác ngộ, phần phân loại cặp đệ tử, phần phân loại hội chúng đệ tử, phần phân loại người hộ độ, và phần phân loại cha. Phần phân loại đa số (sambahulavāro) chưa được đề cập, nhưng cần phải được đưa vào và trình bày.
47
Sambahulavārakathāvaṇṇanā
Elucidation of the Section on Children (Sambahulavāra)
Phần Giải Thích về Đa Số
48
Sabbabodhisattānañhi ekasmiṃ kulavaṃsānurūpe putte jāte nikkhamitvā pabbajitabbanti ayameva vaṃso, ayaṃ paveṇī.
Indeed, for all Bodhisattas, it is the tradition and the lineage that they should leave home and go forth as renunciants after a son, suitable to their family lineage, is born.
Thật vậy, đối với tất cả các vị Bồ-tát, khi một người con được sinh ra phù hợp với dòng dõi gia đình, thì đó là dòng dõi, là truyền thống rằng họ phải từ bỏ gia đình và xuất gia.
Kasmā?
Why is this so?
Tại sao?
Sabbaññubodhisattānañhi mātukucchiṃ okkamanato paṭṭhāya pubbe vuttappakārāni anekāni pāṭihāriyāni honti, tatra nesaṃ yadi neva jātanagaraṃ, na pitā, na mātā, na bhariyā, na putto paññāyeyya, ‘‘imassa neva jātanagaraṃ, na pitā, na bhariyā, na putto paññāyati, devo vā sakko vā māro vā brahmā vā esa maññe, devānañca īdisaṃ pāṭihāriyaṃ anacchariya’’nti maññamāno jano neva sotabbaṃ, na saddhātabbaṃ maññeyya.
For all Bodhisattas who are to attain omniscience, from the moment they enter their mother's womb, many miracles of the previously stated kind occur. If, in such circumstances, their birthplace, father, mother, wife, and son were not known, people might think, "This person has no known birthplace, no father, no wife, no son. Perhaps this is a deva, Sakka, Māra, or Brahmā. Such a miracle is not surprising for devas." Thinking thus, people would not consider it worth listening to or believing.
Thật vậy, từ khi các vị Bồ-tát Toàn Giác nhập thai mẹ, nhiều phép lạ như đã nói ở trên xảy ra. Trong trường hợp đó, nếu thành phố nơi sinh, cha, mẹ, vợ, con của các Ngài không được biết đến, thì người đời sẽ nghĩ: “Người này không rõ thành phố nơi sinh, không rõ cha, không rõ vợ, không rõ con. Có lẽ đây là một vị chư thiên, hay Sakka, hay Māra, hay Brahmā. Đối với chư thiên, phép lạ như vậy không phải là điều kỳ diệu.” Và họ sẽ không nghĩ rằng điều đó đáng nghe hay đáng tin.
Tato abhisamayo na bhaveyya, abhisamaye asati niratthakova buddhuppādo, aniyyānikaṃ sāsanaṃ hoti.
Consequently, there would be no realization of the Dhamma, and without realization, the appearance of a Buddha would be fruitless, and the Dispensation would not lead to liberation.
Do đó, sẽ không có sự chứng ngộ. Khi không có sự chứng ngộ, sự xuất hiện của chư Phật sẽ vô ích, và giáo pháp sẽ không dẫn đến giải thoát.
Tasmā sabbabodhisattānaṃ – ‘‘ekasmiṃ kulavaṃsānurūpe putte jāte nikkhamitvā pabbajitabba’’nti ayameva vaṃso ayaṃ paveṇī.
Therefore, for all Bodhisattas, "It is the tradition and the lineage that they should leave home and go forth as renunciants after a son, suitable to their family lineage, is born."
Vì vậy, đối với tất cả các vị Bồ-tát, đây là dòng dõi, là truyền thống rằng: “Khi một người con được sinh ra phù hợp với dòng dõi gia đình, thì phải từ bỏ gia đình và xuất gia.”
Tasmā puttādīnaṃ vasena sambahulavāro ānetvā dīpetabbo.
Hence, the section on children (sambahulavāra), based on sons and so on, should be brought forth and elucidated.
Vì thế, phần phân loại đa số cần được đưa vào và trình bày theo khía cạnh của con cái, v.v.
49
Sambahulaparicchedavaṇṇanā
Elucidation of the Section on Many Factors (Sambahulapariccheda)
Giải Thích Phần Đa Số
50
Tattha –
In this regard:
Trong đó –
51
Samavattakkhandho atulo, suppabuddho ca uttaro;
Samavattakkhandha, Atula, Suppabuddha, and Uttara;
Samavattakkhandha, Atula, Suppabuddha và Uttara;
52
Satthavāho vijitaseno, rāhulo bhavati sattamoti.
Satthavāha, Vijitasena, and Rāhula is the seventh.
Satthavāha, Vijitasena, và Rāhula là người thứ bảy.
53
Ete tāva sattannampi bodhisattānaṃ anukkameneva satta puttā veditabbā.
These are to be understood as the seven sons of the seven Bodhisattas in due order.
Bảy người này là bảy người con của bảy vị Bồ-tát theo thứ tự, cần phải được biết.
54
Tattha rāhulabhadde tāva jāte paṇṇaṃ āharitvā mahāpurisassa hatthe ṭhapayiṃsu.
Among these, when Rāhula-bhadda was born, they brought a leaf and placed it in the hand of the Great Being.
Trong đó, khi Rāhulabhadda được sinh ra, họ mang một tờ giấy đặt vào tay vị Đại nhân (Bồ-tát).
Athassa tāvadeva sakalasarīraṃ khobhetvā puttasineho aṭṭhāsi.
At that very moment, affection for his son, shaking his whole body, arose in him.
Ngay lúc đó, tình yêu thương con cái đã lay động toàn thân Ngài và an trụ.
So cintesi – ‘‘ekasmiṃ tāva jāte evarūpo puttasineho, parosahassaṃ kira me puttā bhavissanti, tesu ekekasmiṃ jāte idaṃ sinehabandhanaṃ evaṃ vaḍḍhantaṃ dubbhejjaṃ bhavissati, rāhu jāto, bandhanaṃ jāta’’nti āha.
He thought, "Such a deep affection for one son born! It seems I will have over a thousand sons. With each one born, this bond of affection will grow and become difficult to break. A Rāhu is born, a fetter is born," he said.
Ngài suy nghĩ: “Khi chỉ một người con được sinh ra mà tình yêu thương con cái lại mạnh mẽ đến thế, thì nếu ta có hơn một ngàn người con, mỗi khi một người con được sinh ra, mối ràng buộc tình cảm này sẽ càng tăng trưởng và trở nên khó phá vỡ. Rāhu đã sinh ra, sự ràng buộc đã sinh ra.” Ngài đã nói như vậy.
Taṃ divasameva ca rajjaṃ pahāya nikkhanto.
And on that very day, he renounced the kingdom and went forth.
Và chính ngày hôm đó, Ngài đã từ bỏ vương quốc và xuất gia.
Esa nayo sabbesaṃ puttuppattiyanti.
This is the way for the birth of all sons.
Đây là quy luật đối với sự ra đời của tất cả các người con.
Ayaṃ puttaparicchedo.
This is the section on sons.
Đây là phần phân loại con cái.
55
Sutanā sabbakāmā ca, sucittā atha rocinī;
Sutanā, Sabbakāmā, Sucittā, and Rocinī;
Sutanā, Sabbakāmā, Sucittā và Rocinī;
56
Rucaggatī sunandā ca, bimbā bhavati sattamāti.
Rucaggatī, Sunandā, and Bimbā is the seventh.
Rucaggatī, Sunandā, và Bimbā là người thứ bảy.
57
Etā tesaṃ sattannampi puttānaṃ mātaro ahesuṃ.
These were the mothers of those seven sons. But Queen Bimbādevī, after Prince Rāhula was born, became known as Rāhula's Mother.
Những vị này là mẹ của bảy người con đó.
Bimbādevī pana rāhulakumāre jāte rāhulamātāti paññāyittha.
But Queen Bimbādevī, after Prince Rāhula was born, became known as Rāhula's Mother.
Còn Bimbādevī thì được biết đến là mẹ của Rāhula khi hoàng tử Rāhula ra đời.
Ayaṃ bhariyaparicchedo.
This is the section on wives.
Đây là phần phân loại vợ.
58
Vipassī kakusandhoti ime pana dve bodhisattā payuttaājaññarathamāruyha mahābhinikkhamanaṃ nikkhamiṃsu.
Vipassī and Kakusandha, these two Bodhisattas, mounted a well-trained noble chariot and performed the Great Renunciation. (This is to be taken as the great going forth to the forest, or the going forth into the forest where the great going forth took place).
Hai vị Bồ-tát Vipassī và Kakusandha đã thực hiện Đại xuất gia bằng cách cưỡi cỗ xe ngựa quý đã được chuẩn bị.
Sikhī koṇāgamanoti ime dve hatthikkhandhavaragatā hutvā nikkhamiṃsu.
Sikhī and Koṇāgamana, these two, went forth seated on the back of excellent elephants.
Sikhī và Koṇāgamana đã xuất gia bằng cách cưỡi trên lưng voi quý.
Vessabhū suvaṇṇasivikāya nisīditvā nikkhami.
Vessabhū went forth seated in a golden palanquin.
Vessabhū đã xuất gia bằng cách ngồi trên kiệu vàng.
Kassapo uparipāsāde mahātale nisinnova ānāpānacatutthajjhānaṃ nibbattetvā jhānā uṭṭhāya taṃ jhānaṃ pādakaṃ katvā – ‘‘pāsādo uggantvā bodhimaṇḍe otaratū’’ti adhiṭṭhāsi.
Kassapa, seated on the highest floor of the palace, developed the fourth jhāna of Anāpāna, rose from that jhāna, and making that jhāna his basis, he resolved, "May the palace rise up and descend onto the Bodhimaṇḍa."
Kassapa thì ngồi trên tầng cao nhất của cung điện, chứng đắc Tứ thiền Ānāpāna, rồi xuất khỏi thiền, lấy thiền đó làm nền tảng và quyết định: “Cung điện này hãy bay lên và hạ xuống tại Bồ-đề đạo tràng!”
Pāsādo ākāsena gantvā bodhimaṇḍe otari.
The palace went through the air and descended onto the Bodhimaṇḍa.
Cung điện bay trên không trung và hạ xuống tại Bồ-đề đạo tràng.
Mahāpurisopi tato otaritvā bhūmiyaṃ ṭhatvā – ‘‘pāsādo yathāṭhāneyeva patiṭṭhātū’’ti cintesi.
The Great Being then descended from it, stood on the ground, and thought, "May the palace be established in its original place."
Vị Đại nhân cũng từ đó đi xuống, đứng trên mặt đất và suy nghĩ: “Cung điện hãy an vị tại chỗ cũ!”
So yathāṭhāne patiṭṭhāsi.
It was established in its original place.
Nó đã an vị tại chỗ cũ.
Mahāpurisopi satta divasāni padhānamanuyuñjitvā bodhipallaṅke nisīditvā sabbaññutaṃ paṭivijjhi.
The Great Being, having practiced exertion for seven days, sat on the Bodhipallaṅka and penetrated omniscience.
Vị Đại nhân cũng đã tinh tấn trong bảy ngày, rồi ngồi trên Bồ-đề tòa và chứng đắc Nhất thiết trí.
Amhākaṃ pana bodhisatto kaṇṭakaṃ assavaramāruyha nikkhantoti.
However, our Bodhisatta went forth mounted on the excellent horse Kaṇṭaka.
Còn Bồ-tát của chúng ta thì xuất gia bằng cách cưỡi ngựa quý Kaṇṭaka.
Ayaṃ yānaparicchedo.
This is the section on conveyances.
Đây là phần phân loại phương tiện.
59
Vipassissa pana bhagavato yojanappamāṇe padese vihāro patiṭṭhāsi, sikhissa tigāvute, vessabhussa aḍḍhayojane, kakusandhassa gāvute, koṇāgamanassa aḍḍhagāvute, kassapassa vīsatiusabhe.
For the Blessed One Vipassī, the monastery was established on a site one yojana in extent; for Sikhī, three gāvutas; for Vessabhū, half a yojana; for Kakusandha, one gāvuta; for Koṇāgamana, half a gāvuta; for Kassapa, twenty usabhas.
Tịnh xá của Đức Thế Tôn Vipassī được xây dựng trên một khu đất rộng một dojana; của Sikhī là ba gāvuta; của Vessabhū là nửa dojana; của Kakusandha là một gāvuta; của Koṇāgamana là nửa gāvuta; của Kassapa là hai mươi usabha.
Amhākaṃ bhagavato pakatimānena soḷasakarīse, rājamānena aṭṭhakarīse padese vihāro patiṭṭhitoti.
For our Blessed One, the monastery was established on a site sixteen karīsas by the ordinary measure, or eight karīsas by the royal measure.
Tịnh xá của Đức Thế Tôn của chúng ta được xây dựng trên một khu đất rộng mười sáu karīsa theo thước đo thông thường, và tám karīsa theo thước đo của vua.
Ayaṃ vihāraparicchedo.
This is the section on monasteries.
Đây là phần phân loại tịnh xá.
60
Vipassissa pana bhagavato ekaratanāyāmā vidatthivitthārā aṭṭhaṅgulubbedhā suvaṇṇiṭṭhakā kāretvā cūḷaṃsena chādetvā vihāraṭṭhānaṃ kiṇiṃsu.
In this regard, for the Blessed One Vipassī, golden bricks one cubit long, one span wide, and eight finger-breadths thick were made, and the monastery site was purchased by covering it with these bricks (or with smaller portions of gold).
Trong đó, đối với Đức Thế Tôn Vipassī, họ đã làm những viên gạch vàng dài một ratana, rộng một vidatthi, dày tám ngón tay, rồi dùng một phần nhỏ của chúng để lợp, và mua khu đất tịnh xá.
Sikhissa suvaṇṇayaṭṭhiphālehi chādetvā kiṇiṃsu.
For Sikhī, it was purchased by covering it with gold bar-like fragments.
Đối với Sikhī, họ đã lợp bằng những thanh vàng giống như răng nanh và mua đất.
Vessabhussa suvaṇṇahatthipādāni kāretvā tesaṃ cūḷaṃsena chādetvā kiṇiṃsu.
For Vessabhū, golden elephant-foot shaped blocks were made, and the site was purchased by covering it with these.
Đối với Vessabhū, họ đã làm những khối vàng lớn bằng chân voi, rồi dùng một phần nhỏ của chúng để lợp và mua đất.
Kakusandhassa vuttanayeneva suvaṇṇiṭṭhakāhi chādetvā kiṇiṃsu.
For Kakusandha, it was purchased by covering it with golden bricks in the manner stated.
Đối với Kakusandha, họ đã lợp bằng gạch vàng theo cách đã nói và mua đất.
Koṇāgamanassa vuttanayeneva suvaṇṇakacchapehi chādetvā kiṇiṃsu.
For Koṇāgamana, it was purchased by covering it with golden tortoise figures in the manner stated.
Đối với Koṇāgamana, họ đã lợp bằng những con rùa vàng theo cách đã nói và mua đất.
Kassapassa suvaṇṇakaṭṭīhiyeva chādetvā kiṇiṃsu.
For Kassapa, it was purchased by covering it with gold ingots.
Đối với Kassapa, họ đã lợp bằng những thanh vàng và mua đất.
Amhākaṃ bhagavato salakkhaṇānaṃ kahāpaṇānaṃ cūḷaṃsena chādetvā kiṇiṃsu.
For our Blessed One, it was purchased by covering it with a small portion of Kahāpaṇas bearing royal marks.
Đối với Đức Thế Tôn của chúng ta, họ đã dùng một phần nhỏ của những đồng tiền vàng có dấu hiệu để lợp và mua đất.
Ayaṃ vihārabhūmiggahaṇadhanaparicchedo.
This is the section on the wealth used to acquire the monastery land.
Đây là phần phân loại tiền mua đất tịnh xá.
61
Tattha vipassissa bhagavato tathā bhūmiṃ kiṇitvā vihāraṃ katvā dinnupaṭṭhāko punabbasumitto nāma ahosi, sikhissa sirivaḍḍhano nāma, vessabhussa sotthiyo nāma, kakusandhassa accuto nāma, koṇāgamanassa uggo nāma, kassapassa sumano nāma, amhākaṃ bhagavato sudatto nāma.
Among these, for the Blessed One Vipassī, the attendant who purchased the land and built the monastery was named Punabbasu-mitta; for Sikhī, Sirivaḍḍhana; for Vessabhū, Sotthiya; for Kakusandha, Accuta; for Koṇāgamana, Ugga; for Kassapa, Sumana; and for our Blessed One, Sudatta.
Trong đó, người hộ độ đã mua đất và xây tịnh xá dâng cúng cho Đức Thế Tôn Vipassī là Punabbasumitta, cho Sikhī là Sirivaḍḍhana, cho Vessabhū là Sotthiya, cho Kakusandha là Accuta, cho Koṇāgamana là Ugga, cho Kassapa là Sumana, và cho Đức Thế Tôn của chúng ta là Sudatta.
Sabbe cete gahapatimahāsālā seṭṭhino ahesunti.
All these householders were great wealthy merchants and bankers.
Tất cả những vị này đều là các gia chủ đại phú, các trưởng giả.
Ayaṃ upaṭṭhākaparicchedo nāma.
This is called the section on chief attendants.
Đây là phần phân loại người hộ độ.
62
Aparāni cattāri avijahitaṭṭhānāni nāma honti.
There are also four unabandoned places.
Có bốn nơi khác không bị từ bỏ.
Sabbabuddhānañhi bodhipallaṅko avijahito, ekasmiṃyeva ṭhāne hoti.
Indeed, the Bodhi-pallaṅka of all Buddhas is never abandoned; it is always in the same place.
Bồ-đề tòa của tất cả các vị Phật không bị từ bỏ, luôn ở cùng một nơi.
Dhammacakkappavattanaṃ isipatane migadāye avijahitameva hoti.
The turning of the Wheel of Dhamma always takes place at Isipatana Migadāya.
Việc chuyển Pháp luân tại Isipatana Migadāya (Vườn Nai) cũng không bị từ bỏ.
Devorohanakāle saṅkassanagaradvāre paṭhamapadagaṇṭhikā avijahitāva hoti.
At the time of descent from the deva realm, the first footprint at the gate of Saṅkassa city is never abandoned.
Vào thời chư thiên giáng trần, dấu chân đầu tiên tại cổng thành Saṅkassa cũng không bị từ bỏ.
Jetavane gandhakuṭiyā cattāri mañcapādaṭṭhānāni avijahitāneva honti.
In the Jetavana, the four places for the feet of the couch in the Fragrant Hut are never abandoned.
Bốn vị trí chân giường trong hương thất tại Jetavana cũng không bị từ bỏ.
Vihāro pana khuddakopi mahantopi hoti, vihāropi na vijahitoyeva, nagaraṃ pana vijahati.
However, a monastery can be small or large, and the monastery is also not abandoned; but the city is abandoned.
Còn tịnh xá thì có thể nhỏ hoặc lớn, tịnh xá cũng không bị từ bỏ, nhưng thành phố thì có thể thay đổi.
Yadā nagaraṃ pācīnato hoti, tadā vihāro pacchimato; yadā nagaraṃ dakkhiṇato, tadā vihāro uttarato.
When the city is to the east, the monastery is to the west; when the city is to the south, the monastery is to the north.
Khi thành phố ở phía đông, tịnh xá ở phía tây; khi thành phố ở phía nam, tịnh xá ở phía bắc.
Yadā nagaraṃ pacchimato, tadā vihāro pācīnato; yadā nagaraṃ uttarato, tadā vihāro dakkhiṇato.
When the city is to the west, the monastery is to the east; when the city is to the north, the monastery is to the south.
Khi thành phố ở phía tây, tịnh xá ở phía đông; khi thành phố ở phía bắc, tịnh xá ở phía nam.
Idāni pana nagaraṃ uttarato, vihāro dakkhiṇato.
Currently, the city is to the north, and the monastery is to the south.
Hiện nay, thành phố ở phía bắc, và tịnh xá ở phía nam.
63
Sabbabuddhānañca āyuvemattaṃ, pamāṇavemattaṃ, kulavemattaṃ, padhānavemattaṃ, rasmivemattanti pañca vemattāni honti.
And for all Buddhas, there are five differences: differences in lifespan, in physical stature, in family lineage, in spiritual exertion, and in radiance.
Tất cả chư Phật có năm sự khác biệt: khác biệt về tuổi thọ, khác biệt về tầm vóc, khác biệt về dòng dõi, khác biệt về sự tinh tấn, và khác biệt về hào quang.
Āyuvemattaṃ nāma keci dīghāyukā honti, keci appāyukā.
Difference in lifespan means that some are long-lived, and some are short-lived.
Khác biệt về tuổi thọ nghĩa là một số vị có tuổi thọ dài, một số vị có tuổi thọ ngắn.
Tathā hi dīpaṅkarassa vassasatasahassaṃ āyuppamāṇaṃ ahosi, amhākaṃ bhagavato vassasataṃ āyuppamāṇaṃ.
Thus, the lifespan of Dīpaṅkara was one hundred thousand years, and the lifespan of our Blessed One was one hundred years.
Thật vậy, Đức Phật Dīpaṅkara có tuổi thọ một trăm ngàn năm, còn Đức Thế Tôn của chúng ta có tuổi thọ một trăm năm.
64
Pamāṇavemattaṃ nāma keci dīghā honti keci rassā.
Difference in physical stature means that some are tall, and some are short.
Khác biệt về tầm vóc nghĩa là một số vị cao, một số vị thấp.
Tathā hi dīpaṅkaro asītihattho ahosi, sumano navutihattho, amhākaṃ bhagavā aṭṭhārasahattho.
Thus, Dīpaṅkara was eighty cubits tall, Sumana was ninety cubits tall, and our Blessed One was eighteen cubits tall.
Thật vậy, Đức Phật Dīpaṅkara cao tám mươi cubit, Đức Phật Sumana cao chín mươi cubit, còn Đức Thế Tôn của chúng ta cao mười tám cubit.
65
Kulavemattaṃ nāma keci khattiyakule nibbattanti, keci brāhmaṇakule.
Difference in family lineage means that some are born into a warrior (khattiya) family, and some into a brahmin family.
Khác biệt về dòng dõi nghĩa là một số vị sinh ra trong dòng dõi Sát-đế-lợi, một số vị sinh ra trong dòng dõi Bà-la-môn.
Padhānavemattaṃ nāma kesañci padhānaṃ ittarakālameva hoti, yathā kassapassa bhagavato.
Difference in spiritual exertion (padhāna) means that for some, the period of exertion is short, like for Kassapa the Blessed One.
Khác biệt về sự tinh tấn nghĩa là sự tinh tấn của một số vị chỉ diễn ra trong thời gian ngắn, như của Đức Thế Tôn Kassapa.
Kesañci addhaniyaṃ, yathā amhākaṃ bhagavato.
For some, it is long, like for our Blessed One.
Còn sự tinh tấn của một số vị kéo dài, như của Đức Thế Tôn của chúng ta.
66
Rasmivemattaṃ nāma maṅgalassa bhagavato sarīrarasmi dasasahassilokadhātuppamāṇā ahosi.
Difference in radiance means that the bodily radiance of Maṅgala the Blessed One extended for the measure of ten thousand world-systems.
Khác biệt về hào quang nghĩa là hào quang từ thân của Đức Thế Tôn Maṅgala có tầm vóc bằng mười ngàn thế giới.
Amhākaṃ bhagavato samantā byāmamattā.
For our Blessed One, it extended for one fathom all around.
Còn hào quang từ thân của Đức Thế Tôn của chúng ta chỉ rộng một sải tay về mọi phía.
Tatra rasmivemattaṃ ajjhāsayappaṭibaddhaṃ, yo yattakaṃ icchati, tassa tattakaṃ sarīrappabhā pharati.
Among these, the difference in radiance is dependent on the Buddha’s aspiration: as far as one wishes, so far does one’s bodily glow radiate.
Ở đây, sự khác biệt về hào quang tùy thuộc vào ý nguyện; vị nào muốn hào quang tỏa ra bao nhiêu thì ánh sáng từ thân của vị ấy tỏa ra bấy nhiêu.
Maṅgalassa pana niccampi dasasahassilokadhātuṃ pharatūti ajjhāsayo ahosi.
But Maṅgala’s aspiration was that his radiance should always extend to ten thousand world-systems.
Tuy nhiên, Đức Maṅgala luôn có ý nguyện rằng hào quang của Ngài sẽ tỏa khắp mười ngàn thế giới.
Paṭividdhaguṇesu pana kassaci vemattaṃ nāma natthi.
However, regarding the qualities realized through penetration, there is no difference for anyone.
Tuy nhiên, đối với các phẩm chất đã được chứng đắc, không có sự khác biệt nào cả.
67
Aparaṃ amhākaṃyeva bhagavato sahajātaparicchedañca nakkhattaparicchedañca dīpesuṃ.
Furthermore, they explained the co-born companions and the astrological configurations (nakkhatta) of our own Blessed One.
Ngoài ra, họ cũng đã trình bày về những người đồng sinh và các chòm sao liên quan đến Đức Thế Tôn của chúng ta.
Sabbaññubodhisattena kira saddhiṃ rāhulamātā, ānandatthero, channo, kaṇṭako, nidhikumbho, mahābodhi, kāḷudāyīti imāni satta sahajātāni.
Indeed, along with the All-Knowing Bodhisatta, the seven co-born companions were Rāhulamātā, Venerable Ānanda, Channa, Kaṇṭaka, the four treasure jars, the Mahābodhi tree, and Kāḷudāyī.
Thật vậy, cùng với vị Bồ-tát Toàn Giác, có bảy người đồng sinh là: mẫu thân của Rāhula, Trưởng lão Ānanda, Channa, con ngựa Kaṇṭaka, bốn chum kho báu, cây Đại Bồ-đề, và Kāludāyī.
Mahāpuriso ca uttarāsāḷhanakkhatteneva mātukucchiṃ okkami, mahābhinikkhamanaṃ nikkhami, dhammacakkaṃ pavattesi, yamakapāṭihāriyaṃ akāsi.
And the Great Being entered his mother's womb, departed on the Great Renunciation, set in motion the Wheel of Dhamma, and performed the Twin Miracle, all under the Uttarāsāḷha constellation.
Đức Đại Nhân đã nhập thai mẹ dưới chòm sao Uttarāsāḷha, xuất gia Đại Biến Ly, chuyển Pháp Luân, và thực hiện Song Thông Biến.
Visākhānakkhattena jāto ca abhisambuddho ca parinibbuto ca.
He was born, attained full enlightenment, and passed into Parinibbāna under the Visākhā constellation.
Ngài đản sinh, thành đạo và nhập Niết-bàn dưới chòm sao Visākhā.
Māghanakkhattenassa sāvakasannipāto ca ahosi, āyusaṅkhārossajjanañca, assayujanakkhattena devorohananti ettakaṃ āharitvā dīpetabbaṃ.
His assembly of disciples and his relinquishing of the life-span (āyusaṅkhāra) occurred under the Māgha constellation, and his descent from the deva realm under the Assayuja constellation—so much should be brought forth and explained.
Dưới chòm sao Māgha, có cuộc hội họp của các đệ tử và sự xả bỏ thọ hành của Ngài; dưới chòm sao Assayuja, có sự giáng trần từ cõi trời. Cần phải trình bày những điều này.
Ayaṃ sambahulaparicchedo nāma.
This is called the section on various classifications.
Đây được gọi là sự phân loại đa dạng.
68
13. Idāni atha kho tesaṃ bhikkhūnantiādīsu te bhikkhū – ‘‘āvuso, pubbenivāsassa nāma ayaṃ gati, yadidaṃ cutito paṭṭhāya paṭisandhiārohanaṃ.
13. Now, in the passage starting with “ Then, bhikkhus, to those bhikkhus,” those bhikkhus—having become utterly amazed, thinking, “Friends, this is the nature of the recollection of past lives (pubbenivāsa), that is, ascending to rebirth starting from death.
13. Bây giờ, trong câu “ Rồi các Tỳ-khưu ấy” và các câu tiếp theo, các Tỳ-khưu ấy đã nói: “Này chư Hiền, đây là bản chất của túc mạng trí, tức là sự tái sinh từ khi chết.
Yaṃ pana idaṃ paṭisandhito paṭṭhāya pacchāmukhaṃ ñāṇaṃ pesetvā cuti gantabbaṃ, idaṃ atigarukaṃ.
But to send the knowledge backward, starting from rebirth, to reach death—this is extremely difficult.
Nhưng việc phóng trí tuệ ngược về quá khứ từ khi tái sinh để đi đến cái chết thì lại vô cùng khó khăn.
Ākāse padaṃ dassento viya bhagavā kathesī’’ti ativimhayajātā hutvā – ‘‘acchariyaṃ, āvuso,’’tiādīni vatvā puna aparampi kāraṇaṃ dassento – ‘‘yatra hi nāma tathāgato’’tiādimāhaṃsu.
The Blessed One spoke as if showing a footprint in the sky!”—said, “It is wonderful, friends,” and so on, and then, to show another reason, they continued, “ How is it possible that the Tathāgata…”
Đức Thế Tôn đã thuyết giảng như thể Ngài đang chỉ ra dấu chân trên hư không,” và sau khi nói những lời như “Thật kỳ diệu, này chư Hiền,” các vị ấy lại tiếp tục trình bày một lý do khác bằng cách nói “Này chư Hiền, Như Lai…”.
Tattha yatra hi nāmāti acchariyatthe nipāto, yo nāma tathāgatoti attho.
Here, the particle yatra hi nāma is used in the sense of wonder, meaning, “Who is this Tathāgata (who can remember)?”
Ở đó, từ “ yatra hi nāma” là một tiểu từ mang ý nghĩa kỳ diệu, có nghĩa là “Như Lai nào”.
Chinnapapañceti ettha papañcā nāma taṇhā māno diṭṭhīti ime tayo kilesā.
In chinnapapañce, the papañcas are these three defilements: craving, conceit, and wrong views.
Trong cụm từ “ chinnapapañce” (đã đoạn trừ papañca), papañca là ba phiền não này: tham ái, kiêu mạn, và tà kiến.
Chinnavaṭumeti ettha vaṭumanti kusalākusalakammavaṭṭaṃ vuccati.
In chinnavaṭume, vaṭuma refers to the cycle of kamma, both wholesome and unwholesome.
Trong cụm từ “ chinnavaṭume” (đã đoạn trừ vaṭuma), “vaṭuma” được gọi là vòng luân hồi của nghiệp thiện và bất thiện.
Pariyādinnavaṭṭeti tasseva vevacanaṃ, pariyādinnasabbakammavaṭṭeti attho.
Pariyādinnavaṭṭe is a synonym for that, meaning "whose entire cycle of kamma has been taken away."
Pariyādinnavaṭṭe” là từ đồng nghĩa của từ đó, có nghĩa là “đã đoạn trừ hoàn toàn vòng luân hồi của tất cả các nghiệp”.
Sabbadukkhavītivatteti sabbaṃ vipākavaṭṭasaṅkhātaṃ dukkhaṃ vītivatte.
Sabbadukkhavītivatte means transcending all suffering, which is the cycle of results (vipāka-vaṭṭa).
Sabbadukkhavītivatte” (đã vượt qua mọi khổ đau) là đã vượt qua mọi khổ đau được gọi là vòng luân hồi của quả báo.
Anussarissatīti idaṃ yatrāti nipātavasena anāgatavacanaṃ, attho panettha atītavasena veditabbo.
Anussarissati is a future tense word due to the particle yatrā, but its meaning here should be understood in the past tense.
Từ “ anussarissati” này là một từ ở thì tương lai theo cách dùng của tiểu từ “yatrā”, nhưng ý nghĩa ở đây cần được hiểu theo thì quá khứ.
Bhagavā hi te buddhe anussari, na idāni anussarissati.
For the Blessed One remembered those Buddhas; he will not remember them now.
Vì Đức Thế Tôn đã nhớ lại các vị Phật đó, chứ không phải bây giờ Ngài sẽ nhớ lại.
Evaṃsīlāti maggasīlena phalasīlena lokiyalokuttarasīlena evaṃsīlā.
Evaṃsīlā means "having such sīla" by way of magga-sīla, phala-sīla, and mundane and supramundane sīla.
Evaṃsīlā” (có giới như vậy) là có giới như vậy bởi giới của đạo lộ, giới của quả vị, giới thế gian và giới xuất thế gian.
Evaṃdhammāti ettha samādhipakkhā dhammā adhippetā, maggasamādhinā phalasamādhinā lokiyalokuttarasamādhinā, evaṃsamādhayoti attho.
In evaṃdhammā, the qualities pertaining to concentration (samādhi) are intended, meaning "having such samādhi" by way of magga-samādhi, phala-samādhi, and mundane and supramundane samādhi.
Trong cụm từ “ evaṃdhammā” (có pháp như vậy), các pháp thuộc về định được đề cập, có nghĩa là có định như vậy bởi định của đạo lộ, định của quả vị, định thế gian và định xuất thế gian.
Evaṃpaññāti maggapaññādivaseneva evaṃpaññā.
Evaṃpaññā means "having such wisdom" by way of magga-paññā, and so on.
Evaṃpaññā” (có tuệ như vậy) là có tuệ như vậy chỉ bằng tuệ của đạo lộ, v.v.
Evaṃvihārīti ettha pana heṭṭhā samādhipakkhānaṃ dhammānaṃ gahitattā vihāro gahitova puna kasmā gahitameva gaṇhātīti ce; na idaṃ gahitameva, idañhi nirodhasamāpattidīpanatthaṃ vuttaṃ.
If it is asked why, in evaṃvihārī, dwelling (vihāra) is taken again, even though the qualities pertaining to concentration were already taken above (in evaṃdhammā), it is not a repetition; this is stated to explain the attainment of cessation (nirodhasamāpatti).
Nếu hỏi tại sao trong cụm từ “ evaṃvihārī” (an trú như vậy), sự an trú lại được đề cập lại, trong khi các pháp thuộc về định đã được đề cập ở trên; thì đây không phải là sự đề cập lại, mà là được nói ra để làm sáng tỏ sự nhập Diệt Thọ Tưởng Định.
Tasmā evaṃ nirodhasamāpattivihārī te bhagavanto ahesunti evamettha attho daṭṭhabbo.
Therefore, the meaning here should be understood as: “Those Blessed Ones were thus dwellers in the attainment of cessation.”
Vì vậy, ý nghĩa ở đây cần được hiểu là: “Các Đức Thế Tôn ấy đã an trú trong Diệt Thọ Tưởng Định như vậy.”
69
Evaṃvimuttāti ettha vikkhambhanavimutti, tadaṅgavimutti, samucchedavimutti, paṭippassaddhivimutti, nissaraṇavimuttīti pañcavidhā vimutti.
Evaṃvimuttā: Here, there are five kinds of liberation: suppression-liberation (vikkhambhanavimutti), liberation by substitution of opposites (tadaṅgavimutti), eradication-liberation (samucchedavimutti), tranquilisation-liberation (paṭippassaddhivimutti), and escape-liberation (nissaraṇavimutti).
14. Trong cụm từ “ Evaṃvimuttā” (đã giải thoát như vậy), có năm loại giải thoát: vikkhambhanavimutti (giải thoát bằng cách trấn áp), tadaṅgavimutti (giải thoát từng phần), samucchedavimutti (giải thoát bằng cách đoạn trừ), paṭippassaddhivimutti (giải thoát bằng cách an tịnh), và nissaraṇavimutti (giải thoát bằng cách thoát ly).
Tattha aṭṭha samāpattiyo sayaṃ vikkhambhitehi nīvaraṇādīhi vimuttattā vikkhambhanavimuttīti saṅkhyaṃ gacchanti.
Among these, the eight attainments (samāpattis) are called suppression-liberation because they are liberated from the hindrances, etc., by suppressing them.
Trong đó, tám thiền định được gọi là vikkhambhanavimutti vì chúng đã giải thoát khỏi các triền cái, v.v., bằng cách tự trấn áp.
Aniccānupassanādikā sattānupassanā sayaṃ tassa tassa paccanīkaṅgavasena pariccattāhi niccasaññādīhi vimuttattā tadaṅgavimuttīti saṅkhyaṃ gacchanti.
The seven contemplations beginning with the contemplation of impermanence (aniccānupassanā) are called liberation by substitution of opposites because they are liberated from perceptions of permanence, etc., by abandoning them through their respective opposing factors.
Bảy quán tưởng, bắt đầu bằng quán tưởng về vô thường, được gọi là tadaṅgavimutti vì chúng đã giải thoát khỏi các tưởng về thường, v.v., bằng cách tự từ bỏ theo phương pháp đối trị từng phần.
Cattāro ariyamaggā sayaṃ samucchinnehi kilesehi vimuttattā samucchedavimuttīti saṅkhyaṃ gacchanti.
The four Noble Paths (ariyamagga) are called eradication-liberation because they are liberated from defilements completely cut off by themselves.
Bốn Thánh Đạo được gọi là samucchedavimutti vì chúng đã giải thoát khỏi các phiền não đã được đoạn trừ hoàn toàn.
Cattāri sāmaññaphalāni maggānubhāvena kilesānaṃ paṭippassaddhante uppannattā paṭippassaddhivimuttīti saṅkhyaṃ gacchanti.
The four fruits of recluseship (sāmaññaphala) are called tranquilisation-liberation because they arise upon the tranquilisation of defilements through the power of the Paths.
Bốn quả vị Sa-môn được gọi là paṭippassaddhivimutti vì chúng phát sinh khi các phiền não đã được an tịnh nhờ năng lực của đạo lộ.
Nibbānaṃ sabbakilesehi nissaṭattā apagatattā dūre ṭhitattā nissaraṇavimuttīti saṅkhyaṃ gacchati.
Nibbāna is called escape-liberation because it has escaped, departed, and stands far away from all defilements.
Niết-bàn được gọi là nissaraṇavimutti vì nó đã thoát ly, đã lìa xa, và đứng cách xa tất cả các phiền não.
Iti imāsaṃ pañcannaṃ vimuttīnaṃ vasena – ‘‘evaṃ vimuttā’’ti ettha attho daṭṭhabbo.
Thus, the meaning of “evaṃ vimuttā” should be understood by way of these five liberations.
Vì vậy, ý nghĩa của cụm từ “evaṃ vimuttā” ở đây cần được hiểu theo năm loại giải thoát này.
70
14. Paṭisallānā vuṭṭhitoti ekībhāvā vuṭṭhito.
14. Paṭisallānā vuṭṭhito means "having risen from solitude (ekībhāva)."
14. “ Paṭisallānā vuṭṭhito” nghĩa là đã xuất khỏi sự độc cư.
71
16. ‘‘Ito so, bhikkhave’’ti ko anusandhi?
16. “From this, bhikkhus, is that…” What is the connection?
16. “ Này các Tỳ-khưu, đó là từ đây”—sự liên kết là gì?
Idañhi suttaṃ – ‘‘tathāgatassevesā, bhikkhave, dhammadhātu suppaṭividdhā’’ti ca ‘‘devatāpi tathāgatassa etamatthaṃ ārocesu’’nti ca imehi dvīhi padehi ābaddhaṃ.
This Sutta is connected by these two phrases: “This Dhamma element, bhikkhus, was perfectly penetrated by the Tathāgata,” and “The devas, too, informed the Tathāgata of this matter.”
Thật vậy, bài kinh này được liên kết bởi hai cụm từ: “Này các Tỳ-khưu, Pháp tính này đã được Như Lai chứng ngộ hoàn toàn” và “Chư Thiên cũng đã báo cáo điều này cho Như Lai”.
Tattha devatārocanapadaṃ suttantapariyosāne devacārikakolāhalaṃ dassento vicāressati.
Here, the phrase about the devas' informing will be examined at the end of the Sutta, explaining the uproar of the deva messengers.
Trong đó, cụm từ về sự báo cáo của chư Thiên sẽ được giải thích ở cuối bài kinh, khi trình bày về sự ồn ào của chư Thiên du hành.
Dhammadhātupadānusandhivasena pana ayaṃ desanā āraddhā.
However, this discourse was commenced by way of the connection with the phrase about the Dhamma element.
Tuy nhiên, bài thuyết giảng này được bắt đầu dựa trên sự liên kết với cụm từ Pháp tính.
Tattha khattiyo jātiyātiādīni ekādasapadāni nidānakaṇḍe vuttanayeneva veditabbāni.
Here, the eleven phrases starting with “a khattiya by birth” should be understood in the same way as stated in the Nidāna-kaṇḍa (Introduction section).
Ở đó, mười một cụm từ bắt đầu bằng “ Khattiyo jātiyā” (sinh ra trong dòng dõi Sát-đế-lợi) cần được hiểu theo cách đã được trình bày trong phần dẫn nhập.
72
Bodhisattadhammatāvaṇṇanā
Description of the Bodhisatta’s Nature
Giải thích về Pháp tính của Bồ-tát
73
17. Atha kho, bhikkhave, vipassī bodhisattotiādīsu pana vipassīti tassa nāmaṃ, tañca kho vividhe atthe passanakusalatāya laddhaṃ.
17. Now, in passages like “Then, bhikkhus, Vipassī the Bodhisatta…”, Vipassī is his name, obtained because of his skill in seeing various meanings.
17. Trong các câu “ Rồi này các Tỳ-khưu, Bồ-tát Vipassī” và các câu tiếp theo, “ Vipassī” là tên của Ngài, và tên đó được đặt vì Ngài khéo léo thấy rõ các ý nghĩa khác nhau.
Bodhisattoti paṇḍitasatto bujjhanakasatto.
Bodhisatta means a wise being, a being destined for awakening.
Bodhisatto” (Bồ-tát) là một chúng sinh có trí tuệ, một chúng sinh sẽ giác ngộ.
Bodhisaṅkhātesu vā catūsu maggesu satto āsatto laggamānasoti bodhisatto.
Or, it means a being devoted to (satta) and attached to the four Paths, which are called Bodhi.
Hoặc Bồ-tát là chúng sinh đã an trú, đã gắn bó tâm ý vào bốn đạo lộ được gọi là Bồ-đề.
Sato sampajānoti ettha satoti satiyeva.
In the phrase sato sampajāno, sato means mindfulness (sati) itself.
Trong cụm từ “ sato sampajāno” (có niệm, có tỉnh giác), “ sato” chỉ là niệm.
Sampajānoti ñāṇaṃ.
Sampajāno means wisdom (ñāṇa).
Sampajāno” là trí tuệ.
Satiṃ sūpaṭṭhitaṃ katvā ñāṇena paricchinditvā mātukucchiṃ okkamīti attho.
The meaning is that, having established mindfulness well and discerned with wisdom, he entered his mother's womb.
Ý nghĩa là: sau khi thiết lập niệm một cách vững chắc và phân biệt bằng trí tuệ, Ngài đã nhập vào thai mẹ.
Okkamīti iminā cassa okkantabhāvo pāḷiyaṃ dassito, na okkamanakkamo.
With this word okkamī, his having entered is shown in the Pāḷi, not the sequence of entry.
Bằng từ “ okkamī” (đã nhập), trạng thái nhập của Ngài được chỉ ra trong Pāḷi, chứ không phải trình tự nhập.
So pana yasmā aṭṭhakathaṃ ārūḷho, tasmā evaṃ veditabbo –
But since it has been included in the Aṭṭhakathā, it should be understood as follows:
Tuy nhiên, vì điều đó đã được đưa vào Chú giải, nên cần được hiểu như sau:
74
Sabbabodhisattā hi samatiṃsa pāramiyo pūretvā, pañca mahāpariccāge pariccajitvā, ñātatthacariyalokatthacariyabuddhacariyānaṃ koṭiṃ patvā, vessantarasadise tatiye attabhāve ṭhatvā, satta mahādānāni datvā, sattakkhattuṃ pathaviṃ kampetvā, kālaṅkatvā, dutiyacittavāre tusitabhavane nibbattanti.
All Bodhisattas indeed, having fulfilled the thirty perfections, having made the five great renunciations, having reached the apex of the welfare of relatives, the welfare of the world, and the welfare of Buddhahood, having remained in the third existence like Vessantara, having given the seven great offerings, having shaken the earth seven times, having passed away, are reborn in the Tusita heaven at the second thought-moment.
Tất cả các vị Bồ-tát, sau khi đã viên mãn ba mươi ba-la-mật, đã thực hành năm sự từ bỏ vĩ đại, đã đạt đến đỉnh cao của sự thực hành lợi ích cho thân quyến, lợi ích cho thế gian và lợi ích cho Phật quả, đã an trú trong kiếp sống thứ ba giống như Vessantara, đã thực hành bảy đại thí, đã khiến đất rung chuyển bảy lần, sau khi từ bỏ kiếp sống, họ tái sinh vào cõi trời Tusita trong tâm niệm thứ hai.
Vipassī bodhisattopi tatheva katvā tusitapure nibbattitvā saṭṭhisatasahassādhikā sattapaññāsa vassakoṭiyo tattha aṭṭhāsi.
Bodhisatta Vipassī also, having done likewise, was reborn in the Tusita city and remained there for fifty-seven koṭis of years, exceeding six million.
Bồ-tát Vipassī cũng đã làm như vậy, sau khi tái sinh vào cõi Tusita, Ngài đã an trú ở đó trong năm mươi bảy ngàn sáu trăm vạn kiếp tuổi thọ.
Aññadā pana dīghāyukadevaloke nibbattā bodhisattā na yāvatāyukaṃ tiṭṭhanti.
However, at other times, Bodhisattas born in long-lived deva realms do not remain for their full lifespan.
Tuy nhiên, các vị Bồ-tát tái sinh vào các cõi trời có tuổi thọ dài không an trú trọn vẹn tuổi thọ của mình.
Kasmā?
Why?
Tại sao?
Tattha pāramīnaṃ duppūraṇīyattā.
Because the perfections are difficult to fulfill there.
Vì ở đó, các ba-la-mật rất khó để viên mãn.
Te adhimuttikālakiriyaṃ katvā manussapatheyeva nibbattanti.
Those (Bodhisattas), having performed the death-moment of resolute intention, are reborn only in the human realm.
Các Ngài đã thực hiện sự chuyển kiếp do ý muốn (adhimuttikālakiriyaṃ) và tái sinh vào cõi người.
Pāramīnaṃ pūrento pana yathā idāni ekena attabhāvena sabbaññutaṃ upanetuṃ sakkonti, evaṃ sabbaso pūritattā tadā vipassī bodhisatto tattha yāvatāyukaṃ aṭṭhāsi.
But since his perfections were completely fulfilled in such a way that he could attain Omniscience in that one life, Bodhisatta Vipassī then remained there for his full lifespan.
Nhưng Bồ-tát Vipassī, vì đã viên mãn các ba-la-mật một cách hoàn hảo, đến mức Ngài có thể đạt được Toàn Giác trong một kiếp sống duy nhất như bây giờ, nên Ngài đã an trú trọn vẹn tuổi thọ ở đó.
75
Devatānaṃ pana – ‘‘manussānaṃ gaṇanāvasena idāni sattahi divasehi cuti bhavissatī’’ti pañca pubbanimittāni uppajjanti – mālā milāyanti, vatthāni kilissanti, kacchehi sedā muccanti, kāye dubbaṇṇiyaṃ okkamati, devo devāsane na saṇṭhāti.
Then, for the devas, these five premonitory signs arise, indicating, "Death will occur in seven days according to human reckoning": the garlands wilt, the garments become soiled, sweat issues from the armpits, the body takes on a poor complexion, and the deva cannot remain seated on his divine couch.
Khi các vị trời sắp lâm chung, năm dấu hiệu báo trước xuất hiện: vòng hoa héo úa, y phục dơ bẩn, mồ hôi chảy ra từ nách, thân thể trở nên xấu xí, và vị trời không còn an trú trên thiên tòa của mình.
Tattha mālāti paṭisandhiggahaṇadivase piḷandhanamālā, tā kira saṭṭhisatasahassādhikā sattapaṇṇāsa vassakoṭiyo amilāyitvā tadā milāyanti.
Among these, garlands refer to the garlands worn on the day of conception; those garlands, which had not withered for fifty-seven koṭis of years, exceeding six million, then wilt.
Trong đó, vòng hoa là những vòng hoa được đeo vào ngày tái sinh, chúng không héo úa trong suốt năm mươi bảy ngàn sáu trăm vạn năm, nhưng đến khi sắp lâm chung thì chúng héo úa.
Vatthesupi eseva nayo.
The same applies to garments.
Đối với y phục cũng vậy.
Ettakaṃ pana kālaṃ devānaṃ neva sītaṃ na uṇhaṃ hoti, tasmiṃ kāle sarīrā bindubinduvasena sedā muccanti.
For the devas, there is neither cold nor heat for such a long time, but at that time, sweat issues from their bodies in drops.
Trong suốt thời gian đó, các vị trời không cảm thấy lạnh cũng không nóng, nhưng vào thời điểm đó, mồ hôi chảy ra từ thân thể họ từng giọt từng giọt.
Ettakañca kālaṃ tesaṃ sarīre khaṇḍiccapāliccādivasena vivaṇṇatā na paññāyati, devadhītā soḷasavassuddesikā viya khāyanti, devaputtā vīsativassuddesikā viya khāyanti, maraṇakāle pana tesaṃ kilantarūpo attabhāvo hoti.
And for such a long time, no discoloration of their bodies, such as broken teeth or gray hair, is evident; female devas appear like sixteen-year-olds, and male devas appear like twenty-year-olds, but at the time of death, their bodies become weary.
Trong suốt thời gian đó, thân thể của họ không biểu hiện sự xấu xí như răng sứt, tóc bạc, v.v.; các thiên nữ trông như thiếu nữ mười sáu tuổi, các thiên tử trông như thanh niên hai mươi tuổi, nhưng vào thời điểm lâm chung, thân thể của họ trở nên mệt mỏi.
Ettakañca tesaṃ kālaṃ devaloke ukkaṇṭhitā nāma natthi, maraṇakāle pana nissasanti vijambhanti, sake āsane nābhiramanti.
And for such a long time, there is no weariness in the deva realm, but at the time of death, they sigh, yawn, and do not delight in their own seats.
Trong suốt thời gian đó, không có sự chán nản nào ở cõi trời, nhưng vào thời điểm lâm chung, họ thở dài, vươn vai và không còn vui thích trên thiên tòa của mình.
76
Imāni pana pubbanimittāni yathā loke mahāpuññānaṃ rājarājamahāmattādīnaṃyeva ukkāpātabhūmicālacandaggāhādīni nimittāni paññāyanti, na sabbesaṃ; evaṃ mahesakkhadevatānaṃyeva paññāyanti, na sabbesaṃ.
Indeed, just as in the world, these premonitory signs like falling meteors, earthquakes, and lunar eclipses appear only to those of great merit, such as kings, great ministers, and so on, but not to everyone; so too, they appear only to devas of great power, but not to all.
Những dấu hiệu báo trước này chỉ xuất hiện đối với các vị trời có đại phước báu, giống như trên thế gian, các dấu hiệu như sao băng, động đất, nhật thực, nguyệt thực, v.v., chỉ xuất hiện đối với các vị vua, đại thần có đại phước báu, chứ không phải tất cả mọi người.
Yathā ca manussesu pubbanimittāni nakkhattapāṭhakādayova jānanti, na sabbe; evaṃ tānipi na sabbadevatā jānanti, paṇḍitā eva pana jānanti.
And just as among humans, only astrologers and the like know the premonitory signs, not everyone; so too, not all devas know them, but only the wise ones know them.
Và giống như trong loài người, chỉ có các nhà chiêm tinh, v.v., mới biết các dấu hiệu báo trước, chứ không phải tất cả mọi người; thì những dấu hiệu đó cũng không phải tất cả các vị trời đều biết, mà chỉ những vị trời có trí tuệ mới biết.
Tattha ye mandena kusalakammena nibbattā devaputtā, te tesu uppannesu – ‘‘idāni ko jānāti, ‘kuhiṃ nibbattessāmā’ti’’ bhāyanti.
Among those devas, those who were reborn due to slight meritorious deeds, when those signs appear, fear, thinking, "Now, who knows where we will be reborn?"
Trong số đó, những thiên tử tái sinh do nghiệp thiện yếu kém thì khi những dấu hiệu đó xuất hiện, họ sợ hãi tự hỏi: "Bây giờ ai biết chúng ta sẽ tái sinh ở đâu?"
Ye mahāpuññā, te ‘‘amhehi dinnaṃ dānaṃ, rakkhitaṃ sīlaṃ, bhāvitaṃ bhāvanaṃ āgamma upari devalokesu sampattiṃ anubhavissāmā’’ti na bhāyanti.
Those who have great merit do not fear, thinking, "Through the merits of the dana we gave, the sīla we observed, and the bhavana we cultivated, we shall experience prosperity in higher deva realms."
Những vị có đại phước báu thì không sợ hãi, vì họ nghĩ: "Nhờ vào sự bố thí, giữ giới và tu tập mà chúng ta đã thực hiện, chúng ta sẽ hưởng thụ sự giàu sang ở các cõi trời cao hơn."
Vipassī bodhisattopi tāni pubbanimittāni disvā ‘‘idāni anantare attabhāve buddho bhavissāmī’’ti na bhāyati.
Bodhisatta Vipassī also, seeing those premonitory signs, did not fear, knowing, "Now, in the next existence, I shall become a Buddha."
Bồ-tát Vipassī cũng vậy, khi thấy những dấu hiệu báo trước đó, Ngài không sợ hãi, vì Ngài biết: "Bây giờ ta sẽ thành Phật trong kiếp sống kế tiếp."
Athassa tesu nimittesu pātubhūtesu dasasahassacakkavāḷadevatā sannipatitvā – ‘‘mārisa, tumhehi dasa pāramiyo pūrentehi na sakkasampattiṃ, na mārasampattiṃ, na brahmasampattiṃ, na cakkavattisampattiṃ patthentehi pūritā, lokanittharaṇatthāya pana buddhattaṃ patthayamānehi pūritā.
Then, when those signs appeared, the devas from ten thousand world-systems assembled and pleaded, saying, "Venerable Sir, when you fulfilled the ten perfections, you did not do so desiring the prosperity of Sakka, nor the prosperity of Māra, nor the prosperity of Brahmā, nor the prosperity of a Cakkavatti; rather, you fulfilled them aspiring to Buddhahood for the liberation of the world.
Khi những dấu hiệu đó xuất hiện, các vị trời của mười ngàn thế giới đã tề tựu lại và thỉnh cầu: "Thưa Ngài, khi Ngài viên mãn mười ba-la-mật, Ngài không phải vì mong cầu sự giàu sang của Sakka, hay sự giàu sang của Māra, hay sự giàu sang của Phạm Thiên, hay sự giàu sang của Chuyển Luân Vương mà viên mãn, mà Ngài đã viên mãn vì mong cầu Phật quả để cứu độ thế gian.
So vo, idāni kālo, mārisa, buddhattāya, samayo, mārisa, buddhattāyā’’ti yācanti.
Now is the time, Venerable Sir, for your Buddhahood; it is the proper season, Venerable Sir, for your Buddhahood."
Thưa Ngài, bây giờ là lúc để Ngài thành Phật, thưa Ngài, bây giờ là thời điểm để Ngài thành Phật."
77
Atha mahāsatto tāsaṃ devatānaṃ paṭiññaṃ adatvāva kāladīpadesakulajanettiāyuparicchedavasena pañcamahāvilokanaṃ nāma vilokesi.
Then the Great Being, without giving a promise to those devas, made the five great observations (pañcamahāvilokanaṃ) regarding the time, continent, region, family, and lifespan of his mother.
Sau đó, Đại Bồ-tát, mà không hứa hẹn với các vị trời đó, đã thực hiện năm đại quán sát, đó là quán sát thời gian, châu lục, xứ sở, dòng tộc và tuổi thọ của mẹ.
Tattha ‘‘kālo nu kho, na kālo’’ti paṭhamaṃ kālaṃ vilokesi.
First, he observed the time, asking, "Is it the right time, or not the right time?"
Trong đó, Ngài quán sát thời gian đầu tiên: "Đây có phải là thời điểm thích hợp hay không?"
Tattha vassasatasahassato uddhaṃ vaḍḍhitaāyukālo kālo nāma na hoti.
In this context, a lifespan exceeding one hundred thousand years is not considered the right time (kāla).
Trong đó, thời điểm mà tuổi thọ của chúng sinh kéo dài hơn một trăm ngàn năm thì không phải là thời điểm thích hợp.
Kasmā?
Why?
Tại sao?
Tadā hi sattānaṃ jātijarāmaraṇāni na paññāyanti, buddhānañca dhammadesanā nāma tilakkhaṇamuttā natthi.
Because at that time, the birth, aging, and death of beings are not evident, and the teachings of the Buddhas are never devoid of the three characteristics (tilakkhaṇa).
Vì vào thời điểm đó, chúng sinh không thấy rõ sự sinh, già, chết; và giáo pháp của chư Phật không vượt ngoài ba tướng (vô thường, khổ, vô ngã).
Te tesaṃ – ‘‘aniccaṃ dukkhamanattā’’ti kathentānaṃ – ‘‘kiṃ nāmetaṃ kathentī’’ti neva sotuṃ, na saddahituṃ maññanti, tato abhisamayo na hoti, tasmiṃ asati aniyyānikaṃ sāsanaṃ hoti.
When Buddhas teach them about impermanence, suffering, and non-self, those beings do not consider it worth listening to or believing, hence there is no penetration (abhisamaya), and without that, the Sasana becomes ineffectual (aniyyānikaṃ).
Khi chư Phật thuyết giảng về "vô thường, khổ, vô ngã", chúng sinh không nghĩ rằng đó là điều đáng nghe hay đáng tin, do đó không có sự giác ngộ, và nếu không có sự giác ngộ thì giáo pháp sẽ không đưa đến giải thoát.
Tasmā so akālo.
Therefore, that is an unsuitable time.
Vì vậy, đó là thời điểm không thích hợp.
Vassasatato ūnaāyukālopi kālo na hoti.
A lifespan of less than one hundred years is also not a suitable time.
Thời điểm mà tuổi thọ dưới một trăm năm cũng không phải là thời điểm thích hợp.
Kasmā?
Why?
Tại sao?
Tadā hi sattā ussannakilesā honti, ussannakilesānañca dinno ovādo ovādaṭṭhāne na tiṭṭhati, udake daṇḍarāji viya khippaṃ vigacchati.
Because at that time, beings are overwhelmed with defilements, and advice given to those overwhelmed with defilements does not remain in the place of advice; it quickly disappears like a line drawn on water.
Vì vào thời điểm đó, chúng sinh có nhiều phiền não, và lời khuyên dạy cho những người có nhiều phiền não sẽ không trụ lại được trong tâm họ, mà sẽ nhanh chóng biến mất như vết gậy trên mặt nước.
Tasmā sopi akālova.
Therefore, that too is an unsuitable time.
Vì vậy, đó cũng là thời điểm không thích hợp.
Vassasatasahassato paṭṭhāya heṭṭhā, vassasatato paṭṭhāya uddhaṃ āyukālo kālo nāma, tadā ca asītivassasahassāyukā manussā.
A lifespan from one hundred thousand years downwards and from one hundred years upwards is considered the right time; and at that time, humans had a lifespan of eighty thousand years.
Thời điểm mà tuổi thọ từ một trăm năm trở lên và từ một trăm ngàn năm trở xuống thì là thời điểm thích hợp; và vào thời điểm đó, tuổi thọ của loài người là tám mươi ngàn năm.
Atha mahāsatto – ‘‘nibbattitabbakālo’’ti kālaṃ passi.
Then the Great Being saw the time as "the time to be reborn."
Sau đó, Đại Bồ-tát thấy rằng: "Đây là thời điểm thích hợp để tái sinh."
78
Tato dīpaṃ vilokento saparivāre cattāro dīpe oloketvā – ‘‘tīsu dīpesu buddhā na nibbattanti, jambudīpeyeva nibbattantī’’ti dīpaṃ passi.
Then, observing the continent, he looked at the four continents with their retinues and saw the continent, realizing, "Buddhas are not born in the three continents; they are born only in Jambudīpa."
Sau đó, Ngài quán sát châu lục, nhìn bốn châu lục cùng với các tiểu châu, Ngài thấy: "Chư Phật không tái sinh ở ba châu lục, mà chỉ tái sinh ở Jambudīpa (Nam Thiệm Bộ Châu)," và Ngài đã quán sát châu lục đó.
79
Tato – ‘‘jambudīpo nāma mahā, dasayojanasahassaparimāṇo, katarasmiṃ nu kho padese buddhā nibbattantī’’ti desaṃ vilokento majjhimadesaṃ passi.
Then, observing the region, thinking, "Jambudīpa is vast, with a circumference of ten thousand yojanas; in which particular region are Buddhas born?", he saw the Middle Country (Majjhimadesa).
Sau đó, Ngài quán sát xứ sở: "Jambudīpa thì rộng lớn, có chu vi mười ngàn do-tuần, vậy chư Phật sẽ tái sinh ở xứ sở nào?" Ngài đã quán sát xứ Trung Bộ (Majjhimadesa).
Majjhimadeso nāma – ‘‘puratthimāya disāya gajaṅgalaṃ nāma nigamo’’tiādinā (mahāva. 259) nayena vinaye vuttova.
The Middle Country is indeed as stated in the Vinaya, beginning with "the town called Gajaṅgala to the east," and so on.
Xứ Trung Bộ là xứ đã được đề cập trong Luật tạng theo cách nói: "Ở phía đông là thị trấn tên Gajaṅgala," v.v.
So āyāmato tīṇi yojanasatāni, vitthārato aḍḍhateyyāni, parikkhepato navayojanasatānīti.
It is three hundred yojanas in length, two and a half hundred in width, and nine hundred yojanas in circumference.
Xứ đó có chiều dài ba trăm do-tuần, chiều rộng hai trăm rưỡi do-tuần, và chu vi chín trăm do-tuần.
Etasmiñhi padese buddhā paccekabuddhā aggasāvakā asīti mahāsāvakā cakkavattirājāno aññe ca mahesakkhā khattiyabrāhmaṇagahapatimahāsālā uppajjanti.
Indeed, in this region, Buddhas, Paccekabuddhas, Chief Disciples, eighty Great Disciples, Cakkavatti kings, and other powerful Khattiyas, Brāhmaṇas, and wealthy householders are born.
Chính ở xứ này mà chư Phật, chư Phật Độc Giác, các vị Thượng Thủ Thanh Văn, tám mươi vị Đại Thanh Văn, các vị Chuyển Luân Vương và các vị đại gia tộc Sát-đế-lợi, Bà-la-môn, gia chủ có oai lực lớn khác đều xuất hiện.
Idañcettha bandhumatī nāma nagaraṃ, tattha mayā nibbattitabbanti niṭṭhaṃ agamāsi.
And in this place, there is a city called Bandhumatī, and it was concluded that "I must be born there."
Và ở đây có một thành phố tên là Bandhumatī, Ngài quyết định rằng: "Ta sẽ tái sinh ở đó."
80
Tato kulaṃ vilokento – ‘‘buddhā nāma lokasammate kule nibbattanti.
Then, observing the family, he realized, "Buddhas are born into families respected by the world.
Sau đó, Ngài quán sát dòng tộc: "Chư Phật tái sinh trong dòng tộc được thế gian tôn kính.
Idāni ca khattiyakulaṃ lokasammataṃ, tattha nibbattissāmi, bandhumā nāma me rājā pitā bhavissatī’’ti kulaṃ passi.
Now, the Khattiya clan is respected by the world; I shall be born into that, and King Bandhumā will be my father." Thus he observed the family.
Bây giờ, dòng tộc Sát-đế-lợi được thế gian tôn kính, ta sẽ tái sinh vào đó, vua Bandhumā sẽ là cha của ta," và Ngài đã quán sát dòng tộc đó.
81
Tato mātaraṃ vilokento – ‘‘buddhamātā nāma lolā surādhuttā na hoti, kappasatasahassaṃ pūritapāramī, jātito paṭṭhāya akhaṇḍapañcasīlā hoti, ayañca bandhumatī nāma devī īdisā, ayaṃ me mātā bhavissati, ‘‘kittakaṃ panassā āyū’’ti āvajjanto ‘‘dasannaṃ māsānaṃ upari satta divasānī’’ti passi.
Then, observing the mother, he realized, "A Buddha's mother is not frivolous or a drunkard; she is one who has fulfilled perfections for one hundred thousand aeons, and she has unbroken five precepts from birth onwards. And this Queen Bandhumatī is such a one; she will be my mother." Then, considering, "What is her lifespan?", he saw, "Seven days after ten months."
Sau đó, Ngài quán sát mẹ: "Mẹ của chư Phật không phải là người phóng đãng, nghiện rượu, mà là người đã viên mãn ba-la-mật trong một trăm ngàn đại kiếp, và từ khi sinh ra đã giữ trọn vẹn năm giới. Hoàng hậu Bandhumatī này là người như vậy, bà sẽ là mẹ của ta. Tuổi thọ của bà còn bao lâu?" Khi quán xét, Ngài thấy: "Còn bảy ngày sau mười tháng nữa."
82
Iti imaṃ pañcamahāvilokanaṃ viloketvā ‘‘kālo, me mārisā, buddhabhāvāyā’’ti devatānaṃ saṅgahaṃ karonto paṭiññaṃ datvā – ‘‘gacchatha, tumhe’’ti tā devatā uyyojetvā tusitadevatāhi parivuto tusitapure nandanavanaṃ pāvisi.
Thus, having made this five great observation, he said to the devas, "Venerable Sirs, it is time for my Buddhahood!" and thereby showing compassion to the devas, he gave his promise and dismissed them, saying, "Go now, all of you." Accompanied by the Tusita devas, he entered the Nandanavana in the Tusita city.
Như vậy, sau khi thực hiện năm đại quán sát này, Ngài nói với các vị trời: "Thưa chư thiên, đã đến lúc ta thành Phật," rồi chấp nhận lời thỉnh cầu của họ, Ngài tiễn các vị trời đó đi và cùng với các vị trời Tusita, Ngài đi vào vườn Nandanā trong thành Tusita.
Sabbadevalokesu hi nandanavanaṃ atthiyeva.
Indeed, there is a Nandanavana in all deva realms.
Thật vậy, ở tất cả các cõi trời đều có vườn Nandanā.
Tatra naṃ devatā ito cuto sugatiṃ gacchāti pubbekatakusalakammokāsaṃ sārayamānā vicaranti.
There, the devatās wandered about, reminding the Bodhisatta of the opportunity for past wholesome deeds, saying, "Having passed away from here, go to a good destination!"
Tại đó, các chư thiên nhắc nhở Bồ Tát thiên tử về cơ hội của những thiện nghiệp đã làm trong quá khứ, rằng: “Ngài sẽ chuyển sinh từ cõi này và đi đến cõi thiện lành!” và họ đi lại xung quanh.
So evaṃ devatāhi kusalaṃ sārayamānāhi parivuto tattha vicarantoyeva cavi.
That Bodhisatta, surrounded by devatās who were thus reminding him of wholesome deeds, passed away while still wandering there.
Vị Bồ Tát thiên tử ấy, được các chư thiên nhắc nhở về thiện nghiệp như vậy, đã chuyển sinh ngay khi đang đi lại tại đó.
83
Evaṃ cuto ca ‘cavāmī’ti jānāti, cuticittaṃ na jānāti.
Thus, when he passed away, he knew, "I am passing away," but he did not know the passing-away consciousness (cuticitta).
Khi chuyển sinh như vậy, vị ấy biết: ‘Ta đang chuyển sinh’, nhưng không biết tâm chuyển sinh (cuticitta).
Paṭisandhiṃ gahetvāpi jānāti, paṭisandhicittameva na jānāti.
Even after taking rebirth (paṭisandhi), he knew, but he did not know the rebirth-linking consciousness (paṭisandhicitta) itself.
Ngay cả khi đã thọ paṭisandhi (tái sinh), vị ấy vẫn biết, nhưng không biết chính tâm paṭisandhi.
‘‘Imasmiṃ me ṭhāne paṭisandhiṃ gahitā’’ti evaṃ pana jānāti.
However, he knew, "My rebirth has been taken in this place."
Tuy nhiên, vị ấy biết: “Ta đã thọ paṭisandhi ở nơi này.”
Keci pana therā – ‘‘āvajjanapariyāyo nāma laddhuṃ vaṭṭati, dutiyatatiyacittavāre eva jānissatī’’ti vadanti.
Some Elders say: "It is possible for the advertising turn (āvajjanapariyāya) to arise; he will know in the second or third moment of consciousness."
Một số trưởng lão nói rằng: “Đến lượt tâm chú ý (āvajjanapariyāya) là có thể biết được, vị ấy sẽ biết ở lượt tâm thứ hai hoặc thứ ba.”
Tipiṭakamahāsīvatthero pana āha – ‘‘mahāsattānaṃ paṭisandhi na aññesaṃ paṭisandhisadisā, koṭippattaṃ pana tesaṃ satisampajaññaṃ.
But the Elder Tipiṭaka Mahāsīva said: "The rebirth of Great Beings is not like the rebirth of others, for their mindfulness and clear comprehension (satisampajañña) have reached their peak.
Tuy nhiên, Trưởng lão Tipiṭakamahāsīva nói: “Paṭisandhi của các bậc Đại sĩ không giống như paṭisandhi của những người khác, chánh niệm và tỉnh giác của các vị ấy đã đạt đến tột đỉnh.
Yasmā pana teneva cittena taṃ cittaṃ ñātuṃ na sakkā, tasmā cuticittaṃ na jānāti.
However, since that consciousness cannot be known by that very consciousness, he does not know the passing-away consciousness (cuticitta).
Tuy nhiên, vì không thể dùng chính tâm đó để biết tâm đó, nên vị ấy không biết tâm chuyển sinh (cuticitta).
Cutikkhaṇepi ‘cavāmī’ti jānāti.
Even at the moment of passing away, he knows, 'I am passing away.'
Ngay cả vào khoảnh khắc chuyển sinh, vị ấy cũng biết: ‘Ta đang chuyển sinh’.
Paṭisandhicittaṃ na jānāti.
He does not know the rebirth-linking consciousness (paṭisandhicitta).
Vị ấy không biết tâm paṭisandhi.
‘Asukasmiṃ me ṭhāne paṭisandhi gahitā’ti jānāti, tasmiṃ kāle dasasahassilokadhātu kampatī’’ti.
He knows, 'My rebirth has been taken in such-and-such a place,' and at that time, the ten-thousand-fold world system quakes."
Vị ấy biết: ‘Ta đã thọ paṭisandhi ở nơi kia’, vào thời điểm đó, mười ngàn thế giới chấn động.”
Evaṃ sato sampajāno mātukucchiṃ okkamanto pana ekūnavīsatiyā paṭisandhicittesu mettāpubbabhāgassa somanassasahagatañāṇasampayuttaasaṅkhārikakusalacittassa sadisamahāvipākacittena paṭisandhi gaṇhi.
Thus, mindful and clearly comprehending, entering the mother's womb, he took rebirth with a great resultant consciousness (mahāvipākacitta) similar to a karma-formations-free wholesome consciousness (asaṅkhārika kusalacitta) associated with knowledge and accompanied by joy, having loving-kindness (mettā) as its precursor, out of the nineteen rebirth-linking consciousnesses (paṭisandhicitta).
Như vậy, với chánh niệm và tỉnh giác, khi nhập vào thai mẹ, vị ấy đã thọ paṭisandhi bằng một tâm đại quả (mahāvipākacitta) tương tự như tâm thiện vô hành (asaṅkhārika-kusalacitta) hợp với hỷ và trí tuệ, có từ bi làm phần trước, trong số mười chín tâm paṭisandhi.
Mahāsīvatthero pana upekkhāsahagatenāti āha.
However, the Elder Mahāsīva said it was accompanied by equanimity (upekkhāsahagata).
Tuy nhiên, Trưởng lão Mahāsīva nói rằng đó là tâm hợp với xả (upekkhāsahagata).
Yathā ca amhākaṃ bhagavā, evaṃ sopi āsāḷhīpuṇṇamāyaṃ uttarāsāḷhanakkhatteneva paṭisandhiṃ aggahesi.
Just as our Bhagavā, so too did he take rebirth on the full moon day of Āsāḷha, with the Uttarāsāḷha constellation.
Và như Đức Thế Tôn của chúng ta, vị ấy cũng đã thọ paṭisandhi vào ngày trăng tròn Āsāḷhī, dưới chòm sao Uttarāsāḷha.
84
Tadā kira pure puṇṇamāya sattamadivasato paṭṭhāya vigatasurāpānaṃ mālāgandhādivibhūtisampannaṃ nakkhattakīḷaṃ anubhavamānā bodhisattamātā sattame divase pāto uṭṭhāya gandhodakena nahāyitvā sabbālaṅkāravibhūsitā varabhojanaṃ bhuñjitvā uposathaṅgāni adhiṭṭhāya sirigabbhaṃ pavisitvā sirisayane nipannā niddaṃ okkamamānā idaṃ supinaṃ addasa – ‘‘cattāro kira naṃ mahārājāno sayaneneva saddhiṃ ukkhipitvā anotattadahaṃ netvā nahāpetvā dibbavatthaṃ nivāsetvā dibbagandhehi vilimpetvā dibbapupphāni piḷandhitvā, tato avidūre rajatapabbato, tassa anto kanakavimānaṃ atthi, tasmiṃ pācīnato sīsaṃ katvā nipajjāpesuṃ.
It is said that at that time, starting seven days before the full moon, the Bodhisatta’s mother, who had abstained from intoxicants and was adorned with garlands, perfumes, and other adornments, enjoyed the festival. On the seventh day, she arose in the morning, bathed with scented water, adorned herself with all ornaments, ate exquisite food, undertook the Uposatha observances, entered her glorious chamber, and lying on her glorious couch, she fell asleep and had this dream: "Four Great Kings, they say, lifted her up along with her couch, took her to Lake Anotatta, bathed her, dressed her in divine garments, anointed her with divine perfumes, adorned her with divine flowers, and then, not far from there, there was a silver mountain, and inside it a golden mansion. In that mansion, they laid her down with her head towards the east.
Vào thời điểm đó, bảy ngày trước ngày trăng tròn, mẹ của Bồ Tát đã hưởng thụ lễ hội sao (nakkhattakīḷa) với việc kiêng rượu, được trang hoàng bằng vòng hoa và hương liệu, v.v. Vào ngày thứ bảy, bà thức dậy sớm, tắm gội bằng nước thơm, trang sức đầy đủ, dùng bữa ăn ngon, thọ trì các giới uposatha, rồi vào phòng ngủ quý giá, nằm trên giường quý giá, khi chìm vào giấc ngủ, bà đã thấy giấc mơ này: “Bốn vị Đại Thiên Vương đã nâng bà cùng với giường lên, đưa đến hồ Anotatta, tắm gội cho bà, mặc cho bà y phục trời, xức cho bà hương liệu trời, và cài cho bà hoa trời. Sau đó, không xa nơi đó có một ngọn núi bạc, bên trong có một cung điện vàng. Các vị ấy đã đặt bà nằm xuống, đầu hướng về phía đông.
Atha bodhisatto setavaravāraṇo hutvā tato avidūre eko suvaṇṇapabbato, tattha caritvā tato oruyha rajatapabbataṃ abhiruhitvā kanakavimānaṃ pavisitvā mātaraṃ padakkhiṇaṃ katvā dakkhiṇapassaṃ phāletvā kucchiṃ paviṭṭhasadiso ahosi’’.
Then the Bodhisatta, having become a magnificent white elephant, grazed on a golden mountain not far from there, descended from it, ascended the silver mountain, entered the golden mansion, circumambulated his mother, and appeared as if he had pierced her right side and entered her womb."
Sau đó, Bồ Tát hiện thành một con voi trắng vĩ đại, đi trên một ngọn núi vàng không xa nơi đó, rồi từ đó đi xuống, leo lên ngọn núi bạc, vào cung điện vàng, đi nhiễu quanh mẹ, rồi như thể xuyên qua hông phải mà vào bụng mẹ.”
85
Atha pabuddhā devī taṃ supinaṃ rañño ārocesi.
Then the awakened queen recounted the dream to the king.
Sau đó, vị Thiên hậu tỉnh giấc và kể giấc mơ đó cho Đức vua.
Rājā vibhātāya rattiyā catusaṭṭhimatte brāhmaṇapāmokkhe pakkosāpetvā haritūpalittāya lājādīhi katamaṅgalasakkārāya bhūmiyā mahārahāni āsanāni paññapetvā tattha nisinnānaṃ brāhmaṇānaṃ sappimadhusakkarābhisaṅkhatassa varapāyāsassa suvaṇṇarajatapātiyo pūretvā suvaṇṇarajatapātīheva paṭikujjitvā adāsi, aññehi ca ahatavatthakapilagāvīdānādīhi nesaṃ santappesi.
When the night brightened, the king summoned sixty-four prominent brahmins, spread out costly seats on ground smoothed with fresh cow-dung and adorned with auspicious offerings of parched rice and the like. He then filled golden and silver bowls with excellent milk-rice prepared with ghee, honey, and sugar, and covering them with other golden and silver bowls, he gave them to the brahmins seated there. He also satisfied them with other gifts, such as new cloths and tawny cows.
Khi đêm đã rạng sáng, Đức vua cho gọi sáu mươi bốn vị Bà la môn trưởng, cho trải những chỗ ngồi sang trọng trên nền đất đã được trét bằng phân bò tươi và được trang hoàng bằng các vật phẩm may mắn như cốm, v.v. Rồi Ngài cho đổ đầy sữa gạo quý giá, được chế biến bằng bơ, mật ong và đường, vào các bát vàng bạc, và đậy lại bằng chính các bát vàng bạc đó, dâng lên các vị Bà la môn đang ngồi đó. Ngài còn làm cho họ hài lòng bằng các vật phẩm khác như vải mới, bò cái màu nâu đỏ, v.v.
Atha nesaṃ sabbakāmasantappitānaṃ taṃ supinaṃ ārocetvā – ‘‘kiṃ bhavissatī’’ti pucchi.
Then, after satisfying all their desires, he recounted the dream to them and asked, "What will be the outcome?"
Sau khi đã làm cho họ hài lòng với mọi thứ mong muốn, Ngài kể cho họ nghe giấc mơ đó và hỏi: “Điều gì sẽ xảy ra?”
Brāhmaṇā āhaṃsu – ‘‘mā cintayi, mahārāja, deviyā te kucchimhi gabbho patiṭṭhito, so ca kho purisagabbho na itthigabbho, putto te bhavissati.
The brahmins replied, "Do not worry, great king. A fetus has been conceived in your queen's womb; it is a male fetus, not a female fetus. You will have a son.
Các vị Bà la môn thưa: “Đại vương, xin đừng lo lắng. Trong bụng của Hoàng hậu đã có thai, và đó là thai nam, không phải thai nữ. Ngài sẽ có một người con trai.
So sace agāraṃ ajjhāvasissati, rājā bhavissati cakkavattī.
If he lives in the household, he will become a Wheel-turning Monarch (Cakkavatti).
Nếu vị ấy sống đời gia đình, vị ấy sẽ trở thành một vị Chuyển Luân Vương.
Sace agārā nikkhamma pabbajissati, buddho bhavissati loke vivaṭṭacchado’’ti.
But if he leaves home and goes forth into homelessness, he will become an Awakened One (Buddha) in the world, with his defilement-roof removed (vivaṭṭacchada)."
Nếu vị ấy rời bỏ gia đình và xuất gia, vị ấy sẽ trở thành một vị Phật, người đã mở toang mái nhà (phiền não) trên thế gian.”
Ayaṃ tāva – ‘‘mātukucchiṃ okkamī’’ti ettha vaṇṇanākkamo.
This is the method of exposition for "entered the mother's womb" (mātukucchiṃ okkamī).
Đây là trình tự giải thích về việc “nhập vào thai mẹ” ở đây.
86
Ayamettha dhammatāti ayaṃ ettha mātukucchiokkamane dhammatā, ayaṃ sabhāvo, ayaṃ niyāmoti vuttaṃ hoti.
Ayamettha dhammatā means that this is the natural law (dhammatā), this is the nature, this is the fixed order (niyāma) regarding the Bodhisatta's entering the mother's womb.
Ayamettha dhammatā (Đây là pháp tắc ở đây) có nghĩa là: đây là pháp tắc, đây là bản chất, đây là quy luật trong việc nhập vào thai mẹ.
Niyāmo ca nāmesa kammaniyāmo, utuniyāmo, bījaniyāmo, cittaniyāmo, dhammaniyāmoti pañcavidho (dha. sa. aṭṭha. 498).
This niyāma is fivefold: the fixed order of kamma (kammaniyāma), the fixed order of season (utuniyāma), the fixed order of seed (bījaniyāma), the fixed order of mind (cittaniyāma), and the fixed order of Dhamma (dhammaniyāma).
Quy luật (Niyāma) này có năm loại: quy luật nghiệp (kammaniyāma), quy luật thời tiết (utuniyāma), quy luật hạt giống (bījaniyāma), quy luật tâm (cittaniyāma), và quy luật pháp (dhammaniyāma).
87
Tattha kusalassa iṭṭhavipākadānaṃ, akusalassa aniṭṭhavipākadānanti ayaṃ kammaniyāmo. Tassa dīpanatthaṃ – ‘‘na antalikkhe’’ti (khu. pā. 127) gāthāya vatthūni vattabbāni.
Among these, the giving of desirable results by wholesome kamma, and the giving of undesirable results by unwholesome kamma, this is the kammaniyāma. To explain this, the stories from the verse "Not in the sky" should be recounted.
Trong đó, việc nghiệp thiện mang lại quả tốt đẹp, và nghiệp bất thiện mang lại quả không tốt đẹp, đây là quy luật nghiệp (kammaniyāma). Để minh họa điều này, cần kể các câu chuyện trong bài kệ “Không ở giữa hư không” v.v.
Apica ekā kira itthī sāmikena saddhiṃ bhaṇḍitvā ubbandhitvā maritukāmā rajjupāse gīvaṃ pavesesi.
Moreover, it is said that once a woman, having quarrelled with her husband, wishing to die by hanging, put her neck into a noose.
Hơn nữa, có một câu chuyện kể rằng một người phụ nữ đã cãi nhau với chồng, muốn tự tử bằng cách treo cổ, và đã đưa cổ vào dây thòng lọng.
Aññataro puriso vāsiṃ nisento taṃ itthikammaṃ disvā rajjuṃ chinditukāmo – ‘‘mā bhāyi, mā bhāyī’’ti taṃ samassāsento upadhāvi.
A certain man, sharpening his adze, saw this act of the woman and, wishing to cut the rope, ran towards her, comforting her, "Do not fear, do not fear!"
Một người đàn ông khác đang mài rìu, thấy hành động của người phụ nữ đó, muốn cắt sợi dây, liền chạy đến trấn an cô ấy: “Đừng sợ, đừng sợ!”
Rajju āsīviso hutvā aṭṭhāsi.
The rope became a venomous snake and stood still.
Sợi dây biến thành một con rắn độc và đứng yên.
So bhīto palāyi.
He, frightened, fled.
Người đàn ông sợ hãi bỏ chạy.
Itarā tattheva mari.
The other woman died right there.
Người phụ nữ kia chết ngay tại đó.
Evamādīni cettha vatthūni dassetabbāni.
Such stories should be shown here.
Những câu chuyện tương tự như vậy cần được trình bày ở đây.
88
Tesu tesu janapadesu tasmiṃ tasmiṃ kāle ekappahāreneva rukkhānaṃ pupphaphalagahaṇādīni, vātassa vāyanaṃ avāyanaṃ, ātapassa tikkhatā mandatā, devassa vassanaṃ avassanaṃ, padumānaṃ divā vikasanaṃ rattiṃ milāyananti evamādi utuniyāmo.
The simultaneous blossoming and fruiting of trees, the blowing or not blowing of wind, the intensity or mildness of heat, the raining or not raining of rain, the blooming of lotuses by day and their wilting by night in various countries at various times — this is the utuniyāma.
Ở những quốc độ khác nhau, vào những thời điểm khác nhau, việc cây cối ra hoa kết trái cùng một lúc, gió thổi hay không thổi, nắng gay gắt hay dịu nhẹ, mưa rơi hay không rơi, hoa sen nở vào ban ngày và héo vào ban đêm, v.v., đây là quy luật thời tiết (utuniyāma).
89
Yaṃ panetaṃ sālibījato sāliphalameva, madhurato madhurasaṃyeva, tittato tittarasaṃyeva phalaṃ hoti, ayaṃ bījaniyāmo.
That from rice seed only rice grain comes, from sweet* only sweet tasting fruit, from bitter* only bitter tasting fruit — this is the bījaniyāma.
Việc từ hạt lúa chỉ cho ra quả lúa, từ hạt ngọt chỉ cho ra vị ngọt, từ hạt đắng chỉ cho ra vị đắng, đây là quy luật hạt giống (bījaniyāma).
90
Purimā purimā cittacetasikā dhammā pacchimānaṃ pacchimānaṃ cittacetasikānaṃ dhammānaṃ upanissayapaccayena paccayoti evaṃ yadetaṃ cakkhuviññāṇādīnaṃ anantarā sampaṭicchanādīnaṃ nibbattanaṃ, ayaṃ cittaniyāmo.
That previous mental and concomitant phenomena are a condition for subsequent mental and concomitant phenomena by way of decisive support (upanissayapaccaya), such as the arising of receiving consciousnesses (sampaṭicchana) immediately after eye-consciousness (cakkhuviññāṇa) and so on — this is the cittaniyāma.
Việc các pháp tâm và tâm sở trước làm duyên cho các pháp tâm và tâm sở sau bằng duyên cận y (upanissaya-paccaya), như việc các tâm tiếp thọ (sampaṭicchana) v.v. phát sinh ngay sau các tâm nhãn thức (cakkhuviññāṇa) v.v., đây là quy luật tâm (cittaniyāma).
91
Yā panesā bodhisattānaṃ mātukucchiokkamanādīsu dasasahassilokadhātukampanādīnaṃ pavatti, ayaṃ dhammaniyāmo nāma.
But this occurrence of the ten-thousand-fold world system quaking and so forth, when Bodhisattas enter the mother's womb, is called the dhammaniyāma.
Việc các thế giới chấn động mười ngàn cõi khi các vị Bồ Tát nhập thai mẹ v.v., đây được gọi là quy luật pháp (dhammaniyāma).
Tesu idha dhammaniyāmo adhippeto.
Among these, the dhammaniyāma is intended here.
Trong số đó, ở đây, quy luật pháp (dhammaniyāma) được đề cập.
Tasmā tamevatthaṃ dassento dhammatā esā bhikkhavetiādimāha.
Therefore, showing that very meaning, he began by saying, " This, bhikkhus, is the natural law."
Vì vậy, để chỉ rõ ý nghĩa đó, Ngài đã nói đoạn: “Này các Tỳ khưu, đây là pháp tắc” v.v.
92
18. Tattha kucchiṃ okkamatīti ettha kucchiṃ okkanto hotīti ayamevattho.
18. In this context, kucchiṃ okkamati (enters the womb) means that he has entered the womb. This is the only meaning.
18. Trong đó, kucchiṃ okkamati (nhập vào thai mẹ) có nghĩa là đã nhập vào thai mẹ. Bởi vì khi đã nhập vào, điều này mới xảy ra, chứ không phải khi đang nhập.
Okkante hi tasmiṃ evaṃ hoti, na okkamamāne.
For it happens thus when he has entered, not while he is entering.
Khi Ngài đã nhập thai, thì mới có sự việc như vậy, chứ không phải khi đang nhập thai.
Appamāṇoti vuḍḍhippamāṇo, vipuloti attho.
Appamāṇo means of immeasurable growth, meaning vast.
Appamāṇo nghĩa là vô lượng về sự phát triển, tức là rộng lớn.
Uḷāroti tasseva vevacanaṃ.
Uḷāro is a synonym for the same.
Uḷāro là từ đồng nghĩa của từ đó.
Uḷārāni uḷārāni khādanīyāni khādantītiādīsu (ma. ni. 1.399) hi madhuraṃ uḷāranti vuttaṃ.
For in passages like "They eat excellent eatables" (ma. ni. 1.399), uḷāra is said to mean sweet.
Trong các đoạn như “ăn những món ăn ngon tuyệt vời” (Ma. Ni. 1.399), từ uḷāra được dùng với nghĩa là ngọt ngào.
Uḷārāya khalu bhavaṃ vacchāyano samaṇaṃ gotamaṃ pasaṃsāya pasaṃsatītiādīsu (ma. ni. 1.288) seṭṭhaṃ uḷāranti vuttaṃ.
In passages like "Vacchāyana praises the recluse Gotama with excellent praise" (ma. ni. 1.288), uḷāra is said to mean supreme.
Trong các đoạn như “Tôn giả Vacchāyana ca ngợi Sa-môn Gotama bằng lời ca ngợi tuyệt vời” (Ma. Ni. 1.288), từ uḷāra được dùng với nghĩa là tối thượng.
Idha pana vipulaṃ adhippetaṃ.
Here, however, vast is intended.
Tuy nhiên, ở đây, ý nghĩa là rộng lớn.
Devānaṃ devānubhāvanti ettha devānaṃ ayamānubhāvo nivatthavatthassa pabhā dvādasayojanāni pharati, tathā sarīrassa, tathā alaṅkārassa, tathā vimānassa, taṃ atikkamitvāti attho.
In devānaṃ devānubhāvaṃ (the divine power of devas), this is the divine power of devas: the radiance of their clothes covers twelve yojanas, similarly their bodies, similarly their adornments, similarly their mansions. "Surpassing that" is the meaning.
Trong devānaṃ devānubhāvaṃ (thần lực của chư thiên), đây là thần lực của chư thiên: hào quang của y phục mặc tỏa sáng mười hai dojana, cũng như hào quang của thân thể, của trang sức, và của cung điện. Ý nghĩa là vượt qua điều đó.
93
Lokantarikāti tiṇṇaṃ tiṇṇaṃ cakkavāḷānaṃ antarā ekeko lokantariko hoti, tiṇṇaṃ sakaṭacakkānaṃ vā tiṇṇaṃ pattānaṃ vā aññamaññaṃ āhacca ṭhapitānaṃ majjhe okāso viya.
Lokantarikā means that between every three world-systems, there is one Lokantarika hell, like the space in the middle of three chariot wheels or three bowls placed touching each other.
Lokantarikā là khoảng trống giữa ba cõi giới (cakkavāḷa), mỗi cõi giới là một Lokantarikā, giống như khoảng trống ở giữa ba bánh xe bò hoặc ba cái bát đặt sát nhau.
So pana lokantarikanirayo parimāṇato aṭṭhayojanasahasso hoti.
That Lokantarika hell is, in measure, eight thousand yojanas.
Địa ngục Lokantarikā đó có kích thước tám ngàn dojunā.
Aghāti niccavivaṭā.
Aghā means constantly open.
Aghā nghĩa là luôn luôn rộng mở.
Asaṃvutāti heṭṭhāpi appatiṭṭhā.
Asaṃvutā means without support, even below.
Asaṃvutā nghĩa là không có chỗ dựa ở phía dưới.
Andhakārāti tamabhūtā.
Andhakārā means full of darkness.
Andhakārā nghĩa là tối tăm.
Andhakāratimisāti cakkhuviññāṇuppattinivāraṇato andhabhāvakaraṇatimisena samannāgatā.
Andhakāratimisā means endowed with darkness that causes blindness by preventing the arising of eye-consciousness.
Andhakāratimisā nghĩa là đầy bóng tối và u ám, ngăn cản sự phát sinh của nhãn thức, khiến cho trở nên mù lòa.
Tattha kira cakkhuviññāṇaṃ na jāyati.
There, it is said, eye-consciousness does not arise.
Ở nơi đó, nhãn thức không thể phát sinh.
Evaṃmahiddhikāti candimasūriyā kira ekappahāreneva tīsu dīpesu paññāyanti, evaṃ mahiddhikā.
Evaṃmahiddhikā means that the moon and sun are indeed visible simultaneously in the three continents; such is their great power.
Evaṃmahiddhikā nghĩa là mặt trăng và mặt trời được cho là xuất hiện đồng thời trên ba châu, chúng có thần thông lớn như vậy.
Ekekāya disāya nava nava yojanasatasahassāni andhakāraṃ vidhamitvā ālokaṃ dassenti, evaṃmahānubhāvā.
They dispel darkness for nine hundred thousand yojanas in each direction and show light, evaṃmahānubhāvā (of such great might).
Mỗi phương có thể xua tan bóng tối đến chín trăm ngàn dojunā và chiếu sáng, có uy lực lớn như vậy.
Ābhāya nānubhontīti attano pabhāya nappahonti.
Ābhāya nānubhontīti means they are not capable with their own light.
Ābhāya nānubhontī nghĩa là chúng không đủ ánh sáng của chính mình.
Te kira cakkavāḷapabbatassa vemajjhena vicaranti, cakkavāḷapabbatañca atikkamma lokantarikanirayā.
It is said that they revolve through the middle of the Cakkavāḷa mountain, and the Lokantarika hells are beyond the Cakkavāḷa mountain.
Chúng được cho là di chuyển ở giữa núi Cakkavāḷa, còn địa ngục Lokantarikā thì vượt qua núi Cakkavāḷa.
Tasmā te tattha ābhāya nappahonti.
Therefore, they are not capable with their light there.
Vì vậy, ánh sáng của chúng không thể chiếu tới đó.
94
Yepi tattha sattāti yepi tasmiṃ lokantarikamahāniraye sattā uppannā.
Yepi tattha sattā means the beings who are born in that great Lokantarika hell.
Yepi tattha sattā nghĩa là những chúng sanh nào đã tái sanh vào đại địa ngục Lokantarikā đó.
Kiṃ pana kammaṃ katvā tattha uppajjantīti.
What deeds did they do to be born there?
Họ đã làm nghiệp gì mà tái sanh vào nơi đó?
Bhāriyaṃ dāruṇaṃ mātāpitūnaṃ dhammikasamaṇabrāhmaṇānañca upari aparādhaṃ, aññañca divase divase pāṇavadhādisāhasikakammaṃ katvā uppajjanti, tambapaṇṇidīpe abhayacoranāgacorādayo viya.
They are born there after having committed grievous, cruel offenses against their parents, righteous ascetics and brahmins, and other audacious acts such as killing living beings day after day, like the Abhaya and Nāga bandits and others on the island of Tambapaṇṇi.
Họ đã phạm những tội nặng nề, tàn ác đối với cha mẹ, các Sa-môn và Bà-la-môn có đạo đức, và đã thực hiện những hành động bạo lực như sát sanh hàng ngày, giống như các tên cướp Abhaya, Nāga, v.v. ở đảo Tambapaṇṇi.
Tesaṃ attabhāvo tigāvutiko hoti, vaggulīnaṃ viya dīghanakhā honti.
Their bodies are three gāvutas in height, and they have long claws like bats.
Thân hình của họ cao ba gāvuta, móng tay của họ dài như móng của loài dơi.
Te rukkhe vagguliyo viya nakhehi cakkavāḷapabbate lagganti.
Like bats on trees, they cling to the Cakkavāḷa mountain with their claws.
Chúng bám vào núi Cakkavāḷa bằng móng vuốt của mình, giống như dơi bám vào cây.
Yadā saṃsappantā aññamaññassa hatthapāsaṃ gatā honti, atha ‘‘bhakkho no laddho’’ti maññamānā tattha vāvaṭā viparivattitvā lokasandhārakaudake patanti, vāte paharantepi madhukaphalāni viya chijjitvā udake patanti, patitamattāva accantakhāre udake piṭṭhapiṇḍi viya vilīyanti.
When they creep along and come within reach of each other, they think, “We have found food,” and, being eager, they turn over and fall into the world-sustaining water. Even when struck by the wind, they break off like Madhuka fruits and fall into the water. As soon as they fall, they dissolve like a lump of flour in extremely caustic water.
Khi chúng bò và chạm vào nhau, nghĩ rằng "chúng ta đã tìm thấy thức ăn", chúng bận rộn lật mình và rơi xuống nước nâng đỡ thế giới; ngay cả khi gió thổi, chúng vẫn bị cắt đứt như quả Madhuka và rơi xuống nước, vừa rơi xuống nước kiềm cực mạnh là chúng tan rã như một cục bột.
95
Aññepi kira bho santi sattāti bho yathā mayaṃ mahādukkhaṃ anubhavāma, evaṃ aññe kira sattāpi imaṃ dukkhamanubhavanatthāya idhūpapannāti taṃ divasaṃ passanti.
Aññepi kira bho santi sattāti: "O sirs, just as we experience great suffering, so too are other beings born here to experience this suffering," they see that day.
Aññepi kira bho santi sattā nghĩa là "Này các bạn, có những chúng sanh khác cũng tái sanh vào đây để chịu đựng khổ đau này, giống như chúng ta đang chịu đựng khổ đau lớn lao này", chúng nhìn thấy điều đó vào ngày ấy.
Ayaṃ pana obhāso ekayāgupānamattampi na tiṭṭhati, accharāsaṅghāṭamattameva vijjobhāso viya niccharitvā – ‘‘kiṃ ida’’nti bhaṇantānaṃyeva antaradhāyati.
This light does not last even for the duration of drinking one spoonful of gruel; it vanishes like a flash of lightning for only the snap of a finger, disappearing even as they say, "What is this?"
Tuy nhiên, ánh sáng này không tồn tại lâu, chỉ bằng một cái nháy mắt, giống như ánh sáng chớp nhoáng, nó phát ra rồi biến mất ngay khi chúng đang nói "Cái gì đây?".
Saṅkampatīti samantato kampati.
Saṅkampatīti means it trembles all around.
Saṅkampatī nghĩa là rung động khắp nơi.
Itaradvayaṃ purimapadasseva vevacanaṃ.
The other two words are synonyms for the preceding word.
Hai từ còn lại là đồng nghĩa với từ trước.
Puna appamāṇo cātiādi nigamanatthaṃ vuttaṃ.
Furthermore, appamāṇo cātiādi (and immeasurable, etc.) was stated for the conclusion.
Hơn nữa, appamāṇo cā và những từ tiếp theo được nói ra để kết luận.
96
19. Cattāro naṃ devaputtā cātuddisaṃ rakkhāya upagacchantīti ettha cattāroti catunnaṃ mahārājānaṃ vasena vuttaṃ.
Cattāro naṃ devaputtā cātuddisaṃ rakkhāya upagacchantīti (four devaputtas approach to guard in the four directions): here, cattāro is stated with reference to the four Great Kings.
19. Cattāro naṃ devaputtā cātuddisaṃ rakkhāya upagacchantī Ở đây, cattāro được nói đến theo nghĩa bốn vị Đại Thiên Vương.
Dasasahassacakkavāḷesu pana cattāro cattāro katvā cattālīsasahassāni honti.
However, in the ten thousand world-systems, there are forty thousand devas, taking four in each.
Trong mười ngàn cõi giới, có bốn vạn vị (Đại Thiên Vương) với mỗi cõi giới có bốn vị.
Tattha imasmiṃ cakkavāḷe mahārājāno khaggahatthā bodhisattassa ārakkhatthāya upagantvā sirigabbhaṃ paviṭṭhā, itare gabbhadvārato paṭṭhāya avaruddhake paṃsupisācakādiyakkhagaṇe paṭikkamāpetvā yāva cakkavāḷā ārakkhaṃ gaṇhiṃsu.
In this world-system, the Great Kings, sword in hand, entered the splendid chamber to guard the Bodhisatta, while the others, from the door of the chamber onwards, made the obstructing groups of yakkhas, such as dust-ogres and pisacas, retreat and took up guard all the way to the world-system boundary.
Trong cõi giới này, các vị Đại Thiên Vương cầm kiếm đã đến cung điện để bảo vệ Bồ-tát, và những vị khác đã xua đuổi các nhóm quỷ như Paṃsupisāca, v.v. đang cản trở từ cửa cung điện trở đi, và thực hiện việc bảo vệ cho đến tận cõi giới.
97
Kimatthāya panāyaṃ rakkhā?
For what purpose, then, is this guard?
Sự bảo vệ này là vì mục đích gì?
Nanu paṭisandhikkhaṇe kalalakālato paṭṭhāya sacepi koṭisatasahassamārā koṭisatasahassasineruṃ ukkhipitvā bodhisattassa vā bodhisattamātuyā vā antarāyakaraṇatthaṃ āgaccheyyuṃ, sabbe antarāva antaradhāyeyyuṃ.
At the moment of conception, from the time of the kalala stage, if even a hundred thousand crores of Māras were to come lifting a hundred thousand crores of Meru mountains to cause harm to the Bodhisatta or the Bodhisatta’s mother, they would all vanish midway.
Chẳng phải ngay từ khoảnh khắc tái sanh, từ giai đoạn kalala, nếu có một trăm ngàn vạn Māra đến, nhấc một trăm ngàn vạn núi Sineru để gây trở ngại cho Bồ-tát hoặc mẹ của Bồ-tát, tất cả chúng sẽ biến mất giữa chừng sao?
Vuttampi cetaṃ bhagavatā ruhiruppādavatthusmiṃ – ‘‘aṭṭhānametaṃ, bhikkhave, anavakāso, yaṃ parupakkamena tathāgataṃ jīvitā voropeyya.
It was also said by the Blessed One in the context of the Ruhiṛuppāda story: “It is impossible, monks, there is no opportunity for anyone to take the Tathāgata’s life through violence.
Điều này cũng đã được Đức Thế Tôn nói trong câu chuyện về sự phát sinh máu: "Này các Tỳ-khưu, điều này là không thể, không có cơ hội để người khác có thể cướp đi mạng sống của một Như Lai bằng sự tấn công.
Anupakkamena, bhikkhave, tathāgatā parinibbāyanti.
Tathāgatas attain parinibbāna without violence, monks.
Này các Tỳ-khưu, các Như Lai nhập Niết-bàn mà không bị tấn công.
Gacchatha, tumhe bhikkhave, yathāvihāraṃ, arakkhiyā, bhikkhave tathāgatā’’ti (cūḷava. 341).
Go, monks, to your respective monasteries; Tathāgatas are unguardable, monks” (Cūḷava. 341).
Này các Tỳ-khưu, các con hãy đi về trú xứ của mình, này các Tỳ-khưu, các Như Lai không cần được bảo vệ."
Evameva, tena parupakkamena na tesaṃ jīvitantarāyo atthi, santi kho pana amanussā virūpā duddasikā bheravarūpā migapakkhino, yesaṃ rūpaṃ vā disvā saddaṃ vā sutvā bodhisattamātu bhayaṃ vā santāso vā uppajjeyya, tesaṃ nivāraṇatthāya rakkhaṃ aggahesuṃ.
Likewise, there is no danger to their lives due to such violence from others. However, there are non-human beings who are ugly, repulsive, of terrifying appearance, and also animals and birds, whose forms, if seen, or sounds, if heard, might cause fear or terror to the Bodhisatta’s mother. It was to ward off these that they took up guard.
Cũng như vậy, không có nguy hiểm đến tính mạng của họ do sự tấn công của người khác; tuy nhiên, có những phi nhân (amanussa) xấu xí, khó nhìn, có hình dạng đáng sợ, và những loài động vật, chim chóc mà khi mẹ của Bồ-tát nhìn thấy hoặc nghe tiếng, có thể phát sinh sợ hãi hoặc kinh hoàng, nên họ đã thực hiện sự bảo vệ để ngăn chặn những điều đó.
Apica bodhisattassa puññatejena sañjātagāravā attano gāravacoditāpi te evamakaṃsu.
Moreover, out of the respect generated by the Bodhisatta’s merit and impelled by their own reverence, they acted in this way.
Hơn nữa, vì sự tôn kính phát sinh do phước đức của Bồ-tát, họ cũng đã làm như vậy do sự thúc đẩy của lòng tôn kính của chính mình.
98
Kiṃ pana te antogabbhaṃ pavisitvā ṭhitā cattāro mahārājāno bodhisattassa mātuyā attānaṃ dassenti, na dassentīti?
Do those four Great Kings, who have entered and are standing inside the chamber, show themselves to the Bodhisatta’s mother, or do they not?
Bốn vị Đại Thiên Vương đã vào trong cung điện có hiển lộ thân mình cho mẹ của Bồ-tát thấy không?
Nahānamaṇḍanabhojanādisarīrakiccakāle na dassenti, sirigabbhaṃ pavisitvā varasayane nipannakāle pana dassenti.
They do not show themselves during bodily activities such as bathing, adorning, and eating, but they do show themselves when she has entered the splendid chamber and is lying on the excellent couch.
Họ không hiển lộ thân mình trong các hoạt động hàng ngày như tắm rửa, trang điểm, ăn uống, nhưng họ hiển lộ thân mình khi bà nằm trên chiếc giường quý giá trong cung điện.
Tattha kiñcāpi amanussadassanaṃ nāma manussānaṃ sappaṭibhayaṃ hoti, bodhisattassa mātā pana attano ceva puttassa ca puññānubhāvena te disvā na bhāyati, pakatiantepurapālakesu viya assā etesu cittaṃ uppajjati.
Although the sight of non-human beings is indeed frightening to humans, the Bodhisatta’s mother, by the power of her own merit and that of her son, does not fear them when she sees them; her mind towards them is like her mind towards ordinary palace guards.
Mặc dù việc nhìn thấy phi nhân thường gây sợ hãi cho con người, nhưng mẹ của Bồ-tát, nhờ phước báu của chính mình và của con trai, đã nhìn thấy họ mà không sợ hãi, tâm bà đối với họ giống như đối với những người bảo vệ nội cung bình thường.
99
20. Pakatiyā sīlavatīti sabhāveneva sīlasampannā.
Pakatiyā sīlavatī means naturally endowed with virtue.
20. Pakatiyā sīlavatī nghĩa là tự nhiên đã đầy đủ giới hạnh.
Anuppanne kira buddhe manussā tāpasaparibbājakānaṃ santike vanditvā ukkuṭikaṃ nisīditvā sīlaṃ gaṇhanti.
Indeed, when a Buddha has not yet arisen, people bow down before ascetics and wanderers, sit squatting, and undertake precepts.
Được biết, khi Đức Phật chưa xuất hiện, con người thường đến các vị đạo sĩ và du sĩ để đảnh lễ, ngồi xổm và thọ trì giới.
Bodhisattamātāpi kāladevilassa isino santike sīlaṃ gaṇhāti.
The Bodhisatta’s mother also undertook precepts from the sage Kāladevila.
Mẹ của Bồ-tát cũng đã thọ trì giới từ vị đạo sĩ Kāladevila.
Bodhisatte pana kucchigate aññassa pādamūle nisīdituṃ nāma na sakkā, samānāsane nisīditvā gahitasīlampi āvajjanakaraṇamattaṃ hoti.
But when the Bodhisatta was in her womb, it was impossible for her to sit at the feet of another, and even precepts undertaken while sitting on the same seat would amount to an act of disrespect.
Tuy nhiên, khi Bồ-tát đã nhập thai, bà không thể ngồi dưới chân người khác, và việc thọ trì giới khi ngồi ngang hàng cũng chỉ là một hành động thiếu tôn kính.
Tasmā sayameva sīlaṃ aggahesīti vuttaṃ hoti.
Therefore, it is said that she herself undertook the precepts.
Vì vậy, điều đó có nghĩa là bà đã tự mình thọ trì giới.
100
21. Purisesūti bodhisattassa pitaraṃ ādiṃ katvā kesuci manussesu purisādhippāyacittaṃ nuppajjati.
Purisesūti means that the thought of desire for men, starting with the Bodhisatta’s father, does not arise in any men.
21. Purisesū nghĩa là, bắt đầu từ cha của Bồ-tát, không có bất kỳ người đàn ông nào phát sinh ý nghĩ dục vọng.
Bodhisattamāturūpaṃ pana kusalā sippikā potthakammādīsupi kātuṃ na sakkonti.
However, skilled artists cannot even create the Bodhisatta’s mother’s form in paintings and other art.
Ngay cả những nghệ nhân tài giỏi cũng không thể vẽ hoặc tạc hình dáng của mẹ Bồ-tát.
Taṃ disvā purisassa rāgo nuppajjatīti na sakkā vattuṃ, sace pana taṃ rattacitto upasaṅkamitukāmo hoti, pādā na vahanti, dibbasaṅkhalikā viya bajjhanti.
It cannot be said that seeing her form does not arouse passion in a man, but if a man with a passionate mind desires to approach her, his feet will not carry him; they will be bound as if by divine shackles.
Không thể nói rằng khi nhìn thấy bà, một người đàn ông không phát sinh dục vọng; nhưng nếu một người đàn ông có tâm tham ái muốn đến gần bà, đôi chân của anh ta sẽ không thể bước đi, chúng sẽ bị trói chặt như xiềng xích của chư thiên.
Tasmā ‘‘anatikkamanīyā’’tiādi vuttaṃ.
Therefore, anatikkamanīyātiādi (not to be transgressed, etc.) was stated.
Vì vậy, anatikkamanīyā và những từ tương tự đã được nói.
101
22. Pañcannaṃ kāmaguṇānanti pubbe kāmaguṇūpasañhitanti iminā purisādhippāyavasena vatthupaṭikkhepo kato, idha ārammaṇappaṭilābho dassito.
Pañcannaṃ kāmaguṇānanti (of the five sense pleasures): previously, by kāmaguṇūpasañhitaṃ (associated with sense pleasures), the prohibition of sexual acts was made from the perspective of male desire; here, the attainment of objects is shown.
22. Pañcannaṃ kāmaguṇāna Trước đây, với cụm từ kāmaguṇūpasañhita, sự cấm đoán đối với đối tượng của dục vọng đã được thực hiện theo ý nghĩa của nam giới; ở đây, sự tiếp nhận đối tượng đã được chỉ ra.
Tadā kira deviyā evarūpo putto kucchiṃ upapannoti sutvā samantato rājāno mahagghaābharaṇatūriyādivasena pañcadvārārammaṇavatthubhūtaṃ paṇṇākāraṃ pesenti.
At that time, indeed, upon hearing that such a son had entered the queen’s womb, kings from all around sent tributes, which were objects of the five sense doors, such as expensive ornaments and musical instruments.
Vào lúc đó, khi các vị vua nghe tin rằng một người con trai như vậy đã nhập thai của hoàng hậu, họ đã gửi những món quà có giá trị lớn như trang sức, nhạc cụ, v.v., là đối tượng của năm cửa giác quan, từ khắp nơi.
Bodhisattassa ca bodhisattamātu ca katakammassa ussannattā lābhasakkārassa pamāṇaparicchedo natthi.
Due to the abundance of good kamma accumulated by both the Bodhisatta and the Bodhisatta’s mother, there was no limit or measure to the gains and honours.
Vì công đức của Bồ-tát và mẹ Bồ-tát quá lớn, nên không có giới hạn nào cho những lợi lộc và sự tôn kính mà họ nhận được.
102
23. Akilantakāyāti yathā aññā itthiyo gabbhabhārena kilamanti hatthapādā uddhumātatādīni pāpuṇanti, evaṃ tassā koci kilamatho nāhosi.
Akilantakāyāti means that she had no fatigue, unlike other women who become tired from the burden of pregnancy and experience swollen hands and feet.
23. Akilantakāyā nghĩa là bà không hề mệt mỏi vì mang thai như những phụ nữ khác, những người thường bị sưng tay chân và các triệu chứng khác.
Tirokucchigatanti antokucchigataṃ.
Tirokucchigatanti means inside the womb.
Tirokucchigata nghĩa là ở bên trong bụng.
Passatīti kalalādikālaṃ atikkamitvā sañjātaaṅgapaccaṅgaahīnindriyabhāvaṃ upagataṃyeva passati.
Sees (passatīti): Having surpassed the stage of kalala (embryo) and so on, she sees only the Bodhisatta who has attained the state of having well-formed limbs and minor parts and unblemished faculties.
Thấy (Passatī) nghĩa là, sau khi vượt qua giai đoạn kalala (nước trong) và các giai đoạn khác, (mẹ của Bồ-tát) chỉ thấy Bồ-tát đã thành tựu đầy đủ các chi phần lớn nhỏ và các căn không khiếm khuyết.
Kimatthaṃ passati?
For what purpose does she see?
Vì mục đích gì mà thấy?
Sukhavāsatthaṃyeva.
Only for the sake of comfortable living.
Chỉ vì mục đích sống an lạc.
Yatheva hi mātā puttena saddhiṃ nipannā vā nisinnā vā – ‘‘hatthaṃ vāssa pādaṃ vā olambantaṃ ukkhipitvā saṇṭhapessāmī’’ti sukhavāsatthaṃ puttaṃ oloketi, evaṃ bodhisattamātāpi yaṃ taṃ mātu uṭṭhānagamanaparivattananisajjādīsu uṇhasītaloṇikatittakakaṭukāhāraajjhoharaṇakālesu ca gabbhassa dukkhaṃ uppajjati, ‘‘atthi nu kho me taṃ puttassā’’ti sukhavāsatthaṃ olokayamānā pallaṅkaṃ ābhujitvā nisinnaṃ bodhisattaṃ passati.
Just as a mother, whether lying down or sitting with her son, watches her son for his comfortable living, thinking, "I will lift up his hand or foot that is hanging down and place it properly," so too the Bodhisatta’s mother, observing the Bodhisatta seated cross-legged, thinks, "Does that suffering for my son, which arises due to my rising, going, turning, sitting, and also during the times of eating hot, cold, salty, bitter, or pungent food, exist?" She sees him for the sake of his comfortable living.
Quả thật, như người mẹ nằm hay ngồi cùng con – nhìn con với mục đích sống an lạc, (nghĩ rằng) “Nếu tay hay chân của con buông thõng xuống, ta sẽ nâng lên và đặt lại cho ngay ngắn”, thì cũng vậy, mẹ của Bồ-tát, khi thấy những khổ đau phát sinh cho thai nhi trong những lúc mẹ đứng dậy, đi lại, xoay trở, ngồi xuống, và trong những lúc ăn thức ăn nóng, lạnh, mặn, đắng, cay, (mẹ Bồ-tát) nhìn Bồ-tát đang ngồi kiết già với mục đích sống an lạc, (tự hỏi) “Con ta có bị khổ đau đó không?”
Yathā hi aññe antokucchigatā pakkāsayaṃ avattharitvā āmāsayaṃ ukkhipitvā udarapaṭalaṃ piṭṭhito katvā piṭṭhikaṇḍakaṃ nissāya ukkuṭikaṃ dvīsu muṭṭhīsu hanukaṃ ṭhapetvā deve vassante rukkhasusire makkaṭā viya nisīdanti, na evaṃ bodhisatto, bodhisatto pana piṭṭhikaṇḍakaṃ piṭṭhito katvā dhammāsane dhammakathiko viya pallaṅkaṃ ābhujitvā puratthābhimukho nisīdati.
Indeed, just as other beings within the womb squat down like monkeys in a tree hollow when it rains, pressing down on the large intestine, lifting up the stomach, turning their backs to the abdominal wall, resting their chins on their two fists, relying on the spine—the Bodhisatta does not sit thus. Instead, the Bodhisatta, with his back to the spine, sits cross-legged facing east, like a Dhamma preacher on a Dhamma seat.
Quả thật, như những chúng sinh khác ở trong bụng mẹ, đè lên ruột già, nâng ruột non lên, lấy thành bụng làm lưng, nương vào xương sống, ngồi xổm, đặt cằm lên hai nắm tay, như những con khỉ trong hốc cây khi trời mưa, thì Bồ-tát không như vậy. Bồ-tát thì, lấy xương sống làm lưng, ngồi kiết già, mặt hướng về phía đông, như một vị thuyết pháp trên pháp tòa.
Pubbekatakammaṃ panassā vatthuṃ sodheti, suddhe vatthumhi sukhumacchavilakkhaṇaṃ nibbattati.
Moreover, his past good kamma purifies her womb, and in the purified womb, the characteristic of a delicate skin develops.
Nghiệp thiện đã làm từ kiếp trước của Bồ-tát làm cho tử cung của mẹ thanh tịnh, và khi tử cung thanh tịnh, các tướng vi tế của làn da được phát sinh.
Atha naṃ kucchitaco paṭicchādetuṃ na sakkoti, olokentiyā bahiṭhito viya paññāyati.
Then her abdominal skin cannot conceal him; when she looks, he appears as if he were outside.
Do đó, thành bụng của mẹ không thể che phủ được Bồ-tát, khi mẹ nhìn thì Bồ-tát như hiện ra bên ngoài.
Tamatthaṃ upamāya vibhāvento bhagavā seyyathāpītiādimāha.
The Blessed One, clarifying that matter with a simile, said, “Just as,” and so on.
Đức Thế Tôn đã nói câu seyyathāpi (ví như) và tiếp theo để giải thích ý nghĩa đó bằng ví dụ.
Bodhisatto pana antokucchigato mātaraṃ na passati.
However, the Bodhisatta, being within the womb, does not see his mother.
Tuy nhiên, Bồ-tát ở trong bụng mẹ không thấy mẹ.
Na hi antokucchiyaṃ cakkhuviññāṇaṃ uppajjati.
For eye-consciousness does not arise within the womb.
Vì nhãn thức không phát sinh trong bụng mẹ.
103
24. Kālaṅkarotīti na vijātabhāvapaccayā, āyuparikkhayeneva.
24. Passes away (kālaṅkarotīti): It is not due to having given birth, but only due to the exhaustion of her life-span.
24. Kālaṅkarotī (từ trần) nghĩa là, không phải do nguyên nhân sinh nở, mà chỉ do tuổi thọ đã hết.
Bodhisattena vasitaṭṭhānañhi cetiyakuṭisadisaṃ hoti, aññesaṃ aparibhogārahaṃ, na ca sakkā bodhisattamātaraṃ apanetvā aññaṃ aggamahesiṭṭhāne ṭhapetunti tattakaṃyeva bodhisattamātu āyuppamāṇaṃ hoti, tasmā tadā kālaṅkaroti.
Indeed, the place where the Bodhisatta resides is like a cetiya-shrine, unworthy of being used by others. And it is not possible to remove the Bodhisatta's mother and place another queen in the position of chief consort; therefore, the Bodhisatta's mother's life-span is only that long. Thus, she passes away then.
Nơi Bồ-tát cư ngụ giống như một ngôi tháp cetiya (thờ xá lợi), không thích hợp cho người khác sử dụng, và cũng không thể thay thế mẹ Bồ-tát bằng một vị hoàng hậu khác; vì vậy, tuổi thọ của mẹ Bồ-tát chỉ có bấy nhiêu, do đó, bà từ trần vào lúc đó.
Katarasmiṃ pana vaye kālaṃ karotīti?
But in which age does she pass away?
Vào tuổi nào thì bà từ trần?
Majjhimavaye.
In middle age.
Vào tuổi trung niên.
Paṭhamavayasmiñhi sattānaṃ attabhāve chandarāgo balavā hoti, tena tadā sañjātagabbhā itthī gabbhaṃ anurakkhituṃ na sakkoti, gabbho bahvābādho hoti.
Indeed, in the first age, beings have strong desire-passion for existence; therefore, a woman who conceives then cannot protect the embryo, and the embryo becomes afflicted with many diseases.
Thật vậy, trong giai đoạn đầu đời, dục ái đối với thân thể của chúng sinh rất mạnh, do đó, người phụ nữ mang thai vào lúc đó không thể bảo vệ thai nhi, và thai nhi dễ mắc nhiều bệnh tật.
Majjhimavayassa pana dve koṭṭhāse atikkamma tatiye koṭṭhāse vatthu visadaṃ hoti, visade vatthumhi nibbattadārakā arogā honti, tasmā bodhisattamātāpi paṭhamavaye sampattiṃ anubhavitvā majjhimavayassa tatiye koṭṭhāse vijāyitvā kālaṃ karotīti ayamettha dhammatā.
However, having passed the first two portions of middle age, in the third portion, the womb is clear. Children born in a clear womb are healthy. Therefore, it is a custom (dhammatā) here that the Bodhisatta's mother, having experienced prosperity in her first age, gives birth in the third portion of her middle age and then passes away.
Tuy nhiên, sau khi vượt qua hai phần ba của tuổi trung niên, đến phần ba thứ ba, tử cung trở nên thanh tịnh, và những đứa trẻ sinh ra từ tử cung thanh tịnh thì không bệnh tật; do đó, mẹ của Bồ-tát, sau khi hưởng thụ sự sung túc trong giai đoạn đầu đời, sinh con vào phần ba thứ ba của tuổi trung niên rồi từ trần – đây là quy luật tự nhiên trong trường hợp này.
104
25. Nava vā dasa vāti ettha vā saddassa vikappanavasena satta vā aṭṭha vā ekādasa vā dvādasa vāti evamādīnaṃ saṅgaho veditabbo.
25. Nine or ten: Here, the word "or" (vā) should be understood to include seven or eight, eleven or twelve, and so on, by way of diversification.
25. Nava vā dasa vā (chín hoặc mười) ở đây, từ “vā” (hoặc) nên được hiểu là bao gồm bảy hoặc tám, mười một hoặc mười hai, v.v., theo cách lựa chọn.
Tattha sattamāsajāto jīvati, sītuṇhakkhamo pana na hoti.
Among these, one born in the seventh month lives, but cannot endure cold and heat.
Trong số đó, đứa trẻ sinh ra ở tháng thứ bảy thì sống sót, nhưng không chịu được nóng lạnh.
Aṭṭhamāsajāto na jīvati, avasesā jīvanti.
One born in the eighth month does not live; the rest live.
Đứa trẻ sinh ra ở tháng thứ tám thì không sống sót, còn những đứa khác thì sống sót.
105
27. Devā paṭhamaṃ paṭiggaṇhantīti khīṇāsavā suddhāvāsabrahmāno paṭiggaṇhanti.
27. The devas first receive him (devā paṭhamaṃ paṭiggaṇhanti): The Arahant Suddhāvāsa-brahmās receive him.
27. Chư thiên đón đỡ trước tiên (Devā paṭhamaṃ paṭiggaṇhanti) nghĩa là các vị Phạm thiên Suddhāvāsa đã diệt tận lậu hoặc đón đỡ.
Kathaṃ paṭiggaṇhanti?
How do they receive him?
Họ đón đỡ như thế nào?
‘‘Sūtivesaṃ gaṇhitvā’’ti eke.
Some say, "Having assumed the guise of a midwife."
“Bằng cách hóa hiện thành bà mụ” – một số người nói như vậy.
Taṃ pana paṭikkhipitvā idaṃ vuttaṃ – ‘tadā bodhisattamātā suvaṇṇakhacitaṃ vatthaṃ nivāsetvā macchakkhisadisaṃ dukūlapaṭaṃ yāva pādantā pārupitvā aṭṭhāsi.
Rejecting that, this was said: ‘At that time, the Bodhisatta’s mother stood, wearing a garment interwoven with gold and wrapped in a fine cloth (dukūlapaṭa) resembling a fish’s eye, reaching to her feet.
Tuy nhiên, bác bỏ điều đó, điều này đã được nói: ‘Lúc đó, mẹ của Bồ-tát mặc một tấm y phục thêu vàng, và khoác một tấm vải lụa mềm mại như mắt cá, che phủ đến tận chân, rồi đứng đó.
Athassā sallahukagabbhavuṭṭhānaṃ ahosi, dhamakaraṇato udakanikkhamanasadisaṃ.
Then there was a light expulsion of the embryo for her, like water flowing from a dhamakarana (water-filter).
Sau đó, việc sinh nở của bà diễn ra nhẹ nhàng, giống như nước chảy ra từ một cái ống lọc.
Atha te pakatibrahmaveseneva upasaṅkamitvā paṭhamaṃ suvaṇṇajālena paṭiggahesuṃ.
Then they approached in their natural Brahma form and first received him in a golden net.
Rồi các vị Phạm thiên đó, với hình dáng Phạm thiên tự nhiên, đến gần và đón đỡ Bồ-tát trước tiên bằng một tấm lưới vàng.
Tesaṃ hatthato cattāro mahārājāno ajinappaveṇiyā paṭiggahesuṃ.
From their hands, the Four Great Kings received him in an antelope-skin rug.
Từ tay các vị đó, bốn vị Đại Thiên Vương đón đỡ bằng một tấm thảm da linh dương.
Tato manussā dukūlacumbaṭakena paṭiggahesuṃ’.
From them, humans received him in a roll of fine cloth.’
Từ đó, loài người đón đỡ bằng một tấm vải lụa xếp tròn.’
Tena vuttaṃ – ‘‘devā paṭhamaṃ paṭiggaṇhanti, pacchā manussā’’ti.
Therefore, it was said: “Devas first receive him, then humans.”
Vì vậy, đã nói: “Chư thiên đón đỡ trước tiên, sau đó là loài người.”
106
28. Cattāro naṃ devaputtāti cattāro mahārājāno.
28. Four devaputtas (cattāro naṃ devaputtā): The Four Great Kings.
28. Bốn vị thiên tử (Cattāro naṃ devaputtā) nghĩa là bốn vị Đại Thiên Vương.
Paṭiggahetvāti ajinappaveṇiyā paṭiggahetvā.
Having received him (paṭiggahetvā): Having received him in an antelope-skin rug.
Đón đỡ (Paṭiggahetvā) nghĩa là đón đỡ bằng tấm thảm da linh dương.
Mahesakkhoti mahātejo mahāyaso lakkhaṇasampanno.
Mahesakkho: Possessing great power, great fame, and endowed with (major and minor) marks.
Mahesakkho (có uy lực lớn) nghĩa là có uy lực lớn, có danh tiếng lớn, và đầy đủ các tướng tốt.
107
29. Visadova nikkhamatīti yathā aññe sattā yonimagge laggantā bhaggavibhaggā nikkhamanti, na evaṃ nikkhamati, alaggo hutvā nikkhamatīti attho udenāti udakena.
29. Emerges clean (visadova nikkhamatīti): He does not emerge broken and shattered like other beings clinging to the birth canal; the meaning is that he emerges without clinging. By water (udenā): By the water (in the womb).
29. Thanh tịnh xuất ra (Visadova nikkhamatī) nghĩa là, như những chúng sinh khác khi xuất ra từ đường sinh, bị gãy nát và tan vỡ, thì Bồ-tát không xuất ra như vậy, mà xuất ra không bị dính mắc – đó là ý nghĩa của từ udenā (bởi nước).
Kenaci asucināti yathā aññe sattā kammajavātehi uddhaṃpādā adhosirā yonimagge pakkhittā sataporisaṃ narakapapātaṃ patantā viya, tāḷacchiddena nikkaḍḍhiyamānā hatthī viya mahādukkhaṃ anubhavantā nānāasucimakkhitāva nikkhamanti, na evaṃ bodhisatto.
Without any impurity (kenaci asucinā): Just as other beings are pushed by kamma-born winds, head down and feet up, as if falling into a hundred-man-deep chasm of hell, or like elephants being dragged out through a hole in a palmyra tree, experiencing great suffering and emerging smeared with various impurities, the Bodhisatta is not so.
Không bị ô uế nào (Kenaci asucinā) nghĩa là, như những chúng sinh khác, bị gió nghiệp đẩy vào đường sinh, chân lên đầu xuống, như rơi vào hố sâu địa ngục một trăm tầm, hoặc như những con voi bị kéo ra khỏi lỗ cọc, phải chịu đựng khổ đau lớn và bị dính đầy các loại ô uế khi xuất ra, thì Bồ-tát không như vậy.
Bodhisattañhi kammajavātā uddhapādaṃ adhosiraṃ kātuṃ na sakkonti.
Indeed, kamma-born winds cannot make the Bodhisatta head down and feet up.
Gió nghiệp không thể làm cho Bồ-tát chân lên đầu xuống.
So dhammāsanato otaranto dhammakathiko viya, nisseṇito otaranto puriso viya ca dve hatthe ca dve pāde ca pasāretvā ṭhitakova mātukucchisambhavena kenaci asucinā amakkhitova nikkhamati.
He emerges unstained by any impurity born from his mother’s womb, standing with his two hands and two feet extended, like a Dhamma preacher descending from a Dhamma seat, or like a person descending from a ladder.
Bồ-tát xuất ra không bị dính mắc bởi bất kỳ ô uế nào do sinh ra từ bụng mẹ, đứng thẳng, duỗi hai tay và hai chân, như một vị thuyết pháp bước xuống từ pháp tòa, hoặc như một người đàn ông bước xuống từ cầu thang.
108
Udakassa dhārāti udakavaṭṭiyo.
Streams of water (udakassa dhārā): Water spirals.
Dòng nước (Udakassa dhārā) nghĩa là những cột nước.
Tāsu sītā suvaṇṇakaṭāhe patati uṇhā rajatakaṭāhe.
Among these, cold water falls into a golden bowl, and hot water into a silver bowl.
Trong số đó, nước lạnh rơi vào chậu vàng, nước nóng rơi vào chậu bạc.
Idañca pathavitale kenaci asucinā asammissaṃ tesaṃ pānīyaparibhojanīyaudakañceva aññehi asādhāraṇaṃ kīḷāudakañca dassetuṃ vuttaṃ, aññassa pana suvaṇṇarajataghaṭehi āhariyamānaudakassa ceva haṃsavattakādipokkharaṇīgatassa ca udakassa paricchedo natthi.
This is said to show that the drinking and bathing water for the mother and child is unmixed with any impurity on the earth, and also that their play water is exclusive to them. There is no limit to the other water brought in golden and silver pots, or the water in lotus ponds frequented by geese and other birds.
Điều này được nói để chỉ ra rằng nước uống và nước dùng của họ, không bị lẫn với bất kỳ ô uế nào trên mặt đất, và nước để vui chơi, không dành cho người khác; còn về nước được mang đến bằng các bình vàng bạc, và nước trong các ao hồ như ao Hamsa-vaṭṭaka, v.v., thì không có giới hạn.
109
31. Sampatijātoti muhuttajāto.
31. Just born (sampatijāto): Born but a moment ago.
31. Sampatijāto (vừa mới sinh) nghĩa là vừa mới sinh ra một lát.
Pāḷiyaṃ pana mātukucchito nikkhantamatto viya dassito, na evaṃ daṭṭhabbaṃ.
However, in the Pāḷi, he is shown as if just having emerged from his mother's womb, but it should not be understood thus.
Tuy nhiên, trong Pāḷi, Bồ-tát được trình bày như vừa mới ra khỏi bụng mẹ, nhưng không nên hiểu như vậy.
Nikkhantamattañhi naṃ paṭhamaṃ brahmāno suvaṇṇajālena paṭiggaṇhiṃsu, tesaṃ hatthato cattāro mahārājāno ajinappaveṇiyā, tesaṃ hatthato manussā dukūlacumbaṭakena.
For no sooner had he emerged than the Brahmās first received him in a golden net; from their hands, the Four Great Kings received him in an antelope-skin rug; and from their hands, humans received him in a roll of fine cloth.
Thật vậy, ngay khi vừa ra khỏi bụng mẹ, trước tiên các vị Phạm thiên đón đỡ Bồ-tát bằng một tấm lưới vàng, từ tay họ, bốn vị Đại Thiên Vương đón đỡ bằng một tấm thảm da linh dương, và từ tay họ, loài người đón đỡ bằng một tấm vải lụa xếp tròn.
Manussānaṃ hatthato muccitvā pathaviyaṃ patiṭṭhito.
Having been released from the hands of humans, he stood on the earth.
Sau khi được giải thoát khỏi tay loài người, Bồ-tát đứng vững trên mặt đất.
Setamhi chatte anudhāriyamāneti dibbasetacchatte anudhāriyamānamhi.
While the white parasol was being held over him (setamhi chatte anudhāriyamāne): While the divine white parasol was being held over him.
Khi chiếc lọng trắng được che chở (Setamhi chatte anudhāriyamāne) nghĩa là khi chiếc lọng trắng của chư thiên được che chở.
Ettha ca chattassa parivārāni khaggādīni pañca rājakakudhabhaṇḍānipi āgatāneva.
And here, the attendants of the parasol, such as swords and other five royal insignias, are also included.
Ở đây, năm vật phẩm vương quyền đi kèm với chiếc lọng, như thanh kiếm, v.v., cũng đã được đề cập.
Pāḷiyaṃ pana rājagamane rājā viya chattameva vuttaṃ.
However, in the Pāḷi, only the parasol is mentioned, as is the king in a royal procession.
Tuy nhiên, trong Pāḷi, chỉ có chiếc lọng được nói đến, giống như vị vua được nói đến trong việc đi lại của vua.
Tesu chattameva paññāyati, na chattaggāhako.
Among these, only the parasol is visible, not the parasol-holder.
Trong số đó, chỉ có chiếc lọng được thấy rõ, chứ không phải người cầm lọng.
Tathā khaggatālavaṇṭamorahatthakavāḷabījanīuṇhīsamattāyeva paññāyanti, na tesaṃ gāhakā.
Similarly, only the sword, palm-leaf fan, peacock-feather fan, chowrie, and turban are visible, not their bearers.
Tương tự, chỉ có kiếm, quạt lá cọ, quạt lông công, quạt lông đuôi bò yak và vương miện được thấy rõ, chứ không phải những người cầm chúng.
Sabbāni kira tāni adissamānarūpā devatā gaṇhiṃsu.
Indeed, all those (insignias) were held by deities with invisible forms.
Thật vậy, tất cả những vật đó đều được các vị thiên nhân có hình tướng vô hình cầm giữ.
Vuttañcetaṃ –
It is said:
Điều này đã được nói:
110
‘‘Anekasākhañca sahassamaṇḍalaṃ,
“The devas held the parasol,
“Chiếc lọng nhiều nhánh, ngàn vòng,
111
Chattaṃ marū dhārayumantalikkhe;
with many branches and a thousand circles, in the sky;
Chư thiên cầm giữ trên không trung;
112
Suvaṇṇadaṇḍā vipatanti cāmarā,
Chowries with golden handles waved,
Những chiếc phất trần cán vàng bay phấp phới,
113
Na dissare cāmarachattagāhakā’’ti.(su. ni. 693);
But the bearers of the chowries and parasol were not seen.”
Không thấy người cầm phất trần và lọng.” (Su. Ni. 693);
114
Sabbā ca disāti idaṃ sattapadavītihārūpari ṭhitassa viya sabbadisānuvilokanaṃ vuttaṃ, na kho panevaṃ daṭṭhabbaṃ.
All directions (sabbā ca disā): This is said as if looking in all directions while standing upon the seven steps, but it should not be understood thus.
Tất cả các phương (Sabbā ca disā) nghĩa là việc nhìn tất cả các phương này được nói đến như thể Bồ-tát đứng trên bảy bước đi, nhưng không nên hiểu như vậy.
Mahāsatto hi manussānaṃ hatthato muccitvā paṭhaviyaṃ patiṭṭhito puratthimaṃ disaṃ olokesi.
The Great Being, having been released from the hands of humans, stood firm on the earth and looked towards the eastern direction.
Đức Đại Sĩ, sau khi thoát khỏi tay loài người và đứng vững trên mặt đất, Ngài nhìn về phương Đông.
Anekāni cakkavāḷasahassāni ekaṅgaṇāni ahesuṃ.
Many thousands of world-systems became like a single open space.
Hàng ngàn thế giới trở thành một mặt phẳng.
Tattha devamanussā gandhamālādīhi pūjayamānā – ‘‘mahāpurisa, idha tumhehi sadisopi natthi, kuto uttaritaro’’ti āhaṃsu.
There, devas and humans, worshipping with perfumes, garlands, and so on, said: "O Great Man, here there is none equal to you; how then could there be one superior?"
Tại đó, chư thiên và loài người, đang cúng dường bằng hương hoa và các vật phẩm khác, đã nói: “Này bậc Đại nhân, ở đây không có ai sánh bằng Ngài, huống chi là người vượt trội hơn?”
Evaṃ catasso disā, catasso anudisā, heṭṭhā, uparīti dasa disā anuviloketvā attanā sadisaṃ adisvā – ‘‘ayaṃ uttarā disā’’ti uttarābhimukho sattapadavītihārena agamāsīti evamettha attho veditabbo.
Thus, having looked successively at the four main directions, the four intermediate directions, below, and above—ten directions in all—and not seeing anyone equal to himself, he thought, "This is the noble direction," and went seven steps facing north. This is how the meaning here should be understood.
Như vậy, sau khi nhìn khắp mười phương: bốn phương chính, bốn phương phụ, bên dưới và bên trên, và không thấy ai sánh bằng mình, Ngài đã nghĩ: “Đây là phương tối thượng (Bắc)”, rồi Ngài đi về phía Bắc bằng bảy bước chân vượt trội. Ý nghĩa ở đây phải được hiểu như vậy.
Āsabhinti uttamaṃ.
Āsabhi means supreme.
Āsabhinti có nghĩa là tối thượng.
Aggoti guṇehi sabbapaṭhamo.
Aggo means first of all in terms of virtues.
Aggoti có nghĩa là người đứng đầu trong tất cả về phẩm hạnh.
Itarāni dve padāni etasseva vevacanāni.
The other two terms are synonyms of this very word.
Hai từ còn lại là đồng nghĩa với từ này.
Ayamantimā jāti, natthi dāni punabbhavoti padadvayena imasmiṃ attabhāve pattabbaṃ arahattaṃ byākāsi.
With the two phrases "This is the last birth, there is no more rebirth now," he declared the Arahantship to be attained in this existence.
Với hai từ Ayamantimā jāti, natthi dāni punabbhavo (Đây là kiếp cuối cùng, không còn tái sinh nữa), Ngài đã tuyên bố về quả vị Arahant sẽ đạt được trong kiếp này.
115
Ettha ca samehi pādehi pathaviyā patiṭṭhānaṃ caturiddhipādapaṭilābhassa pubbanimittaṃ, uttarābhimukhabhāvo mahājanaṃ ajjhottharitvā abhibhavitvā gamanassa pubbanimittaṃ, sattapadagamanaṃ sattabojjhaṅgaratanapaṭilābhassa pubbanimittaṃ, dibbasetacchattadhāraṇaṃ vimuttivarachattapaṭilābhassa pubbanimittaṃ, pañcarājakakudhabhaṇḍānaṃ paṭilābho pañcahi vimuttīhi vimuccanassa pubbanimittaṃ, sabbadisānuvilokanaṃ anāvaraṇañāṇapaṭilābhassa pubbanimittaṃ, āsabhivācābhāsanaṃ appaṭivattiyadhammacakkappavattanassa pubbanimittaṃ, ‘‘ayamantimā jātī’’ti sīhanādo anupādisesāya nibbānadhātuyā parinibbānassa pubbanimittanti veditabbaṃ.
Here, standing on the earth with even feet is a premonition of the attainment of the four bases of psychic power (iddhipāda); facing north is a premonition of going forth, overcoming and overpowering the multitude; walking seven steps is a premonition of the attainment of the seven factors of enlightenment (bojjhaṅga) jewels; holding the divine white umbrella is a premonition of the attainment of the supreme umbrella of liberation; the attainment of the five royal insignia is a premonition of liberation through the five liberations (vimutti); looking around in all directions is a premonition of the attainment of unimpeded knowledge (anāvaraṇañāṇa); uttering the supreme utterance (āsabhivācā) is a premonition of setting in motion the irreversible Wheel of Dhamma; and the lion's roar "This is the last birth" is a premonition of attaining parinibbāna with the element of Nibbāna without any remainder of clinging (anupādisesāya nibbānadhātuyā). This should be understood.
Ở đây, việc đứng vững trên mặt đất với đôi chân bằng phẳng là điềm báo trước cho sự thành tựu bốn thần túc (iddhipāda); việc hướng về phía Bắc là điềm báo trước cho việc Ngài sẽ vượt qua và chế ngự đại chúng; việc đi bảy bước là điềm báo trước cho sự thành tựu bảy giác chi (bojjhaṅga) quý báu; việc che lọng trắng của chư thiên là điềm báo trước cho sự thành tựu lọng cao quý của sự giải thoát (vimutti); việc nhận được năm bảo vật vương quyền là điềm báo trước cho sự giải thoát khỏi năm loại giải thoát; việc nhìn khắp các phương là điềm báo trước cho sự thành tựu trí tuệ không chướng ngại (anāvaraṇañāṇa); việc nói lời āsabhi là điềm báo trước cho sự chuyển Pháp luân không thể đảo ngược; và tiếng rống sư tử “Ayamantimā jāti” là điềm báo trước cho sự nhập Đại Bát Niết Bàn (parinibbāna) với Niết Bàn giới vô dư y (anupādisesāya nibbānadhātuyā).
Ime vārā pāḷiyaṃ āgatā, sambahulavāro pana nāgato, āharitvā dīpetabbo.
These accounts are explicitly mentioned in the Pāli, but the comprehensive account (sambahulavāra) is not explicitly mentioned; it should be brought forth and explained.
Những trường hợp này đã được đề cập trong Pāḷi, nhưng trường hợp sambahulavāra thì chưa được đề cập, cần phải đưa vào và giải thích.
116
Mahāpurisassa hi jātadivase dasasahassilokadhātu kampi.
On the day the Great Man was born, the ten-thousandfold world-system trembled.
Vào ngày Đại nhân đản sinh, mười ngàn thế giới chấn động.
Dasasahassilokadhātumhi devatā ekacakkavāḷe sannipatiṃsu.
Devatās in the ten-thousandfold world-system gathered in one world-system.
Chư thiên từ mười ngàn thế giới đã tề tựu về một luân vũ.
Paṭhamaṃ devā paṭiggaṇhiṃsu, pacchā manussā.
First the devas received him, then humans.
Đầu tiên chư thiên đón nhận, sau đó là loài người.
Tantibaddhā vīṇā cammabaddhā bheriyo ca kenaci avāditā sayameva vajjiṃsu.
Stringed lutes and hide-covered drums, unplayed by anyone, sounded by themselves.
Đàn dây và trống da, không ai đánh, tự chúng phát ra âm thanh.
Manussānaṃ andubandhanādīni khaṇḍākhaṇḍaṃ chijjiṃsu.
The bonds of humans, such as fetters, broke into pieces.
Dây trói và các loại xiềng xích của loài người đều đứt thành từng mảnh.
Sabbarogā vūpasamiṃsu, ambilena dhotatambamalaṃ viya vigacchiṃsu.
All diseases subsided, vanishing like the tarnish on copper washed with sour liquid.
Mọi bệnh tật đều thuyên giảm, tiêu tan như đồng bẩn được rửa bằng axit.
Jaccandhā rūpāni passiṃsu.
Those born blind saw forms.
Người mù từ khi sinh ra thấy được sắc.
Jaccabadhirā saddaṃ suṇiṃsu.
Those born deaf heard sounds.
Người điếc từ khi sinh ra nghe được âm thanh.
Pīṭhasappī javasampannā ahesuṃ.
Those who moved by crawling on their buttocks became swift-footed.
Người bò bằng ghế có bánh xe trở nên nhanh nhẹn.
Jātijaḷānampi eḷamūgānaṃ sati patiṭṭhāsi.
Even the memory of those born idiotic and mute became established.
Ngay cả những người đần độn và câm bẩm sinh cũng có được chánh niệm.
Videsapakkhandā nāvā supaṭṭanaṃ pāpuṇiṃsu.
Ships that had gone astray in foreign lands reached safe harbors.
Những con thuyền bị lạc hướng ở nước ngoài đã đến được bến cảng an toàn.
Ākāsaṭṭhakabhūmaṭṭhakaratanāni sakatejobhāsitāni ahesuṃ.
Jewels located in the sky and on the ground shone with their own splendor.
Những viên ngọc quý trên trời và dưới đất đều tự phát sáng rực rỡ.
Verino mettacittaṃ paṭilabhiṃsu.
Enemies developed thoughts of loving-kindness.
Kẻ thù có được tâm từ bi.
Avīcimhi aggi nibbāyi.
The fire in Avīci was extinguished.
Lửa trong địa ngục Avīci đã tắt.
Lokantaresu āloko udapādi.
Light appeared in the Lokantarika hells.
Ánh sáng xuất hiện ở các cõi Lokantarika.
Nadīsu jalaṃ nappavattati.
Water in the rivers did not flow.
Nước sông không chảy.
Mahāsamudde madhurasaṃ udakaṃ ahosi.
The water in the great ocean became sweet.
Nước trong đại dương trở nên ngọt ngào.
Vāto na vāyi.
The wind did not blow.
Gió không thổi.
Ākāsapabbatarukkhagatā sakuṇā bhassitvā pathavigatā ahesuṃ.
Birds that were in the sky, mountains, and trees fell and landed on the ground.
Chim chóc trên trời, núi và cây cối đều rơi xuống đất.
Cando ativiroci.
The moon shone exceptionally bright.
Mặt trăng chiếu sáng rực rỡ.
Sūriyo na uṇho, na sītalo, nimmalo utusampanno ahosi.
The sun was neither hot nor cold, but pure and seasonably pleasant.
Mặt trời không nóng, không lạnh, trong lành và thời tiết ôn hòa.
Devatā attano attano vimānadvāre ṭhatvā apphoṭanaseḷanacelukkhepādīhi mahākīḷakaṃ kīḷiṃsu.
Devatās, standing at the doors of their respective mansions, engaged in great festivities with clapping, whistling, throwing up their garments, and so on.
Chư thiên đứng ở cửa cung điện của mình, hò reo, huýt sáo, tung khăn choàng và các trò vui khác.
Cātuddīpikamahāmegho vassi.
A great cloud rained over the four continents.
Mưa lớn bao trùm bốn châu lục.
Mahājanaṃ neva khudā na pipāsā pīḷesi.
The multitude was afflicted neither by hunger nor by thirst.
Đại chúng không bị đói khát hành hạ.
Dvārakavāṭāni sayameva vivariṃsu.
Door panels opened by themselves.
Cửa cổng tự động mở ra.
Pupphūpagaphalūpagā rukkhā pupphaphalāni gaṇhiṃsu.
Trees bearing flowers and fruits bore flowers and fruits.
Cây ra hoa kết trái.
Dasasahassilokadhātu ekaddhajamālā ahosi.
The ten-thousandfold world-system became a single garland of banners.
Mười ngàn thế giới trở thành một chuỗi cờ phướn duy nhất.
117
Tatrāpi dasasahassilokadhātukampo sabbaññutaññāṇapaṭilābhassa pubbanimittaṃ.
In this context, the trembling of the ten-thousandfold world-system is a premonition of the attainment of Omniscience (sabbaññutañāṇa).
Ở đây, sự chấn động của mười ngàn thế giới là điềm báo trước cho sự thành tựu trí tuệ Toàn giác (sabbaññutañāṇa).
Devatānaṃ ekacakkavāḷe sannipāto dhammacakkappavattanakāle ekappahāreneva sannipatitvā dhammaṃ paṭiggaṇhanassa pubbanimittaṃ.
The gathering of devatās in one world-system is a premonition of their gathering simultaneously to receive the Dhamma at the time of the setting in motion of the Wheel of Dhamma.
Sự tề tựu của chư thiên trong một luân vũ là điềm báo trước cho việc họ sẽ tề tựu và đón nhận Pháp cùng một lúc khi Pháp luân được chuyển.
Paṭhamaṃ devatānaṃ paṭiggahaṇaṃ catunnaṃ rūpāvacarajjhānānaṃ paṭilābhassa pubbanimittaṃ.
The devatās receiving him first is a premonition of the attainment of the four rūpāvacara jhāna meditations.
Việc chư thiên đón nhận trước là điềm báo trước cho sự thành tựu bốn thiền sắc giới (rūpāvacarajjhāna).
Pacchā manussānaṃ paṭiggahaṇaṃ catunnaṃ arūpāvacarajjhānānaṃ paṭilābhassa pubbanimittaṃ.
The humans receiving him later is a premonition of the attainment of the four arūpāvacara jhāna meditations.
Việc loài người đón nhận sau là điềm báo trước cho sự thành tựu bốn thiền vô sắc giới (arūpāvacarajjhānāna).
Tantibaddhavīṇānaṃ sayaṃ vajjanaṃ anupubbavihārapaṭilābhassa pubbanimittaṃ.
The stringed lutes sounding by themselves is a premonition of the attainment of the successive attainments (anupubbavihāra).
Việc đàn dây tự vang lên là điềm báo trước cho sự thành tựu các tầng thiền định tuần tự (anupubbavihāra).
Cammabaddhabherīnaṃ vajjanaṃ mahatiyā dhammabheriyā anussāvanassa pubbanimittaṃ.
The hide-covered drums sounding is a premonition of the sounding of the great drum of Dhamma.
Việc trống da tự vang lên là điềm báo trước cho việc đánh trống Pháp lớn (dhammabherī) để tuyên bố Pháp.
Andubandhanādīnaṃ chedo asmimānasamucchedassa pubbanimittaṃ.
The breaking of fetters and bonds is a premonition of the complete eradication of the conceit "I am" (asmimāna).
Sự đứt gãy của dây trói và các loại xiềng xích là điềm báo trước cho sự đoạn trừ hoàn toàn ngã mạn (asmimāna).
Mahājanassa rogavigamo catusaccapaṭilābhassa pubbanimittaṃ.
The disappearance of disease for the multitude is a premonition of the attainment of the Four Noble Truths.
Sự khỏi bệnh của đại chúng là điềm báo trước cho sự thành tựu Tứ Thánh Đế (catusacca).
Jaccandhānaṃ rūpadassanaṃ dibbacakkhupaṭilābhassa pubbanimittaṃ.
The seeing of forms by those born blind is a premonition of the attainment of the divine eye (dibbacakkhu).
Việc người mù bẩm sinh thấy được sắc là điềm báo trước cho sự thành tựu thiên nhãn (dibbacakkhu).
Badhirānaṃ saddassavanaṃ dibbasotadhātupaṭilābhassa pubbanimittaṃ.
The hearing of sounds by the deaf is a premonition of the attainment of the divine ear element (dibbasotadhātu).
Việc người điếc nghe được âm thanh là điềm báo trước cho sự thành tựu thiên nhĩ (dibbasotadhātu).
Pīṭhasappīnaṃ javasampadā caturiddhipādapaṭilābhassa pubbanimittaṃ.
The swiftness of foot of those who crawled on their buttocks is a premonition of the attainment of the four bases of psychic power (iddhipāda).
Sự nhanh nhẹn của người bò bằng ghế có bánh xe là điềm báo trước cho sự thành tựu bốn thần túc (iddhipāda).
Jaḷānaṃ satipatiṭṭhānaṃ catusatipaṭṭhānapaṭilābhassa pubbanimittaṃ.
The establishment of mindfulness in the idiotic is a premonition of the attainment of the four foundations of mindfulness (satipaṭṭhāna).
Sự thiết lập chánh niệm của người đần độn là điềm báo trước cho sự thành tựu Tứ Niệm Xứ (catusatipaṭṭhāna).
Videsapakkhandanāvānaṃ supaṭṭanasampāpuṇanaṃ catupaṭisambhidādhigamassa pubbanimittaṃ.
The ships that had gone astray reaching safe harbors is a premonition of the attainment of the four analytical knowledges (paṭisambhidā).
Việc những con thuyền bị lạc hướng ở nước ngoài đến được bến cảng an toàn là điềm báo trước cho sự thành tựu Tứ Vô Ngại Giải (catupaṭisambhidā).
Ratanānaṃ sakatejobhāsitattaṃ yaṃ lokassa dhammobhāsaṃ dassessati, tassa pubbanimittaṃ.
The shining of jewels with their own splendor is a premonition of the light of Dhamma that he would show to the world.
Việc các viên ngọc quý tự phát sáng rực rỡ là điềm báo trước cho việc Ngài sẽ chiếu sáng ánh sáng Pháp cho thế gian.
118
Verīnaṃ mettacittapaṭilābho catubrahmavihārapaṭilābhassa pubbanimittaṃ.
The attainment of thoughts of loving-kindness by enemies is a premonition of the attainment of the four divine abidings (brahmavihāra).
Việc kẻ thù có được tâm từ bi là điềm báo trước cho sự thành tựu bốn vô lượng tâm (catubrahmavihāra).
Avīcimhi agginibbāyanaṃ ekādasaagginibbāyanassa pubbanimittaṃ.
The extinguishing of fire in Avīci is a premonition of the extinguishing of the eleven fires (eleven types of defilements).
Việc lửa trong địa ngục Avīci tắt là điềm báo trước cho sự dập tắt mười một loại lửa (ekādasaaggi).
Lokantarikāloko avijjandhakāraṃ vidhamitvā ñāṇālokadassanassa pubbanimittaṃ.
The light in the Lokantarika hells is a premonition of seeing the light of wisdom, having dispelled the darkness of ignorance.
Ánh sáng trong cõi Lokantarika là điềm báo trước cho việc xua tan bóng tối vô minh (avijjandhakāra) và chiếu sáng ánh sáng trí tuệ (ñāṇāloka).
Mahāsamuddassa madhuratā nibbānarasena ekarasabhāvassa pubbanimittaṃ.
The sweetness of the great ocean is a premonition of the oneness of flavor with the taste of Nibbāna.
Sự ngọt ngào của đại dương là điềm báo trước cho trạng thái nhất vị của vị Niết Bàn (nibbānarasena ekarasabhāvassa).
Vātassa avāyanaṃ dvāsaṭṭhidiṭṭhigatabhindanassa pubbanimittaṃ.
The wind not blowing is a premonition of the breaking of the sixty-two wrong views.
Việc gió không thổi là điềm báo trước cho sự phá vỡ sáu mươi hai tà kiến (dvāsaṭṭhidiṭṭhigata).
Sakuṇānaṃ pathavigamanaṃ mahājanassa ovādaṃ sutvā pāṇehi saraṇagamanassa pubbanimittaṃ.
The birds coming down to earth is a premonition of the multitude, having heard his instructions, taking refuge with their lives.
Việc chim chóc rơi xuống đất là điềm báo trước cho việc đại chúng lắng nghe lời giáo huấn và quy y Tam Bảo bằng cả sinh mạng.
Candassa ativirocanaṃ bahujanakantatāya pubbanimittaṃ.
The exceptional shining of the moon is a premonition of being pleasing to many people.
Việc mặt trăng chiếu sáng rực rỡ là điềm báo trước cho việc Ngài được nhiều người yêu mến.
Sūriyassa uṇhasītavivajjanautusukhatā kāyikacetasikasukhappattiyā pubbanimittaṃ.
The sun's freedom from heat and cold, and its pleasant seasonable state, is a premonition of the attainment of physical and mental happiness.
Sự không nóng không lạnh, thời tiết ôn hòa của mặt trời là điềm báo trước cho sự đạt được hạnh phúc thân và tâm (kāyikacetasikasukhappatti).
Devatānaṃ vimānadvāresu ṭhatvā apphoṭanādīhi kīḷanaṃ buddhabhāvaṃ patvā udānaṃ udānassa pubbanimittaṃ.
The devatās standing at the gates of their mansions and frolicking with clapping and so on, is a premonition of his uttering an utterance of joy (udāna) after attaining Buddhahood.
Việc chư thiên đứng ở cửa cung điện của mình, hò reo và các trò vui khác là điềm báo trước cho việc Ngài sẽ đạt được Phật quả và thốt lên lời cảm hứng (udāna).
Cātuddīpikamahāmeghavassanaṃ mahato dhammameghavassanassa pubbanimittaṃ.
The raining of the great cloud over the four continents is a premonition of the raining of the great cloud of Dhamma.
Việc mưa lớn bao trùm bốn châu lục là điềm báo trước cho trận mưa Pháp lớn (dhammamegha).
Khudāpīḷanassa abhāvo kāyagatāsatiamatapaṭilābhassa pubbanimittaṃ.
The absence of affliction by hunger is a premonition of the attainment of the deathless based on mindfulness of the body (kāyagatāsati).
Sự không bị đói hành hạ là điềm báo trước cho sự thành tựu bất tử (amata) dựa trên niệm thân (kāyagatāsati).
Pipāsāpīḷanassa abhāvo vimuttisukhena sukhitabhāvassa pubbanimittaṃ.
The absence of affliction by thirst is a premonition of being happy with the happiness of liberation.
Sự không bị khát hành hạ là điềm báo trước cho trạng thái hạnh phúc với sự giải thoát (vimuttisukhena sukhitabhāvassa).
Dvārakavāṭānaṃ sayameva vivaraṇaṃ aṭṭhaṅgikamaggadvāravivaraṇassa pubbanimittaṃ.
The door panels opening by themselves is a premonition of the opening of the door of the Noble Eightfold Path (aṭṭhaṅgika magga).
Việc cửa cổng tự động mở ra là điềm báo trước cho việc mở ra cánh cửa Bát Chánh Đạo (aṭṭhaṅgikamaggadvāra).
Rukkhānaṃ pupphaphalaggahaṇaṃ vimuttipupphehi pupphitassa ca sāmaññaphalabhārabharitabhāvassa ca pubbanimittaṃ.
The trees bearing flowers and fruits is a premonition of having blossomed with the flowers of liberation and being laden with the burden of the fruits of recluseship.
Việc cây cối ra hoa kết trái là điềm báo trước cho việc Ngài sẽ nở hoa với hoa giải thoát (vimuttipuppha) và gánh đầy quả vị Sa-môn (sāmaññaphala).
Dasasahassilokadhātuyā ekaddhajamālitā ariyaddhajamālamālitāya pubbanimittanti veditabbaṃ.
The ten-thousandfold world-system becoming adorned with a single garland of banners is a premonition of being adorned with the garland of noble banners. This should be understood.
Việc mười ngàn thế giới trở thành một chuỗi cờ phướn duy nhất là điềm báo trước cho việc được trang hoàng bằng chuỗi cờ phướn Thánh (ariyaddhajamālā).
Ayaṃ sambahulavāro nāma.
This is called the "Comprehensive Account."
Đây được gọi là sambahulavāra.
119
Ettha pañhaṃ pucchanti – ‘‘yadā mahāpuriso pathaviyaṃ patiṭṭhahitvā uttarābhimukho padasā gantvā āsabhiṃ vācaṃ abhāsi, tadā kiṃ pathaviyā gato, udāhu ākāsena; dissamāno gato, udāhu adissamāno; acelako gato, udāhu alaṅkatapaṭiyatto; daharo hutvā gato, udāhu mahallako; pacchāpi kiṃ tādisova ahosi, udāhu puna bāladārako’’ti?
Here, a question is asked: "When the Great Being stood on the earth, faced north, and went on foot, uttering a noble speech, did he go by land or by air? Did he go visibly or invisibly? Did he go without clothes or adorned and prepared? Did he go as a youth or as an elder? And afterwards, did he remain like that, or was he a young child again?"
Ở đây, người ta đặt câu hỏi: “Khi Đại nhân đứng trên mặt đất, hướng về phía Bắc và đi bộ, rồi thốt ra lời āsabhi, lúc đó Ngài đi trên mặt đất hay trên không trung? Ngài đi hiện hữu hay vô hình? Ngài đi không mặc y phục hay trang phục chỉnh tề? Ngài đi khi còn trẻ hay đã lớn tuổi? Và sau đó Ngài có còn như vậy không, hay lại trở thành một đứa trẻ sơ sinh?”
Ayaṃ pana pañho heṭṭhālohapāsāde samuṭṭhito tipiṭakacūḷābhayattherena vissajjitova.
Moreover, this question, which arose at the foot of the Lohapāsāda, was answered by Tipiṭakacūḷābhaya Thera.
Tuy nhiên, vấn đề này đã được Trưởng lão Tipiṭakacūḷābhaya giải đáp tại Loha Pāsāda phía dưới.
Thero kira ettha niyatipubbekatakammaissaranimmānavādavasena taṃ taṃ bahuṃ vatvā avasāne evaṃ byākari – ‘‘mahāpuriso pathaviyā gato, mahājanassa pana ākāsena gacchanto viya ahosi.
The Thera, it is said, concerning this question, spoke at length on various topics according to the doctrines of Niyati, Pubbekatakamma, and Issaranimmāna, and finally answered thus: "The Great Being went by land, but to the multitude, it was as if he went by air.
Vị Trưởng lão ấy, trong trường hợp này, đã nói rất nhiều điều liên quan đến thuyết định mệnh (niyati), thuyết nghiệp quá khứ (pubbekatakamma) và thuyết thần tạo (issaranimmāna), rồi cuối cùng giải thích như sau: “Đức Đại nhân đã đi trên mặt đất, nhưng đối với đại chúng thì dường như Ngài đi trên không trung.
Dissamāno gato, mahājanassa pana adissamāno viya ahosi.
He went visibly, but to the multitude, it was as if he went invisibly.
Ngài đã đi một cách hiển lộ, nhưng đối với đại chúng thì dường như Ngài vô hình.
Acelako gato, mahājanassa pana alaṅkatapaṭiyatto viya upaṭṭhāsi.
He went without clothes, but to the multitude, he appeared as if adorned and prepared.
Ngài đã đi trần trụi, nhưng đối với đại chúng thì dường như Ngài được trang sức chỉnh tề.
Daharova gato, mahājanassa pana soḷasavassuddesiko viya ahosi.
He went as a youth, but to the multitude, he appeared as if sixteen years old.
Ngài đã đi khi còn trẻ, nhưng đối với đại chúng thì dường như Ngài đã mười sáu tuổi.
Pacchā pana bāladārakova ahosi, na tādiso’’ti.
Afterwards, however, he was indeed a young child, not like that."
Nhưng sau đó Ngài chỉ là một đứa trẻ, không phải như vậy nữa.”
Parisā cassa – ‘‘buddhena viya hutvā bho therena pañho kathito’’ti attamanā ahosi.
And his assembly was delighted, saying: "The Thera has answered the question as if he were the Buddha!"
Và hội chúng của Ngài đã hoan hỷ mà nói: “Ôi Trưởng lão đã giải đáp vấn đề như Đức Phật vậy!”
Lokantarikavāro vuttanayo eva.
The section on Lokantarika is as stated before.
Phần Lokantarika cũng theo cách đã nói.
120
Imā ca pana ādito paṭṭhāya kathitā sabbadhammatā sabbabodhisattānaṃ hontīti veditabbā.
It should be understood that all these Dhammatā, mentioned from the beginning, belong to all Bodhisattas.
Và cần phải hiểu rằng tất cả các Pháp tánh (dhammatā) đã được nói từ ban đầu này đều thuộc về tất cả các vị Bồ Tát.
121
Dvattiṃsamahāpurisalakkhaṇavaṇṇanā
Description of the Thirty-two Marks of a Great Man
Mô tả 32 tướng Đại nhân
122
33. Addasa khoti dukūlacumbaṭake nipajjāpetvā ānītaṃ addasa.
33. He saw means he saw the Prince who was brought and laid on a coil of fine cloth.
33. Addasa kho có nghĩa là đã thấy vị hoàng tử được đặt trên tấm vải lụa mỏng và mang đến.
Mahāpurisassāti jātigottakulapadesādivasena mahantassa purisassa.
Of a Great Man means of a great person in terms of birth, lineage, family, region, and so on.
Mahāpurisassa có nghĩa là của một vị nam nhân vĩ đại về dòng dõi, chủng tộc, gia đình, địa vị, v.v.
Dve gatiyoti dve niṭṭhā, dve nipphattiyo.
Two destinies means two conclusions, two accomplishments.
Dve gatiyo có nghĩa là hai sự kết thúc, hai sự thành tựu.
Ayañhi gatisaddo – ‘‘pañca kho imā, sāriputta, gatiyo’’ti (ma. ni. 1.153) ettha nirayādibhedāya sattehi gantabbagatiyā vattati.
Indeed, this word gati in "These are the five destinies, Sāriputta" refers to the destination to be reached by beings, such as hell and so on.
Từ gati này, trong câu “Này Sāriputta, có năm gati này” (M.N. 1.153), nó được dùng để chỉ gati mà chúng sinh phải đi, được phân loại thành địa ngục, v.v.
‘‘Imesaṃ kho ahaṃ bhikkhūnaṃ sīlavantānaṃ kalyāṇadhammānaṃ neva jānāmi āgatiṃ vā gatiṃ vā’’ti (ma. ni. 1.508) ettha ajjhāsaye.
In "I do not know the coming or going of these virtuous bhikkhus with good qualities," it refers to intention.
Trong câu “Ta không biết sự đến hay sự đi của những Tỳ-khưu có giới hạnh, có Pháp lành này” (M.N. 1.508), nó được dùng để chỉ ý định (ajjhāsaya).
‘‘Nibbānaṃ arahato gatī’’ti (pari. 339) ettha paṭissaraṇe.
In "Nibbāna is the refuge of the Arahant," it refers to a refuge.
Trong câu “Nibbāna là nơi nương tựa của bậc A-la-hán” (Pari. 339), nó được dùng để chỉ nơi nương tựa (paṭissaraṇa).
‘‘Api ca tyāhaṃ brahme gatiñca pajānāmi, jutiñca pajānāmi evaṃmahiddhiko bako brahmā’’ti (ma. ni. 1.503) ettha nipphattiyaṃ vattati.
In "But O Brahmā, I know your accomplishment, and I know your radiance; such is the great power of Brahmā Baka," it refers to accomplishment.
Trong câu “Này Phạm thiên, ta biết sự thành tựu (gati) của ngươi, và ta biết ánh sáng (juti) của ngươi, Phạm thiên Baka có đại thần lực như vậy” (M.N. 1.503), nó được dùng để chỉ sự thành tựu (nipphatti).
Svāyamidhāpi nipphattiyaṃ vattatīti veditabbo.
This* here also refers to accomplishment, so it should be understood.
Vậy nên, ở đây nó cũng cần được hiểu là chỉ sự thành tựu.
Anaññāti aññā gati nipphatti nāma natthi.
No other means there is no other such destiny or accomplishment.
Anaññā có nghĩa là không có sự thành tựu nào khác.
123
Dhammikoti dasakusaladhammasamannāgato agatigamanavirahito.
Righteous means endowed with the ten wholesome dhammas, free from unrighteous conduct.
Dhammiko có nghĩa là người đầy đủ mười pháp thiện nghiệp, không đi theo con đường sai trái.
Dhammarājāti idaṃ purimapadasseva vevacanaṃ.
Righteous King is a synonym for the preceding word.
Dhammarājā là từ đồng nghĩa của từ trước.
Dhammena vā laddharajjattā dhammarājā.
Or he is a righteous king because his kingship was obtained righteously.
Hoặc là Dhammarājā vì đã đạt được vương quyền bằng Pháp.
Cāturantoti puratthimasamuddādīnaṃ catunnaṃ samuddānaṃ vasena caturantāya pathaviyā issaro.
Lord of the four continents means he is the ruler of the four-continent earth, bounded by the four oceans, such as the eastern ocean and so on.
Cāturanto có nghĩa là vị vua của trái đất có bốn bờ cõi, tức là bốn đại dương như biển phía đông, v.v.
Vijitāvīti vijitasaṅgāmo.
Victorious means one whose battles are won.
Vijitāvī có nghĩa là người đã chiến thắng trong các trận chiến.
Janapado asmiṃ thāvariyaṃ thirabhāvaṃ pattoti janapadatthāvariyappatto. Caṇḍassa hi rañño balidaṇḍādīhi lokaṃ pīḷayato manussā majjhimajanapadaṃ chaḍḍetvā pabbatasamuddatīrādīni nissāya paccante vāsaṃ kappenti.
The kingdom has attained stability or firmness under him, therefore janapadatthāvariyappatto (one who has attained stability in his kingdom). For when a cruel king oppresses the people with taxes and punishments, people abandon the central regions and settle in border areas, relying on mountains, sea-shores, and so on.
Janapadatthāvariyappatto có nghĩa là quốc độ đã đạt được sự vững chắc, ổn định trong vị vua này. Thật vậy, khi một vị vua hung ác áp bức dân chúng bằng thuế má và hình phạt, người dân sẽ bỏ vùng trung tâm mà nương tựa vào các vùng núi, bờ biển, v.v., và sinh sống ở các vùng biên giới.
Atimudukassa rañño corehi sāhasikadhanavilopapīḷitā manussā paccantaṃ pahāya janapadamajjhe vāsaṃ kappenti, iti evarūpe rājini janapado thirabhāvaṃ na pāpuṇāti.
When a very gentle king rules, people, oppressed by robbers who violently seize their wealth, abandon the border areas and settle in the middle of the kingdom. Thus, in such a king, the kingdom does not attain stability.
Khi một vị vua quá mềm yếu, người dân bị bọn cướp và kẻ bạo tàn cướp bóc tài sản, áp bức, họ sẽ bỏ vùng biên giới mà đến sống ở giữa quốc độ; do đó, trong một vị vua như vậy, quốc độ không đạt được sự ổn định.
Imasmiṃ pana kumāre rajjaṃ kārayamāne etassa janapado pāsāṇapiṭṭhiyaṃ ṭhapetvā ayopaṭṭena parikkhitto viya thiro bhavissatīti dassento – ‘‘janapadatthāvariyappatto’’ti āhaṃsu.
But they said, "His kingdom will be firm, as if placed on a rock and surrounded by an iron plate," indicating that when this prince rules, his kingdom will be stable, hence " janapadatthāvariyappatto."
Nhưng khi vị hoàng tử này trị vì, quốc độ của Ngài sẽ vững chắc như được đặt trên một tảng đá và được bao quanh bởi một tấm sắt; để chỉ điều này, họ đã nói: “janapadatthāvariyappatto”.
124
Sattaratanasamannāgatoti ettha ratijananaṭṭhena ratanaṃ. Apica –
Endowed with the Seven Jewels. Here, ratana (jewel) means that which gives delight.
Sattaratanasamannāgato Ở đây, ratana (báu vật) có nghĩa là vật tạo ra sự hoan hỷ.
125
‘‘Cittīkataṃ mahagghañca, atulaṃ dullabhadassanaṃ;
Furthermore:
Hơn nữa:
126
Anomasattaparibhogaṃ, ratanaṃ tena vuccati’’.
"It is esteemed, precious, incomparable, hard to see;
“Vật được quý trọng, có giá trị lớn, vô song, hiếm thấy;
127
Cakkaratanassa ca nibbattakālato paṭṭhāya aññaṃ devaṭṭhānaṃ nāma na hoti, sabbe gandhapupphādīhi tasseva pūjañca abhivādanādīni ca karontīti cittīkataṭṭhena ratanaṃ.
enjoyed by noble beings, therefore it is called a jewel."
Được hưởng dụng bởi chúng sinh cao quý, đó gọi là ratana.” Từ khi bánh xe báu (cakkaratana) xuất hiện, không còn có nơi thờ cúng thần linh nào khác; tất cả mọi người đều cúng dường bằng hương hoa, v.v., và làm lễ đảnh lễ nó; do đó, nó là ratana vì được quý trọng.
Cakkaratanassa ca ettakaṃ nāma dhanaṃ agghatīti aggho natthi, iti mahagghaṭṭhenāpi ratanaṃ.
And from the time the Wheel-jewel appears, there is no other place of worship; everyone performs reverence and salutations to it with perfumes, flowers, and so on. Thus, it is a jewel in the sense of being esteemed.
Và bánh xe báu không có giá trị nào có thể định được, nên nó cũng là ratana vì có giá trị lớn.
Cakkaratanañca aññehi loke vijjamānaratanehi asadisanti atulaṭṭhenāpi ratanaṃ.
And the Wheel-jewel has no specific value, meaning there is no price for it. Thus, it is a jewel also in the sense of being precious.
Và bánh xe báu không thể so sánh với các báu vật khác có trên thế gian, nên nó cũng là ratana vì vô song.
Yasmā ca pana yasmiṃ kappe buddhā uppajjanti, tasmiṃyeva cakkavattino uppajjanti, buddhā ca kadāci karahaci uppajjanti, tasmā dullabhadassanaṭṭhenāpi ratanaṃ.
And the Wheel-jewel is incomparable to other jewels existing in the world. Thus, it is a jewel also in the sense of being incomparable.
Và bởi vì các vị Phật xuất hiện trong kiếp nào thì các vị Chuyển Luân Vương cũng xuất hiện trong kiếp đó, và các vị Phật thì thỉnh thoảng mới xuất hiện; do đó, nó cũng là ratana vì hiếm thấy.
Tadetaṃ jātirūpakulaissariyādīhi anomassa uḷārasattasseva uppajjati, na aññassāti anomasattaparibhogaṭṭhenāpi ratanaṃ.
And since Buddhas arise in the same eon as Wheel-turning monarchs, and Buddhas arise rarely, it is a jewel also in the sense of being hard to see.
Và báu vật này chỉ xuất hiện cho những chúng sinh cao quý, không thấp kém về dòng dõi, sắc đẹp, gia đình, quyền lực, v.v., chứ không phải cho người khác; do đó, nó cũng là ratana vì được hưởng dụng bởi chúng sinh cao quý.
Yathā cakkaratanaṃ, evaṃ sesānipīti.
And it arises only for a noble being, one who is superior in birth, appearance, family, power, and so on, not for anyone else. Thus, it is a jewel also in the sense of being enjoyed by noble beings.
Cũng như bánh xe báu, các báu vật còn lại cũng vậy.
Imehi sattahi ratanehi parivārabhāvena ceva sabbabhogūpakaraṇabhāvena ca samannāgatoti sattaratanasamannāgato.
Just as the Wheel-jewel, so are the others.
Sattaratanasamannāgato có nghĩa là được đầy đủ bảy báu vật này, vừa là tùy tùng vừa là tất cả các vật dụng và công cụ hưởng thụ.
128
Idāni tesaṃ sarūpato dassanatthaṃ tassimānītiādi vuttaṃ.
Thus, he is endowed with the seven jewels, both in the sense of being surrounded by them and in the sense of all provisions and equipment.
Bây giờ, để trình bày bản chất của chúng, đã nói tassimānī (những điều này), v.v.
Tattha cakkaratanantiādīsu ayaṃ saṅkhepādhippāyo – dvesahassadīpaparivārānaṃ catunnaṃ mahādīpānaṃ sirivibhavaṃ gahetvā dātuṃ samatthaṃ cakkaratanaṃ pātubhavati.
Now, in order to show their nature, the phrase tassimāni and so on, is stated.
Trong đó, cakkaratana (bánh xe báu), v.v., ý nghĩa tóm tắt là: bánh xe báu xuất hiện, có khả năng thu nhận và ban phát sự vinh quang và tài sản của bốn đại châu cùng hai ngàn tiểu đảo.
Tathā purebhattameva sāgarapariyantaṃ pathaviṃ anusaṃyāyanasamatthaṃ vehāsaṅgamaṃ hatthiratanaṃ, tādisameva assaratanaṃ, caturaṅgasamannāgate andhakāre yojanappamāṇaṃ andhakāraṃ vidhamitvā ālokadassanasamatthaṃ maṇiratanaṃ, chabbidhadosavivajjitaṃ manāpacāri itthiratanaṃ, yojanappamāṇe antopathavigataṃ nidhiṃ dassanasamatthaṃ gahapatiratanaṃ, aggamahesiyā kucchimhi nibbattitvā sakalarajjamanusāsanasamatthaṃ jeṭṭhaputtasaṅkhātaṃ pariṇāyakaratanaṃ pātubhavati.
Among these, in cakkaratanaṃ and so on, this is the brief meaning: The Wheel-jewel appears, capable of seizing and bestowing the splendor and prosperity of the four great continents, each surrounded by two thousand small islands.
Tương tự, voi báu (hatthiratana) có khả năng bay trên không trung, có thể đi khắp trái đất đến tận biển cả ngay trước bữa ăn; ngựa báu (assaratana) cũng tương tự; ngọc báu (maṇiratana) có khả năng xua tan bóng tối rộng một dojana (yojana) trong bóng tối đầy đủ bốn yếu tố (mây, đêm, rừng rậm, nửa đêm) và hiển lộ ánh sáng; nữ báu (itthiratana) là một hoàng hậu có phẩm hạnh đáng yêu, không có sáu lỗi lầm (đen, trắng, béo, gầy, thấp, cao); gia chủ báu (gahapatiratana) có khả năng nhìn thấy kho báu ẩn sâu trong lòng đất rộng một dojana; và con trưởng (jeṭṭhaputta) được gọi là vị lãnh đạo báu (pariṇāyakaratana), xuất hiện trong bụng của hoàng hậu tối cao và có khả năng cai trị toàn bộ vương quốc.
129
Parosahassanti atirekasahassaṃ.
Likewise, the Elephant-jewel appears, capable of traversing the earth up to the ocean, flying through the air, even before the morning meal; similarly, the Horse-jewel; the Jewel-gem appears, capable of dispelling darkness and showing light for a yojana (league) even in fourfold darkness (dense fog, clouds, night, and forest); the Woman-jewel appears, of charming conduct, free from six kinds of faults; the Householder-jewel appears, capable of seeing hidden treasures within the earth for a yojana; the Guide-jewel, meaning the eldest son, appears, born in the chief queen's womb and capable of ruling the entire kingdom.
Parosahassaṃ có nghĩa là hơn một ngàn.
Sūrāti abhīrukā.
More than a thousand means over a thousand.
Sūrā có nghĩa là không sợ hãi, dũng cảm.
Vīraṅgarūpāti vīrānaṃ aṅgaṃ vīraṅgaṃ, vīriyassetaṃ nāmaṃ, vīraṅgaṃ rūpametesanti vīraṅgarūpā, vīriyajātikā vīriyasabhāvā vīriyamayā akilāsuno ahesuṃ.
Heroes means fearless ones.
Vīraṅgarūpā có nghĩa là vīraṅga là phẩm chất của những người dũng cảm, đây là tên của sự tinh tấn; những người có phẩm chất vīraṅga thì được gọi là vīraṅgarūpā, tức là những người có bản chất tinh tấn, có tính chất tinh tấn, đầy tinh tấn, không mệt mỏi.
Divasampi yujjhantā na kilamantīti vuttaṃ hoti.
Heroic in form means vīraṅga is the quality of heroes, it is a name for vīriya (energy); vīraṅgarūpā means those whose form is vīraṅga, they are of the nature of energy, possessed of energy, full of energy, unwearying.
Có nghĩa là họ không mệt mỏi dù chiến đấu cả ngày.
Sāgarapariyantanti cakkavāḷapabbataṃ sīmaṃ katvā ṭhitasamuddapariyantaṃ.
It is said that they do not tire even if they fight for a day.
Sāgarapariyantaṃ có nghĩa là đến tận biển cả, với dãy núi Cakkavāḷa làm ranh giới.
Adaṇḍenāti ye katāparādhe satte satampi sahassampi gaṇhanti, te dhanadaṇḍena rajjaṃ kārenti.
Bounded by the ocean means bounded by the ocean that stands with the Cakkavāḷa mountain as its limit.
Adaṇḍena có nghĩa là những vị vua bắt giữ hàng trăm, hàng ngàn chúng sinh phạm tội, họ trị vì bằng hình phạt tiền bạc.
Ye chejjabhejjaṃ anusāsanti, te satthadaṇḍena.
Without punishment means those kings who seize hundreds or thousands from offenders rule the kingdom with monetary punishment.
Những vị vua ra lệnh cắt xẻ, chặt chém, họ trị vì bằng hình phạt vũ khí.
Ayaṃ pana duvidhampi daṇḍaṃ pahāya adaṇḍena ajjhāvasati.
Those who prescribe cutting and breaking rule with weapon punishment.
Nhưng vị vua này trị vì mà không dùng cả hai loại hình phạt đó.
Asatthenāti ye ekatodhārādinā satthena paraṃ vihesanti, te satthena rajjaṃ kārenti nāma.
But this one (the Cakkavatti king), abandoning both kinds of punishment, rules without punishment.
Asatthenā có nghĩa là những vị vua làm hại người khác bằng vũ khí như gươm một lưỡi, v.v., thì được gọi là trị vì bằng vũ khí.
Ayaṃ pana satthena khuddamakkhikāyapi pivanamattaṃ lohitaṃ kassaci anuppādetvā dhammeneva – ‘‘ehi kho mahārājā’’ti evaṃ paṭirājūhi sampaṭicchitāgamano vuttappakāraṃ pathaviṃ abhivijinitvā ajjhāvasati, abhibhavitvā sāmī hutvā vasatīti attho.
This (Cakkavatti king), however, without causing even an amount of blood (sufficient for drinking) of a small fly to arise in anyone by force of arms, by righteousness alone, being one whose arrival is accepted by opposing kings saying, "Come, Your Majesty!", conquers the aforementioned kind of earth and dwells in it, meaning he overcomes it and resides as its master.
Nhưng vị này, không dùng vũ khí làm chảy máu dù chỉ bằng lượng một con ruồi nhỏ của bất cứ ai, mà bằng Pháp, được các vua đối địch chấp nhận và đến với lời thỉnh cầu "Xin mời, Đại vương!", đã chinh phục và an trú trên trái đất như đã nói, nghĩa là đã chế ngự và trở thành chủ nhân.
130
Evaṃ ekaṃ nipphattiṃ kathetvā dutiyaṃ kathetuṃ sace kho panātiādi vuttaṃ.
Thus, having explained one achievement, the passage beginning with " sace kho pana" was stated to explain the second.
Sau khi nói về sự thành tựu thứ nhất như vậy, để nói về sự thành tựu thứ hai, câu sace kho pana (nếu như) và những từ tiếp theo đã được nói đến.
Tattha rāgadosamohamānadiṭṭhikilesataṇhāsaṅkhātaṃ chadanaṃ āvaraṇaṃ vivaṭaṃ viddhaṃsitaṃ vivaṭakaṃ etenāti vivaṭacchado. ‘‘Vivaṭṭacchadā’’tipi pāṭho, ayameva attho.
Therein, because by him the concealing and obstructing defilement and craving, which are reckoned as passion, hatred, delusion, conceit, and wrong views, have been opened, destroyed, and unveiled, therefore he is called vivaṭacchada. The reading "Vivaṭṭacchadā" also exists, and the meaning is the same.
Ở đó, vivaṭacchado (người đã mở bỏ màn che) có nghĩa là vị ấy đã mở bỏ, đã phá hủy, đã gỡ bỏ màn che, sự che đậy được gọi là tham, sân, si, mạn, tà kiến, phiền não và ái. Cũng có bản đọc là ‘‘Vivaṭṭacchadā’’, ý nghĩa vẫn như vậy.
131
35. Evaṃ dutiyaṃ nipphattiṃ kathetvā tāsaṃ nimittabhūtāni lakkhaṇāni dassetuṃ ayañhi, deva, kumārotiādi vuttaṃ.
35. Thus, having explained the second achievement, the passage beginning with " Ayañhi, deva, kumāro" was stated to show the marks that are the signs of these achievements.
35. Sau khi nói về sự thành tựu thứ hai như vậy, để chỉ ra các dấu hiệu là biểu tượng của những thành tựu đó, câu ayañhi, deva, kumāro (Thưa Thiên chủ, vị hoàng tử này) và những từ tiếp theo đã được nói đến.
Tattha suppatiṭṭhitapādoti yathā aññesaṃ bhūmiyaṃ pādaṃ ṭhapentānaṃ aggapādatalaṃ vā paṇhi vā passaṃ vā paṭhamaṃ phusati, vemajjhe vā pana chiddaṃ hoti, ukkhipantānaṃ aggatalādīsu ekakoṭṭhāsova paṭhamaṃ uṭṭhahati, na evamassa.
Therein, suppatiṭṭhitapādo means that unlike others whose toes, or heels, or sides of the feet touch the ground first when they place their feet, or whose mid-soles have a gap, or when they lift their feet, only one part such as the toes rises first—it is not so for him.
Ở đó, suppatiṭṭhitapādo (bàn chân đặt vững vàng) có nghĩa là không như những người khác khi đặt chân xuống đất, phần mũi bàn chân, gót chân hoặc cạnh bàn chân chạm đất trước, hoặc có một khoảng trống ở giữa, và khi nhấc chân lên, chỉ một phần của mũi chân hoặc các phần khác nhấc lên trước; vị ấy không như vậy.
Assa pana suvaṇṇapādukatalamiva ekappahāreneva sakalaṃ pādatalaṃ bhūmiṃ phusati, ekappahāreneva bhūmito uṭṭhahati.
But for him, like a golden sandal, his entire sole touches the ground with one stroke, and rises from the ground with one stroke.
Mà bàn chân của vị ấy, giống như đế dép vàng, toàn bộ lòng bàn chân chạm đất cùng một lúc, và cũng nhấc khỏi mặt đất cùng một lúc.
Tasmā ayaṃ suppatiṭṭhitapādo.
Therefore, he is called suppatiṭṭhitapādo (firm-footed, or having feet well-established on the ground).
Vì vậy, vị ấy là người có bàn chân đặt vững vàng.
132
Cakkānīti dvīsu pādatalesu dve cakkāni, tesaṃ arā ca nemi ca nābhi ca pāḷiyaṃ vuttāva.
Cakkāni (wheels) refers to the two wheels on the two soles of his feet. Their spokes, felloe, and nave are already mentioned in the Pāḷi text.
Cakkāni (các bánh xe) là hai bánh xe trên hai lòng bàn chân, các nan hoa, vành và trục của chúng đã được nói đến trong Pāḷi.
Sabbākāraparipūrānīti iminā pana ayaṃ viseso veditabbo, tesaṃ kira cakkānaṃ pādatalassa majjhe nābhi dissati, nābhiparicchinnā vaṭṭalekhā dissati, nābhimukhaparikkhepapaṭṭo dissati, panāḷimukhaṃ dissati, arā dissanti, aresu vaṭṭilekhā dissanti, nemimaṇikā dissanti.
With " sabbākāraparipūrāni" (complete in all aspects), this specific detail should be understood: it is said that in the middle of the sole of his feet, the nave of the wheels is visible, a circular line encompassing the nave is visible, a band encircling the opening of the nave is visible, the opening of the pipe is visible, the spokes are visible, circular lines on the spokes are visible, and gem-like ornaments on the felloe are visible.
Tuy nhiên, với từ sabbākāraparipūrāni (đầy đủ mọi hình tướng), điều đặc biệt này cần được hiểu: trên lòng bàn chân của các bánh xe đó, trục bánh xe hiện rõ, đường tròn bao quanh trục hiện rõ, vành bao quanh miệng trục hiện rõ, miệng ống hiện rõ, các nan hoa hiện rõ, các đường tròn trên nan hoa hiện rõ, và các hạt ngọc trên vành hiện rõ.
Idaṃ tāva pāḷiyaṃ āgatameva.
This much is directly from the Pāḷi text.
Điều này đã được đề cập trong Pāḷi.
Sambahulavāro pana anāgato, so evaṃ daṭṭhabbo – satti, sirivaccho, nandi, sovattiko, vaṭaṃsako, vaḍḍhamānakaṃ, macchayugaḷaṃ, bhaddapīṭhaṃ, aṅkusako, pāsādo, toraṇaṃ, setacchattaṃ, khaggo, tālavaṇṭaṃ, morahatthako, vāḷabījanī, uṇhīsaṃ, maṇi, patto, sumanadāmaṃ, nīluppalaṃ, rattuppalaṃ, setuppalaṃ, padumaṃ, puṇḍarīkaṃ, puṇṇaghaṭo, puṇṇapāti, samuddo, cakkavāḷo, himavā, sineru, candimasūriyā, nakkhattāni, cattāro mahādīpā, dviparittadīpasahassāni, antamaso cakkavattirañño parisaṃ upādāya sabbo cakkalakkhaṇasseva parivāro.
However, the sambahulavāra (multiplicity of characteristics) is not directly present, and it should be understood as follows: spear, śrīvatsa (a lucky mark), nandi (auspicious symbol), svastika, vaṭaṃsaka (diadem), vaḍḍhamānaka (bowl of plenty), a pair of fish, bhaddapīṭha (auspicious seat), aṅkusako (elephant goad), pāsāda (palace), toraṇa (archway), white parasol, sword, tālavaṇṭa (palm-leaf fan), morahatthako (peacock-feather fan), vāḷabījanī (yak-tail whisk), uṇhīsa (turban), jewel, bowl, garland of jasmine, blue water-lily, red water-lily, white water-lily, lotus, puṇḍarīka (white lotus), puṇṇaghaṭo (full jar), puṇṇapāti (full bowl), ocean, Cakkavāḷa (world-system), Himavā (Himalayas), Sineru (Mount Sineru), moon and sun, constellations, the four great continents, two thousand minor islands – in short, the entire retinue of the Cakkavatti king's assembly is itself the retinue of the wheel-mark.
Nhưng phần sambahulavāro (nhiều biểu tượng) thì chưa được đề cập trực tiếp, nên cần được hiểu như sau: cây thương, dấu Sri Vatsa, hoa sen Nandi, dấu Svastika, vòng hoa, vật may mắn, cặp cá, ghế tốt, cái móc, lâu đài, cổng chào, lọng trắng, kiếm, quạt lá cọ, quạt lông công, quạt lông đuôi bò, khăn đội đầu, ngọc quý, bát, vòng hoa Sumanā, hoa súng xanh, hoa súng đỏ, hoa súng trắng, hoa sen, hoa sen trắng, bình đầy, chén đầy, biển cả, vũ trụ, dãy Himalaya, núi Sineru, mặt trăng và mặt trời, các chòm sao, bốn đại châu, hai ngàn tiểu châu, và thậm chí cả hội chúng của Chuyển Luân Thánh Vương, tất cả đều là các biểu tượng phụ trợ của dấu bánh xe.
133
Āyatapaṇhīti dīghapaṇhi, paripuṇṇapaṇhīti attho.
Āyatapaṇhī means long-heeled, or having full heels.
Āyatapaṇhī (gót chân dài) có nghĩa là gót chân đầy đặn.
Yathā hi aññesaṃ aggapādo dīgho hoti, paṇhimatthake jaṅghā patiṭṭhāti, paṇhiṃ tacchetvā ṭhapitā viya hoti, na evaṃ mahāpurisassa.
Just as with others, whose forefoot is long, and the shin rests on the heel, as if the heel has been cut and placed, it is not so for the Great Man.
Không như những người khác có mũi bàn chân dài, bắp chân đặt trên gót chân, gót chân như được gọt đẽo và đặt xuống; vị Đại nhân không như vậy.
Mahāpurisassa pana catūsu koṭṭhāsesu dve koṭṭhāsā aggapādo hoti, tatiye koṭṭhāse jaṅghā patiṭṭhāti, catutthakoṭṭhāse āraggena vaṭṭetvā ṭhapitā viya rattakambalageṇḍukasadisā paṇhi hoti.
But for the Great Man, two parts out of four are the forefoot, the shin rests on the third part, and the heel is like a red woollen ball, as if rounded and placed with a spear-point at the fourth part.
Mà gót chân của vị Đại nhân, trong bốn phần, hai phần là mũi bàn chân, bắp chân đặt ở phần thứ ba, và gót chân ở phần thứ tư, giống như một quả bóng len đỏ được cuộn tròn bằng đầu kim.
134
Dīghaṅgulīti yathā aññesaṃ kāci aṅguliyo dīghā honti, kāci rassā, na evaṃ mahāpurisassa.
Dīghaṅgulī means that unlike others whose some fingers are long and some short, it is not so for the Great Man.
Dīghaṅgulī (ngón tay, ngón chân dài) có nghĩa là không như những người khác có ngón tay, ngón chân cái dài, cái ngắn; vị Đại nhân không như vậy.
Mahāpurisassa pana makkaṭasseva dīghā hatthapādaṅguliyo mūle thūlā, anupubbena gantvā agge tanukā, niyyāsatelena madditvā vaṭṭitaharitālavaṭṭisadisā honti.
For the Great Man, his fingers and toes are long like a monkey's, thick at the base, gradually tapering towards the tips, resembling a stick of haritāla (yellow orpiment) kneaded with resinous oil and rolled.
Mà ngón tay, ngón chân của vị Đại nhân dài như của loài khỉ, gốc thì to, dần dần thon lại ở đầu, giống như những que thuốc nhuộm màu vàng được nhào nặn bằng dầu nhựa cây.
Tena vuttaṃ – ‘‘dīghaṅgulī’’ti.
Therefore, it is said, "dīghaṅgulī."
Vì thế mà nói: ‘‘dīghaṅgulī’’.
135
Mudutalunahatthapādoti sappimaṇḍe osāretvā ṭhapitaṃ satavāravihatakappāsapaṭalaṃ viya mudu.
Mudutalunahatthapādo means soft like a hundred-times beaten cotton sheet soaked in ghee, and tender.
Mudutalunahatthapādo (bàn tay và bàn chân mềm mại, non tơ) có nghĩa là mềm mại như một tấm bông gòn đã được đánh tơi hàng trăm lần, nhúng trong bơ sữa và đặt xuống.
Yathā ca idāni jātamattassa, evaṃ vuḍḍhakālepi mudutalunāyeva bhavissanti, mudutalunā hatthapādā etassāti mudutalunahatthapādo.
Just as they are soft and tender when he is newly born, so too will they be soft and tender in old age; he is one whose hands and feet are soft and tender, hence mudutalunahatthapādo.
Và như khi mới sinh ra, bàn tay và bàn chân của vị ấy đã mềm mại, non tơ, thì khi về già cũng sẽ vẫn mềm mại, non tơ như vậy. Vì vị ấy có bàn tay và bàn chân mềm mại, non tơ nên được gọi là mudutalunahatthapādo.
136
Jālahatthapādoti na cammena paṭibaddhaaṅgulantaro.
Jālahatthapādo means that the spaces between his fingers are not bound by skin.
Jālahatthapādo (bàn tay và bàn chân có màng lưới) có nghĩa là các ngón tay và ngón chân không bị dính liền bởi da.
Ediso hi phaṇahatthako purisadosena upahato pabbajjaṃ na paṭilabhati.
Indeed, a person with such webbed hands, if afflicted by a defect of the assembly, cannot obtain ordination.
Thật vậy, một người có bàn tay như vậy, bị khuyết tật do lỗi của hội chúng, sẽ không được thọ giới xuất gia.
Mahāpurisassa pana catasso hatthaṅguliyo pañcapi pādaṅguliyo ekappamāṇā honti, tāsaṃ ekappamāṇatāya yavalakkhaṇaṃ aññamaññaṃ paṭivijjhitvā tiṭṭhati.
But for the Great Man, his four fingers and five toes are of equal length, and because of their equal length, the barley-corn marks interpenetrate each other.
Tuy nhiên, bốn ngón tay và năm ngón chân của vị Đại nhân đều có cùng kích thước, và do có cùng kích thước, dấu hiệu hạt lúa mạch xuyên qua nhau và đứng vững.
Athassa hatthapādā kusalena vaḍḍhakinā yojitajālavātapānasadisā honti.
His hands and feet are then like a latticed window fixed by a skilled carpenter.
Thế nên, bàn tay và bàn chân của vị ấy giống như cửa sổ lưới được lắp đặt bởi một người thợ mộc lành nghề.
Tena vuttaṃ – ‘‘jālahatthapādo’’ti.
Therefore, it is said, " jālahatthapādo."
Vì thế mà nói: ‘‘jālahatthapādo’’.
137
Uddhaṃ patiṭṭhitagopphakattā ussaṅkhā pādā assāti ussaṅkhapādo. Aññesañhi piṭṭhipāde gopphakā honti, tena tesaṃ pādā āṇibaddhā viya baddhā honti, na yathāsukhaṃ parivaṭṭanti, gacchantānaṃ pādatalānipi na dissanti.
Because his ankles are firmly placed upwards, his feet have raised ankles, hence ussaṅkhapādo. For others, the ankles are near the top of the foot, and thus their feet are bound as if by an awl, they cannot turn freely, and the soles of their feet are not visible when they walk.
Ussaṅkhapādo (bàn chân có mắt cá chân cao) có nghĩa là mắt cá chân của vị ấy nằm ở phía trên. Mắt cá chân của những người khác nằm ở mu bàn chân, do đó bàn chân của họ bị bó chặt như bị đóng đinh, không thể xoay chuyển dễ dàng, và lòng bàn chân của họ không nhìn thấy được khi đi.
Mahāpurisassa pana āruhitvā upari gopphakā patiṭṭhahanti, tenassa nābhito paṭṭhāya uparimakāyo nāvāya ṭhapitasuvaṇṇapaṭimā viya niccalo hoti, adhokāyova iñjati, sukhena pādā parivaṭṭanti, puratopi pacchatopi ubhayapassesupi ṭhatvā passantānaṃ pādatalāni paññāyanti, na hatthīnaṃ viya pacchatoyeva.
But for the Great Man, the ankles are placed high up. Due to this, his upper body from the navel upwards is still, like a golden statue placed on a boat, only his lower body moves; his feet turn easily, and his soles are visible to those looking from the front, from the back, and from both sides, not just from the back like elephants.
Mắt cá chân của vị Đại nhân thì nằm ở phía trên, do đó phần thân trên từ rốn trở lên bất động như một bức tượng vàng đặt trên thuyền, chỉ có phần thân dưới cử động, bàn chân có thể xoay chuyển dễ dàng, và lòng bàn chân có thể nhìn thấy được bởi những người đứng trước, sau hoặc hai bên, không như voi chỉ có thể nhìn thấy từ phía sau.
138
Eṇijaṅghoti eṇimigasadisajaṅgho maṃsussadena paripuṇṇajaṅgho, na ekato baddhapiṇḍikamaṃso, samantato samasaṇṭhitena maṃsena parikkhittāhi suvaṭṭitāhi sāligabbhayavagabbhasadisāhi jaṅghāhi samannāgatoti attho.
Eṇijaṅgho means having shins like those of an eṇi deer, having shins full with abundant flesh; not having calf muscles bound on one side, but endowed with well-rounded shins enveloped on all sides by evenly formed flesh, resembling the core of paddy grains or barley grains, is the meaning.
Eṇijaṅgho (bắp chân như nai Eṇi) có nghĩa là bắp chân đầy đặn với nhiều thịt, không phải là bắp chân có khối thịt chỉ ở một bên, mà là bắp chân được bao quanh bởi thịt phân bố đều khắp, tròn trịa đẹp đẽ, giống như lõi lúa hoặc lõi lúa mạch.
139
Anonamantoti anamanto, etenassa akhujjaavāmanabhāvo dīpito.
Anonamanto means not bending. By this, his non-hunchbacked and non-dwarfish nature is indicated.
Anonamanto (không cúi xuống) có nghĩa là không cong người, điều này cho thấy vị ấy không bị gù lưng hay thấp bé.
Avasesajanā hi khujjā vā honti vāmanā vā.
Other people are either hunchbacked or dwarfish.
Những người còn lại thì hoặc gù lưng hoặc thấp bé.
Khujjānaṃ uparimakāyo aparipuṇṇo hoti, vāmanānaṃ heṭṭhimakāyo.
For hunchbacked people, the upper body is incomplete; for dwarfish people, the lower body is incomplete.
Những người gù lưng có phần thân trên không đầy đủ, những người thấp bé có phần thân dưới không đầy đủ.
Te aparipuṇṇakāyattā na sakkonti anonamantā jaṇṇukāni parimajjituṃ.
Because their bodies are incomplete, they cannot touch their knees without bending.
Do thân thể không đầy đủ, họ không thể xoa đầu gối mà không cúi xuống.
Mahāpuriso pana paripuṇṇaubhayakāyattā sakkoti.
But the Great Man can, because both parts of his body are complete.
Nhưng vị Đại nhân thì có thể, vì thân thể cả hai phần đều đầy đủ.
140
Kosohitavatthaguyhoti usabhavāraṇādīnaṃ viya suvaṇṇapadumakaṇṇikasadisehi kosehi ohitaṃ paṭicchannaṃ vatthaguyhaṃ assāti kosohitavatthaguyho.
Kosohitavatthaguyho means he has his private parts enclosed and hidden by sheaths like those of a bull or a great elephant, resembling the pericarp of a golden lotus.
Kosohitavatthaguyho (bộ phận kín được che giấu trong vỏ bọc) có nghĩa là bộ phận kín của vị ấy được che giấu trong vỏ bọc, giống như của những con bò đực, voi chúa, v.v., và giống như nhụy hoa sen vàng.
Vatthaguyhanti vatthena guhitabbaṃ aṅgajātaṃ vuccati.
Vatthaguyha is said to be the organ that should be concealed by clothing.
Vatthaguyha có nghĩa là bộ phận sinh dục cần được che giấu bằng y phục.
141
Suvaṇṇavaṇṇoti jātihiṅgulakena majjitvā dīpidāṭhāya ghaṃsitvā gerukaparikammaṃ katvā ṭhapitaghanasuvaṇṇarūpasadisoti attho.
Suvaṇṇavaṇṇo means having a body like a solid golden image, polished with natural vermillion, rubbed with the tusk of a tiger, and finished with red ochre.
Suvaṇṇavaṇṇo (màu da vàng óng) có nghĩa là vị ấy có màu da giống như một bức tượng vàng khối đã được tô son bằng chu sa tự nhiên, đánh bóng bằng ngà voi và hoàn thiện bằng đất son.
Etenassa ghanasiniddhasaṇhasarīrataṃ dassetvā chavivaṇṇadassanatthaṃ kañcanasannibhattacoti vuttaṃ.
Having shown his body's solidity, smoothness, and fineness with this, kañcanasannibhattaco (having skin like gold) was stated to show the complexion of his skin.
Điều này cho thấy thân thể của vị ấy dày đặc, mịn màng và thanh thoát, và để chỉ rõ sắc da, câu kañcanasannibhattaco (da như vàng ròng) đã được nói đến.
Purimassa vā vevacanametaṃ.
Or, this is a synonym for the former (suvaṇṇavaṇṇo).
Hoặc đây là một từ đồng nghĩa với từ trước.
142
Rajojallanti rajo vā malaṃ vā.
Rajojallaṃ means dust or grime.
Rajojallaṃ (bụi bẩn) là bụi hoặc cặn bẩn.
Na upalimpatīti na laggati padumapalāsato udakabindu viya vivaṭṭati.
Na upalimpati means it does not cling, but rolls off like a drop of water from a lotus leaf.
Na upalimpati (không dính bám) có nghĩa là không dính vào, mà lăn đi như giọt nước trên lá sen.
Hatthadhovanādīni pana utuggahaṇatthāya ceva dāyakānaṃ puññaphalatthāya ca buddhā karonti, vattasīsenāpi ca karontiyeva.
However, the Buddhas perform hand-washing and similar acts for the sake of taking the warmth and for the merit of the donors, and they also perform them as a matter of duty.
Tuy nhiên, chư Phật thực hiện việc rửa tay và các việc tương tự để thích nghi với thời tiết và để các thí chủ được phước báu, và cũng thực hiện theo quy tắc giới luật.
Senāsanaṃ pavisantena hi bhikkhunā pāde dhovitvā pavisitabbanti vuttametaṃ.
For it is stated that a bhikkhu entering a dwelling should wash his feet and enter.
Thật vậy, đã có lời dạy rằng một tỳ khưu khi vào tịnh xá phải rửa chân rồi mới vào.
143
Uddhaggalomoti āvaṭṭapariyosāne uddhaggāni hutvā mukhasobhaṃ ullokayamānāni viya ṭhitāni lomāni assāti uddhaggalomo.
Having hair standing on end (Uddhaggalomo) means that his hairs, having become upright at the end of the whirls, stand as if gazing at the beauty of his face, thus he is called uddhaggalomo.
Uddhaggalomo (lông mọc ngược) nghĩa là, lông tóc của vị ấy mọc ngược lên ở cuối mỗi vòng xoáy, như thể đang chiêm ngưỡng vẻ đẹp của khuôn mặt, nên gọi là uddhaggalomo.
144
Brahmujugattoti brahmā viya ujugatto, ujumeva uggatadīghasarīro bhavissati.
Straight-bodied like Brahmā (Brahmujugatto) means that his body is upright like Brahmā; his tall body will be upright and erect.
Brahmujugatto (thân thẳng như Phạm thiên) nghĩa là, thân của vị ấy thẳng như Phạm thiên, sẽ có thân hình cao lớn, thẳng tắp vươn lên.
Yebhuyyena hi sattā khandhe kaṭiyaṃ jāṇūsūti tīsu ṭhānesu namanti, te kaṭiyaṃ namantā pacchato namanti, itaresu dvīsu ṭhānesu purato.
For indeed, most beings bend at three places: the shoulders, the waist, and the knees. Bending at the waist, they bend backward; at the other two places, they bend forward.
Hầu hết chúng sinh đều cong ở ba chỗ: vai, eo và đầu gối; khi cong ở eo thì cong ra sau, còn ở hai chỗ kia thì cong ra trước.
Dīghasarīrā pana eke passavaṅkā honti, eke mukhaṃ unnametvā nakkhattāni gaṇayantā viya caranti, eke appamaṃsalohitā sūlasadisā honti, eke purato pabbhārā honti, pavedhamānā gacchanti.
But among those with tall bodies, some have crooked sides, some walk with faces uplifted as if counting the stars, some have little flesh and blood and are like stakes, and some are bent forward, walking with a tremor.
Một số người có thân hình cao lớn thì bị cong vẹo ở hông, một số khác thì ngẩng mặt lên như thể đang đếm các vì sao, một số khác thì ít thịt ít máu, gầy gò như cây giáo, một số khác thì cúi gập về phía trước, đi lại run rẩy.
Ayaṃ pana ujumeva uggantvā dīghappamāṇo devanagare ussitasuvaṇṇatoraṇaṃ viya bhavissatīti dīpenti.
This one, however, having risen straight up, will be of tall stature, like a golden arch erected in a divine city—thus they explain.
Nhưng vị này, họ chỉ ra rằng, sẽ có thân hình cao lớn, thẳng tắp vươn lên như một cổng chào vàng được dựng lên trong thành phố chư thiên.
Yathā cetaṃ, evaṃ yaṃ yaṃ jātamattassa sabbaso aparipuṇṇaṃ mahāpurisalakkhaṇaṃ hoti, taṃ taṃ āyatiṃ tathābhāvitaṃ sandhāya vuttanti veditabbaṃ.
It should be understood that, just as this is so, whatever great-man mark is not fully perfected in one who has just been born, that is stated with reference to its becoming so in the future.
Tương tự như vậy, cần phải hiểu rằng bất kỳ đại nhân tướng nào chưa hoàn chỉnh khi vị ấy vừa mới sinh ra, đều được nói đến với ý nghĩa rằng chúng sẽ trở nên hoàn chỉnh trong tương lai.
145
Sattussadoti dve hatthapiṭṭhiyo dve pādapiṭṭhiyo dve aṃsakūṭāni khandhoti imesu sattasu ṭhānesu paripuṇṇo maṃsussado assāti sattussado.
Having seven convexities (Sattussado) means that he has a full, prominent mass of flesh at these seven places: the two backs of the hands, the two backs of the feet, the two shoulder-blades, and the neck; thus he is sattussado.
Sattussado (bảy chỗ đầy đặn) nghĩa là, vị ấy có thịt đầy đặn ở bảy chỗ này: hai mu bàn tay, hai mu bàn chân, hai đỉnh vai và cổ, nên gọi là sattussado.
Aññesaṃ pana hatthapādapiṭṭhādīsu sirājālaṃ paññāyati, aṃsakūṭakkhandhesu aṭṭhikoṭiyo.
In others, however, a network of veins is visible on the backs of the hands and feet, etc., and bone-tips on the shoulder-blades and neck.
Đối với những người khác, mạng lưới gân nổi rõ trên mu bàn tay, mu bàn chân, v.v., và xương nhô ra ở đỉnh vai và cổ.
Te manussā petā viya khāyanti, na tathā mahāpuriso, mahāpuriso pana sattasu ṭhānesu paripuṇṇamaṃsussadattā nigūḷhasirājālehi hatthapiṭṭhādīhi vaṭṭetvā suṭṭhapitasuvaṇṇāḷiṅgasadisena khandhena silārūpakaṃ viya khāyati, cittakammarūpakaṃ viya ca khāyati.
These people appear like hungry ghosts, but not so the Great Man. The Great Man, on the other hand, due to having a full, prominent mass of flesh in seven places, appears like a stone sculpture or a painted image, with backs of hands etc. where veins are concealed, and a neck like a beautifully fashioned golden pillar.
Những người đó trông như ngạ quỷ, không như đại nhân; đại nhân thì do có thịt đầy đặn ở bảy chỗ, nên mu bàn tay, v.v. có mạng lưới gân ẩn kín, và cổ của vị ấy như một cây cột vàng được đặt vững chắc, trông như một bức tượng đá, và cũng trông như một bức tượng vẽ.
146
Sīhassa pubbaddhaṃ viya kāyo assāti sīhapubbaddhakāyo. Sīhassa hi puratthimakāyova paripuṇṇo hoti, pacchimakāyo aparipuṇṇo.
Lion-torso-bodied (Sīhapubbaddhakāyo) means that his body is like the forepart of a lion. For indeed, only the front part of a lion's body is fully developed, not the hind part.
Thân của vị ấy như nửa thân trước của sư tử, nên gọi là sīhapubbaddhakāyo (thân như nửa thân trước của sư tử). Nửa thân trước của sư tử thì đầy đặn, còn nửa thân sau thì không đầy đặn.
Mahāpurisassa pana sīhassa pubbaddhakāyo viya sabbo kāyo paripuṇṇo.
But the Great Man's entire body is fully developed, like the forepart of a lion.
Nhưng đối với đại nhân, toàn bộ thân thể đều đầy đặn như nửa thân trước của sư tử.
Sopi sīhasseva tattha tattha vinatunnatādivasena dussaṇṭhitavisaṇṭhito na hoti, dīghayuttaṭṭhāne pana dīgho, rassathūlakisaputhulaanuvaṭṭitayuttaṭṭhānesu tathāvidhova hoti.
And his body is not disfigured or ill-formed with bends and rises here and there, like a lion's; rather, it is long where it should be long, and similarly short, thick, thin, broad, and uniformly rounded where it should be so.
Thân của vị ấy cũng không bị cong vẹo hay biến dạng ở chỗ này chỗ kia như thân sư tử, mà ở chỗ cần dài thì dài, ở chỗ cần ngắn, mập, gầy, rộng, tròn thì đúng như vậy.
Vuttañhetaṃ bhagavatā –
For it was said by the Blessed One:
Điều này đã được Thế Tôn nói đến:
147
‘‘Manāpiyeva kho, bhikkhave, kammavipāke paccupaṭṭhite yehi aṅgehi dīghehi sobhati, tāni aṅgāni dīghāni saṇṭhanti.
“When the result of wholesome kamma appears, bhikkhus, those limbs by which one appears graceful when they are long, those limbs become long.
“Này các Tỳ-kheo, khi quả dị thục của nghiệp vừa ý hiện hữu, những chi phần nào mà nhờ dài mà đẹp, những chi phần ấy sẽ trở nên dài.
Yehi aṅgehi rassehi sobhati, tāni aṅgāni rassāni saṇṭhanti.
Those limbs by which one appears graceful when they are short, those limbs become short.
Những chi phần nào mà nhờ ngắn mà đẹp, những chi phần ấy sẽ trở nên ngắn.
Yehi aṅgehi thūlehi sobhati, tāni aṅgāni thūlāni saṇṭhanti.
Those limbs by which one appears graceful when they are thick, those limbs become thick.
Những chi phần nào mà nhờ mập mà đẹp, những chi phần ấy sẽ trở nên mập.
Yehi aṅgehi kisehi sobhati, tāni aṅgāni kisāni saṇṭhanti.
Those limbs by which one appears graceful when they are thin, those limbs become thin.
Những chi phần nào mà nhờ gầy mà đẹp, những chi phần ấy sẽ trở nên gầy.
Yehi aṅgehi puthulehi sobhati, tāni aṅgāni puthulāni saṇṭhanti.
Those limbs by which one appears graceful when they are broad, those limbs become broad.
Những chi phần nào mà nhờ rộng mà đẹp, những chi phần ấy sẽ trở nên rộng.
Yehi aṅgehi vaṭṭehi sobhati, tāni aṅgāni vaṭṭāni saṇṭhantī’’ti.
Those limbs by which one appears graceful when they are rounded, those limbs become rounded.”
Những chi phần nào mà nhờ tròn mà đẹp, những chi phần ấy sẽ trở nên tròn.”
148
Iti nānācittena puññacittena cittito dasahi pāramīhi sajjito mahāpurisassa attabhāvo, loke sabbasippino vā sabbaiddhimanto vā patirūpakampi kātuṃ na sakkonti.
Thus, the Great Man's body, adorned by meritorious thoughts and perfected through the ten pāramīs, is such that no artists or mighty ones in the world can create even a likeness of it.
Như vậy, thân thể của đại nhân, được tạo tác bởi tâm thiện đa dạng và được trang hoàng bởi mười ba-la-mật, thì không ai trên thế gian, dù là tất cả các nghệ nhân hay tất cả các bậc có thần thông, có thể tạo ra một hình ảnh tương tự.
149
Citantaraṃsoti antaraṃsaṃ vuccati dvinnaṃ koṭṭānaṃ antaraṃ, taṃ citaṃ paripuṇṇaṃ antaraṃsaṃ assāti citantaraṃso.
Having a well-filled space between the shoulders (Citantaraṃso) means that the space between the two shoulder-blades is called antaraṃsa, and that space is well-filled and complete for him, thus he is citantaraṃso.
Citantaraṃso (vai đầy đặn) nghĩa là, khoảng giữa hai bả vai được gọi là antaraṃsa, khoảng giữa hai bả vai của vị ấy đầy đặn như được xếp đặt, nên gọi là citantaraṃso.
Aññesañhi taṃ ṭhānaṃ ninnaṃ hoti, dve piṭṭhikoṭṭā pāṭiyekkā paññāyanti.
In others, indeed, that place is sunken, and the two shoulder-blades appear distinct.
Đối với những người khác, chỗ đó lõm xuống, hai xương bả vai nhô ra riêng biệt.
Mahāpurisassa pana kaṭito paṭṭhāya maṃsapaṭalaṃ yāva khandhā uggamma samussitasuvaṇṇaphalakaṃ viya piṭṭhiṃ chādetvā patiṭṭhitaṃ.
But for the Great Man, a layer of flesh rises from the waist up to the shoulders, covering the back and resting there like an upright golden plank.
Nhưng đối với đại nhân, một lớp thịt từ eo vươn lên đến vai, che kín lưng như một tấm ván vàng được dựng lên vững chắc.
150
Nigrodhaparimaṇḍaloti nigrodho viya parimaṇḍalo.
Nigrodha-tree-like in symmetry (Nigrodhaparimaṇḍalo) means that he is perfectly proportioned like a banyan tree.
Nigrodhaparimaṇḍalo (thân tròn như cây Nigrodha) nghĩa là, thân tròn như cây Nigrodha.
Yathā paññāsahatthatāya vā satahatthatāya vā samakkhandhasākho nigrodho dīghatopi vitthāratopi ekappamāṇova hoti, evaṃ kāyatopi byāmatopi ekappamāṇo.
Just as a banyan tree with an even trunk and branches, whether fifty or a hundred cubits tall, is of the same measure in both height and breadth, so too is his body of the same measure in height and arm-span.
Như cây Nigrodha có cành và thân cân đối, dù dài năm mươi hay một trăm cubit, thì chiều dài và chiều rộng đều có cùng kích thước, thì thân của vị ấy cũng có cùng kích thước về chiều cao và sải tay.
Yathā aññesaṃ kāyo dīgho vā hoti byāmo vā, na evaṃ visamappamāṇoti attho.
The meaning is that his body is not disproportionate, with height or arm-span differing, as is the case with others.
Điều đó có nghĩa là, không như những người khác, thân của họ có thể dài hơn sải tay hoặc ngược lại, không có kích thước không cân đối như vậy.
Teneva yāvatakvassa kāyotiādi vuttaṃ.
Therefore, it is said: “ Whatever be his body's extent (yāvatakvassa kāyo)”, and so on.
Chính vì thế mà có câu: yāvatakvassa kāyo (thân của vị ấy dài bao nhiêu) v.v.
Tattha yāvatako assāti yāvatakvassa.
Here, yāvatako assa becomes yāvatakvassa.
Ở đây, yāvatako assa (dài bao nhiêu) là yāvatakvassa.
151
Samavaṭṭakkhandhoti samavaṭṭitakkhandho.
Having a uniformly rounded neck (Samavaṭṭakkhandho) means having a uniformly rounded neck.
Samavaṭṭakkhandho (cổ tròn đều) nghĩa là, cổ của vị ấy tròn đều.
Yathā eke koñcā viya ca bakā viya ca varāhā viya ca dīghagalā vaṅkagalā puthulagalā ca honti, kathanakāle sirājālaṃ paññāyati, mando saro nikkhamati, na evaṃ mahāpurisassa.
Just as some people have long necks like cranes, crooked necks like herons, or broad necks like boars, and a network of veins is visible when they speak, and a faint sound emerges, it is not so with the Great Man.
Như một số người có cổ dài như chim sếu, cong như chim cò, hay rộng như lợn rừng, khi nói chuyện thì mạng lưới gân nổi rõ, giọng nói nhỏ nhẹ, đại nhân thì không như vậy.
Mahāpurisassa pana suvaṭṭitasuvaṇṇāḷiṅgasadiso khandho hoti, kathanakāle sirājālaṃ na paññāyati, meghassa viya gajjito saro mahā hoti.
But the Great Man has a neck like a beautifully rounded golden pillar; when he speaks, a network of veins is not visible, and his voice is loud like the roar of a cloud.
Nhưng đại nhân có cổ như một cây cột vàng được tiện tròn đẹp đẽ, khi nói chuyện thì mạng lưới gân không nổi rõ, giọng nói của vị ấy lớn như tiếng sấm của mây.
152
Rasaggasaggīti ettha rasaṃ gasanti harantīti rasaggasā.
Having excellent taste-canals (Rasaggasaggī): Here, rasaggasā refers to those that consume or convey taste. This is a designation for the taste-conveying channels, and these channels are excellent for him, thus he is rasaggasaggī.
Rasaggasaggī (có các mạch vị giác tối thượng). Ở đây, những gì hấp thụ hoặc mang hương vị được gọi là rasaggasā.
Rasaharaṇīnametaṃ adhivacanaṃ, tā aggā assāti rasaggasaggī.
This is a designation for the taste-conveying channels, and these channels are excellent for him, thus he is rasaggasaggī.
Đây là tên gọi của các mạch vị giác, chúng là tối thượng, nên gọi là rasaggasaggī.
Mahāpurisassa kira sattarasaharaṇīsahassāni uddhaggāni hutvā gīvāyameva paṭimukkāni.
It is said that the Great Man had seven thousand taste-conveying channels, all reaching upwards and connected to his neck.
Người ta nói rằng, bảy ngàn mạch vị giác của đại nhân đều hướng lên và được gắn vào cổ.
Tilaphalamattopi āhāro jivhagge ṭhapito sabbakāyaṃ anupharati.
Even a morsel of food the size of a sesame seed, placed on the tip of his tongue, would pervade his entire body.
Dù chỉ một lượng thức ăn nhỏ bằng hạt mè được đặt trên đầu lưỡi cũng có thể lan tỏa khắp toàn thân.
Teneva mahāpadhānaṃ padahantassa ekataṇḍulādīhipi kaḷāyayūsapasatamattenāpi kāyassa yāpanaṃ ahosi.
That is why, when he was undertaking the Great Struggle, even a single grain of rice or a handful of pea soup was sufficient for the sustenance of his body.
Chính vì vậy, khi thực hành đại khổ hạnh, vị ấy có thể duy trì thân thể bằng một hạt gạo hay một nắm nước súp đậu lăng.
Aññesaṃ pana tathā abhāvā na sakalaṃ kāyaṃ ojā pharati.
In others, however, because it is not so, the nutritive essence does not pervade the entire body.
Đối với những người khác, do không có đặc điểm đó, tinh chất không thể lan tỏa khắp toàn thân.
Tena te bahvābādhā honti.
Due to this, they suffer from many ailments.
Do đó, họ mắc nhiều bệnh tật.
153
Sīhasseva hanu assāti sīhahanu. Tattha sīhassa heṭṭhimahanumeva paripuṇṇaṃ hoti, na uparimaṃ.
Lion-jawed (Sīhahanu) means his jaw is like a lion's. In a lion, only the lower jaw is fully developed, not the upper.
Hàm của vị ấy như hàm sư tử, nên gọi là sīhahanu (hàm sư tử). Hàm dưới của sư tử đầy đặn, nhưng hàm trên thì không.
Mahāpurisassa pana sīhassa heṭṭhimaṃ viya dvepi paripuṇṇāni dvādasiyā pakkhassa candasadisāni honti.
But for the Great Man, both jaws are fully developed like a lion's lower jaw, resembling the moon on the twelfth day of the waxing fortnight.
Nhưng đối với đại nhân, cả hai hàm đều đầy đặn như hàm dưới của sư tử, và chúng giống như mặt trăng của nửa tháng thứ mười hai.
Atha nemittakā hanukapariyantaṃ olokentāva imesu hanukesu heṭṭhime vīsati uparime vīsatīti cattālīsadantā samā aviraḷā patiṭṭhahissantīti sallakkhetvā ayañhi deva, kumāro cattālīsadanto hotītiādimāhaṃsu.
Then, the soothsayers, observing the extent of his jaws, discerned that "in these jaws, twenty teeth will be evenly and closely set in the lower jaw, and twenty in the upper jaw, making forty teeth in total," and thus they said, "This prince, indeed, has forty teeth," and so forth.
Khi đó, các nhà tướng số, khi nhìn vào phần cuối của hàm, đã nhận định rằng: “Trong hai hàm này, hai mươi răng ở hàm dưới và hai mươi răng ở hàm trên, tổng cộng là bốn mươi răng, sẽ mọc đều và khít nhau,” và đã nói: “Này thiên tử, vị hoàng tử này có bốn mươi răng,” v.v.
Tatrāyamattho, aññesañhi paripuṇṇadantānampi dvattiṃsa dantā honti.
The meaning here is that for others, even with a full set of teeth, there are thirty-two teeth.
Ý nghĩa ở đây là, ngay cả những người khác có răng đầy đủ cũng chỉ có ba mươi hai răng.
Imassa pana cattālīsaṃ bhavissanti.
But for him, there will be forty.
Nhưng vị này sẽ có bốn mươi răng.
Aññesañca keci dantā uccā, keci nīcāti visamā honti, imassa pana ayapaṭṭakena chinnasaṅkhapaṭalaṃ viya samā bhavissanti.
Also, some people's teeth are uneven, some high and some low, but his will be even, like a conch shell section cut with an iron plate.
Và răng của những người khác có cái cao, cái thấp, không đều; nhưng răng của vị này sẽ đều như một tấm vỏ ốc được cắt bằng một tấm sắt.
Aññesaṃ kumbhilānaṃ viya dantā viraḷā honti, macchamaṃsāni khādantānaṃ dantantaraṃ pūrenti.
And some people's teeth are widely spaced, like a crocodile's; they fill the gaps between their teeth when eating fish and meat.
Răng của những người khác thưa như răng cá sấu, khi ăn cá thịt thì thức ăn lấp đầy kẽ răng.
Imassa pana kanakaphalakāyaṃ samussitavajirapanti viya aviraḷā tūlikāya dassitaparicchedā viya dantā bhavissanti.
But his teeth will be closely set, like a row of diamonds embedded in a golden slab, and distinct like divisions marked with a brush.
Nhưng răng của vị này sẽ khít nhau như một hàng kim cương được đính trên tấm vàng, và có ranh giới rõ ràng như được vẽ bằng bút lông.
Aññesañca pūtidantā uṭṭhahanti.
Also, in others, decayed teeth erupt.
Và răng của những người khác thì bị sâu.
Tena kāci dāṭhā kāḷāpi vivaṇṇāpi honti.
Hence, some tusks are black or discolored.
Do đó, một số răng nanh có thể bị đen hoặc đổi màu.
Ayaṃ pana suṭṭhu sukkadāṭho osadhitārakampi atikkamma virocamānāya pabhāya samannāgatadāṭho bhavissati.
But this one will have extremely white tusks, endowed with a radiance that surpasses even the morning star.
Nhưng vị này sẽ có răng nanh trắng tinh, vượt qua cả sao Thốc Tú (sao Kim), với ánh sáng rực rỡ.
154
Pahūtajivhoti puthulajivho.
Having an abundant tongue (Pahūtajivho) means having a broad tongue.
Pahūtajivho (lưỡi rộng) nghĩa là, lưỡi của vị ấy rộng.
Aññesaṃ jivhā thūlāpi honti kisāpi rassāpi thaddhāpi visamāpi, mahāpurisassa pana jivhā mudu dīghā puthulā vaṇṇasampannā hoti.
In others, tongues can be thick, thin, short, stiff, or uneven, but the Great Man's tongue is soft, long, broad, and beautiful in color.
Lưỡi của những người khác có thể dày, mỏng, ngắn, cứng hoặc không đều; nhưng lưỡi của đại nhân thì mềm mại, dài, rộng và có màu sắc tuyệt đẹp.
So hi etaṃ lakkhaṇaṃ pariyesituṃ āgatānaṃ kaṅkhāvinodanatthaṃ mudukattā taṃ jivhaṃ kathinasūciṃ viya vaṭṭetvā ubho nāsikasotāni parāmasati, dīghattā ubho kaṇṇasotāni parāmasati, puthulattā kesantapariyosānaṃ kevalampi nalāṭaṃ paṭicchādeti.
Indeed, to dispel the doubt of the brahmins who had come to seek this mark, because of its softness, he rolls that tongue like a hard needle and touches both nostrils; because of its length, he touches both ear canals; and because of its breadth, he covers even the entire forehead up to the hairline.
Thật vậy, để xua tan nghi ngờ của những người đến tìm kiếm tướng ấy, vì mềm mại, Ngài cuộn lưỡi ấy như một cây kim cứng, chạm vào hai lỗ mũi; vì dài, Ngài chạm vào hai lỗ tai; vì rộng, Ngài che phủ toàn bộ vầng trán cho đến chân tóc.
Evamassa mududīghaputhulabhāvaṃ pakāsento tesaṃ kaṅkhaṃ vinodeti.
Thus, making clear the softness, length, and breadth of that tongue, he dispels their doubt.
Như vậy, Ngài xua tan nghi ngờ của họ bằng cách biểu lộ đặc tính mềm mại, dài và rộng của lưỡi mình.
Evaṃ tilakkhaṇasampannaṃ jivhaṃ sandhāya ‘‘pahūtajivho’’ti vuttaṃ.
It is with reference to such a tongue, endowed with these three characteristics, that it is said, "He has a great tongue (pahūtajivho)."
Chính vì cái lưỡi đầy đủ ba tướng (mềm mại, dài, rộng) như vậy mà được gọi là “pahūtajivho” (lưỡi rộng dài).
155
Brahmassaroti aññe chinnassarāpi bhinnassarāpi kākassarāpi honti, ayaṃ pana mahābrahmuno sarasadisena sarena samannāgato bhavissati, mahābrahmuno hi pittasemhehi apalibuddhattā saro visado hoti.
Brahmassaro means that while others have broken, distorted, or crow-like voices, he will be endowed with a voice similar to that of a Mahābrahmā. The voice of a Mahābrahmā is clear because it is not obstructed by phlegm and bile.
Brahmassaro (tiếng Phạm âm) nghĩa là: những người khác thì có tiếng nói đứt quãng, tiếng nói vỡ, tiếng nói như quạ, nhưng vị Đại nhân này sẽ có tiếng nói giống như tiếng của Đại Phạm thiên. Tiếng của Đại Phạm thiên trong trẻo vì không bị vướng mắc bởi mật và đờm.
Mahāpurisenāpi katakammaṃ tassa vatthuṃ sodheti.
The good deeds done by the Mahāpurisa purify the physical basis of that voice.
Và những nghiệp đã làm của vị Đại nhân cũng thanh lọc cơ sở phát ra tiếng nói ấy.
Vatthuno suddhattā nābhito paṭṭhāya samuṭṭhahanto saro visado aṭṭhaṅgasamannāgatova samuṭṭhāti.
Due to the purity of its basis, the voice arising from the navel is clear and endowed with eight qualities.
Vì cơ sở phát ra tiếng nói thanh tịnh, nên tiếng nói phát ra từ rốn trong trẻo và đầy đủ tám chi phần.
Karavīko viya bhaṇatīti karavīkabhāṇī, mattakaravīkarutamañjughosoti attho.
He speaks like a karavīka bird, hence karavīkabhāṇī, meaning his voice is as sweet as the song of an intoxicated karavīka bird.
Vì nói như chim karavīka, nên gọi là karavīkabhāṇī (nói như chim karavīka), nghĩa là có tiếng nói ngọt ngào như tiếng hót say mê của chim karavīka.
156
Abhinīlanettoti na sakalanīlanetto, nīlayuttaṭṭhāne panassa umāpupphasadisena ativisuddhena nīlavaṇṇena samannāgatāni nettāni honti, pītayuttaṭṭhāne kaṇikārapupphasadisena pītavaṇṇena, lohitayuttaṭṭhāne bandhujīvakapupphasadisena lohitavaṇṇena, setayuttaṭṭhāne osadhitārakasadisena setavaṇṇena, kāḷayuttaṭṭhāne addāriṭṭhakasadisena kāḷavaṇṇena samannāgatāni.
Abhinīlanetto does not mean that his entire eyes are blue. Instead, where blue is appropriate, his eyes are endowed with an exceedingly pure blue color like an umā flower; where yellow is appropriate, with a yellow color like a kaṇikāra flower; where red is appropriate, with a red color like a bandhujīvaka flower; where white is appropriate, with a white color like the morning star; and where black is appropriate, with a black color like a black bead.
Abhinīlanetto (mắt xanh thẫm) nghĩa là không phải toàn bộ mắt đều xanh, mà ở những chỗ mắt nên có màu xanh thì có màu xanh rất trong trẻo như hoa vừng; ở chỗ nên có màu vàng thì có màu vàng như hoa kaṇikāra; ở chỗ nên có màu đỏ thì có màu đỏ như hoa bandhujīvaka; ở chỗ nên có màu trắng thì có màu trắng như sao osadhī; ở chỗ nên có màu đen thì có màu đen như hạt arittha đen.
Suvaṇṇavimāne ugghāṭitamaṇisīhapañjarasadisāni khāyanti.
They appear like a lion-cage made of jewels, opened in a golden palace.
Chúng trông như những ô cửa sổ sư tử gắn ngọc được mở ra trong cung điện vàng.
157
Gopakhumoti ettha pakhumanti sakalacakkhubhaṇḍaṃ adhippetaṃ, taṃ kāḷavacchakassa bahaladhātukaṃ hoti, rattavacchakassa vippasannaṃ, taṃmuhuttajātataruṇarattavacchakasadisacakkhubhaṇḍoti attho.
Gopakhumo: Here, pakhuma refers to the entire eyeball. The eyeball of a black calf is dense, and that of a red calf is exceedingly clear. This means he has eyes like those of a tender, red calf born just a moment ago.
Gopakhumo (lông mi như bò) ở đây, “lông mi” (pakhuma) được hiểu là toàn bộ nhãn cầu. Nhãn cầu của bê đen thì đặc, của bê đỏ thì rất trong. Nghĩa là có nhãn cầu giống như nhãn cầu non của một chú bê đỏ vừa mới sinh ra.
Aññesañhi cakkhubhaṇḍā aparipuṇṇā honti, hatthimūsikādīnaṃ akkhisadisehi viniggatehipi gambhīrehipi akkhīhi samannāgatā honti.
The eyeballs of others are incomplete; some are endowed with prominent or deep-set eyes similar to those of elephants, mice, and so forth.
Thật vậy, nhãn cầu của những người khác thì không đầy đặn, một số có mắt lồi như voi, chuột, hoặc mắt sâu.
Mahāpurisassa pana dhovitvā majjitvā ṭhapitamaṇiguḷikā viya mudusiniddhanīlasukhumapakhumācitāni akkhīni.
But the Mahāpurisa's eyes are adorned with soft, smooth, dark, and fine eyelashes, like a polished jewel sphere that has been cleaned and set down.
Nhưng mắt của vị Đại nhân thì như viên ngọc đã được rửa sạch và đánh bóng, được trang điểm bằng những sợi lông mi mềm mại, mịn màng, đen và tinh tế.
158
Uṇṇāti uṇṇalomaṃ.
Uṇṇā refers to the uṇṇā hair-tuft.
Uṇṇā là sợi lông uṇṇā.
Bhamukantareti dvinnaṃ bhamukānaṃ vemajjhe nāsikamatthakeyeva jātā, uggantvā pana nalāṭavemajjhe jātā.
Bhamukantare: It grows between the two eyebrows, right above the nose; having grown, it then appears in the middle of the forehead.
Bhamukantare (giữa hai chân mày) nghĩa là mọc ngay trên đỉnh mũi, giữa hai chân mày, nhưng lại mọc vươn lên giữa vầng trán.
Odātāti parisuddhā, osadhitārakasamānavaṇṇā.
Odātā means pure, having a color like the morning star.
Odātā (trắng tinh) nghĩa là trong sạch, có màu giống như sao osadhī.
Mudūti sappimaṇḍe osāretvā ṭhapitasatavāravihatakappāsapaṭalasadisā.
Mudū means soft, like a layer of cotton beaten a hundred times, steeped in ghee.
Mudū (mềm mại) nghĩa là giống như một lớp bông gòn đã được nhúng vào bơ sữa và đánh tơi hàng trăm lần.
Tūlasannibhāti simbalitūlalatātūlasamānā, ayamassa odātatāya upamā.
Tūlasannibhā means similar to kapok or creepers' cotton. This is a simile for its purity.
Tūlasannibhā (như bông gòn) nghĩa là giống như bông gòn cây simbali hoặc bông gòn dây leo. Đây là ví dụ cho sự trắng tinh của nó.
Sā panesā koṭiyaṃ gahetvā ākaḍḍhiyamānā upaḍḍhabāhuppamāṇā hoti, vissaṭṭhā dakkhiṇāvaṭṭavasena āvaṭṭitvā uddhaggā hutvā santiṭṭhati.
When this hair-tuft is held at its tip and pulled, it extends to half the length of an arm; when released, it curls upwards in a clockwise direction and remains in place.
Sợi lông ấy, khi được nắm ở đầu và kéo ra, dài khoảng nửa cánh tay; khi buông ra, nó cuộn lại theo chiều kim đồng hồ và dựng đứng lên.
Suvaṇṇaphalakamajjhe ṭhapitarajatapubbuḷakaṃ viya, suvaṇṇaghaṭato nikkhamamānā khīradhārā viya, aruṇappabhārañjite gaganappadese osadhitārakā viya ca atimanoharāya siriyā virocati.
It shines with an exceedingly captivating splendor, like a silver bubble placed in the middle of a golden plate, like a stream of milk flowing from a golden pot, or like the morning star in a sky tinged with dawn's light.
Nó tỏa sáng với vẻ đẹp vô cùng quyến rũ, như một viên ngọc bạc đặt giữa tấm bảng vàng, như dòng sữa chảy ra từ bình vàng, và như những vì sao osadhī trên bầu trời được nhuộm màu rạng đông.
159
Uṇhīsasīsoti idaṃ paripuṇṇanalāṭatañca paripuṇṇasīsataṃ cāti dve atthavase paṭicca vuttaṃ.
Uṇhīsasīso is said with reference to two meanings: having a full forehead and having a full head.
Uṇhīsasīso (đầu có uṇhīsa) từ này được nói dựa trên hai ý nghĩa: trán đầy đặn và đầu đầy đặn.
Mahāpurisassa hi dakkhiṇakaṇṇacūḷikato paṭṭhāya maṃsapaṭalaṃ uṭṭhahitvā sakalanalāṭaṃ chādayamānaṃ pūrayamānaṃ gantvā vāmakaṇṇacūḷikāyaṃ patiṭṭhitaṃ, taṃ rañño bandhauṇhīsapaṭṭo viya virocati.
Indeed, in the Mahāpurisa, a layer of flesh rises from the tip of the right ear, covers and fills the entire forehead, and rests at the tip of the left ear. This appears like the headband tied by a king.
Thật vậy, ở vị Đại nhân, một lớp thịt nổi lên từ dái tai phải, che phủ và làm đầy toàn bộ vầng trán, rồi cố định ở dái tai trái. Lớp thịt ấy tỏa sáng như dải khăn đội đầu của vua.
Mahāpurisassa kira imaṃ lakkhaṇaṃ disvā rājūnaṃ uṇhīsapaṭṭaṃ akaṃsu.
It is said that kings made headbands after seeing this characteristic of the Mahāpurisa.
Người ta kể rằng, khi thấy tướng này của vị Đại nhân, các vị vua đã làm dải khăn đội đầu cho mình.
Ayaṃ tāva eko attho.
This is one meaning.
Đây là một ý nghĩa.
Aññe pana janā aparipuṇṇasīsā honti, keci kapisīsā, keci phalasīsā, keci aṭṭhisīsā, keci hatthisīsā, keci tumbasīsā, keci pabbhārasīsā.
Other people, however, have incomplete heads; some have ape-like heads, some have fruit-like heads, some have bone-like heads, some have elephant-like heads, some have gourd-like heads, some have cavernous heads.
Còn những người khác thì có đầu không đầy đặn; một số có đầu như khỉ, một số có đầu như quả, một số có đầu như xương, một số có đầu như voi, một số có đầu như bầu, một số có đầu như hang động.
Mahāpurisassa pana āraggena vaṭṭetvā ṭhapitaṃ viya suparipuṇṇaṃ udakapubbuḷasadisaṃ sīsaṃ hoti.
But the Mahāpurisa's head is perfectly round, like a water bubble, as if it were rolled with an auger and placed there.
Nhưng vị Đại nhân lại có cái đầu tròn trịa hoàn hảo như một giọt nước, như thể được cuộn lại và đặt bằng mũi dùi.
Tattha purimanaye uṇhīsaveṭhitasīso viyāti uṇhīsasīso.
In the former sense, it is uṇhīsasīso as if his head were wrapped with a turban.
Trong trường hợp này, theo cách giải thích trước, “uṇhīsasīso” nghĩa là đầu như được quấn khăn đội đầu.
Dutiyanaye uṇhīsaṃ viya sabbattha parimaṇḍalasīsoti uṇhīsasīso.
In the second sense, it is uṇhīsasīso because his head is perfectly round everywhere, like a turban.
Theo cách giải thích thứ hai, “uṇhīsasīso” nghĩa là đầu tròn trịa khắp nơi như khăn đội đầu.
160
Vipassīsamaññāvaṇṇanā
Description of Vipassī's Naming
Giải thích tên Vipassī
161
37. Sabbakāmehīti idaṃ lakkhaṇāni pariggaṇhāpetvā pacchā kataṃ viya vuttaṃ, na panevaṃ daṭṭhabbaṃ.
37. Sabbakāmehī – this is stated as if it were said after the marks had been taken, but it should not be seen in this way.
37. Sabbakāmehī (với mọi dục lạc) lời này được nói như thể được thực hiện sau khi đã xem xét các tướng, nhưng không nên hiểu như vậy.
Paṭhamañhi te nemittake santappetvā pacchā lakkhaṇapariggaṇhanaṃ katanti veditabbaṃ.
It should be understood that first, the prognosticators were satisfied, and only afterwards was the observation of the marks made.
Thật vậy, cần phải hiểu rằng trước tiên họ đã làm hài lòng các nhà chiêm tinh, sau đó mới xem xét các tướng.
Tassa vitthāro gabbhokkantiyaṃ vuttoyeva.
Its detailed account is already given in the section on the descent into the womb.
Sự giải thích chi tiết về điều đó đã được nói trong phần nhập thai.
Pāyentīti thaññaṃ pāyenti.
Pāyentī means they give milk.
Pāyentī (cho bú) nghĩa là cho bú sữa.
Tassa kira niddosena madhurena khīrena samannāgatā saṭṭhi dhātiyo upaṭṭhāpesi, tathā sesāpi tesu tesu kammesu kusalā saṭṭhisaṭṭhiyeva.
Indeed, sixty wet nurses, endowed with pure and sweet milk, were appointed for him. Likewise, for other duties, sixty nurses each, skilled in those respective tasks, were appointed.
Người ta kể rằng, ông đã sắp xếp sáu mươi vú nuôi có sữa tinh khiết và ngọt ngào cho vị hoàng tử ấy; tương tự, những người khác cũng là sáu mươi sáu mươi người thành thạo trong các công việc khác nhau.
Tāsaṃ pesanakārake saṭṭhi purise, tassa tassa katākatabhāvaṃ sallakkhaṇe saṭṭhi amacce upaṭṭhāpesi.
Sixty men were appointed as attendants for these nurses, and sixty ministers were appointed to observe whether each task was performed or not performed.
Ông đã sắp xếp sáu mươi người đàn ông làm người sai vặt cho các vú nuôi ấy, và sáu mươi vị quan để ghi nhận việc đã làm hay chưa làm của từng việc.
Evaṃ cattāri saṭṭhiyo itthīnaṃ, dve saṭṭhiyo purisānanti cha saṭṭhiyo upaṭṭhakānaṃyeva ahesuṃ.
Thus, there were four sixties of women and two sixties of men, making six sixties of attendants in total.
Như vậy, có bốn sáu mươi (240) phụ nữ và hai sáu mươi (120) đàn ông, tổng cộng có sáu sáu mươi (360) người hầu cận.
Setacchattanti dibbasetacchattaṃ.
Setachattaṃ refers to a divine white parasol.
Setacchattaṃ (cây dù trắng) là cây dù trắng thần thánh.
Kuladattiyaṃ pana sirigabbheyeva tiṭṭhati.
The family parasol, however, remains in the royal chamber.
Còn cây dù trắng do dòng tộc ban tặng thì chỉ ở trong phòng quý giá.
Mā naṃ sītaṃ vātiādīsu mā abhibhavīti attho veditabbo.
In phrases such as Mā naṃ sītaṃ vā (Let not cold, etc.,*), the meaning to be understood is "let it not overcome him."
Trong các câu như Mā naṃ sītaṃ vā (chớ để lạnh giá) v.v., ý nghĩa cần hiểu là “chớ để lấn át”.
Svāssudanti so assudaṃ.
Svāssudaṃ means so assudaṃ (that indeed).
Svāssudaṃ là so assudaṃ.
Aṅkeneva aṅkanti aññassa bāhunāva aññassa bāhuṃ.
Aṅkeneva aṅkaṃ means the arm of one person with the arm of another.
Aṅkeneva aṅkaṃ (từ cánh tay này đến cánh tay khác) nghĩa là từ cánh tay của người này đến cánh tay của người khác.
Aññassa ca aṃsakūṭeneva aññassa aṃsakūṭaṃ.
And the shoulder of one person with the shoulder of another.
Và từ vai của người này đến vai của người khác.
Parihariyatīti nīyati, sampāpiyatīti attho.
Parihariyatī means he is carried, meaning he is brought to.
Parihariyatī (được mang đi) nghĩa là được đưa đi, được đưa đến.
162
38. Mañjussaroti akharassaro.
38. Mañjussaro means having a gentle voice.
38. Mañjussaro (tiếng nói êm dịu) nghĩa là tiếng nói không thô ráp.
Vaggussaroti chekanipuṇassaro.
Vaggussaro means having a clear and skillful voice.
Vaggussaro (tiếng nói hòa nhã) nghĩa là tiếng nói khéo léo, tinh tế.
Madhurassaroti sātassaro.
Madhurassaro means having a sweet voice.
Madhurassaro (tiếng nói ngọt ngào) nghĩa là tiếng nói dễ chịu.
Pemaniyassaroti pemajanakassaro.
Pemaniyassaro means having a voice that generates love.
Pemaniyassaro (tiếng nói đáng yêu) nghĩa là tiếng nói tạo ra tình yêu thương.
Tatridaṃ karavīkānaṃ madhurassaratāya – karavīkasakuṇe kira madhurarasaṃ ambapakkaṃ mukhatuṇḍakena paharitvā paggharitarasaṃ pivitvā pakkhena tālaṃ datvā vikūjamāne catuppadā mattā viya laḷituṃ ārabhanti.
Here is a story concerning the sweetness of the karavīka birds' voices: it is said that when karavīka birds peck open a mango ripe with sweet juice, drink the flowing juice, flap their wings, and sing, quadrupeds begin to frolic as if intoxicated.
Ở đây, về sự ngọt ngào của tiếng chim karavīka: Người ta kể rằng, khi chim karavīka dùng mỏ đập vào quả xoài chín có vị ngọt, uống nước chảy ra, rồi vỗ cánh và hót, các loài động vật bốn chân bắt đầu vui đùa như bị say.
Gocarapasutāpi catuppadā mukhagatāni tiṇāni chaḍḍetvā taṃ saddaṃ suṇanti.
Quadrupeds, even those busy grazing, drop the grass from their mouths and listen to that sound.
Các loài động vật bốn chân đang ăn cỏ cũng bỏ cỏ trong miệng và lắng nghe tiếng hót ấy.
Vāḷamigā khuddakamige anubandhamānā ukkhittaṃ pādaṃ anikkhipitvāva tiṭṭhanti.
Predatory animals, pursuing smaller prey, stop with their raised paws still in the air, without setting them down.
Các loài thú dữ đang đuổi theo thú nhỏ cũng dừng lại mà không đặt chân đã nhấc xuống.
Anubaddhamigā ca maraṇabhayaṃ jahitvā tiṭṭhanti.
And the pursued animals abandon their fear of death and stand still.
Và các loài thú bị đuổi cũng bỏ đi nỗi sợ hãi cái chết mà dừng lại.
Ākāse pakkhandā pakkhinopi pakkhe pasāretvā taṃ saddaṃ suṇamānāva tiṭṭhanti.
Birds flying in the sky spread their wings and remain suspended, listening to that sound.
Ngay cả những con chim đang bay trên không trung cũng dang cánh và dừng lại để lắng nghe tiếng hót ấy.
Udake macchāpi kaṇṇapaṭalaṃ papphoṭetvā taṃ saddaṃ suṇamānāva tiṭṭhanti.
Even fish in the water flap their ear-fins and remain still, listening to that sound.
Cá dưới nước cũng vỗ mang và dừng lại để lắng nghe tiếng hót ấy.
Evaṃ madhurassarā karavīkā.
Such are the sweet-voiced karavīka birds.
Chim karavīka ngọt ngào như vậy.
163
Asandhimittāpi dhammāsokassa devī – ‘‘atthi nu kho, bhante, buddhassarena sadiso kassaci saro’’ti saṅghaṃ pucchi.
Asandhimittā, King Dhammāsoka's queen, also asked the Saṅgha, "Venerable sirs, is there anyone whose voice is similar to the Buddha's voice?"
Hoàng hậu Asandhimittā của vua Dhammāsoka cũng hỏi Tăng đoàn: “Bạch chư Tăng, có tiếng nói nào giống tiếng của Đức Phật không?”
Atthi karavīkasakuṇassāti.
"The karavīka bird has such a voice," they replied.
“Có, tiếng của chim karavīka.”
Kuhiṃ, bhante, te sakuṇāti?
"Where, venerable sirs, are these birds?" she asked.
“Bạch chư Tăng, những con chim ấy ở đâu?”
Himavanteti.
"In the Himavanta," they replied.
“Ở dãy Hy Mã Lạp Sơn.”
Sā rājānaṃ āha – ‘‘deva, ahaṃ karavīkasakuṇaṃ passitukāmāmhī’’ti.
She then said to the king, "Your Majesty, I wish to see a karavīka bird."
Hoàng hậu bèn nói với vua: “Tâu Đại vương, thiếp muốn nhìn thấy chim karavīka.”
Rājā – ‘‘imasmiṃ pañjare nisīditvā karavīko āgacchatū’’ti suvaṇṇapañjaraṃ vissajjesi.
The king ordered, "Let a karavīka bird come and sit in this cage," and released a golden cage.
Vua bèn thả một cái lồng vàng ra, nói: “Hãy để chim karavīka đến và đậu trong lồng này!”
Pañjaro gantvā ekassa karavīkassa purato aṭṭhāsi.
The cage went and stopped in front of one karavīka bird.
Cái lồng bay đến và dừng lại trước một con chim karavīka.
So – ‘‘rājāṇāya āgato pañjaro, na sakkā na gantu’’nti tattha nisīdi.
He thought, "The cage has come by the king's command; it is impossible not to go," and he sat in it.
Con chim ấy nghĩ: "Chiếc lồng này đến theo lệnh vua, không thể không đi," rồi nó ngồi vào đó.
Pañjaro āgantvā rañño purato aṭṭhāsi.
The cage returned and stood before the king.
Chiếc lồng trở về và đứng trước mặt vua.
Na karavīkasaddaṃ kārāpetuṃ sakkonti.
They could not make the karavīka bird sing.
Họ không thể làm cho chim karavīka hót.
Atha rājā – ‘‘kathaṃ, bhaṇe, ime saddaṃ na karontī’’ti āha.
Then the king said, “Friends, why do these birds not sing?”
Bấy giờ, vua nói: "Này các ngươi, tại sao những con chim này không hót?"
Ñātake adisvā devāti.
“Your Majesty, because it does not see its relatives.”
"Thưa bệ hạ, vì chúng không thấy bà con của mình."
Atha naṃ rājā ādāsehi parikkhipāpesi.
Then the king had it surrounded with mirrors.
Bấy giờ, vua cho đặt gương bao quanh nó.
So attano chāyaṃ disvā – ‘‘ñātakā me āgatā’’ti maññamāno pakkhena tālaṃ datvā madhurassarena maṇivaṃsaṃ dhamamāno viya viravi.
Seeing its own reflection, it thought, “My relatives have come!” and, flapping its wings, it sang with a sweet voice, as if playing a jeweled flute.
Khi thấy bóng của mình, nó nghĩ: "Bà con của ta đã đến," rồi nó vỗ cánh và hót lên bằng giọng ngọt ngào, như thể đang thổi một cây sáo ngọc.
Sakalanagare manussā mattā viya laḷiṃsu.
The people throughout the city rejoiced as if intoxicated.
Mọi người trong toàn thành phố đều hoan hỷ như say sưa.
Asandhimittā cintesi – ‘‘imassa tāva tiracchānagatassa evaṃ madhuro saddo, kīdiso nu kho sabbaññutaññāṇasiripattassa bhagavato saddo ahosī’’ti pītiṃ uppādetvā taṃ pītiṃ avijahitvā sattahi jaṅghasatehi saddhiṃ sotāpattiphale patiṭṭhāsi.
Asandhimittā reflected: “If the voice of this animal is so sweet, how wonderful must have been the voice of the Bhagavā, who had attained the glory of omniscience?” Generating this rapture and not abandoning it, she, together with seven hundred walking maidens, became established in the fruit of stream-entry (sotāpatti).
Asandhimittā nghĩ: "Giọng của con vật tầm thường này còn ngọt ngào đến thế, thì giọng của Đức Thế Tôn, bậc đã đạt được sự vinh quang của Tuệ Tri Toàn Giác, chắc hẳn phải như thế nào?" Nàng khởi lên niềm hoan hỷ, không từ bỏ niềm hoan hỷ ấy, và cùng với bảy trăm tỳ nữ đã chứng đắc quả Dự Lưu.
Evaṃ madhuro kira karavīkasaddoti.
It is said that the voice of the karavīka bird is indeed so sweet.
Giọng chim karavīka quả thật ngọt ngào như vậy.
Tato pana satabhāgena sahassabhāgena ca madhurataro vipassissa kumārassa saddo ahosīti veditabbo.
It should be understood that the voice of Prince Vipassī was a hundred times, a thousand times sweeter than that.
Và cần phải biết rằng giọng của hoàng tử Vipassī ngọt ngào hơn gấp trăm lần, ngàn lần so với giọng đó.
164
39. Kammavipākajanti na bhāvanāmayaṃ, kammavipākavasena pana devatānaṃ cakkhusadisameva maṃsacakkhu ahosi, yena nimittaṃ katvā tilavāhe pakkhittaṃ ekatilampi ayaṃ soti uddharitvā dātuṃ sakkoti.
39. Kammavipākaja means not born of development (bhāvanā), but it was a physical eye (maṃsacakkhu) like that of deities, due to kamma-result. With this eye, if even one sesame seed is put into a pile of sesame seeds, one can identify which sesame seed it is, take it out, and give it.
39. Kammavipākaja (do nghiệp báo sinh): không phải do tu tập mà là do quả của nghiệp, mắt thịt của chư thiên tương tự như mắt của chúng ta, nhờ đó mà họ có thể đánh dấu một hạt mè trong một đống mè và nhặt đúng hạt đó để đưa cho người khác.
165
40. Vipassīti ettha ayaṃ vacanattho, antarantarā nimīlajanitandhakāravirahena visuddhaṃ passati, vivaṭehi ca akkhīhi passatīti vipassī; dutiyavāre viceyya viceyya passatīti vipassī; vicinitvā vicinitvā passatīti attho.
40. Vipassī: Here is the meaning of the word: One who sees clearly, without the darkness caused by blinking from time to time, and one who sees with open eyes, is Vipassī. In the second instance, one who sees by carefully distinguishing, by discriminating, is Vipassī; the meaning is: one who sees by selecting and distinguishing.
40. Vipassī: Ở đây, ý nghĩa của từ này là: vị ấy nhìn thấy rõ ràng vì không có bóng tối do nhắm mắt gây ra, và nhìn thấy bằng đôi mắt mở to, nên gọi là Vipassī; lần thứ hai, vị ấy nhìn thấy bằng cách phân tích kỹ lưỡng, nên gọi là Vipassī; có nghĩa là nhìn thấy bằng cách chọn lọc và phân tích.
166
Atthe panāyatīti atthe jānāti passati, nayati vā pavattetīti attho.
Atthe panāyatī: means one knows and sees what is beneficial, or one causes it to come about, or one brings it forth.
Atthe panāyatī (dẫn dắt các vấn đề/lợi ích): có nghĩa là biết và thấy các vấn đề/lợi ích, hoặc dẫn dắt chúng.
Ekadivasaṃ kira vinicchayaṭṭhāne nisīditvā atthe anusāsantassa rañño alaṅkatapaṭiyattaṃ mahāpurisaṃ ānetvā hatthe ṭhapayiṃsu.
It is said that one day, while the king was seated in the judgment hall, instructing on matters of benefit, they brought a well-adorned and prepared great man (Bodhisatta) and placed him in his hands.
Người ta kể rằng, một ngày nọ, khi nhà vua đang ngồi tại nơi xét xử và giảng dạy về các vấn đề/lợi ích, họ đã đưa một vị đại nhân đã được trang điểm và chuẩn bị kỹ lưỡng đến đặt vào tay ngài.
Tassa taṃ aṅkekatvā upalāḷayamānasseva amaccā sāmikaṃ assāmikaṃ akaṃsu.
While he was holding the prince in his lap and caressing him, the ministers made the owner into a non-owner.
Trong khi ngài đang ôm và vuốt ve vị ấy, các vị đại thần đã biến người chủ thành người không có chủ.
Bodhisatto anattamanasaddaṃ nicchāresi.
The Bodhisatta uttered a sound of displeasure.
Bồ Tát phát ra âm thanh không hài lòng.
Rājā – ‘‘kimetaṃ, upadhārethā’’ti āha.
The king said, “What is this? Investigate it.”
Vua nói: "Cái gì vậy? Hãy xem xét."
Upadhāriyamānā aññaṃ adisvā – ‘‘aḍḍassa dubbinicchitattā evaṃ kataṃ bhavissatī’’ti puna sāmikaṃyeva sāmikaṃ katvā ‘‘ñatvā nu kho kumāro evaṃ karotī’’ti vīmaṃsantā puna sāmikaṃ assāmikaṃ akaṃsu.
When they investigated, they saw nothing else and thought, “This must have been done due to a bad judgment of the case,” and again made the owner the owner. Then, wondering, “Does the prince know when he does this?” they again made the owner a non-owner.
Khi xem xét, họ không thấy điều gì khác, nên nghĩ: "Chắc là do việc xét xử sai lầm của quan chức cấp cao," rồi họ lại biến người không có chủ thành người có chủ, và để kiểm tra xem "Hoàng tử có biết mà làm như vậy không?", họ lại biến người có chủ thành người không có chủ.
Punapi bodhisatto tatheva saddaṃ nicchāresi.
Again, the Bodhisatta uttered a sound just as before.
Bồ Tát lại phát ra âm thanh tương tự.
Atha rājā – ‘‘jānāti mahāpuriso’’ti tato paṭṭhāya appamatto ahosi.
Then the king thought, “The great man knows,” and from that time onward, he became diligent.
Bấy giờ, vua nghĩ: "Đại nhân biết," và từ đó trở đi, ngài trở nên cẩn trọng hơn.
Idaṃ sandhāya vuttaṃ – ‘‘viceyya viceyya kumāro atthe panāyatī’’ti.
It is with reference to this that it was said, “The prince brings about beneficial matters by carefully distinguishing.”
Điều này được nói đến khi nói: "Hoàng tử Vipassī dẫn dắt các vấn đề/lợi ích bằng cách phân tích kỹ lưỡng."
167
42. Vassikantiādīsu yattha sukhaṃ hoti vassakāle vasituṃ, ayaṃ vassiko.
42. In Vassika and so on, where it is pleasant to reside during the rainy season, that is called Vassika.
42. Trong Vassika và các từ khác, nơi nào thoải mái để ở vào mùa mưa, đó là vassika.
Itaresupi eseva nayo.
The same method applies to the others.
Đối với các từ khác cũng vậy.
Ayaṃ panettha vacanattho vassāvāso vassaṃ, vassaṃ arahatīti vassiko.
Herein, the meaning of the word is: residence during the rainy season is vassa, that which is suitable for vassa is vassika.
Ở đây, ý nghĩa của từ này là: chỗ ở mùa mưa là vassa, xứng đáng với mùa mưa thì gọi là vassika.
Itaresupi eseva nayo.
The same method applies to the others.
Đối với các từ khác cũng vậy.
168
Tattha vassiko pāsādo nātiucco hoti, nātinīco, dvāravātapānānipissa nātibahūni nātitanūni, bhūmattharaṇapaccattharaṇakhajjabhojjānipettha missakāneva vaṭṭanti.
Among these, the rainy-season palace (Vassika pāsāda) is neither too high nor too low; its doors and windows are neither too many nor too few; and mixed arrangements of ground coverings, cushions, and various foods are suitable there.
Trong số đó, cung điện mùa mưa (vassika) không quá cao, không quá thấp; cửa ra vào và cửa sổ cũng không quá nhiều, không quá ít; thảm trải sàn, đệm, đồ ăn nhẹ và thức ăn ở đây đều là loại pha trộn.
Hemantike thambhāpi bhittiyopi nīcā honti, dvāravātapānāni tanukāni sukhumacchiddāni, uṇhappavesanatthāya bhittiniyūhāni nīhariyanti.
In the Hemantika (winter palace), both pillars and walls are low; the doors and windows are small with tiny openings, and wall-niches are constructed to allow warmth to enter.
Trong cung điện mùa đông (hemantika), các cột và tường thấp, cửa ra vào và cửa sổ nhỏ, có lỗ hổng nhỏ; các hốc tường được mở ra để đón nắng ấm.
Bhūmattharaṇapaccattharaṇanivāsanapārupanāni panettha uṇhaviriyāni kambalādīni vaṭṭanti.
Ground coverings, cushions, lower garments, and upper garments of warm materials like blankets are suitable here.
Thảm trải sàn, đệm, quần áo và chăn ở đây là loại giữ ấm như chăn len.
Khajjabhojjaṃ siniddhaṃ kaṭukasannissitaṃ nirudakasannissitañca.
The foods are oily, pungent, and without much water.
Đồ ăn nhẹ và thức ăn thì béo, có vị cay và không có nước.
Gimhike thambhāpi bhittiyopi uccā honti, dvāravātapānāni panettha bahūni vipulajātāni honti, bhūmattharaṇādīni dukūlamayāni vaṭṭanti.
In the Gimhika (summer palace), both pillars and walls are high; there are many large doors and windows, and ground coverings made of fine cloth (dukūla) are suitable.
Trong cung điện mùa hè (gimhika), các cột và tường cao; cửa ra vào và cửa sổ ở đây nhiều và rộng; thảm trải sàn và các thứ khác là bằng vải lụa.
Khajjabhojjāni madhurasasannissitabharitāni.
The foods are filled with sweet flavors.
Đồ ăn nhẹ và thức ăn đầy ắp hương vị ngọt ngào.
Vātapānasamīpesu cettha nava cāṭiyo ṭhapetvā udakassa pūretvā nīluppalādīhi sañchādenti.
Near the windows, fresh jars are placed, filled with water, and covered with blue lotuses and so forth.
Gần các cửa sổ, người ta đặt chín chum nước mới, đổ đầy nước và phủ lên bằng hoa sen xanh và các loại hoa khác.
Tesu tesu padesesu udakayantāni karonti, yehi deve vassante viya udakadhārā nikkhamanti.
In various places, water machines are installed, from which streams of water emerge as if the sky were raining.
Ở những nơi đó, người ta làm các máy bơm nước, từ đó nước phun ra như trời đổ mưa.
169
Nippurisehīti purisavirahitehi.
Nippurisehī means without men.
Nippurisehī (không có đàn ông): không có đàn ông.
Na kevalañcettha tūriyāneva nippurisāni, sabbaṭṭhānānipi nippurisāneva, dovārikāpi itthiyova, nahāpanādiparikammakarāpi itthiyova.
Not only were the musical instruments without men, but all places were without men; the doorkeepers were women, and those who performed bathing and other services were also women.
Không chỉ các nhạc cụ không có đàn ông, mà tất cả các nơi đều không có đàn ông; người gác cổng cũng là phụ nữ, và những người làm công việc tắm rửa và các công việc khác cũng là phụ nữ.
Rājā kira – ‘‘tathārūpaṃ issariyasukhasampattiṃ anubhavamānassa purisaṃ disvā purisāsaṅkā uppajjati, sā me puttassa mā ahosī’’ti sabbakiccesu itthiyova ṭhapesīti.
It is said that the king thought, “If my son, while enjoying such royal ease and prosperity, sees a man, the thought of manhood might arise in him. May that not happen to my son!” So he appointed only women for all services.
Người ta kể rằng, nhà vua đã sắp xếp toàn bộ công việc cho phụ nữ, vì ngài nghĩ: "Khi con trai ta đang hưởng thụ sự giàu sang và hạnh phúc như vậy, nếu nó nhìn thấy đàn ông, e rằng sẽ nảy sinh nghi ngờ về giới tính, ta không muốn điều đó xảy ra với con trai ta."
170
Paṭhamabhāṇavāravaṇṇanā niṭṭhitā.
The explanation of the first recital section is concluded.
Phần giải thích về Bhāṇavāra thứ nhất đã hoàn tất.
171
Jiṇṇapurisavaṇṇanā
Description of the Aged Man
Giải thích về người già
172
43. Dutiyabhāṇavāre gopānasivaṅkanti gopānasī viya vaṅkaṃ.
43. In the second recital section, gopānasivaṅkaṃ means bent like a gable-rafter.
43. Trong Bhāṇavāra thứ hai, gopānasivaṅkaṃ (cong như mái nhà) có nghĩa là cong như mái nhà.
Bhogganti khandhe, kaṭiyaṃ, jāṇūsūti tīsu ṭhānesu bhoggavaṅkaṃ.
Bhoggaṃ means bent and stooped at three places: shoulders, waist, and knees.
Bhoggaṃ (cong): cong ở ba chỗ: vai, eo và đầu gối.
Daṇḍaparāyananti daṇḍagatikaṃ daṇḍapaṭisaraṇaṃ.
Daṇḍaparāyaṇaṃ means relying on a staff, depending on a staff for movement.
Daṇḍaparāyanaṃ (nương tựa vào gậy): có nghĩa là đi bằng gậy, nương tựa vào gậy.
Āturanti jarāturaṃ.
Āturaṃ means afflicted by old age.
Āturaṃ (bệnh tật): có nghĩa là đau ốm vì tuổi già.
Gatayobbananti atikkantayobbanaṃ pacchimavaye ṭhitaṃ.
Gatayobbanaṃ means one whose youth has passed, remaining in the last stage of life.
Gatayobbanaṃ (tuổi trẻ đã qua): có nghĩa là đã qua tuổi trẻ, đang ở tuổi xế chiều.
Disvāti aḍḍhayojanappamāṇena balakāyena parivuto susaṃvihitārakkhopi gacchanto yadā ratho purato hoti, pacchā balakāyo, tādise okāse suddhāvāsakhīṇāsavabrahmehi attano ānubhāvena rathassa puratova dassitaṃ, taṃ purisaṃ passitvā.
Disvā means having seen that man, who was shown right in front of the chariot by the Arahant Brahmās of Suddhāvāsa heaven through their power, when the Bodhisatta was traveling surrounded by a half-yojana-sized army, well-protected, and the chariot was ahead with the army following behind.
Disvā (thấy): Mặc dù Bồ Tát được bao quanh bởi một đội quân hùng hậu khoảng nửa dojana và được bảo vệ cẩn mật, khi xe ngựa đi trước và đội quân theo sau, vào lúc đó, các vị Phạm thiên A-la-hán từ cõi Suddhāvāsa đã dùng thần thông của mình để hiện ra người đàn ông đó ngay trước xe ngựa, và Bồ Tát đã nhìn thấy người đó.
Suddhāvāsā kira – ‘‘mahāpuriso paṅke gajo viya pañcasu kāmaguṇesu laggo, satimassa uppādessāmā’’ti taṃ dassesuṃ.
Indeed, the Suddhāvāsa Brahmās showed him that man, thinking, “The Great Being is stuck in the five strands of sensual pleasure like an elephant stuck in mud; we will make mindfulness arise in him.”
Các vị Phạm thiên Suddhāvāsa đã nghĩ: "Vị đại nhân này đang mắc kẹt trong năm dục lạc như một con voi trong bùn, chúng ta hãy làm cho ngài khởi lên chánh niệm," rồi họ hiện ra người đó.
Evaṃ dassitañca taṃ bodhisatto ceva passati sārathi ca.
And when he was thus shown, only the Bodhisatta and the charioteer saw him.
Khi người đó được hiện ra như vậy, chỉ có Bồ Tát và người đánh xe nhìn thấy.
Brahmāno hi bodhisattassa appamādatthaṃ sārathissa ca kathāsallāpatthaṃ taṃ dassesuṃ.
For the Brahmās showed him that man for the sake of the Bodhisatta's diligence and for the charioteer to engage in conversation.
Các vị Phạm thiên đã hiện ra người đó để Bồ Tát khởi lên sự không phóng dật và để người đánh xe có thể nói chuyện.
Kiṃ panesoti ‘‘eso jiṇṇoti kiṃ vuttaṃ hoti, nāhaṃ, bho ito pubbe evarūpaṃ addasa’’nti pucchi.
Kiṃ paneso means, "What is this one? What is meant by 'old'? Master, I have never seen such a person before." Thus he asked.
Kiṃ paneso (người này là gì): "Này bạn, người già này là gì? Trước đây tôi chưa từng thấy một người như vậy," ngài hỏi.
173
Tena ti yadi mayhampi evarūpehi kesehi evarūpena ca kāyena bhavitabbaṃ, tena hi samma sārathi.
Tena hi means, "If I too am to have such hair and such a body, then, good charioteer, then let it be so."
Tena hi (vậy thì): Nếu tôi cũng phải có mái tóc trắng như thế và thân thể cong vẹo như thế, vậy thì, này bạn, người đánh xe.
Alaṃ dānajja uyyānabhūmiyāti – ‘‘ajja uyyānabhūmiṃ passissāmā’’ti gacchāma, alaṃ tāya uyyānabhūmiyāti saṃviggahadayo saṃvegānurūpamāha.
Alaṃ dānajja uyyānabhūmiyā means, "We are going today to see the pleasure garden; enough with that pleasure garden!" Thus, with a trembling heart, he spoke appropriately to his agitation.
Alaṃ dānajja uyyānabhūmiyā (đủ rồi hôm nay với cuộc dạo chơi): "Hôm nay chúng ta sẽ đi xem khu vườn," nhưng đủ rồi với khu vườn đó; với trái tim kinh hoàng, ngài nói những lời phù hợp với sự kinh hoàng của mình.
Antepuraṃ gatoti itthijanaṃ vissajjetvā sirigabbhe ekakova nisinno.
Antepuraṃ gato means, dismissing the womenfolk, he sat alone in his glorious chamber.
Antepuraṃ gato (đi vào nội cung): có nghĩa là ngài đã cho các tỳ nữ lui ra và ngồi một mình trong phòng ngủ vương giả.
Yatra hi nāmāti yāya jātiyā sati jarā paññāyati, sā jāti dhiratthu dhikkatā atthu, jigucchāmetaṃ jātinti, jātiyā mūlaṃ khaṇanto nisīdi, paṭhamena sallena hadaye viddho viya.
Yatra hi nāmā means, "Disgrace be to that birth in which, when it exists, old age becomes apparent! I despise this birth!" Thus, reflecting, he sat as if pierced in the heart by the first dart (of sorrow regarding birth).
Yatra hi nāmā (thật vậy, nếu): "Khi có sự sinh, thì sự già hiện hữu. Thật đáng ghê tởm cho sự sinh đó! Ta ghê tởm sự sinh này!" Ngài ngồi xuống như thể bị mũi tên đầu tiên đâm vào tim, đào tận gốc rễ của sự sinh.
174
45. Sārathiṃ āmantāpetvāti rājā kira nemittakehi kathitakālato paṭṭhāya ohitasoto vicarati, so ‘‘kumāro uyyānaṃ gacchanto antarāmagge nivatto’’ti sutvā sārathiṃ āmantāpesi.
45. Sārathiṃ āmantāpetvā: It is said that the king, from the time foretold by the soothsayers, was attentive. Hearing that the prince, while going to the pleasure garden, had turned back midway, he sent for the charioteer.
45. Sārathiṃ āmantāpetvā (cho gọi người đánh xe): Người ta kể rằng, nhà vua đã chú ý lắng nghe từ khi các nhà tiên tri nói về thời điểm đó, và khi nghe tin "Hoàng tử đã quay về giữa đường khi đang đi đến khu vườn," ngài đã cho gọi người đánh xe.
Mā heva khotiādīsu rajjaṃ kāretu, mā pabbajatu, brāhmaṇānaṃ vacanaṃ mā saccaṃ hotūti evaṃ cintesīti attho.
Mā heva kho and so on, means "Let him rule the kingdom, let him not go forth into homelessness, let the words of the brahmins not come true," thus he thought.
Mā heva kho và các từ khác: có nghĩa là ngài nghĩ: "Mong rằng con ta sẽ cai trị vương quốc, mong rằng nó sẽ không xuất gia, mong rằng lời nói của các Bà-la-môn sẽ không thành sự thật."
175
Byādhipurisavaṇṇanā
Description of the Sick Man
Giải thích về người bệnh
176
47. Addasa khoti pubbe vuttanayeneva suddhāvāsehi dassitaṃ addasa.
47. Addasa kho means he saw, indeed, in the manner already stated in the previous accounts of births, what was shown by the Suddhāvāsa devas.
Addasa kho (thấy) là đã thấy điều được chư Phạm thiên Suddhāvāsa chỉ ra theo cách đã nói trước đây.
Ābādhikanti iriyāpathabhañjanakena visabhāgabādhena ābādhikaṃ.
Ābādhikanti means afflicted with an illness that destroys postures, with an incompatible ailment that causes intense suffering.
Ābādhika (bệnh hoạn) là bị bệnh hoạn bởi sự đau đớn bất thường làm phá hoại oai nghi.
Dukkhitanti rogadukkhena dukkhitaṃ.
Dukkhitanti means suffering from the pain of disease, intensely afflicted by suffering.
Dukkhita (khổ não) là khổ não bởi sự đau khổ của bệnh tật.
Bāḷhagilānanti adhimattagilānaṃ.
Bāḷhagilānanti means exceedingly ill, unwell to an excessive degree.
Bāḷhagilāna (bệnh nặng) là bệnh quá nặng.
Palipannanti nimuggaṃ.
Palipannanti means submerged.
Palipanna (lâm vào) là chìm đắm.
Jarā paññāyissati byādhi paññāyissatīti idhāpi yāya jātiyā sati idaṃ dvayaṃ paññāyati, dhikkatā sā jāti, ajātaṃ khemanti jātiyā mūlaṃ khaṇanto nisīdi, dutiyena sallena viddho viya.
Jarā paññāyissati byādhi paññāyissatīti: Here too, he sat, as if pierced by a second dart, contemplating thus: "That birth is condemned if, when it exists, this duality of old age and sickness becomes manifest. The unborn is secure."
Jarā paññāyissati byādhi paññāyissatī (sự già sẽ hiện rõ, sự bệnh sẽ hiện rõ) – ở đây, khi nào có sinh, hai điều này (già và bệnh) sẽ hiện rõ. Sự sinh ấy thật đáng ghinh tởm. Vị ấy ngồi xuống, đào tận gốc rễ của sự sinh, nghĩ rằng: “Không sinh là an ổn”, như thể bị mũi tên thứ hai xuyên thủng.
177
Kālaṅkatapurisavaṇṇanā
Description of a Corpse
Giải thích về người chết
178
50. Vilātanti sivikaṃ.
50. Vilāta means a stretcher for a corpse.
Vilāta (cái cáng) là cáng.
Petanti ito paṭigataṃ.
Peta means departed from this existence.
Peta (người đã chết) là người đã ra đi khỏi đây.
Kālaṅkatanti katakālaṃ, yattakaṃ tena kālaṃ jīvitabbaṃ, taṃ sabbaṃ katvā niṭṭhapetvā matanti attho.
Kālaṅkata means one whose time has been made, meaning one who has completed all the time he was destined to live and has died.
Kālaṅkata (đã đến lúc) là đã đến lúc, nghĩa là đã hoàn thành tất cả thời gian đáng sống và đã chết.
Imampissa purimanayeneva brahmāno dassesuṃ.
This too was shown to him by the Brahmās in the aforementioned manner.
Chư Phạm thiên cũng đã chỉ ra điều này cho vị ấy theo cách đã nói trước đây.
Yatra hi nāmāti idhāpi yāya jātiyā sati idaṃ tayaṃ paññāyati, dhikkatā sā jāti, ajātaṃ khemanti jātiyā mūlaṃ khaṇanto nisīdi, tatiyena sallena viddho viya.
Yatra hi nāmāti: Here too, he sat, as if pierced by a third dart, contemplating thus: "That birth is condemned if, when it exists, this triad of old age, sickness, and death becomes manifest. The unborn is secure."
Yatra hi nāmā (chắc chắn rằng) – ở đây, khi nào có sinh, ba điều này (già, bệnh, chết) sẽ hiện rõ. Sự sinh ấy thật đáng ghinh tởm. Vị ấy ngồi xuống, đào tận gốc rễ của sự sinh, nghĩ rằng: “Không sinh là an ổn”, như thể bị mũi tên thứ ba xuyên thủng.
179
Pabbajitavaṇṇanā
Description of a Recluse
Giải thích về vị xuất gia
180
52. Bhaṇḍunti muṇḍaṃ.
52. Bhaṇḍu means shaven-headed.
Bhaṇḍu (cạo trọc) là đầu trọc.
Imampissa purimanayeneva brahmāno dassesuṃ.
This too was shown to him by the Brahmās in the aforementioned manner.
Chư Phạm thiên cũng đã chỉ ra điều này cho vị ấy theo cách đã nói trước đây.
Sādhu dhammacariyātiādīsu ayaṃ deva dhammacaraṇabhāvo sādhūti cintetvā pabbajitoti evaṃ ekamekassa padassa yojanā veditabbā.
In the phrases such as Sādhu dhammacariyāti, the explanation of each word should be understood as: "O Prince, this state of living righteously is good," thinking thus, he became a recluse.
Trong các từ như sādhu dhammacariyā (sống đúng Pháp thật tốt đẹp), cần hiểu rằng mỗi từ được giải thích như sau: “Này chư thiên, sự thực hành Pháp này là tốt đẹp”, suy nghĩ như vậy, vị ấy đã xuất gia.
Sabbāni cetāni dasakusalakammapathavevacanāneva.
All these are indeed synonyms for the ten wholesome courses of action.
Tất cả những điều này đều là các từ đồng nghĩa của mười thiện nghiệp đạo.
Avasāne pana avihiṃsāti karuṇāya pubbabhāgo.
At the end, avihiṃsā is the preliminary stage of karuṇā (compassion).
Cuối cùng, avihiṃsā (không làm hại) là giai đoạn đầu của lòng bi.
Anukampāti mettāya pubbabhāgo.
Anukampā is the preliminary stage of mettā (loving-kindness).
Anukampā (lòng thương xót) là giai đoạn đầu của lòng từ.
Tenahīti uyyojanatthe nipāto.
Tenahīti is an interjection in the sense of urging.
Tenahī (vậy thì) là một giới từ dùng để thúc giục.
Pabbajitaṃ hissa disvā cittaṃ pabbajjāya ninnaṃ jātaṃ.
Indeed, seeing the recluse, his mind became inclined towards reclusion.
Thật vậy, khi thấy vị xuất gia, tâm của vị ấy đã hướng về sự xuất gia.
Atha tena saddhiṃ kathetukāmo hutvā sārathiṃ uyyojento tena hītiādimāha.
Then, desiring to speak with him, he urged the charioteer, saying, tena hīti and so on.
Sau đó, muốn nói chuyện với vị ấy, vị ấy đã thúc giục người đánh xe bằng cách nói tena hī và các từ khác.
181
Bodhisattapabbajjāvaṇṇanā
Description of the Bodhisatta's Renunciation
Giải thích về sự xuất gia của Bồ Tát
182
54. Atha kho, bhikkhaveti – ‘‘pabbajitassa sādhu dhammacariyā’’tiādīni ca aññañca bahuṃ mahājanakāyena rakkhiyamānassa puttadārasambādhe ghare vasato ādīnavapaṭisaṃyuttañceva migabhūtena cetasā yathāsukhaṃ vane vasato pabbajitassa vivekānisaṃsapaṭisaṃyuttañca dhammiṃ kathaṃ sutvā pabbajitukāmo hutvā – atha kho, bhikkhave, vipassī kumāro sārathiṃ āmantesi.
54. Atha kho, bhikkhaveti: — Having heard the discourse on the benefits of reclusion, such as "Right conduct is good for a recluse," and much else pertaining to the danger of living in a crowded household with children and wives, as well as the advantages of solitude for a recluse living freely in the forest like a wild animal, Vipassī Kumāra desired to renounce. It was then, monks, that Vipassī Kumāra addressed the charioteer.
Atha kho, bhikkhave (Này chư Tỳ-khưu, sau đó) – sau khi nghe những lời Pháp về sự xuất gia như “sự thực hành Pháp của vị xuất gia là tốt đẹp” và nhiều lời khác nữa, về những tai hại khi sống trong gia đình chật chội với vợ con, được đông đảo người dân bảo vệ, và về những lợi ích của sự độc cư của một vị xuất gia sống tự do trong rừng như một con nai, vị Bồ Tát Vipassī đã muốn xuất gia. Sau đó, này chư Tỳ-khưu, Thái tử Vipassī đã gọi người đánh xe.
183
Imāni cattāri disvā pabbajitaṃ nāma sabbabodhisattānaṃ vaṃsova tantiyeva paveṇīyeva.
This act of renouncing after seeing these four signs is indeed a lineage, a tradition, a continuous practice for all Bodhisattas.
Việc xuất gia sau khi thấy bốn cảnh (già, bệnh, chết, và Sa-môn) là truyền thống, là dòng dõi, là tập quán của tất cả các vị Bồ Tát.
Aññepi ca bodhisattā yathā ayaṃ vipassī kumāro, evaṃ cirassaṃ cirassaṃ passanti.
Other Bodhisattas, too, like Vipassī Kumāra, see these signs only after a long, long time.
Các vị Bồ Tát khác cũng thấy những cảnh này rất lâu sau đó, giống như Thái tử Vipassī này.
Amhākaṃ pana bodhisatto cattāripi ekadivasaṃyeva disvā mahābhinikkhamanaṃ nikkhamitvā anomānadītīre pabbajito.
But our Bodhisatta, having seen all four in a single day, performed the Great Renunciation and became a recluse on the bank of the Anomā River.
Tuy nhiên, vị Bồ Tát của chúng ta đã thấy cả bốn cảnh trong cùng một ngày, rồi thực hiện cuộc Đại Xuất Gia, và xuất gia bên bờ sông Anomā.
Teneva rājagahaṃ patvā tattha raññā bimbisārena – ‘‘kimatthaṃ, paṇḍita, pabbajitosīti’’ puṭṭho āha –
For this reason, when he reached Rājagaha and was asked by King Bimbisāra, "For what purpose, wise one, have you renounced?", he replied:
Vì vậy, khi đến Rājagaha, được vua Bimbisāra hỏi: “Này hiền giả, vì lý do gì mà ngài xuất gia?”, vị ấy đã trả lời:
184
‘‘Jiṇṇañca disvā dukhitañca byādhitaṃ,
“Having seen an old man, and one afflicted and sick,
“Thấy người già, người bệnh khổ đau,
185
Matañca disvā gatamāyusaṅkhayaṃ;
And having seen a dead man, one whose lifespan had ended;
Thấy người chết, đã hết tuổi thọ;
186
Kāsāyavatthaṃ pabbajitañca disvā,
And having seen a recluse clad in a yellow robe,
Thấy vị xuất gia mặc y kāṣāya,
187
Tasmā ahaṃ pabbajitomhi rājā’’ti.
Therefore, O King, I have renounced.”
Vì vậy, tôi đã xuất gia, thưa Đại vương.”
188
Mahājanakāyaanupabbajjāvaṇṇanā
Description of the Multitude Following the Renunciation
Giải thích về sự xuất gia theo của đại chúng
189
55. Sutvāna tesanti tesaṃ caturāsītiyā pāṇasahassānaṃ sutvā etadahosi.
55. Sutvāna tesanti means, having heard the words of those eighty-four thousand beings, this thought occurred to them.
Sutvāna tesa (sau khi nghe những lời của họ) là sau khi nghe những lời của tám vạn bốn ngàn chúng sinh ấy, ý nghĩ này đã khởi lên.
Orakoti ūnako lāmako.
Orako means inferior, contemptible.
Orako (thấp kém) là thấp kém, tầm thường.
Anupabbajiṃsūti anupabbajitāni.
Anupabbajiṃsūti means they followed in reclusion.
Anupabbajiṃsū (đã xuất gia theo) là đã xuất gia theo.
Kasmā panettha yathā parato khaṇḍatissānaṃ anupabbajjāya – ‘‘bandhumatiyā rājadhāniyā nikkhamitvā’’ti vuttaṃ, evaṃ na vuttanti?
Why is it not stated here, as it is later concerning the renunciation of the Khaṇḍatissas, "having departed from the royal capital of Bandhumatī"?
Tại sao ở đây không nói “rời khỏi kinh thành Bandhumatī” như đã nói sau đó về sự xuất gia theo của Khandatissa?
Nikkhamitvā sutattā.
Because it was heard after departing.
Vì họ đã nghe sau khi rời khỏi thành.
Ete kira sabbepi vipassissa kumārassa upaṭṭhākaparisāva, te pātova upaṭṭhānaṃ āgantvā kumāraṃ adisvā pātarāsatthāya gantvā bhuttapātarāsā āgamma ‘‘kuhiṃ kumāro’’ti pucchitvā ‘‘uyyānabhūmiṃ gato’’ti sutvā ‘‘tattheva naṃ dakkhissāmā’’ti nikkhamantā nivattamānaṃ sārathiṃ disvā – ‘‘kumāro pabbajito’’ti cassa vacanaṃ sutvā sutaṭṭhāneyeva sabbābharaṇāni omuñcitvā antarāpaṇato kāsāvapītāni vatthāni āharāpetvā kesamassuṃ ohāretvā pabbajiṃsu.
Indeed, all these eighty-four thousand men were attendants of Vipassī Kumāra. Having come for service early in the morning, and not seeing the Prince, they went to eat their morning meal. After eating, they returned and asked, "Where is the Prince?" Having heard that he had gone to the pleasure garden, they thought, "We shall see him there," and departed. Seeing the charioteer returning and hearing his words, "The Prince has renounced," they removed all their ornaments right where they heard it, had saffron-colored robes brought from the market, shaved their hair and beards, and became recluses.
Tất cả những người này đều là đoàn tùy tùng của Thái tử Vipassī. Họ đến hầu vào buổi sáng, không thấy Thái tử, họ đi ăn sáng, sau khi ăn sáng xong, họ trở lại hỏi: “Thái tử ở đâu?”, nghe nói “đã đi đến vườn thượng uyển”, họ nghĩ: “Chúng ta sẽ gặp ngài ở đó”, và khi họ đang đi ra, họ thấy người đánh xe quay lại, nghe lời người đánh xe nói: “Thái tử đã xuất gia”, ngay tại chỗ nghe, họ đã cởi bỏ tất cả trang sức, sai người mang y màu kāṣāya từ chợ đến, cạo bỏ tóc râu, rồi xuất gia.
Iti nagarato nikkhamitvā bahinagare sutattā ettha – ‘‘bandhumatiyā rājadhāniyā nikkhamitvā’’ti na vuttaṃ.
Thus, because they heard it outside the city after departing from the city, it is not stated here, "having departed from the royal capital of Bandhumatī."
Vì vậy, ở đây không nói “rời khỏi kinh thành Bandhumatī” vì họ đã nghe tin này ở ngoại thành sau khi rời khỏi thành phố.
190
Cārikaṃ caratīti gatagataṭṭhāne mahāmaṇḍapaṃ katvā dānaṃ sajjetvā āgamma svātanāya nimantito janassa āyācitabhikkhameva paṭiggaṇhanto cattāro māse cārikaṃ cari.
Cārikaṃ carati means he wandered for four months, establishing a great pavilion in every place he visited, preparing alms, and then, having been invited for the morrow by the people, accepting only the alms requested.
Cārikaṃ carati (du hành) là vị ấy đã du hành trong bốn tháng, dựng đại sảnh ở mỗi nơi đến, sắp đặt vật cúng dường, rồi đến và nhận chỉ những thức ăn đã được thỉnh cầu từ những người đã thỉnh mời cho ngày hôm sau.
191
Ākiṇṇoti iminā gaṇena parivuto.
Ākiṇṇo means surrounded by this retinue of recluses.
Ākiṇṇo (được bao quanh) là được đoàn này bao quanh.
Ayaṃ pana vitakko bodhisattassa kadā uppannoti?
When did this thought arise in the Bodhisatta?
Vậy, ý nghĩ này của Bồ Tát đã khởi lên khi nào?
Sve visākhapuṇṇamā bhavissatīti cātuddasīdivase.
On the fourteenth day, thinking, "Tomorrow will be the full moon of Vesākha."
Vào ngày mười bốn, khi nghĩ: “Ngày mai sẽ là ngày trăng tròn Visākha.”
Tadā kira so – ‘‘yatheva maṃ ime pubbe gihibhūtaṃ parivāretvā caranti, idānipi tatheva, kiṃ iminā gaṇenā’’ti gaṇasaṅgaṇikāya ukkaṇṭhitvā ‘‘ajjeva gacchāmī’’ti cintetvā puna ‘‘ajja avelā, sace idāni gamissāmi, sabbeva ime jānissanti, sveva gamissāmī’’ti cintesi.
At that time, he was wearied by the crowd and company, thinking, "Just as these recluses attended me when I was a layman, so they do now. What is the need for this retinue?" He thought, "I will leave today." But then he reconsidered, "Today is not the right time. If I leave now, all these will know. I will leave tomorrow."
Vào lúc đó, vị ấy đã chán ghét sự tụ tập đông đảo này, nghĩ rằng: “Những người này trước đây đã vây quanh ta khi ta còn là cư sĩ, bây giờ họ vẫn như vậy. Cần gì đoàn này?”, rồi nghĩ: “Hôm nay ta sẽ đi.” Nhưng rồi lại nghĩ: “Hôm nay chưa phải lúc. Nếu ta đi bây giờ, tất cả những người này sẽ biết. Ta sẽ đi vào ngày mai.”
Taṃ divasañca uruvelagāmasadise gāme gāmavāsino svātanāya nimantayiṃsu.
On that very day, villagers in a village similar to Uruvelā village invited them for the next day.
Vào ngày đó, những người dân làng ở một ngôi làng tương tự như làng Uruvelā đã thỉnh mời vị ấy cho ngày hôm sau.
Te caturāsītisahassānampi tesaṃ pabbajitānaṃ mahāpurisassa ca pāyāsameva paṭiyādayiṃsu.
Those villagers prepared only milk-rice for the eighty-four thousand recluses and the Great Being.
Họ đã chuẩn bị món sữa gạo (pāyāsa) cho vị Đại nhân và cả tám vạn bốn ngàn vị xuất gia đó.
Atha mahāpuriso punadivase tasmiṃyeva gāme tehi pabbajitehi saddhiṃ bhattakiccaṃ katvā vasanaṭṭhānameva agamāsi.
Then, on the next day, the Great Being, having eaten his meal with those recluses in that same village, went to his dwelling place.
Sau đó, vào ngày hôm sau, vị Đại nhân đã dùng bữa cùng với các vị xuất gia đó tại ngôi làng ấy, rồi đi đến chỗ ở của mình.
Tattha te pabbajitā mahāpurisassa vattaṃ dassetvā attano attano rattiṭṭhānadivāṭṭhānāni paviṭṭhā.
There, those recluses, having performed their duties for the Great Being, entered their respective night and day quarters.
Ở đó, các vị xuất gia đã trình bày nghi thức của vị Đại nhân, rồi đi vào chỗ ở ban đêm và chỗ ở ban ngày của riêng mình.
Bodhisattopi paṇṇasālaṃ pavisitvā nisinno.
The Bodhisatta also entered his leaf-hut and sat down.
Bồ Tát cũng vào tịnh xá lá và ngồi xuống.
192
‘‘Ṭhite majjhanhike kāle, sannisīvesu pakkhisu;
“When it is midday, when the birds are silent,
“Khi giữa trưa đứng bóng, chim chóc đều im lặng;
193
Saṇateva brahāraññaṃ, taṃ bhayaṃ paṭibhāti ma’’nti.(saṃ. ni. 1.15);
The great forest seems to roar; that frightens me.”
Rừng lớn vẫn rì rào, điều đó khiến tôi sợ hãi.”
194
Evarūpe avivekārāmānaṃ bhayakāle sabbasattānaṃ sadarathakāleyeva – ‘‘ayaṃ kālo’’ti nikkhamitvā paṇṇasālāya dvāraṃ pidahitvā bodhimaṇḍābhimukho pāyāsi.
It was at such a fearful time for those who do not delight in solitude, at a time of agitation for all beings, that he thought, "This is the time." Having departed, he closed the door of the leaf-hut and set off towards the Bodhimaṇḍa.
Vào thời điểm đáng sợ như vậy đối với những người không ưa độc cư, vào thời điểm mà tất cả chúng sinh đều lo lắng, vị ấy đã nghĩ: “Đây là lúc rồi”, rồi đi ra, đóng cửa tịnh xá lá, và hướng về Bồ-đề đạo tràng.
Aññadāpi ca tasmiṃ ṭhāne vicaranto bodhimaṇḍaṃ passati, nisīdituṃ panassa cittaṃ na namitapubbaṃ.
Even on other occasions, when wandering in that place, he would see the Bodhimaṇḍa, but his mind had never before inclined to sit there.
Những lúc khác, khi đi lại ở chỗ đó, vị ấy cũng thấy Bồ-đề đạo tràng, nhưng tâm của vị ấy chưa từng hướng đến việc ngồi xuống.
Taṃ divasaṃ panassa ñāṇaṃ paripākagataṃ, tasmā alaṅkataṃ bodhimaṇḍaṃ disvā ārohanatthāya cittaṃ uppannaṃ.
However, on that day, his knowledge had come to maturity, and therefore, upon seeing the adorned Bodhimaṇḍa, the thought to ascend it arose.
Nhưng vào ngày đó, trí tuệ của vị ấy đã chín muồi, vì vậy, khi thấy Bồ-đề đạo tràng được trang hoàng, tâm của vị ấy đã khởi lên ý muốn ngồi lên đó.
So dakkhiṇadisābhāgena upagamma padakkhiṇaṃ katvā puratthimadisābhāge cuddasahatthaṃ pallaṅkaṃ paññapetvā caturaṅgavīriyaṃ adhiṭṭhahitvā – ‘‘yāva buddho na homi, na tāva ito vuṭṭhahāmī’’ti paṭiññaṃ katvā nisīdi.
He approached from the southern side, circumambulated it clockwise, then in the eastern quarter, he spread a fourteen-cubit seat, resolved with fourfold energy, and sat down, making the vow, "Until I become a Buddha, I will not rise from this seat."
Vị ấy đi đến từ phía nam, đi nhiễu hữu, rồi trải tòa ngồi (pallaṅka) rộng mười bốn cubit ở phía đông, kiên quyết với tứ chi tinh tấn, và ngồi xuống, thề rằng: “Cho đến khi nào ta chưa thành Phật, ta sẽ không đứng dậy khỏi đây.”
Idamassa vūpakāsaṃ sandhāya – ‘‘ekova gaṇamhā vūpakaṭṭho vihāsī’’ti vuttaṃ.
It is with reference to this withdrawal that it is said, "He dwelt alone, withdrawn from the crowd."
Điều này được nói đến trong câu: “Vị ấy đã sống một mình, tách biệt khỏi đoàn thể”, ám chỉ sự độc cư của vị ấy.
195
Aññeneva tānīti te kira sāyaṃ bodhisattassa upaṭṭhānaṃ āgantvā paṇṇasālaṃ parivāretvā nisinnā ‘‘ativikālo jāto, upadhārethā’’ti vatvā paṇṇasālaṃ vivaritvā taṃ apassantāpi ‘‘kuhiṃ gato’’ti nānubandhiṃsu, ‘‘gaṇavāse nibbinno eko viharitukāmo maññe mahāpuriso, buddhabhūtaṃyeva naṃ passissāmā’’ti vatvā antojambudīpābhimukhā cārikaṃ pakkantā.
Concerning the phrase " Aññeneva tānī": those eighty-four thousand bhikkhus, having come to attend upon the Bodhisatta in the evening, sat surrounding his leaf-hut. Having said, "It is very late, let us investigate," and having opened the leaf-hut, even though they did not see him, they did not pursue him asking, "Where has he gone?" Instead, they said, "This great being is probably weary of dwelling among a group and desires to dwell alone. We will see him when he has become a Buddha." Having said this, they departed on their wandering, facing towards the interior of Jambudīpa.
Aññeneva tānīti (ở đây): quả thật, những vị tỳ-khưu đó vào buổi chiều đã đến nơi phụng sự của Bồ-tát, vây quanh tịnh xá và ngồi xuống. Khi nói: "Đã quá muộn rồi, hãy xem xét kỹ lưỡng," họ mở tịnh xá. Mặc dù không thấy Ngài, họ cũng không truy hỏi: "Ngài đã đi đâu?" Thay vào đó, họ nói: "Vị Đại nhân này có lẽ đã chán ghét việc sống chung với chúng tăng và muốn sống một mình. Chúng ta sẽ gặp Ngài khi Ngài đã thành Phật." Nói xong, họ lên đường du hành hướng về phía nội địa Jambudīpa.
196
Bodhisattaabhivesavaṇṇanā
Description of the Bodhisatta's Enlightenment
Mô tả về sự giác ngộ của Bồ-tát
197
57. Vāsūpagatassāti bodhimaṇḍe ekarattivāsaṃ upagatassa.
Vāsūpagatassa means "who had gone to dwell for one night" at the Bodhimaṇḍa.
57. Vāsūpagatassāti: (ở đây) nghĩa là vị đã đến ở tại bồ-đề đạo tràng chỉ một đêm.
Rahogatassāti rahasi gatassa.
Rahogatassa means "who had gone to a secluded place."
Rahogatassāti: nghĩa là vị đã đi đến nơi vắng vẻ.
Paṭisallīnassāti ekībhāvavasena nilīnassa.
Paṭisallīnassa means "who had retreated into solitude (become one)."
Paṭisallīnassāti: nghĩa là vị đã ẩn mình trong sự cô độc.
Kicchanti dukkhaṃ.
Kicchaṃ means "suffering."
Kicchaṃti: là sự khổ đau.
Cavati ca upapajjati cāti idaṃ dvayaṃ pana aparāparaṃ cutipaṭisandhiṃ sandhāya vuttaṃ.
These two phrases, cavati ca upapajjati cā (he passes away and is reborn), are spoken with reference to successive deaths and rebirths.
Còn hai từ cavati ca upapajjati cā (chết đi và tái sinh) này được nói đến để chỉ sự chết và tái sinh liên tiếp.
Jarāmaraṇassāti ettha yasmā pabbajanto jiṇṇabyādhimatteyeva disvā pabbajito, tasmāssa jarāmaraṇameva upaṭṭhāti.
Here, in Jarāmaraṇassa, since the Bodhisatta went forth (renounced the world) after seeing merely an old person, a sick person, and a dead person, it is aging-and-death that stood out to him.
Trong jarāmaraṇassāti (già và chết), vì khi xuất gia, Ngài chỉ thấy người già, người bệnh, người chết, nên đối với Ngài, chỉ có già và chết hiện hữu.
Tenevāha – ‘‘jarāmaraṇassā’’ti.
Therefore, it is said – " Jarāmaraṇassa."
Vì lẽ đó, Ngài nói: "jarāmaraṇassā" (già và chết).
Iti jarāmaraṇaṃ mūlaṃ katvā abhiniviṭṭhassa bhavaggato otarantassa viya – atha kho, bhikkhave, vipassissa bodhisattassa etadahosi.
Thus, for the Great Being, who was firmly established with aging-and-death as the root, it was as if he was descending from the apex of existence, when this thought arose in the Bodhisatta Vipassī, "Indeed, Bhikkhus!"
Như vậy, sau khi lấy già và chết làm gốc và chuyên tâm quán sát, như thể đang từ đỉnh của các cõi hữu xuống, này các tỳ-khưu, Bồ-tát Vipassī đã nghĩ như sau:
198
Yonisomanasikārāti upāyamanasikārā pathamanasikārā.
Yonisomanasikārā means "from appropriate attention" (upāya-manasikārā, patha-manasikārā).
Yonisomanasikārāti: do sự tác ý đúng đắn, do sự tác ý theo phương pháp đúng. Tác ý đúng đắn là khi tác ý về các pháp vô thường, v.v., đúng như bản chất vô thường, v.v. Sự tác ý này là một trong số đó, vì nó diễn ra dưới hình thức quán sát sự sinh và diệt, với câu hỏi: "Khi nào thì sinh, v.v., hiện hữu? Khi nào thì không có, thì không hiện hữu?"
Aniccādīni hi aniccāditova manasikaroto yonisomanasikāro nāma hoti.
Indeed, when one attends to impermanent things as impermanent, etc., that is called yoniso manasikāra.
Quả thật, các pháp vô thường, v.v., khi tác ý về các pháp vô thường, v.v., đúng như bản chất vô thường, v.v., thì đó gọi là tác ý đúng đắn.
Ayañca – ‘‘kismiṃ nu kho satijātiādīni honti, kismiṃ asati na hontī’’ti udayabbayānupassanāvasena pavattattā tesaṃ aññataro.
And this (attention) is one of them, as it occurred by way of contemplating rise and fall, asking, "When what exists, do birth, etc., exist? When what does not exist, do they not exist?"
Và sự tác ý này là một trong số đó, vì nó diễn ra dưới hình thức quán sát sự sinh và diệt, với câu hỏi: "Khi nào thì sinh, v.v., hiện hữu? Khi nào thì không có, thì không hiện hữu?"
Tasmāssa ito yonisomanasikārā iminā upāyamanasikārena ahu paññāya abhisamayo, bodhisattassa paññāya yasmiṃ sati jarāmaraṇaṃ hoti, tena jarāmaraṇakāraṇena saddhiṃ samāgamo ahosi.
Therefore, from this appropriate attention, through this skillful attention, " ahu paññāya abhisamayo" – an understanding of wisdom arose in the Bodhisatta. A meeting occurred with the cause of aging and death, that is, that upon which aging and death depend.
Do đó, từ sự tác ý đúng đắn này, nhờ phương pháp tác ý này, ahu paññāya abhisamayo (sự giác ngộ đã phát sinh trong trí tuệ). Trí tuệ của Bồ-tát đã hòa hợp với nguyên nhân của già và chết, tức là cái gì hiện hữu thì già và chết hiện hữu.
Kiṃ pana tanti?
What is that (cause)?
Thế thì, nguyên nhân đó là gì?
Jāti.
Birth.
Là sinh.
Tenāha – ‘‘jātiyā kho sati jarāmaraṇaṃ hotī’’ti.
Therefore, it is said – "When birth exists, aging and death exist."
Vì vậy, Ngài nói: "Khi có sinh, thì có già và chết."
Yā cāyaṃ jarāmaraṇassa kāraṇapariggāhikā paññā, tāya saddhiṃ bodhisattassa samāgamo ahosīti ayamettha attho.
And the meaning here is that the Bodhisatta encountered the wisdom that ascertains the cause of aging and death.
Ở đây, ý nghĩa là: trí tuệ nắm bắt nguyên nhân của già và chết đã hòa hợp với Bồ-tát.
Etenupāyena sabbapadāni veditabbāni.
All other terms should be understood by this method.
Tất cả các từ ngữ cần được hiểu theo phương pháp này.
199
Nāmarūpe kho sati viññāṇanti ettha pana saṅkhāresu sati viññāṇanti ca, avijjāya sati saṅkhārāti ca vattabbaṃ bhaveyya, tadubhayampi na gahitaṃ.
However, in the phrase " Nāmarūpe kho sati viññāṇaṃ," it could also have been said, "When saṅkhāras exist, consciousness exists," and "When ignorance exists, saṅkhāras exist." Neither of these two was taken.
Trong đoạn nāmarūpe kho sati viññāṇaṃ (khi có danh sắc, thì có thức), đáng lẽ phải nói: "khi có các hành (saṅkhāra), thì có thức" và "khi có vô minh (avijjā), thì có các hành," nhưng cả hai điều đó đều không được đề cập.
Kasmā?
Why?
Tại sao?
Avijjāsaṅkhārā hi atīto bhavo tehi saddhiṃ ayaṃ vipassanā na ghaṭiyati.
Because ignorance and saṅkhāras belong to a past existence, and this vipassanā (insight) does not connect with them.
Vì vô minh và các hành thuộc về kiếp quá khứ, thiền quán này không liên quan đến chúng.
Mahāpuriso hi paccuppannavasena abhiniviṭṭhoti.
For the Great Being was focused on the present existence.
Bởi vì Đại nhân đã chuyên tâm vào kiếp hiện tại.
Nanu ca avijjāsaṅkhārehi adiṭṭhehi na sakkā buddhena bhavitunti.
Is it not true that without seeing ignorance and saṅkhāras, one cannot become a Buddha?
Há không phải không thể thành Phật nếu không thấy vô minh và các hành sao?
Saccaṃ na sakkā, iminā pana te bhavaupādānataṇhāvaseneva diṭṭhāti.
It is true that one cannot. However, by this method, the Great Being saw those (ignorance and saṅkhāras) through the craving for existence and clinging to existence.
Đúng vậy, không thể, nhưng Bồ-tát đã thấy vô minh và các hành thông qua hữu, chấp thủ và tham ái.
Imasmiṃ ṭhāne vitthārato paṭiccasamuppādakathā kathetabbā.
In this section, the explanation of dependent origination should be given in detail.
Ở đây, cần phải trình bày chi tiết về giáo lý Duyên khởi (Paṭiccasamuppāda).
Sā panesā visuddhimagge kathitāva.
But that has already been explained in the Visuddhimagga.
Nhưng điều đó đã được trình bày trong Thanh Tịnh Đạo (Visuddhimagga).
200
58. Paccudāvattatīti paṭinivattati.
Paccudāvattatī means "returns."
58. Paccudāvattatīti: quay trở lại.
Katamaṃ panettha viññāṇaṃ paccudāvattatīti?
Which consciousness returns here?
Thức nào ở đây quay trở lại?
Paṭisandhiviññāṇampi vipassanāñāṇampi.
Both rebirth-consciousness and insight-knowledge (vipassanāñāṇa).
Cả thức tái sinh (paṭisandhiviññāṇa) và trí tuệ thiền quán (vipassanāñāṇa).
Tattha paṭisandhiviññāṇaṃ paccayato paṭinivattati, vipassanāñāṇaṃ ārammaṇato.
Of these, rebirth-consciousness returns due to condition (paccaya), and insight-knowledge due to object (ārammaṇa).
Trong đó, thức tái sinh quay trở lại từ nhân duyên, còn trí tuệ thiền quán quay trở lại từ đối tượng.
Ubhayampi nāmarūpaṃ nātikkamati, nāmarūpato paraṃ na gacchati.
Both do not transcend nāmarūpa; they do not go beyond nāmarūpa.
Cả hai đều không vượt quá danh sắc, không đi xa hơn danh sắc.
Ettāvatā jāyetha vātiādīsu viññāṇe nāmarūpassa paccaye honte, nāmarūpe ca viññāṇassa paccaye honte, dvīsupi aññamaññapaccayesu hontesu ettakena jāyetha vā…pe… upapajjetha vā, ito hi paraṃ kiṃ aññaṃ jāyeyya vā…pe… upapajjeyya vā.
In phrases like " Ettāvatā jāyetha vā," when consciousness is the condition for nāmarūpa, and nāmarūpa is the condition for consciousness, and when both are mutually conditioned, by this much, one would be born, etc., one would be reborn. For what else beyond this would be born, etc., or reborn?
Trong các câu như ettāvatā jāyetha vā (chỉ đến đây mà sinh), khi thức là nhân duyên cho danh sắc, và danh sắc là nhân duyên cho thức, khi cả hai đều là nhân duyên cho nhau, thì chỉ đến mức này mà sinh, v.v., hoặc tái sinh, v.v., vì từ đây trở đi, còn gì khác có thể sinh, v.v., hoặc tái sinh, v.v. nữa?
Nanu etadeva jāyati ca…pe… upapajjati cāti?
Is it not precisely this that is born, etc., and reborn?
Há không phải chính điều này sinh, v.v., và tái sinh sao?
Evaṃ saddhiṃ aparāparacutipaṭisandhīhi pañca padāni dassetvā puna taṃ ettāvatāti vuttamatthaṃ niyyātento – ‘‘yadidaṃ nāmarūpapaccayā viññāṇaṃ, viññāṇapaccayā nāmarūpa’’nti vatvā tato paraṃ anulomapaccayākāravasena viññāṇapaccayā nāmarūpamūlaṃ āyatimpi jātijarāmaraṇaṃ dassetuṃ nāmarūpapaccayā saḷāyatanantiādimāha.
Thus, having shown five terms along with successive deaths and rebirths, and then wanting to conclude the meaning stated by "ettāvatā" by saying, "This means consciousness arises conditioned by nāmarūpa, and nāmarūpa arises conditioned by consciousness," he then goes on to say " Nāmarūpapaccayā saḷāyatanaṃ" etc., to show that conditioned by consciousness, rooted in nāmarūpa, aging-and-death also occur in the future, following the pattern of dependent origination in direct order.
Như vậy, sau khi trình bày năm pháp cùng với sự chết và tái sinh liên tiếp, Ngài lại giải thích ý nghĩa đã nói bằng ettāvatā (chỉ đến đây), nói rằng: "Cái này là thức do danh sắc làm duyên, danh sắc do thức làm duyên," và từ đó trở đi, để trình bày về sinh, già và chết sẽ đến trong tương lai, có gốc rễ từ danh sắc do thức làm duyên, theo cách nhân duyên thuận chiều, Ngài nói: nāmarūpapaccayā saḷāyatanaṃ (do danh sắc làm duyên, có sáu xứ).
Tattha kevalassa dukkhakkhandhassa samudayo hotīti sakalassa jātijarāmaraṇasokaparidevadukkhadomanassupāyāsādibhedassa dukkharāsissa nibbatti hoti.
There, kevalassa dukkhakkhandhassa samudayo hotīti means the arising of the entire mass of suffering, including birth, aging, death, sorrow, lamentation, pain, dejection, and despair, etc.
Ở đây, kevalassa dukkhakkhandhassa samudayo hotīti (sự tập khởi của toàn bộ khối khổ) là sự phát sinh của toàn bộ khối khổ bao gồm sinh, già, chết, sầu, bi, khổ, ưu, não, v.v.
Iti mahāpuriso sakalassa vaṭṭadukkhassa nibbattiṃ addasa.
Thus, the Great Being saw the arising of the entire suffering of saṃsāra.
Như vậy, Đại nhân đã thấy sự phát sinh của toàn bộ khổ đau trong vòng luân hồi.
201
59. Samudayo samudayoti khoti nibbatti nibbattīti kho.
Samudayo samudayoti kho means "arising, arising indeed."
59. Samudayo samudayoti khoti: quả thật, sự phát sinh, sự phát sinh.
Pubbe ananussutesūti na anussutesu assutapubbesu.
Pubbe ananussutesu means "not heard before," "never heard previously."
Pubbe ananussutesuti: chưa từng được nghe trước đây, chưa từng nghe.
Cakkhuṃ udapādītiādīsu udayadassanapaññāvesā.
In phrases like " Cakkhuṃ udapādī," it is the insight-wisdom that sees the arising.
Trong các câu như cakkhuṃ udapādīti (mắt đã khởi sinh), đó là trí tuệ thấy sự sinh khởi.
Dassanaṭṭhena cakkhu, ñātakaraṇaṭṭhena ñāṇaṃ, pajānanaṭṭhena paññā, nibbijjhitvā paṭivijjhitvā uppannaṭṭhena vijjā, obhāsaṭṭhena ca ālokoti vuttā.
It is called cakkhu due to its function of seeing, ñāṇaṃ due to its function of knowing, paññā due to its function of understanding, vijjā due to its function of penetrating and piercing, and āloka due to its function of illuminating.
Được gọi là cakkhu (mắt) theo nghĩa thấy; ñāṇaṃ (trí) theo nghĩa biết; paññā (tuệ) theo nghĩa hiểu biết; vijjā (minh) theo nghĩa thâm nhập và xuyên thấu; và āloko (ánh sáng) theo nghĩa chiếu sáng.
Yathāha – ‘‘cakkhuṃ udapādīti dassanaṭṭhena.
As it is said: "Cakkhuṃ udapādī (eye arose) means in the sense of seeing.
Như đã nói:
Ñāṇaṃ udapādīti ñātaṭṭhena.
Ñāṇaṃ udapādī (knowledge arose) means in the sense of knowing.
"Cakkhuṃ udapādīti (mắt đã khởi sinh) theo nghĩa thấy.
Paññā udapādīti pajānanaṭṭhena.
Paññā udapādī (wisdom arose) means in the sense of understanding.
Ñāṇaṃ udapādīti (trí đã khởi sinh) theo nghĩa biết.
Vijjā udapādīti paṭivedhaṭṭhena.
Vijjā udapādī (true knowledge arose) means in the sense of penetration.
Paññā udapādīti (tuệ đã khởi sinh) theo nghĩa hiểu biết.
Āloko udapādīti obhāsaṭṭhena.
Āloko udapādī (light arose) means in the sense of illumination.
Vijjā udapādīti (minh đã khởi sinh) theo nghĩa xuyên thấu.
Cakkhudhammo dassanaṭṭho attho.
The dharma of eye means the meaning in the sense of seeing.
Āloko udapādīti (ánh sáng đã khởi sinh) theo nghĩa chiếu sáng.
Ñāṇadhammo ñātaṭṭho attho.
The dharma of knowledge means the meaning in the sense of knowing.
Pháp cakkhu có nghĩa là thấy.
Paññādhammo pajānanaṭṭho attho.
The dharma of wisdom means the meaning in the sense of understanding.
Pháp ñāṇa có nghĩa là biết.
Vijjādhammo paṭivedhaṭṭho attho.
The dharma of true knowledge means the meaning in the sense of penetration.
Pháp paññā có nghĩa là hiểu biết.
Āloko dhammo obhāsaṭṭho attho’’ti (paṭi. ma. 2.39).
The dharma of light means the meaning in the sense of illumination" (Paṭi. Ma. 2.39).
Pháp vijjā có nghĩa là xuyên thấu.
Ettakehi padehi kiṃ kathitanti?
What is explained by these terms?
Pháp āloko có nghĩa là chiếu sáng."
Imasmiṃ sati idaṃ hotīti paccayasañjānanamattaṃ kathitaṃ.
Only the mere understanding of conditionality, that "When this exists, that comes to be," is explained.
Với những từ này, điều gì đã được nói đến?
Athavā vīthipaṭipannā taruṇavipassanā kathitāti.
Or, it refers to nascent vipassanā that has entered the path.
Chỉ là sự nhận biết về nhân duyên: "Khi cái này có, thì cái kia có." Hoặc là, thiền quán sơ khởi đã đi vào con đường (vīthi) đã được nói đến.
202
61. Adhigato kho myāyanti adhigato kho me ayaṃ.
Adhigato kho myāyaṃ means "this has been attained by me."
61. Adhigato kho myāyaṃti: quả thật, cái này đã được tôi chứng đắc.
Maggoti vipassanāmaggo.
Maggo means the path of vipassanā.
Maggoti: con đường thiền quán (vipassanāmagga).
Bodhāyāti catusaccabujjhanatthāya, nibbānabujjhanatthāya eva vā.
Bodhāya means "for the sake of understanding the Four Noble Truths," or "for the sake of understanding Nibbāna."
Bodhāyāti: để giác ngộ Tứ Thánh Đế, hoặc để giác ngộ Nibbāna.
Api ca bujjhatīti bodhi, ariyamaggassetaṃ nāmaṃ, tadatthāyātipi vuttaṃ hoti.
Moreover, that which understands is bodhi. This is a name for the Noble Path (ariyamagga); thus, it is also said to be "for the sake of that (Noble Path)."
Hơn nữa, cái gì giác ngộ thì gọi là bodhi (giác ngộ), đó là tên của Bát Chánh Đạo, cũng có nghĩa là vì mục đích đó.
Vipassanāmaggamūlako hi ariyamaggoti.
For the Noble Path has its root in the path of vipassanā.
Bởi vì Bát Chánh Đạo có gốc rễ từ con đường thiền quán.
Idāni taṃ maggaṃ niyyātento – ‘‘yadidaṃ nāmarūpanirodhātiādimāha.
Now, in order to show that path, it is said – " Yadidaṃ nāmarūpanirodhā" and so on.
Bây giờ, để trình bày con đường đó, Ngài nói: "yadidaṃ nāmarūpanirodhā" (đó là sự diệt của danh sắc), v.v.
Ettha ca viññāṇanirodhotiādīhi paccattapadehi nibbānameva kathitaṃ.
And here, through terms in the nominative case such as " viññāṇanirodho," Nibbāna itself is explained.
Ở đây, các từ ngữ riêng biệt như viññāṇanirodho (sự diệt của thức), v.v., chỉ nói về Nibbāna.
Iti mahāpuriso sakalassa vaṭṭadukkhassa anibbattinirodhaṃ addasa.
Thus, the Great Being saw the cessation (non-arising) of the entire suffering of saṃsāra.
Như vậy, Đại nhân đã thấy sự diệt trừ, không tái sinh của toàn bộ khổ đau trong vòng luân hồi.
203
62. Nirodho nirodhoti khoti anibbatti anibbattiti kho.
Nirodho nirodhoti kho means "cessation, cessation indeed," or "non-arising, non-arising indeed."
62. Nirodho nirodhoti khoti: quả thật, sự không tái sinh, sự không tái sinh.
Cakkhuntiādīni vuttatthāneva.
Cakkhuṃ and so on have the same meaning as stated before.
Các từ như cakkhuṃ (mắt), v.v., đã được giải thích ý nghĩa.
Idha pana sabbeheva etehi padehi – ‘‘imasmiṃ asati idaṃ na hotī’’ti nirodhasañjānanamattameva kathitaṃ, athavā vuṭṭhānagāminī balavavipassanā kathitāti.
Here, however, by all these terms, only the mere understanding of cessation, that "When this does not exist, that does not come to be," is explained. Alternatively, it refers to strong vipassanā leading to emergence (from saṃsāra).
Ở đây, tất cả những từ này chỉ nói về sự nhận biết về sự diệt trừ: "Khi cái này không có, thì cái kia không có," hoặc là, thiền quán mạnh mẽ dẫn đến sự xuất ly (vuṭṭhānagāminī vipassanā) đã được nói đến.
204
63. Aparena samayenāti evaṃ paccayañca paccayanirodhañca viditvā tato aparabhāge.
Aparena samayenā means "afterward," having thus known the condition and the cessation of the condition.
63. Aparena samayenāti: sau đó, sau khi đã biết về nhân duyên và sự diệt trừ nhân duyên.
Upādānakkhandhesūti upādānassa paccayabhūtesu khandhesu.
Upādānakkhandhesu means "in the aggregates that are conditions for clinging."
Upādānakkhandhesūti: trong các uẩn là nhân duyên của chấp thủ.
Udayabbayānupassīti tameva paṭhamaṃ diṭṭhaṃ udayañca vayañca anupassamāno.
Udayabbayānupassī means "constantly contemplating that same rise and fall which was first seen."
Udayabbayānupassīti: liên tục quán sát sự sinh và diệt mà Ngài đã thấy trước đó.
Vihāsīti sikhāpattaṃ vuṭṭhānagāminivipassanaṃ vahanto vihari.
Vihāsī means "he dwelt, carrying the consummate vipassanā that leads to emergence."
Vihāsīti: Ngài đã an trú, thực hành thiền quán xuất ly đã đạt đến đỉnh cao.
Idaṃ kasmā vuttaṃ?
Why was this said?
Tại sao điều này được nói đến?
Sabbeyeva hi pūritapāramino bodhisattā pacchimabhave puttassa jātadivase mahābhinikkhamanaṃ nikkhamitvā pabbajitvā padhānamanuyuñjitvā bodhipallaṅkamāruyha mārabalaṃ vidhamitvā paṭhamayāme pubbenivāsaṃ anussaranti, dutiyayāme dibbacakkhuṃ visodhenti, tatiyayāme paccayākāraṃ sammasitvā ānāpānacatutthajjhānato uṭṭhāya pañcasu khandhesu abhinivisitvā udayabbayavasena samapaññāsa lakkhaṇāni disvā yāva gotrabhuñāṇā vipassanaṃ vaḍḍhetvā ariyamaggena sakale buddhaguṇe paṭivijjhanti.
For all Bodhisattas who have fulfilled their Pāramīs, in their last existence, on the day of their son's birth, they go forth in the Great Renunciation, renounce the world, diligently engage in exertion (Padhāna), ascend the Bodhi-pallaṅka, overcome the forces of Māra, recollect past existences in the first watch of the night, purify the divine eye in the second watch, contemplate the dependent origination in the third watch, rise from the fourth jhāna of Anāpāna, focus on the five aggregates, perceive the fifty precise characteristics in terms of rise and fall, develop vipassanā up to Gotrabhū-ñāṇa, and penetrate all the Buddha's qualities through the Noble Path.
Quả vậy, tất cả các vị Bồ Tát đã viên mãn Ba-la-mật, trong kiếp cuối cùng, vào ngày sinh của con trai mình, đều thực hiện Đại Xả Ly, xuất gia, tinh tấn tu tập, rồi lên Bồ đề tòa, đánh tan quân Ma vương; trong canh đầu, các ngài hồi tưởng các đời quá khứ; trong canh giữa, các ngài làm cho Thiên nhãn thanh tịnh; trong canh cuối, các ngài quán xét Duyên khởi, xuất khỏi Tứ thiền Anapanasati, an trú vào năm uẩn, thấy năm mươi tướng sinh diệt theo cách sinh diệt, tăng trưởng Vipassanā cho đến Gotrabhu-ñāṇa, và bằng Thánh đạo, các ngài thấu triệt tất cả Phật đức.
Ayampi mahāpuriso pūritapāramī.
This Great Man (Mahāpurisa) also had fulfilled Pāramīs.
Vị Đại nhân này cũng là người đã viên mãn Ba-la-mật.
So yathāvuttaṃ sabbaṃ anukkamaṃ katvā pacchimayāme ānāpānacatutthajjhānato uṭṭhāya pañcasu khandhesu abhinivisitvā vuttappakāraṃ udayabbayavipassanaṃ ārabhi.
Having completed all the aforementioned sequence, in the last watch of the night, he rose from the fourth jhāna of Anāpāna, focused on the five aggregates, and commenced the vipassanā of rise and fall (udayabbaya) as described.
Ngài đã thực hiện tất cả trình tự như đã nói, và trong canh cuối, xuất khỏi Tứ thiền Anapanasati, an trú vào năm uẩn, bắt đầu tu tập Vipassanā sinh diệt như đã đề cập.
Taṃ dassetuṃ idaṃ vuttaṃ.
This statement was made to illustrate that.
Để chỉ rõ điều đó, câu này đã được nói.
205
Tattha iti rūpanti idaṃ rūpaṃ, ettakaṃ rūpaṃ, ito uddhaṃ rūpaṃ natthīti ruppanasabhāvañceva bhūtupādāyabhedañca ādiṃ katvā lakkhaṇarasapaccupaṭṭhānapadaṭṭhānavasena anavasesarūpapariggaho vutto.
Therein, "Such is rūpa" (iti rūpaṃ) means that the entire rūpa is spoken of, beginning with its characteristic of being afflicted (ruppana-sabhāva) and its division into primary elements and derived matter, and also in terms of its characteristics, functions, manifestations, and proximate causes, indicating that this is rūpa, rūpa to this extent, and beyond this there is no rūpa.
Trong đó, "iti rūpaṃ" (rūpa là như vậy) là sự bao hàm toàn bộ sắc (rūpa), bắt đầu từ bản chất biến hoại (ruppana-sabhāva) và sự phân loại thành đại chủng (bhūta) và sắc y sinh (upādāya-rūpa), theo đặc tính, chức năng, biểu hiện và nguyên nhân trực tiếp, nghĩa là: đây là sắc, sắc chỉ có chừng này, không có sắc nào khác ngoài cái này.
Iti rūpassa samudayoti iminā evaṃ pariggahitassa rūpassa samudayadassanaṃ vuttaṃ.
"Such is the origin of rūpa" (iti rūpassa samudayo)—by this, the showing of the origin of rūpa, thus encompassed, is stated.
"Iti rūpassa samudayo" (sự tập khởi của sắc là như vậy) là sự chỉ rõ sự tập khởi của sắc đã được bao hàm như vậy.
Tattha itīti evaṃ samudayo hotīti attho.
Therein, "Such" (iti) means that the origin occurs in this way.
Trong đó, "iti" có nghĩa là sự tập khởi xảy ra như vậy.
Tassa vitthāro – ‘‘avijjāsamudayā rūpasamudayo, taṇhāsamudayā rūpasamudayo, kammasamudayā rūpasamudayo, āhārasamudayā rūpasamudayoti, nibbattilakkhaṇaṃ passantopi rūpakkhandhassa udayaṃ passatī’’ti evaṃ veditabbo.
Its detailed explanation should be understood as: "With the origin of ignorance comes the origin of rūpa; with the origin of craving comes the origin of rūpa; with the origin of kamma comes the origin of rūpa; with the origin of nutriment comes the origin of rūpa. One who sees the characteristic of production (nibbattilakkhaṇa) also sees the origin of the rūpa-aggregate."
Sự giải thích rộng hơn về điều đó cần được hiểu như sau: "Do vô minh tập khởi nên sắc tập khởi, do ái tập khởi nên sắc tập khởi, do nghiệp tập khởi nên sắc tập khởi, do vật thực tập khởi nên sắc tập khởi; người thấy tướng sinh khởi cũng thấy sự tập khởi của sắc uẩn."
Atthaṅgamepi ‘‘avijjānirodhā rūpanirodho…pe… vipariṇāmalakkhaṇaṃ passantopi rūpakkhandhassa nirodhaṃ passatī’’ti (paṭi. ma. 1.50) ayamassa vitthāro.
Regarding cessation, its detailed explanation is: "With the cessation of ignorance comes the cessation of rūpa... One who sees the characteristic of change (vipariṇāma-lakkhaṇa) also sees the cessation of the rūpa-aggregate."
Về sự diệt tận cũng vậy, "Do vô minh diệt nên sắc diệt... (v.v.)... người thấy tướng biến hoại cũng thấy sự diệt tận của sắc uẩn" – đây là sự giải thích rộng hơn về điều đó.
206
Iti vedanātiādīsupi ayaṃ vedanā, ettakā vedanā, ito uddhaṃ vedanā natthi.
Likewise, in "Such is vedanā" (iti vedanā) and so on, it means: "This is vedanā, vedanā to this extent, and beyond this there is no vedanā.
Trong "iti vedanā" (thọ là như vậy) và các câu tương tự cũng vậy: đây là thọ, thọ chỉ có chừng này, không có thọ nào khác ngoài cái này.
Ayaṃ saññā, ime saṅkhārā, idaṃ viññāṇaṃ, ettakaṃ viññāṇaṃ, ito uddhaṃ viññāṇaṃ natthīti vedayitasañjānanaabhisaṅkharaṇavijānanasabhāvañceva sukhādirūpasaññādi phassādi cakkhuviññāṇādi bhedañca ādiṃ katvā lakkhaṇarasapaccupaṭṭhānapadaṭṭhānavasena anavasesavedanāsaññāsaṅkhāraviññāṇapariggaho vutto.
This is saññā, these are saṅkhārā, this is viññāṇa, viññāṇa to this extent, and beyond this there is no viññāṇa." This states the comprehension of all vedanā, saññā, saṅkhārā, and viññāṇa, based on their nature of feeling, perceiving, volitional forming, and cognizing, as well as their divisions into pleasantness, visual perception, contact, eye-consciousness, and so forth, in terms of their characteristics, functions, manifestations, and proximate causes.
Đây là tưởng, đây là các hành, đây là thức, thức chỉ có chừng này, không có thức nào khác ngoài cái này – là sự bao hàm toàn bộ thọ, tưởng, hành, thức, bắt đầu từ bản chất cảm nhận (vedayita), ghi nhận (sañjānana), tạo tác (abhisaṅkharaṇa), nhận biết (vijānana), và sự phân loại thành thọ lạc, v.v., tưởng sắc, v.v., xúc, v.v., nhãn thức, v.v., theo đặc tính, chức năng, biểu hiện và nguyên nhân trực tiếp.
Iti vedanāya samudayotiādīhi pana evaṃ pariggahitānaṃ vedanāsaññāsaṅkhāraviññāṇānaṃ samudayadassanaṃ vuttaṃ.
By "Such is the origin of vedanā" (iti vedanāya samudayo) and so on, the showing of the origin of vedanā, saññā, saṅkhārā, and viññāṇa, thus encompassed, is stated.
Còn với "iti vedanāya samudayo" (sự tập khởi của thọ là như vậy) và các câu tương tự, là sự chỉ rõ sự tập khởi của thọ, tưởng, hành, thức đã được bao hàm như vậy.
Tatrāpi itīti evaṃ samudayo hotīti attho.
Here too, "Such" (iti) means that the origin occurs in this way.
Trong đó, "iti" cũng có nghĩa là sự tập khởi xảy ra như vậy.
Tesampi vitthāro – ‘‘avijjāsamudayā vedanāsamudayo’’ti (paṭi. ma. 1.50) rūpe vuttanayeneva veditabbo.
Their detailed explanation should also be understood in the same way as stated for rūpa: "With the origin of ignorance comes the origin of vedanā."
Sự giải thích rộng hơn về chúng cũng cần được hiểu theo cách đã nói về sắc: "Do vô minh tập khởi nên thọ tập khởi."
Ayaṃ pana viseso – tīsu khandhesu ‘‘āhārasamudayā’’ti avatvā ‘‘phassasamudayā’’ti vattabbaṃ.
However, this is the distinction: in the three aggregates (vedanā, saññā, saṅkhārā), instead of saying "with the origin of nutriment," it should be said, "with the origin of contact."
Tuy nhiên, có một điểm khác biệt: đối với ba uẩn (thọ, tưởng, hành) thì không nói "do vật thực tập khởi" mà phải nói "do xúc tập khởi".
Viññāṇakkhandhe ‘‘nāmarūpasamudayā’’ti atthaṅgamapadampi tesaṃyeva vasena yojetabbaṃ.
In the viññāṇa-aggregate, "with the origin of nāmarūpa" should be said, and the cessation clause (atthaṅgama-pada) should also be applied according to these terms.
Đối với thức uẩn, phải nói "do danh sắc tập khởi". Từ về sự diệt tận cũng phải được kết hợp theo cách của chúng.
Ayamettha saṅkhepo, vitthāro pana udayabbayavinicchayo sabbākāraparipūro visuddhimagge vutto.
This is the concise explanation here, but the full and complete determination of rise and fall (udayabbaya-vinicchaya) is stated in the Visuddhimagga.
Đây là phần tóm tắt ở đây, còn sự phân tích chi tiết về sinh diệt (udayabbayavinicchaya) đầy đủ mọi phương diện đã được trình bày trong Thanh Tịnh Đạo (Visuddhimagga).
Tassa pañcasu upādānakkhandhesu udayabbayānupassino viharatoti tassa vipassissa bodhisattassa imesu rūpādīsu pañcasu upādānakkhandhesu samapaññāsalakkhaṇavasena udayabbayānupassino viharato yathānukkamena vaḍḍhite vipassanāñāṇe anuppādanirodhena nirujjhamānehi āsavasaṅkhātehi kilesehi anupādāya aggahetvāva cittaṃ vimuccati, tadetaṃ maggakkhaṇe vimuccati nāma, phalakkhaṇe vimuttaṃ nāma; maggakkhaṇe vā vimuttañceva vimuccati ca, phalakkhaṇe vimuttameva.
"While he, the vipassī, the Bodhisatta, dwelt contemplating the rise and fall in these five aggregates of clinging (upādānakkhandha) beginning with rūpa," the Vipassanā-ñāṇa, having gradually matured, his mind was liberated, without clinging, from the defilements, called āsavas, which ceased by non-production and cessation. This is called 'being liberated' at the moment of the path (magga-kṣaṇa), and 'having been liberated' at the moment of the fruit (phala-kṣaṇa); or, at the moment of the path, it is both liberated and being liberated, and at the moment of the fruit, it is only liberated.
"Tassa pañcasu upādānakkhandhesu udayabbayānupassino viharato" (khi vị hành giả ấy an trú quán chiếu sự sinh diệt trong năm uẩn chấp thủ) có nghĩa là: khi vị Bồ Tát hành giả ấy an trú quán chiếu sự sinh diệt trong năm uẩn chấp thủ như sắc, v.v., theo năm mươi tướng chính xác của sinh diệt, thì khi tuệ quán tăng trưởng theo thứ tự, tâm được giải thoát khỏi các phiền não gọi là lậu hoặc (āsava) đang diệt tận bằng sự diệt không tái sinh, không còn chấp thủ (anupādāya) dù chỉ một chút phiền não; điều này được gọi là tâm được giải thoát (vimuccati) vào khoảnh khắc Đạo (magga-kkhana), và được gọi là tâm đã giải thoát (vimuttaṃ) vào khoảnh khắc Quả (phala-kkhana); hoặc vào khoảnh khắc Đạo, tâm vừa đã giải thoát vừa đang giải thoát, còn vào khoảnh khắc Quả, tâm chỉ là đã giải thoát.
207
Ettāvatā ca mahāpuriso sabbabandhanā vippamutto sūriyarasmisamphuṭṭhamiva padumaṃ suvikasitacittasantāno cattāri maggañāṇāni, cattāri phalañāṇāni, catasso paṭisambhidā, catuyoniparicchedakañāṇaṃ, pañcagatiparicchedakañāṇaṃ, cha asādhāraṇañāṇāni, sakale ca buddhaguṇe hatthagate katvā paripuṇṇasaṅkappo bodhipallaṅke nisinnova –
At this point, the Great Man, entirely freed from all bonds, with a mind as fully blossomed as a lotus touched by the sun's rays, having mastered the four path-knowledges, the four fruit-knowledges, the four analytical knowledges (paṭisambhidā), the knowledge of discerning the four origins, the knowledge of discerning the five destinies, the six unique knowledges, and all the qualities of a Buddha, with his aspirations fulfilled, seated on the Bodhi-pallaṅka, reflected thus:
Cho đến đây, vị Đại nhân đã hoàn toàn thoát khỏi mọi ràng buộc, tâm thức của ngài đã nở rộ như hoa sen được ánh mặt trời chiếu rọi, ngài đã nắm giữ trong tay bốn Đạo trí, bốn Quả trí, bốn Phân tích trí (paṭisambhidā), trí phân biệt bốn loại sinh, trí phân biệt năm cõi tái sinh, sáu trí phi thường, và tất cả Phật đức, với tâm nguyện viên mãn, ngài an tọa trên Bồ đề tòa và nói:
208
‘‘Anekajātisaṃsāraṃ, sandhāvissaṃ anibbisaṃ;
“Through many births I wandered in saṃsāra, seeking, but not finding,
“Ta đã lang thang không biết bao nhiêu kiếp sống trong luân hồi,
209
Gahakāraṃ gavesanto, dukkhā jāti punappunaṃ.
The builder of this house; painful is repeated birth.”
Tìm kiếm người thợ làm nhà, sự tái sinh khổ đau lặp đi lặp lại.
210
Gahakāraka diṭṭhosi, puna gehaṃ na kāhasi;
“House-builder, you are seen! You shall not build a house again!
Hỡi người thợ làm nhà, ngươi đã bị ta thấy rõ, ngươi sẽ không làm nhà nữa;
211
Sabbā te phāsukā bhaggā, gahakūṭaṃ visaṅkhataṃ;
All your rafters are broken, the ridge-pole dismantled.
Tất cả kèo cột của ngươi đã bị bẻ gãy, nóc nhà đã bị phá hủy;
212
Visaṅkhāragataṃ cittaṃ, taṇhānaṃ khayamajjhagā’’ti.(dha. pa. 153, 154);
My mind, unconditioned, has attained the end of craving.”
Tâm đã đạt đến trạng thái không còn tạo tác, đã đạt đến sự diệt tận của ái dục.”
213
‘‘Ayoghanahatasseva, jalato jātavedaso;
“Just as the path of a blazing fire,
“Như ngọn lửa đang cháy,
214
Anupubbūpasantassa, yathā na ñāyate gati.
struck by a blacksmith’s hammer, gradually extinguishes and is not known,
Khi dần dần tắt đi, không ai biết nó đi đâu;
215
Evaṃ sammāvimuttānaṃ, kāmabandhoghatārinaṃ;
So, for those perfectly liberated, who have crossed the flood of sensual desires,
Cũng vậy, những ai đã hoàn toàn giải thoát,
216
Paññāpetuṃ gati natthi, pattānaṃ acalaṃ sukha’’nti.(udā. 80);
There is no designating of their destiny, for they have attained the unshakeable bliss.”
Đã vượt qua dòng lũ dục vọng, đã đạt đến an lạc bất động, không thể nói được nơi đến của họ.”
217
Evaṃ manasi karonto sarade sūriyo viya, puṇṇacando viya ca virocitthāti.
Thus reflecting, he shone forth like the sun in autumn and like the full moon.
Khi Đức Phật quán tưởng như vậy, Ngài đã tỏa sáng như mặt trời vào mùa thu, và như vầng trăng tròn.
218
Dutiyabhāṇavāravaṇṇanā niṭṭhitā.
The description of the Second Recitation Section is concluded.
Phần giải thích về bhāṇavāra thứ hai đã kết thúc.
219
Brahmayācanakathāvaṇṇanā
Description of the Story of Brahmā’s Request
Phần giải thích về câu chuyện Phạm thiên thỉnh cầu
220
64. Tatiyabhāṇavāre yaṃnūnāhaṃ dhammaṃ deseyyanti yadi panāhaṃ dhammaṃ deseyyaṃ.
In the Third Recitation Section, "Yaṃ nūnāhaṃ dhammaṃ deseyyaṃ" means "If I were to teach the Dhamma."
64. Trong bhāṇavāra thứ ba, "yaṃ nūnāhaṃ dhammaṃ deseyyaṃ" (tốt hơn hết là ta nên thuyết pháp).
Ayaṃ pana vitakko kadā uppannoti?
But when did this thought arise?
Vậy ý nghĩ này phát sinh khi nào?
Buddhabhūtassa aṭṭhame sattāhe.
In the eighth week after becoming a Buddha.
Vào tuần thứ tám sau khi thành Phật.
So kira buddho hutvā sattāhaṃ bodhipallaṅke nisīdi, sattāhaṃ bodhipallaṅkaṃ olokento aṭṭhāsi, sattāhaṃ ratanacaṅkame caṅkami, sattāhaṃ ratanagabbhe dhammaṃ vicinanto nisīdi, sattāhaṃ ajapālanigrodhe nisīdi, sattāhaṃ mucalinde nisīdi, sattāhaṃ rājāyatane nisīdi.
Indeed, having become a Buddha, he sat for one week at the Bodhi-pallaṅka, stood for one week gazing at the Bodhi-pallaṅka, walked for one week on the Jewel Promenade, sat for one week contemplating the Dhamma in the Jewel House, sat for one week under the Ajapāla Nigrodha tree, sat for one week under the Mucalinda tree, and sat for one week under the Rājāyatana tree.
Đức Phật đã ngồi trên Bồ đề tòa bảy ngày, đứng nhìn Bồ đề tòa bảy ngày, đi kinh hành trên đài kinh hành quý báu bảy ngày, ngồi suy tư về Pháp trong Bảo cung bảy ngày, ngồi dưới cây Ajapāla Nigrodha bảy ngày, ngồi dưới cây Mucalinda bảy ngày, ngồi dưới cây Rājāyatana bảy ngày.
Tato uṭṭhāya aṭṭhame sattāhe puna āgantvā ajapālanigrodhe nisinnamattasseva sabbabuddhānaṃ āciṇṇasamāciṇṇo ayañceva ito anantaro ca vitakko uppannoti.
Then, having arisen from there, and having come again in the eighth week, as soon as he sat under the Ajapāla Nigrodha tree, this thought of teaching the Dhamma, which is a customary practice of all Buddhas, arose, and immediately after it, the thought of not teaching the Dhamma also arose.
Sau đó, vào tuần thứ tám, khi vừa đến và ngồi dưới cây Ajapāla Nigrodha, ý nghĩ này và ý nghĩ tiếp theo (về việc không thuyết pháp) đã phát sinh, theo truyền thống của tất cả các Đức Phật.
221
Tattha adhigatoti paṭividdho.
Therein, "adhigato" means penetrated.
Trong đó, "adhigato" (đã chứng đắc) có nghĩa là đã thấu triệt.
Dhammoti catusaccadhammo.
"dhammo" refers to the Dhamma of the Four Noble Truths.
"Dhammo" (Pháp) là Tứ Thánh Đế.
Gambhīroti uttānabhāvapaṭikkhepavacanametaṃ.
"Gambhīro" is a word that rejects shallowness.
"Gambhīro" (sâu xa) là từ phủ nhận tính nông cạn.
Duddasoti gambhīrattāva duddaso dukkhena daṭṭhabbo, na sakkā sukhena daṭṭhuṃ.
"Duddaso" means difficult to see precisely because it is profound; it cannot be seen easily.
"Duddaso" (khó thấy) là khó thấy vì sâu xa, không thể dễ dàng thấy được.
Duddasattāva duranubodho dukkhena avabujjhitabbo, na sakkā sukhena avabujjhituṃ.
Precisely because it is difficult to see, it is "duranubodho", difficult to comprehend; it cannot be comprehended easily.
Chính vì khó thấy nên "duranubodho" (khó thấu hiểu), khó thấu hiểu, không thể dễ dàng thấu hiểu được.
Santoti nibbuto.
"Santo" means peaceful (nibbuto).
"Santo" (an tịnh) có nghĩa là tịch diệt.
Paṇītoti atappako.
"Paṇīto" means unsurpassed (atappako).
"Paṇīto" (thù thắng) có nghĩa là không làm thỏa mãn.
Idaṃ dvayaṃ lokuttarameva sandhāya vuttaṃ.
These two terms are spoken with reference to the supramundane (lokuttara) alone.
Hai từ này được nói chỉ để chỉ đến Pháp siêu thế.
Atakkāvacaroti takkena avacaritabbo ogāhitabbo na hoti, ñāṇeneva avacaritabbo.
"Atakkāvacaro" means not to be traversed or penetrated by mere reasoning, but to be penetrated by knowledge alone.
"Atakkāvacaro" (không thể đạt đến bằng suy luận) có nghĩa là không thể đi vào hay thâm nhập bằng suy luận, mà chỉ có thể đi vào bằng trí tuệ.
Nipuṇoti saṇho.
"Nipuṇo" means subtle (saṇho).
"Nipuṇo" (vi tế) có nghĩa là tinh tế.
Paṇḍitavedanīyoti sammāpaṭipadaṃ paṭipannehi paṇḍitehi veditabbo.
"Paṇḍitavedanīyo" means to be known by the wise (paṇḍita) who practice the right path (sammā-paṭipadā).
"Paṇḍitavedanīyo" (chỉ người trí mới có thể hiểu) có nghĩa là chỉ những người trí đã thực hành đúng đắn mới có thể hiểu được.
Ālayarāmāti sattā pañcasu kāmaguṇesu allīyanti, tasmā te ālayāti vuccanti.
"Ālayarāmā" means that beings cling to the five strands of sensual pleasure, therefore they are called "ālayā" (clinging-places).
"Ālayarāmā" (thích thú nơi trú ẩn) có nghĩa là chúng sinh bám víu vào năm dục lạc, vì vậy chúng được gọi là ālayā (nơi trú ẩn).
Aṭṭhasatataṇhāvicaritāni ālayanti, tasmā ālayāti vuccanti.
The 108 modes of craving (taṇhāvicaritāni) also cling, therefore they are called "ālayā."
Một trăm lẻ tám loại ái dục (taṇhāvicārita) bám víu vào, vì vậy chúng được gọi là ālayā.
Tehi ālayehi ramantīti ālayarāmā. Ālayesu ratāti ālayaratā. Ālayesu suṭṭhu muditāti ālayasammuditā. Yatheva hi susajjitaṃ pupphaphalabharitarukkhādisampannaṃ uyyānaṃ paviṭṭho rājā tāya tāya sampattiyā ramati, pamudito āmodito hoti, na ukkaṇṭhati, sāyaṃ nikkhamituṃ na icchati, evamimehipi kāmālayataṇhālayehi sattā ramanti, saṃsāravaṭṭe pamuditā anukkaṇṭhitā vasanti.
They delight in those attachments, thus they are ālayarāmā (delighting in attachments). They are attached to attachments, thus they are ālayaratā (attached to attachments). They are exceedingly joyful in attachments, thus they are ālayasammuditā (exceedingly joyful in attachments). Just as a king, having entered a well-prepared garden abundant with trees laden with flowers and fruits, delights in those various felicities, is joyful and exceedingly pleased, does not grow weary, and does not wish to leave in the evening; in the same way, beings delight in these attachments of sense pleasures and attachments of craving, and they dwell in the cycle of transmigration, joyful and not weary.
Vì chúng thích thú với những sự bám víu ấy, nên gọi là ālayarāmā (thích thú sự bám víu). Vì chúng vui thích trong những sự bám víu, nên gọi là ālayaratā (vui thích sự bám víu). Vì chúng cực kỳ hoan hỷ trong những sự bám víu, nên gọi là ālayasammuditā (cực kỳ hoan hỷ sự bám víu). Thật vậy, giống như một vị vua khi vào một khu vườn được trang hoàng lộng lẫy, đầy cây cối trĩu hoa kết trái, thì vui thích với mọi sự sung túc ấy, trở nên hoan hỷ và hân hoan, không hề chán nản, và không muốn ra về vào buổi chiều; cũng vậy, các chúng sinh này vui thích với những sự bám víu dục lạc và sự bám víu tham ái, sống trong vòng luân hồi với niềm hoan hỷ và không hề chán nản.
Tena nesaṃ bhagavā duvidhampi ālayaṃ uyyānabhūmiṃ viya dassento – ‘‘ālayarāmā’’tiādimāha.
Therefore, the Blessed One, showing these two kinds of attachment as if they were a pleasure garden for those beings, said, "delighting in attachments," and so on.
Vì thế, Thế Tôn đã nói: “ālayarāmā” và các từ khác, để chỉ ra hai loại bám víu này như một khu vườn cho chúng sinh.
222
Yadidanti nipāto, tassa ṭhānaṃ sandhāya – ‘‘yaṃ ida’’nti, paṭiccasamuppādaṃ sandhāya – ‘‘yo aya’’nti evamattho daṭṭhabbo.
The word yadidaṃ is a particle; with reference to its position, it means "that which is this"; with reference to paṭiccasamuppāda, it means "this which is that" – such is the meaning to be understood.
Yadidaṃ là một từ bất biến, liên quan đến vị trí của nó, có nghĩa là “cái này”. Liên quan đến duyên khởi (paṭiccasamuppāda), nó có nghĩa là “cái đó”.
Idappaccayatāpaṭiccasamuppādoti imesaṃ paccayā idappaccayā, idappaccayā eva idappaccayatā, idappaccayatā ca sā paṭiccasamuppādo cāti idappaccayatāpaṭiccasamuppādo.
Idappaccayatāpaṭiccasamuppādo means "conditions are these conditions for these results (such as saṅkhāras), these very conditions are idappaccayatā, and that idappaccayatā is also paṭiccasamuppāda," thus it is Idappaccayatāpaṭiccasamuppāda (dependent origination with specific conditions).
Idappaccayatāpaṭiccasamuppādo là duyên khởi có duyên này làm điều kiện (idappaccayatāpaṭiccasamuppāda). Các duyên này là các duyên của những điều kiện ấy (imesaṃ paccayā idappaccayā); chỉ những duyên này là idappaccayatā; và đó là idappaccayatā, đồng thời cũng là duyên khởi (paṭiccasamuppādo), nên gọi là idappaccayatāpaṭiccasamuppādo.
Saṅkhārādipaccayānaṃ avijjādīnaṃ etaṃ adhivacanaṃ.
This is a designation for avijjā and other causes of saṅkhāras and other results.
Đây là một tên gọi khác của vô minh (avijjā) và các duyên khác, là những điều kiện của các hành (saṅkhāra) và các pháp khác.
Sabbasaṅkhārasamathotiādi sabbaṃ nibbānameva.
Sabbasaṅkhārasamatho and so forth, all refer to Nibbāna.
Sabbasaṅkhārasamatho (sự chấm dứt mọi hành) và các từ khác đều chỉ Niết Bàn.
Yasmā hi taṃ āgamma sabbasaṅkhāravipphanditāni sammanti vūpasammanti tasmā – ‘‘sabbasaṅkhārasamatho’’ti vuccati.
Because by realizing Nibbāna, all the agitations of saṅkhāras completely cease and subside, therefore it is called "the calming of all saṅkhāras."
Vì nhờ nó mà mọi sự biến động của các hành đều lắng dịu và chấm dứt, nên được gọi là “sabbasaṅkhārasamatho” (sự chấm dứt mọi hành).
Yasmā ca taṃ āgamma sabbe upadhayo paṭinissaṭṭhā honti, sabbā taṇhā khīyanti, sabbe kilesarāgā virajjanti, sabbaṃ dukkhaṃ nirujjhati, tasmā ‘‘sabbūpadhipaṭinissaggo taṇhākkhayo virāgo nirodho’’ti vuccati.
And because by realizing Nibbāna, all substrata of becoming (upadhi) are completely abandoned, all cravings (taṇhā) are exhausted, all defiling passions (kilesarāga) fade away, and all suffering (dukkha) ceases, therefore it is called "the abandoning of all substrata, the exhaustion of craving, fading away, cessation."
Và vì nhờ nó mà mọi chấp thủ (upadhi) đều được từ bỏ, mọi tham ái (taṇhā) đều được diệt trừ, mọi phiền não dục vọng (kilesarāga) đều được ly tham, mọi khổ đau đều được chấm dứt, nên được gọi là “sabbūpadhipaṭinissaggo taṇhākkhayo virāgo nirodho” (sự từ bỏ mọi chấp thủ, sự diệt trừ tham ái, sự ly tham, sự chấm dứt).
Sā panesā taṇhā bhavena bhavaṃ, phalena vā saddhiṃ kammaṃ vinati saṃsibbatīti katvā vānanti vuccati.
This craving, moreover, is called vāna (the weaver) because it weaves and stitches together one existence with another, or karma with its results.
Tham ái (taṇhā) này được gọi là vāna (sợi dệt) vì nó dệt, nó kết nối nghiệp (kamma) với quả báo (phala), từ đời này sang đời khác.
Tato vānato nikkhantanti nibbānaṃ.
That which has gone out from vāna is nibbāna.
Thoát khỏi cái vāna đó, nên gọi là Nibbāna (Niết Bàn).
So mamassa kilamathoti yā ajānantānaṃ desanā nāma, so mama kilamatho assa, sā mama vihesā assāti attho.
So mamassa kilamatho means, "that teaching to those who do not understand would be an exertion for me, it would be a vexation for me."
So mamassa kilamatho (đó sẽ là sự mệt mỏi của Ta) có nghĩa là: cái sự thuyết pháp cho những người không hiểu biết ấy sẽ là sự mệt mỏi của Ta, sẽ là sự phiền toái của Ta.
Kāyakilamatho ceva kāyavihesā ca assāti vuttaṃ hoti, citte pana ubhayampetaṃ buddhānaṃ natthi.
It is said that it would be a bodily exertion and a bodily vexation, but for the Buddhas, neither of these exists in their minds.
Điều đó có nghĩa là sẽ có sự mệt mỏi về thân và sự phiền toái về thân, nhưng trong tâm của các bậc giác ngộ thì cả hai điều này đều không tồn tại.
223
65. Apissūti anubrūhanatthe nipāto.
65. Apissu is a particle used in the sense of further amplification.
65. Apissu là một từ bất biến dùng để tăng cường ý nghĩa.
So – ‘‘na kevalaṃ etadahosi, imāpi gāthā paṭibhaṃsū’’ti dīpeti.
It indicates that "not only was this thought, but these verses also occurred to him."
Nó cho thấy rằng: “Không chỉ có ý nghĩ này, mà những bài kệ này cũng hiện ra trong tâm Ta”.
Vipassintiādīsu vipassissa bhagavato arahato sammāsambuddhassāti attho.
In vipassi and so forth, the meaning is "of the Blessed One, the Arahant, the Perfectly Self-Enlightened Buddha Vipassī."
Trong các từ như Vipassī và các từ khác, có nghĩa là: của Đức Thế Tôn, bậc A-la-hán, Chánh Đẳng Giác Vipassī.
Anacchariyāti anuacchariyā.
Anacchariyā means "not un-wonderful (i.e., truly wonderful)."
Anacchariyā có nghĩa là không có gì đáng kinh ngạc.
Paṭibhaṃsūti paṭibhānasaṅkhātassa ñāṇassa gocarā ahesuṃ, parivitakkayitabbataṃ pāpuṇiṃsu.
Paṭibhaṃsū means they became objects of knowledge called insight (paṭibhāna), they reached the state of being fit for reflection.
Paṭibhaṃsū có nghĩa là chúng trở thành đối tượng của tuệ tri (ñāṇa) được gọi là sự ứng hiện (paṭibhāna), chúng đạt đến trạng thái có thể được suy tư lặp đi lặp lại.
224
Kicchenāti dukkhena, na dukkhāya paṭipadāya.
Kicchenā means with difficulty, not by a difficult path.
Kicchenā có nghĩa là bằng sự khó khăn, không phải bằng con đường hành đạo khổ hạnh.
Buddhānañhi cattāropi maggā sukhapaṭipadāva honti.
For Buddhas, all four paths are indeed paths of ease.
Thật vậy, bốn con đường (maggā) của chư Phật đều là con đường hành đạo an lạc (sukhapaṭipadā).
Pāramīpūraṇakāle pana sarāgasadosasamohasseva sato āgatāgatānaṃ yācakānaṃ alaṅkatapaṭiyattaṃ sīsaṃ chinditvā galalohitaṃ nīharitvā suañjitāni akkhīni uppāṭetvā kulavaṃsapadīpakaṃ puttaṃ manāpacāriniṃ bhariyanti evamādīni dentassa aññāni ca khantivādisadisesu attabhāvesu chejjabhejjādīni pāpuṇantassa āgamanīyapaṭipadaṃ sandhāyetaṃ vuttaṃ.
However, this was said with reference to the path leading to enlightenment (āgamanīyapaṭipadā) when, during the period of fulfilling the perfections, the Bodhisatta, still with passion, hatred, and delusion, gave away objects difficult to relinquish, such as cutting off his own decorated and prepared head, extracting blood from his throat, plucking out his well-anointed eyes, giving his son who was the light of his family line, and his pleasing wife, and also enduring cutting, breaking, and other such sufferings in his existences, similar to those of the ascetic Khantīvādī.
Tuy nhiên, điều này được nói đến khi đề cập đến con đường hành đạo mà chư Phật đã trải qua trong thời kỳ viên mãn ba-la-mật (pāramī), khi các Ngài còn là Bồ Tát với tham ái, sân hận và si mê, đã dâng hiến những thứ như cắt đầu đã được trang hoàng và chuẩn bị kỹ lưỡng, rút máu từ cổ, nhổ bỏ đôi mắt đã được kẻ viền đẹp đẽ, dâng hiến người con trai là ngọn đèn của dòng tộc, và người vợ hiền lành; và đã trải qua những sự cắt xẻ, phân chia và những điều tương tự trong các kiếp sống như của vị ẩn sĩ Khantīvādī.
Halanti ettha hakāro nipātamatto, alanti attho.
In halaṃ, the letter 'ha' is merely a particle; the meaning is 'alaṃ' (enough, no use).
Trong từ halaṃ, chữ “ha” chỉ là một từ bất biến, nghĩa là “đủ rồi”.
Pakāsitunti desetuṃ; evaṃ kicchena adhigatassa dhammassa alaṃ desetuṃ; ko attho desitenāti vuttaṃ hoti.
Pakāsituṃ means to teach; thus, "it is useless to teach this Dhamma, which was attained with difficulty"; what is the use of teaching, is what is said.
Pakāsituṃ có nghĩa là để thuyết giảng; như vậy, không cần thiết phải thuyết giảng Pháp đã đạt được một cách khó khăn; điều đó có nghĩa là thuyết giảng thì có ích gì?
Rāgadosaparetehīti rāgadosaphuṭṭhehi rāgadosānugatehi vā.
Rāgadosaparetehi means afflicted by passion and hatred, or followed by passion and hatred.
Rāgadosaparetehi có nghĩa là bị nhiễm bởi tham ái và sân hận, hoặc bị tham ái và sân hận chi phối.
225
Paṭisotagāminti niccādīnaṃ paṭisotaṃ aniccaṃ dukkhamanattāsubhanti evaṃ gataṃ catusaccadhammaṃ.
Paṭisotagāmiṃ refers to the Four Noble Truths, which go against the current of permanence and so on, by being impermanent, suffering, non-self, and impure.
Paṭisotagāmiṃ là Pháp Tứ Diệu Đế đã đi ngược dòng (paṭisotaṃ) của thường (nicca), lạc (sukha), ngã (attā), tịnh (subha), mà là vô thường (anicca), khổ (dukkha), vô ngã (anattā), bất tịnh (asubha).
Rāgarattāti kāmarāgena bhavarāgena diṭṭhirāgena ca rattā.
Rāgarattā means stained by sensual passion, passion for existence, and passion for wrong views.
Rāgarattā có nghĩa là bị tham ái dục lạc (kāmarāga), tham ái hữu (bhavarāga) và tham ái tà kiến (diṭṭhirāga) làm cho say đắm.
Na dakkhantīti aniccaṃ dukkhamanattā asubhanti iminā sabhāvena na passissanti, te apassante ko sakkhissati evaṃ gāhāpetuṃ?
Na dakkhanti means they will not see it with the nature of impermanence, suffering, non-self, and impurity; who will be able to make those who do not see, grasp it in this way?
Na dakkhanti có nghĩa là họ sẽ không thấy bản chất vô thường, khổ, vô ngã, bất tịnh này; ai có thể khiến những người không thấy được điều đó hiểu được?
Tamokhandhena āvuṭāti avijjārāsinā ajjhotthaṭā.
Tamokhandhena āvuṭā means overwhelmed by the mass of ignorance.
Tamokhandhena āvuṭā có nghĩa là bị che phủ bởi khối vô minh (avijjārāsi).
226
Appossukkatāyāti nirussukkabhāvena, adesetukāmatāyāti attho.
Appossukkatāya means due to being without zeal, meaning due to not wishing to teach.
Appossukkatāya có nghĩa là do không có sự cố gắng, tức là không muốn thuyết Pháp.
Kasmā panassa evaṃ cittaṃ nami?
But why did his mind incline thus?
Nhưng tại sao tâm của Ngài lại nghiêng về hướng đó?
Nanu esa – ‘‘mutto mocessāmī, tiṇṇo tāressāmi’’,
Surely he had thought, "Having been freed, I will free others; having crossed over, I will cause others to cross over."
Há chẳng phải Ngài đã nói: “Đã giải thoát, Ta sẽ giải thoát cho người khác; đã vượt qua, Ta sẽ giúp người khác vượt qua”,
227
‘‘Kiṃ me aññātavesena, dhammaṃ sacchikatenidha;
"What is the use for me, here, of realizing the Dhamma in an unknown guise?"
“Ta đã chứng đạt Pháp ở đây, nhưng với hình dạng không được biết đến, thì có ích gì cho Ta?”
228
Sabbaññutaṃ pāpuṇitvā, santāressaṃ sadevaka’’nti.
"Having attained omniscience, I will save all beings with the devas."
“Sau khi đạt được Nhất Thiết Trí, Ta sẽ cứu độ chư thiên và nhân loại.”
229
Patthanaṃ katvā pāramiyo pūretvā sabbaññutaṃ pattoti.
Having made such an aspiration and completed the perfections, he attained omniscience. Isn't that so?
Ngài đã lập lời nguyện và viên mãn các ba-la-mật, rồi đạt được Nhất Thiết Trí.
Saccametaṃ, paccavekkhaṇānubhāvena panassa evaṃ cittaṃ nami.
This is true, but his mind inclined thus due to the power of his reflection.
Điều này là sự thật, nhưng tâm của Ngài đã nghiêng về hướng đó do năng lực của sự quán xét.
Tassa hi sabbaññutaṃ patvā sattānaṃ kilesagahanataṃ dhammassa ca gambhīrataṃ paccavekkhantassa sattānaṃ kilesagahanatā ca dhammagambhīratā ca sabbākārena pākaṭā jātā.
For when he attained omniscience and reflected on the dense defilements of beings and the profundity of the Dhamma, both the density of beings' defilements and the profundity of the Dhamma became manifest in all respects.
Khi Ngài đạt được Nhất Thiết Trí và quán xét sự dày đặc của phiền não (kilesagahanatā) của chúng sinh và sự thâm sâu (gambhīratā) của Pháp, thì sự dày đặc của phiền não của chúng sinh và sự thâm sâu của Pháp đã trở nên rõ ràng dưới mọi khía cạnh.
Athassa – ‘‘ime sattā kañjikapuṇṇalābu viya takkabharitacāṭi viya vasātelapītapilotikā viya añjanamakkhitahatthā viya kilesabharitā atisaṃkiliṭṭhā rāgarattā dosaduṭṭhā mohamūḷhā, te kiṃ nāma paṭivijjhissantī’’ti cintayato kilesagahanapaccavekkhaṇānubhāvenāpi evaṃ cittaṃ nami.
Then, as he thought, "These beings are filled with defilements, exceedingly impure, stained by passion, corrupted by hatred, deluded by ignorance, like a gourd full of gruel, like a jar filled with buttermilk, like an old cloth soaked in fat and oil, like hands smeared with collyrium; what Dhamma will they penetrate?" his mind also inclined thus due to the power of reflecting on the density of defilements.
Sau đó, khi Ngài suy nghĩ: “Những chúng sinh này đầy phiền não, cực kỳ ô nhiễm, say đắm bởi tham ái, bị sân hận làm cho hư hoại, bị si mê che lấp, giống như quả bầu đầy cháo, như chum đầy rượu bã, như miếng vải cũ thấm dầu mỡ, như bàn tay dính mực kẻ mắt; vậy thì chúng có thể thấu hiểu được Pháp nào?” – do năng lực của sự quán xét sự dày đặc của phiền não, tâm của Ngài cũng đã nghiêng về hướng đó.
230
‘‘Ayañca dhammo pathavīsandhārakaudakakkhandho viya gambhīro, pabbatena paṭicchādetvā ṭhapito sāsapo viya duddaso, satadhā bhinnassa vālassa koṭiyā koṭiṃ paṭipādanaṃ viya duranubodho, nanu mayā hi imaṃ dhammaṃ paṭivijjhituṃ vāyamantena adinnaṃ dānaṃ nāma natthi, arakkhitaṃ sīlaṃ nāma natthi, aparipūritā kāci pāramī nāma natthi.
And this Dhamma is profound like the mass of water that supports the earth, difficult to see like a mustard seed hidden by a mountain, difficult to comprehend like aligning the tip of a hair split a hundred times. Indeed, striving to penetrate this Dhamma, I have given countless gifts, guarded immeasurable precepts, and perfected innumerable perfections.
“Và Pháp này thâm sâu như khối nước nâng đỡ trái đất, khó thấy như hạt cải được giấu dưới núi, khó thấu hiểu như việc đặt đầu sợi lông đã chẻ làm trăm mảnh chạm vào đầu sợi lông khác. Thật vậy, để thấu hiểu Pháp này, Ta đã không từ bỏ bất kỳ sự bố thí (dāna) nào chưa được cho, không có giới (sīla) nào chưa được giữ gìn, không có ba-la-mật nào chưa được viên mãn.
Tassa me nirussāhaṃ viya mārabalaṃ vidhamantassāpi pathavī na kampittha, paṭhamayāme pubbenivāsaṃ anussarantassāpi na kampittha, majjhimayāme dibbacakkhuṃ visodhentassāpi na kampittha, pacchimayāme pana paṭiccasamuppādaṃ paṭivijjhantasseva me dasasahassilokadhātu kampittha.
When I, with such keen wisdom, dispelled the forces of Māra as if without effort, the earth did not quake. When I recollected my past existences in the first watch of the night, it did not quake. When I purified the divine eye in the middle watch of the night, it did not quake. But in the last watch of the night, when I penetrated dependent origination, the ten-thousand-world system quaked.
Mặc dù Ta đã đánh tan quân ma (mārabala) mà không cần nỗ lực, trái đất vẫn không rung chuyển. Khi Ta nhớ lại các đời sống quá khứ (pubbenivāsa) trong canh đầu, trái đất cũng không rung chuyển. Khi Ta thanh lọc thiên nhãn (dibbacakkhu) trong canh giữa, trái đất cũng không rung chuyển. Nhưng khi Ta thấu hiểu Duyên Khởi (paṭiccasamuppāda) trong canh cuối, thì mười ngàn thế giới (dasasahassilokadhātu) đã rung chuyển.
Iti mādisenāpi tikkhañāṇena kicchenevāyaṃ dhammo paṭividdho taṃ lokiyamahājanā kathaṃ paṭivijjhissantī’’ti dhammagambhīratāpaccavekkhaṇānubhāvenāpi evaṃ cittaṃ namīti veditabbaṃ.
Thus, it should be understood that his mind also inclined thus due to the power of reflecting on the profundity of the Dhamma, thinking, "If even I, with such keen wisdom, penetrated this Dhamma with difficulty, how will the ordinary multitude of people in the world penetrate it?"
Như vậy, ngay cả một người có trí tuệ sắc bén như Ta cũng phải khó khăn lắm mới thấu hiểu Pháp này, thì làm sao đại chúng thế gian có thể thấu hiểu được?” – cần phải hiểu rằng tâm của Ngài cũng đã nghiêng về hướng đó do năng lực của sự quán xét sự thâm sâu của Pháp.
231
Apica brahmunā yācite desetukāmatāyapissa evaṃ cittaṃ nami.
Furthermore, his mind inclined thus also out of a desire to teach, being implored by Brahmā.
Hơn nữa, tâm của Ngài cũng đã nghiêng về hướng muốn thuyết Pháp khi Phạm Thiên thỉnh cầu.
Jānāti hi bhagavā – ‘‘mama appossukkatāya citte namamāne maṃ mahābrahmā dhammadesanaṃ yācissati, ime ca sattā brahmagarukā, te ‘satthā kira dhammaṃ na desetukāmo ahosi, atha naṃ mahābrahmā yācitvā desāpesi, santo vata bho dhammo, paṇīto vata bho dhammo’ti maññamānā sussūsissantī’’ti.
For the Blessed One knew: "When my mind inclines towards being disinclined to teach, Mahābrahmā will implore me to teach the Dhamma, and these beings revere Brahmā. Thinking, 'Indeed, the Teacher was not willing to teach the Dhamma, but Mahābrahmā implored him and made him teach; truly, this Dhamma is peaceful, truly, this Dhamma is sublime!', they will listen respectfully."
Thật vậy, Đức Thế Tôn biết rằng: “Khi tâm Ta nghiêng về việc không muốn thuyết Pháp, Đại Phạm Thiên sẽ thỉnh cầu Ta thuyết Pháp. Và những chúng sinh này kính trọng Phạm Thiên. Chúng sẽ nghĩ: ‘Đức Đạo Sư dường như không muốn thuyết Pháp, nhưng Đại Phạm Thiên đã thỉnh cầu và khiến Ngài thuyết. Ôi, thật an tịnh thay Pháp này! Ôi, thật vi diệu thay Pháp này!’ – và chúng sẽ lắng nghe một cách cung kính.”
Imampissa kāraṇaṃ paṭicca appossukkatāya cittaṃ nami, no dhammadesanāyāti veditabbaṃ.
It should be understood that his mind inclined towards disinclination due to this reason as well, not truly towards not teaching the Dhamma.
Cần phải hiểu rằng tâm của Ngài nghiêng về việc không muốn thuyết Pháp cũng vì lý do này, chứ không phải vì không muốn thuyết Pháp.
232
66. Aññatarassāti ettha kiñcāpi ‘‘aññataro’’ti vuttaṃ, atha kho imasmiṃ cakkavāḷe jeṭṭhakamahābrahmā esoti veditabbo.
66. In aññatarassa, although it is said "one of them" (aññataro), it should be understood that this is the Chief Mahābrahmā in this world system.
66. Trong từ aññatarassā, mặc dù được nói là “aññataro” (một vị nào đó), nhưng cần phải hiểu rằng đây là Đại Phạm Thiên (Mahābrahmā) tối cao trong vũ trụ này.
Nassati vata bho lokoti so kira imaṃ saddaṃ tathā nicchāresi, yathā dasasahassilokadhātubrahmāno sutvā sabbe sannipatiṃsu.
“Alas, indeed, the world is perishing!”—that Great Brahmā, it is said, uttered this sound in such a way that the brahmās of the ten-thousand world-systems, having heard it, all assembled.
Ôi, thế gian thật đang hoại diệt! – vị ấy đã phát ra âm thanh này theo cách mà tất cả chư Phạm thiên trong mười ngàn thế giới nghe được và hội họp lại.
Yatra hi nāmāti yasmiṃ nāma loke.
“Yatra hi nāmā” means: in which world.
Yatra hi nāmā (trong thế gian này) có nghĩa là trong thế gian nào.
Purato pāturahosīti tehi dasahi brahmasahassehi saddhiṃ pāturahosi.
“Purato pāturahosīti” means: he appeared together with those ten thousand brahmās.
Purato pāturahosī (hiện ra trước mặt) có nghĩa là hiện ra cùng với mười ngàn Phạm thiên ấy.
Apparajakkhajātikāti paññāmaye akkhimhi appaṃ parittaṃ rāgadosamoharajaṃ etesaṃ, evaṃ sabhāvāti apparajakkhajātikā.
“Apparajakkhajātikā” means: in the eye of wisdom of these beings, there is little, slight dust of lust, hatred, and delusion; such is their nature, therefore they are called apparajakkhajātikā.
Apparajakkhajātikā (những chúng sanh có ít bụi trần) có nghĩa là những chúng sanh mà trong con mắt trí tuệ của họ có ít bụi trần tham, sân, si, v.v…; bản chất của họ là như vậy, nên gọi là apparajakkhajātikā.
Assavanatāti assavanatāya.
“Assavanatā” means: due to not having heard.
Assavanatā (do không được nghe) có nghĩa là do không được nghe.
Bhavissantīti purimabuddhesu dasapuññakiriyavatthuvasena katādhikārā paripākagatā padumāni viya sūriyarasmisamphassaṃ, dhammadesanaṃyeva ākaṅkhamānā catuppadikagāthāvasāne ariyabhūmiṃ okkamanārahā na eko, na dve, anekasatasahassā dhammassa aññātāro bhavissantīti dasseti.
“Bhavissantīti” indicates that, like lotuses that have developed and matured by accumulating merits through the ten bases of meritorious deeds in the presence of past Buddhas, eagerly awaiting the touch of the sun's rays, there will be not one, not two, but hundreds of thousands of beings who desire only the Dhamma discourse and are worthy of attaining the noble stages at the conclusion of the four-lined stanzas, capable of comprehending the Dhamma.
Bhavissantī (sẽ có) cho thấy rằng, những vị đã tạo các pháp ba-la-mật bằng mười pháp hành thiện trong các thời chư Phật quá khứ, đã đạt đến sự chín muồi, giống như những hoa sen đang mong chờ sự tiếp xúc của ánh nắng mặt trời, chỉ mong chờ giáo pháp được thuyết giảng, thì khi kết thúc bài kệ bốn câu, sẽ có không phải một hay hai, mà là vô số trăm ngàn vị xứng đáng đạt đến Thánh địa sẽ là những người thấu hiểu Giáo pháp.
233
69. Ajjhesananti evaṃ tikkhattuṃ yācanaṃ.
69. “Ajjhesanaṃ” means: such a three-time request.
69. Ajjhesanaṃ (sự thỉnh cầu) có nghĩa là lời thỉnh cầu như vậy ba lần.
Buddhacakkhunāti indriyaparopariyattañāṇena ca āsayānusayañāṇena ca.
“Buddhacakkhunā” means: by the knowledge of the varying faculties of beings (indriyaparopariyattañāṇa) and by the knowledge of their inclinations and underlying tendencies (āsayānusayañāṇa).
Buddhacakkhunā (bằng Phật nhãn) có nghĩa là bằng indriyaparopariyattañāṇa (trí tuệ về sự hơn kém của các căn) và āsayānusayañāṇa (trí tuệ về khuynh hướng và tùy miên).
Imesañhi dvinnaṃ ñāṇānaṃ ‘‘buddhacakkhū’’ti nāmaṃ, sabbaññutaññāṇassa ‘‘samantacakkhū’’ti, tiṇṇaṃ maggañāṇānaṃ ‘‘dhammacakkhū’’ti.
Indeed, these two knowledges are called “Buddhacakkhu,” the knowledge of omniscience is called “Samantacakkhu,” and the three path-knowledges are called “Dhammacakkhu.”
Hai loại trí tuệ này được gọi là “Phật nhãn” (Buddhacakkhū); trí tuệ Toàn tri được gọi là “Samantacakkhū” (Toàn giác nhãn); ba loại Đạo trí được gọi là “Dhammacakkhū” (Pháp nhãn).
Apparajakkhetiādīsu yesaṃ vuttanayeneva paññācakkhumhi rāgādirajaṃ appaṃ, te apparajakkhā. Yesaṃ taṃ mahantaṃ, te mahārajakkhā. Yesaṃ saddhādīni indriyāni tikkhāni, te tikkhindriyā. Yesaṃ tāni mudūni, te mudindriyā. Yesaṃ teyeva saddhādayo ākārā sundarā, te svākārā. Ye kathitakāraṇaṃ sallakkhenti, sukhena sakkā honti viññāpetuṃ, te suviññāpayā. Ye paralokañceva vajjañca bhayato passanti, te paralokavajjabhayadassāvino nāma.
In “Apparajakkhe” and so forth: those in whose eye of wisdom, in the manner stated, the dust of lust, etc., is little, are apparajakkhā (those with little dust of defilements). Those in whom it is great are mahārajakkhā (those with much dust of defilements). Those whose faculties of faith, etc., are keen are tikkhindriyā (those with sharp faculties). Those whose faculties are dull are mudindriyā (those with dull faculties). Those whose faith, etc., are beautiful in appearance are svākārā (those of good disposition). Those who understand the spoken reason and can be easily instructed are suviññāpayā (those easy to instruct). Those who perceive the next world and fault as fearful are called paralokavajjabhayadassāvino (those who see danger in the next world and in faults).
Trong các từ Apparajakkhe (ít bụi trần), v.v…: những chúng sanh có ít bụi trần tham, v.v… trong con mắt trí tuệ theo cách đã được nói, thì được gọi là Apparajakkhā (người ít bụi trần). Những chúng sanh có nhiều bụi trần ấy, thì được gọi là Mahārajakkhā (người nhiều bụi trần). Những chúng sanh có các căn tín, v.v… sắc bén, thì được gọi là Tikkhindriyā (người có căn bén nhạy). Những chúng sanh có các căn ấy mềm yếu, thì được gọi là Mudindriyā (người có căn mềm yếu). Những chúng sanh có các trạng thái tín, v.v… ấy tốt đẹp, thì được gọi là Svākārā (người có trạng thái tốt đẹp). Những chúng sanh thấu hiểu nguyên nhân được thuyết giảng, có thể được giáo hóa một cách dễ dàng, thì được gọi là Suviññāpayā (người dễ giáo hóa). Những chúng sanh thấy thế giới bên kia và tội lỗi là đáng sợ, thì được gọi là Paralokavajjabhayadassāvino (người thấy rõ sự nguy hiểm của thế giới bên kia và tội lỗi).
234
Ayaṃ panettha pāḷi – ‘‘saddho puggalo apparajakkho, assaddho puggalo mahārajakkho.… Āraddhavīriyo…pe… kusīto… upaṭṭhitassati… muṭṭhassati… samāhito… asamāhito… paññavā… duppañño puggalo mahārajakkho.
Here is the Pāḷi for it: “A person with faith is apparajakkha; a person without faith is mahārajakkha… One who has exerted effort… (similarly) … one who is lazy… one with established mindfulness… one with lost mindfulness… one who is concentrated… one who is not concentrated… one who is wise… a foolish person is mahārajakkha.
Và đây là đoạn Pāḷi về điều này: “Người có đức tin là người ít bụi trần; người không có đức tin là người nhiều bụi trần… Người tinh tấn… Người biếng nhác… Người chánh niệm… Người thất niệm… Người định tâm… Người không định tâm… Người có trí tuệ… Người không có trí tuệ là người nhiều bụi trần.
Tathā saddho puggalo tikkhindriyo…pe… paññavā puggalo paralokavajjabhayadassāvī, duppañño puggalo na paralokavajjabhayadassāvī.
Similarly, a person with faith is tikkhindriya… (similarly) … a wise person sees danger in the next world and in faults; a foolish person does not see danger in the next world and in faults.
Tương tự, người có đức tin là người có căn bén nhạy… Người có trí tuệ là người thấy rõ sự nguy hiểm của thế giới bên kia và tội lỗi; người không có trí tuệ là người không thấy rõ sự nguy hiểm của thế giới bên kia và tội lỗi.
Lokoti khandhaloko, dhātuloko, āyatanaloko, sampattibhavaloko, vipattibhavaloko, sampattisambhavaloko, vipattisambhavaloko.
“Loko” refers to: the world of aggregates (khandhaloka), the world of elements (dhātuloka), the world of sense bases (āyatanaloka), the world of fortunate existences (sampattibhavaloka), the world of unfortunate existences (vipattibhavaloka), the world of causes leading to fortunate existences (sampattisambhavaloka), the world of causes leading to unfortunate existences (vipattisambhavaloka).
Loko (thế gian) là thế gian của các uẩn (khandhaloko), thế gian của các giới (dhātuloko), thế gian của các xứ (āyatanaloko), thế gian của sự sanh khởi đầy đủ (sampattibhavaloko), thế gian của sự sanh khởi bất hạnh (vipattibhavaloko), thế gian của sự kết hợp đầy đủ (sampattisambhavaloko), thế gian của sự kết hợp bất hạnh (vipattisambhavaloko).
Eko loko – sabbe sattā āhāraṭṭhitikā.
One world: all beings subsist on food.
Một thế gian (eko loko) – tất cả chúng sanh đều được duy trì bởi thực phẩm.
Dve lokā – nāmañca rūpañca.
Two worlds: name and form.
Hai thế gian (dve lokā) – danh và sắc.
Tayo lokā – tisso vedanā.
Three worlds: the three feelings.
Ba thế gian (tayo lokā) – ba thọ.
Cattāro lokā – cattāro āhārā.
Four worlds: the four nutriments.
Bốn thế gian (cattāro lokā) – bốn thực phẩm.
Pañca lokā – pañcupādānakkhandhā.
Five worlds: the five aggregates of clinging.
Năm thế gian (pañca lokā) – năm thủ uẩn.
Cha lokā – cha ajjhattikāni āyatanāni.
Six worlds: the six internal sense bases.
Sáu thế gian (cha lokā) – sáu nội xứ.
Satta lokā – satta viññāṇaṭṭhitiyo.
Seven worlds: the seven stations of consciousness.
Bảy thế gian (satta lokā) – bảy thức trú.
Aṭṭha lokā – aṭṭha lokadhammā.
Eight worlds: the eight worldly conditions.
Tám thế gian (aṭṭha lokā) – tám pháp thế gian.
Nava lokā – nava sattāvāsā.
Nine worlds: the nine abodes of beings.
Chín thế gian (nava lokā) – chín trú xứ của hữu tình.
Dasa lokā – dasāyatanāni.
Ten worlds: the ten sense bases.
Mười thế gian (dasa lokā) – mười xứ.
Dvādasa lokā – dvādasāyatanāni.
Twelve worlds: the twelve sense bases.
Mười hai thế gian (dvādasa lokā) – mười hai xứ.
Aṭṭhārasa lokā – aṭṭhārasa dhātuyo.
Eighteen worlds: the eighteen elements.
Mười tám thế gian (aṭṭhārasa lokā) – mười tám giới.
Vajjanti sabbe kilesā vajjaṃ, sabbe duccaritā vajjaṃ, sabbe abhisaṅkhārā vajjaṃ, sabbe bhavagāmikammā vajjaṃ.
“Vajjaṃ” means: all defilements are faults, all evil deeds are faults, all formations are faults, all kamma leading to rebirth are faults.
Vajjaṃ (tội lỗi) là tất cả phiền não là tội lỗi, tất cả ác hạnh là tội lỗi, tất cả phi phúc hành là tội lỗi, tất cả nghiệp dẫn đến tái sanh là tội lỗi.
Iti imasmiñca loke imasmiñca vajje tibbā bhayasaññā paccupaṭṭhitā hoti, seyyathāpi ukkhittāsike vadhake.
Thus, in this world and in these faults, a keen perception of danger is present, just as in a murderer with an upraised sword.
Như vậy, trong thế gian này và trong tội lỗi này, một sự sợ hãi mãnh liệt hiện hữu, giống như đối với một kẻ sát nhân cầm gươm đã rút ra.
Imehi paññāsāya ākārehi imāni pañcindriyāni jānāti passati aññāti paṭivijjhati, idaṃ tathāgatassa indriyaparopariyatte ñāṇa’’nti (paṭi. ma. 1.112).
By these fifty aspects, he knows, sees, understands, and penetrates these five faculties. This is the Tathāgata’s knowledge of the varying faculties of beings.”
Bằng năm mươi phương diện này, Ngài biết, thấy, hiểu và thấu triệt năm căn này; đây là trí tuệ của Đức Như Lai về sự hơn kém của các căn (indriyaparopariyatte ñāṇaṃ).
235
Uppaliniyanti uppalavane.
“Uppaliniyaṃ” means: in a lotus pond.
Uppaliniyaṃ (trong ao sen xanh) có nghĩa là trong rừng sen xanh.
Itaresupi eseva nayo.
The same method applies to the others as well.
Đối với các loại sen khác cũng theo cách tương tự.
Antonimuggaposīnīti yāni aññānipi padumāni antonimuggāneva posayanti.
“Antonimuggaposīnī” refers to: any other lotuses that grow while submerged within the water.
Antonimuggaposīnī (những hoa sen đang lớn lên chìm trong nước) có nghĩa là những hoa sen khác đang lớn lên chìm trong nước.
Udakaṃ accuggamma ṭhitānīti udakaṃ atikkamitvā ṭhitāni.
“Udakaṃ accuggamma ṭhitānī” means: those that stand having risen above the water.
Udakaṃ accuggamma ṭhitānī (những hoa sen vươn lên khỏi mặt nước) có nghĩa là những hoa sen đã vượt lên khỏi mặt nước.
Tattha yāni accuggamma ṭhitāni, tāni sūriyarasmisamphassaṃ āgamayamānāni ṭhitāni ajja pupphanakāni.
Among these, those that have risen above the water, standing in expectation of the touch of the sun’s rays, are those that will bloom today.
Trong số đó, những hoa sen đã vươn lên khỏi mặt nước, đang chờ đợi sự tiếp xúc của ánh nắng mặt trời, là những hoa sen sẽ nở hôm nay.
Yāni samodakaṃ ṭhitāni, tāni sve pupphanakāni.
Those that stand level with the water are those that will bloom tomorrow.
Những hoa sen đang ở ngang mặt nước, là những hoa sen sẽ nở vào ngày mai.
Yāni udakānuggatāni antoudakaposīni, tāni tatiyadivase pupphanakāni.
Those that have not yet emerged from the water and are growing submerged within the water are those that will bloom on the third day.
Những hoa sen chưa vươn lên khỏi mặt nước, đang lớn lên chìm trong nước, là những hoa sen sẽ nở vào ngày thứ ba.
Udakā pana anuggatāni aññānipi sarojauppalādīni nāma atthi, yāni neva pupphissanti, macchakacchapabhakkhāneva bhavissanti, tāni pāḷiṃ nārūḷhāni.
Furthermore, there are other types of lotuses like saroja and uppala that have not emerged from the water, which will never bloom but will become food for fish and tortoises; these are not included in the Pāḷi.
Ngoài ra, còn có những loại hoa sen khác như sarojā, uppalā, v.v… chưa vươn lên khỏi mặt nước, chúng sẽ không bao giờ nở mà sẽ trở thành thức ăn cho cá và rùa; những loại này không được đề cập trong Pāḷi.
Āharitvā pana dīpetabbānīti dīpitāni.
However, they are explained here because they ought to be clarified.
Tuy nhiên, chúng cần được giải thích, nên đã được giải thích.
Yatheva hi tāni catubbidhāni pupphāni, evameva ugghaṭitaññū, vipañcitaññū, neyyo, padaparamoti cattāro puggalā.
Just as there are these four kinds of flowers, so too there are four types of individuals: ugghaṭitaññū, vipañcitaññū, neyyo, and padaparama.
Cũng như bốn loại hoa ấy, có bốn hạng người: ugghaṭitaññū (người hiểu nhanh), vipañcitaññū (người hiểu rõ), neyyo (người cần được hướng dẫn), và padaparamo (người chỉ biết lời).
Tattha yassa puggalassa saha udāhaṭavelāya dhammābhisamayo hoti, ayaṃ vuccati puggalo ugghaṭitaññū. Yassa puggalassa saṅkhittena bhāsitassa vitthārena atthe vibhajiyamāne dhammābhisamayo hoti, ayaṃ vuccati puggalo vipañcitaññū. Yassa puggalassa uddesato paripucchato yonisomanasikaroto kalyāṇamitte sevato bhajato payirupāsato anupubbena dhammābhisamayo hoti, ayaṃ vuccati puggalo neyyo. Yassa puggalassa bahumpi suṇato bahumpi bhaṇato bahumpi gaṇhato bahumpi dhārayato bahumpi vācayato na tāya jātiyā dhammābhisamayo hoti, ayaṃ vuccati puggalo padaparamo (pu. pa. 148, 149, 150, 151).
Among these: the individual for whom comprehension of the Dhamma occurs simultaneously with the explanation is called an ugghaṭitaññū (one who comprehends immediately). The individual for whom comprehension of the Dhamma occurs when the meaning of a brief teaching is expounded in detail is called a vipañcitaññū (one who comprehends after elaborate explanation). The individual for whom comprehension of the Dhamma occurs gradually through instruction, questioning, wise attention, and associating with, resorting to, and attending upon good friends is called a neyyo (one who is guided). The individual for whom, even after much listening, much speaking, much learning, much retaining, and much reciting, comprehension of the Dhamma does not occur in that very life, is called a padaparamo (one who is only concerned with words).
Trong số đó, người mà sự thấu hiểu Giáo pháp (dhammābhisamayo) xảy ra cùng lúc với lời thuyết giảng, người ấy được gọi là ugghaṭitaññū. Người mà sự thấu hiểu Giáo pháp xảy ra khi ý nghĩa của lời thuyết giảng vắn tắt được giải thích chi tiết, người ấy được gọi là vipañcitaññū. Người mà sự thấu hiểu Giáo pháp xảy ra dần dần qua việc nghe giảng, hỏi han, tác ý đúng đắn, thân cận, phụng sự và gần gũi với bạn lành, người ấy được gọi là neyyo. Người mà dù nghe nhiều, nói nhiều, học nhiều, ghi nhớ nhiều, và giảng dạy nhiều, nhưng sự thấu hiểu Giáo pháp không xảy ra trong kiếp sống đó, người ấy được gọi là padaparamo.
236
Tattha bhagavā uppalavanādisadisaṃ dasasahassilokadhātuṃ olokento – ‘‘ajja pupphanakāni viya ugghaṭitaññū, sve pupphanakāni viya vipañcitaññū, tatiyadivase pupphanakāni viya neyyo, macchakacchapabhakkhāni viya padaparamo’’ti addasa.
Therein, the Blessed One, observing the ten-thousand world-system, which was like a lotus pond, perceived: "There are ugghaṭitaññū individuals like those that will bloom today, vipañcitaññū individuals like those that will bloom tomorrow, neyyo individuals like those that will bloom on the third day, and padaparama individuals like those that will be eaten by fish and tortoises."
Tại đó, Đức Thế Tôn nhìn mười ngàn thế giới giống như rừng sen, v.v… và thấy: “Có những người ugghaṭitaññū như những hoa sen sẽ nở hôm nay; có những người vipañcitaññū như những hoa sen sẽ nở ngày mai; có những người neyyo như những hoa sen sẽ nở ngày thứ ba; và có những người padaparamo như những hoa sen sẽ bị cá và rùa ăn.”
Passanto ca – ‘‘ettakā apparajakkhā, ettakā mahārajakkhā.
And seeing them, he thought: "So many are apparajakkhā, so many are mahārajakkhā.
Và khi nhìn thấy, Ngài thấy: “Có bấy nhiêu người ít bụi trần, có bấy nhiêu người nhiều bụi trần.
Tatrāpi ettakā ugghaṭitaññū’’ti evaṃ sabbākārato addasa.
Among these, so many are ugghaṭitaññū," and so he saw them in all their aspects.
Trong số đó, có bấy nhiêu người ugghaṭitaññū,” như vậy, Ngài thấy tất cả các phương diện.
Tattha tiṇṇaṃ puggalānaṃ imasmiṃyeva attabhāve bhagavato dhammadesanā atthaṃ sādheti, padaparamānaṃ anāgate vāsanatthāya hoti.
In this situation, the Blessed One’s Dhamma discourse benefits the three types of individuals in this very existence, while for the padaparamā, it serves for the development of latent tendencies in the future.
Trong số đó, đối với ba hạng người, giáo pháp của Đức Thế Tôn có thể mang lại lợi ích ngay trong kiếp sống này; đối với hạng người padaparamo, giáo pháp là để gieo trồng hạt giống cho tương lai.
237
Atha bhagavā imesaṃ catunnaṃ puggalānaṃ atthāvahaṃ dhammadesanaṃ viditvā desetukamyataṃ uppādetvā puna te sabbesupi tīsu bhavesu sabbe satte bhabbābhabbavasena dve koṭṭhāse akāsi.
Then, the Blessed One, knowing that the Dhamma discourse would be beneficial to these four types of individuals, generated the desire to teach and then again divided all beings in all three existences into two categories based on their capability and incapability.
Sau đó, Đức Thế Tôn, khi biết giáo pháp mang lại lợi ích cho bốn hạng người này, đã phát khởi ý muốn thuyết giảng, rồi Ngài lại phân chia tất cả chúng sanh trong ba cõi thành hai loại dựa trên khả năng và bất khả năng (tiếp thu Giáo pháp).
Ye sandhāya vuttaṃ – ‘‘ye te sattā kammāvaraṇena samannāgatā, vipākāvaraṇena samannāgatā, kilesāvaraṇena samannāgatā, assaddhā acchandikā duppaññā abhabbā niyāmaṃ okkamituṃ kusalesu dhammesu sammattaṃ, ime te sattā abhabbā.
Referring to whom it was said: “Those beings who are endowed with karmic obstructions (kammāvaraṇa), with result-obstructions (vipākāvaraṇa), with defilement-obstructions (kilesāvaraṇa), who are faithless, without aspiration, and foolish, are incapable of entering the fixed path (niyāma) to certainty in wholesome states; these beings are incapable (abhabbā).
Những gì đã được nói về điều này là: “Những chúng sanh bị nghiệp chướng, bị quả báo chướng, bị phiền não chướng, không có đức tin, không có ý muốn, không có trí tuệ, không thể đạt được sự chắc chắn trong các thiện pháp, những chúng sanh này là bất khả năng (abhabbā).
Katame sattā bhabbā?
Which beings are capable?
Những chúng sanh nào là khả năng (bhabbā)?
Ye te sattā na kammāvaraṇena…pe…ime te sattā bhabbā’’ti (vibha. 827; paṭi. ma. 1.114).
Those beings who are not endowed with karmic obstructions… (similarly) … these beings are capable (bhabbā).”
Những chúng sanh nào không bị nghiệp chướng… những chúng sanh này là khả năng (bhabbā).”
238
Tattha sabbepi abhabbapuggale pahāya bhabbapuggaleyeva ñāṇena pariggahetvā – ‘‘ettakā rāgacaritā, ettakā dosamohavitakkasaddhābuddhicaritā’’ti cha koṭṭhāse akāsi.
Therein, having set aside all incapable individuals and having encompassed only the capable individuals with his knowledge, he divided them into six categories: “So many are of lustful temperament (rāgacaritā), so many are of hateful temperament (dosacaritā), so many are of deluded temperament (mohacaritā), so many are of speculative temperament (vitakkacaritā), so many are of faithful temperament (saddhācaritā), so many are of intellectual temperament (buddhicaritā).”
Trong số đó, Ngài đã loại bỏ tất cả những người bất khả năng (abhabbapuggale) và chỉ nắm giữ những người khả năng (bhabbapuggale) bằng trí tuệ, rồi Ngài chia họ thành sáu loại: “Có bấy nhiêu người có tánh tham, có bấy nhiêu người có tánh sân, tánh si, tánh tầm, tánh tín, tánh tuệ.”
Evaṃ katvā – ‘‘dhammaṃ desessāmī’’ti cintesi.
Having done this, he thought, "I shall teach the Dhamma."
Sau khi làm như vậy, Ngài suy nghĩ: "Ta sẽ thuyết pháp."
Brahmā taṃ ñatvā somanassajāto bhagavantaṃ gāthāhi ajjhabhāsi.
Brahmā, knowing this, filled with joy, addressed the Bhagavā with verses.
Phạm Thiên biết được điều ấy, lòng tràn đầy hoan hỷ, đã thỉnh cầu Thế Tôn bằng những bài kệ.
Idaṃ sandhāya – ‘‘atha kho so, bhikkhave, mahābrahmā’’tiādi vuttaṃ.
It is with reference to this that "Then, O bhikkhus, Mahābrahmā," and so forth, was said.
Liên quan đến điều này, đã được nói: "Này các Tỳ-khưu, rồi Đại Phạm Thiên ấy..."
239
70. Tattha ajjhabhāsīti adhiabhāsi, adhikicca ārabbha abhāsīti attho.
70. Here, ajjhabhāsī means adhi-abhāsi, that is, he spoke with reference to, or regarding.
70. Ở đây, ajjhabhāsī có nghĩa là adhiabhāsi, tức là nói lên điều mình muốn, nói về một điều gì đó.
240
Sele yathā pabbatamuddhaniṭṭhitoti selamaye ekagghane pabbatamuddhani yathāṭhitova, na hi tattha ṭhitassa dassanatthaṃ gīvukkhipanapasāraṇādikiccaṃ atthi.
Sele yathā pabbatamuddhaniṭṭhito: just as one stands on a solid rock mountain peak; indeed, for one standing there, there is no need to raise or stretch the neck to see.
Sele yathā pabbatamuddhaniṭṭhito có nghĩa là như người đứng trên đỉnh núi đá nguyên khối, không cần phải ngước cổ hay vươn mình để nhìn thấy.
Tathūpamanti tappaṭibhāgaṃ selapabbatūpamaṃ.
Tathūpamaṃ: a similar comparison to that rock mountain.
Tathūpamaṃ có nghĩa là tương tự như vậy, ví như núi đá.
Ayaṃ panettha saṅkhepattho, yathā selapabbatamuddhani yathāṭhitova cakkhumā puriso samantato janataṃ passeyya, tathā tvampi sumedha, sundarapaññasabbaññutaññāṇena samantacakkhu bhagavā dhammamayaṃ paññāmayaṃ pāsādamāruyha sayaṃ apetasoko sokāvatiṇṇaṃ jātijarābhibhūtaṃ janataṃ apekkhassu, upadhāraya upaparikkha.
This is the brief meaning here: just as a clear-sighted person, standing on a rock mountain peak, would see the people all around, so too, O Sumedha, Bhagavā, who has perfect wisdom and all-knowing knowledge as his all-seeing eye, having ascended the palace of Dhamma and wisdom, himself free from sorrow, look upon and observe the people who are afflicted by sorrow, overwhelmed by birth and old age.
Đây là ý nghĩa tóm tắt ở đây: Như một người có mắt đứng trên đỉnh núi đá có thể nhìn thấy mọi người xung quanh, thì Ngài, bậc có trí tuệ siêu việt, bậc Toàn Giác, với tuệ nhãn toàn diện, hãy leo lên cung điện Pháp-tuệ, tự mình đã thoát khỏi sầu khổ, hãy nhìn xuống, hãy quán sát những người đang chìm đắm trong sầu khổ, bị sinh, già chi phối.
241
Ayamettha adhippāyo – yathā hi pabbatapāde samantā mahantaṃ khettaṃ katvā tattha kedārapāḷīsu kuṭikāyo katvā rattiṃ aggiṃ jāleyyuṃ.
This is the intention here: Just as if, having made a large field all around the base of a mountain and built small huts on the bunds of the fields, they were to light fires at night.
Ý nghĩa ở đây là: Ví như, người ta làm một cánh đồng lớn xung quanh chân núi, dựng những túp lều trên các bờ ruộng và đốt lửa vào ban đêm.
Caturaṅgasamannāgatañca andhakāraṃ assa.
And there would be a fourfold darkness.
Và có một màn đêm tối tăm dày đặc bốn phương.
Athassa pabbatassa matthake ṭhatvā cakkhumato purisassa bhūmiṃ olokayato neva khettaṃ, na kedārapāḷiyo, na kuṭiyo, na tattha sayitamanussā paññāyeyyuṃ, kuṭikāsu pana aggijālamattameva paññāyeyya.
Then, for a clear-sighted person standing on the peak of that mountain and looking down upon the ground, neither the field, nor the field bunds, nor the huts, nor the people sleeping there would be visible; only the flame of the fires in the huts would be visible.
Khi đó, một người có mắt đứng trên đỉnh núi nhìn xuống đất sẽ không thấy cánh đồng, không thấy bờ ruộng, không thấy những túp lều, cũng không thấy những người đang ngủ trong đó, mà chỉ thấy ánh lửa từ những túp lều mà thôi.
Evaṃ dhammapāsādamāruyha sattanikāyaṃ olokayato tathāgatassa ye te akatakalyāṇā sattā, te ekavihāre dakkhiṇajāṇupasse nisinnāpi buddhacakkhussa āpāthaṃ nāgacchanti, rattiṃ khittasarā viya honti.
Similarly, for the Tathāgata, looking upon the assembly of beings from the palace of Dhamma, those beings who have not done good deeds do not come into the range of the Buddha-eye, even if they are seated in the same monastery beside his right knee; they are like arrows shot in the night.
Cũng vậy, khi Như Lai leo lên cung điện Pháp và nhìn xuống chúng sanh, những chúng sanh chưa từng làm điều thiện, dù ngồi gần bên đầu gối phải trong cùng một trú xứ, cũng không lọt vào tầm mắt Phật nhãn, giống như những mũi tên bắn vào ban đêm.
Ye pana katakalyāṇā veneyyapuggalā, te tassa dūre ṭhitāpi āpāthaṃ āgacchanti, so aggi viya himavantapabbato viya ca.
But those who have done good deeds, those who are amenable to training, they come into his range even if they are standing far away, like that fire or like the Himālaya mountain.
Còn những người đáng được giáo hóa đã làm điều thiện, dù đứng xa, cũng lọt vào tầm mắt của Ngài, giống như ngọn lửa hoặc núi tuyết Himavanta.
Vuttampi cetaṃ –
It was also said:
Và điều này cũng đã được nói:
242
‘‘Dūre santo pakāsenti, himavantova pabbato;
"The good shine from afar, like the Himālaya mountain;
“Bậc thiện lành dù ở xa, vẫn hiển lộ như núi tuyết;
243
Asantettha na dissanti, rattiṃ khittā yathā sarā’’ti.(dha. pa. 304);
The unvirtuous are not seen here, like arrows shot in the night."
Kẻ bất thiện dù ở gần, vẫn không thấy được, như mũi tên bắn vào ban đêm.”
244
Uṭṭhehīti bhagavato dhammadesanatthaṃ cārikacaraṇaṃ yācanto bhaṇati.
Uṭṭhehī is said by him requesting the Bhagavā to wander for the purpose of teaching the Dhamma.
Uṭṭhehī là lời thỉnh cầu Thế Tôn đi du hóa để thuyết Pháp.
Vīrātiādīsu bhagavā vīriyavantatāya vīro, devaputtamaccukilesamārānaṃ vijitattā vijitasaṅgāmo, jātikantarādinittharaṇatthāya veneyyasatthavāhanasamatthatāya satthavāho, kāmacchandaiṇassa abhāvato aṇaṇoti veditabbo.
Among Vīra and so forth, the Bhagavā is to be understood as Vīra because of his vigor, vijitasaṅgāmo because he has conquered the Māras of devaputta, death, and defilements, satthavāho because he is capable of leading the caravan of those to be trained across birth and various existences, and aṇaṇo because of the absence of the debt of sensual desire.
Trong các từ Vīrā và các từ khác, Thế Tôn được biết đến là vīro (bậc anh hùng) vì Ngài có tinh tấn; vijitasaṅgāmo (bậc chiến thắng mọi trận chiến) vì Ngài đã chiến thắng các ma vương Devaputta, Mṛtyu và Kilesa; satthavāho (bậc dẫn đường) vì Ngài có khả năng dẫn dắt đoàn người đáng được giáo hóa vượt qua sinh tử; và aṇaṇo (bậc không nợ nần) vì Ngài không có món nợ dục ái.
245
71. Apārutāti vivaṭā.
71. Apārutā means opened.
71. Apārutā có nghĩa là đã mở ra.
Amatassa dvārāti ariyamaggo.
Amatassa dvārā means the Noble Path.
Amatassa dvārā là Thánh đạo.
So hi amatasaṅkhātassa nibbānassa dvāraṃ.
For it is the door to Nibbāna, which is called the Deathless (Amata).
Vì Thánh đạo là cánh cửa dẫn đến Nibbāna, được gọi là Bất tử (amata).
So mayā vivaritvā ṭhapitoti dasseti.
He indicates that "this has been opened by me."
Điều này cho thấy rằng: "Cánh cửa đó đã được Ta mở ra."
Pamuñcantu saddhanti sabbe attano saddhaṃ pamuñcantu vissajjentu.
Pamuñcantu saddhaṃ means "let all release their faith."
Pamuñcantu saddhaṃ có nghĩa là tất cả hãy buông bỏ niềm tin của mình.
Pacchimapadadvaye ayamattho, ahañhi attano paguṇaṃ suppavattitampi imaṃ paṇītaṃ uttamaṃ dhammaṃ kāyavācākilamathasaññī hutvā na bhāsiṃ, idāni pana sabbe janā saddhābhājanaṃ upanentu, pūressāmi tesaṃ saṅkappanti.
In the last two phrases, the meaning is: "Indeed, I did not teach this refined and supreme Dhamma, which was well-practiced and well-manifested in myself, thinking it would cause weariness to body and speech. But now, let all beings present the vessel of faith, and I shall fulfill their aspirations."
Ý nghĩa của hai câu cuối là: "Ta đã không thuyết giảng giáo pháp cao thượng, thù thắng này, dù đã thuần thục và vận hành tốt, vì nghĩ đến sự mệt mỏi của thân và khẩu. Nhưng giờ đây, tất cả mọi người hãy dâng lên bình tín tâm, Ta sẽ làm viên mãn ý nguyện của họ."
246
Aggasāvakayugavaṇṇanā
Description of the Chief Disciples' Pair
Mô tả hai vị Thượng Thủ Đệ Tử
247
73. Bodhirukkhamūleti bodhirukkhassa avidūre ajapālanigrodhe antarahitoti attho.
73. Bodhirukkhamūle means having vanished near the Bodhi tree, at the Ajapāla Banyan tree, he then reappeared.
73. Bodhirukkhamūle có nghĩa là Ngài đã ẩn mình tại cây Ajapāla Nigrodha, gần cây Bồ-đề.
Kheme migadāyeti isipatanaṃ tena samayena khemaṃ nāma uyyānaṃ hoti, migānaṃ pana abhayavāsatthāya dinnattā migadāyoti vuccati.
Kheme migadāye: Isipatana was at that time an enjoyable park named Khema, and it is called Migadāya because it was given for the fearless dwelling of deer.
Kheme migadāye có nghĩa là Isipatana vào thời đó là một khu vườn an toàn (khema), và được gọi là Migadāya (Vườn Nai) vì nó được dành để nai sống không sợ hãi.
Taṃ sandhāya vuttaṃ – ‘‘kheme migadāye’’ti.
It is with reference to this that "in the safe Migadāya" was said.
Liên quan đến điều đó, đã được nói: "tại Migadāya an toàn."
Yathā ca vipassī bhagavā, evaṃ aññepi buddhā paṭhamaṃ dhammadesanatthāya gacchantā ākāsena gantvā tattheva otaranti.
And just as the Bhagavā Vipassī, so too other Buddhas, when going to teach the Dhamma for the first time, would go through the air and descend right there.
Như Đức Phật Vipassī, các Đức Phật khác cũng vậy, khi lần đầu tiên đi thuyết Pháp, các Ngài đi bằng đường không và hạ xuống ngay tại đó.
Amhākaṃ pana bhagavā upakassa ājīvakassa upanissayaṃ disvā – ‘‘upako imaṃ addhānaṃ paṭipanno, so maṃ disvā sallapitvā gamissati.
However, our Bhagavā, seeing the predisposition of Upaka the Ājīvaka, thought: "Upaka is traveling this path; he will see me, converse, and then depart.
Nhưng Đức Thế Tôn của chúng ta, khi thấy nhân duyên của Upaka Ājīvaka, Ngài biết: "Upaka đã đi trên con đường này, anh ta sẽ gặp Ta, nói chuyện rồi đi.
Atha puna nibbindanto āgamma arahattaṃ sacchikarissatī’’ti ñatvā aṭṭhārasayojanamaggaṃ padasāva agamāsi.
Then, disaffected, he will return and realize arahantship." Knowing this, he traveled the eighteen-yojana path on foot.
Sau đó, anh ta sẽ chán nản, quay lại và chứng đắc A-la-hán."
Dāyapālaṃ āmantesīti disvāva punappunaṃ oloketvā – ‘‘ayyo no, bhante, āgato’’ti vatvā upagataṃ āmantesi.
Dāyapālaṃ āmantesī means having seen him, and repeatedly looking, he addressed the park keeper who had approached, saying, "Venerable Sir, has our master arrived?"
Biết vậy, Ngài đã đi bộ mười tám dojana.
248
75-6. Anupubbiṃ kathanti dānakathaṃ, dānānantaraṃ sīlaṃ, sīlānantaraṃ saggaṃ, saggānantaraṃ magganti evaṃ anupaṭipāṭikathaṃ kathesi.
75-6. Anupubbiṃ kathaṃ: he delivered a graduated discourse, speaking of generosity, then morality, then heaven, and then the path, in that sequential order.
75-6. Anupubbiṃ kathaṃ có nghĩa là Ngài đã thuyết giảng một bài pháp tuần tự, bắt đầu bằng pháp bố thí, sau bố thí là giới, sau giới là cõi trời, và sau cõi trời là con đường (đạo).
Tattha dānakathanti idaṃ dānaṃ nāma sukhānaṃ nidānaṃ, sampattīnaṃ mūlaṃ, bhogānaṃ patiṭṭhā, visamagatassa tāṇaṃ leṇaṃ gati parāyaṇaṃ, idhalokaparalokesu dānasadiso avassayo patiṭṭhā ārammaṇaṃ tāṇaṃ leṇaṃ gati parāyaṇaṃ natthi.
Among these, dānakathā means that giving (dāna) is the source of happiness, the root of prosperity, the foundation of wealth, a refuge, shelter, destination, and ultimate resort for one in difficulty; there is no support, foundation, reliance, refuge, shelter, destination, or ultimate resort like giving in this world or the next.
Ở đó, dānakatha có nghĩa là: Bố thí này là cội nguồn của mọi hạnh phúc, là gốc rễ của mọi thành tựu, là nền tảng của mọi tài sản, là nơi nương tựa, trú ẩn, chỗ đến, nơi giải thoát cho người gặp hoạn nạn. Ở đời này và đời sau, không có nơi nương tựa, nền tảng, chỗ dựa, sự che chở, nơi trú ẩn, chỗ đến, nơi giải thoát nào sánh bằng bố thí.
Idañhi avassayaṭṭhena ratanamayasīhāsanasadisaṃ, patiṭṭhānaṭṭhena mahāpathavīsadisaṃ, ārammaṇaṭṭhena ālambanarajjusadisaṃ.
Indeed, by way of being a support, it is like a jewel-studded throne; by way of being a foundation, it is like the great earth; by way of being an object of reliance, it is like a rope for clinging.
Thật vậy, bố thí này giống như ngai vàng bằng ngọc quý về phương diện nương tựa, giống như đại địa về phương diện nền tảng, giống như sợi dây để bám víu về phương diện chỗ dựa.
Idañhi dukkhanittharaṇaṭṭhena nāvā, samassāsanaṭṭhena saṅgāmasūro, bhayaparittāṇaṭṭhena susaṅkhatanagaraṃ, maccheramalādīhi anupalittaṭṭhena padumaṃ, tesaṃ nidahanaṭṭhena aggi, durāsadaṭṭhena āsīviso, asantāsanaṭṭhena sīho, balavantaṭṭhena hatthī, abhimaṅgalasammataṭṭhena setausabho, khemantabhūmisampāpanaṭṭhena valāhakaassarājā.
Indeed, by way of extracting from suffering, it is a ship; by way of bringing comfort, it is a hero in battle; by way of protecting from fear, it is a well-built city; by way of being untainted by the defilement of avarice and so forth, it is a lotus; by way of burning away those defilements, it is fire; by way of being unapproachable (by defilements), it is a venomous snake; by way of not causing alarm, it is a lion; by way of being mighty, it is an elephant; by way of being regarded as highly auspicious, it is a white bull; by way of leading to the land of safety, it is a cloud-horse king.
Thật vậy, bố thí này giống như con thuyền về phương diện thoát khỏi khổ đau, giống như dũng sĩ trong trận chiến về phương diện trấn an, giống như thành trì kiên cố về phương diện bảo vệ khỏi hiểm nguy, giống như hoa sen về phương diện không bị ô nhiễm bởi cấu uế keo kiệt, giống như lửa về phương diện thiêu đốt chúng, giống như rắn độc về phương diện khó tiếp cận, giống như sư tử về phương diện không sợ hãi, giống như voi về phương diện sức mạnh, giống như bò đực trắng về phương diện được coi là điềm lành tối thượng, giống như vua ngựa mây về phương diện đưa đến vùng đất an toàn.
Dānañhi loke sakkasampattiṃ mārasampattiṃ brahmasampattiṃ cakkavattisampattiṃ sāvakapāramiñāṇaṃ paccekabodhiñāṇaṃ abhisambodhiñāṇaṃ detīti evamādidānaguṇapaṭisaṃyuttaṃ kathaṃ.
Indeed, giving in the world bestows the prosperity of Sakka, the prosperity of Māra, the prosperity of Brahmā, the prosperity of a Cakkavatti king, the knowledge of a disciple's perfections, the knowledge of a Paccekabuddha, and the knowledge of perfect enlightenment. This is the discourse associated with the virtues of giving, and so forth.
Thật vậy, bố thí trong thế gian mang lại sự thành tựu của Sakka (vua trời), sự thành tựu của Māra, sự thành tựu của Phạm Thiên, sự thành tựu của Chuyển Luân Thánh Vương, trí tuệ Ba-la-mật của các đệ tử (Sāvakapāramiñāṇa), trí tuệ Bích Chi Phật (Paccekabodhiñāṇa), và trí tuệ Chánh Đẳng Giác (Abhisambodhiñāṇa). Đây là bài pháp liên quan đến những công đức bố thí như vậy.
249
Yasmā pana dānaṃ dadanto sīlaṃ samādātuṃ sakkoti, tasmā tadanantaraṃ sīlakathaṃ kathesi.
Since one who gives is able to undertake morality, he then taught a discourse on morality.
Vì người bố thí có thể thọ trì giới, nên sau đó Ngài đã thuyết giảng về giới.
Sīlakathanti sīlaṃ nāmetaṃ avassayo patiṭṭhā ārammaṇaṃ tāṇaṃ leṇaṃ gati parāyaṇaṃ.
Sīlakathā means that this morality is a support, a foundation, an object of reliance, a refuge, a shelter, a destination, an ultimate resort.
Sīlakatha có nghĩa là: Giới này là nơi nương tựa, nền tảng, chỗ dựa, sự che chở, nơi trú ẩn, chỗ đến, nơi giải thoát.
Idhalokaparalokasampattīnañhi sīlasadiso avassayo patiṭṭhā ārammaṇaṃ tāṇaṃ leṇaṃ gati parāyaṇaṃ natthi, sīlasadiso alaṅkāro natthi, sīlapupphasadisaṃ pupphaṃ natthi, sīlagandhasadiso gandho natthi, sīlālaṅkārena hi alaṅkataṃ sīlakusumapiḷandhanaṃ sīlagandhānulittaṃ sadevakopi loko olokento tittiṃ na gacchatīti evamādisīlaguṇapaṭisaṃyuttaṃ kathaṃ.
Indeed, for the prosperities of this world and the next, there is no support, foundation, reliance, refuge, shelter, destination, or ultimate resort like morality; there is no ornament like morality; there is no flower like the flower of morality; there is no fragrance like the fragrance of morality. For the world, including devas, looking upon a person adorned with the ornament of morality, wearing the garland of morality-flowers, and anointed with the fragrance of morality, is never satiated. This is the discourse associated with the virtues of morality, and so forth.
Thật vậy, không có nơi nương tựa, nền tảng, chỗ dựa, sự che chở, nơi trú ẩn, chỗ đến, nơi giải thoát nào sánh bằng giới đối với những thành tựu ở đời này và đời sau. Không có trang sức nào sánh bằng giới, không có hoa nào sánh bằng hoa giới, không có hương nào sánh bằng hương giới. Thật vậy, thế gian cùng với chư thiên, khi nhìn người được trang sức bằng trang sức giới, được cài hoa giới, được xức hương giới, cũng không bao giờ chán đủ. Đây là bài pháp liên quan đến những công đức giới như vậy.
250
Idaṃ pana sīlaṃ nissāya ayaṃ saggo labbhatīti dassetuṃ sīlānantaraṃ saggakathaṃ kathesi.
To show that this heaven is attained by relying on morality, he then taught a discourse on heaven after the discourse on morality.
Để chỉ ra rằng cõi trời này có được nhờ nương vào giới, sau giới, Ngài đã thuyết giảng về cõi trời.
Saggakathanti ayaṃ saggo nāma iṭṭho kanto manāpo, niccamettha kīḷā, niccaṃ sampattiyo labbhanti, cātumahārājikā devā navutivassasatasahassāni dibbasukhaṃ dibbasampattiṃ paṭilabhanti, tāvatiṃsā tisso ca vassakoṭiyo saṭṭhi ca vassasatasahassānīti evamādisaggaguṇapaṭisaṃyuttaṃ kathaṃ.
Saggakathā means that this heaven is desirable, pleasing, delightful; there is always amusement here, and prosperities are always attained. The Cātumahārājika devas obtain divine happiness and divine prosperity for ninety thousand years. The Tāvatiṃsa devas obtain them for thirty million years and sixty thousand years. This is the discourse associated with the virtues of heaven, and so forth.
Saggakatha có nghĩa là: Cõi trời này là nơi mong muốn, đáng yêu, làm hài lòng. Ở đây luôn có sự vui chơi, luôn có những thành tựu. Chư thiên Tứ Đại Thiên Vương hưởng thụ hạnh phúc và thành tựu của cõi trời trong chín mươi vạn năm. Chư thiên Đao Lợi trong ba mươi triệu sáu mươi vạn năm. Đây là bài pháp liên quan đến những công đức cõi trời như vậy.
Saggasampattiṃ kathayantānañhi buddhānaṃ mukhaṃ nappahoti.
Indeed, the mouths of Buddhas are insufficient to describe the prosperity of heaven.
Thật vậy, miệng của chư Phật không đủ để thuyết giảng về sự thành tựu của cõi trời.
Vuttampi cetaṃ – ‘‘anekapariyāyena kho ahaṃ, bhikkhave, saggakathaṃ katheyya’’ntiādi.
And this was also said: ‘Monks, I can speak of the heavens in various ways,’ and so on.
Điều này cũng đã được nói: “Này các tỳ-khưu, Ta có thể nói về câu chuyện thiên đường bằng nhiều phương cách khác nhau,” v.v.
251
Evaṃ saggakathāya palobhetvā puna hatthiṃ alaṅkaritvā tassa soṇḍaṃ chindanto viya – ‘‘ayampi saggo anicco addhuvo, na ettha chandarāgo kātabbo’’ti dassanatthaṃ – ‘‘appassādā kāmā bahudukkhā bahupāyāsā, ādīnavo ettha bhiyyo’’tiādinā (ma. ni. 1.235; 2.42) nayena kāmānaṃ ādīnavaṃ okāraṃ saṃkilesaṃ kathesi.
Having thus enticed with a talk on the heavens, then, like one adorning an elephant and then cutting off its trunk, in order to show, ‘This heaven, too, is impermanent, unstable, no desire-passion should be made here,’ He spoke of the danger, the degradation, and the defilement of sensual pleasures with such sayings as, ‘Sensual pleasures have little gratification, much suffering, much tribulation; the danger in them is greater.’
Như vậy, sau khi đã lôi cuốn bằng câu chuyện thiên đường, rồi lại như trang sức cho con voi mà cắt đứt vòi của nó—để chỉ ra rằng “thiên đường này cũng vô thường, không bền vững, không nên có tham ái ở đây”—Ngài đã thuyết giảng về sự nguy hiểm, sự thấp kém, và sự nhiễm ô của các dục vọng, theo cách nói “các dục vọng ít vị ngọt, nhiều khổ đau, nhiều phiền não, sự nguy hiểm ở đây nhiều hơn,” v.v.
Tattha ādīnavoti doso.
Therein, ādīnava means fault.
Trong đó, ādīnava có nghĩa là lỗi lầm.
Okāroti avakāro lāmakabhāvo.
Okāra means debasement, a deplorable state.
Okāra có nghĩa là sự thấp kém, sự ti tiện.
Saṃkilesoti tehi sattānaṃ saṃsāre saṃkilissanaṃ.
Saṃkilesa means the defilement of beings in saṃsāra by them.
Saṃkilesa có nghĩa là sự nhiễm ô của chúng sinh trong vòng luân hồi do các dục vọng ấy.
Yathāha – ‘‘kilissanti vata bho sattā’’ti (ma. ni. 2.351).
As it is said, ‘‘Indeed, beings are defiled!’’
Như đã nói: “Ôi! Chúng sinh bị nhiễm ô!”
Evaṃ kāmādīnavena tejjatvā nekkhamme ānisaṃsaṃ pakāsesi, pabbajjāya guṇaṃ pakāsesīti attho.
Having thus warned with the danger of sensual pleasures, He proclaimed the benefit of renunciation; that is, He proclaimed the excellence of going forth.
Như vậy, sau khi đã cảnh báo bằng sự nguy hiểm của các dục vọng, Ngài đã tuyên bố lợi ích của sự xuất ly, nghĩa là Ngài đã tuyên bố đức hạnh của đời sống xuất gia.
Sesaṃ ambaṭṭhasuttavaṇṇanāyaṃ vuttanayañceva uttānatthañca.
The rest is in the manner explained in the commentary on the Ambaṭṭha Sutta, and its meaning is clear.
Phần còn lại là cách nói đã được trình bày trong phần chú giải kinh Ambaṭṭha và cũng có nghĩa rõ ràng.
252
77. Alatthunti kathaṃ alatthuṃ?
77. Alatthuṃ (They obtained): How did they obtain?
77. Alatthuṃ — họ đã đạt được bằng cách nào?
Ehibhikkhubhāvena.
By becoming "Ehibhikkhu" (come, monk).
Bằng cách trở thành tỳ-khưu với lời mời “Ehi Bhikkhu.”
Bhagavā kira tesaṃ iddhimayapattacīvarassūpanissayaṃ olokento anekāsu jātīsu cīvaradānādīni disvā etha bhikkhavotiādimāha.
For the Blessed One, looking into the strong condition for their robes and bowls made by supernormal power, saw their acts of offering robes, etc., in many past existences, and then spoke the words, "Come, monks," and so on.
Đức Thế Tôn, khi xem xét nhân duyên mạnh mẽ để họ có được y bát do thần thông tạo ra, đã thấy các hạnh bố thí y phục, v.v., trong nhiều kiếp quá khứ của họ, và Ngài đã nói lời “Etha Bhikkhavo” (Hãy đến, này các tỳ-khưu), v.v.
Te tāvadeva bhaṇḍū kāsāyavasanā aṭṭhahi bhikkhuparikkhārehi sarīrapaṭimukkeheva vassasatikattherā viya bhagavantaṃ namassamānāva nisīdiṃsu.
Immediately, they became shaven-headed, clad in saffron robes, with the eight requisites of a bhikkhu appearing as if attached to their bodies, and like elders who had spent a hundred vassa, they sat down, worshipping the Blessed One.
Ngay lúc đó, họ trở thành những người đầu trọc, mặc y cà-sa, với tám vật dụng của một tỳ-khưu tự động xuất hiện trên thân, và họ ngồi xuống như những vị trưởng lão đã tu tập một trăm năm, đảnh lễ Đức Thế Tôn.
253
Sandassesītiādīsu idhalokatthaṃ sandassesi, paralokatthaṃ sandassesi.
In sandassesītiādi (He revealed, etc.), He revealed matters of this world, and He revealed matters of the other world.
Trong các câu như sandassesi, v.v., Ngài đã chỉ rõ về lợi ích ở đời này, Ngài đã chỉ rõ về lợi ích ở đời sau.
Idhalokatthaṃ dassento aniccanti dassesi, dukkhanti dassesi, anattāti dassesi, khandhe dassesi, dhātuyo dassesi, āyatanāni dassesi, paṭiccasamuppādaṃ dassesi, rūpakkhandhassa udayaṃ dassento pañca lakkhaṇāni dassesi, tathā vedanākkhandhādīnaṃ, tathā vayaṃ dassentopi udayabbayavasena paññāsalakkhaṇāni dassesi, paralokatthaṃ dassento nirayaṃ dassesi, tiracchānayoniṃ, pettivisayaṃ, asurakāyaṃ, tiṇṇaṃ kusalānaṃ vipākaṃ, channaṃ devalokānaṃ, navannaṃ brahmalokānaṃ sampattiṃ dassesi.
In revealing matters of this world, He revealed impermanence, He revealed suffering, He revealed non-self, He revealed the aggregates, He revealed the elements, He revealed the sense bases, He revealed Dependent Origination. In revealing the arising of the rūpa-khandha, He revealed five characteristics; similarly for the vedanā-khandha and so on. Similarly, in revealing cessation, He revealed fifty characteristics by way of arising and passing away. In revealing matters of the other world, He revealed hell, the animal realm, the realm of hungry ghosts, the asura realm, the results of the three wholesome deeds, the attainments of the six deva worlds, and the nine Brahma worlds.
Khi chỉ rõ về lợi ích ở đời này, Ngài đã chỉ ra sự vô thường, chỉ ra sự khổ, chỉ ra sự vô ngã, chỉ ra các uẩn, chỉ ra các giới, chỉ ra các xứ, chỉ ra duyên khởi; khi chỉ ra sự sinh khởi của sắc uẩn, Ngài đã chỉ ra năm đặc tính, cũng như của thọ uẩn, v.v.; và khi chỉ ra sự hoại diệt, Ngài cũng đã chỉ ra năm mươi đặc tính theo cách sinh diệt. Khi chỉ rõ về lợi ích ở đời sau, Ngài đã chỉ ra địa ngục, loài súc sinh, cõi ngạ quỷ, loài A-tu-la, quả báo của ba thiện nghiệp, sự sung túc của sáu cõi trời, và sự sung túc của chín cõi Phạm thiên.
254
Samādapesīti catupārisuddhisīlaterasadhutaṅgadasakathāvatthuādike kalyāṇadhamme gaṇhāpesi.
Samādāpesi (He exhorted them to undertake): He made them undertake virtuous practices such as the fourfold purity of morality, the thirteen ascetic practices (dhutaṅga), and the ten topics of discourse.
Samādāpesi có nghĩa là Ngài đã khiến họ thọ trì các thiện pháp như Tứ Thanh Tịnh Giới, mười ba pháp Đầu Đà, mười đề tài nói chuyện, v.v.
255
Samuttejesīti suṭṭhu uttejesi, abbhussāhesi.
Samuttejesi (He greatly encouraged): He highly stimulated and greatly inspired them.
Samuttejesi có nghĩa là Ngài đã khích lệ một cách mạnh mẽ, đã làm cho họ phấn chấn.
Idhalokatthañceva paralokatthañca tāsetvā tāsetvā adhigataṃ viya katvā kathesi.
He spoke having made them experience as if they had attained, terrifying and terrifying them with regard to matters of this world and the other world.
Ngài đã nói về lợi ích ở đời này và đời sau, khiến họ sợ hãi và đạt được như thể đã chứng ngộ.
Dvattiṃsakammakāraṇapañcavīsatimahābhayappabhedañhi idhalokatthaṃ buddhe bhagavati tāsetvā tāsetvā kathayante pacchābāhaṃ, gāḷhabandhanaṃ bandhitvā cātumahāpathe pahārasatena tāḷetvā dakkhiṇadvārena niyyamāno viya āghātanabhaṇḍikāya ṭhapitasīso viya sūle uttāsito viya mattahatthinā maddiyamāno viya ca saṃviggo hoti.
For when the Buddha, the Blessed One, speaks, terrifying and terrifying them with regard to matters of this world, such as the thirty-two karmic punishments and the twenty-five great dangers, one becomes agitated as if bound with one's arms tied behind one's back with a tight bond, beaten with a hundred blows at the crossroads, being led out through the southern gate, with one's head placed on the executioner's block, impaled on a stake, or being trampled by a rutting elephant.
Thật vậy, khi Đức Phật nói về các vấn đề ở đời này, bao gồm ba mươi hai loại hình phạt và hai mươi lăm nỗi sợ hãi lớn, khiến người nghe kinh hãi, họ trở nên sợ hãi như thể bị trói tay ra sau, bị đánh một trăm roi ở ngã tư đường, bị dẫn ra khỏi cổng phía nam, như thể đầu bị đặt trên thớt tử hình, như thể bị xiên trên cọc nhọn, hoặc như thể bị voi say giẫm đạp.
Paralokatthañca kathayante nirayādīsu nibbatto viya devalokasampattiṃ anubhavamāno viya ca hoti.
And when He speaks of matters of the other world, one feels as if born in hell and so on, or as if experiencing the bliss of the heavenly realms.
Và khi Ngài nói về các vấn đề ở đời sau, người nghe cảm thấy như thể mình đã tái sinh vào địa ngục, v.v., hoặc như thể đang hưởng thụ sự sung túc ở cõi trời.
256
Sampahaṃsesīti paṭiladdhaguṇena codesi, mahānisaṃsaṃ katvā kathesīti attho.
Sampahaṃsesi (He gladdened): He censured with the virtues already attained; the meaning is that He spoke making it of great benefit.
Sampahaṃsesi có nghĩa là Ngài đã khích lệ họ bằng những đức tính đã đạt được, nghĩa là Ngài đã nói về những lợi ích to lớn.
257
Saṅkhārānaṃ ādīnavanti heṭṭhā paṭhamamaggādhigamatthaṃ kāmānaṃ ādīnavaṃ kathesi, idha pana uparimaggādhigamatthaṃ – ‘‘aniccā, bhikkhave, saṅkhārā addhuvā anassāsikā, yāvañcidaṃ, bhikkhave, alameva sabbasaṅkhāresu nibbindituṃ alaṃ virajjituṃ alaṃ vimuccitu’’ntiādinā (a. ni. 7.66; saṃ. ni. 2.134) nayena saṅkhārānaṃ ādīnavañca lāmakabhāvañca tappaccayañca kilamathaṃ pakāsesi.
Saṅkhārānaṃ ādīnavaṃ (the danger in phenomena): Earlier, for the attainment of the first path, He spoke of the danger in sensual pleasures. Here, however, for the attainment of the higher paths, He proclaimed the danger, the degradation, and the weariness caused by phenomena with such sayings as, ‘Monks, phenomena are impermanent, unstable, unreliable. It is enough, monks, to become dispassionate towards all phenomena, enough to be disengaged, enough to be liberated.’
Saṅkhārānaṃ ādīnavaṃ — trước đây Ngài đã nói về sự nguy hiểm của các dục vọng để đạt được đạo quả đầu tiên, nhưng ở đây, để đạt được các đạo quả cao hơn, Ngài đã tuyên bố về sự nguy hiểm, sự thấp kém và sự mệt mỏi do các hành (saṅkhāra) gây ra, theo cách nói: “Này các tỳ-khưu, các hành là vô thường, không bền vững, không đáng tin cậy. Này các tỳ-khưu, chừng ấy thôi cũng đủ để nhàm chán tất cả các hành, đủ để ly tham, đủ để giải thoát.”
Yathā ca tattha nekkhamme, evamidha – ‘‘santamidaṃ, bhikkhave, nibbānaṃ nāma paṇītaṃ tāṇaṃ leṇa’’ntiādinā nayena nibbāne ānisaṃsaṃ pakāsesi.
And just as He proclaimed the benefit in renunciation there, so here He proclaimed the benefit in Nibbāna with such sayings as, ‘Monks, this Nibbāna is peaceful, sublime, a refuge, a shelter,’ and so on.
Và như ở đó Ngài đã tuyên bố lợi ích của sự xuất ly, thì ở đây Ngài đã tuyên bố lợi ích của Nibbāna, theo cách nói: “Này các tỳ-khưu, Nibbāna này là sự an tịnh, là tối thượng, là nơi nương tựa, là nơi ẩn náu,” v.v.
258
Mahājanakāyapabbajjāvaṇṇanā
The Description of the Going Forth of the Great Multitude
Chú giải về sự xuất gia của đại chúng
259
78. Mahājanakāyoti tesaṃyeva dvinnaṃ kumārānaṃ upaṭṭhākajanakāyoti.
78. Mahājanakāyo (the great multitude) refers to the multitude of attendants of those two princes themselves.
78. Mahājanakāyo có nghĩa là đoàn tùy tùng của hai vị hoàng tử đó.
260
80. Bhagavantaṃ saraṇaṃ gacchāma, dhammañcāti saṅghassa aparipuṇṇattā dvevācikameva saraṇamagamaṃsu.
80. Bhagavantaṃ saraṇaṃ gacchāma, dhammañcā (We go for refuge to the Blessed One, and to the Dhamma): As the Saṅgha was not yet complete, they went for refuge with only a two-fold declaration.
80. Bhagavantaṃ saraṇaṃ gacchāma, dhammañcā — vì Tăng đoàn chưa đầy đủ, họ chỉ quy y Tam Bảo bằng hai lời tuyên bố.
261
81. Alatthunti pubbe vuttanayeneva ehibhikkhubhāveneva alatthuṃ.
81. Alatthuṃ (They obtained): They obtained in the same way as described before, by becoming "Ehibhikkhu."
81. Alatthuṃ — họ đã đạt được bằng cách trở thành tỳ-khưu với lời mời “Ehi Bhikkhu,” theo cách đã nói ở trên.
Ito anantare pabbajitavārepi eseva nayo.
The same method applies to the subsequent occasion of ordination.
Cách này cũng áp dụng cho những người xuất gia trong trường hợp tiếp theo.
262
Cārikāanujānanavaṇṇanā
The Description of the Authorization for Wandering
Chú giải về sự cho phép du hành
263
85. Parivitakko udapādīti kadā udapādi?
85. Parivitakko udapādi (A thought arose): When did it arise?
85. Parivitakko udapādi — khi nào ý nghĩ này khởi lên?
Sambodhito satta saṃvaccharāni satta māse satta divase atikkamitvā udapādi.
It arose seven years, seven months, and seven days after the Enlightenment.
Nó khởi lên sau bảy năm, bảy tháng và bảy ngày kể từ khi giác ngộ.
Bhagavā kira pitusaṅgahaṃ karonto vihāsi.
The Blessed One, it is said, was residing there, showing compassion to His father.
Đức Thế Tôn đã ở lại để giúp đỡ phụ vương của Ngài.
Rājāpi cintesi – ‘‘mayhaṃ jeṭṭhaputto nikkhamitvā buddho jāto, dutiyaputto me nikkhamitvā aggasāvako jāto, purohitaputto dutiyaaggasāvako, ime ca avasesā bhikkhū gihikālepi mayhaṃ puttameva parivāretvā vicariṃsu.
The king also thought, "My elder son went forth and became the Buddha. My second son went forth and became the chief disciple. The purohita's son became the second chief disciple. And these other bhikkhus, even in their lay state, always surrounded my son.
Đức vua cũng suy nghĩ: “Con trai trưởng của ta đã xuất gia và trở thành Phật, con trai thứ của ta đã xuất gia và trở thành vị đại đệ tử đầu tiên, con trai của vị đạo sĩ chủ trì tế lễ đã trở thành vị đại đệ tử thứ hai, và những tỳ-khưu còn lại này, ngay cả khi còn là cư sĩ, cũng đã theo con trai ta. Tất cả những vị này bây giờ cũng là trách nhiệm của ta, và chính ta sẽ cung cấp cho họ bốn vật dụng, ta sẽ không cho phép người khác làm điều đó.”
Ime sabbe idānipi mayhaṃyeva bhāro, ahameva ca ne catūhi paccayehi upaṭṭhahissāmi, aññesaṃ okāsaṃ na dassāmī’’ti vihāradvārakoṭṭhakato paṭṭhāya yāva rājagehadvārā ubhayato khadirapākāraṃ kārāpetvā kilañjehi chādāpetvā vatthehi paṭicchādāpetvā upari ca chādāpetvā suvaṇṇatārakavicittaṃ samolambitatālakkhandhamattaṃ vividhapupphadāmavitānaṃ kārāpetvā heṭṭhā bhūmiyaṃ cittattharaṇehi santharāpetvā anto ubhosu passesu mālāvacchake puṇṇaghaṭe, sakalamaggavāsatthāya ca gandhantare pupphāni pupphantare gandhe ca ṭhapāpetvā bhagavato kālaṃ ārocāpesi.
Now all these are my responsibility; I alone will attend to them with the four requisites, and I will not give anyone else an opportunity." Having thought this, he had a thorny acacia fence built on both sides from the gate of the monastery up to the palace gate, covered with mats, then covered again with cloths, and roofed over. He had a canopy adorned with golden stars, adorned with various flower garlands, hanging down to the length of a palm tree trunk, and he had the ground beneath spread with embroidered rugs. Inside, on both sides, he had small flower plants and full water pots placed. And for the comfort of the entire path, he had various perfumes and flowers placed alternately, and then he announced the time for the Blessed One.
Sau khi suy nghĩ như vậy, từ cổng tu viện cho đến cổng hoàng cung, đức vua đã cho xây dựng một hàng rào bằng gỗ keo ở hai bên, che phủ bằng chiếu, rồi lại phủ bằng vải, và che phủ phía trên. Ông còn cho làm một mái vòm bằng dây hoa đủ loại, dài bằng thân cây thốt nốt, được trang trí bằng những ngôi sao vàng. Dưới đất, ông cho trải những tấm thảm đẹp, và ở hai bên trong, ông cho đặt những chậu hoa nhỏ, những bình nước đầy, và để phục vụ cho toàn bộ con đường, ông cho đặt hương ở chỗ này, hoa ở chỗ kia, rồi ông cho người thông báo giờ thọ trai cho Đức Thế Tôn.
264
Bhagavā bhikkhusaṅghaparivuto antosāṇiyāva rājagehaṃgantvā bhattakiccaṃ katvā vihāraṃ paccāgacchati.
The Blessed One, surrounded by the community of bhikkhus, went to the palace remaining within the curtain, ate His meal, and returned to the monastery.
Đức Thế Tôn, cùng với Tăng đoàn, đi vào hoàng cung qua màn che, dùng bữa xong rồi trở về tu viện.
Añño koci daṭṭhumpi na labhati, kuto pana bhikkhaṃ vā dātuṃ, pūjaṃ vā kātuṃ, dhammaṃ vā sotuṃ.
No one else could even see them, much less offer alms, make offerings, or listen to the Dhamma.
Không ai khác có thể nhìn thấy Ngài, huống chi là dâng cúng thức ăn, dâng cúng lễ vật, hoặc nghe pháp.
Nāgarā cintesuṃ – ‘‘ajja satthu loke uppannassa sattamāsādhikāni sattasaṃvaccharāni, mayañca daṭṭhumpi na labhāma, pageva bhikkhaṃ vā dātuṃ, pūjaṃ vā kātuṃ, dhammaṃ vā sotuṃ.
The townspeople thought, "Today, seven years and seven months have passed since the Master appeared in the world, and we cannot even see Him, much less offer alms, make offerings, or listen to the Dhamma.
Dân chúng trong thành suy nghĩ: “Hôm nay, đã bảy năm bảy tháng kể từ khi Đức Thế Tôn xuất hiện trên thế gian, mà chúng ta còn không thể nhìn thấy Ngài, chứ đừng nói đến việc dâng cúng thức ăn, dâng cúng lễ vật, hoặc nghe pháp.
Rājā – ‘mayhameva buddho, mayhameva dhammo, mayhameva saṅgho’ti mamāyitvā sayameva upaṭṭhahi.
The king, thinking, ‘The Buddha is mine alone, the Dhamma is mine alone, the Saṅgha is mine alone,’ has taken possession of them and attends to them himself.
Đức vua đã tự mình chăm sóc, coi như ‘Phật là của ta, Pháp là của ta, Tăng là của ta’.
Satthā ca uppajjamāno sadevakassa lokassa atthāya hitāya uppanno.
But the Master, when He arose, arose for the welfare and benefit of the entire world, including devas.
Đức Thế Tôn xuất hiện là vì lợi ích và hạnh phúc của toàn thể thế gian, bao gồm cả chư thiên.
Na hi raññoyeva nirayo uṇho assa, aññesaṃ nīluppalavanasadiso.
Indeed, hell would not be hot only for the king and like a lotus forest for others.
Không lẽ địa ngục chỉ nóng đối với đức vua, còn đối với người khác thì như rừng sen xanh sao?
Tasmā rājānaṃ vadāma.
Therefore, we will speak to the king.
Vì vậy, chúng ta hãy nói với đức vua.
Sace no satthāraṃ deti, iccetaṃ kusalaṃ.
If he gives us the Master, that would be good.
Nếu Ngài cho phép chúng ta gặp Đức Thế Tôn, thì đó là điều tốt.
No ce deti, raññā saddhiṃ yujjhitvāpi saṅghaṃ gahetvā dānādīni puññāni karoma.
If he does not give Him, we will fight with the king, take the Saṅgha, and perform meritorious deeds such as giving alms.
Nếu không, chúng ta sẽ chiến đấu với đức vua để đưa Tăng đoàn về và thực hiện các công đức như bố thí, v.v.
Na sakkā kho pana suddhanāgareheva evaṃ kātuṃ, ekaṃ jeṭṭhapurisampi gaṇhāmā’’ti.
But ordinary townspeople alone cannot do this; let us take a leading man with us."
Tuy nhiên, những người dân thường không thể làm như vậy được, chúng ta hãy chọn một vị trưởng lão để dẫn dắt.”
265
Te senāpatiṃ upasaṅkamitvā tassetamatthaṃ ārocetvā – ‘‘sāmi, kiṃ amhākaṃ pakkho hosi, udāhu rañño’’ti āhaṃsu.
Those townspeople approached the general, and having reported this matter to him, said, "Lord, are you on our side, or the king's?"
Họ đến gặp vị tướng quân, kể cho ông ấy nghe sự việc này và hỏi: “Thưa ngài, ngài đứng về phía chúng tôi, hay về phía nhà vua?”
So – ‘‘ahaṃ tumhākaṃ pakkho homi, api ca kho pana paṭhamadivaso mayhaṃ dātabbo’’ti.
He said, "I will be on your side, but the first day must be given to me."
Ông ấy nói: “Tôi đứng về phía các ông, nhưng ngày đầu tiên phải dành cho tôi.”
Te sampaṭicchiṃsu.
Those townspeople accepted.
Họ đã chấp nhận.
So rājānaṃ upasaṅkamitvā – ‘‘nāgarā, deva, tumhākaṃ kupitā’’ti āha.
That general approached the king and said, "Your Majesty, the townspeople are angry with you."
Ông ấy đến gặp nhà vua và tâu: “Tâu Đại vương, dân chúng đang tức giận với ngài.”
Kimatthaṃ tātāti?
"My son, for what reason are they angry?"
“Vì lý do gì vậy, con trai?”
Satthāraṃ kira tumheyeva upaṭṭhahatha, amhe na labhāmāti.
"Indeed, it is because you alone attend to the Teacher, and we do not get to attend."
“Họ nói rằng chỉ có ngài được cúng dường cho Bậc Đạo Sư, còn chúng tôi thì không được.”
Sace idānipi labhanti, na kuppanti, alabhantā tumhehi saddhiṃ yujjhitukāmā devāti.
"Your Majesty, if they still get to attend now, they will not be angry. If they do not get to attend, they wish to fight with you."
“Nếu bây giờ họ được cúng dường, họ sẽ không tức giận; nếu không được, họ muốn giao chiến với ngài, tâu Đại vương.”
Yujjhāmi, tāta, nāhaṃ bhikkhusaṅghaṃ demīti.
"My son, I will fight; I will not give up the Saṅgha of bhikkhus."
“Ta sẽ giao chiến, con trai, ta sẽ không nhường Tăng đoàn.”
Deva tumhākaṃ dāsā tumhehi saddhiṃ yujjhāmāti vadanti, tumhe kaṃ gaṇhitvā yujjhissathāti?
"Your Majesty, your servants say they will fight with you. Whom will you take to fight?"
“Tâu Đại vương, các thần dân của ngài nói rằng họ sẽ giao chiến với ngài, vậy ngài sẽ dựa vào ai để giao chiến?”
Nanu tvaṃ senāpatīti?
"Are you not the general?"
“Chẳng phải con là tướng quân sao?”
Nāgarehi vinā na samattho ahaṃ devāti.
"Your Majesty, without the townspeople, I am not capable."
“Tâu Đại vương, không có dân chúng thì thần không thể làm gì được.”
Tato rājā – ‘‘balavanto nāgarā, senāpatipi tesaññeva pakkho’’ti ñatvā ‘‘aññānipi sattamāsādhikāni sattasaṃvaccharāni mayhaṃ bhikkhusaṅghaṃ dadantū’’ti āha.
Then the king, knowing that "the townspeople are powerful, and even the general is on their side," said, "Let them give the Saṅgha of bhikkhus to me for another seven years and seven months."
Khi đó, nhà vua biết rằng “dân chúng rất mạnh, và tướng quân cũng đứng về phía họ,” nên nói: “Hãy để họ cúng dường Tăng đoàn cho ta thêm bảy năm, bảy tháng và bảy ngày nữa.”
Nāgarā na sampaṭicchiṃsu.
The townspeople did not accept.
Dân chúng không chấp nhận.
Rājā – ‘‘cha vassāni, pañca, cattāri, tīṇi, dve, ekavassa’’nti hāpesi.
The king reduced it: "Six years, five, four, three, two, one year."
Nhà vua giảm xuống sáu năm, năm, bốn, ba, hai, và một năm.
Evaṃ hāpentepi na sampaṭicchiṃsu.
Even with such reductions, they did not accept.
Dù giảm như vậy, họ vẫn không chấp nhận.
Aññe satta divase yāci.
Then he requested for seven more days.
Ngài lại xin thêm bảy ngày.
Nāgarā – ‘‘atikakkhaḷaṃ dāni raññā saddhiṃ kātuṃ na vaṭṭatī’’ti anujāniṃsu.
The townspeople thought, "Now it is not proper to be too harsh with the king," and they granted it.
Dân chúng nghĩ: “Bây giờ không nên quá cứng rắn với nhà vua,” nên đã đồng ý.
266
Rājā sattamāsādhikānaṃ sattannaṃ saṃvaccharānaṃ sajjitaṃ dānamukhaṃ sattannameva divasānaṃ vissajjetvā cha divase kesañci apassantānaṃyeva dānaṃ datvā sattame divase nāgare pakkosāpetvā – ‘‘sakkhissatha, tāta, evarūpaṃ dānaṃ dātu’’nti āha.
The king, having dedicated the gifts prepared for seven years and seven months to just seven days, gave gifts for six days without anyone else seeing, and on the seventh day, he had the townspeople summoned and said, "My sons, would you be able to give such a gift?"
Nhà vua đã chuẩn bị lễ vật cúng dường cho bảy năm, bảy tháng và bảy ngày, nhưng nay chỉ cúng dường trong bảy ngày. Sáu ngày đầu tiên, ngài cúng dường mà không để ai khác nhìn thấy, đến ngày thứ bảy, ngài cho gọi dân chúng đến và hỏi: “Này các con, các con có thể cúng dường một lễ vật như thế này không?”
Tepi – ‘‘nanu amheyeva nissāya taṃ devassa uppanna’’nti vatvā – ‘‘sakkhissāmā’’ti āhaṃsu.
They too said, "Did that not arise for Your Majesty because of us?" and then added, "We will be able."
Họ đáp: “Chẳng phải nhờ chúng con mà lễ vật này mới đến với Đại vương sao?” và nói: “Chúng con có thể làm được.”
Rājā piṭṭhihatthena assūni puñchamāno bhagavantaṃ vanditvā – ‘‘bhante, ahaṃ aṭṭhasaṭṭhibhikkhusatasahassaṃ aññassa vāraṃ akatvā yāvajīvaṃ catūhi paccayehi upaṭṭhahissāmīti cintesiṃ.
The king, wiping his tears with the back of his hand, paid homage to the Bhagavā and said, "Bhante, I intended to attend to one hundred sixty-eight thousand bhikkhus with the four requisites for as long as I live, without giving a turn to anyone else.
Nhà vua lấy mu bàn tay lau nước mắt, đảnh lễ Đức Thế Tôn và tâu: “Bạch Thế Tôn, con đã nghĩ rằng con sẽ cúng dường bốn vật dụng cho một trăm sáu mươi tám ngàn Tỳ-kheo suốt đời mà không để ai khác có lượt.
Nāgarā na dāni me anuññātā, nāgarā hi ‘mayaṃ dānaṃ dātuṃ na labhāmā’ti kuppanti.
But now the townspeople have not permitted me. Indeed, the townspeople are angry, saying, 'We do not get to give alms.'
Nhưng bây giờ dân chúng không cho phép con. Dân chúng tức giận vì 'chúng tôi không được cúng dường.'
Bhagavā sve paṭṭhāya tesaṃ anuggahaṃ karothā’’ti āha.
Bhagavā, please show favor to them starting from tomorrow."
Bạch Thế Tôn, xin ngài hãy ban ân cho họ từ ngày mai trở đi.”
267
Atha dutiyadivase senāpati mahādānaṃ sajjetvā – ‘‘ajja yathā añño koci ekabhikkhampi na deti, evaṃ rakkhathā’’ti samantā purise ṭhapesi.
Then on the second day, the general prepared a great almsgiving and placed men all around, saying, "Today, let no one else give even a single bhikkhu any alms; guard against this."
Rồi ngày hôm sau, vị tướng quân chuẩn bị một đại lễ cúng dường và bố trí người canh gác khắp nơi, nói: “Hôm nay, hãy canh gác để không ai khác có thể cúng dường dù chỉ một thìa cơm cho một vị Tỳ-kheo.”
Taṃ divasaṃ seṭṭhibhariyā rodamānā dhītaraṃ āha – ‘‘sace, amma, tava pitā jīveyya, ajjāhaṃ paṭhamaṃ dasabalaṃ bhojeyya’’nti.
On that day, the treasurer's wife, weeping, said to her daughter, "If, my dear, your father were alive, today I would be the first to offer food to the Dasabala."
Ngày hôm đó, vợ của vị trưởng giả khóc lóc nói với con gái: “Nếu cha con còn sống, con gái ạ, hôm nay mẹ đã cúng dường cho Đức Thập Lực trước tiên rồi.”
Sā taṃ āha – ‘‘amma, mā cintayi, ahaṃ tathā karissāmi yathā buddhappamukho bhikkhusaṅgho paṭhamaṃ amhākaṃ bhikkhaṃ paribhuñjissatī’’ti.
She said to her, "Mother, do not worry; I will ensure that the Saṅgha of bhikkhus, headed by the Buddha, will first partake of our alms."
Cô ấy nói với mẹ: “Mẹ ơi, đừng lo lắng, con sẽ làm sao để Tăng đoàn do Đức Phật dẫn đầu sẽ thọ thực bát cơm của chúng ta trước tiên.”
Tato satasahassagghanikāya suvaṇṇapātiyā nirudakapāyāsassa pūretvā sappimadhusakkarādīhi abhisaṅkharitvā aññāya pātiyā paṭikujjitvā taṃ sumanamālāguḷehi parikkhipitvā mālāguḷasadisaṃ katvā bhagavato gāmaṃ pavisanavelāya sayameva ukkhipitvā dāsigaṇaparivutā nagarā nikkhami.
Then, filling a golden bowl worth one hundred thousand with milk-rice without water, and preparing it with ghee, honey, sugar, and so on, she covered it with another bowl, surrounded it with jasmine flower garlands, making it resemble a flower garland, and when the Bhagavā was entering the village, she herself carried it out of the city, accompanied by a group of female attendants.
Rồi cô ấy lấy một bát vàng trị giá một trăm ngàn, đổ đầy cháo sữa đặc không nước, thêm bơ, mật, đường, v.v., rồi úp một bát khác lên, bao quanh bằng những vòng hoa lài, làm cho nó trông giống như một vòng hoa, rồi tự mình mang theo, cùng với đoàn tỳ nữ, rời khỏi thành phố vào lúc Đức Thế Tôn đang vào làng.
Antarāmagge senāpatiupaṭṭhākā – ‘‘amma, mā ito agamā’’ti vadanti.
On the way, the general's attendants said, "Mother, do not go this way."
Trên đường, những người phục vụ của vị tướng quân nói: “Cô ơi, đừng đi lối này.”
Mahāpuññā nāma manāpakathā honti, na ca tesaṃ punappunaṃ bhaṇantānaṃ kathā paṭikkhipituṃ sakkā hoti.
People with great merit have pleasant conversations, and it is not possible to refuse them even if they speak repeatedly.
Những người có phước lớn có lời nói dễ thương, và không thể từ chối lời nói của họ khi họ nói đi nói lại.
Sā – ‘‘cūḷapitā mahāpitā mātulā kissa tumhe gantuṃ na dethā’’ti āha.
She said, "My uncles and elder uncles, why do you not let me go?"
Cô ấy nói: “Các chú, các bác, tại sao các chú các bác không cho tôi đi?”
Senāpatinā – ‘‘aññassa kassaci khādanīyabhojanīyaṃ dātuṃ mā dethā’’ti ṭhapitamha ammāti.
"Mother, the general has instructed us, 'Do not allow anyone else to give any food or edibles.'"
“Cô ơi, tướng quân đã ra lệnh ‘không được cho bất cứ ai khác cúng dường đồ ăn thức uống.’”
Kiṃ pana me hatthe khādanīyaṃ bhojanīyaṃ passathāti?
"But do you see any food or edibles in my hand?"
“Vậy các chú các bác có thấy đồ ăn thức uống trong tay tôi không?”
Mālāguḷaṃ passāmāti.
"We see a flower garland," they replied.
“Chúng tôi thấy một vòng hoa.”
Kiṃ tumhākaṃ senāpati mālāguḷapūjampi kātuṃ na detīti?
"Does your general not even allow offering flower garlands?"
“Tướng quân của các chú các bác không cho phép cúng dường hoa sao?”
Deti, ammāti.
"He does, Mother," they replied.
“Cho phép, cô ơi.”
Tena hi, apetha, apethāti bhagavantaṃ upasaṅkamitvā mālāguḷaṃ gaṇhāpetha bhagavāti āha.
"Then move aside, move aside!" she said, and approaching the Bhagavā, she pleaded, "Bhagavā, please accept this flower garland."
“Vậy thì, tránh ra, tránh ra!” Cô ấy nói như vậy, rồi đến gần Đức Thế Tôn và thưa: “Bạch Thế Tôn, xin ngài hãy nhận vòng hoa này.”
Bhagavā ekaṃ senāpatissupaṭṭhākaṃ oloketvā mālāguḷaṃ gaṇhāpesi.
The Bhagavā looked at one of the general's attendants and had the flower garland accepted.
Đức Thế Tôn nhìn một người phục vụ của vị tướng quân và cho nhận vòng hoa.
Sā bhagavantaṃ vanditvā – ‘‘bhagavā, bhavābhave nibbattiyaṃ me sati paritassanajīvitaṃ nāma mā hotu, ayaṃ sumanamālā viya nibbattanibbattaṭṭhāne piyāva homi, nāmena ca sumanā yevā’’ti patthanaṃ katvā satthārā – ‘‘sukhinī hohī’’ti vuttā vanditvā padakkhiṇaṃ katvā pakkāmi.
She paid homage to the Bhagavā and made a wish: "Bhagavā, if I am reborn in any existence, may I never have a life of distress. May I be beloved in every place of rebirth, like this jasmine garland, and may my name always be Sumanā." After the Teacher said to her, "May you be happy," she paid homage, circumambulated him clockwise, and departed.
Cô ấy đảnh lễ Đức Thế Tôn và ước nguyện: “Bạch Thế Tôn, nếu con phải tái sinh trong các cõi, xin đừng để con có một cuộc sống lo âu, sợ hãi. Xin cho con được yêu mến ở bất cứ nơi nào con tái sinh, giống như vòng hoa lài này, và xin cho con có tên là Sumanā.” Sau khi được Bậc Đạo Sư nói: “Con hãy được hạnh phúc,” cô ấy đảnh lễ, đi nhiễu hữu và rời đi.
268
Bhagavā senāpatissa gehaṃ gantvā paññattāsane nisīdi.
The Bhagavā went to the general's house and sat on the prepared seat.
Đức Thế Tôn đến nhà vị tướng quân và ngồi vào chỗ đã được sắp đặt.
Senāpati yāguṃ gahetvā upagañchi, satthā pattaṃ pidahi.
The general approached with gruel, but the Teacher covered his bowl.
Vị tướng quân mang cháo đến, nhưng Bậc Đạo Sư đã đậy bát lại.
Nisinno, bhante, bhikkhusaṅghoti.
"Bhante, the Saṅgha of bhikkhus is seated," he said.
“Bạch Thế Tôn, Tăng đoàn đã an tọa rồi.”
Atthi no eko antarā piṇḍapāto laddhoti.
"We received a meal in between," the Bhagavā said.
“Chúng ta đã nhận được một bát cơm cúng dường trên đường đi rồi.”
So mālaṃ apanetvā piṇḍapātaṃ addasa.
The general removed the garland and saw the meal.
Ông ấy gỡ vòng hoa ra và thấy bát cơm.
Cūḷupaṭṭhāko āha – ‘‘sāmi, mālāti maṃ vatvā mātugāmo vañcesī’’ti.
His junior attendant said, "Master, that woman deceived me, saying it was a garland."
Người phục vụ nhỏ tuổi nói: “Thưa chủ nhân, người phụ nữ đó đã lừa tôi khi nói đó là hoa.”
Pāyāso bhagavantaṃ ādiṃ katvā sabbesaṃ bhikkhūnaṃ pahoti.
The milk-rice was enough for all the bhikkhus, beginning with the Bhagavā.
Cháo sữa đó đủ cho tất cả các Tỳ-kheo, bắt đầu từ Đức Thế Tôn.
Senāpatipi attano deyyadhammaṃ adāsi.
The general also offered his own gift.
Vị tướng quân cũng đã cúng dường lễ vật của mình.
Satthā bhattakiccaṃ katvā maṅgalaṃ vatvā pakkāmi.
After finishing his meal, the Teacher spoke words of blessing and departed.
Bậc Đạo Sư sau khi dùng bữa xong, ban lời chúc lành và rời đi.
Senāpati – ‘‘kā nāma sā piṇḍapātamadāsī’’ti pucchi.
The general asked, "Who was that woman who offered the alms?"
Vị tướng quân hỏi: “Người phụ nữ nào đã cúng dường bát cơm đó?”
Seṭṭhidhītā, sāmīti.
"She is the treasurer's daughter, Master," they replied.
“Thưa chủ nhân, đó là con gái của vị trưởng giả.”
Sappaññā sā itthī, evarūpāya ghare vasantiyā purisassa saggasampatti nāma na dullabhāti taṃ ānetvā jeṭṭhikaṭṭhāne ṭhapesi.
"That woman is wise; for a man who has such a woman dwelling in his house, heavenly happiness is not difficult to obtain." He had her brought and appointed her to the position of chief wife.
“Người phụ nữ đó thật trí tuệ! Đối với người đàn ông có một người phụ nữ như vậy trong nhà, sự giàu có ở cõi trời không khó đạt được.” Ông ấy nói như vậy, rồi đón cô ấy về và đặt vào vị trí vợ cả.
269
Punadivase nāgarā dānamadaṃsu, punadivase rājāti ekantarikāya dānaṃ dātuṃ ārabhiṃsu.
On the next day, the townspeople gave alms, and on the day after that, the king. Thus, they began to give alms on alternate days.
Ngày hôm sau, dân chúng cúng dường, rồi ngày hôm sau nữa là nhà vua, cứ thế họ bắt đầu cúng dường xen kẽ nhau.
Rājāpi carapurise ṭhapetvā nāgarehi dinnadānato atirekataraṃ deti, nāgarāpi tatheva katvā raññā dinnadānato atirekataraṃ.
The king also appointed investigators to go around, and he gave more than the gifts given by the townspeople. The townspeople also did the same, giving more than the gifts given by the king.
Nhà vua cũng cho người đi dò xét và cúng dường nhiều hơn những gì dân chúng cúng dường, và dân chúng cũng làm như vậy, cúng dường nhiều hơn những gì nhà vua cúng dường.
Rājagehe nāṭakitthiyo daharasāmaṇere vadanti – ‘‘gaṇhatha, tātā, na gahapatikānaṃ gattavatthādīsu puñchitvā bāḷadārakānaṃ kheḷasiṅghāṇikādidhovanahatthehi kataṃ, suciṃ paṇītaṃ kata’’nti.
In the king's palace, the dancing girls would say to the young novices, "Take these, dear sons! These were not made by householders after wiping their bodies and clothes, nor by the hands of unruly children who have washed their spittle and snot. These are pure and exquisite!"
Trong cung vua, các vũ nữ nói với các Sa-di nhỏ tuổi: “Này các con, hãy nhận lấy! Đây không phải là đồ do các gia chủ đã dùng để lau quần áo hay các vật dụng khác, hoặc do những đứa trẻ ngu ngốc đã dùng tay rửa nước mũi dãi mà làm ra. Đây là đồ sạch sẽ, tinh khiết và cao quý.”
Punadivase nāgarāpi dadamānā vadanti – ‘‘gaṇhatha, tātā, na nagaragāmanigamādīsu saṅkaḍḍhitataṇḍulakhīradadhisappiādīhi, na aññesaṃ jaṅghasīsapiṭṭhiādīni bhañjitvā āharāpitehi kataṃ, jātisappikhīrādīhiyeva kata’’nti.
On the next day, the townspeople, while giving alms, would say, "Take these, dear sons! These were not made from rice, milk, curd, ghee, etc., collected from towns, villages, and market-towns, nor by breaking the shins, heads, and backs of others. These were made solely from pure ghee and milk from our own households!"
Ngày hôm sau, khi dân chúng cúng dường, họ cũng nói: “Này các con, hãy nhận lấy! Đây không phải là đồ được làm từ gạo, sữa, sữa chua, bơ, v.v., được gom góp từ các thành phố, làng mạc, thị trấn, hoặc do người khác đã phải chịu đựng gian khổ để mang về. Đây là đồ được làm từ bơ sữa nguyên chất, v.v.”
Evaṃ sattasu saṃvaccharesu sattasu māsesu sattasu divasesu ca atikkantesu atha bhagavato ayaṃ vitakko udapādi.
Thus, after seven years, seven months, and seven days had passed, this thought arose in the Bhagavā.
Cứ như vậy, sau bảy năm, bảy tháng và bảy ngày trôi qua, một ý nghĩ đã khởi lên trong Đức Thế Tôn.
Tena vuttaṃ – ‘‘sambodhito satta saṃvaccharāni satta māsāni satta divasāni atikkamitvā udapādī’’ti.
Therefore, it is said, "Seven years, seven months, and seven days after enlightenment, it arose."
Vì thế, đã nói: “Bảy năm, bảy tháng và bảy ngày sau khi đạt giác ngộ, ý nghĩ đó đã khởi lên.”
270
87. Aññataro mahābrahmāti dhammadesanaṃ āyācitabrahmāva.
87. A certain mahābrahmā: this refers to the Brahmā who requested the teaching of the Dhamma.
87. Một vị Phạm Thiên vĩ đại có nghĩa là vị Phạm Thiên đã thỉnh cầu thuyết Pháp.
271
89. Caturāsīti āvāsasahassānīti caturāsīti vihārasahassāni.
89. Eighty-four thousand monasteries (āvāsasahassāni): this means eighty-four thousand monasteries (vihārasahassāni).
89. Tám mươi bốn ngàn trú xứ có nghĩa là tám mươi bốn ngàn tu viện.
Te sabbepi dvādasasahassabhikkhugaṇhanakā mahāvihārā abhayagiricetiyapabbatacittalapabbatamahāvihārasadisāva ahesuṃ.
All those great monasteries, capable of accommodating twelve thousand bhikkhus, were like the Abhayagiri Vihāra, Cetiya Pabbata Vihāra, and Cittala Pabbata Mahāvihāra.
Tất cả những đại tu viện này đều có thể chứa mười hai ngàn Tỳ-kheo, giống như các đại tu viện Abhayagiri, Cetiyapabbata và Citttalapabbata.
272
90. Khantī paramaṃ tapoti adhivāsanakhanti nāma paramaṃ tapo.
90. Patience is the highest austerity (Khantī paramaṃ tapo): enduring patience (adhivāsanakhanti) is indeed the highest austerity.
90. Khantī paramaṃ tapo (Nhẫn nhục là khổ hạnh tối thượng) có nghĩa là sự nhẫn nhục chịu đựng là khổ hạnh tối thượng.
Titikkhāti khantiyā eva vevacanaṃ.
Forbearance (Titikkhā): is a synonym for patience (khanti) itself.
Titikkhā là một từ đồng nghĩa với khantī.
Titikkhā saṅkhātā adhivāsanakhanti uttamaṃ tapoti attho.
Tolerance, known as adhivāsanakhanti, is the highest ascetic practice (tapa).
Sự nhẫn nhục (titikkhā) được gọi là adhivāsanakhanti (sự chịu đựng nhẫn nại) là pháp khổ hạnh tối thượng, đó là ý nghĩa.
Nibbānaṃ paramanti sabbākārena pana nibbānaṃ paramanti vadanti buddhā.
Nibbāna is supreme means that the Buddhas declare Nibbāna to be supreme in all respects.
Còn Nibbāna là tối thượng thì chư Phật tuyên bố Nibbāna là tối thượng về mọi phương diện.
Na hi pabbajito parūpaghātīti yo adhivāsanakhantivirahitattā paraṃ upaghāteti bādheti hiṃsati, so pabbajito nāma na hoti.
Truly, one who has gone forth does not harm others means that one who, being devoid of the patience of endurance (adhivāsanakhanti), harms, oppresses, or torments another, is not called a pabbajita.
Quả thật, người xuất gia không làm hại người khác (Na hi pabbajito parūpaghātī) có nghĩa là người nào do không có adhivāsanakhanti mà làm hại, gây tổn thương, bức hại người khác, thì người ấy không phải là pabbajita (người xuất gia).
Catutthapādo pana tasseva vevacanaṃ.
The fourth line, however, is a synonym for that very statement.
Còn đoạn thứ tư là từ đồng nghĩa của đoạn đó.
‘‘Na hi pabbajito’’ti etassa hi na samaṇo hotīti vevacanaṃ.
For "Truly, one who has gone forth" is synonymous with "is not a samaṇa."
Quả thật, cụm từ “Na hi pabbajito” là từ đồng nghĩa với “na samaṇo hoti”.
Parūpaghātīti etassa paraṃ viheṭhayantoti vevacanaṃ.
"Harmer of others" is synonymous with "one who torments others."
Cụm từ “parūpaghātī” là từ đồng nghĩa với “paraṃ viheṭhayanto” (làm hại người khác).
Atha vā parūpaghātīti sīlūpaghātī.
Alternatively, "harmer of others" means one who destroys morality.
Hoặc là, parūpaghātī có nghĩa là người hủy hoại giới (sīlūpaghātī).
Sīlañhi uttamaṭṭhena paranti vuccati.
For morality is called para (supreme) in the sense of being excellent.
sīla (giới) được gọi là para (tối thượng) do ý nghĩa tối thượng.
Yo ca samaṇo paraṃ yaṃ kañci sattaṃ viheṭhayanto parūpaghātī hoti, attano sīlaṃ vināsako, so pabbajito nāma na hotīti attho.
The meaning is that any samaṇa who torments any living being, thereby harming others and destroying his own morality, is not called a pabbajita.
Và ý nghĩa là: vị Sa-môn nào làm hại bất kỳ chúng sinh nào, là người hủy hoại giới của chính mình, thì người ấy không phải là pabbajita.
Athavā yo adhivāsanakhantiyā abhāvato parūpaghātī hoti, paraṃ antamaso ḍaṃsamakasampi sañcicca jīvitā voropeti, so na hi pabbajito.
Or else, one who, due to the absence of the patience of endurance, harms others, even intentionally depriving a gnat or mosquito of life, is truly not a pabbajita.
Hoặc là, người nào do không có adhivāsanakhanti mà làm hại người khác, cố ý tước đoạt mạng sống của người khác, thậm chí là ruồi muỗi, thì người ấy quả thật không phải là pabbajita.
Kiṃ kāraṇā?
For what reason?
Vì lý do gì?
Malassa apabbājitattā.
Because defilement has not been expelled.
Vì chưa xua đuổi được cấu uế.
‘‘Pabbājayamattano malaṃ, tasmā pabbajitoti vuccatī’’ti (dha. pa. 388) idañhi pabbajitalakkhaṇaṃ.
For this is the characteristic of one who has gone forth: "He expels his own defilement, therefore he is called one who has gone forth" (Dhp. 388).
Vì đặc tính của pabbajita là: “Vì xua đuổi cấu uế của mình, nên được gọi là pabbajita.”
Yopi na heva kho upaghāteti, na māreti, api ca daṇḍādīhi viheṭheti, so paraṃ viheṭhayanto samaṇo na hoti.
And one who does not kill or harm, but rather torments with sticks and so forth, is not a samaṇa who torments others.
Vị nào không làm hại, không giết hại, nhưng lại làm khổ người khác bằng gậy gộc, v.v., thì vị ấy không phải là Sa-môn.
Kiṃ kāraṇā?
For what reason?
Vì lý do gì?
Vihesāya asamitattā.
Because torment has not been extinguished.
Vì sự làm hại chưa được làm lắng dịu.
‘‘Samitattā hi pāpānaṃ, samaṇoti pavuccatī’’ti (dha. pa. 265) idañhi samaṇalakkhaṇaṃ.
For this is the characteristic of a samaṇa: "Because he has appeased evil, he is called a samaṇa" (Dhp. 265).
Vì đặc tính của Sa-môn là: “Vì đã làm lắng dịu các điều ác, nên được gọi là Sa-môn.”
273
Dutiyagāthāya sabbapāpassāti sabbākusalassa.
In the second verse, "all evil" means all unwholesome actions.
Trong kệ ngôn thứ hai, sabbapāpassā có nghĩa là của tất cả các điều bất thiện.
Akaraṇanti anuppādanaṃ.
"Not doing" means not giving rise to.
Akaraṇaṃ (không làm) có nghĩa là không phát sinh.
Kusalassāti catubhūmikakusalassa.
"Of wholesome" means of wholesome actions belonging to the four planes of existence.
Kusalassā (của điều thiện) có nghĩa là của điều thiện thuộc bốn cõi.
Upasampadāti paṭilābho.
"Acquiring" means obtaining.
Upasampadā (thành tựu) có nghĩa là đạt được.
Sacittapariyodapananti attano cittajotanaṃ, taṃ pana arahattena hoti.
"Purifying one's own mind" means enlightening one's own mind, which occurs through arahantship.
Sacittapariyodapanaṃ (làm trong sạch tâm mình) có nghĩa là làm sáng tâm của mình, điều đó xảy ra nhờ quả vị A-la-hán.
Iti sīlasaṃvarena sabbapāpaṃ pahāya samathavipassanāhi kusalaṃ sampādetvā arahattaphalena cittaṃ pariyodāpetabbanti etaṃ buddhānaṃ sāsanaṃ ovādo anusiṭṭhī ti.
Thus, abandoning all evil through morality (sīlasaṃvara), accomplishing wholesome states through serenity and insight, and purifying the mind with the fruit of arahantship – this is the teaching, counsel, and instruction of the Buddhas.
Như vậy, từ bỏ mọi điều ác bằng sự giữ giới, thành tựu điều thiện bằng samatha (tịnh chỉ) và vipassanā (quán) rồi làm trong sạch tâm bằng quả vị A-la-hán, đó là lời giáo huấn, lời khuyên dạy của chư Phật.
274
Tatiyagāthāya anūpavādoti vācāya kassaci anupavadanaṃ.
In the third verse, "not reviling" means not verbally reviling anyone.
Trong kệ ngôn thứ ba, anūpavādo (không phỉ báng) có nghĩa là không phỉ báng bất kỳ ai bằng lời nói.
Anūpaghātoti kāyena upaghātassa akaraṇaṃ.
"Not harming" means not physically inflicting harm.
Anūpaghāto (không làm hại) có nghĩa là không làm hại bằng thân.
Pātimokkheti yaṃ taṃ paatimokkhaṃ, atipamokkhaṃ, uttamasīlaṃ, pāti vā agativisesehi mokkheti duggatibhayehi, yo vā naṃ pāti, taṃ mokkhetīti ‘‘pātimokkha’’nti vuccati.
"In the Pātimokkha": that which is called Pātimokkha is the foremost, supreme morality, or it protects (pāti) from wrong paths and delivers (mokkheti) from the fear of lower realms, or it protects one who observes it and delivers him; therefore, it is called "Pātimokkha."
Pātimokkhe (trong giới bổn) có nghĩa là giới bổn (pātimokkha) đó là sự giải thoát tối thượng, giới hạnh tối cao, hoặc nó bảo vệ khỏi những nẻo ác, giải thoát khỏi những nỗi sợ khổ cảnh, hoặc người nào bảo vệ giới đó, thì giới đó giải thoát người ấy khỏi những nỗi sợ khổ cảnh, nên được gọi là “pātimokkha”.
Tasmiṃ pātimokkhe ca saṃvaro.
And restraint in that Pātimokkha.
Và sự phòng hộ trong giới bổn đó.
Mattaññutāti paṭiggahaṇaparibhogavasena pamāṇaññutā.
"Moderation" means knowing the measure in terms of receiving and consuming.
Mattaññutā (biết đủ) có nghĩa là biết lượng vừa phải trong việc thọ nhận và sử dụng.
Pantañca sayanāsananti sayanāsanañca saṅghaṭṭanavirahitanti attho.
"And solitary lodging" means that the lodging is free from crowdedness.
Pantañca sayanāsanaṃ (chỗ nằm ngồi thanh vắng) có nghĩa là chỗ nằm ngồi không có sự va chạm.
Tattha dvīhiyeva paccayehi catupaccayasantoso dīpito hotīti veditabbo.
Herein, it should be understood that contentment with the four requisites is indicated by just two requisites.
Tại đó, cần phải hiểu rằng sự biết đủ về bốn vật dụng đã được chỉ ra chỉ bằng hai vật dụng.
Etaṃ buddhāna sāsananti etaṃ parassa anupavadanaṃ anupaghātanaṃ pātimokkhasaṃvaro paṭiggahaṇaparibhogesu mattaññutā aṭṭhasamāpattivasibhāvāya vivittasenāsanasevanañca buddhānaṃ sāsanaṃ ovādo anusiṭṭhīti.
"This is the teaching of the Buddhas" means that this not reviling others, not harming others, restraint in the Pātimokkha, moderation in receiving and consuming, and the practice of secluded abodes for the mastery of the eight attainments—this is the teaching, counsel, and instruction of the Buddhas.
Etaṃ buddhāna sāsanaṃ (đây là lời giáo huấn của chư Phật) có nghĩa là: không phỉ báng người khác, không làm hại người khác, sự phòng hộ trong giới bổn, sự biết đủ trong việc thọ nhận và sử dụng, và sự thực hành chỗ ở thanh vắng để thành tựu tám định (samāpatti) — đây là lời giáo huấn, lời khuyên dạy của chư Phật.
Imā pana sabbabuddhānaṃ pātimokkhuddesagāthā hontīti veditabbā.
These verses, moreover, should be understood as the Pātimokkha recitation verses of all Buddhas.
Và cần phải biết rằng những kệ ngôn này là những kệ ngôn tụng giới bổn của tất cả chư Phật.
275
Devatārocanavaṇṇanā
Account of the Devas' Announcement
Giải thích về sự báo cáo của chư Thiên
276
91. Ettāvatā ca iminā vipassissa bhagavato apadānānusārena vitthārakathanena – ‘‘tathāgatassevesā, bhikkhave, dhammadhātu suppaṭividdhā’’ti evaṃ vuttāya dhammadhātuyā suppaṭividdhabhāvaṃ pakāsetvā idāni – ‘‘devatāpi tathāgatassa etamatthaṃ ārocesu’’nti vuttaṃ devatārocanaṃ pakāsetuṃ ekamidāhantiādimāha.
Having thus demonstrated the perfectly penetrated nature of the Dhamma-element, as stated in "Indeed, this Dhamma-element, bhikkhus, was perfectly penetrated by the Tathāgata," through this detailed exposition following the life story of the Blessed One Vipassī, the text now states, "The devas also announced this matter to the Tathāgata," and to explain this announcement by the devas, it introduces the passage beginning "At one time, I..."
Cho đến đây, với sự trình bày chi tiết này theo hạnh của Đức Thế Tôn Vipassī – sau khi đã làm sáng tỏ sự giác ngộ hoàn toàn của Pháp giới (dhammadhātu) được nói đến như “Này các Tỳ-kheo, Pháp giới này đã được Như Lai thấu hiểu hoàn toàn” – bây giờ, để làm sáng tỏ sự báo cáo của chư Thiên được nói đến như “Chư Thiên cũng báo cáo việc này cho Như Lai”, Ngài đã nói đoạn bắt đầu bằng “ekamidāhaṃ” (một thời tôi nghe).
277
Tattha subhagavaneti evaṃnāmake vane.
Therein, "in Subhaga Wood" means in a wood by that name.
Trong đó, subhagavane có nghĩa là trong khu rừng có tên như vậy.
Sālarājamūleti vanappatijeṭṭhakassa mūle.
"At the foot of the Sāla King" means at the foot of the chief of trees.
Sālarājamūle có nghĩa là dưới gốc cây lớn nhất trong rừng.
Kāmacchandaṃ virājetvāti anāgāmimaggena mūlasamugghātavasena virājetvā.
"Having dispassionately renounced sensual desire" means having dispassionately renounced it through the non-returner path, by utterly uprooting it.
Kāmacchandaṃ virājetvā có nghĩa là đã làm cho sự dục tham không còn bằng con đường Bất Lai (Anāgāmimagga), theo cách nhổ tận gốc.
Yathā ca vipassissa, evaṃ sesabuddhānampi sāsane vutthabrahmacariyā devatā ārocayiṃsu, pāḷi pana vipassissa ceva amhākañca bhagavato vasena āgatā.
Just as in Vipassī's dispensation, so too did devas who had lived the holy life in the dispensations of the other Buddhas make this announcement, but the Pāḷi text is presented concisely with reference to Vipassī and our own Blessed One.
Và giống như đối với Đức Phật Vipassī, chư Thiên đã báo cáo về việc thực hành phạm hạnh trong giáo pháp của các Đức Phật còn lại, nhưng kinh văn (Pāḷi) chỉ đề cập đến Đức Phật Vipassī và Đức Thế Tôn của chúng ta.
278
Tattha attano sampattiyā na hāyanti, na vihāyantīti avihā. Na kañci sattaṃ tapantīti atappā. Sundaradassanā abhirūpā pāsādikāti sudassā. Suṭṭhu passanti, sundarametesaṃ vā dassananti sudassī. Sabbeheva ca saguṇehi bhavasampattiyā ca jeṭṭhā, natthettha kaniṭṭhāti akaniṭṭhā.
Among those, those who do not fall away from their own prosperity, who do not decline, are called Avihā. Those who do not torment any being are called Atappā. Those with beautiful appearances, charming, and pleasing are called Sudassā. Those who see well, or whose seeing is beautiful, are called Sudassī. And those who are supreme in all good qualities and in their state of existence, where there are no lesser ones, are called Akaniṭṭhā.
Trong đó, những vị không suy giảm, không mất đi sự sung túc của mình được gọi là Avihā. Những vị không làm khổ bất kỳ chúng sinh nào được gọi là Atappā. Những vị có vẻ đẹp đáng chiêm ngưỡng, xinh đẹp và dễ nhìn được gọi là Sudassā. Những vị nhìn thấy rõ ràng, hoặc sự nhìn thấy của họ là đẹp đẽ được gọi là Sudassī. Và những vị tối thượng về mọi phẩm chất và sự sung túc của cõi sống, không có vị nào thấp kém hơn ở đây được gọi là Akaniṭṭhā.
279
Idha ṭhatvā bhāṇavārā samodhānetabbā.
Here, one should pause and enumerate the bhāṇavāras (recitation sections).
Ở đây, các phần tụng (bhāṇavāra) cần được tổng hợp.
Imasmiñhi sutte vipassissa bhagavato apadānavasena tayo bhāṇavārā vuttā.
In this Sutta, there are three bhāṇavāras stated with reference to the life story of the Blessed One Vipassī.
Quả thật, trong kinh này, ba phần tụng đã được nói theo hạnh của Đức Thế Tôn Vipassī.
Yathā ca vipassissa, evaṃ sikhīādīnampi apadānavasena vuttāva.
And just as with Vipassī, so too are there bhāṇavāras stated with reference to the life stories of Sikhī and the others.
Và giống như đối với Đức Phật Vipassī, các phần tụng cũng đã được nói theo hạnh của Đức Phật Sikhī, v.v.
Pāḷi pana saṅkhittā.
However, the Pāḷi text is abridged.
Tuy nhiên, kinh văn (Pāḷi) thì được tóm tắt.
Iti sattannaṃ buddhānaṃ vasena amhākaṃ bhagavatā ekavīsati bhāṇavārā kathitā.
Thus, with reference to the seven Buddhas, twenty-one bhāṇavāras were taught by our Blessed One.
Như vậy, Đức Thế Tôn của chúng ta đã thuyết giảng hai mươi mốt phần tụng liên quan đến bảy Đức Phật.
Tathā avihehi.
Similarly, by the Avihā devas.
Cũng vậy với chư Thiên Avihā.
Tathā atappehi.
Similarly, by the Atappā devas.
Cũng vậy với chư Thiên Atappā.
Tathā sudassehi.
Similarly, by the Sudassā devas.
Cũng vậy với chư Thiên Sudassā.
Tathā sudassīhi.
Similarly, by the Sudassī devas.
Cũng vậy với chư Thiên Sudassī.
Tathā akaniṭṭhehīti sabbampi chabbīsatibhāṇavārasataṃ hoti.
Similarly, by the Akaniṭṭhā devas—so the entire Pāḷi text amounts to one hundred and twenty-six bhāṇavāras.
Cũng vậy với chư Thiên Akaniṭṭhā. Tổng cộng là một trăm hai mươi sáu phần tụng.
Tepiṭake buddhavacane aññaṃ suttaṃ chabbīsatibhāṇavārasataparimāṇaṃ nāma natthi, suttantarājā nāma ayaṃ suttantoti veditabbo.
There is no other Sutta in the Tepiṭaka Buddha-word that is of the measure of one hundred and twenty-six bhāṇavāras; this Sutta should be known as the King of Suttas.
Trong Tam Tạng Phật Ngôn (Tepiṭaka Buddhavacana), không có kinh nào có dung lượng một trăm hai mươi sáu phần tụng; kinh này cần được biết là Vua của các kinh (Suttantarājā).
Ito paraṃ anusandhidvayampi niyyātento iti kho bhikkhavetiādimāha.
Beyond this, seeking to conclude the two connecting passages, it states "Thus, bhikkhus..." and so forth.
Từ đây trở đi, để kết thúc hai phần liên quan, Ngài đã nói đoạn bắt đầu bằng “iti kho bhikkhave” (Này các Tỳ-kheo, như vậy).
Taṃ sabbaṃ uttānamevāti.
All of that is self-evident.
Tất cả những điều đó đều rõ ràng.
280
Iti sumaṅgalavilāsiniyā dīghanikāyaṭṭhakathāyaṃ
Thus concludes the commentary on the Mahāpadāna Sutta in the Dīgha Nikāya Aṭṭhakathā, Sumaṅgalavilāsinī.
Như vậy, phần giải thích Đại Phẩm Kinh trong Chú Giải Trường Bộ Kinh Sumaṅgalavilāsinī
Next Page →