131. Pūjanīyabhāvato, buddhasampadañca pahāya pavattatā mahantañca taṃ parinibbānañcāti mahāparinibbānaṃ; savāsanappahānato mahantaṃ kilesakkhayaṃ nissāya pavattaṃ parinibbānantipi mahāparinibbānaṃ; mahatā kālena mahatā vā guṇarāsinā sādhitaṃ parinibbānantipi mahāparinibbānaṃ; mahantabhāvāya, dhātūnaṃ bahubhāvāya parinibbānantipi mahāparinibbānaṃ; mahato lokato nissaṭaṃ parinibbānantipi mahāparinibbānaṃ; sabbalokāsādhāraṇattā buddhānaṃ sīlādiguṇehi mahato buddhassa bhagavato parinibbānantipi mahāparinibbānaṃ;mahati sāsane patiṭṭhite parinibbānantipi mahāparinibbānanti buddhassa bhagavato parinibbānaṃ vuccati, tappaṭisaṃyuttaṃ suttaṃ mahāparinibbānasuttaṃ. Gijjhā ettha vasantīti gijjhaṃ, gijjhaṃ kūṭaṃ etassāti gijjhakūṭo, gijjhaṃ viya vā gijjhaṃ, kūṭaṃ, taṃ etassāti gijjhakūṭo, pabbato, tasmiṃ gijjhakūṭe. Tenāha ‘‘gijjhā’’tiādi.
131. Because of its worship-worthiness, and because it occurs having abandoned the Buddha's perfections, and because that Parinibbāna is great, it is called Mahāparinibbāna; because of the abandoning (of defilements) along with their latent tendencies (vāsanā), the Parinibbāna that occurs by relying on the great destruction of defilements is also called Mahāparinibbāna; the Parinibbāna accomplished over a long time or by a great accumulation of virtues is also called Mahāparinibbāna; the Parinibbāna that occurs for the sake of greatness, for the sake of the abundance of relics (dhātu), is also called Mahāparinibbāna; the Parinibbāna that is released from the great world is also called Mahāparinibbāna; because of being unshared with all worlds, the Parinibbāna of the great Buddha, the Blessed One, endowed with the virtues of morality (sīla) and so on, is also called Mahāparinibbāna; the Parinibbāna that occurs when the great Dispensation (sāsana) is established is also called Mahāparinibbāna. The Parinibbāna of the Buddha, the Blessed One, is called Mahāparinibbāna, and the discourse connected with it is the Mahāparinibbānasutta. Where vultures (gijjhā) dwell is Gijjha; the peak (kūṭa) of which has vultures is Gijjhakūṭa; or, that which is like a vulture is Gijjha, and its peak is Gijjhakūṭa; the mountain, on that Gijjhakūṭa. Therefore, it is said, "gijjhā" and so on.
131. Do trạng thái đáng được cúng dường, và do sự từ bỏ hoàn toàn các đức tính trọn vẹn của chư Phật mà phát sinh, đó là sự Niết-bàn vĩ đại, nên gọi là Mahāparinibbāna (Đại Bát Niết-bàn); do sự từ bỏ hoàn toàn các phiền não cùng với những dấu vết tiềm ẩn, nương vào sự diệt tận phiền não vĩ đại mà phát sinh sự Niết-bàn, nên cũng gọi là Mahāparinibbāna; do được thành tựu bởi thời gian dài lâu hoặc bởi khối công đức vĩ đại, nên cũng gọi là Mahāparinibbāna; do vì sự vĩ đại, vì sự phong phú của các xá-lợi mà phát sinh sự Niết-bàn, nên cũng gọi là Mahāparinibbāna; do sự Niết-bàn thoát ly khỏi thế gian vĩ đại, nên cũng gọi là Mahāparinibbāna; do sự Niết-bàn của Đức Phật, Bậc Thế Tôn vĩ đại với các đức tính như giới hạnh của chư Phật là điều không thể sánh bằng với tất cả thế gian, nên cũng gọi là Mahāparinibbāna; do sự Niết-bàn phát sinh khi Giáo pháp vĩ đại đã được thiết lập vững vàng, nên cũng gọi là Mahāparinibbāna. Kinh liên quan đến sự Niết-bàn của Đức Phật, Bậc Thế Tôn, được gọi là Mahāparinibbānasutta (Kinh Đại Bát Niết-bàn). Vì kền kền trú ngụ ở đây nên gọi là Gijjha (Kền kền); vì có ngọn núi nơi kền kền trú ngụ nên gọi là Gijjhakūṭa (Kỳ-xà-quật); hoặc vì giống như kền kền nên gọi là Gijjha, đó là ngọn núi, vì có ngọn núi này nên gọi là Gijjhakūṭa. Trên ngọn núi Gijjhakūṭa. Do đó, đã nói “Gijjhā” v.v.
Abhiyātukāmoti ettha abhi-saddo abhibhavanattho, ‘‘abhivijānātū’’tiādīsu (dī. ni. 2.244; 3.85; ma. ni. 3.256) viyāti āha ‘‘abhibhavanatthāya yātukāmo’’ti.
In Abhiyātukāmo, the prefix abhi- has the meaning of overpowering, as in "abhivijānātū" and so on, therefore it is said, "desirous of going to overpower."
Trong từ Abhiyātukāmo, tiền tố abhi- có nghĩa là chinh phục, như trong “abhivijānātū” v.v. (Dī. Ni. 2.244; 3.85; Ma. Ni. 3.256), nên đã nói “mong muốn chinh phục”.
Vajjirājānoti ‘‘vajjetabbā ime’’tiādito pavattaṃ vacanaṃ upādāya ‘‘vajjī’’ti laddhanāmā rājāno, vajjīraṭṭhassa vā rājāno vajjirājāno. Vajjiraṭṭhassa pana vajjisamaññā tannivāsirājakumāravasena veditabbā.
Vajjirājāno means kings who acquired the name "Vajjī" based on the saying "these are to be avoided," or kings of the Vajjī land. The designation of the Vajjī land as Vajjī should be understood in terms of the royal princes residing therein.
Vajjirājāno là các vị vua được gọi là “Vajjī” do từ ngữ phát sinh từ “những người này đáng bị tránh” v.v., hoặc là các vị vua của xứ Vajjī. Tên gọi Vajjī của xứ Vajjī cần được hiểu theo nghĩa các hoàng tử cư trú ở đó.
Rājiddhiyāti rājabhāvānugatena sabhāvena.
Rājiddhiyā means by the inherent nature (sabhāva) that accords with kingship.
Rājiddhiyā có nghĩa là do bản chất tự nhiên đi kèm với địa vị vương giả.
So pana sabhāvo nesaṃ gaṇarājūnaṃ mitho sāmaggiyā loke pākaṭo, ciraṭṭhāyī ca ahosīti ‘‘samaggabhāvaṃ kathesī’’ti vuttaṃ.
That inherent nature of those republican kings was renowned in the world for their mutual unity, and it lasted for a long time, therefore it is said, "he spoke of their unity."
Bản chất đó của các vị vua liên minh đã nổi tiếng trong thế gian nhờ sự hòa hợp lẫn nhau của họ, và nó cũng tồn tại lâu dài, nên đã nói “kể về sự hòa hợp”.
Anu anu taṃsamaṅgino bhāveti vaḍḍhetīti anubhāvo, anubhāvo eva ānubhāvo, patāpo, so pana nesaṃ patāpo hatthiassādivāhanasampattiyā, tattha ca susikkhitabhāvena loke pākaṭo jātoti ‘‘etena…pe… kathesī’’ti vuttaṃ.
That which repeatedly develops and increases the person endowed with it is anubhāva; anubhāva itself is ānubhāva, power. That power of theirs became known in the world due to their wealth of conveyances like elephants and horses, and their skillfulness therein, therefore it is said, "by this... he spoke."
Anu anu có nghĩa là làm cho người có năng lực đó phát triển liên tục, nên gọi là anubhāvo. Anubhāvo chính là ānubhāvo, tức là uy lực. Uy lực của họ đã trở nên nổi tiếng trong thế gian nhờ sự giàu có về các phương tiện vận chuyển như voi, ngựa, v.v., và nhờ sự huấn luyện tốt trong đó. Do đó, đã nói “bởi điều này… v.v. … đã kể”.
Tāḷacchiggalenāti kuñcikāchiddena.
Tāḷacchiggalena means through the keyhole.
Tāḷacchiggalenā có nghĩa là bằng lỗ khóa.
Asananti saraṃ.
Asanaṃ means the arrow (that went first).
Asanaṃ là mũi tên.
Atipātayissantīti atikkāmenti.
Atipātayissanti means they will go beyond (it).
Atipātayissanti có nghĩa là vượt qua.
Poṅkhānupoṅkhanti poṅkhassa anupoṅkhaṃ, purimasarassa poṅkhapadānugatapoṅkhaṃ itaraṃ saraṃ katvāti attho.
Poṅkhānupoṅkhaṃ means following shaft after shaft, that is, making the succeeding arrow follow the nock-part of the preceding arrow.
Poṅkhānupoṅkhaṃ có nghĩa là mũi tên này nối tiếp mũi tên kia, tức là mũi tên sau theo sát phần đuôi của mũi tên trước.
Avirādhitanti avirajjhitaṃ.
Avirādhitaṃ means unerringly.
Avirādhitaṃ có nghĩa là không sai lệch.
Ucchindissāmīti ummūlanavasena kulasantatiṃ chindissāmi.
Ucchindissāmī means I will sever the family lineage by uprooting it.
Ucchindissāmī có nghĩa là ta sẽ cắt đứt dòng dõi gia đình bằng cách nhổ tận gốc.
Ayanaṃ vaḍḍhanaṃ ayo, tappaṭikkhepena anayoti āha ‘‘avaḍḍhiyā etaṃ nāma’’nti.
Growth is aya, and by its negation, anaya. Therefore, it is said, "this is called non-growth."
Sự phát triển là ayo, trái ngược với điều đó là anayo, nên đã nói “đó là sự không phát triển”.
Vikkhipatīti vidūrato khipati, apanetīti attho.
Vikkhipatī means he throws it far away, that is, he removes it.
Vikkhipatī có nghĩa là ném đi xa, tức là loại bỏ.
134. Sītaṃ vā uṇhaṃ vā natthi, tāyaṃ velāyaṃ puññānubhāvena buddhānaṃ sabbakālaṃ samasītuṇhāva utu hoti, taṃ sandhāya tathā vuttaṃ.
134. Neither cold nor hot: At that time, by the power of merit, the Buddhas always have a balanced season, neither too cold nor too hot. It was said thus with reference to that.
134. Không có lạnh hay nóng, vào thời điểm đó, nhờ năng lực phước đức, chư Phật luôn có khí hậu ôn hòa, không quá lạnh cũng không quá nóng. Điều này được nói để chỉ điều đó.
Abhiṇhaṃ sannipātāti niccasannipātā, taṃ pana niccasannipātataṃ dassetuṃ ‘‘divasassā’’tiādi vuttaṃ.
Abhiṇhaṃ sannipātā means constant assemblies. To show this constancy of assembly, "divasassā" and so on, was said.
Abhiṇhaṃ sannipātā có nghĩa là thường xuyên hội họp. Để chỉ sự thường xuyên hội họp đó, đã nói “divasassā” v.v.
Sannipātabahulāti pacurasannipātā.
Sannipātabahulā means numerous assemblies.
Sannipātabahulā có nghĩa là thường xuyên hội họp.
Vosānanti saṅkocaṃ.
Vosānaṃ means contraction.
Vosānaṃ có nghĩa là sự co rút.
‘‘Yāvakīva’’nti ekamevetaṃ padaṃ aniyamato parimāṇavācī, kālo cettha adhippetoti āha ‘‘yattakaṃ kāla’’nti.
"Yāvakīva" is a single word expressing an indeterminate quantity; here, time is intended. Therefore, it is said, "for as long a time."
“Yāvakīvaṃ” là một từ chỉ lượng không xác định, và ở đây ý muốn nói đến thời gian, nên đã nói “yattakaṃ kāla”.
‘‘Vuddhiyevā’’tiādinā vuttamatthaṃ byatirekamukhena dassetuṃ ‘‘abhiṇhaṃ asannipatantā hī’’tiādi vuttaṃ.
To show the meaning expressed by "vuddhiyevā" and so on, in a contrary way, "for if they do not assemble frequently" and so on, was said.
Để chỉ rõ ý nghĩa đã được nói bằng “vuddhiyevā” v.v. theo cách phủ định, đã nói “abhiṇhaṃ asannipatantā hī” v.v.
Ākulāti khubhitā, na pasannā.
Ākulā means agitated, not serene.
Ākulā có nghĩa là bị xáo động, không thanh tịnh.
Bhijjitvāti vaggabandhato vibhajja visuṃ visuṃ hutvā.
Bhijjitvā means having split from their groups, having become separate, each distinct.
Bhijjitvā có nghĩa là chia rẽ khỏi nhóm, trở thành riêng lẻ.
Pubbe akatanti pubbe anibbattaṃ.
Pubbe akataṃ means that which was not established before.
Pubbe akataṃ có nghĩa là chưa từng được tạo ra trước đây.
Suṅkanti bhaṇḍaṃ gahetvā gacchantehi pabbatakhaṇḍa nadītitthagāmadvārādīsu rājapurisānaṃ dātabbabhāgaṃ.
Suṅkaṃ means the portion that must be given to royal officials at mountain passes, river fords, village gates, and so on, by those carrying goods.
Suṅkaṃ là phần mà những người mang hàng hóa phải nộp cho quan lại ở các đèo núi, bến sông, cửa làng, v.v.
Balinti nipphannasassādito chabhāgaṃ, sattabhāgantiādinā laddhakaraṃ.
Baliṃ means the sixth or seventh part of the harvested crops and so on, which is the levied tax.
Baliṃ là phần thu thuế từ mùa màng đã thu hoạch, như một phần sáu, một phần bảy, v.v.
Daṇḍanti dasavīsatikahāpaṇādikaṃ aparādhānurūpaṃ gahetabbadhanadaṇḍaṃ.
Daṇḍaṃ means a monetary fine to be collected according to the offense, such as ten, twenty kahāpaṇas, and so on.
Daṇḍaṃ là khoản tiền phạt phải thu theo mức độ phạm tội, như mười, hai mươi kahāpaṇa, v.v.
Vajjidhammanti vajjirājadhammaṃ.
Vajjidhammaṃ means the code of conduct of the Vajjī kings.
Vajjidhammaṃ là pháp tắc của các vua Vajjī.
Idāni apaññattapaññāpanādīsu tappaṭikkhepa ādīnavānisaṃse vitthārato dassetuṃ ‘‘tesaṃ apaññatta’’ntiādi vuttaṃ.
Now, in order to extensively show the drawbacks and benefits of establishing what was not established before, and of rejecting such establishment, "their unestablished" and so on, was said.
Bây giờ, để chỉ rõ những nguy hại và lợi ích của việc ban hành những điều chưa được ban hành, v.v., và việc bác bỏ chúng, đã nói “tesaṃ apaññatta” v.v. một cách chi tiết.
Pāricariyakkhamāti upaṭṭhānakkhamā.
Pāricariyakkhamā means capable of being attended upon.
Pāricariyakkhamā có nghĩa là có khả năng phục vụ.
Kulabhogaissariyādivasena mahatī mattā pamāṇaṃ etesanti mahāmattā, nītisatthavihite vinicchaye ṭhapitā mahāmattā vinicchayamahāmattā, tesaṃ.
Those whose measure of greatness, due to their family, possessions, authority, and so on, is great are mahāmattā; the mahāmattā appointed to legal decisions as prescribed in the Nītisattha are vinicchayamahāmattā; their (decision).
Những người có địa vị, tài sản, quyền lực, v.v. lớn lao được gọi là mahāmattā (đại thần). Các đại thần được bổ nhiệm vào việc xét xử theo luật pháp được gọi là vinicchayamahāmattā (đại thần xét xử). Của họ.
Dentīti niyyātenti.
Dentī means they entrust.
Denti có nghĩa là trao lại.
Sace coroti evaṃsaññino sace honti.
Sace coro means if they are of such a perception (that he is a thief).
Sace coro có nghĩa là nếu họ có nhận thức như vậy.
Pāpabhīrutāya attanā kiñci avatvā. Daṇḍanītisaññite vohāre niyuttāti vohārikā, ye ‘‘dhammaṭṭhā’’ti vuccanti.
Due to fear of evil, not saying anything themselves. Appointed to legal affairs as recognized in the Daṇḍanīti (Treatise on Punishments) are vohārikā, who are called "dhammaṭṭhā" (those who stand in righteousness).
Do sợ hãi điều ác, không tự mình nói gì cả. Những người được bổ nhiệm vào việc xét xử theo luật hình sự được gọi là vohārikā (luật sư), những người được gọi là “dhammaṭṭhā”.
Suttadharā nītisuttadharā, īdise vohāravinicchaye niyametvā ṭhapitā.
Suttadharā are those who uphold the Nītisutta (Treatise on Policy), appointed to regulate such legal decisions.
Suttadharā là những người nắm giữ các kinh điển về luật pháp, được bổ nhiệm vào việc xét xử như vậy.
Paramparābhatesu aṭṭhasu kulesu jātā agatigamanaviratā aṭṭhamahallakapurisā aṭṭhakulikā.
The aṭṭhakulikā are eight venerable men, born into eight families passed down through generations, who refrain from improper courses of action.
Tám vị trưởng lão, những người sinh ra trong tám gia đình được truyền thừa, từ bỏ sự thiên vị, được gọi là aṭṭhakulikā (tám vị gia trưởng).
Sakkāranti upakāraṃ.
Sakkāraṃ means respect.
Sakkāraṃ có nghĩa là sự tôn kính.
Garubhāvaṃ paccupaṭṭhapetvāti ‘‘ime amhākaṃ garuno’’ti tattha garubhāvaṃ pati pati upaṭṭhapetvā.
Garubhāvaṃ paccupaṭṭhapetvā means having established a sense of respect for them, thinking, "these are our elders."
Garubhāvaṃ paccupaṭṭhapetvā có nghĩa là thiết lập sự tôn trọng đối với họ, nghĩ rằng “đây là những bậc trưởng lão của chúng ta”.
Mānentīti sammānenti, taṃ pana sammānanaṃ tesu nesaṃ attamanatāpubbakanti āha ‘‘manena piyāyantī’’ti.
Mānentī means they honor, and that honor is preceded by their inner satisfaction towards them, therefore it is said, "they please with their minds."
Mānenti có nghĩa là tôn trọng. Sự tôn trọng đó là do lòng yêu mến tự nhiên của họ đối với những vị đó, nên đã nói “yêu mến bằng tâm”.
Nipaccakāranti paṇipātaṃ.
Nipaccakāraṃ means prostration.
Nipaccakāraṃ có nghĩa là sự cung kính.
Dassentīti ‘‘ime amhākaṃ pitāmahā, mātāmahā’’tiādinā nīcacittā hutvā garucittākāraṃ dassenti.
Dassentī means they show a respectful attitude, thinking, "these are our grandfathers, grandmothers," and so on, with humble minds.
Dassentī có nghĩa là thể hiện thái độ tôn kính với tâm khiêm nhường, nghĩ rằng “đây là ông nội, bà nội của chúng ta” v.v.
Sandhāretunti sambandhaṃ avicchinnaṃ katvā ghaṭetuṃ.
Sandhāretuṃ means to unite by making the connection uninterrupted.
Sandhāretuṃ có nghĩa là để duy trì mối quan hệ không bị gián đoạn.
Anicchitanti aniṭṭhaṃ.
Anicchita means undesirable.
Anicchita (không mong muốn) là điều không mong muốn.
Āvaraṇatoti nisedhanato.
Āvaraṇato means from hindering.
Āvaraṇato (từ sự ngăn che) là từ sự ngăn cấm.
Yassa dhammato anapetā dhammiyāti idha ‘‘dhammikā’’ti vuttā.
That which is not separated from the Dhamma is dhammiyā; here, it is stated as dhammikā.
Pháp nào không tách rời khỏi thiện pháp thì được gọi là “dhammikā” (pháp tính) ở đây.
Migasūkarādighātāya sunakhādīnaṃ kaḍḍhitvā vanacaraṇaṃ vājo, migavā, tattha niyuttā, te vā vājenti nentīti vājikā, migavadhacārino.
Leading dogs and the like for hunting deer, wild boars, etc., is vājo, i.e., hunting; those engaged in it, or who lead (vājeti, nenti) these animals, are vājikā, i.e., deer hunters.
Việc dắt chó săn, v.v., đi vào rừng để săn nai, heo rừng, v.v., được gọi là vājo (sự săn bắt), tức là săn thú rừng; những người được giao nhiệm vụ đó, hoặc những người dắt (vājeti, neti) những con thú đó, được gọi là vājikā (thợ săn), tức là những người đi săn thú.
Cittappavattiṃ pucchati. Kāyikavācasikapayogena hi sā loke pākaṭā pakāsabhūtāti.
He inquires about the cittappavattiṃ (mental activity). For that is well-known and manifest in the world through bodily and verbal exertion.
Hỏi về sự vận hành của tâm. Bởi vì sự vận hành đó được biểu lộ rõ ràng trong thế gian thông qua việc sử dụng thân và khẩu.
Kāmaṃkāravasena kiñcipi na karaṇīyāti akaraṇīyā. Kāmaṃkāro pana hatthagatakaraṇavasenāti āha ‘‘aggahetabbāti attho’’ti.
"Nothing whatsoever should be done as one pleases" means akaraṇīyā (not to be done). As 'doing as one pleases' implies taking into one's hands, he says, "It means not to be grasped."
Không nên làm bất cứ điều gì theo ý muốn của mình, nên gọi là akaraṇīyā (không nên làm). Nhưng ý muốn của mình là theo cách nắm giữ trong tay, nên nói “nghĩa là không được nắm giữ.”
Abhimukhayuddhenāti abhimukhaṃ ujukameva saṅgāmakaraṇena.
Abhimukhayuddhena means by fighting directly, straightaway in battle.
Abhimukhayuddhena (bằng cách đối đầu trực diện) là bằng cách chiến đấu thẳng thừng, trực tiếp.
Upalāpanaṃ sāmaṃ dānañcāti dassetuṃ ‘‘ala’’ntiādi vuttaṃ.
To show that persuasion (upalāpana) is also a gift, it is stated as alaṃ and so on.
Để chỉ ra rằng sự dụ dỗ (upalāpana) cũng là sự bố thí tự nguyện, nên đã nói “ala” (đủ rồi), v.v.
Bhedopi idha upāyo evāti vuttaṃ ‘‘aññatra mithubhedāyā’’ti.
Discord (bheda) is also a means here, hence it is stated as "except for mutual discord."
Sự chia rẽ ở đây cũng là một phương tiện, nên nói “ngoại trừ sự chia rẽ lẫn nhau.”
Yuddhassa pana anupāyatā pageva pakāsitā.
However, the non-efficacy of war as a means has already been explained.
Tuy nhiên, việc chiến tranh không phải là một phương tiện đã được công bố từ trước.
Idanti ‘‘aññatra upalāpanāya, aññatra mithubhedā’’ti ca idaṃ vacanaṃ.
Idaṃ refers to the statement, "except for persuasion, except for mutual discord."
Idaṃ (điều này) là lời nói “ngoại trừ sự dụ dỗ, ngoại trừ sự chia rẽ lẫn nhau.”
Kathāya nayaṃ labhitvāti ‘‘yāvakīvañca…pe… no parihānī’’ti imāya bhagavato kathāya nayaṃ upāyaṃ labhitvā.
Kathāya nayaṃ labhitvā means having obtained the method (naya) or means (upāya) from the Buddha's discourse, "As long as... they do not decline."
Kathāya nayaṃ labhitvā (nhận được phương pháp từ lời nói) là nhận được phương pháp (upāya) từ lời nói của Đức Thế Tôn: “Chừng nào mà… v.v… không suy giảm.”
Yasmā bhagavā ‘‘tassa brāhmaṇassa sammukhā vajjīnaṃ abhiṇhasannipātādipaṭipattiṃ kathentoyeva ayaṃ aparihāniyakathā aniyyānikā vaṭṭanissitā, mayhaṃ pana sāsane tathārūpī kathā kathetabbā, sā hoti niyyānikā vivaṭṭanissitā, yāya sāsanaṃ mayhaṃ parinibbānato parampi addhaniyaṃ assa ciraṭṭhitika’’nti cintesi, tasmā bhikkhū sannipātāpetvā tesaṃ aparihāniye dhamme desento teneva niyāmena desesi.
Because the Blessed One reflected, "This discourse on non-decline, as I explained the Vajjian's practice of frequent assemblies and so on in front of that Brahmin, is not leading to emancipation; it is tied to saṃsāra. But in my dispensation, such a discourse should be taught which leads to emancipation and is tied to Nibbāna, by which my dispensation would endure and be long-lasting even after my parinibbāna." Therefore, having assembled the bhikkhus, he taught them the factors of non-decline in that very manner.
Vì Đức Thế Tôn đã suy nghĩ rằng: “Lời nói về các pháp không suy thoái này, chỉ nói về việc thực hành thường xuyên hội họp của người Vajji trước mặt vị Bà-la-môn đó, là không đưa đến giải thoát, là nương tựa vào luân hồi. Còn trong giáo pháp của ta, cần phải nói một lời nói như vậy, đó là lời nói đưa đến giải thoát, nương tựa vào sự thoát ly luân hồi, nhờ đó giáo pháp của ta sẽ trường tồn và vững chắc ngay cả sau khi ta nhập Niết-bàn.” Do đó, Ngài đã triệu tập các Tỳ-kheo và thuyết giảng các pháp không suy thoái cho họ theo cùng một phương pháp đó.
Tena vuttaṃ ‘‘idaṃ vajjisattake vuttasadisamevā’’ti.
Thus it is stated, "This is similar to what was said about the seven Vajjīs."
Vì vậy, đã nói “điều này giống hệt như đã nói trong Vajji-sattaka.”
Evaṃ saṅkhepato vuttamatthaṃ vitthārato dassento ‘‘idhāpi cā’’tiādimāha.
Thus, to explain this concisely stated meaning in detail, he says, idhāpi cā and so on.
Để trình bày chi tiết ý nghĩa đã được nói tóm tắt như vậy, nên đã nói “idhāpi cā” (ở đây cũng vậy), v.v.
Tattha ‘‘tato’’tiādi disāsu āgatasāsane vuttaṃ taṃ kathanaṃ.
There, tato and so on refers to that discourse mentioned in the message that arrived from various directions.
Trong đó, “tato” (từ đó), v.v., là lời nói đã được nói trong thông điệp đến các phương hướng.
Vihārasīmā ākulā yasmā, tasmā uposathapavāraṇā ṭhitā.
Because the boundaries of the monastery were confused, the Uposatha and Pavāraṇā ceremonies ceased.
Vì ranh giới của tu viện bị rối loạn, nên lễ Uposatha và Pavāraṇā bị đình chỉ.
137. Āramitabbaṭṭhena kammaṃ ārāmo.
137. Kammaṃ ārāmo (work is delight) in the sense of being delighted in.
137. Kammaṃ ārāmo (công việc là niềm vui) vì là nơi để vui thích.
Kamme ratā, na ganthadhure, vāsadhure vāti kammaratā, anuyuttāti tapparabhāvena punappunaṃ pasutā.
Kammaratā (delighting in work) means those who are keen (anuyuttā) on work again and again, not on the burden of texts or the burden of dwelling.
Kamme ratā (ưa thích công việc), không phải trong việc học kinh điển hay việc trú ngụ, nên gọi là kammaratā (ưa thích công việc), anuyuttā (chuyên tâm) là chuyên tâm lặp đi lặp lại.
Iti kātabbakammanti taṃ taṃ bhikkhūnaṃ kātabbaṃ uccāvacakammaṃ cīvaravicāraṇādi.
Iti kātabbakammaṃ means various kinds of work to be done by bhikkhus, such as attending to robes.
Iti kātabbakammaṃ (công việc phải làm như vậy) là các công việc lớn nhỏ mà Tỳ-kheo phải làm, như việc may y, v.v.
Tenāha ‘‘seyyathida’’ntiādi.
Therefore, he says seyyathida and so on.
Vì vậy, đã nói “seyyathida” (như là), v.v.
Upatthambhananti dupaṭṭatipaṭṭādikaraṇaṃ.
Upatthambhanaṃ means making two-layered or three-layered. (making a lining for a robe).
Upatthambhanaṃ (sự chống đỡ) là việc làm y hai lớp, ba lớp, v.v.
Tañhi paṭhamapaṭalādīnaṃ upatthambhanakāraṇattā tathā vuttaṃ.
This is so called because it serves as a support for the first layer and so on.
Vì nó là yếu tố chống đỡ cho lớp y đầu tiên, v.v., nên được gọi như vậy.
Yadi evaṃ kathaṃ ayaṃ kammarāmatā paṭikkhittāti āha ‘‘ekacco hī’’tiādi.
If so, how is this delight in work rejected? He says ekacco hī and so on.
Nếu vậy, tại sao sự ưa thích công việc này lại bị cấm đoán? Nên đã nói “ekacco hī” (một số người), v.v.
138. Saddhā etesaṃ atthīti saddhāti āha ‘‘saddhāsampannā’’ti.
He says "saddhāsampannā" (endowed with faith) because they have faith.
138. Có đức tin nên gọi là đức tin (saddhā), vì vậy có lời dạy “có đức tin đầy đủ”.
Āgamanīyapaṭipadāya āgatasaddhā āgamanīyasaddhā, sā sātisayā mahābodhisattānaṃ paropadesena vinā saddheyyavatthuṃ aviparītato ogāhetvā adhimuccanatoti āha ‘‘sabbaññubodhisattānaṃ hotī’’ti.
Āgamanīya-saddhā (faith arising from the path) is faith that arises from the path leading to Arahantship and omniscience. This āgamanīya-saddhā is exceedingly powerful in great Bodhisattas, as they enter into and firmly believe in matters of faith without distortion, even without instruction from others. Hence, it is said, "it arises in omniscient Bodhisattas."
Đức tin phát sinh từ con đường cần phải đến là đức tin cần phải đến (āgamanīyasaddhā); đức tin ấy là siêu việt, vì các Đại Bồ Tát không cần sự chỉ dạy của người khác mà vẫn thâm nhập và tin tưởng một cách không sai lệch vào những đối tượng đáng tin, nên có lời dạy “có ở các vị Toàn Giác Bồ Tát”.
Saccapaṭivedhato āgatasaddhā adhigamasaddhā surabandhādīnaṃ (dī. ni. aṭṭha. 3.118; dha. pa. aṭṭha. 1.suppabuddhakuṭṭhivatthu; udā. aṭṭha. 43) viya.
Adhigama-saddhā (faith of attainment) is faith that arises from the penetration of the Truths, like the faith of Surabandha and others.
Đức tin phát sinh từ sự thể nhập chân lý là đức tin thể nhập (adhigamasaddhā), như đức tin của Surabandha và những vị khác.
‘‘Sammāsambuddho bhagavā’’tiādinā buddhādīsu uppajjanakapasādo pasādasaddhā mahākappinarājādīnaṃ (a. ni. aṭṭha. 1.1.231; dha. pa. aṭṭha. 1.mahākappinattheravatthu; theragā. aṭṭha. 2.mahākappinattheragāthāvaṇṇanā, vitthāro) viya.
Pasāda-saddhā (faith of serene confidence) is the serene confidence that arises in the Buddha and others, starting with "The Blessed One is perfectly and fully enlightened" (sammāsambuddho bhagavā), like the faith of King Mahākappina and others.
Sự tịnh tín phát sinh đối với Đức Phật và những bậc khác, như “Đức Thế Tôn là Bậc Chánh Đẳng Giác” và những điều tương tự, là đức tin tịnh tín (pasādasaddhā), như đức tin của Đại vương Kappina và những vị khác.
‘‘Evameta’’nti okkantitvā pakkhanditvā saddahanavasena kappanaṃ okappanaṃ.
Okappana is the determination made by entering into and penetrating with firm belief that "it is so."
Sự quyết định bằng cách thâm nhập và đi sâu vào để tin tưởng rằng “việc này là như vậy” là sự quyết định (okappanaṃ).
Duvidhāpīti pasādasaddhāpi okappanasaddhāpi.
"Duvidhāpī" means both pasāda-saddhā and okappana-saddhā.
Cả hai loại này tức là đức tin tịnh tín (pasādasaddhā) và đức tin quyết định (okappanasaddhā).
Tattha pasādasaddhā aparaneyyarūpā hoti savanamattena pasīdanato.
Among these, pasāda-saddhā is of a nature that cannot be led away by others, because one becomes serene just by hearing.
Trong đó, đức tin tịnh tín có tính chất không cần người khác dẫn dắt, vì chỉ nghe mà đã tịnh tín.
Okappanasaddhā saddheyyavatthuṃ ogāhetvā anupavisitvā ‘‘evameta’’nti paccakkhaṃ karontī viya pavattati.
Okappana-saddhā proceeds as if it directly experiences the object of faith, penetrating into it and entering it, thinking "it is so."
Đức tin quyết định thì diễn ra như thể tự mình chứng kiến, thâm nhập và đi sâu vào đối tượng đáng tin mà xác quyết “việc này là như vậy”.
Tenāha ‘‘saddhādhimutto vakkalittherasadiso hotī’’ti.
Therefore, he says, "one devoted to faith is like Thera Vakkali."
Vì vậy, có lời dạy: “người giải thoát bằng đức tin giống như Trưởng lão Vakkali”.
Tassa hīti okappanasaddhāya samannāgatassa.
"Tassa hī" means for one endowed with okappana-saddhā.
Của người ấy tức là của người có đức tin quyết định.
Hirī etassa atthīti hiri, hiri mano etesanti hirimanāti āha ‘‘pāpa…pe… cittā’’ti.
He says "pāpa…pe… cittā" because "hiri" (moral shame) means this mind has shame, and "hirimanā" (modest) means these bhikkhus have minds endowed with moral shame.
Có sự hổ thẹn nên gọi là hổ thẹn (hiri); có tâm hổ thẹn nên gọi là tâm hổ thẹn (hirimanā), vì vậy có lời dạy “ác… v.v… tâm”.
Pāpato ottappenti ubbijjanti bhāyantīti ottappī.
They are ottappī (morally dreading) because they are alarmed, troubled, and afraid of evil.
Vì sợ hãi, e dè, kinh hoàng trước điều ác nên gọi là sợ hãi điều ác (ottappī).
Bahu sutaṃ suttageyyādi etenāti bahussuto, sutaggahaṇaṃ cettha nidassanamattaṃ dhāraṇaparicayaparipucchānupekkhanadiṭṭhinijjhānānaṃ pettha icchitabbattā.
He is bahussuto (well-versed) because much (bahu) has been heard (sutaṃ) by him, such as Suttas, Geyyas, etc. The mention of "hearing" here is merely an example, as retention, familiarization, inquiry, contemplation, and insight are also desired here.
Vì đã nghe nhiều kinh điển, bài kệ v.v. nên gọi là người đa văn (bahussuto); việc nắm giữ kinh điển ở đây chỉ là một ví dụ, vì sự ghi nhớ, quen thuộc, hỏi han, quán sát và thấu triệt cũng được mong muốn ở đây.
Savanamūlakattā vā tesampi taggahaṇeneva gahaṇaṃ daṭṭhabbaṃ.
Or, since these also have their roots in hearing, their comprehension should be understood as being included in the comprehension of hearing.
Hoặc, vì tất cả những điều đó đều có gốc rễ từ sự nghe, nên việc nắm giữ chúng cũng được xem là bao hàm cả sự nắm giữ kinh điển.
Atthakāmena pariyāpuṇitabbato, diṭṭhadhammikādipurisatthasiddhiyā pariyattabhāvato ca pariyatti, tīṇi piṭakāni.
Pariyatti refers to the three Piṭakas, because they should be learned by one who desires benefit, and because they are conducive to the attainment of benefit in this life and the next.
Vì người mong cầu lợi ích cần phải học hỏi, và vì nó là điều kiện để thành tựu các lợi ích thế gian và xuất thế gian, nên gọi là giáo pháp (pariyatti), tức là ba tạng kinh điển.
Saccappaṭivedho saccānaṃ paṭivijjhanaṃ.
Saccapaṭivedho means the penetration of the Truths.
Sự thể nhập chân lý (saccappaṭivedho) là sự thấu hiểu các chân lý.
Tadapi bāhusaccaṃ yathāvuttabāhusaccakiccanipphattito.
That also is bāhusaccaṃ (being learned), because of the accomplishment of the duty of being learned as stated.
Điều đó cũng là đa văn, vì thành tựu công việc của người đa văn như đã nói.
Pariyatti adhippetā saccapaṭivedhāvahena bāhusaccena bahussutabhāvassa idha icchitattā.
Pariyatti is intended here, because being well-versed by means of the bāhusacca that leads to the penetration of the Truths is desired here.
Giáo pháp được mong muốn ở đây, vì sự đa văn đưa đến sự thể nhập chân lý được mong muốn.
Soti pariyattibahussuto.
"So" refers to the pariyattibahussuta (one well-versed in the Pariyatti).
Người ấy tức là người đa văn về giáo pháp.
Catubbidho hoti pañcamassa pakārassa abhāvato.
"Catubbidho hoti" (he is of four kinds) because there is no fifth kind.
Có bốn loại vì không có loại thứ năm.
Sabbatthakabahussutoti nissayamuccanakabahussutādayo viya padesiko ahutvā piṭakattaye sabbatthakameva bāhusaccasabbhāvato sabbassa atthassa kāyanato kathanato sabbatthakabahussuto.
"Sabbatthakabahussuto" (one well-versed in all aspects) means one who is not partial, like those who are well-versed in liberating from dependence on a teacher and so forth, but whose learning is universal in all three Piṭakas, and who is well-versed in all aspects because he explains all meanings.
Người đa văn toàn diện (sabbatthakabahussuto) tức là không phải là người đa văn cục bộ như người đa văn tự do không cần thầy, mà là người có sự đa văn toàn diện trong ba tạng kinh điển, và vì có khả năng trình bày tất cả các ý nghĩa nên gọi là người đa văn toàn diện.
Te idha adhippetā paṭipattipaṭivedhasaddhammānaṃ mūlabhūte pariyattisaddhamme suppatiṭṭhitabhāvato.
"Te idha adhippetā" (these are intended here) because of their firm establishment in the Saddhamma of Pariyatti, which is the foundation of the Saddhammas of Paṭipatti and Paṭivedha.
Những người này được mong muốn ở đây vì họ vững chắc trong giáo pháp học (pariyatti saddhamma), vốn là nền tảng của giáo pháp hành (paṭipatti saddhamma) và giáo pháp chứng (paṭivedha saddhamma).
139. Bujjhati etāyāti ‘‘bodhī’’ti laddhanāmāya sammādiṭṭhiādidhammasāmaggiyā aṅgoti bojjhaṅgo, pasattho, sundaro vā bojjhaṅgo sambojjhaṅgo.
139. Because one awakens by it, it is called "bodhi." The component of this entire collection of Dhammas, beginning with Right View, is called Bojjhaṅga. A praiseworthy or excellent Bojjhaṅga is Sambojjhaṅga.
139. Vì giác ngộ bằng nó nên gọi là “giác ngộ” (bodhī), là chi phần của toàn bộ các pháp như chánh kiến, v.v., nên gọi là chi giác ngộ (bojjhaṅgo); chi giác ngộ tốt đẹp, thù thắng là chi giác ngộ hoàn toàn (sambojjhaṅgo).
Upaṭṭhānalakkhaṇoti kāyavedanācittadhammānaṃ asubhadukkhāniccānattabhāvasallakkhaṇasaṅkhātaṃ ārammaṇe upaṭṭhānaṃ lakkhaṇaṃ etassāti upaṭṭhānalakkhaṇo.
Upaṭṭhānalakkhaṇo means having the characteristic of presentation, which is the presentation in the object, consisting of observing the aspects of foulness, suffering, impermanence, and non-self regarding body, feelings, mind, and Dhammas.
Có đặc tính chú tâm (upaṭṭhānalakkhaṇo) là có đặc tính chú tâm vào đối tượng, tức là sự nhận biết tính chất bất tịnh, khổ, vô thường, vô ngã của thân, thọ, tâm, pháp.
Catunnaṃ ariyasaccānaṃ pīḷanādippakārato vicayo upaparikkhā lakkhaṇaṃ etassāti pavicayalakkhaṇo. Anuppannā kusalānuppādanādivasena cittassa paggaho paggaṇhanaṃ lakkhaṇaṃ etassāti paggahalakkhaṇo. Pharaṇaṃ vipphārikatā lakkhaṇaṃ etassāti pharaṇalakkhaṇo. Upasamo kāyacittapariḷāhānaṃ vūpasamanaṃ lakkhaṇaṃ etassāti upasamalakkhaṇo. Avikkhepo vikkhepaviddhaṃsanaṃ lakkhaṇaṃ etassāti avikkhepalakkhaṇo. Līnuddhaccarahite adhicitte pavattamāne paggahaniggahasampahaṃsanesu abyāvaṭattā ajjhupekkhanaṃ paṭisaṅkhānaṃ lakkhaṇaṃ etassāti paṭisaṅkhānalakkhaṇo.
Pavicayalakkhaṇo means having the characteristic of discrimination or investigation, which is the analysis and examination of the four Noble Truths in terms of oppression and so forth. Paggahalakkhaṇo means having the characteristic of exertion, which is the uplifting of the mind in terms of producing unarisen wholesome states. Pharaṇalakkhaṇo means having the characteristic of pervading or spreading. Upasamalakkhaṇo means having the characteristic of calming, which is the appeasement of bodily and mental agitation. Avikkhepalakkhaṇo means having the characteristic of non-distraction, which is the destruction of distraction. Paṭisaṅkhānalakkhaṇo means having the characteristic of equanimity and discerning wisdom, which is overlooking in the higher mind, free from laxity and agitation, and not engaged in uplifting, suppressing, or exhilarating.
Có đặc tính trạch pháp (pavicayalakkhaṇo) là có đặc tính phân tích, quán xét các Tứ Diệu Đế theo cách áp bức, v.v. Có đặc tính tinh tấn (paggahalakkhaṇo) là có đặc tính nỗ lực, thúc đẩy tâm theo cách làm phát sinh các thiện pháp chưa sinh, v.v. Có đặc tính lan tỏa (pharaṇalakkhaṇo) là có đặc tính lan rộng, bao trùm. Có đặc tính an tịnh (upasamalakkhaṇo) là có đặc tính làm lắng dịu sự bức bách của thân và tâm. Có đặc tính không tán loạn (avikkhepalakkhaṇo) là có đặc tính tiêu diệt sự tán loạn. Có đặc tính xả (paṭisaṅkhānalakkhaṇo) là có đặc tính quán xét, buông xả khi tâm cao thượng không bị hôn trầm hay phóng dật, không bận tâm đến việc thúc đẩy, kiềm chế hay khích lệ.
Catūhi kāraṇehīti satisampajaññaṃ, muṭṭhassatipuggalaparivajjanā, upaṭṭhitassatipuggalasevanā, tadadhimuttatāti imehi catūhi kāraṇehi.
"Catūhi kāraṇehī" (by four reasons) refers to these four reasons: mindfulness and clear comprehension, avoiding individuals lacking mindfulness, associating with individuals with present mindfulness, and inclination towards that.
Bởi bốn lý do này tức là chánh niệm và tỉnh giác, tránh xa người thất niệm, thân cận người có chánh niệm, và khuynh hướng thiên về điều đó.
Chahi kāraṇehīti paripucchakatā, vatthuvisadakiriyā, indriyasamattapaṭipādanā, duppaññapuggalaparivajjanā, paññavantapuggalasevanā, tadadhimuttatāti imehi chahi kāraṇehi.
"Chahi kāraṇehī" (by six reasons) refers to these six reasons: being inquisitive, clarifying the basis, achieving equipoise of faculties, avoiding foolish individuals, associating with wise individuals, and inclination towards that.
Bởi sáu lý do này tức là việc hỏi han, việc làm cho đối tượng sáng tỏ, việc làm cho các căn được quân bình, tránh xa người kém trí tuệ, thân cận người có trí tuệ, và khuynh hướng thiên về điều đó.
Mahāsatipaṭṭhānavaṇṇanāyaṃ pana ‘‘sattahi kāraṇehī’’ (dī. ni. aṭṭha. 2.385; ma. ni. aṭṭha. 1.118) vakkhati, taṃ gambhīrañāṇacariyāpaccavekkhaṇāti imaṃ kāraṇaṃ pakkhipitvā veditabbaṃ.
However, in the Mahāsatipaṭṭhāna Commentary, he will speak of "by seven reasons." This should be understood by including the reason of deep knowledge, conduct, and review.
Trong Chú giải Đại Niệm Xứ, sẽ nói “bởi bảy lý do”, điều đó cần được hiểu là bao gồm thêm lý do về sự quán xét hành vi và trí tuệ sâu sắc này.
Navahi kāraṇehīti apāyabhayapaccavekkhaṇā, gamanavīthipaccavekkhaṇā, piṇḍapātassa apacāyanatā, dāyajjamahattapaccavekkhaṇā, satthumahattapaccavekkhaṇā, sabrahmacārīmahattapaccavekkhaṇā, kusītapuggalaparivajjanā, āraddhavīriyapuggalasevanā, tadadhimuttatāti imehi navahi kāraṇehi.
By nine causes are: the reflection on the fear of the lower realms, the reflection on the path of going (to Nibbāna), the reverence for almsfood, the reflection on the greatness of the inheritance (of the Dhamma), the reflection on the greatness of the Teacher, the reflection on the greatness of fellow practitioners, the avoidance of lazy individuals, the association with energetic individuals, and the inclination towards that (Nibbāna) – by these nine causes.
Do chín nguyên nhân này là: quán xét nỗi sợ hãi về các cõi khổ (apāya), quán xét con đường tu tập, sự trân trọng đối với vật thực khất thực, quán xét sự vĩ đại của tài sản thừa kế, quán xét sự vĩ đại của Bậc Đạo Sư, quán xét sự vĩ đại của các bậc đồng Phạm hạnh, tránh xa người biếng nhác, thân cận người tinh tấn, và sự thiên về điều đó – do chín nguyên nhân này.
Mahāsatipaṭṭhānavaṇṇanāyaṃ (dī. ni. aṭṭha. 2.385; ma. ni. aṭṭha. 1.118) pana ānisaṃsadassāvitā, jātimahattapaccavekkhaṇāti imehi saddhiṃ ‘‘ekādasā’’ti vakkhati.
However, in the Commentary on the Mahāsatipaṭṭhāna Sutta, it will be stated as "eleven" with these, namely, the demonstration of advantages and the reflection on the greatness of birth (as the Buddha's son).
Tuy nhiên, trong Mahāsatipaṭṭhāna-vaṇṇanā (Dī. Ni. Aṭṭha. 2.385; Ma. Ni. Aṭṭha. 1.118) sẽ nói là “mười một” cùng với sự thấy rõ lợi ích và quán xét sự vĩ đại của dòng dõi.
Dasahi kāraṇehīti buddhānussati, dhammānussati, saṅghasīlacāgadevatāupasamānussati, lūkhapuggalaparivajjanā, siniddhapuggalasevanā, tadadhimuttatāti imehi dasahi.
By ten causes are: recollection of the Buddha, recollection of the Dhamma, recollection of the Saṅgha, of morality, of generosity, of devas, of peace (Nibbāna) – the avoidance of coarse individuals, the association with amiable individuals, and the inclination towards that (Nibbāna) – by these ten.
Do mười nguyên nhân này là: niệm Phật, niệm Pháp, niệm Tăng, niệm giới, niệm thí, niệm chư thiên, niệm sự an tịnh (upasamānussati), tránh xa người thô tháo, thân cận người nhu hòa, và sự thiên về điều đó – do mười nguyên nhân này.
Mahāsatipaṭṭhānavaṇṇanāyaṃ (dī. ni. aṭṭha. 2.385; ma. ni. aṭṭha. 1.118) pana pasādaniyasuttantapaccavekkhaṇāya saddhiṃ ‘‘ekādasā’’ti vakkhati.
However, in the Commentary on the Mahāsatipaṭṭhāna Sutta, it will be stated as "eleven" with the reflection on the Pasādaniya Suttanta.
Tuy nhiên, trong Mahāsatipaṭṭhāna-vaṇṇanā (Dī. Ni. Aṭṭha. 2.385; Ma. Ni. Aṭṭha. 1.118) sẽ nói là “mười một” cùng với sự quán xét các bài kinh đáng khởi tín tâm.
Sattahi kāraṇehīti paṇītabhojanasevanatā, utusukhasevanatā, iriyāpathasukhasevanatā, majjhattapayogatā, sāraddhakāyapuggalaparivajjanatā, passaddhakāyapuggalasevanatā, tadadhimuttatāti imehi sattahi.
By seven causes are: the cultivation of exquisite food, the cultivation of agreeable seasons, the cultivation of agreeable postures, the practice of moderation, the avoidance of agitated individuals, the association with tranquil-bodied individuals, and the inclination towards that (Nibbāna) – by these seven.
Do bảy nguyên nhân này là: thọ dụng thực phẩm thượng vị, thọ dụng sự thoải mái về thời tiết, thọ dụng sự thoải mái về oai nghi, sự thực hành trung đạo, tránh xa người có thân thể thô bạo, thân cận người có thân thể an tịnh, và sự thiên về điều đó – do bảy nguyên nhân này.
Dasahi kāraṇehīti vatthuvisadakiriyā, indriyasamattapaṭipādanā, nimittakusalatā, samaye cittassa paggahaṇaṃ, samaye cittassa niggahaṇaṃ, samaye cittassa sampahaṃsanaṃ, samaye cittassa ajjhupekkhanaṃ, asamāhitapuggalaparivajjanaṃ, samāhitapuggalasevanaṃ, tadadhimuttatāti imehi dasahi kāraṇehi.
By ten causes are: purification of the basis, establishing equality of the faculties, skill in the sign, uplifting the mind at the proper time, suppressing the mind at the proper time, gladdening the mind at the proper time, looking on with equanimity at the proper time, avoidance of uncomposed individuals, association with composed individuals, and the inclination towards that (Nibbāna) – by these ten causes.
Do mười nguyên nhân này là: làm cho nền tảng (vatthu) trong sạch, thành tựu sự quân bình các căn, khéo léo về tướng (nimitta), nâng đỡ tâm đúng lúc, chế ngự tâm đúng lúc, làm cho tâm hoan hỷ đúng lúc, xả tâm đúng lúc, tránh xa người tâm không định, thân cận người tâm định, và sự thiên về điều đó – do mười nguyên nhân này.
Mahāsatipaṭṭhānavaṇṇanāyaṃ (dī. ni. aṭṭha. 2.385; ma. ni. aṭṭha. 1.118) pana ‘‘jhānavimokkhapaccavekkhaṇā’’ti iminā saddhiṃ ‘‘ekādasahī’’ti vakkhati.
However, in the Commentary on the Mahāsatipaṭṭhāna Sutta, it will be stated as "eleven" with "reflection on jhāna and vimokkha".
Tuy nhiên, trong Mahāsatipaṭṭhāna-vaṇṇanā (Dī. Ni. Aṭṭha. 2.385; Ma. Ni. Aṭṭha. 1.118) sẽ nói là “mười một” cùng với sự quán xét các thiền và giải thoát.
Pañcahi kāraṇehīti sattamajjhattatā, saṅkhāramajjhattatā, sattasaṅkhārakelāyanapuggalaparivajjanā, sattasaṅkhāramajjhattapuggalasevanā, tadadhimuttatāti imehi pañcahi kāraṇehi.
By five causes are: equanimity towards beings, equanimity towards formations, avoidance of individuals attached to beings and formations, association with individuals who are equanimous towards beings and formations, and the inclination towards that (Nibbāna) – by these five causes.
Do năm nguyên nhân này là: sự xả đối với chúng sanh, sự xả đối với các hành, tránh xa người ham muốn chúng sanh và các hành, thân cận người xả đối với chúng sanh và các hành, và sự thiên về điều đó – do năm nguyên nhân này.
Yaṃ panettha vattabbaṃ, taṃ mahāsatipaṭṭhānavaṇṇanāyaṃ (dī. ni. aṭṭha. 2.385; ma. ni. aṭṭha. 1.118) āgamissati.
What needs to be said here will come in the Commentary on the Mahāsatipaṭṭhāna Sutta.
Những điều cần nói ở đây sẽ được trình bày trong Mahāsatipaṭṭhāna-vaṇṇanā (Dī. Ni. Aṭṭha. 2.385; Ma. Ni. Aṭṭha. 1.118).
Kāmaṃ bodhipakkhiyadhammā nāma nippariyāyato ariyamaggasampayuttā eva niyyānikabhāvato.
Indeed, the Bodhipakkhiya Dhammas are in the ultimate sense conjoined with the Noble Path, being conducive to liberation.
Các pháp Bồ-đề phần là những pháp dẫn đến sự giải thoát, do đó chúng đích thực là những pháp tương ưng với Thánh đạo.
Suttantadesanā nāma pariyāyakathāti ‘‘iminā vipassanā…pe… kathesī’’ti vuttaṃ.
The teaching of the Suttantas is a conventional discourse, therefore it is stated: "By this vipassanā... he taught".
Lời dạy trong các bài kinh là lời dạy theo phương tiện, do đó đã nói “do điều này… cho đến… đã thuyết”.
140. Tebhūmake saṅkhāre ‘‘aniccā’’ti anupassati etāyāti aniccānupassanā, tathā pavattā vipassanā, sā pana yasmā attanā sahagatasaññāya bhāvitāya vibhāvitā eva hotīti vuttaṃ ‘‘aniccānupassanāya saddhiṃ uppannasaññā’’ti.
140. That by which one repeatedly contemplates the formations of the three realms as "impermanent" is anicca-anupassanā (contemplation of impermanence). This is insight (vipassanā) occurring in such a way. Since that (anicca-anupassanā), when developed together with its concomitant perception, is indeed considered developed, it is said: "the perception arisen with the contemplation of impermanence."
140. Do pháp này, người ấy quán xét các hành trong ba cõi là “vô thường”, nên gọi là aniccānupassanā (quán vô thường), tức là tuệ quán diễn tiến như vậy. Tuy nhiên, vì tuệ quán ấy khi được tu tập cùng với tưởng đồng sanh với nó thì đã là được tu tập rồi, nên đã nói “tưởng sanh khởi cùng với quán vô thường”.
Saññāsīsena vāyaṃ vipassanāya eva niddeso.
This is an exposition of vipassanā itself, with perception as its head.
Và sự trình bày này là sự trình bày về tuệ quán bằng cách dùng tưởng làm chủ yếu.
Anattasaññādīsupi eseva nayo.
The same method applies to anattasaññā and so forth.
Trong anattasaññā (tưởng vô ngã) và các tưởng khác cũng theo cách này.
Lokiyavipassanāpi honti, yasmā ‘‘anicca’’ntiādinā tā pavattantīti.
Worldly vipassanā also exists, since they (these perceptions) arise with "impermanent" and so forth.
Cũng có các tuệ quán thuộc thế gian, vì chúng diễn tiến với “vô thường” và các điều khác.
Lokiyavipassanāpīti pi-saddena missakāpettha santīti atthato āpannanti atthāpattisiddhamatthaṃ niddhāretvā sarūpato dassetuṃ ‘‘virāgo’’tiādi vuttaṃ.
By the word pi in "worldly vipassanā also," it is implied that mixed ones (lokuttara-sahagata) also exist here. Having thus ascertained the meaning established by implication, in order to show it in its own nature, "dispassion" and so forth are stated.
Trong lokiyavipassanāpi (cũng có các tuệ quán thuộc thế gian), do từ “pi” (cũng) mà có nghĩa là ở đây cũng có các tuệ quán hỗn hợp. Để trình bày ý nghĩa đã được suy ra từ sự hàm ý như vậy theo bản chất của nó, nên đã nói “virāgo (ly tham)” và các điều khác.
Tattha āgatavasenāti tathā āgatapāḷivasena ‘‘virāgo nirodho’’ti hi tattha nibbānaṃ vuttanti idha ‘‘virāgasaññā, nirodhasaññā’’ti vuttasaññā nibbānārammaṇāpi siyuṃ.
There, "by way of what has come" means according to the Pāli that has come in that manner. For there it is said, "dispassion is cessation" as Nibbāna; hence, the perceptions mentioned here as "perception of dispassion, perception of cessation" could also have Nibbāna as their object.
Ở đó, āgatavasena (theo cách đã được trình bày) là theo cách của Pāḷi đã được trình bày như vậy. Vì ở đó Niết Bàn được nói là “ly tham, diệt tận”, nên các tưởng được nói ở đây là “virāgasaññā (tưởng ly tham), nirodhasaññā (tưởng diệt tận)” cũng có thể có Niết Bàn làm đối tượng.
Tena vuttaṃ ‘‘dve lokuttarāpi hontī’’ti.
Therefore it is said: "two are also supramundane."
Do đó đã nói “hai tưởng cũng thuộc siêu thế”.
141. Mettā etassa atthīti mettaṃ, cittaṃ.
141. That in which mettā (loving-kindness) exists is mettaṃ (loving-kindness), the mind.
141. Có tâm từ này nên gọi là mettaṃ, tức là tâm.
Taṃsamuṭṭhānaṃ kāyakammaṃ mettaṃ kāyakammaṃ. Esa nayo sesadvayepi.
The bodily action originating from that (mind) is mettaṃ kāyakammaṃ (bodily action of loving-kindness). The same method applies to the other two.
Thân nghiệp sanh khởi từ tâm ấy gọi là mettaṃ kāyakammaṃ (thân nghiệp từ ái). Cách này cũng áp dụng cho hai loại còn lại.
Imānipi mettākāyakammādīni bhikkhūnaṃ vasena āgatāni tesaṃ seṭṭhaparisabhāvato.
These, too, the bodily action of loving-kindness and so forth, are mentioned in relation to bhikkhus, because they constitute the foremost assembly.
Những thân nghiệp từ ái này và các điều khác đã được trình bày theo phương diện của các Tỳ-kheo vì họ là chúng hội tối thượng.
Yathā pana bhikkhūsupi labbhanti, evaṃ gihīsupi labbhanti catuparisasādhāraṇattāti taṃ dassento ‘‘bhikkhūnañhī’’tiādimāha.
However, just as they are found among bhikkhus, so too are they found among laypeople, because they are common to all four assemblies. Showing this, he says, "For bhikkhus" and so forth.
Tuy nhiên, để chỉ rõ rằng chúng có thể được tìm thấy trong hàng Tỳ-kheo cũng như trong hàng cư sĩ, vì chúng là chung cho cả bốn hội chúng, nên đã nói “bhikkhūnañhī” và các điều khác.
Kāmaṃ ādibrahmacariyakadhammassavanenapi mettākāyakammāni labbhanti, nippariyāyato pana cārittadhammassavanena ayamattho icchitoti dassento ‘‘ābhisamācārikadhammapūraṇa’’nti āha.
Indeed, bodily actions of loving-kindness can be acquired through listening to discourses on the initial stages of the holy life; however, in the ultimate sense, this meaning is desired through listening to discourses on conventional morality. Showing this, he says, "completion of conventional duties."
Mặc dù các thân nghiệp từ ái có thể được tìm thấy ngay cả khi chỉ nghe pháp về đời sống Phạm hạnh sơ khởi, nhưng để chỉ rõ rằng ý nghĩa này được mong muốn một cách trực tiếp thông qua việc nghe pháp về các hành vi ứng xử, nên đã nói “ābhisamācārikadhammapūraṇaṃ” (sự hoàn thành các pháp về hành vi ứng xử).
Tepiṭakampi buddhavacanaṃ paripucchanaatthakathanavasena pavattiyamānaṃ hitajjhāsayena pavattitabbato.
The entire Tipiṭaka of the Buddha's word should be conducted with benevolent intention when it is being discoursed by way of questioning and explaining its meaning.
Lời Phật dạy gồm ba tạng kinh điển cũng vậy, khi được trình bày dưới hình thức hỏi đáp và giải thích ý nghĩa, thì phải được thực hiện với ý định vì lợi ích.
Lābhasaddo kammasādhano ‘‘lābhāvata, lābho laddho’’tiādīsu viya, so cettha ‘‘dhammaladdhā’’ti vacanato atītakālikoti āha ‘‘cīvarādayo laddhapaccayā’’ti.
The word lābha (gain) is in the instrumental case of action, as in "lābhāvata, lābho laddho" (one has gained, a gain has been obtained) and so forth. Here, since it means "obtained righteously" (dhammaladdhā), it refers to the past tense. Therefore it is said: "gains such as robes are obtained requisites."
Từ Lābha (lợi lộc) là danh từ chỉ nghiệp, giống như trong các câu “lābhāvata, lābho laddho” (lợi lộc đã đến, lợi lộc đã được), và ở đây nó là thì quá khứ theo cách nói “dhammaladdhā” (được theo pháp), nên đã nói “cīvarādayo laddhapaccayā” (y phục và các vật dụng khác đã được thọ nhận)”.
Dhammato āgatāti dhammikā. Tenāha ‘‘dhammaladdhā’’ti.
Those that come from the Dhamma are dhammika. Therefore he said "obtained righteously."
Đến từ Pháp nên gọi là dhammikā (hợp pháp). Do đó đã nói “dhammaladdhā” (được theo pháp).
Imameva hi atthaṃ dassetuṃ ‘‘kuhanādī’’tiādi vuttaṃ.
Indeed, in order to show this very meaning, "kuhanā and so forth" is stated.
Để chỉ rõ ý nghĩa này, đã nói “kuhanādī” và các điều khác.
Cittena vibhajanapubbakaṃ kāyena vibhajananti mūlameva dassetuṃ ‘‘evaṃ cittena vibhajana’’nti vuttaṃ, tena cittuppādamattenapi paṭivibhāgo na kātabboti dasseti.
To show the very root of sharing physically after having first shared mentally, it is said: "thus sharing mentally." This shows that one should not share merely by a thought-moment.
Để chỉ rõ rằng sự phân chia bằng thân trước hết là sự phân chia bằng tâm, đã nói “evaṃ cittena vibhajanaṃ” (sự phân chia bằng tâm như vậy). Điều này cho thấy không nên phân chia ngay cả chỉ bằng sự khởi lên của tâm.
Appaṭivibhattanti bhāvanapuṃsakaniddeso, appaṭivibhattaṃ vā lābhaṃ bhuñjatīti kammaniddeso eva.
Appaṭivibhattaṃ is an explanation in the neuter gender of the state of not having been shared. Or, "he consumes an unshared gain" is an explanation in the instrumental case of action.
Appaṭivibhattaṃ là sự trình bày ở dạng trung tính chỉ hành động, hoặc là sự trình bày ở dạng chủ cách, có nghĩa là thọ dụng lợi lộc không phân chia.
Taṃ taṃ neva gihīnaṃ deti attano ājīvasodhanatthaṃ.
He does not give that to laypeople for the purification of his own livelihood.
Taṃ taṃ neva gihīnaṃ deti (người ấy không bố thí cái đó cho cư sĩ) là để thanh lọc đời sống của mình.
Na attanā bhuñjatīti attanāva na paribhuñjati ‘‘mayhaṃ asādhāraṇabhogitā mā hotū’’ti.
Nor does he consume it himself, meaning he does not consume it alone, thinking, "May I not have exclusive ownership of property."
Na attanā bhuñjatī (người ấy không tự mình thọ dụng) là không tự mình thọ dụng, với ý nghĩ “mong cho tôi không có sự độc chiếm tài sản”.
‘‘Paṭiggaṇhanto ca…pe… passatī’’ti iminā tassa lābhassa tīsupi kālesu sādhāraṇato ṭhapanaṃ dassitaṃ.
By "while receiving... he sees", it is shown that the gain is made common in all three periods.
“Paṭiggaṇhanto ca… cho đến… passatī” (khi thọ nhận… cho đến… thấy) điều này chỉ ra rằng lợi lộc đó được giữ chung trong cả ba thời điểm.
‘‘Paṭiggaṇhanto ca saṅghena sādhāraṇaṃ hotū’’ti iminā paṭiggahaṇakālo dassito, ‘‘gahetvā…pe… passatī’’ti iminā paṭiggahitakālo, tadubhayaṃ pana tādisena pubbābhogena vinā na hotīti atthasiddho purimakālo.
By "while receiving, may it be common to the Saṅgha", the time of receiving is shown. By "having received... he sees", the time after receiving is shown. However, both of these do not occur without such a prior intention, so the prior time is implicitly established.
“Paṭiggaṇhanto ca saṅghena sādhāraṇaṃ hotū” (khi thọ nhận, mong cho nó là chung với Tăng đoàn) điều này chỉ ra thời điểm thọ nhận. “Gahetvā… cho đến… passatī” (sau khi thọ nhận… cho đến… thấy) điều này chỉ ra thời điểm đã thọ nhận. Tuy nhiên, cả hai điều này không thể xảy ra nếu không có sự suy nghĩ trước như vậy, nên thời điểm trước đó được suy ra từ ý nghĩa.
Tayidaṃ paṭiggahaṇato pubbe vassa hoti ‘‘saṅghena sādhāraṇaṃ hotūti paṭiggahessāmī’’ti.
This occurs before receiving, thinking, "I shall receive it so that it may be common to the Saṅgha."
Điều này xảy ra trước khi thọ nhận, rằng “tôi sẽ thọ nhận để nó là chung với Tăng đoàn”.
Paṭiggaṇhantassa hoti ‘‘saṅghena sādhāraṇaṃ hotūti paṭiggaṇhāmī’’ti.
It occurs to the one receiving, thinking, "I receive it so that it may be common to the Saṅgha."
Khi thọ nhận, người ấy nghĩ “tôi thọ nhận để nó là chung với Tăng đoàn”.
Paṭiggahetvā hoti ‘‘saṅghena sādhāraṇaṃ hotūti paṭiggahitaṃ mayā’’ti evaṃ tilakkhaṇasampannaṃ katvā laddhalābhaṃ osānalakkhaṇaṃ avikopetvā paribhuñjanto sādhāraṇabhogī, appaṭivibhattabhogī ca hoti.
Having received it,*: “‘May it be common to the Saṅgha’—thus it has been received by me.” Having thus made the acquired gain endowed with the three characteristics, and consuming it without disturbing the characteristic of finality, he becomes one who shares his possessions, and one who does not divide his possessions.
Sau khi đã thọ nhận với ý nghĩ: “Nguyện cho vật này là của chung của Tăng-già, tôi đã thọ nhận”, như vậy, vị ấy hưởng dụng những vật đã thọ nhận mà không làm hư hoại ba đặc tính cuối cùng, thì vị ấy là người hưởng dụng chung, và là người không phân chia hưởng dụng.
Imaṃ pana sāraṇīyadhammanti imaṃ catutthaṃ saritabbayuttadhammaṃ.
"But this principle of amiability" refers to this fourth principle suitable for remembrance.
Imaṃ pana sāraṇīyadhammaṃti – đây là pháp đáng ghi nhớ thứ tư.
Na hi…pe… gaṇhanti, tasmā sādhāraṇabhogitā eva dussīlassa natthīti ārambhopi tāva na sambhavati, kuto pūraṇanti adhippāyo.
"Indeed…pe… they do not accept," therefore, the very sharing of possessions is absent for an immoral person, so even the beginning is not possible, let alone the completion—this is the intention.
Na hi…pe… gaṇhanti, do đó, người phạm giới thậm chí không có sự hưởng dụng chung, vậy làm sao có thể hoàn thành? Đó là ý nghĩa.
‘‘Parisuddhasīlo’’ti iminā lābhassa dhammikabhāvaṃ dasseti.
By the phrase “of purified morality,” he shows the dharmic nature of the gain.
Bằng cụm từ ‘‘Parisuddhasīlo’’ (giới hạnh thanh tịnh), vị ấy trình bày tính chất hợp pháp của lợi lộc.
‘‘Vattaṃ akhaṇḍento’’ti iminā appaṭivibhattabhogitaṃ, sādhāraṇabhogitañca dasseti.
By the phrase “not breaking the practice,” he shows both the non-division of possessions and the sharing of possessions.
Bằng cụm từ ‘‘Vattaṃ akhaṇḍento’’ (không làm gián đoạn bổn phận), vị ấy trình bày sự hưởng dụng không phân chia và sự hưởng dụng chung.
Sati pana tadubhaye sāraṇīyadhammo pūrito eva hotīti āha ‘‘pūretī’’ti.
When both of these are present, the principle of amiability is indeed fulfilled, thus he says: “he fulfills.”
Khi cả hai điều đó hiện hữu, thì pháp đáng ghi nhớ đã được hoàn thành, nên vị ấy nói ‘‘pūretī’’ (hoàn thành).
‘‘Odissakaṃ katvā’’ti etena anodissakaṃ katvā pituno, ācariyupajjhāyādīnaṃ vā therāsanato paṭṭhāya dentassa sāraṇīyadhammoyeva hotīti.
By the phrase “having specified it,”* that giving to one’s father, or to teachers, preceptors, and so on, starting from the elder’s seat, without specifying it, is indeed a principle of amiability.
Bằng cụm từ ‘‘Odissakaṃ katvā’’ (đã xác định), điều này có nghĩa là khi cúng dường mà không xác định, cho cha, mẹ, hoặc các vị trưởng lão như thầy giáo thọ, thầy y chỉ, v.v., bắt đầu từ chỗ ngồi của các vị trưởng lão, thì đó chính là pháp đáng ghi nhớ.
Sāraṇīyadhammo panassa na hotīti paṭijagganaṭṭhāne odissakaṃ katvā dinnattā.
It is not a principle of amiability for him because it was given by specifying it as a place for personal maintenance.
Sāraṇīyadhammo panassa na hotī (đó không phải là pháp đáng ghi nhớ đối với vị ấy) vì đã cúng dường một cách xác định tại nơi chăm sóc.
Tenāha ‘‘palibodhajagganaṃ nāma hotī’’tiādi.
Therefore, he said, “it is called the maintenance of a hindrance,” and so on.
Vì thế, vị ấy nói ‘‘palibodhajagganaṃ nāma hotī’’ (đó là sự chăm sóc chướng ngại), v.v.
Yadi evaṃ sabbena sabbaṃ sāraṇīyadhammapūrakassa odissakadānaṃ na vaṭṭatīti?
If so, is it absolutely not permissible for one who fulfills the principle of amiability to give specified gifts?
Nếu vậy, việc cúng dường xác định hoàn toàn không phù hợp với người thực hành pháp đáng ghi nhớ sao?
No na vaṭṭati yuttaṭṭhāneti dassento ‘‘tena panā’’tiādimāha.
No, it is permissible in appropriate circumstances, showing this he says, “but by that,” and so on.
Không, không phải là không phù hợp ở những nơi thích hợp, nên vị ấy nói ‘‘tena panā’’ (nhưng bởi điều đó), v.v.
Gilānādīnaṃ odissakaṃ katvā dānaṃ appaṭivibhāgapakkhikaṃ ‘‘asukassa na dassāmī’’ti paṭikkhepassa abhāvato.
Giving gifts to the sick and others, having specified them, belongs to the category of non-division, due to the absence of rejection, "I will not give to that person."
Việc cúng dường xác định cho người bệnh, v.v., thuộc về khía cạnh không phân chia, vì không có sự từ chối “Tôi sẽ không cúng dường cho người này”.
Byatirekappadhāno hi paṭivibhāgo.
For division is primarily based on exclusion.
Thật vậy, sự phân chia chủ yếu là sự đối lập.
Tenāha ‘‘avasesa’’ntiādi.
Therefore, he said, “the remaining,” and so on.
Vì thế, vị ấy nói ‘‘avasesa’’ (phần còn lại), v.v.
Adātumpīti pi-saddena dātumpi vaṭṭatīti dasseti, tañca kho karuṇāyanavasena, na vattapūraṇavasena.
Even not to give—by the word "pi", it shows that it is also permissible to give, but that is out of compassion, not for the sake of fulfilling the practice.
Bằng từ pi trong Adātumpī (thậm chí không cho), vị ấy trình bày rằng cũng có thể cho, nhưng đó là do lòng từ bi, không phải để hoàn thành bổn phận.
Susikkhitāyāti sāraṇīyadhammapūraṇavidhimhi suṭṭhu sikkhitāya, sukusalāyāti attho.
"Well-trained" means thoroughly trained in the method of fulfilling the principle of amiability, proficient—this is the meaning.
Susikkhitāyā (đã được huấn luyện tốt) có nghĩa là đã được huấn luyện kỹ lưỡng, đã thành thạo trong phương pháp hoàn thành pháp đáng ghi nhớ.
Idāni tassā kosallaṃ dassetuṃ ‘‘susikkhitāya hī’’tiādi vuttaṃ.
Now, to show her proficiency, the phrase "for she was well-trained" and so on, was spoken.
Bây giờ, để trình bày sự thành thạo đó, câu ‘‘susikkhitāya hī’’ (thật vậy, đối với người đã được huấn luyện tốt), v.v., đã được nói.
‘‘Dvādasahi vassehi pūrati, na tato ora’’nti iminā tassa duppūraṇaṃ dasseti.
By "it is completed in twelve years, not less than that," he shows the difficulty of its completion.
Bằng câu ‘‘Dvādasahi vassehi pūrati, na tato ora’’ (hoàn thành trong mười hai năm, không ít hơn), điều này trình bày sự khó khăn trong việc hoàn thành điều đó.
Tathā hi so mahapphalo mahānisaṃso, diṭṭhadhammikehipi tāva garutarehi phalānisaṃsehi ca anugato.
Indeed, it has great fruit and great benefit, accompanied even in this visible world by very significant results and benefits.
Thật vậy, điều đó mang lại quả lớn và lợi ích lớn, được đi kèm với những quả và lợi ích rất lớn ngay trong đời này.
Taṃsamaṅgī ca puggalo visesalābhī ariyapuggalo viya loke acchariyabbhutadhammasamannāgato hoti.
And the person endowed with it becomes in the world one endowed with astonishing and wonderful qualities, like an Ariya-Puggala who has attained special realizations.
Và người nào đầy đủ điều đó thì giống như một bậc Thánh đạt được sự đặc biệt, được xem là người có những pháp kỳ diệu và phi thường trên thế gian.
Tathā hi so duppajahaṃ dānamayassa, sīlamayassa ca puññassa paṭipakkhadhammaṃ sudūre vikkhambhitaṃ katvā suvisuddhena cetasā loke pākaṭo paññāto hutvā viharati, tassimamatthaṃ byatirekato, anvayato ca vibhāvetuṃ ‘‘sace hī’’tiādi vuttaṃ, taṃ suviññeyyameva.
Indeed, such a person, having far cast away the opposing qualities of merit consisting of giving and morality, which are difficult to abandon, abides with a very purified mind, manifest and renowned in the world. To expound this matter by way of both exclusion and inclusion, "if indeed," and so on, was said, and that is very easy to understand.
Thật vậy, vị ấy đã loại bỏ rất xa những pháp đối lập với phước báu do bố thí và phước báu do giới luật mà khó từ bỏ, sống với tâm ý rất thanh tịnh, nổi bật và được biết đến trong thế gian, để làm rõ ý nghĩa này bằng cả cách phủ định và khẳng định, câu ‘‘sace hī’’ (nếu vậy), v.v., đã được nói, điều đó rất dễ hiểu.
Idāni ye samparāyike, diṭṭhadhammike ca ānisaṃse dassetuṃ ‘‘eva’’ntiādi vuttaṃ.
Now, to show the benefits in the future life and in this present life, "thus," and so on, was said.
Bây giờ, để trình bày những lợi ích trong đời sau và trong đời này, câu ‘‘eva’’ (như vậy), v.v., đã được nói.
Neva issā, na macchariyaṃ hoti cirakālabhāvanāya vidhutabhāvato.
There is neither envy nor stinginess because they have been shaken off by long cultivation.
Neva issā, na macchariyaṃ hoti (không có ganh tị, không có keo kiệt) vì đã được loại bỏ do tu tập lâu dài.
Manussānaṃ piyo hoti pariccāgasīlatāya visuddhattā.
He is dear to humans due to his purity arising from his habit of generosity.
Manussānaṃ piyo hoti (được mọi người yêu mến) vì tâm đã thanh tịnh do có thói quen bố thí.
Tenāha ‘‘dadaṃ piyo hoti bhajanti naṃ bahū’’tiādi (a. ni. 5.34).
Therefore, it is said: "One who gives is dear; many approach him," and so on.
Vì thế, vị ấy nói: “Dadaṃ piyo hoti bhajanti naṃ bahū” (Người bố thí được yêu mến, nhiều người tìm đến vị ấy), v.v. (A.N. 5.34).
Sulabhapaccayo hoti dānavasena uḷārajjhāsayānaṃ paccayalābhassa idhānisaṃsabhāvato dānassa.
His requisites are easily obtained, because obtaining requisites for those with noble intentions by means of giving is a benefit in this very life of giving.
Sulabhapaccayo hoti (có được vật dụng dễ dàng) vì việc có được vật dụng là lợi ích trong đời này của bố thí đối với những người có ý định cao thượng.
Pattagataṃ assa diyyamānaṃ na khīyati pattagatavasena dvādasavassikassa mahāpattassa avicchedena pūritattā.
What is in his bowl is not exhausted when given away due to the continuous fulfillment of the great practice of twelve years with regard to what is in the bowl.
Pattagataṃ assa diyyamānaṃ na khīyati (vật trong bát của vị ấy khi được cúng dường sẽ không cạn kiệt) vì đã hoàn thành đại bổn phận mười hai năm một cách liên tục bằng cách giữ vật trong bát.
Aggabhaṇḍaṃ labhati devasikaṃ dakkhiṇeyyānaṃ aggato paṭṭhāya dānassa dinnattā.
He receives the best goods because offerings were given daily to worthy recipients, starting with the best.
Aggabhaṇḍaṃ labhati (nhận được vật phẩm tốt nhất) vì đã cúng dường vật phẩm tốt nhất cho các bậc đáng cúng dường mỗi ngày.
Bhayevā…pe… āpajjanti deyyapaṭiggāhakavikappaṃ akatvā attani nirapekkhacittena cirakālaṃ dānapūratāya pasāditacittattā.
In times of danger…pe… they fall into* because his mind has been gladdened by a long period of fulfilling generosity with a selfless mind, without making distinctions between givers and recipients.
Bhayevā…pe… āpajjanti (các vị trời sẽ lo lắng) vì tâm đã được làm cho thanh tịnh do hoàn thành bố thí lâu dài với tâm vô chấp đối với bản thân, không phân biệt người cúng dường và người thọ nhận.
Natthi etesaṃ khaṇḍanti akhaṇḍāni. Taṃ pana nesaṃ khaṇḍaṃ dassetuṃ ‘‘yassā’’tiādi vuttaṃ.
These have no breaks, hence "unbroken." But to show their unbrokenness, "whose," and so on, was said.
Không có sự đứt đoạn đối với những điều này, nên chúng là akhaṇḍāni (không đứt đoạn). Để trình bày sự đứt đoạn của chúng, câu ‘‘yassā’’ (của ai), v.v., đã được nói.
Tattha upasampannasīlānaṃ uddesakkamena ādi antā veditabbā.
Here, the beginning and end of the sīlas of the fully ordained are to be understood in the order of instruction.
Ở đó, sự khởi đầu và kết thúc của giới hạnh của những người đã thọ Cụ túc giới cần được biết theo thứ tự trình bày.
Tenāha ‘‘sattasū’’tiādi.
Therefore, he said, "in the seven," and so on.
Vì thế, vị ấy nói ‘‘sattasū’’ (trong bảy điều), v.v.
Anupasampannasīlānaṃ pana samādānakkamenapi ādi antā labbhanti.
For those not fully ordained, the beginning and end can also be found in the order of undertaking.
Tuy nhiên, sự khởi đầu và kết thúc của giới hạnh của những người chưa thọ Cụ túc giới cũng có thể được tìm thấy theo thứ tự thọ trì.
Pariyante chinnasāṭako viyāti vatthante, dasante vā chinnavatthaṃ viya, visadisūdāharaṇaṃ cetaṃ ‘‘akhaṇḍānī’’ti imassa adhigatattā.
Like a torn cloth at the end means like a garment torn at the edge or hem, and this is a dissimilar example because "unbroken" has been understood.
Pariyante chinnasāṭako viyā (như tấm vải bị cắt ở mép) là như tấm vải bị cắt ở cuối hoặc ở mép, và đây là một ví dụ không tương đồng để làm rõ ý nghĩa của “akhaṇḍāni” (không đứt đoạn).
Evaṃ sesānipi udāharaṇāni.
The other examples are similar.
Tương tự như vậy là các ví dụ còn lại.
Khaṇḍitabhinnatā khaṇḍaṃ, taṃ etassa atthīti khaṇḍaṃ, sīlaṃ.
Khaṇḍa (brokenness) is being torn and shattered; that which has this is khaṇḍa (broken), which refers to sīla.
Sự đứt đoạn và vỡ nát là khaṇḍaṃ, điều này có ở nó, nên nó là khaṇḍaṃ (đứt đoạn), tức là giới hạnh.
‘‘Chidda’’ntiādīsupi eseva nayo.
The same method applies to "chidda" and so on.
Trong ‘‘Chidda’’ (lỗ hổng), v.v., cũng theo cách tương tự.
Vemajjhe bhinnaṃ vinivijjhanavasena visabhāgavaṇṇena gāvī viyāti sambandho.
"Broken in the middle" is connected to "like a cow with a dissimilar color piercing through."
Vemajjhe bhinnaṃ (bị vỡ ở giữa) có liên quan đến việc như một con bò có màu sắc khác biệt do bị xuyên thủng.
Sabalarahitāni asabalāni. Tathā akammāsāni. Sīlassa taṇhādāsabyato mocanaṃ vivaṭṭūpanissayabhāvāpādanaṃ.
Without mixed colors are "unspotted." Similarly, "unblemished." "Release from the servitude of craving" for sīla means leading to the state of being a proximate cause for the turning away (from saṃsāra).
Không có đốm đen là asabalāni (không đốm đen). Tương tự là akammāsāni (không vết nhơ). Taṇhādāsabyato mocanaṃ (sự giải thoát khỏi sự nô lệ của tham ái) của giới hạnh là việc tạo ra điều kiện để dẫn đến sự thoát ly (vivaṭṭa).
Yasmā ca taṃsamaṅgīpuggalo serī sayaṃvasī bhujisso nāma hoti, tasmāpi bhujissāni.
And because a person endowed with it is called free, self-controlled, and liberated, therefore they are also called "liberated."
Và vì người nào đầy đủ điều đó thì được gọi là người tự do, tự chủ, không bị ràng buộc, nên chúng cũng là bhujissāni (tự do).
Tenevāha ‘‘bhujissabhāvakāraṇato bhujissānī’’ti.
Therefore, he said, "they are liberated because of being the cause of liberation."
Vì thế, vị ấy nói ‘‘bhujissabhāvakāraṇato bhujissānī’’ (là tự do vì là nguyên nhân của sự tự do).
Suparisuddhabhāvena pāsaṃsattā viññupasatthāni. Imināhaṃ sīlena devo vā bhaveyyaṃ, devaññataro vā, tattha ‘‘nicco dhuvo sassato’’ti, ‘‘sīlena suddhī’’ti ca evaṃ ādinā taṇhādiṭṭhīhi aparāmaṭṭhattā. ‘‘Ayaṃ te sīlesu doso’’ti catūsupi vipattīsu yāya kāyaci vipattiyā dassanena parāmaṭṭhuṃ anuddhaṃsetuṃ.
They are praised by the wise due to their extreme purity. By this, I might become a deva by this morality, or one of the devas, there he says "permanent, stable, eternal," "purity by morality," and so on, thus "not grasped by craving and views." "To grasp" means to disparage, by showing any of the four misfortunes in the context of "This is your fault in morality."
Do sự thanh tịnh tuyệt đối nên được khen ngợi, nên chúng là viññupasatthāni (được người trí khen ngợi). Bằng điều này, tôi có thể trở thành một vị trời hoặc một vị khác trong số các vị trời, ở đó, “vĩnh cửu, bền vững, thường hằng”, và “thanh tịnh bằng giới hạnh”, v.v., theo cách này, do taṇhādiṭṭhīhi aparāmaṭṭhattā (không bị tham ái và tà kiến chạm đến). Parāmaṭṭhuṃ (làm tổn hại) có nghĩa là làm suy yếu bằng cách chỉ ra bất kỳ sự suy đồi nào trong bốn sự suy đồi.
Samādhisaṃvattanappayojanāni samādhisaṃvattanikāni.
"Conducive to concentration" means having concentration as their purpose.
Những điều có mục đích dẫn đến định là samādhisaṃvattanikāni (dẫn đến định).
Yāyanti yā ayaṃ mayhañceva tumhākañca paccakkhabhūtā.
"Yāya" means "that which is directly perceivable by both me and you."
“Yāyaṃ” (cái mà) có nghĩa là cái đang hiện diện trước mắt tôi và các vị.
Diṭṭhīti maggasammādiṭṭhi.
"Diṭṭhī" means right view of the path (maggasammādiṭṭhi).
“Diṭṭhī” (kiến) là Chánh kiến (sammādiṭṭhi) của Đạo.
Niddosāti nidhutadosā, samucchinnarāgādipāpadhammāti attho.
"Niddosā" means "whose defilements are shaken off," meaning "whose evil qualities such as greed are eradicated."
“Niddosā” (không lỗi) có nghĩa là đã loại bỏ các lỗi lầm, tức là đã nhổ tận gốc các pháp bất thiện như tham ái.
Niyyātīti vaṭṭadukkhato nissarati nigacchati.
"Niyyātī" means "it escapes or is freed from the suffering of saṃsāra."
“Niyyātī” (dẫn ra) có nghĩa là thoát ra, đi ra khỏi khổ luân hồi (vaṭṭadukkha).
Sayaṃ niyyantasseva hi ‘‘taṃsamaṅgīpuggalaṃ vaṭṭadukkhato niyyāpetī’’ti vuccati.
Indeed, it is said that if it itself escapes, "it causes that individual endowed with it to escape from the suffering of saṃsāra."
Thật vậy, chỉ khi tự mình thoát ra thì mới được gọi là "dẫn dắt người có giới hạnh đó thoát khỏi khổ luân hồi".
Yā satthu anusiṭṭhi, taṃ karotīti takkaro, tassa, yathānusiṭṭhaṃ paṭipajjanakassāti attho.
He who acts according to the Teacher's instruction is "takkaro"; that is, one who practices as instructed.
“Takkaro” (người thực hành như vậy) là người thực hành những gì Đức Phật đã dạy, tức là người thực hành theo lời dạy.
Samānadiṭṭhibhāvanti sadisadiṭṭhibhāvaṃ saccasampaṭivedhena abhinnadiṭṭhibhāvaṃ.
"Samānadiṭṭhibhāvaṃ" means having similar right view, or having identical right view through the penetration of the truths.
“Samānadiṭṭhibhāvaṃ” (sự đồng nhất về kiến) là sự đồng nhất về kiến, không có sự khác biệt về kiến do đã thấu hiểu chân lý.
Vuddhiyevāti ariyavinaye guṇehi vuḍḍhiyeva, no parihānīti ayaṃ aparihāniyadhammadesanā attanopi sāsanassa addhaniyataṃ ākaṅkhantena bhagavatā idha desitā.
"Vuddhiyevā" means only growth in qualities in the Noble Discipline, not decline; this teaching on non-decline was taught here by the Blessed One, who desired the long endurance of his own Dispensation.
“Vuddhiyevā” (chỉ có sự tăng trưởng) có nghĩa là chỉ có sự tăng trưởng về các đức tính trong giới luật của bậc Thánh (ariyavinaya), chứ không có sự suy thoái. Lời dạy về pháp không suy thoái này đã được Đức Thế Tôn thuyết giảng ở đây, với mong muốn sự trường tồn của giáo pháp của chính Ngài.
142. Āsannaparinibbānattāti katipayamāsādhikena saṃvaccharamattena parinibbānaṃ bhavissatīti katvā vuttaṃ.
142. "Āsannaparinibbānattā" means it was said because parinibbāna would occur within about a year with a few extra months.
142. “Āsannaparinibbānattā” (vì sắp Niết-bàn) được nói ra vì Đức Phật sẽ nhập Niết-bàn chỉ trong khoảng một năm và vài tháng.
Etaṃyevāti ‘‘iti sīla’’ntiādikaṃyeva iti sīlanti ettha iti-saddo pakārattho, parimāṇattho ca ekajjhaṃ katvā gahitoti āha ‘‘evaṃ sīlaṃ ettakaṃ sīla’’nti.
"Etaṃyevā" means "iti sīlaṃ" and so on. The word "iti" here in "iti sīlaṃ" is taken to mean both "in this manner" (pakārattho) and "to this extent" (parimāṇattho) simultaneously, so it is said: "evaṃ sīlaṃ ettakaṃ sīlaṃ" (such is moral conduct, this much is moral conduct).
“Etaṃyevā” (chỉ điều này) là chính điều “iti sīla” (giới như vậy) v.v... Ở đây, từ “iti” trong “iti sīla” mang nghĩa phân loại và nghĩa số lượng được gộp lại, nên đã nói: “giới như vậy, giới chừng đó.”
Evaṃ sīlanti evaṃ pabhedaṃ sīlaṃ.
"Evaṃ sīlaṃ" means moral conduct of this kind.
“Evaṃ sīlaṃ” (giới như vậy) là giới có các loại như vậy.
Ettakanti etaṃ paramaṃ, na ito bhiyyo.
"Ettakaṃ" means this is the ultimate, there is nothing more than this.
“Ettakaṃ” (chừng đó) là giới này là tối thượng, không còn gì hơn thế.
Catupārisuddhisīlanti maggassa sambhārabhūtaṃ lokiyacatupārisuddhisīlaṃ.
"Catupārisuddhisīlaṃ" means the worldly fourfold pure moral conduct which is a requisite for the path.
“Catupārisuddhisīlaṃ” (Tứ thanh tịnh giới) là Tứ thanh tịnh giới thuộc thế gian, là yếu tố cần thiết cho Đạo.
Cittekaggatā samādhīti etthāpi eseva nayo.
The same method applies to "cittekaggatā samādhī" (one-pointedness of mind, concentration).
“Cittekaggatā samādhī” (Tâm nhất điểm định) cũng theo cách giải thích tương tự.
Yasmiṃ sīle ṭhatvāti yasmiṃ lokuttarakusalassa padaṭṭhānabhūte ‘‘pubbeva kho panassa kāyakammaṃ vacīkammaṃ ājīvo suparisuddho hotī’’ti (ma. ni. 3.431; kathā. 874) evaṃ vuttasīle patiṭṭhāya.
"Yasmiṃ sīle ṭhatvā" means "having established oneself in that moral conduct" which is the proximate cause of supermundane wholesome states, as stated: "Previously, his bodily action, verbal action, and livelihood were completely purified."
“Yasmiṃ sīle ṭhatvā” (nương tựa vào giới nào) có nghĩa là nương tựa vào giới đã được nói đến như “trước đó, thân nghiệp, khẩu nghiệp, và sinh kế của vị ấy đã hoàn toàn thanh tịnh” (Ma. Ni. 3.431; Kathā. 874), là nền tảng cho thiện pháp siêu thế.
Esoti maggaphalasamādhi.
"Eso" means the concentration of the path and its fruition.
“Eso” (đó) là định của Đạo và Quả.
Paribhāvitoti tena sīlena sabbaso bhāvito sambhāvito.
"Paribhāvito" means completely cultivated and developed by that moral conduct.
“Paribhāvito” (được tu tập đầy đủ) có nghĩa là đã được tu tập hoàn toàn, đã được phát triển đầy đủ bởi giới đó.
Mahapphalo hoti mahānisaṃsoti maggasamādhi tāva sāmaññaphalehi mahapphalo, vaṭṭadukkhavūpasamena mahānisaṃso.
"Mahapphalo hoti mahānisaṃso" (it is of great fruit, of great benefit): The concentration of the path is of great fruit through the common fruits, and of great benefit through the cessation of the suffering of saṃsāra.
“Mahapphalo hoti mahānisaṃso” (có quả lớn, có lợi ích lớn) – định của Đạo có quả lớn về các quả Sa-môn, có lợi ích lớn về sự chấm dứt khổ luân hồi.
Itaro paṭippassaddhippahānena mahapphalo, nibbutisukhuppattiyā mahānisaṃso.
The other (the concentration of fruition) is of great fruit through the abandonment by subsidence, and of great benefit through the attainment of the bliss of Nibbāna.
Định của Quả có quả lớn về sự đoạn trừ phiền não, có lợi ích lớn về sự đạt được an lạc Niết-bàn.
Yamhi samādhimhi ṭhatvāti yasmiṃ lokuttarakusalassa padaṭṭhānabhūte pādakajjhānasamādhimhi ceva vuṭṭhānagāminisamādhimhi ca ṭhatvā.
"Yamhi samādhimhi ṭhatvā" means "having established oneself in that foundational jhāna concentration and that exit-bound concentration which are the proximate causes of supermundane wholesome states."
“Yamhi samādhimhi ṭhatvā” (nương tựa vào định nào) có nghĩa là nương tựa vào định thiền cơ sở (pādakajjhānasamādhi) và định hướng đến sự xuất khởi (vuṭṭhānagāminisamādhi), là nền tảng cho thiện pháp siêu thế.
Sāti maggaphalapaññā.
"Sā" means the wisdom of the path and its fruition.
“Sā” (đó) là tuệ của Đạo và Quả.
Tena paribhāvitāti tena yathāvuttasamādhinā sabbaso bhāvitā paribhāvitā.
"Tena paribhāvitā" means thoroughly cultivated and developed by that concentration as stated.
“Tena paribhāvitā” (được tu tập đầy đủ bởi định đó) có nghĩa là đã được tu tập hoàn toàn, đã được phát triển đầy đủ bởi định đã nói trên.
Mahapphalamahānisaṃsatā samādhimhi vuttanayena veditabbā.
Its being of great fruit and great benefit should be understood in the manner stated for concentration.
Sự có quả lớn và lợi ích lớn của định cần được hiểu theo cách đã nói về định.
Api ca te bojjhaṅgamaggaṅgajhānaṅgappabhedahetutāya mahapphalā sattadakkhiṇeyyapuggalavibhāgahetutāya mahānisaṃsāti veditabbā.
Furthermore, these should be understood as "mahapphalā" (of great fruit) due to their being the cause of the divisions of factors of awakening, factors of the path, and factors of jhāna; and "mahānisaṃsā" (of great benefit) due to their being the cause of the division into seven worthy recipients of offerings.
Hơn nữa, các tuệ đó cần được hiểu là “mahapphalā” (có quả lớn) vì là nguyên nhân của các chi giác ngộ (bojjhaṅga), chi Đạo (maggaṅga), chi thiền (jhānaṅga) và “mahānisaṃsā” (có lợi ích lớn) vì là nguyên nhân của sự phân loại bảy hạng người xứng đáng được cúng dường.
Yāya paññāya ṭhatvāti yāyaṃ vipassanāpaññāyaṃ, samādhivipassanāpaññāyaṃ vā ṭhatvā.
"Yāya paññāya ṭhatvā" means "having established oneself in that insight-wisdom, or in that wisdom accompanied by concentration and insight."
“Yāya paññāya ṭhatvā” (nương tựa vào tuệ nào) có nghĩa là nương tựa vào tuệ quán (vipassanāpaññā) hoặc tuệ quán cùng với định (samādhivipassanāpaññā).
Samathayānikassa hi samādhisahagatāpi paññā maggādhigamāya visesapaccayo hotiyeva.
Indeed, for one who makes tranquility their vehicle, wisdom, even if accompanied by concentration, is certainly a special condition for the attainment of the path.
Thật vậy, đối với người hành thiền theo con đường tịnh chỉ (samathayānika), tuệ đi kèm với định cũng là yếu tố đặc biệt giúp đạt được Đạo.
Sammadevāti suṭṭhuyeva yathā āsavānaṃ lesopi nāvasissati, evaṃ sabbaso āsavehi vimuccati.
"Sammadevā" means "thoroughly and perfectly," in such a way that not even a trace of the defilements remains, thus he is completely "released from the defilements".
“Sammadevā” (hoàn toàn đúng đắn) có nghĩa là hoàn toàn đúng đắn, đến mức không còn một chút phiền não nào sót lại, và như vậy, “thoát khỏi các lậu hoặc (āsava)” một cách hoàn toàn.
Aggamaggakkhaṇañhi sandhāyetaṃ vuttaṃ.
Indeed, this was said with reference to the moment of the highest path.
Điều này được nói đến để chỉ khoảnh khắc của A-la-hán Đạo.
143. Lokiyatthasaddānaṃ viya abhiranta-saddassa siddhi daṭṭhabbā.
143. The derivation of the word "abhiranta" should be understood like that of words in worldly usage.
143. Sự thành lập của từ abhiranta cần được hiểu như sự thành lập của các từ ngữ thế gian.
Abhirantaṃ abhirataṃ abhiratīti hi atthato ekaṃ.
"Abhirantaṃ," "abhirataṃ," and "abhirati" are indeed one in meaning.
Thật vậy, abhiranta, abhirata, abhirati là một về ý nghĩa.
Abhiranta-saddo cāyaṃ abhirucipariyāyo, na assādapariyāyo.
And this word "abhiranta" is a synonym for "abhiruci" (liking), not a synonym for "assāda" (taste/enjoyment).
Và từ abhiranta này là một từ đồng nghĩa với abhiruci (sự thích thú), không phải là từ đồng nghĩa với assāda (sự thưởng thức).
Assādavasena hi katthaci vasantassa assādavatthuvigamena siyā tassa tattha anabhirati, yadidaṃ khīṇāsavānaṃ natthi, pageva buddhānanti āha ‘‘buddhānaṃ…pe… natthī’’ti.
For, by way of enjoyment, if one dwells somewhere, there might be disliking there due to the absence of the object of enjoyment, which is not the case for those whose defilements are eradicated, much less for the Buddhas. Thus it is said: "for the Buddhas... not so."
Thật vậy, đối với người sống ở một nơi nào đó do sự thưởng thức, khi đối tượng thưởng thức không còn, có thể có sự không thích thú ở đó; điều này không tồn tại ở các bậc A-la-hán, huống chi là ở các vị Phật, nên đã nói: “ở các vị Phật… v.v… không có.”
Abhirativasena katthaci vasitvā tadabhāvato aññattha gamanaṃ nāma buddhānaṃ natthi.
For the Buddhas, there is no such thing as dwelling somewhere by way of liking and then moving elsewhere because of the absence of that liking.
Việc các vị Phật sống ở một nơi nào đó do sự thích thú, rồi vì sự vắng mặt của sự thích thú đó mà đi đến nơi khác, là điều không có.
Veneyyavinayanatthaṃ pana katthaci vasitvā tasmiṃ siddhe veneyyavinayanatthameva tato aññattha gacchanti, ayamettha yathāruci.
However, for the purpose of disciplining those who are amenable to instruction, they dwell somewhere, and when that purpose is accomplished, they go elsewhere solely for the purpose of disciplining amenable beings; this is a matter of their own discretion here.
Tuy nhiên, vì lợi ích giáo hóa chúng sinh, các Ngài sống ở một nơi nào đó, và khi việc đó hoàn thành, các Ngài đi đến nơi khác cũng vì lợi ích giáo hóa chúng sinh. Đây là điều tùy ý ở đây.
Āyāmāti ettha ā-saddo ‘‘āgacchā’’ti iminā samānatthoti āha ‘‘ehi yāmā’’ti.
"Āyāmā": Here, the word "ā" has the same meaning as "āgacchā" (come). Thus it is said: "ehi yāmā" (come, let us go).
Trong từ “āyāmā”, âm “ā” có nghĩa tương tự như “āgacchā” (hãy đến), nên đã nói: “ehi yāmā” (hãy đến, chúng ta đi).
Ayāmāti pana pāṭhe a-kāro nipātamattaṃ.
However, in the reading "ayāmā", the prefix "a" is merely an indeclinable particle.
Tuy nhiên, trong cách đọc “ayāmā”, âm “a” chỉ là một tiểu từ.
Santikāvacarattā theraṃ ālapati, na pana tadā satthu santike vasantānaṃ bhikkhūnaṃ abhāvato.
"He addresses the Elder (thera) due to his closeness," not because there were no bhikkhus dwelling near the Teacher at that time.
Ngài gọi vị Trưởng lão vì Ngài thường ở gần Ngài, chứ không phải vì không có các Tỳ-khưu đang ở gần Đức Phật vào lúc đó.
Aparicchinnagaṇano hi tadā bhagavato santike bhikkhusaṅgho.
For, at that time, the assembly of bhikkhus near the Blessed One was innumerable.
Thật vậy, vào lúc đó, Tăng đoàn Tỳ-khưu ở gần Đức Thế Tôn có số lượng không thể đếm hết.
Tenāha ‘‘mahatā bhikkhusaṅghena saddhi’’nti.
Therefore, it is said, "together with a great assembly of bhikkhus."
Vì vậy, đã nói: “cùng với một Tăng đoàn Tỳ-khưu lớn.”
Ambalaṭṭhikāgamananti ambalaṭṭhikāgamanapaṭisaṃyuttapāṭhamāha.
"Ambalaṭṭhikāgamanaṃ" refers to the passage related to the journey to Ambalaṭṭhikā.
“Ambalaṭṭhikāgamanaṃ” (việc đi đến Ambalaṭṭhikā) là nói đến đoạn văn liên quan đến việc đi đến Ambalaṭṭhikā.
Pāṭaligamaneti etthāpi eseva nayo.
The same method applies to "Pāṭaligamane".
“Pāṭaligamane” (ở việc đi đến Pāṭaligāma) cũng theo cách giải thích tương tự.
Uttānameva anantaraṃ, heṭṭhā ca saṃvaṇṇitarūpattā.
"Uttānameva" is clear because it has been commented upon immediately before and below.
“Uttānameva” (rõ ràng) là vì đã được giải thích ở phần trước và phần dưới.
149. Dussīloti ettha du-saddo abhāvattho ‘‘duppañño’’tiādīsu (ma. ni. 1.449; a. ni. 5.10) viya, na garahatthoti āha ‘‘asīlo nissīlo’’ti.
149. In "dussīlo" (immoral), the prefix "du" has the sense of absence, as in "duppañño" (unwise) and so on, not the sense of blame. Thus it is said: "asīlo nissīlo" (without morality, devoid of morality).
149. Trong từ “dussīlo” (người phá giới), âm “du” mang nghĩa phủ định, như trong “duppañño” (kẻ vô trí) v.v... (Ma. Ni. 1.449; A. Ni. 5.10), chứ không phải nghĩa chê bai, nên đã nói: “asīlo nissīlo” (không có giới, không giới).
Bhinnasaṃvaroti ettha yo samādinnasīlo kenaci kāraṇena sīlabhedaṃ patto, so tāva bhinnasaṃvaro hoti.
In "bhinnasaṃvaro" (one whose restraint is broken), certainly, one who has undertaken moral precepts and then, for some reason, has broken those precepts, is one whose restraint is broken.
Trong từ “bhinnasaṃvaro” (người bị phá giới), người đã thọ giới nhưng vì lý do nào đó mà bị phá giới, thì người đó là người bị phá giới.
Yo pana sabbena sabbaṃ asamādinnasīlo ācārahīno, so kathaṃ bhinnasaṃvaro nāma hotīti?
But how can one who has not undertaken moral precepts at all and is devoid of good conduct be called one whose restraint is broken?
Nhưng còn người hoàn toàn không thọ giới, không có giới hạnh, thì làm sao gọi là người bị phá giới?
Sopi sādhusamācārassa parihāniyassa bheditattā bhinnasaṃvaro eva nāma.
Even such a person is indeed one whose restraint is broken, because the virtuous conduct that was to be cultivated has been corrupted.
Người đó cũng được gọi là người bị phá giới vì đã làm hư hỏng giới hạnh tốt đẹp.
Vissaṭṭhasaṃvaro saṃvararahitoti hi vuttaṃ hoti.
For it is said that he is one whose restraint is abandoned, or one who is devoid of restraint.
Thật vậy, điều đó có nghĩa là người đã từ bỏ giới, người không có giới hạnh.
Tassāti dussīlassa.
"Tassā" refers to the immoral person.
“Tassā” (của người đó) là của người phá giới.
Samādāya pavattiṭṭhānanti uṭṭhāya samuṭṭhāya katakāraṇaṃ.
"Samādāya pavattiṭṭhānaṃ" means the action performed by repeatedly rising up (with effort).
“Samādāya pavattiṭṭhānaṃ” (nơi khởi đầu của sự thực hành) là hành động đã được thực hiện sau khi đứng dậy và bắt đầu.
Āpāthaṃ āgacchatīti taṃ manaso upaṭṭhāti.
Comes to mind means that it appears to the mind.
"Āpāthaṃ āgacchatī" có nghĩa là điều đó hiện lên trong tâm.
Ummīletvā idhalokanti ummīlanakāle attano puttadārādidassanavasena idha lokaṃ passati.
Opening his eyes, he sees this world means that at the time of opening his eyes, he sees this world by way of seeing his children, wife, and so forth.
"Ummīletvā idhalokaṃ" có nghĩa là khi mở mắt ra, người ấy thấy thế giới này qua việc nhìn thấy con cái, vợ con của mình, v.v.
Nimīletvā paraloka nti nimīlanakāle gatinimittupaṭṭhānavasena paralokaṃ passati. Tenāha ‘‘cattāro apāyā’’tiādi.
Closing his eyes, he sees the other world means that at the time of closing his eyes, he sees the other world by way of the arising of destination-signs. Therefore it is said, "The four lower realms" and so forth.
"Nimīletvā paralokaṃ" có nghĩa là khi nhắm mắt lại, người ấy thấy thế giới bên kia qua sự hiện hữu của các dấu hiệu tái sinh. Do đó, đã nói "bốn cõi khổ" và các điều tương tự.
Pañcamapadanti ‘‘kāyassa bhedā’’tiādinā vutto pañcamo ādīnavakoṭṭhāso.
The fifth point is the fifth category of danger, stated with "at the breaking up of the body" and so forth.
"Pañcamapadaṃ" có nghĩa là phần bất lợi thứ năm được nói đến với câu "kāyassa bhedā" (thân hoại) và các điều tương tự.
152. Issariyamattāyāti issariyappamāṇena, issariyena ceva vittūpakaraṇena cāti evaṃ vā attho daṭṭhabbo.
By their measure of sovereignty means by the extent of their sovereignty, or the meaning should be understood as by their sovereignty and by their wealth and implements.
152. "Issariyamattāya" có nghĩa là theo mức độ quyền lực, hoặc ý nghĩa nên được hiểu là cả quyền lực và các phương tiện tài sản.
Upabhogūpakaraṇānipi hi loke ‘‘mattā’’ti vuccanti.
For even implements of enjoyment are called "mattā" in the world.
Vì trên thế gian, các phương tiện hưởng thụ cũng được gọi là "mattā".
Pāṭaligāmaṃ nagaraṃ katvāti pubbe ‘‘pāṭaligāmo’’ti laddhanāmaṃ ṭhānaṃ idāni nagaraṃ katvā.
Making Pāṭaligāma into a city means now making the place formerly known as Pāṭaligāma into a city.
"Pāṭaligāmaṃ nagaraṃ katvā" có nghĩa là biến nơi trước đây gọi là "Pāṭaligāma" thành một thành phố.
Māpentīti patiṭṭhāpenti.
They construct means they establish.
"Māpenti" có nghĩa là xây dựng.
Āyamukhapacchindanatthanti āyadvārānaṃ upacchedanāya.
For cutting off the sources of revenue means for cutting off the doors of income.
"Āyamukhapacchindanatthaṃ" có nghĩa là để cắt đứt các nguồn thu nhập.
‘‘Sahassasevā’’ti vā pāṭho, sahassaso eva.
Or the reading is "a thousand services", meaning truly a thousandfold.
Hoặc là đọc "sahassasevā", tức là một ngàn mỗi lần.
Tenāha ‘‘ekekavaggavasena sahassaṃ sahassaṃ hutvā’’ti.
Therefore it is said, "becoming a thousand, a thousand, by way of each group."
Do đó, đã nói "mỗi nhóm một ngàn, một ngàn".
Gharavatthūnīti gharapatiṭṭhāpanaṭṭhānāni.
House sites means places for establishing houses.
"Gharavatthūnī" có nghĩa là những nơi để xây dựng nhà cửa.
Cittāni namantīti taṃtaṃdevatānubhāvena tattha tattheva cittāni namanti vatthuvijjāpāṭhakānaṃ, yattha yattha tāhi vatthūni pariggahitāni.
Minds incline means that the minds of those skilled in house-lore incline precisely there, by the power of the respective devatās, where the sites have been taken possession of by them.
"Cittāni namantī" có nghĩa là tâm trí của những người đọc khoa địa lý học nghiêng về những nơi đó, do năng lực của các vị thần liên quan, ở những nơi mà các vị thần đó đã chiếm giữ đất đai.
Sippānubhāvenāti sippānugatavijjānubhāvena.
By the power of their skill means by the power of the knowledge (vijjā) inherent in their craft.
"Sippānubhāvena" có nghĩa là do năng lực của các phép thuật liên quan đến nghề thủ công.
Nāgaggāhoti nāgānaṃ nivāsappariggaho.
Nāga-seizure means the taking possession of a dwelling by nāgas.
"Nāgaggāho" có nghĩa là sự chiếm giữ nơi ở của các loài Nāga.
Sesadvayesupi eseva nayo.
The same method applies to the other two categories (yakkha-seizure and bhūta-seizure).
Tương tự đối với hai trường hợp còn lại.
Pāsāṇoti appalakkhaṇapāsāṇo.
Stone means a small-featured stone.
"Pāsāṇo" có nghĩa là một hòn đá nhỏ.
Khāṇukoti yo koci khāṇuko.
Stump means any stump whatsoever.
"Khāṇuko" có nghĩa là bất kỳ gốc cây nào.
Sippaṃ jappitvā tādisaṃ sārambhaṭṭhānaṃ pariharitvā anārambhe ṭhāne tāhi vatthupariggāhikāhi devatāhi saddhiṃ mantayamānā viya taṃtaṃgehāni māpenti upadesadānavasena.
Having recited the skill (mantra), having avoided such a troublesome place, in a place free from trouble, they construct the respective houses as if consulting with the devatās who take possession of the sites, by way of giving instructions.
Sau khi niệm thần chú, tránh những nơi nguy hiểm như vậy, họ xây dựng những ngôi nhà đó ở những nơi an toàn, như thể đang bàn bạc với các vị thần chiếm giữ đất đai, bằng cách đưa ra lời khuyên.
Nesanti vatthuvijjāpāṭhakānaṃ, sabbāsaṃ devatānaṃ.
For them refers to the experts in house-lore, and to all devatās.
"Nesaṃ" có nghĩa là của những người đọc khoa địa lý học, của tất cả các vị thần.
Maṅgalaṃ vaḍḍhāpessantīti maṅgalaṃ brūhessanti.
They will increase good fortune means they will promote good fortune.
"Maṅgalaṃ vaḍḍhāpessantī" có nghĩa là họ sẽ làm tăng trưởng sự may mắn.
Paṇḍitadassanādīni hi uttamamaṅgalāni.
For seeing the wise and so forth are supreme good fortunes.
Vì việc gặp gỡ những người hiền trí và các điều tương tự là những điều may mắn tối thượng.
Tenāha ‘‘atha maya’’ntiādi.
Therefore it is said, "Then we…" and so forth.
Do đó, đã nói "atha mayaṃ" (bây giờ chúng ta) và các điều tương tự.
Ariyakamanussānanti ariyadesavāsimanussānaṃ.
Of people from an noble region means of people living in an Ariyan country.
"Ariyakamanussānaṃ" có nghĩa là của những người sống ở các xứ Ariya.
Rāsivasenevāti ‘‘sahassaṃ satasahassa’’ntiādinā rāsivaseneva, appakassa pana bhaṇḍassa kayavikkayo aññatthāpi labbhatevāti ‘‘rāsivasenevā’’ti vuttaṃ.
Only in bulk means only in bulk, such as "a thousand, a hundred thousand," and so forth; for the buying and selling of small quantities of goods can be found elsewhere too, hence it is said "only in bulk."
"Rāsivasenevā" có nghĩa là chỉ theo số lượng lớn, như "một ngàn, một trăm ngàn", v.v. Vì việc mua bán hàng hóa số lượng nhỏ cũng có thể thực hiện ở nơi khác, nên mới nói "rāsivasenevā" (chỉ theo số lượng lớn).
Vāṇijāya patho pavattiṭṭhānanti vaṇippathoti purimavikappe attho dutiyavikappe pana vāṇijānaṃ patho pavattiṭṭhānanti, vaṇippathoti imamatthaṃ dassento ‘‘vāṇijānaṃ vasanaṭṭhāna’’nti āha.
The path of trade is a place of occurrence, thus it is vaṇippatho; this is the meaning in the former alternative. In the latter alternative, however, it is the path of merchants, a place of occurrence, thus it is vaṇippatho; indicating this meaning, it says "place of residence for merchants."
Con đường giao thương là nơi diễn ra hoạt động thương mại, nên gọi là "vaṇippatho" (đường thương mại) theo cách giải thích đầu tiên. Trong cách giải thích thứ hai, nó là con đường giao thương của các thương nhân, nên để chỉ ý nghĩa này của "vaṇippatho", đã nói "nơi ở của các thương nhân".
Bhaṇḍapuṭe bhindanti mocenti etthāti puṭabhedananti ayamettha atthoti āha ‘‘bhaṇḍapuṭe…pe… vuttaṃ hotī’’ti.
Where bundles of goods are broken open and loosened, that is puṭabhedana; this is the meaning here, therefore it says "bundles of goods…pe… is said."
Nơi mà người ta mở và tháo các gói hàng hóa được gọi là "puṭabhedanaṃ" (nơi mở gói hàng), đây là ý nghĩa ở đây, do đó đã nói "bhaṇḍapuṭe…pe… vuttaṃ hotī".
Pattiṃ dadeyyāti attanā pasutaṃ puññaṃ tāsaṃ devatānaṃ anuppadajjeyya.
He should share the merit means he should transfer the merit he has generated to those devatās.
"Pattiṃ dadeyyā" có nghĩa là nên hồi hướng công đức đã tạo ra cho các vị thần đó.
‘‘Pūjitā’’tiādīsu tadeva pattidānaṃ pūjā, anāgate eva upaddave ārakkhasaṃvidhānaṃ paṭipūjā. ‘‘Yebhuyyena ñātimanussā ñātipetānaṃ pattidānādinā pūjanamānanādīni karonti ime pana aññātakāpi samānā tathā karonti, tasmā nesaṃ sakkaccaṃ ārakkhā saṃvidhātabbā’’ti aññamaññaṃ sampavāretvā devatā tattha ussukkaṃ āpajjantīti dassento ‘‘ime’’tiādimāha.
In "Worshipped," and so forth, that very sharing of merit is worship (pūjā); the provision of protection from future dangers is reciprocal worship (paṭipūjā). To show that "generally, human relatives perform worship and honor and so forth for their deceased relatives by sharing merit and so forth, but these (humans), though strangers, do likewise, therefore protection should be diligently arranged for them" — thus, having consulted with one another, the devatās become zealous in that matter — therefore it is said, "These" and so forth.
Trong "Pūjitā" và các điều tương tự, việc hồi hướng công đức đó chính là pūjā (cúng dường), còn việc sắp đặt sự bảo vệ chống lại các tai họa trong tương lai là paṭipūjā (cúng dường đáp lễ). Để chỉ ra rằng "thông thường, người thân làm các việc cúng dường, tôn kính, v.v. bằng cách hồi hướng công đức cho các vong linh người thân; nhưng những người này, dù không phải là người thân, cũng làm như vậy, do đó cần phải sắp đặt sự bảo vệ cẩn thận cho họ", các vị thần bàn bạc với nhau và quan tâm đến việc đó, nên đã nói "ime" và các điều tương tự.
Balikammakaraṇaṃ mānanaṃ, sampati uppannaparissayaharaṇaṃ paṭimānanti dassetuṃ ‘‘ete’’tiādi vuttaṃ.
To show that the offering of oblations is honor (mānana), and the removal of currently arisen dangers is reciprocal honor (paṭimānana), it is said, "These" and so forth.
Để chỉ ra rằng việc làm lễ vật là mānanaṃ (tôn kính), và việc loại bỏ các tai họa hiện tại là paṭimānanaṃ (tôn kính đáp lễ), đã nói "ete" và các điều tương tự.
Udakaṭṭhānassetaṃ adhivacananti yathāvuttassa yassa kassaci udakaṭṭhānassa etaṃ ‘‘aṇṇava’’nti adhivacanaṃ, samuddassevāti adhippāyo.
This is a designation for a body of water means this word "aṇṇava" is a designation for any body of water as stated; the intention is that it refers to the ocean.
"Udakaṭṭhānassetaṃ adhivacanaṃ" có nghĩa là từ "aṇṇava" này là tên gọi của bất kỳ nơi chứa nước nào đã được đề cập; ý nghĩa là chỉ biển cả.
Saranti idha nadī adhippetā sarati sandatīti katvā.
They refer to a river here because it flows and streams.
"Saranti idha nadī adhippetā" có nghĩa là ở đây, từ "saraṃ" được hiểu là con sông, vì nó chảy.
Gambhīravitthatanti agādhaṭṭhena gambhīraṃ, sakalalokattayabyāpitāya vitthataṃ.
Deep and extensive means deep in the sense of being unfathomable, and extensive due to its pervading all three worlds.
"Gambhīravitthataṃ" có nghĩa là sâu sắc về mặt không có đáy, và rộng lớn về mặt bao trùm toàn bộ ba cõi.
Visajjāti anāsajja appatvā.
Having bypassed means having not approached, having not reached.
"Visajjā" có nghĩa là không đến gần, không đạt tới.
Pallalāni tesaṃ ataraṇato.
Ponds because they do not cross them.
"Pallalāni" là những ao nhỏ, vì không vượt qua được chúng.
Vināyeva kullenāti īdisaṃ udakaṃ kullena īdisena vinā eva tiṇṇā medhāvino janā, taṇhāsaraṃ pana ariyamaggasaṅkhātaṃ setuṃ katvā nittiṇṇāti yojanā.
Without a raft means that wise people have crossed such water even without such a raft. The implication is that they have crossed the river of craving by making a bridge called the Noble Path.
"Vināyeva kullenā" có nghĩa là những người trí tuệ đã vượt qua loại nước như vậy mà không cần một chiếc bè như vậy. Còn đối với dòng sông tham ái, họ đã vượt qua bằng cách xây dựng một cây cầu là con đường Thánh đạo.
155. Mahāpanādassa rañño.
Of King Mahāpanāda.
155. Của vua Mahāpanāda.
Pāsādakoṭiyaṃ katagāmoti pāsādassa patitathupikāya patiṭṭhitaṭṭhāne niviṭṭhagāmo.
A village built at the pinnacle of the palace means a village established at the place where the fallen stupa of the palace was located.
"Pāsādakoṭiyaṃ katagāmo" có nghĩa là ngôi làng được xây dựng trên nền móng của cung điện bị sụp đổ.
Ariyabhāvakarānanti ye paṭivijjhanti, tesaṃ ariyabhāvakarānaṃ nimittassa kattubhāvūpacāravaseneva vuttaṃ.
Of those who become noble means of those who penetrate (the truths) and become noble, spoken by way of superimposition of the agent of the sign (of nobility).
"Ariyabhāvakarānaṃ" có nghĩa là đã nói theo cách ẩn dụ về nguyên nhân của dấu hiệu tạo ra trạng thái thánh thiện cho những người thấu hiểu.
Tacchāvipallāsabhūtabhāvena saccānaṃ. Anubodho pubbabhāgiyaṃ ñāṇaṃ, paṭivedho maggañāṇena abhisamayo, tattha yasmā anubodhapubbako paṭivedho anubodhena vinā na hoti, anubodhopi ekacco paṭivedhena sambandho, tadubhayābhāvahetukañca vaṭṭeva saṃsaraṇaṃ, tasmā vuttaṃ pāḷiyaṃ ‘‘ananubodhā…pe… tumhākañcā’’ti.
Of the truths due to their being utterly without distortion. "Anubodha" is preliminary knowledge, "paṭivedha" is abhisamaya (penetration) by path-knowledge. Since paṭivedha is preceded by anubodha and does not occur without it, and anubodha is also connected with paṭivedha in some cases, and the cycle of saṃsāra continues due to the absence of both, therefore it is said in the Pāḷi, "Because of not comprehending...pe... and for you."
Do bản chất không sai lầm, chúng là các chân lý. Anubodha là sự hiểu biết sơ khởi, paṭivedha là sự thấu hiểu bằng tuệ giác Đạo. Vì sự thấu hiểu đi trước sự chứng ngộ, và không có sự chứng ngộ nếu không có sự thấu hiểu, và sự luân hồi tiếp diễn là do thiếu cả hai điều đó, nên trong Pāḷi đã nói "ananubodhā...pe... tumhākañcā" (do không thấu hiểu... và của các vị).
Paṭisandhiggahaṇavasena bhavato bhavantarūpagamanaṃ sandhāvanaṃ, aparāparaṃ cavanupapajjanavasena sañcaraṇaṃ saṃsaraṇanti āha ‘‘bhavato’’tiādi.
Moving from one existence to another by way of rebirth is wandering on (sandhāvana); proceeding continuously by way of passing away and reappearing repeatedly is transmigrating (saṃsaraṇa). This is explained by “from existence,” etc.
Sự đi từ hữu này sang hữu khác theo phương diện tái tục được gọi là sandhāvanaṃ (sự chạy), và sự luân chuyển (cavanupapajjana) liên tục được gọi là saṃsaraṇa (sự luân hồi), như đã nói “bhavato” (từ hữu) v.v.
Sandhāvitasaṃsaritapadānaṃ kammasādhanataṃ sandhāyāha ‘‘mayā ca tumhehi cā’’ti paṭhamavikappe.
Referring to the kamma-sādhana (object construction) of the terms sandhāvita and saṃsarita, it states in the first interpretation: "by me and by you."
Trong trường hợp đầu tiên, câu “mayā ca tumhehi cā” (do tôi và do các ông) được nói để chỉ ra rằng các từ sandhāvitasaṃsarita là chủ thể của hành động.
Dutiyavikappe pana bhāvasādhanataṃ hadaye katvā ‘‘mamañceva tumhākañcā’’ti yathārutavaseneva vuttaṃ.
But in the second interpretation, keeping the bhāva-sādhana (impersonal construction) in mind, it is stated exactly as found in the original text: "mine and yours."
Trong trường hợp thứ hai, đặt nghĩa bhāvasādhana (nghĩa là trạng thái hiện hữu) vào trong tâm, thì câu "của tôi và của quý vị" đã được nói theo đúng nghĩa đen của Pali.
Nayanasamatthāti pāpanasamatthā, dīgharajjunā baddhasakuṇaṃ viya rajjuhattho puriso desantaraṃ taṇhārajjunā baddhaṃ sattasantānaṃ abhisaṅkhāro bhavantaraṃ neti etāyāti bhavanetti, taṇhā, sā ariyamaggasatthena suṭṭhu hatā chinnāti bhavanettisamūhatā.
Nayanasamatthā means capable of leading (to rebirth). That which leads a stream of beings, bound by the cord of craving (taṇhārajju), from one existence to another, just as a person holding a rope leads a bird tied with a long rope to another place, is bhavanetti, which is craving (taṇhā). When that bhavanetti is thoroughly destroyed and cut off by the sword of the Noble Path (ariyamagga), it is called bhavanettisamūhatā.
Nayanasamatthā có nghĩa là có khả năng đưa đến, có khả năng dẫn dắt. Giống như một người cầm dây dẫn một con chim bị buộc bằng sợi dây dài đến một nơi khác, thì abhisaṅkhāra (hành) dẫn dòng sinh mạng của chúng sinh bị buộc bằng sợi dây taṇhā (ái) đến một kiếp sống khác bằng cái này. Do đó, cái đó được gọi là bhavanetti (dây dẫn đến tái sinh), tức là taṇhā. Sā (ái) đó đã bị tiêu diệt hoàn toàn, bị cắt đứt bởi thanh kiếm của Thánh Đạo (ariyamagga), nên được gọi là bhavanettisamūhatā (ái đã bị nhổ tận gốc).
156. Dve gāmā ‘‘nātikā’’ti evaṃ laddhanāmo, ña-kārassa cāyaṃ na-kārādesena niddeso ‘‘animittā na nāyare’’tiādīsu (visuddhi. 1.174; jā. aṭṭha. 2.2.34) viya.
156. Two villages are those known as "Nātikā," and this designation uses a change from 'ñ' to 'n', as in "animittā na nāyare" and so on.
156. Dve gāmā (hai ngôi làng) được gọi là “Nātikā”. Đây là sự chỉ định bằng cách thay thế chữ ña bằng chữ na, giống như trong các câu như “animittā na nāyare” (visuddhi. 1.174; jā. aṭṭha. 2.2.34) và các câu khác.
Tenāha ‘‘ñātigāmake’’ti.
Therefore, it states "in the Ñātigāmaka."
Vì vậy, đã nói “ñātigāmake” (ở làng Nātikā).
Giñjakā vuccanti iṭṭhakā, giñjakāhi eva kato āvasathoti giñjakāvasatho.
Giñjakā refers to bricks. An abode made entirely of bricks is called giñjakāvasatha.
Giñjakā được gọi là gạch. Một tu viện được xây hoàn toàn bằng gạch được gọi là giñjakāvasatho.
So kira āvāso yathā sudhāparikammena sampayojanaṃ natthi, evaṃ iṭṭhakāhi eva cinitvā chādetvā kato.
That dwelling was apparently constructed and roofed entirely with bricks, in such a way that there was no need for plastering.
Ngôi tu viện đó được xây dựng và lợp mái hoàn toàn bằng gạch, không cần đến vữa trát.
Tena vuttaṃ ‘‘iṭṭhakāmaye āvasathe’’ti.
Therefore, it is said "in the brick-built abode."
Vì vậy, đã nói “iṭṭhakāmaye āvasathe” (trong tu viện bằng gạch).
Tulādaṇḍakavāṭaphalakāni pana dārumayāneva.
However, the beams, door-frames, and planks were indeed made of wood.
Tuy nhiên, các xà ngang, khung cửa và ván cửa đều làm bằng gỗ.
157. Oraṃ vuccati kāmadhātu, paccayabhāvena taṃ oraṃ bhajantīti orambhāgiyāni, orambhāgassa vā hitāni orambhāgiyāni. Tenāha ‘‘heṭṭhābhāgiyāna’’ntiādi.
157. Oraṃ means the sense-sphere (kāmadhātu). They cling to that oraṃ (lower realm) by way of condition, hence orambhāgiyāni. Or, orambhāgiyāni are those beneficial to the lower part (orambhāga). Therefore, it states "of the lower portion," etc.
157. Oraṃ được gọi là dục giới (kāmadhātu). Chúng nương tựa vào dục giới đó như một điều kiện nên được gọi là orambhāgiyāni (thuộc hạ phần), hoặc chúng hữu ích cho hạ phần nên là orambhāgiyāni. Vì vậy, đã nói “heṭṭhābhāgiyānaṃ” (các kiết sử hạ phần) và các câu khác.
Tīhi maggehīti heṭṭhimehi tīhi maggehi.
By the three paths means by the three lower paths.
Tīhi maggehī (bởi ba đạo) nghĩa là bởi ba đạo thấp hơn.
Tehi pahātabbatāya hi nesaṃ saṃyojanānaṃ orambhāgiyatā.
Indeed, their belonging to the lower realms (orambhāgiyatā) is due to their being abandoned by these (lower paths).
Thật vậy, do phải được đoạn trừ bởi chúng, nên các kiết sử đó thuộc hạ phần (orambhāgiyā).
Orambhañjiyāni vā orambhāgiyāni vuttāni niruttinayena.
Alternatively, orambhañjiyāni are called orambhāgiyāni according to the rule of etymology (nirutti).
Hoặc, orambhāgiyāni được nói theo cách giải thích từ nguyên là orambhañjiyāni (những thứ bị ba đạo thấp hơn hủy diệt).
Idāni byatirekamukhena nesaṃ orambhāgiyabhāvaṃ vibhāvetuṃ ‘‘tatthā’’tiādi vuttaṃ.
Now, to illustrate their nature as belonging to the lower realms through the method of antithesis, "tatthā" etc. is stated.
Bây giờ, để làm rõ tính chất hạ phần của chúng bằng cách phủ định, câu “tatthā” (ở đó) và các câu khác đã được nói.
Vikkhambhitāni samatthatāvighātena puthujjanānaṃ, samucchinnāni sabbaso abhāvena ariyānaṃ rūpārūpabhavūpapattiyā vibandhāya na hontīti vuttaṃ ‘‘avikkhambhitāni asamucchinnānī’’ti.
Vikkhambhitāni are those suppressed for ordinary people by hindering their capacity (for rebirth in higher realms), while samucchinnāni are those utterly eradicated for noble ones, so they do not lead to rebirth in form or formless existences. Therefore, it is said "not suppressed and not eradicated."
Vikkhambhitāni (bị trấn áp) đối với phàm nhân là do sự cản trở khả năng (sinh khởi ở các cõi sắc và vô sắc); samucchinnāni (bị đoạn tận) đối với các bậc Thánh là do hoàn toàn không còn tồn tại, không còn là sự ràng buộc cho sự tái sinh vào các cõi sắc và vô sắc. Vì vậy, đã nói “avikkhambhitāni asamucchinnānī” (chưa bị trấn áp, chưa bị đoạn tận).
Nibbattavasenāti paṭisandhiggahaṇavasena.
By way of rebirth means by way of taking a new existence (paṭisandhi).
Nibbattavasenā (theo cách sinh khởi) nghĩa là theo cách thọ sinh (paṭisandhi).
Gantuṃ na denti mahaggatagāmikammāyūhanassa vinibandhanato.
They do not allow one to go due to obstructing the cultivation of kamma that leads to higher realms.
Gantuṃ na denti (không cho đi) là do sự ràng buộc của việc tích lũy các nghiệp dẫn đến các cõi cao hơn.
Sakkāyadiṭṭhiādīni tīṇi saṃyojanāni kāmacchandabyāpādā viya mahaggatūpapattiyā avinibandhabhūtānipi kāmabhavūpapattiyā visesapaccayattā tattha mahaggatabhave nibbattampi tannibbattihetukammaparikkhaye kāmabhavūpapattipaccayatāya mahaggatabhavato ānetvā puna idheva kāmabhave eva nibbattāpenti, tasmā sabbānipi pañcapi saṃyojanāni orambhāgiyāni eva.
The three fetters, self-view (sakkāyadiṭṭhi) and so on, even if they are not hindrances to rebirth in higher realms like sensual desire (kāmacchanda) and ill-will (byāpāda), nevertheless, due to being special conditions for rebirth in the sense-sphere, even if one is born there in a higher existence, upon the exhaustion of the kamma that caused that birth, they bring one back from that higher existence due to being conditions for rebirth in the sense-sphere, and cause one to be reborn again right here in the sense-sphere. Therefore, all five fetters are orambhāgiyāni (belonging to the lower realms).
Ba kiết sử như sakkāyadiṭṭhi (thân kiến) và các kiết sử khác, mặc dù không phải là sự ràng buộc cho sự tái sinh vào các cõi cao hơn như kāmacchanda (dục ái) và byāpāda (sân hận), nhưng do là nhân duyên đặc biệt cho sự tái sinh vào dục giới, nên ở đó, ngay cả khi đã sinh khởi trong cõi cao hơn (mahaggatabhava), khi nghiệp là nguyên nhân của sự tái sinh đó chấm dứt, chúng sẽ kéo về từ cõi cao hơn và làm cho tái sinh lại ngay tại đây, tức là trong dục giới. Do đó, tất cả năm kiết sử đều là orambhāgiyā (thuộc hạ phần).
Paṭisandhivasena anāgamanasabhāvāti paṭisandhiggahaṇavasena tasmā lokā idha na āgamanasabhāvā.
Of the nature of not returning by way of rebirth means of the nature of not returning to this (sense-sphere) world from that world (of the Suddhāvāsa devas) by way of taking a new existence (paṭisandhi).
Paṭisandhivasena anāgamanasabhāvā (không có bản chất trở lại theo cách thọ sinh) nghĩa là theo cách thọ sinh, từ cõi đó (Tịnh Cư Thiên) không có bản chất trở lại cõi này (dục giới).
Buddhadassanatheradassanadhammassavanānaṃ panatthāyassa āgamanaṃ anivāritaṃ.
However, their coming for the purpose of seeing the Buddha, seeing the Elder, and hearing the Dhamma is not prohibited.
Tuy nhiên, sự trở lại của vị đó (vị Bất Hoàn) vì mục đích chiêm ngưỡng Đức Phật, chiêm ngưỡng các Trưởng lão, và nghe Pháp thì không bị ngăn cản.
Kadāci karahaci uppattiyā saviraḷākāratā pariyuṭṭhānamandatāya abahalatāti dvedhāpi tanubhāvo.
Scarcity in arising occasionally or rarely, and lack of intensity due to weakness of obsession; thus, thinness in both ways.
Kadāci karahaci uppattiyā (sinh khởi đôi khi) là sự hiếm hoi, pariyuṭṭhānamandatāya (do sự yếu ớt của sự khởi lên) là không mãnh liệt. Như vậy, dvedhāpi tanubhāvo (sự mỏng manh theo cả hai cách).
Abhiṇhanti bahuso.
Abhiṇha means frequently.
Abhiṇha (thường xuyên) nghĩa là nhiều lần.
Bahalabahalāti tibbatibbā.
Bahalabahalā means very intense.
Bahalabahalā (rất mãnh liệt) nghĩa là rất dữ dội.
Yattha uppajjanti, taṃ santānaṃ maddantā, pharantā, sādhentā, andhakāraṃ karontā uppajjanti, dvīhi pana maggehi pahīnattā tanukatanukā mandamandā uppajjanti.
Where they arise, they arise crushing, pervading, establishing, and obscuring that continuum; but having been abandoned by the two paths, they arise very slightly, very weakly.
Nơi nào chúng sinh khởi, chúng sinh khởi bằng cách đè nén, bao trùm, chế ngự và tạo ra bóng tối cho dòng tương tục đó. Tuy nhiên, do đã bị đoạn trừ bởi hai đạo, chúng sinh khởi tanukatanukā (rất yếu ớt), mandamandā (rất nhẹ nhàng).
‘‘Puttadhītaro hontī’’ti idaṃ akāraṇaṃ.
The statement "they have sons and daughters" is irrelevant.
Câu “Puttadhītaro hontī” (có con trai và con gái) là vô lý.
Tathā hi aṅgapaccaṅgaparāmasanamattenapi te honti.
Indeed, they come into existence even by merely touching limbs.
Thật vậy, ngay cả chỉ bằng cách chạm vào các bộ phận cơ thể, chúng cũng có thể sinh ra.
Idanti ‘‘rāgadosamohānaṃ tanuttā’’ti idaṃ vacanaṃ.
This refers to the statement "due to the attenuated nature of greed, hatred, and delusion."
Idaṃ (điều này) là câu nói “rāgadosamohānaṃ tanuttā” (do tham, sân, si yếu ớt).
Bhavatanukavasenāti appakabhavavasena.
By way of attenuated existences means by way of few existences.
Bhavatanukavasenā (theo cách giảm thiểu các kiếp sống) nghĩa là theo cách có ít kiếp sống.
Tanti mahāsivattherassa vacanaṃ paṭikkhittanti sambandho.
That refers to the rejection of Mahāsivatthera's statement; this is the connection.
Taṃ (điều đó) có liên quan đến việc bác bỏ lời nói của Trưởng lão Mahāsiva.
Ye bhavā ariyānaṃ labbhanti, te paripuṇṇalakkhaṇabhavā eva.
The existences that noble ones attain are always existences with complete characteristics.
Những kiếp sống mà các bậc Thánh có thể đạt được đều là những kiếp sống có đầy đủ đặc tính.
Ye na labbhanti, tattha kīdisaṃ taṃ bhavatanukaṃ, tasmā ubhayathāpi bhavatanukassa asambhavo evāti dassetuṃ ‘‘sotāpannassā’’tiādi vuttaṃ.
Where they do not attain existences, what kind of attenuated existence would that be? Therefore, to show that an attenuated existence is impossible in both cases, "of the Stream-enterer," etc. is stated.
Những kiếp sống mà họ không thể đạt được, thì sự giảm thiểu kiếp sống đó là như thế nào? Vì vậy, để chỉ ra rằng sự giảm thiểu kiếp sống không thể xảy ra theo cả hai cách, câu “sotāpannassā” (của bậc Nhập Lưu) và các câu khác đã được nói.
Aṭṭhame bhave bhavatanukaṃ natthi aṭṭhamasseva bhavassa sabbasseva abhāvato.
There is no attenuated existence in the eighth existence because the eighth existence itself does not exist at all.
Aṭṭhame bhave bhavatanukaṃ natthi (không có sự giảm thiểu kiếp sống trong kiếp thứ tám) là do kiếp thứ tám không tồn tại hoàn toàn.
Sesesupi eseva nayo.
The same method applies to the remaining cases.
Nguyên tắc tương tự cũng áp dụng cho các trường hợp còn lại.
Kāmāvacaralokaṃ sandhāya vuttaṃ itarassa lokassa vasena tathā vattuṃ asakkuṇeyyattā.
It is said with reference to the sense-sphere world because it is impossible to speak thus with reference to other worlds.
Kāmāvacaralokaṃ sandhāya vuttaṃ (được nói liên quan đến cõi dục giới) là vì không thể nói như vậy đối với các cõi khác.
Yo hi sakadāgāmī devamanussalokesu vomissakavasena nibbattati, sopi kāmabhavavaseneva paricchinditabbo.
Even the once-returner who is born in a mixed way in the deva and human worlds should be delimited by way of the sense-sphere existence.
Vị Nhất Lai (sakadāgāmī) nào tái sinh xen kẽ trong các cõi trời và người, vị đó cũng phải được phân loại theo dục giới.
Bhagavatā ca kāmaloke ṭhatvā ‘‘sakideva imaṃ lokaṃ āgantvā’’ti vuttaṃ, ‘‘imaṃ lokaṃ āgantvā’’ti ca iminā pañcasu sakadāgāmīsu cattāro vajjetvā ekova gahito.
The Blessed One, while dwelling in the sense-sphere world, said: "having come to this world just once," and by "having come to this world," only one out of the five types of once-returners is included, excluding the four.
Đức Thế Tôn đã ở trong dục giới và nói: “sakideva imaṃ lokaṃ āgantvā” (chỉ một lần trở lại cõi này), và với câu “imaṃ lokaṃ āgantvā” (trở lại cõi này), trong năm loại Nhất Lai, bốn loại đã bị loại trừ và chỉ một loại được chấp nhận.
Ekacco hi idha sakadāgāmiphalaṃ patvā idheva parinibbāyati, ekacco idha patvā devaloke parinibbāyati, ekacco devaloke patvā tattheva parinibbāyati, ekacco devaloke patvā idhūpapajjitvā parinibbāyati, ime cattāro idha na labbhanti.
Indeed, some attain the fruit of once-returner here and attain Nibbāna right here; some attain it here and attain Nibbāna in the deva world; some attain it in the deva world and attain Nibbāna right there; some attain it in the deva world, are reborn here, and attain Nibbāna; these four are not included here.
Một số vị đạt được quả Nhất Lai ở đây (cõi người) và nhập Niết Bàn ngay tại đây; một số vị đạt được ở đây và nhập Niết Bàn ở cõi trời; một số vị đạt được ở cõi trời và nhập Niết Bàn ngay tại đó; một số vị đạt được ở cõi trời, tái sinh ở đây và nhập Niết Bàn. Bốn loại này không được chấp nhận ở đây.
Yo pana idha patvā devaloke yāvatāyukaṃ vasitvā puna idhūpapajjitvā parinibbāyati, ayaṃ idha adhippeto.
But the one who attains it here, dwells in the deva world for the duration of their life, then is reborn here again and attains Nibbāna, is intended here.
Tuy nhiên, vị nào đạt được ở đây, sống ở cõi trời cho đến hết tuổi thọ, rồi tái sinh lại ở đây và nhập Niết Bàn, vị này được đề cập ở đây.
Aṭṭhakathāyaṃ pana imaṃ lokanti kāmabhavo adhippetoti imamatthaṃ vibhāvetuṃ ‘‘sace hī’’tiādinā aññaṃyeva catukkaṃ dassitaṃ.
In the commentary, however, to clarify the meaning that the sense-sphere existence is intended by "this world," another set of four types is presented with "if indeed," etc.
Trong chú giải, để làm rõ ý nghĩa rằng “cõi này” (imaṃ lokaṃ) có nghĩa là dục giới, một nhóm bốn loại khác đã được trình bày bằng câu “sace hī” (nếu vậy) và các câu khác.
158. Tesaṃ tesaṃ ñāṇagatinti tesaṃ tesaṃ sattānaṃ ‘‘asuko sotāpanno, asuko sakadāgāmī’’tiādinā taṃtaṃñāṇādhigamanaṃ.
158. The knowledge and destiny of those various individuals means the attainment of specific knowledge of those various beings, such as "so-and-so is a Stream-enterer, so-and-so is a Once-returner."
158. Tesaṃ tesaṃ ñāṇagatiṃ (sự tiến bộ trí tuệ của từng người) nghĩa là sự chứng đắc trí tuệ của từng chúng sinh, chẳng hạn như “người đó là Nhập Lưu, người đó là Nhất Lai”.
Ñāṇūpapattiṃ ñāṇābhisamparāyanti tato parampi ‘‘niyato sambodhiparāyaṇo, sakideva imaṃ lokaṃ āgantvā dukkhassantaṃ karissatī’’tiādinā ca ñāṇasahitaṃ uppattipaccayabhāvaṃ.
The arising of knowledge and the future of knowledge also refers to the condition of rebirth accompanied by knowledge, further stating: "He is determined (to reach) supreme enlightenment; having come to this world just once, he will make an end of suffering," and so on.
Ñāṇūpapattiṃ ñāṇābhisamparāya (sự sinh khởi trí tuệ và sự thành tựu trí tuệ) nghĩa là từ đó trở đi, trạng thái là điều kiện cho sự tái sinh cùng với trí tuệ, như trong các câu “nhất định sẽ đạt đến giác ngộ, chỉ một lần trở lại cõi này và chấm dứt khổ đau”.
Olokentassa ñāṇacakkhunā pekkhantassa kāyakilamathova, na tena kāci veneyyānaṃ atthasiddhīti adhippāyo.
For one who looks with the eye of wisdom (ñāṇacakkhu), it is merely physical exertion, meaning that no benefit is achieved for those who can be tamed.
Olokentassa (khi nhìn), tức là khi nhìn bằng nhãn tuệ (ñāṇacakkhu), kāyakilamathova (chỉ là sự mệt mỏi về thân), ý nghĩa là không có lợi ích gì cho những người có thể được giáo hóa.
Cittavihesāti cittakhedo, sā kilesūpasaṃhitattā buddhānaṃ natthi. Ādīyati ālokīyati attā etenāti ādāsaṃ, dhammabhūtaṃ ādāsaṃ dhammādāsaṃ, ariyamaggañāṇassetaṃ adhivacanaṃ, tena ariyasāvakā catūsu ariyasaccesu viddhastasammohattā attānampi yāthāvato ñatvā yāthāvato byākareyya, tappakāsanato pana dhammapariyāyassa suttassa dhammādāsatā veditabbā.
Mental distress (cittavihesā) means agitation of mind. Being connected with defilements, it does not exist for Buddhas. That by which oneself is taken up and seen is a mirror (ādāsaṃ); a mirror that is Dhamma is a Dhamma-mirror (dhammādāsaṃ). This is a term for the knowledge of the noble path (ariyamaggañāṇa). By it, noble disciples, having completely overcome delusion regarding the Four Noble Truths, might know themselves as they truly are and declare it as it truly is. Furthermore, the Dhamma discourse (dhammapariyāya), the Sutta, should be understood as a Dhamma-mirror because it reveals this.
Cittavihesā (sự khó chịu trong tâm) là sự phiền muộn của tâm; điều đó, vì liên quan đến phiền não, nên không có nơi các vị Phật. Cái mà nhờ đó tự thân được nhìn thấy, được soi sáng, thì gọi là ādāsaṃ (gương); cái gương là pháp thì gọi là dhammādāsaṃ (gương pháp). Đây là tên gọi khác của trí tuệ đạo Thánh (ariyamaggañāṇa). Nhờ đó, các bậc Thánh đệ tử, vì đã phá tan sự si mê đối với Tứ Diệu Đế, nên tự mình biết rõ chân tướng và có thể tuyên bố chân tướng. Tuy nhiên, cần phải hiểu rằng sự tuyên bố đó là do dhammapariyāya (pháp môn) của bài kinh có tính chất dhammādāsa (gương pháp).
Yena dhammādāsenāti idha pana maggadhammameva vadati.
By which Dhamma-mirror (yena dhammādāsenā) — here, it refers to the path-Dhamma itself.
Yena dhammādāsenā (nhờ gương pháp nào) ở đây chỉ nói đến pháp đạo.
161. Tadā kira vesālī iddhā phītā sabbaṅgasampannā ahosi vepullappattā, taṃ sandhāyāha ‘‘khandhake vuttanayena vesāliyā sampannabhāvo veditabbo’’ti.
161. It is said that at that time Vesālī was prosperous, flourishing, endowed with all its constituent parts, and had reached abundance. With reference to that, it is said, “the prosperity of Vesālī, as stated in the Khandhaka, should be understood.”
161. Khi ấy, Vesālī phồn thịnh, phát triển và đầy đủ mọi phương diện; điều này được nói đến khi đề cập rằng: “khandhake vuttanayena vesāliyā sampannabhāvo veditabbo” (cần hiểu sự thịnh vượng của Vesālī theo cách đã được nói trong Khandhaka).
Tasmiṃ kira bhikkhusaṅghe pañcasatamattā bhikkhū navā acirapabbajitā ahesuṃ osannavīriyā ca.
It is said that in that monastic community (Bhikkhusaṅgha), there were five hundred bhikkhus who were newly ordained and lacking in energy.
Trong Tăng đoàn ấy, có khoảng năm trăm vị Tỳ-kheo còn trẻ, mới xuất gia và lười biếng tinh tấn.
Tathā hi vakkhati ‘‘tattha kira ekacce bhikkhū osannavīriyā’’tiādi (dī. ni. aṭṭha. 2.165).
Thus, it will be stated: “It is said that some bhikkhus there were lacking in energy,” and so on.
Thật vậy, sẽ được nói rằng: “Tattha kira ekacce bhikkhū osannavīriyā”tiādi (Dī. Ni. Aṭṭha. 2.165) (Ở đó, một số Tỳ-kheo lười biếng tinh tấn, v.v.).
Satipaccupaṭṭhānatthanti tesaṃ satipaccupaṭṭhāpanatthaṃ.
For the establishment of mindfulness (satipaccupaṭṭhānatthaṃ) means for establishing mindfulness for them.
Satipaccupaṭṭhānatthaṃ (vì mục đích thiết lập niệm) là vì mục đích thiết lập niệm cho họ.
Saratīti kāyādike yathāsabhāvato ñāṇasampayuttāya satiyā anussarati upadhāreti.
Remembers (saratī) means one repeatedly recollects and firmly grasps the body and so on, as they are by nature, with mindfulness endowed with knowledge.
Saratī (nhớ) là nhớ lại, ghi nhớ một cách đúng đắn với niệm đi kèm trí tuệ về thân, v.v., theo bản chất của chúng.
Sampajānātīti samaṃ pakārehi jānāti avabujjhati.
Clearly comprehends (sampajānātī) means one knows and understands equally well in various ways.
Sampajānātī (biết rõ) là biết rõ, thấu hiểu một cách đồng đều với các phương diện.
Ayamettha saṅkhepo, vitthāro pana parato satipaṭṭhānavaṇṇanāyaṃ (dī. ni. aṭṭha. 2.373; ma. ni. aṭṭha. 1.106) āgamissati.
This is the brief explanation here; the detailed explanation will come later in the explanation of Satipaṭṭhāna (satipaṭṭhānavaṇṇanāyaṃ).
Đây là phần tóm tắt ở đây; phần chi tiết sẽ được trình bày sau trong Satipaṭṭhānavaṇṇanā (Dī. Ni. Aṭṭha. 2.373; Ma. Ni. Aṭṭha. 1.106).
Sabbasaṅgāhakanti sarīragatassa ceva vatthālaṅkāragatassa cāti sabbassa nīlabhāvassa saṅgāhakaṃ vacanaṃ.
All-inclusive (sabbasaṅgāhakaṃ) is a term that includes all blueness, whether pertaining to the body or to ornaments and clothing.
Sabbasaṅgāhakaṃ (bao gồm tất cả) là lời nói bao gồm tất cả các sắc thái xanh, cả trên thân thể lẫn trên y phục và trang sức.
Tassevāti nīlāti sabbasaṅgāhakavasena vuttaatthasseva.
Of that very same (tassevā) refers to the meaning stated as “blue” (nīlāti) in an all-inclusive sense.
Tassevā (của chính điều đó) là của chính ý nghĩa đã nói, bao gồm tất cả các sắc thái xanh.
Vibhāgadassananti pabhedadassanaṃ.
Showing the division (vibhāgadassanaṃ) means showing the distinctions.
Vibhāgadassanaṃ (sự trình bày sự phân loại) là sự trình bày các loại.
Yathā te licchavirājāno apītādivaṇṇā eva keci vilepanavasena pītādivaṇṇā khāyiṃsu, evaṃ anīlādivaṇṇā eva keci vilepanavasena nīlādivaṇṇā khāyiṃsūti vuttaṃ ‘‘na tesaṃ pakativaṇṇo nīlo’’tiādi.
Just as some of those Licchavi kings, though not naturally yellow etc. in color, appeared yellow etc. due to anointing, so too some, though not naturally blue etc. in color, appeared blue etc. due to anointing. Therefore, it is said, “their natural color was not blue,” and so on.
Giống như các vị vua Licchavi đó, bản chất không có màu vàng, v.v., nhưng một số người lại trông có màu vàng, v.v., do việc thoa dầu thơm, thì cũng vậy, một số người bản chất không có màu xanh, v.v., nhưng lại trông có màu xanh, v.v., do việc thoa dầu thơm. Vì vậy, có lời rằng: “na tesaṃ pakativaṇṇo nīlo”tiādi (màu tự nhiên của họ không phải là xanh, v.v.).
Nīlo maṇi etesūti nīlamaṇi, indanīlamahānīlādinīlaratanavinaddhā alaṅkārā.
Adorned with blue gems (nīlamaṇi) means ornaments adorned with blue gems like sapphire (indanīla) and great sapphire (mahānīla).
Có ngọc xanh trong những thứ này thì gọi là nīlamaṇi (ngọc xanh), tức là các trang sức được trang trí bằng các loại ngọc xanh như ngọc Indanīla, Mahānīla, v.v.
Te kira suvaṇṇaviracite hi maṇiobhāsehi ekanīlā viya khāyanti.
It is said that those (kings) appeared to be of a uniform blue color due to the gleam of the gems set in gold.
Những thứ đó, khi được chế tác bằng vàng, dường như chỉ có một màu xanh duy nhất do ánh sáng của ngọc.
Nīlamaṇikhacitāti nīlaratanaparikkhittā.
Inlaid with blue gems (nīlamaṇikhacitā) means encircled with blue precious stones.
Nīlamaṇikhacitā (được khảm ngọc xanh) là được bao quanh bởi các viên ngọc xanh.
Nīlavatthaparikkhittāti nīlavatthanīlakampalaparikkhepā.
Enclosed in blue cloth (nīlavatthaparikkhittā) means having coverings of blue cloth and blue blankets.
Nīlavatthaparikkhittā (được bao phủ bởi vải xanh) là được bao phủ bởi vải xanh hoặc chăn xanh.
Nīlavammikehīti nīlakaghaṭaparikkhittehi.
With blue shields (nīlavammikehī) means surrounded by blue armaments.
Nīlavammikehī (bởi những áo giáp xanh) là bởi những áo giáp xanh được bao phủ bởi những chiếc áo choàng xanh.
Sabbapadesūti ‘‘pītā hontī’’tiādisabbapadesu.
In all instances (sabbapadesū) means in all instances such as “may they be yellow” and so on.
Sabbapadesū (trong tất cả các trường hợp) là trong tất cả các trường hợp như “hãy có màu vàng”, v.v.
Parivaṭṭesīti paṭighaṭṭesi.
They clashed (parivaṭṭesī) means they struck against each other.
Parivaṭṭesī (xoay chuyển) là va chạm.
Āharanti imasmā rājapurisā balinti āhāro, tappattajanapadoti āha ‘‘sāhāranti sajanapada’’nti.
Royal officials collect taxes from this region, hence it is a resource (āhāro), meaning a country from which taxes are obtained. Therefore, it is said, “with their resources means with their inhabitants.”
Các quan lại thu thuế từ nơi này thì gọi là āhāro (thuế), tức là vùng đất mà thuế được thu. Vì vậy, có lời rằng: “sāhāranti sajanapada” (sāhāra là cùng với người dân).
Aṅguliphoṭopi aṅguliyā cālanavaseneva hotīti vuttaṃ ‘‘aṅguliṃ cālesu’’nti.
Even the snapping of fingers occurs only by moving the fingers, therefore it is said, “they moved their fingers.”
Tiếng búng ngón tay cũng chỉ xảy ra khi ngón tay được cử động, nên có lời rằng: “aṅguliṃ cālesu” (họ cử động ngón tay).
Ambakāyāti mātugāmena.
By the lady (ambakāyā) means by the woman.
Ambakāyā (bởi người phụ nữ) là bởi người phụ nữ.
Upacāravacanaṃ hetaṃ itthīsu, yadidaṃ ‘‘ambakā mātugāmo jananikā’’ti.
For this, which is “ambakā, mātugāmo, jananikā,” is a figurative expression used for women.
Thật vậy, đây là một cách gọi thông thường đối với phụ nữ, đó là “ambakā, mātugāmo, jananikā” (người phụ nữ, người mẹ, người sinh sản).
‘‘Upasaṃharatha bhikkhave licchaviparisaṃ tāvatiṃsasadisa’’nti nayidaṃ nimittaggāhe niyojanaṃ, kevalaṃ pana dibbasampattisadisā etesaṃ rājūnaṃ issariyasampattīti anupubbikathāya saggasampattikathanaṃ viya daṭṭhabbaṃ.
“Bhikkhus, compare the assembly of the Licchavis to that of the Tāvatiṃsa devas”—this is not an injunction to grasp at an object of sensual pleasure (nimittaggāha). Rather, it should simply be seen as a discourse on the blessings of heaven, like the gradual discourse, where the royal prosperity of these kings is similar to divine prosperity.
“Hỡi các Tỳ-kheo, hãy so sánh hội chúng Licchavi với chư thiên Đao Lợi” – đây không phải là sự chỉ dẫn để nắm giữ tướng, mà chỉ nên xem như là một lời nói tuần tự về sự thịnh vượng của cõi trời, giống như việc nói về sự thịnh vượng của các vị vua này tương đương với sự thịnh vượng của cõi trời.
Tesu pana bhikkhūsu ekaccānaṃ tattha nimittaggāhopi siyā, taṃ sandhāya vuttaṃ ‘‘nimittaggāhe uyyojetī’’ti.
However, for some of those bhikkhus, there might be a grasping at an object of sensual pleasure there. With reference to that, it is said, “he instructs them to grasp at an object of sensual pleasure.”
Tuy nhiên, đối với một số Tỳ-kheo trong số đó, có thể có sự nắm giữ tướng ở đó, nên có lời rằng: “nimittaggāhe uyyojetī” (Ngài khuyến khích nắm giữ tướng).
Hitakāmatāya tesaṃ bhikkhūnaṃ yathā āyasmato nandassa hitakāmatāya saggasampattidassanaṃ.
Out of goodwill (hitakāmatāya) for those bhikkhus, just as the showing of heavenly prosperity was out of goodwill for Venerable Nanda.
Hitakāmatāya (vì lòng mong muốn lợi ích) là vì lòng mong muốn lợi ích cho các Tỳ-kheo đó, giống như việc cho thấy sự thịnh vượng của cõi trời vì lòng mong muốn lợi ích cho Tôn giả Nanda.
Tenāha ‘‘tatra kirā’’tiādi.
Therefore, it is said, “there, it is said,” and so on.
Vì vậy, có lời rằng: “tatra kirā”tiādi (ở đó, v.v.).
Osannavīriyāti sammāpaṭipattiyaṃ avasannavīriyā, ossaṭṭhavīriyā vāti attho.
Lacking in energy (osannavīriyā) means having diminished energy in proper practice, or having given up energy; this is the meaning.
Osannavīriyā (lười biếng tinh tấn) là những người có tinh tấn suy yếu trong sự thực hành đúng đắn, hay nói cách khác là những người đã từ bỏ tinh tấn.
Aniccalakkhaṇavibhāvanatthanti tesaṃ rājūnaṃ vasena bhikkhūnaṃ aniccalakkhaṇavibhūtabhāvatthaṃ.
For the manifestation of the characteristic of impermanence (aniccalakkhaṇavibhāvanatthaṃ) means for the bhikkhus to clearly perceive the characteristic of impermanence in relation to those kings.
Aniccalakkhaṇavibhāvanatthaṃ (vì mục đích làm rõ tướng vô thường) là vì mục đích làm rõ tướng vô thường của các Tỳ-kheo thông qua các vị vua đó.
164. Pharusoti kakkhaḷo, garutaroti attho.
164. Harsh (pharuso) means rough, meaning very severe.
164. Pharuso (khắc nghiệt) là thô ráp, có nghĩa là rất nặng nề.
Visabhāgarogoti dhātuvisabhāgatāya samuṭṭhito bahalatararogo, na ābādhamattaṃ.
Inappropriate disease (visabhāgarogo) means a very intense disease that arose due to imbalance of the elements (dhātu), not merely a slight ailment.
Visabhāgarogo (bệnh không tương hợp) là một căn bệnh nghiêm trọng phát sinh do sự không tương hợp của các yếu tố, không chỉ là một cơn đau thông thường.
Ñāṇena paricchinditvāti vedanānaṃ khaṇikataṃ, dukkhataṃ, attasuññatañca yāthāvato ñāṇena paricchijja parituletvā.
Having discerned with knowledge (ñāṇena paricchinditvā) means having properly discerned and weighed with knowledge the momentary nature, suffering, and emptiness of self regarding the feelings.
Ñāṇena paricchinditvā (sau khi phân tích bằng trí tuệ) là sau khi phân tích và cân nhắc bằng trí tuệ, biết rõ bản chất vô thường, khổ và vô ngã của các cảm thọ.
Adhivāsesīti tā abhibhavanto yathāparimadditākārasallakkhaṇena attani āropetvā vāsesi, na tāhi abhibhuyyamāno.
He endured (adhivāsesī) means he resided, overcoming those (feelings), by observing them as if being crushed, and taking them upon himself, not being overcome by them.
Adhivāsesī (chịu đựng) là Ngài chế ngự các cảm thọ đó, đặt chúng vào tự thân bằng cách nhận biết chúng như thể đang bị nghiền nát, chứ không phải bị chúng chế ngự.
Tenāha ‘‘avihaññamāno’’tiādi.
Therefore, it is said, “without being distressed,” and so on.
Vì vậy, có lời rằng: “avihaññamāno”tiādi (không bị tổn hại, v.v.).
Adukkhiyamānoti cetodukkhavasena adukkhiyamāno, kāyadukkhaṃ pana ‘‘natthī’’ti na sakkā vattuṃ.
Not suffering (adukkhiyamāno) means not suffering mentally; however, it cannot be said that there was no bodily suffering.
Adukkhiyamāno (không bị đau khổ) là không bị đau khổ về mặt tâm lý, nhưng không thể nói rằng không có đau khổ về mặt thể xác.
Asati hi tasmiṃ adhivāsanāya eva asambhavoti.
For if there were no bodily suffering, endurance itself would be impossible.
Vì nếu không có đau khổ thể xác thì sự chịu đựng sẽ không thể xảy ra.
Anāmantetvāti anālapitvā.
Without addressing (anāmantetvā) means without speaking to.
Anāmantetvā (mà không hỏi ý kiến) là mà không nói chuyện.
Anapaloketvāti avissajjitvā.
Without seeking permission (anapaloketvā) means without dismissing.
Anapaloketvā (mà không xin phép) là mà không từ biệt.
Tenāha ‘‘ovādānusāsaniṃ adatvāti vuttaṃ hotī’’ti.
Therefore, it is said, “it means without giving advice or instruction.”
Vì vậy, có lời rằng: “ovādānusāsaniṃ adatvāti vuttaṃ hotī” (có nghĩa là không ban lời khuyên hay giáo huấn).
Pubbabhāgavīriyenāti phalasamāpattiyā parikammavīriyena.
By preliminary effort (pubbabhāgavīriyena) means by the preliminary effort for fruit attainment (phalasamāpatti).
Pubbabhāgavīriyena (bằng tinh tấn chuẩn bị) là bằng tinh tấn chuẩn bị cho sự nhập quả.
Phalasamāpattivīriyenāti phalasamāpattisampayuttavīriyena.
By the effort of fruit attainment (phalasamāpattivīriyena) means by the effort associated with fruit attainment.
Phalasamāpattivīriyenā (bằng tinh tấn nhập quả) là bằng tinh tấn đi kèm với sự nhập quả.
Vikkhambhetvāti vinodetvā.
Having suppressed (vikkhambhetvā) means having dispelled.
Vikkhambhetvā (sau khi ngăn chặn) là sau khi loại bỏ.
Yathā nāma pupphanasamaye campakādirukkhe vekhe dinne yāva so vekho nāpanīyati, tāvassa pupphanasamatthatā vikkhambhitā vinoditā hoti, evameva yathāvuttavīriyavekhadānena tā vedanā satthu sarīre yathāparicchinnaṃ kālaṃ vikkhambhitā vinoditā ahesuṃ.
Just as when a fence is put around a Campaka tree and other trees during flowering season, their ability to flower is suppressed and dispelled as long as the fence is not removed; in the same way, by providing the fence of effort as described, those feelings in the Teacher’s body were suppressed and dispelled for a prescribed period.
Giống như khi một cây hoa champaka, v.v., được buộc lại vào mùa ra hoa, khả năng ra hoa của nó bị ngăn chặn, bị loại bỏ cho đến khi dây buộc được gỡ bỏ, thì cũng vậy, bằng cách buộc lại bằng tinh tấn như đã nói, các cảm thọ đó đã bị ngăn chặn, bị loại bỏ khỏi thân của Đức Phật trong một khoảng thời gian nhất định.
Tena vuttaṃ ‘‘vikkhambhetvāti vinodetvā’’ti.
Therefore, it is said, “having suppressed means having dispelled.”
Vì vậy, có lời rằng: “vikkhambhetvāti vinodetvā” (sau khi ngăn chặn là sau khi loại bỏ).
Jīvitampi jīvitasaṅkhāro kammunā saṅkharīyatīti katvā.
Even life is a life-formation (jīvitampi jīvitasaṅkhāro) because it is conditioned by kamma.
Jīvitampi jīvitasaṅkhāro (sự sống cũng là hành của sự sống) là vì nó được tạo ra bởi nghiệp.
Chijjamānaṃ virodhipaccayasamāyogena payogasampattiyā ghaṭetvā ṭhapīyati.
The waning (life) is joined and established by the perfection of effort, through the union of opposing conditions.
Đang bị cắt đứt, do sự kết hợp của các nhân đối nghịch, được nối kết và duy trì nhờ sự viên mãn của nỗ lực.
Adhiṭṭhāyāti adhiṭṭhānaṃ katvā.
Adhiṭṭhāya means having made a determination.
Adhiṭṭhāya nghĩa là đã tác thành sự quyết định (adhiṭṭhāna).
Tenāha ‘‘dasamāse mā uppajjitthāti samāpattiṃ samāpajjī’’ti.
Therefore, it is said: “‘May it not arise for ten months,’ thus he entered into attainment.”
Do đó, (người ta) nói: “đã nhập định với ý nguyện rằng ‘chớ phát sinh (bệnh) trong mười tháng’”.
Taṃ pana ‘‘adhiṭṭhānaṃ, pavattana’’nti ca vattabbataṃ arahatīti vuttaṃ ‘‘adhiṭṭhahitvā pavattetvā’’ti.
That (determination), however, is worthy of being called “determination” and “causing to occur,” therefore it was said: “having determined, having caused to occur.”
Và điều đó xứng đáng được gọi là “adhiṭṭhāna” và “pavattana”, do đó đã được nói là “adhiṭṭhahitvā pavattetvā” (sau khi quyết định và duy trì).
Khaṇikasamāpattīti tādisaṃ pubbābhisaṅkhāraṃ akatvā ṭhānaso samāpajjitabbasamāpatti.
Khaṇikasamāpatti (momentary attainment) is an attainment that should be entered into instantly without making such a prior pre-determination.
Khaṇikasamāpatti (định sát-na) là sự nhập định cần được nhập ngay lập tức mà không cần tác thành sự chuẩn bị trước như vậy.
Puna sarīraṃ vedanā ajjhottharati savisesapubbābhisaṅkhārassa akatattā.
Again, feelings afflict the body because no prior special pre-determination was made.
Thân thể lại bị cảm thọ đè nặng vì không tác thành sự chuẩn bị đặc biệt.
Rūpasattakaarūpasattakāni visuddhimaggasaṃvaṇṇanāsu (visuddhi. ṭī. 2.706, 717) vitthāritanayena veditabbāni.
The seven rūpa and seven arūpa should be understood in the detailed manner described in the commentaries to the Visuddhimagga.
Bảy pháp sắc và bảy pháp vô sắc cần được biết theo phương pháp đã được giải thích chi tiết trong Visuddhimaggasaṃvaṇṇanā (Visuddhi. ṭī. 2.706, 717).
Suṭṭhu vikkhambheti pubbābhisaṅkhārassa sātisayattā.
Completely suppresses because of the extraordinary nature of the prior pre-determination.
Hoàn toàn đẩy lùi vì sự chuẩn bị trước là siêu việt.
Idāni tamatthaṃ upamāya vibhāvetuṃ ‘‘yathā nāmā’’tiādi vuttaṃ.
Now, in order to clarify that meaning with an analogy, “just as” and so on was said.
Bây giờ, để làm rõ ý nghĩa đó bằng ví dụ, đã nói “yathā nāmā” (ví như) và tiếp theo.
Apabyūḷhoti apanīto.
Apabyūḷho means removed.
Apabyūḷho nghĩa là đã loại bỏ.
Cuddasahākārehi sannetvāti tesaṃyeva rūpasattakaarūpasattakānaṃ vasena cuddasahi pakārehi vipassanācittaṃ, sakalameva vā attabhāvaṃ visabhāgarogasañjanitalūkhabhāvanirogakaraṇāya sinehetvā na uppajjiyeva sammāsambuddhena sātisayasamāpattivegena suvikkhambhitattā.
Having softened with fourteen aspects means by fourteen types, according to those same seven rūpa and seven arūpa, having softened the vipassanā-consciousness, or indeed the entire body, to prevent the arising of rough, dry conditions caused by discordant diseases, (the feeling) did not arise because it was completely suppressed by the Buddha with the momentum of extraordinary attainment.
Cuddasahākārehi sannetvā (sau khi làm cho hòa hợp bằng mười bốn cách) nghĩa là, do mười bốn loại sắc pháp và vô sắc pháp đó, đã làm cho tâm vipassanā hoặc toàn bộ thân thể trở nên dịu mát để chữa lành sự thô cứng do bệnh tật không tương hợp gây ra, (và do đó cảm thọ) na uppajjiyeva (không còn phát sinh nữa) vì đã được Đức Sammāsambuddha đẩy lùi hoàn toàn bằng sức mạnh của sự nhập định siêu việt.
165. Abbhantaraṃ karoti nāma attaniyeva ṭhapanato.
To make something internal means to keep it within oneself.
165. Abbhantaraṃ karoti nāma (làm cho thành nội tại) nghĩa là do giữ gìn trong chính mình.
Puggalaṃ abbhantaraṃ karoti nāma samānattatāvasena dhammena pubbe tassa saṅgaṇhato.
To make a person internal means to embrace that person through the Dhamma, by way of having the same self.
Puggalaṃ abbhantaraṃ karoti nāma (làm cho một người trở thành nội tại) nghĩa là trước đây đã thu hút người đó bằng Dhamma theo cách bình đẳng.
Daharakāleti attano daharakāle.
In my youth means in his own youth.
Daharakāle (khi còn trẻ) nghĩa là khi chính mình còn trẻ.
Kassaci akathetvāti kassaci attano antevāsikassa upanigūhabhūtaṃ ganthaṃ akathetvā.
Without telling anyone means without telling any of his own pupils a text that was to be concealed.
Kassaci akathetvā (không nói với bất cứ ai) nghĩa là không nói một giáo lý bí mật với bất kỳ đệ tử nào của mình.
Muṭṭhiṃ katvāti muṭṭhigataṃ viya rahasibhūtaṃ katvā.
Having made a fist means having made it secret, as if held in a fist.
Muṭṭhiṃ katvā (nắm chặt) nghĩa là đã giữ bí mật như một nắm tay.
Yasmiṃ vā naṭṭhe sabbo taṃmūlako dhammo vinassati, so ādito mūlabhūto dhammo, mussati vinassati dhammo etena naṭṭhenāti muṭṭhi, taṃ tathārūpaṃ muṭṭhiṃ katvā pariharitvā ṭhapitaṃ kiñci natthīti dasseti.
It shows that there is nothing kept like a fist, such that if it were lost, all Dhamma rooted in it would be destroyed, or such that by its loss, the Dhamma would be forgotten or destroyed—that Dhamma, which is a fundamental principle from the beginning.
Pháp nào khi mất đi thì tất cả các pháp có căn nguyên từ đó cũng bị hủy diệt, thì đó là pháp căn nguyên ban đầu. Pháp bị hủy diệt, bị mất đi bởi sự hủy diệt này được gọi là muṭṭhi. (Đức Phật) cho thấy rằng không có bất cứ điều gì được giữ kín như một muṭṭhi như vậy, được gìn giữ cẩn thận.
Ahamevāti avadhāraṇaṃ bhikkhusaṅghapariharaṇassa aññasādhāraṇicchādassanatthaṃ, avadhāraṇena pana vinā ‘‘ahaṃ bhikkhusaṅgha’’ntiādi bhikkhusaṅghapariharaṇe ahaṃkāramamaṃkārābhāvadassananti daṭṭhabbaṃ.
Ahameva is a restrictive particle, intended to show the desire for the support of the Saṅgha to be non-exclusive; but without the restrictive particle, “ahaṃ bhikkhusaṅghaṃ” etc., it should be understood as showing the absence of self-conceit and possessiveness in supporting the Saṅgha.
Ahamevā (chỉ có tôi) là một từ nhấn mạnh để chỉ ra ý muốn rằng việc chăm sóc Tăng đoàn không phải là việc chung với người khác. Và cần phải hiểu rằng nếu không có từ nhấn mạnh này, câu “ahaṃ bhikkhusaṅgha” (tôi Tăng đoàn) và tiếp theo chỉ ra sự không có ngã mạn và ngã sở trong việc chăm sóc Tăng đoàn.
Uddisitabbaṭṭhenāti ‘‘satthā’’ti uddisitabbaṭṭhena.
In the sense of being pointed out means in the sense of being pointed out as “the Teacher.”
Uddisitabbaṭṭhenā (theo cách được chỉ định) nghĩa là theo cách được chỉ định là “Bậc Đạo Sư”.
Mā vā ahesuṃ bhikkhūti adhippāyo.
Or may there be no monks is the intention.
Ý nghĩa là “mā vā ahesuṃ” (chớ có) các tỳ-khưu.
‘‘Mā vā ahosī’’ti vā pāṭho.
Or the reading is “mā vā ahosī.”
Hoặc là đọc “mā vā ahosī” (chớ có).
Evaṃ na hotīti ‘‘ahaṃ bhikkhusaṅghaṃ pariharissāmī’’tiādi ākārena cittappavatti na hoti.
Thus it is not means the mental occurrence of “I will support the Saṅgha” and so forth does not arise.
Evaṃ na hotī (không phải vậy) nghĩa là không có sự phát khởi của tâm theo cách “tôi sẽ chăm sóc Tăng đoàn” và tiếp theo.
‘‘Pacchimavayaanuppattabhāvadīpanatthaṃ vutta’’nti iminā vayo viya buddhakiccampi pariyositakammanti dīpeti.
By stating “said to indicate the attainment of old age,” it is shown that just as life is brought to an end, so too is the Buddha’s task a completed action.
Bằng câu “pacchimavayaanuppattabhāvadīpanatthaṃ vutta” (được nói để chỉ ra sự đạt đến tuổi già), (vị ấy) cho thấy rằng cũng như tuổi thọ, công việc của Đức Phật cũng là một việc đã hoàn thành.
Sakaṭassa bāhappadese daḷhībhāvāya veṭhadānaṃ bāhabandho. Cakkanemisandhīnaṃ daḷhībhāvāya veṭhadānaṃ cakkabandho.
The binding given to the main frame of a cart for strength is bāhabandho. The binding given to the joints of the wheel and rim for strength is cakkabandho.
Việc buộc dây để làm cho phần khung của xe vững chắc được gọi là bāhabandha. Việc buộc dây để làm cho các mối nối của vành bánh xe vững chắc được gọi là cakkabandha.
Tamatthanti veṭhamissakena maññeti vuttamatthaṃ.
That meaning refers to the meaning stated as being sustained by bindings.
Tamatthaṃ (ý nghĩa đó) nghĩa là ý nghĩa đã nói rằng “tôi nghĩ rằng (vị ấy) đã duy trì sự sống bằng cách nối kết”.
Rūpādayo eva dhammā saviggaho viya upaṭṭhānato rūpanimittādayo, tesaṃ rūpanimittādīnaṃ.
The dhammas, such as rūpa, appear as if they have forms; these are the rūpa-nimitta and so forth.
Các pháp như sắc, v.v., hiện hữu như có hình thể, do đó là các sắc tướng, v.v. Của các sắc tướng, v.v. đó.
Lokiyānaṃ vedanānanti yāsaṃ nirodhanena phalasamāpatti samāpajjitabbā, tāsaṃ nirodhā phāsu hoti, tathā bāḷhavedanābhitunnasarīrassāpi.
Of worldly feelings means those by whose cessation the fruition attainment is to be entered, by their cessation there is comfort; similarly for a body afflicted by severe feelings.
Lokiyānaṃ vedanāna (của các cảm thọ thế gian) nghĩa là, do sự đoạn diệt của những cảm thọ mà nhờ đó có thể nhập Phalasamāpatti, thì sự đoạn diệt của chúng mang lại sự thoải mái, cũng như đối với thân thể bị các cảm thọ mãnh liệt hành hạ.
Tadatthāyāti phalasamāpattivihāratthāya.
For that purpose means for the purpose of dwelling in fruition attainment.
Tadatthāyā (vì mục đích đó) nghĩa là vì mục đích an trú trong Phalasamāpatti.
Dvīhi bhāgehi āpo gato etthāti dīpo, oghena parigato hutvā anajjhotthaṭo bhūmibhāgo, idha pana catūhipi oghehi, saṃsāramahogheneva vā anajjhotthaṭo attā ‘‘dīpo’’ti adhippeto.
A dīpa is where water has gone in two parts, or a land area that is surrounded by a flood but not overwhelmed; here, however, it is intended to mean oneself, not overwhelmed by the four floods, or by the great flood of saṃsāra, as a “dīpa.”
Nơi nào nước chảy qua hai phần thì được gọi là dīpo (hòn đảo), là một vùng đất được bao quanh bởi dòng nước nhưng không bị nhấn chìm. Ở đây, ý muốn nói đến tự ngã không bị nhấn chìm bởi cả bốn dòng nước (ogha), hoặc chỉ bởi dòng nước lớn của luân hồi (saṃsāramahogha) là “dīpo”.
Tenāha ‘‘mahāsamuddagatā’’tiādi.
Therefore, it is said: “situated in the great ocean” and so forth.
Do đó, (vị ấy) nói “mahāsamuddagatā” (đã đi vào đại dương) và tiếp theo.
Attassaraṇāti attappaṭisaraṇā.
Attassaraṇā means having oneself as a refuge.
Attassaraṇā (nương tựa vào tự ngã) nghĩa là tự mình nương tựa vào tự ngã.
Attagatikā vāti attaparāyaṇāva.
Or attagatikā means having oneself as one's ultimate resort.
Hoặc attagatikā (tự mình là nơi đến) nghĩa là tự mình là nơi nương tựa cuối cùng.
Mā aññagatikāti aññaṃ kiñci gatiṃ paṭisaraṇaṃ parāyaṇaṃ mā cintayittha.
Mā aññagatikā means do not contemplate anything else as a destination, a refuge, or an ultimate resort.
Mā aññagatikā (chớ nương tựa vào nơi khác) nghĩa là chớ nghĩ đến bất cứ nơi đến, nơi nương tựa, nơi nương tựa cuối cùng nào khác.
Attā nāmettha paramatthato dhammo abbhantaraṭṭhena, so evaṃ sampādito tumhākaṃ dīpaṃ tāṇaṃ gati parāyaṇanti.
Because here, oneself, in the ultimate sense, by way of being an internal essence, is the Dhamma. That, thus perfected, is your island, your protection, your destination, your ultimate resort.
Tự ngã ở đây, về mặt tối hậu, là Dhamma theo nghĩa nội tại, khi được thành tựu như vậy, nó là hòn đảo, nơi nương tựa, nơi đến, nơi nương tựa cuối cùng của các bạn.
Tena vuttaṃ ‘‘dhammadīpā’’tiādi.
Therefore, it is said: “with the Dhamma as your island” and so forth.
Do đó, đã nói “dhammadīpā” (Dhamma là hòn đảo) và tiếp theo.
Tathā cāha ‘‘attā hi attano nātho, ko hi nātho paro siyā’’ti (dha. pa. 160, 380) upadesamattameva hi parasmiṃ paṭibaddhaṃ, aññā sabbā sampatti purisassa attādhīnā eva.
Thus it is said: “Indeed, self is the lord of self; who else could be a lord?” For only guidance is dependent on others; all other accomplishments of a person are dependent on oneself.
Và cũng đã nói: “Tự ngã là nơi nương tựa của chính mình, ai là nơi nương tựa khác?” (Dhp. 160, 380). Chỉ có sự chỉ dạy là phụ thuộc vào người khác, tất cả các thành tựu khác của con người đều phụ thuộc vào chính mình.
Tenāha bhagavā ‘‘tumhehi kiccaṃ ātappaṃ, akkhātāro tathāgatā’’ti (dha. pa. 276).
Therefore, the Blessed One said: “You yourselves must strive; the Tathāgatas are only teachers.”
Do đó, Đức Thế Tôn đã nói: “Các con phải tinh tấn, các Như Lai chỉ là người chỉ đường” (Dhp. 276).
Tamaggeti tamayogassa agge tassa atikkantābhāvato.
At its summit means at the summit of the darkness, because it is not surpassed by it.
Tamagge (ở đỉnh đó) nghĩa là ở đỉnh của sự tối tăm, vì không vượt qua được nó.
Tenevāha ‘‘ime aggatamā’’tiādi.
Therefore, it is said: “these are the most excellent” and so forth.
Do đó, (vị ấy) nói “ime aggatamā” (những người này là tối thượng) và tiếp theo.
Mamāti mama sāsane.
Mama means in my dispensation.
Mamā (của tôi) nghĩa là trong giáo pháp của tôi.
Sabbepi te catusatipaṭṭhānagocarā vāti catubbidhaṃ satipaṭṭhānaṃ bhāvetvā brūhetvā tadeva gocaraṃ attano pavattiṭṭhānaṃ katvā ṭhitā eva bhikkhū agge bhavissanti.
All of those monks, whose domain is the four foundations of mindfulness, means those monks who have developed and cultivated the four types of satipaṭṭhāna, and have made that their domain and place of activity, will be supreme.
Sabbepi te catusatipaṭṭhānagocarā vā (tất cả các vị ấy đều là đối tượng của Tứ Niệm Xứ) nghĩa là các tỳ-khưu đã tu tập và phát triển Tứ Niệm Xứ, và đã lấy đó làm đối tượng, làm nơi an trú của mình, sẽ là tối thượng.
166. Anekavāraṃ bhagavā vesāliyaṃ viharati, tasmā imaṃ vesālippavesanaṃ niyametvā dassetuṃ ‘‘kadā pāvisī’’ti pucchitvā āgamanato paṭṭhāya taṃ dassento ‘‘bhagavā kirā’’tiādimāha.
166. The Blessed One often resided in Vesālī; therefore, in order to specify and show this entry into Vesālī, having asked “when did he enter?” and starting from the coming, in order to show it, he said “it is said the Blessed One” and so on.
166. Đức Thế Tôn đã trú tại Vesālī nhiều lần, do đó, để xác định và chỉ ra sự vào Vesālī này, (vị ấy) đã hỏi “khi nào thì vào?” và sau đó, để chỉ ra điều đó từ khi đến, đã nói “Bhagavā kira” (Đức Thế Tôn quả thật) và tiếp theo.
Āgatamaggenevāti pubbe yāva veḷuvagāmakā āgatamaggeneva paṭinivattento.
By the same path he came means returning by the same path he came previously, as far as Veḷuvagāmaka.
Āgatamaggenevā (ngay trên con đường đã đến) nghĩa là quay trở lại trên chính con đường đã đi đến Veḷuvagāmaka trước đây.
Yathāparicchedenāti yathāparicchinnakālena.
According to the determined time means by the time that was determined.
Yathāparicchedenā (theo thời gian đã định) nghĩa là theo thời gian đã được xác định.
Tatoti phalasamāpattito.
From that means from the fruition attainment.
Tato (từ đó) nghĩa là từ Phalasamāpatti.
Ayanti idāni vuccamānākāro.
This means the manner that is now being stated.
Ayaṃ (điều này) nghĩa là cách thức sắp được nói đến.
Divāṭṭhānolokanādi parinibbānassa ekantikabhāvadassanaṃ.
Looking at the day-residence and so on is a showing of the certain nature of parinibbāna.
Divāṭṭhānolokanā (sự nhìn ngắm nơi an trú ban ngày) và tiếp theo là sự chỉ ra tính tất yếu của sự nhập Niết Bàn.
Ossaṭṭhoti vissaṭṭho āyusaṅkhāro ‘‘sattāhameva mayā jīvitabba’’nti.
Ossaṭṭho means relinquished, the life-aggregate of “I will live only for seven days.”
Ossaṭṭho (đã từ bỏ) nghĩa là āyusaṅkhāro (thọ hành) đã được từ bỏ, với ý nghĩ “tôi sẽ sống thêm bảy ngày nữa”.
167. Udenayakkhassa cetiyaṭṭhāneti udenassa nāma yakkhassa āyatanabhāvena iṭṭhakāhi cite mahājanassa cittīkataṭṭhāne.
“At Udena Yakka’s shrine” means at the place revered by the general populace, built with bricks, as the abode of the yakkha named Udena.
167. Udenayakkhassa cetiyaṭṭhāne (tại tháp thờ của Dạ Xoa Udena) là tại nơi được đại chúng tôn kính, được xây bằng gạch, là nơi thờ tự của Dạ Xoa tên Udena.
Katavihāroti bhagavantaṃ uddissa katavihāro.
“A monastery built” refers to a monastery built dedicated to the Blessed One.
Katavihāro (đã xây dựng tinh xá) là đã xây dựng tinh xá dâng lên Đức Thế Tôn.
Vuccatīti purimavohārena ‘‘udenacetiya’’nti vuccati.
“Is called”—by the former appellation, it is called “Udena-cetiya.”
Vuccatī (được gọi) là được gọi là “Udena-cetiya” theo cách gọi trước đây.
Gotamakādīsupīti ‘‘gotamakacetiya’’nti evaṃ ādīsupi.
“Even in Gotamaka and others”—even in the case of such as “Gotamaka-cetiya.”
Gotamakādīsupī (cũng như trong các tháp Gotamaka, v.v.) là cũng tương tự như trong “Gotamaka-cetiya” và các tháp khác.
Eseva nayoti cetiyaṭṭhāne katavihārabhāvaṃ atidisati.
“The same method applies”—this refers to the fact that a monastery was built at the shrine site.
Eseva nayo (cũng vậy) là chỉ ra rằng tinh xá đã được xây dựng tại nơi thờ tự.
Vaḍḍhitāti bhāvanāpāripūrivasena paribrūhitā.
“Increased” means nurtured to completion through cultivation.
Vaḍḍhitā (đã được tăng trưởng) là đã được phát triển đầy đủ theo sự viên mãn của sự tu tập.
Punappunaṃ katāti bhāvanāya bahulīkaraṇena aparāparaṃ pavattitā.
“Done again and again” means practiced repeatedly through frequent cultivation.
Punappunaṃ katā (đã được thực hành lặp đi lặp lại) là đã được thực hành nhiều lần do sự tu tập được làm cho sung mãn.
Yuttayānaṃ viya katāti yathā yuttaṃ ājaññayānaṃ chekena sārathinā adhiṭṭhitaṃ yathāruci pavattati, evaṃ yathārucipavattirahataṃ gamitā.
“Made like a yoked chariot” means made to proceed as desired by the Arahants, just as a yoked thoroughbred chariot, guided by a skilled charioteer, proceeds as desired.
Yuttayānaṃ viya katā (đã được làm như một cỗ xe được điều khiển) là đã được đưa đến trạng thái A-la-hán, nơi hành động theo ý muốn, giống như một cỗ xe ngựa tốt được điều khiển bởi một người đánh xe khéo léo, di chuyển theo ý muốn.
Patiṭṭhānaṭṭhenāti adhiṭṭhānaṭṭhena.
“In the sense of establishment” means in the sense of determination (adhiṭṭhāna).
Patiṭṭhānaṭṭhenā (theo nghĩa là nền tảng) là theo nghĩa là sự quyết định.
Vatthu viya katāti sabbaso upakkilesavisodhanena iddhivisayatāya pavattiṭṭhānabhāvato suvisodhitaparissayavatthu viya katā.
“Made like a dwelling-place” means made like a dwelling-place free from dangers, due to the complete purification of defilements, becoming a sphere for the manifestation of psychic power.
Vatthu viya katā (đã được làm như một nền tảng) là đã được làm như một nền tảng được thanh lọc hoàn toàn khỏi các hiểm nguy, vì nó là nơi phát sinh các thần thông do sự thanh lọc hoàn toàn các phiền não.
Adhiṭṭhitāti paṭipakkhadūrībhāvato subhāvitabhāvena taṃtaṃadhiṭṭhānayogyatāya ṭhapitā.
“Determined” means established in such a way as to be suitable for various determinations, by being well-cultivated, owing to the removal of opposing factors.
Adhiṭṭhitā (đã được quyết định) là đã được thiết lập để có khả năng quyết định điều này điều nọ, do sự tu tập tốt đẹp làm cho các đối thủ bị loại bỏ.
Samantato citāti sabbabhāgena bhāvanupacayaṃ gamitā.
“Accumulated on all sides” means brought to accumulation through all aspects of cultivation.
Samantato citā (đã được tích lũy toàn diện) là đã được đưa đến sự tích lũy tu tập ở mọi khía cạnh.
Tenāha ‘‘suvaḍḍhitā’’ti.
Therefore, it is said, “well-increased.”
Vì vậy, đã nói “suvaḍḍhitā” (đã được tăng trưởng tốt).
Suṭṭhu samāraddhāti iddhibhāvanāya sikhāppattiyā sammadeva saṃsevitā.
“Well-commenced” means properly practiced to the peak of the development of psychic power.
Suṭṭhu samāraddhā (đã được bắt đầu rất tốt) là đã được thực hành một cách đúng đắn cho đến đỉnh cao của sự tu tập thần thông.
Aniyamenāti ‘‘yassa kassacī’’ti aniyamavacanena.
“Indefinitely” means by the indefinite expression “whoever.”
Aniyamenā (một cách không cố định) là bằng cách nói không cố định: “Bất cứ ai.”
Niyametvāti ‘‘tathāgatassā’’ti sarūpadassanena niyametvā.
“Having specified” means having specified by showing the exact form, "the Tathāgata's."
Niyametvā (sau khi cố định) là sau khi cố định bằng cách chỉ rõ bản chất: “Của Như Lai.”
Āyuppamāṇanti paramāyuppamāṇaṃ vadati, tasseva gahaṇe kāraṇaṃ brahmajālasuttavaṇṇanāyaṃ (dī. ni. aṭṭha. 1.40; dī. ni. ṭī. 1.40) vuttanayeneva veditabbaṃ.
“Lifespan” refers to the maximum lifespan, and the reason for taking that (maximum lifespan) should be understood according to the method stated in the Brahmajāla Sutta commentary.
Āyuppamāṇaṃ (giới hạn tuổi thọ) nói về giới hạn tuổi thọ tối đa, và lý do để chấp nhận điều đó cần được hiểu theo cách đã nói trong Brahmajālasuttavaṇṇanā (Dī. Ni. Aṭṭha. 1.40; Dī. Ni. Ṭī. 1.40).
Mahāsivatthero pana ‘‘mahābodhisattānaṃ carimabhave paṭisandhidāyino kammassa asaṅkhyeyyāyukatāsaṃvattanasamatthataṃ hadaye ṭhapetvā buddhānaṃ āyusaṅkhārassa parissayavikkhambhanasamatthatā pāḷiyaṃ āgatā evāti imaṃ bhaddakappameva tiṭṭheyyā’’ti avoca.
However, Mahāsivatthera said, "Placing in his heart the fact that the kamma giving rebirth in the final existence of a great Bodhisatta is capable of bringing about an immeasurable lifespan, and that the ability of Buddhas to overcome dangers to their life-formations is already stated in the Pāli canon, thus the Tathāgata could remain for this entire fortunate eon."
Tuy nhiên, Trưởng lão Mahāsiva đã nói: “Việc khả năng của nghiệp tạo ra sự tái sinh cho các vị Đại Bồ Tát trong kiếp cuối cùng có thể kéo dài vô số kiếp, và khả năng của tuổi thọ của chư Phật có thể vượt qua các hiểm nguy, đã được đề cập trong Pāḷi. Do đó, Đức Thế Tôn có thể an trú trong toàn bộ kiếp này.”
‘‘Khaṇḍiccādīhi abhibhuyyatī’’ti etena yathā iddhibalena jarāya na paṭighāto, evaṃ tena maraṇassapi na paṭighātoti atthato āpannamevāti.
By this, “is overcome by mutilation, etc.,” it is implied that just as old age cannot be resisted by psychic power, so too death cannot be resisted by it.
Với câu “Khaṇḍiccādīhi abhibhuyyatī” (bị áp đảo bởi sự suy yếu, v.v.), điều này có nghĩa là, giống như thần thông không thể ngăn cản sự già yếu, thì thần thông cũng không thể ngăn cản cái chết.
‘‘Kva saro khitto, kva ca nipatito’’ti aññathā vuṭṭhitenāpi theravādena aṭṭhakathāvacanameva samatthitanti daṭṭhabbaṃ.
It should be understood that even with the Elder’s statement, which diverges somewhat, it is the commentary’s statement that is affirmed, as in "where was the arrow shot, and where did it fall?"
Và cần phải hiểu rằng lời nói của Trưởng lão, dù được trình bày khác, cũng đã xác nhận lời của Chú giải, như câu: “Mũi tên đã được bắn đi đâu, và nó sẽ rơi xuống đâu?”
Tenāha ‘‘so na ruccati…pe… niyamita’’nti.
Therefore, it is said, “that is not pleasing…* …specified.”
Vì vậy, đã nói “so na ruccati…pe… niyamita” (ngài không hài lòng…v.v… cố định).
Pariyuṭṭhitacittoti yathā kiñci atthānatthaṃ sallakkhetuṃ na sakkā, evaṃ abhibhūtacitto.
“With mind beset” means a mind overwhelmed in such a way that it is unable to discern anything beneficial or harmful.
Pariyuṭṭhitacitto (tâm bị áp đảo) là tâm bị áp đảo đến mức không thể nhận thức được bất kỳ điều gì có lợi hay bất lợi.
So pana abhibhavo mahatā udakoghena appakassa udakassa ajjhottharaṇaṃ viya ahosīti vuttaṃ ‘‘ajjhotthaṭacitto’’ti.
That overwhelming, however, was like a great flood of water inundating a small amount of water, which is why it is said, “with mind inundated.”
Sự áp đảo đó giống như một dòng nước lớn tràn ngập một lượng nước nhỏ, vì vậy đã nói “ajjhotthaṭacitto” (tâm bị tràn ngập).
Aññopīti therato, ariyehi vā aññopi yo koci puthujjano. Puthujjanaggahaṇañcettha yathā sabbena sabbaṃ appahīnavipallāso mārena pariyuṭṭhitacitto kiñci atthaṃ sallakkhetuṃ na sakkoti, evaṃ thero bhagavatā kataṃ nimittobhāsaṃ sabbaso na sallakkhesīti dassanatthaṃ.
“Anyone else” means any other ordinary person (puthujjana), whether apart from the Elder (Ānanda) or apart from the noble ones. The inclusion of "ordinary person" here is to show that just as an ordinary person, whose perversions are not fully abandoned and whose mind is beset by Māra, cannot discern anything beneficial, so too the Elder (Ānanda) did not discern the sign-light (nimittobhāsa) made by the Blessed One at all.
Aññopī (bất kỳ ai khác) là bất kỳ phàm phu nào khác ngoài Trưởng lão hoặc các bậc Thánh. Việc đề cập đến phàm phu ở đây là để chỉ ra rằng, giống như một phàm phu có tâm bị Māra áp đảo, chưa hoàn toàn đoạn trừ các tà kiến, không thể nhận thức được bất kỳ điều gì đúng đắn, thì Trưởng lão cũng hoàn toàn không nhận thức được dấu hiệu mà Đức Thế Tôn đã đưa ra.
Tenāha ‘‘māro hī’’tiādi.
Therefore, it is said, “For Māra…” and so on.
Vì vậy, đã nói “Māro hī” (vì Māra) v.v.
Cattāro vipallāsāti asubhe ‘‘subha’’nti saññāvipallāso, cittavipallāso, dukkhe ‘‘sukha’’nti saññāvipallāso, cittavipallāsoti ime cattāro vipallāsā.
“Four perversions” are the perversion of perception of beauty in the unbeautiful, the perversion of mind; and the perversion of perception of pleasure in suffering, the perversion of mind.
Cattāro vipallāsā (bốn sự điên đảo) là bốn sự điên đảo này: sự điên đảo về tưởng và sự điên đảo về tâm đối với cái không thanh tịnh là “thanh tịnh”, và sự điên đảo về tưởng và sự điên đảo về tâm đối với khổ là “lạc”.
Tenāti yadipi itare aṭṭha vipallāsā pahīnā, tathāpi yathāvuttānaṃ catunnaṃ vipallāsānaṃ appahīnabhāvena.
“Because of that,” although the other eight perversions were abandoned, it was due to the unabandoned state of these four aforementioned perversions.
Tenā (do đó) là mặc dù tám sự điên đảo khác đã được đoạn trừ, nhưng do bốn sự điên đảo như đã nói trên chưa được đoạn trừ.
Assāti therassa.
“His” refers to the Elder’s.
Assā (của ngài) là của Trưởng lão.
Maddatīti phusanamattena maddanto viya hoti, aññathā tena maddite sattānaṃ maraṇameva siyā.
“Crushes” means it is as if it crushes by merely touching; otherwise, if it truly crushed, beings would die by it.
Maddatī (nghiền nát) là giống như nghiền nát chỉ bằng cách chạm vào; nếu không, nếu bị nghiền nát thật sự, chúng sinh sẽ chết.
Kiṃ sakkhissati, na sakkhissatīti adhippāyo.
“What will it be able to do?” The intention is that it will not be able to do anything.
Kiṃ sakkhissati, (có thể làm gì), ý nghĩa là không thể làm gì.
Kasmā na sakkhissati, nanu esa aggasāvakassa kucchiṃ paviṭṭhoti?
Why will it not be able to do anything? Was it not that Māra entered the chief disciple's belly?
Tại sao không thể làm gì? Chẳng phải Māra đã đi vào bụng của vị Đại đệ tử sao?
Saccaṃ paviṭṭho, tañca kho attano ānubhāvadassanatthaṃ, na vibādhanādhippāyena.
It is true that it entered, but that was to show its power, not with the intention to harm.
Đúng vậy, Māra đã đi vào, nhưng đó là để thể hiện uy lực của mình, không phải với ý định gây hại.
Vibādhanādhippāyena pana idha ‘‘kiṃ sakkhissatī’’ti vuttaṃ hadayamaddanassa adhigatattā.
However, here, “What will it be able to do?” is said with the intention of causing harm, having gained access to crushing the heart.
Tuy nhiên, ở đây đã nói “kiṃ sakkhissati” (có thể làm gì) với ý định gây hại, vì đã đạt được sự áp đảo tâm.
Nimittobhāsanti ettha ‘‘tiṭṭhatu bhagavā kappa’’nti sakalakappaṃ avaṭṭhānayācanāya ‘‘yassa kassaci ānanda cattāro iddhipādā bhāvitā’’tiādinā aññāpadesena attano caturiddhipādabhāvanānubhāvena kappaṃ avaṭṭhānasamatthatāvasena saññuppādanaṃ nimittaṃ, tathā pana pariyāyaṃ muñcitvā ujukaṃyeva attano adhippāyavibhāvanaṃ obhāso.
In nimittobhāsa (sign-light) here, nimitta (sign) is the production of a hint through indirect speech, such as "May the Blessed One remain for a kappa," referring to the ability to remain for a kappa due to the power of one's cultivation of the four bases of psychic power, as in "Ānanda, whoever has cultivated the four bases of psychic power…"; obhāsa (light) is the direct clarification of one's intention, abandoning circumlocution.
Trong Nimittobhāsa (dấu hiệu và sự hiển lộ), nimitta (dấu hiệu) là sự gợi ý về khả năng an trú trọn kiếp của Đức Thế Tôn nhờ uy lực tu tập Tứ Thần Túc của Ngài, được thể hiện qua lời thỉnh cầu an trú trọn kiếp: “Bạch Thế Tôn, xin Thế Tôn an trú trọn kiếp,” và qua lời nói gián tiếp: “Này Ānanda, bất cứ ai đã tu tập Tứ Thần Túc…”; còn obhāso (sự hiển lộ) là sự bày tỏ ý định của Ngài một cách trực tiếp, không vòng vo.
Jānantoyeva vāti mārena pariyuṭṭhitabhāvaṃ jānanto eva.
“Knowing well” means knowing that his mind was beset by Māra.
Jānantoyeva (chỉ biết) là chỉ biết rằng tâm đã bị Māra áp đảo.
Attano aparādhahetuto sattānaṃ soko tanuko hoti, na balavāti āha ‘‘dosāropanena sokatanukaraṇattha’’nti.
The sorrow of beings is diminished, not strong, due to the fault of oneself (the Elder), which is why it is said, “for the purpose of diminishing sorrow by attributing blame.”
Vì nỗi buồn của chúng sinh sẽ giảm nhẹ, không mạnh mẽ, do nguyên nhân lỗi lầm của chính mình, nên đã nói “dosāropanena sokatanukaraṇattha” (để giảm nhẹ nỗi buồn bằng cách đổ lỗi).
Kiṃ pana thero mārena pariyuṭṭhitacittakāle pavattiṃ pacchā jānātīti?
Does the Elder then later know what happened when his mind was beset by Māra?
Vậy Trưởng lão có biết chuyện xảy ra sau khi tâm bị Māra áp đảo không?
Na jānāti sabhāvena, buddhānubhāvena pana anujānāti.
He does not know it naturally, but he understands it through the power of the Buddha.
Ngài không biết theo bản chất tự nhiên, nhưng ngài biết nhờ uy lực của chư Phật.
168. Anatthe niyojento guṇamāraṇena māreti, virāgavibandhanena vā jātinimittatāya tattha tattha jātaṃ jātaṃ mārento viya hotīti ‘‘māretīti māro’’ti vuttaṃ.
“Māra (the slayer)” is said because he slays by destroying virtues by enjoining on what is unbeneficial, or he is like one who slays again and again whatever arises here and there, being the cause of birth, by binding to dispassion.
168. Māretīti Māro (kẻ giết hại nên gọi là Māra) là đã nói như vậy vì Māra giết hại bằng cách hủy diệt các phẩm chất, hoặc bằng cách trói buộc vào sự ly dục, hoặc bằng cách giết hại những gì sinh ra ở khắp mọi nơi do là nguyên nhân của sự tái sinh.
Ativiya pāpatāya pāpimā. Kaṇhadhammehi samannāgato kaṇho. Virāgādiguṇānaṃ antakaraṇato antako. Sattānaṃ anatthāvahapaṭipattiṃ na muccatīti namuci. Attano mārapāsena pamatte bandhati, pamattā vā bandhū etassāti pamattabandhu. Sattamasattāhato paraṃ satta ahāni sandhāyāha ‘‘aṭṭhame sattāhe’’ti na pana pallaṅkasattāhādi viya niyatakiccassa aṭṭhamasattāhassa nāma labbhanato.
Due to being exceedingly evil, he is called Pāpimā. Being endowed with dark states (evil qualities), he is called Kaṇha. Because he brings an end to qualities such as dispassion, he is called Antaka. Because he does not relinquish the practice that brings harm to beings, he is called Namuci. He binds the negligent with his own Māra's noose, or the negligent are his kinsmen; hence he is called Pamattabandhu. He states "in the eighth week" referring to the seven days after the seventh week, not because the name of a fixed eighth week, like the "Pallaṅka week" and so on, can be found for a set task.
Vì cực kỳ độc ác nên gọi là Pāpimā (Kẻ Ác). Vì đầy đủ các pháp đen tối nên gọi là Kaṇha (Kẻ Đen Tối). Vì làm chấm dứt các thiện pháp như ly tham nên gọi là Antaka (Kẻ Diệt Tận). Vì không buông tha những hành vi dẫn đến bất lợi cho chúng sanh nên gọi là Namuci (Kẻ Không Buông Tha). Vì dùng sợi dây của Māra trói buộc những kẻ buông lung, hoặc vì những kẻ buông lung là bà con của nó nên gọi là Pamattabandhu (Kẻ Thân Thuộc Của Kẻ Buông Lung). Sau bảy tuần lễ thứ bảy, Māra nói “vào tuần lễ thứ tám” là để chỉ bảy ngày sau đó, chứ không phải vì có tên tuần lễ thứ tám cố định như tuần lễ dưới cội bồ đề (pallaṅkasattāha).
Sattamasattāhassa hi parato ajapālanigrodhamūle mahābrahmuno, sakkassa ca devarañño paṭiññātadhammadesanaṃ bhagavantaṃ ñatvā ‘‘idāni satte dhammadesanāya mama visayaṃ atikkamāpessatī’’ti sañjātadomanasso hutvā ṭhito cintesi ‘‘handa dānāhaṃ naṃ upāyena parinibbāpessāmi, evamassa manoratho aññathattaṃ gamissati, mama ca manoratho ijjhissatī’’ti.
For after the seventh week, at the foot of the Ajapāla Banyan tree, Māra thought, knowing that the Blessed One had promised to teach the Dhamma to Mahābrahmā and Sakka, the king of devas: "Now he will make beings transcend my domain through the teaching of the Dhamma." Filled with sorrow, he stood there and pondered, "Come now, I will cause him to attain final Nibbāna by stratagem. In this way, his aspiration will change, and my aspiration will be fulfilled."
Sau tuần lễ thứ bảy, dưới cội cây Ajapāla Nigrodha, Māra biết rằng Đức Thế Tôn đã hứa thuyết Pháp cho Đại Phạm Thiên và Thiên Chủ Sakka, liền khởi tâm buồn rầu và suy nghĩ: “Bây giờ ta sẽ dùng phương kế để khiến Ngài nhập Niết Bàn, như vậy ước nguyện của Ngài sẽ thay đổi, và ước nguyện của ta sẽ thành tựu.”
Evaṃ pana cintetvā bhagavantaṃ upasaṅkamitvā ekaṃ antaṃ ṭhito ‘‘parinibbātu dāni bhante bhagavā’’tiādinā parinibbānaṃ yāci, taṃ sandhāya vuttaṃ ‘‘aṭṭhame sattāhe’’tiādi.
Having thus thought, he approached the Blessed One, stood at one side, and requested the Blessed One's final Nibbāna, saying, "Let the Blessed One now attain final Nibbāna, Venerable Sir," and so on. It is with reference to this that "in the eighth week," and so on, was stated.
Suy nghĩ như vậy, Māra đến gần Đức Thế Tôn, đứng một bên và thỉnh cầu Ngài nhập Niết Bàn với lời lẽ “Bạch Thế Tôn, xin Ngài nhập Niết Bàn ngay bây giờ,” v.v. Điều này được nói đến trong câu “vào tuần lễ thứ tám” v.v.
Tattha ajjāti āyusaṅkhārossajjanadivasaṃ sandhāyāha.
Therein, "today" refers to the day of relinquishing the life-principle.
Trong đó, ajjā (hôm nay) là để chỉ ngày xả bỏ thọ hành.
Bhagavā cassa abhisandhiṃ jānantopi taṃ anāvikatvā parinibbānassa akālabhāvameva pakāsento yācanaṃ paṭikkhipi.
Although the Blessed One knew Māra's intention, he did not disclose it but simply rejected the request, explaining that it was not the right time for final Nibbāna.
Mặc dù Đức Thế Tôn biết rõ ý đồ của Māra, nhưng Ngài không tiết lộ điều đó mà chỉ tuyên bố rằng chưa phải lúc nhập Niết Bàn, và từ chối lời thỉnh cầu của Māra.
Tenāha ‘‘na tāvāha’’ntiādi.
Therefore, he said, "not yet."
Vì vậy, Ngài nói “Ta chưa…” v.v.
Maggavasena viyattāti saccasampaṭivedhaveyyattiyena byattā.
"Manifest through the path" means manifest through the clear comprehension of the truths.
Maggavasena viyattā (hiển bày theo con đường) nghĩa là hiển bày rõ ràng bằng sự chứng ngộ chân lý.
Tatheva vinītāti maggavasena kilesānaṃ samucchedavinayanena vinītā.
"Similarly disciplined" means disciplined through the complete eradication of defilements by means of the path.
Tatheva vinītā (cũng được huấn luyện như vậy) nghĩa là được huấn luyện bằng cách đoạn trừ hoàn toàn các phiền não theo con đường.
Tathā visāradāti ariyamaggādhigameneva satthusāsane vesārajjappattiyā visāradā, sārajjakarānaṃ diṭṭhivicikicchādipāpadhammānaṃ vigamena visāradabhāvaṃ pattāti attho.
"Similarly confident" means confident through the attainment of fearlessness in the Teacher's dispensation solely by realizing the Noble Path, meaning they have attained a state of fearlessness through the elimination of evil states such as wrong views and doubt which cause anxiety.
Tathā visāradā (cũng dũng cảm như vậy) nghĩa là đạt được sự dũng cảm trong giáo pháp của Bậc Đạo Sư chỉ bằng sự chứng đắc Thánh Đạo; tức là đạt được trạng thái dũng cảm nhờ sự diệt trừ các pháp ác như tà kiến, hoài nghi, v.v., là những thứ gây ra sự sợ hãi.
Yassa sutassa vasena vaṭṭadukkhato nissaraṇaṃ sambhavati, taṃ idha ukkaṭṭhaniddesena ‘‘suta’’nti adhippetanti āha ‘‘tepiṭakavasenā’’ti.
That teaching, by means of which release from the suffering of saṃsāra is possible, is here intended as "Suta" (that which is heard) by way of excellent designation, thus it is said, "by means of the Tipitaka."
Vì nhờ sự học hỏi mà có thể thoát khỏi khổ luân hồi, nên ở đây, từ “suta” (sự học hỏi) được dùng để chỉ sự học hỏi tối thượng, tức là Tam Tạng, như đã nói “tepiṭakavasenā” (theo Tam Tạng).
Tiṇṇaṃ piṭakānaṃ samūho tepiṭakaṃ, tīṇi vā piṭakāni tipiṭakaṃ, tipiṭakameva tepiṭakaṃ, tassa vasena.
The collection of the three Piṭakas is the Tipitaka; or three Piṭakas make up the Tipitaka; the Tipitaka itself is the Tipitaka; by means of that.
Tập hợp của ba tạng gọi là Tepiṭaka (Tam Tạng), hoặc ba tạng gọi là Tipiṭaka, Tipiṭaka chính là Tepiṭaka, theo đó.
Tamevāti yaṃ taṃ tepiṭakaṃ sotabbabhāvena ‘‘suta’’nti vuttaṃ, tameva.
"That very Dhamma" means that Tipitaka which was called "Suta" by way of being what should be heard.
Tamevā (chính điều đó) là điều Tam Tạng đã được nói là “suta” (sự học hỏi) theo nghĩa là điều đáng nghe, chính điều đó.
Dhammanti pariyattidhammaṃ.
"Dhamma" refers to the Dhamma of learning (pariyatti).
Dhamma (Pháp) là Pháp Pariyatti (Pháp học).
Dhārentīti suvaṇṇabhājane pakkhittasīhavasaṃ viya avinassantaṃ katvā suppaguṇasuppavattibhāvena dhārenti hadaye ṭhapenti.
"They uphold" means they preserve it without perishing, like lion's fat placed in a golden vessel, by being well-mastered and well-practiced; they store it in their hearts.
Dhārentī (giữ gìn) nghĩa là giữ gìn trong lòng, như giữ gìn mỡ sư tử trong chén vàng mà không bị hư hoại, bằng cách tinh thông và lặp đi lặp lại một cách thuần thục.
Iti pariyattidhammavasena bahussutadhammadharabhāvaṃ dassetvā idāni paṭivedhadhammavasenapi taṃ dassetuṃ ‘‘atha vā’’tiādi vuttaṃ.
Thus, having shown the state of being widely learned and a Dhamma-holder through the Dhamma of learning, it is now said "or else," and so on, to show this also through the Dhamma of penetration (paṭivedha).
Như vậy, sau khi trình bày về sự đa văn và trì Pháp theo Pháp học, bây giờ để trình bày điều đó theo Pháp chứng, câu “atha vā” (hoặc là) v.v. đã được nói.
Ariyadhammassāti maggaphaladhammassa, navavidhassāpi vā lokuttaradhammassa.
"Of the Noble Dhamma" means of the Dhamma of path and fruition, or of the nine-fold supramundane Dhamma.
Ariyadhammassa (của Thánh Pháp) là của Pháp Đạo Quả, hoặc của chín loại Pháp Siêu Thế.
Anudhammabhūtanti adhigamāya anurūpadhammabhūtaṃ.
"Conducive to Dhamma" means a state of Dhamma suitable for attainment.
Anudhammabhūtaṃ (là pháp tương ứng) là pháp phù hợp để chứng đắc.
Anucchavikapaṭipadanti ca tameva vipassanādhammamāha, chabbidhā visuddhiyo vā.
"And suitable practice" refers to that very Vipassanā Dhamma, or to the six kinds of purifications.
Anucchavikapaṭipada (con đường thực hành thích hợp) cũng chỉ chính pháp quán (vipassanā) đó, hoặc là sáu loại thanh tịnh.
Anudhammanti tassā yathāvuttapaṭipadāya anurūpaṃ abhisallekhitaṃ appicchatādidhammaṃ.
"Anudhamma" refers to the Dhamma of fewness of wishes and so on, which is suitable for the aforementioned practice and is conducive to the eradication of defilements.
Anudhamma (pháp tương ứng) là pháp phù hợp với con đường thực hành đã nói, là pháp gọt giũa phiền não như thiểu dục, v.v.
Caraṇasīlāti samādāya pavattanasīlā.
"Having the habit of practicing" means having the habit of undertaking and practicing continuously.
Caraṇasīlā (có thói quen thực hành) là có thói quen thọ trì và thực hành.
Anu maggaphaladhammo etissāti vā anudhammā, vuṭṭhānagāminivipassanā, tassā caraṇasīlā.
Or because the path-and-fruitition Dhamma is in accordance with it, it is Anudhammā; it refers to the Vipassanā that leads to emergence, and they have the habit of practicing it.
Hoặc vì Pháp Đạo Quả là phù hợp với pháp này nên gọi là anudhammā (pháp tương ứng), tức là vipassanā dẫn đến sự xuất ly; có thói quen thực hành pháp đó.
Attano ācariyavādanti attano ācariyassa sammāsambuddhassa vādaṃ.
"Their teacher's doctrine" means the doctrine of their teacher, the Perfectly Self-Enlightened One.
Attano ācariyavāda (giáo lý của bậc thầy của mình) là giáo lý của bậc thầy của mình, tức là Đức Chánh Đẳng Giác.
Sadevakassa lokassa ācārasikkhāpanena ācariyo, bhagavā.
The Blessed One is the teacher because he instructs the world, including devas, in conduct.
Đức Thế Tôn là bậc thầy vì Ngài dạy dỗ về đạo đức cho thế gian cùng với chư thiên.
Tassa vādo, catusaccadesanā.
His doctrine is the teaching of the Four Noble Truths.
Giáo lý của Ngài là sự thuyết giảng Tứ Diệu Đế.
Ācikkhissantīti ādito kathessanti, attanā uggahitaniyāmena pare uggaṇhāpessantīti attho.
"They will proclaim" means they will teach from the beginning; the meaning is that they will cause others to learn according to the method they themselves have learned.
Ācikkhissanti (sẽ giảng dạy) nghĩa là sẽ thuyết giảng từ đầu, sẽ khiến người khác học hỏi theo phương pháp mà mình đã học.
Desessantīti vācessanti, pāḷiṃ sammā pabodhessantīti attho.
"They will teach" means they will instruct, the meaning is they will cause the Pāli text to be correctly understood.
Desessantī (sẽ thuyết giảng) nghĩa là sẽ giảng giải, sẽ làm cho Pāḷi được hiểu rõ.
Paññāpessantīti pajānāpessanti, saṅkāpessantīti attho.
"They will expound" means they will make known, they will make manifest.
Paññāpessantī (sẽ trình bày) nghĩa là sẽ làm cho người khác hiểu rõ, sẽ làm cho điều đó trở nên rõ ràng.
Paṭṭhapessantīti pakārehi ṭhapessanti, pakāsessantīti attho.
"They will establish" means they will establish in various ways, they will make clear.
Paṭṭhapessantī (sẽ thiết lập) nghĩa là sẽ thiết lập theo nhiều cách, sẽ làm cho điều đó được công bố.
Vivarissantīti vivaṭaṃ karissanti.
"They will reveal" means they will make it uncovered.
Vivarissantī (sẽ khai mở) nghĩa là sẽ làm cho điều đó được mở ra.
Vibhajissantīti vibhattaṃ karissanti.
"They will analyze" means they will make it divided.
Vibhajissantī (sẽ phân tích) nghĩa là sẽ làm cho điều đó được phân tích.
Uttāniṃ karissantīti anuttānaṃ gambhīraṃ uttānaṃ pākaṭaṃ karissanti.
"They will make it clear" means they will make the hidden and profound clear and evident.
Uttāniṃ karissantī (sẽ làm cho rõ ràng) nghĩa là sẽ làm cho điều sâu xa, không rõ ràng trở nên rõ ràng, hiển nhiên.
Saha dhammenāti ettha dhamma-saddo kāraṇapariyāyo ‘‘hetumhi ñāṇaṃ dhammapaṭisambhidā’’tiādīsu (vibha. 270) viyāti āha ‘‘sahetukena sakāraṇena vacanenā’’ti.
In "together with the Dhamma," the word Dhamma is a synonym for cause, as in "knowledge of the cause is Dhammapaṭisambhidā," and so on; hence it is said, "with a statement that has a cause and a reason."
Ở đây, từ dhamma trong saha dhammenā (cùng với Pháp) là một từ đồng nghĩa với kāraṇa (nguyên nhân), như trong các câu “hetumhi ñāṇaṃ dhammapaṭisambhidā” (Trí tuệ về nguyên nhân là Pháp phân tích) v.v., nên nói “sahetukena sakāraṇena vacanenā” (bằng lời nói có nguyên nhân, có lý do).
Sappāṭihāriyanti sanissaraṇaṃ, yathā paravādaṃ bhañjitvā sakavādo patiṭṭhahati, evaṃ hetudāharaṇehi yathādhigatamatthaṃ sampādetvā dhammaṃ kathessanti.
"With wondrous power" means leading to liberation, meaning they will teach the Dhamma by fully explaining the meaning they have understood with reasons and examples, in such a way that their own doctrine becomes established, having refuted other doctrines.
Sappāṭihāriyaṃ (cùng với phép lạ) nghĩa là cùng với sự giải thoát, họ sẽ thuyết giảng Pháp bằng cách trình bày ý nghĩa đã chứng đắc bằng các lý do và ví dụ, sao cho giáo lý của mình được thiết lập vững chắc sau khi bác bỏ các giáo lý khác.
Tenāha ‘‘niyyānikaṃ katvā dhammaṃ desessantī’’ti, navavidhaṃ lokuttaradhammaṃ pabodhessantīti attho.
Therefore, it is said, "they will teach the Dhamma leading to release," meaning they will cause the nine-fold supramundane Dhamma to be known.
Vì vậy, Ngài nói “niyyānikaṃ katvā dhammaṃ desessantī” (sẽ thuyết giảng Pháp dẫn đến giải thoát), nghĩa là sẽ làm cho chín loại Pháp Siêu Thế được hiểu rõ.
Ettha ca ‘‘paññāpessantī’’tiādīhi chahi padehi cha atthapadāni dassitāni, ādito pana dvīhi padehi cha byañjanapadāni.
Here, six meanings are shown by the six terms beginning with "paññāpessanti," while the first two terms show six modes of expression.
Ở đây, sáu từ “paññāpessantī” v.v. đã trình bày sáu phần ý nghĩa, còn hai từ đầu đã trình bày sáu phần văn tự.
Ettāvatā tepiṭakaṃ buddhavacanaṃ saṃvaṇṇanānayena saṅgahetvā dassitaṃ hoti.
By this much, the Tipitaka, the Buddha's word, is shown as being gathered by way of explanation.
Đến đây, lời Phật dạy trong Tam Tạng đã được tóm lược và trình bày theo phương pháp chú giải.
Vuttañhetaṃ nettiyaṃ ‘‘dvādasapadāni suttaṃ, taṃ sabbaṃ byañjanañca attho cā’’ti (netti. saṅkhāre).
For this has been said in the Netti: "The twelve terms are the Sutta; all that is both expression and meaning."
Điều này đã được nói trong Netti (Nettipakaraṇa): “Mười hai phần là Sutta (Kinh), tất cả đều là văn tự và ý nghĩa.”
Sikkhattayasaṅgahitanti adhisīlasikkhādisikkhattayasaṅgahaṇaṃ.
"Comprised of the three trainings" means the inclusion of the three trainings, such as the training in higher morality.
Sikkhattayasaṅgahitaṃ (bao gồm ba học pháp) là sự bao gồm ba học pháp như Tăng Thượng Giới Học (Adhisīlasikkhā), v.v.
Sakalaṃ sāsanabrahmacariyanti anavasesaṃ satthusāsanabhūtaṃ seṭṭhacariyaṃ.
"The entire holy life of the Dispensation" means the complete noble conduct that is the Teacher's Dispensation.
Sakalaṃ sāsanabrahmacariyaṃ (toàn bộ phạm hạnh trong giáo pháp) là toàn bộ phạm hạnh tối thượng thuộc về giáo pháp của Bậc Đạo Sư.
Samiddhanti sammadeva vaḍḍhitaṃ.
"Flourishing" means perfectly developed.
Samiddhaṃ (thành tựu) nghĩa là đã được phát triển một cách hoàn hảo.
Jhānassādavasenāti tehi tehi bhikkhūhi samadhigatajhānasukhavasena.
"By means of the enjoyment of jhāna" means by means of the happiness of jhāna attained by those various bhikkhus.
Jhānassādavasena (theo sự an lạc của thiền) là theo sự an lạc thiền định mà các Tỳ-kheo đó đã chứng đắc.
Vuddhippattanti uḷārapaṇītabhāvagamanena sabbaso parivuddhiṃ upagataṃ.
"Reached growth" means completely progressed by reaching an exalted and refined state.
Vuddhippattaṃ (đã đạt được sự phát triển) nghĩa là đã đạt được sự phát triển hoàn toàn bằng cách đạt đến trạng thái cao quý và vi diệu.
Sabbapāliphullaṃ viya abhiññāsampattivasena abhiññāsampadāhi sāsanābhivuddhiyā matthakappattito.
"Like a fully blooming forest" means due to the attainment of the pinnacle of the Dispensation's growth through supernormal powers.
Sabbapāliphullaṃ viya abhiññāsampattivasena (như hoa nở rộ khắp nơi với sự thành tựu các thắng trí) là vì sự phát triển của giáo pháp đã đạt đến đỉnh cao nhờ các thắng trí.
Patiṭṭhitavasenāti patiṭṭhānavasena, patiṭṭhappattiyāti attho.
"By way of being established" means by way of establishment, meaning by way of reaching stability.
Patiṭṭhitavasena (theo sự thiết lập) nghĩa là theo sự thiết lập, tức là đạt được sự thiết lập.
Paṭivedhavasena bahuno janassa hitanti bāhujaññaṃ. Tenāha ‘‘bahujanābhisamayavasenā’’ti.
Conducive to the welfare of many people through penetration (paṭivedha) is bāhujaññaṃ. Hence it is said, "by means of the realization of many people."
Điều lợi ích cho nhiều người (bahujana) nhờ sự chứng ngộ (paṭivedha) gọi là bāhujaññaṃ (sự lợi ích cho số đông). Vì vậy, Ngài nói “bahujanābhisamayavasenā” (theo sự chứng ngộ của số đông).
Puthu puthulaṃ bhūtaṃ jātaṃ, puthu vā puthuttaṃ bhūtaṃ pattanti puthubhūtaṃ. Tenāha ‘‘sabbākāra…pe… patta’’nti.
Widely, extensively, has become, originated; or has become, reached wide or manifoldness is puthubhūtaṃ. Hence it is said, "all aspects... etc.... reached."
Puthu (rộng lớn) đã trở thành, hoặc puthu (rộng lớn) đã đạt đến trạng thái rộng lớn gọi là puthubhūtaṃ (trở nên rộng lớn). Vì vậy, Ngài nói “sabbākāra…pe… patta” (đã đạt đến mọi phương diện… v.v.).
Suṭṭhu pakāsitanti suṭṭhu sammadeva ādikalyāṇādibhāvena paveditaṃ.
"Well-proclaimed" means truly and perfectly proclaimed as excellent in the beginning and so on.
Suṭṭhu pakāsitaṃ (đã được tuyên bố một cách hoàn hảo) nghĩa là đã được tuyên bố một cách hoàn hảo, tức là đã được công bố một cách đúng đắn theo nghĩa là thiện hảo ở ban đầu, v.v.
169. Satiṃ sūpaṭṭhitaṃ katvāti ayaṃ kāyādivibhāgo attabhāvasaññito dukkhabhāro mayā ettakaṃ kālaṃ vahito, idāni pana na vahitabbo, etassa avahanatthaṃ cirataraṃ kālaṃ ariyamaggasambhāro sambhato, svāyaṃ ariyamaggo paṭividdho, yato ime kāyādayo asubhādito sammadeva pariññātā, catubbidhampi sammāsatiṃ yathātathaṃ visaye suṭṭhu upaṭṭhitaṃ katvā.
169. "Having firmly established mindfulness" means having firmly established the four kinds of correct mindfulness in their true nature, realizing that this burden of suffering, consisting of the body and so on, has been borne by me for such a long time and should no longer be borne, and that the requisites of the Noble Path have been accumulated for a very long time for the non-bearing of this burden, and this Noble Path has been penetrated, from which these bodies and so on are perfectly understood as impure and so on.
169. Satiṃ sūpaṭṭhitaṃ katvā (thiết lập chánh niệm một cách vững chắc) nghĩa là: “Cái gánh nặng khổ đau này, tức là sự phân chia thân thể v.v., đã được ta gánh vác bấy lâu nay, nhưng bây giờ không còn phải gánh vác nữa. Để không gánh vác nó, ta đã tích lũy các yếu tố của Thánh Đạo trong một thời gian dài, và Thánh Đạo ấy đã được chứng ngộ. Do đó, các thân thể v.v. này đã được quán xét một cách đúng đắn từ khía cạnh bất tịnh v.v., và bốn loại chánh niệm đã được thiết lập một cách đúng đắn trên đối tượng một cách chân thật.”
Ñāṇena paricchinditvāti yasmā imassa attabhāvasaññitassa dukkhabhārassa vahane payojanabhūtaṃ attahitaṃ tāva mahābodhimūle eva parisamāpitaṃ, parahitaṃ pana buddhaveneyyavinayanaṃ parisamāpitabbaṃ, taṃ idāni māsattayeneva parisamāpanaṃ pāpuṇissati, tasmā abhāsi ‘‘visākhapuṇṇamāyaṃ parinibbāyissāmī’’ti, evaṃ buddhañāṇena paricchinditvā sabbabhāgena nicchayaṃ katvā.
“Having delimited by knowledge” means: because the personal welfare, which was the purpose in bearing this burden of suffering identified with self-existence, had already been fully accomplished at the foot of the great Bodhi tree, while the welfare of others, the disciplining of those to be trained by the Buddha, was yet to be fully accomplished, and that would now reach completion in just three months, therefore* spoke thus: ‘‘I will attain Parinibbāna on the full moon day of Vesākha.’’ Thus, having delimited by the Buddha’s knowledge, having made a firm decision in every respect.
Ñāṇena paricchinditvā (sau khi đã quán xét bằng tuệ tri) là vì, việc lợi ích cho tự thân, vốn là mục đích của việc gánh vác gánh nặng khổ đau được gọi là thân này, đã được hoàn tất tại cội Đại Bồ-đề. Còn việc lợi ích cho tha nhân, tức là việc giáo hóa những chúng sanh có thể được Đức Phật giáo hóa, thì cần phải được hoàn tất, và nay sẽ được hoàn tất trong vòng ba tháng. Do đó, Ngài đã tuyên bố: “Ta sẽ nhập Niết-bàn vào ngày trăng tròn tháng Visākha.” Như vậy, sau khi đã quán xét bằng Phật tuệ, Đức Phật đã quyết định một cách hoàn toàn.
Āyusaṅkhāraṃ vissajjīti āyuno jīvitassa abhisaṅkhārakaṃ phalasamāpattidhammaṃ ‘‘na samāpajjissāmī’’ti vissajji taṃvissajjaneneva tena abhisaṅkhariyamānaṃ jīvitasaṅkhāraṃ ‘‘nappavattessāmī’’ti vissajji.
“Released the life-process” means he released the jhāna-attainment, which conditions life and vitality, saying, ‘‘I shall not enter into*.’’ By that very release, he released the life-process conditioned by it, saying, ‘‘I shall not allow it to continue.’’
Āyusaṅkhāraṃ vissajji (xả bỏ hành thọ) là Ngài đã xả bỏ pháp quả định (phalasamāpatti) là nhân duyên cho sự tồn tại của tuổi thọ, sinh mạng, với ý nghĩ “Ta sẽ không nhập định nữa.” Chính bằng sự xả bỏ đó, Ngài đã xả bỏ hành sinh mạng được duy trì bởi định đó, với ý nghĩ “Ta sẽ không cho nó tiếp tục tồn tại nữa.”
Tenāha ‘‘tatthā’’tiādi.
Therefore, it says “there” and so forth.
Do đó, có lời nói “tatthā” (ở đó) v.v.
Ṭhānamahantatāyapi pavattiākāramahantatāyapi mahanto pathavīkampo. Tattha ṭhānamahantatāya bhūmicālassa mahattaṃ dassetuṃ ‘‘tadā kira…pe… kampitthā’’ti vuttaṃ.
Due to the immensity of the place and the immensity of the manner of occurrence, there was a great earthquake. To show the greatness of the earthquake in terms of the immensity of the place, it is said: “At that time, indeed…pe…it quaked.”
Do sự rộng lớn của nơi chốn và sự rộng lớn của hình thái xảy ra, nên có địa chấn lớn (mahanto pathavīkampo). Để chỉ ra sự rộng lớn của địa chấn về mặt rộng lớn của nơi chốn, đã nói “tadā kira…pe… kampitthā” (khi ấy…pe… đã rung chuyển).
Sā pana jātikkhettabhūtā dasasahassī lokadhātu eva, na yā kāci, yā mahābhinīhāramahājātiādīsupi kampittha.
That* was none other than the ten-thousandfold world system, which constitutes the birth-field, which also quaked at the Great Determination, the Great Birth, and so forth.
Và nơi đó chính là mười ngàn thế giới (dasasahassī lokadhātu) là cõi sinh, không phải bất cứ nơi nào khác; nơi đã rung chuyển cả trong các sự kiện như Đại Phát Nguyện và Đại Giáng Sinh.
Tadāpi tattikāya eva kampane kiṃ kāraṇaṃ?
What was the reason that only that specific extent quaked at that time as well?
Khi ấy, tại sao chỉ có bấy nhiêu (mười ngàn thế giới) rung chuyển?
Jātikkhettabhāvena tasseva ādito pariggahassa katattā.
Because that very* was initially taken as the birth-field.
Vì ngay từ đầu, chỉ có cõi đó được thâu tóm do là cõi sinh.
Pariggahakaraṇaṃ cassa dhammatāvasena veditabbaṃ.
Its being taken should be understood as due to natural law (dhammatā).
Việc thâu tóm cõi đó cần được hiểu theo luật tự nhiên (dhammatā).
Tathā hi purimabuddhānampi tāvatakameva jātikkhettaṃ ahosi.
Indeed, the birth-field for previous Buddhas was also precisely that extent.
Quả thật, các vị Phật quá khứ cũng có cõi sinh rộng lớn như vậy.
Tathā hi vuttaṃ ‘‘dasasahassī lokadhātū, nissaddā honti nirākulā…pe… mahāsamuddo ābhujati, dasasahassī pakampatī’’ti ca ādi (bu. vaṃ. 84-91).
Thus, it is said: “The ten-thousandfold world system, silent and undisturbed…pe…the great ocean churns, the ten-thousandfold* quakes,” and so forth.
Như đã nói: “Mười ngàn thế giới, không tiếng động, không hỗn loạn…pe… đại dương cuộn sóng, mười ngàn thế giới rung chuyển” v.v. (Bu.vaṃ. 84-91).
Udakapariyantaṃ katvā chappakārapavedhanena avītarāge bhiṃsetīti bhiṃsano, so eva bhiṃsanakoti āha ‘‘bhayajanako’’ti.
Since it frightens those not free from passion (avītarāga) through six kinds of trembling up to the water’s edge, it is terrifying (bhiṃsano); that very* is bhiṃsanako, hence it says “generating fear.”
Do sự rung chuyển sáu kiểu đến tận cùng nước, làm cho những người chưa đoạn trừ tham ái phải khiếp sợ, nên nó được gọi là đáng sợ (bhiṃsano). Chính đó là bhiṃsanako, nên đã nói “bhayajanako” (gây ra sợ hãi).
Devabheriyoti devadundubhisaddassa pariyāyavacanamattaṃ.
“Devabheriyo” is merely a synonymous word for the sound of a divine drum (devadundubhi).
Devabheriyo chỉ là một từ đồng nghĩa với tiếng trống trời (devadundubhisadda).
Na cettha kāci bherī ‘‘devadundubhī’’ti adhippetā, atha kho uppātabhāvena labbhamāno ākāsagato nigghosasaddo.
No actual drum is meant here by “devadundubhī,” but rather a resounding noise in the sky, occurring as an omen.
Ở đây, không có cái trống nào được gọi là “trống trời” (devadundubhī) cả, mà là tiếng vang trên không trung được tạo ra như một điềm báo.
Tenāha ‘‘devo’’tiādi.
Therefore, it says “devo” and so forth.
Do đó, đã nói “devo” (chư thiên) v.v.
Devoti megho.
“Devo” means a cloud.
Devo (chư thiên) là mây.
Tassa hi acchabhāvena ākāsassa vassābhāvena sukkhagajjitasaññite sadde niccharante devadundubhisamaññā.
When the sound, known as dry thunder, is emitted from a cloud because the sky is clear and there is no rain, it is called a devadundubhi.
Khi tiếng sấm khô (không mưa) vang lên trên bầu trời trong xanh, thì đó được gọi là tiếng trống trời (devadundubhī).
Tenāha ‘‘devo sukkhagajjitaṃ gajjī’’ti.
Therefore, it says, “the cloud thundered a dry thunder.”
Do đó, đã nói “devo sukkhagajjitaṃ gajjī” (chư thiên sấm khô).
Tulīyatīti tulanti tula-saddo kammasādhanoti dassetuṃ ‘‘tulita’’nti vuttaṃ.
“That which is weighed (tulīyati) is tula”; the word tula is said to indicate the object-making sense (kammasādhana) by stating “tulita” (weighed).
Được cân đo, đó là tula. Để chỉ ra rằng từ tula là một danh từ thụ động (kammasādhana), đã nói “tulitaṃ” (được cân đo).
Appānubhāvatāya paricchinnaṃ. Tathā hi taṃ parito khaṇḍitabhāvena ‘‘paritta’’nti vuccati.
“Limited” due to having little power. Indeed, it is called “paritta” (limited, small) because it is fragmented all around.
Do năng lực yếu kém, nên bị giới hạn (paricchinnaṃ). Quả thật, nó được gọi là “paritta” (nhỏ bé) vì bị cắt xén từ mọi phía.
Paṭipakkhavikkhambhanato dīghasantānatāya, vipulaphalatāya ca na tulaṃ na paricchinnaṃ.
It is “not tula,” not limited, due to its long continuation by overcoming opponents, and its abundant fruit.
Do sự trấn áp các đối thủ, do dòng chảy kéo dài, và do quả báo rộng lớn, nên không cân đo (na tulaṃ), không bị giới hạn.
Yehi kāraṇehi pubbe avisesato mahaggataṃ ‘‘atula’’nti vuttaṃ, tāni kāraṇāni rūpāvacarato āruppassa sātisayāni vijjantīti ‘‘arūpāvacaraṃ atula’’nti vuttaṃ, itarañca ‘‘tula’’nti, appavipākaṃ tīsupi kammesu yaṃ tanuvipākaṃ hīnaṃ, taṃ tulaṃ.
The reasons for which the Mahaggata (developed) was previously called “atula” (immeasurable) without distinction, those reasons are superior in the immaterial (āruppa) realm compared to the fine-material (rūpāvacara) realm; therefore, it is said, “the immaterial is immeasurable (arūpāvacaraṃ atula),” and the other (kāmāvacara and rūpāvacara) is called “tula.” “Appavipākaṃ” (of small result) refers to that karma among the three types that has a weak, inferior result, which is tula.
Những lý do mà trước đây đã nói về các pháp thuộc cõi sắc (mahaggata) là “atula” (không thể cân đo) mà không có sự phân biệt, những lý do đó tồn tại một cách vượt trội trong các pháp thuộc cõi vô sắc (āruppa) so với các pháp thuộc cõi sắc (rūpāvacara). Do đó, đã nói “arūpāvacaraṃ atula” (các pháp thuộc cõi vô sắc là không thể cân đo), và các pháp khác là “tula” (có thể cân đo). Appavipākaṃ (quả báo ít) là trong ba loại nghiệp, nghiệp nào có quả báo yếu kém, hạ liệt, thì đó là tula.
Bahuvipāka nti yaṃ mahāvipākaṃ paṇītaṃ, taṃ atulaṃ. Yaṃ panettha majjhimaṃ, taṃ hīnaṃ, ukkaṭṭhanti dvidhā bhinditvā dvīsu bhāgesu pakkhipitabbaṃ.
“Bahuvipākaṃ” (of great result) refers to that which has a great, excellent result, which is atula. That which is intermediate among these should be divided into two types, inferior and superior, and classified into the two categories.
Bahuvipākaṃ (quả báo nhiều) là nghiệp nào có quả báo lớn, thù thắng, thì đó là atula. Nghiệp nào ở giữa, thì nên chia thành hai phần: hạ liệt và tối thượng, rồi xếp vào hai loại đó.
Hīnattikavaṇṇanāyaṃ vuttanayeneva appabahuvipākataṃ niddhāretvā tassa vasena tulātulabhāvo veditabbo.
The state of being tula or atula should be understood by determining the small or great result in the manner stated in the Hīnattikavaṇṇanā.
Tính ít quả báo hay nhiều quả báo cần được xác định theo cách đã trình bày trong Hīnattikavaṇṇanā (Giải thích về ba loại hạ liệt), và từ đó, tính chất tula và atula cần được hiểu.
Sambhavati etasmāti sambhavoti āha ‘‘sambhavassa hetubhūta’’nti.
Since existence arises from it, it is sambhava (origin), hence it says “the cause of existence.”
Từ đó mà phát sinh, nên là sambhava. Do đó, đã nói “sambhavassa hetubhūtaṃ” (là nhân duyên của sự phát sinh).
Niyakajjhattaratoti sasantānadhammesu vipassanāvasena, gocarāsevanāya ca nirato.
“Niyakajjhattarato” means devoted to the states of one’s own continuum through insight (vipassanā) and through cultivating sense objects.
Niyakajjhattarato (an trú trong nội tâm của mình) là người chuyên tâm vào các pháp trong dòng tâm thức của mình bằng thiền quán (vipassanā) và bằng cách thực hành đối tượng (gocara).
Savipākaṃ samānaṃ pavattivipākamattadāyikammaṃ savipākaṭṭhena sambhavaṃ. Na ca taṃ kāmādibhavābhisaṅkhārakanti tato visesanatthaṃ ‘‘sambhava’’nti vatvā ‘‘bhavasaṅkhāra’’nti vuttaṃ.
Karma that yields only results in the present life (pavattivipākamattadāyikammaṃ), being accompanied by results, is called sambhava (existence). And that* is not one that conditions rebirth in the sensual or other realms; therefore, to distinguish it from that, it is said “sambhava” and then “bhavasaṅkhāra” (condition for existence).
Nghiệp có quả báo, chỉ cho quả báo trong sự tiếp nối, được gọi là sambhava (sự phát sinh) vì có quả báo. Và nghiệp đó không phải là nghiệp tạo ra các cõi như dục giới (kāmādibhava). Do đó, để phân biệt, sau khi nói “sambhava”, đã nói “bhavasaṅkhāra” (hành hữu).
Ossajjīti ariyamaggena avassajji.
“Ossajjī” means he relinquished it by means of the Noble Path (ariyamagga).
Ossajjī (đã từ bỏ) là đã từ bỏ bằng Thánh đạo (ariyamagga).
Kavacaṃ viya attabhāvaṃ pariyonandhitvā ṭhitaṃ attani sambhūtattā attasambhavaṃ kilesañca abhindīti kilesabhedasahabhāvikammossajjanaṃ dassento tadubhayassa kāraṇaṃ avoca ‘‘ajjhattarato samāhito’’ti.
He also “shattered the defilements that are self-born (attasambhavaṃ kilesañca abhindī),” meaning those that arose in himself, enveloping his self-existence like armor. To show the relinquishing of karma concomitant with the shattering of defilements, he stated the cause of both: “ajjhattarato samāhito” (delighting inwardly, concentrated).
Kavacaṃ viya (như áo giáp), phiền não attasambhavaṃ (tự sinh) là phiền não phát sinh trong tự thân, bao phủ thân như áo giáp. Và Ngài abhindī (đã phá hủy) phiền não đó. Để chỉ ra sự từ bỏ nghiệp đồng thời với việc phá hủy phiền não, Ngài đã nói về nguyên nhân của cả hai: “ajjhattarato samāhito” (an trú nội tâm, định tĩnh).
171. Yanti karaṇe vā adhikaraṇe vā paccattavacananti adhippāyena āha ‘‘yena samayena, yasmiṃ vā samaye’’ti.
“Yanti” (when, at which) means in the sense of the instrumental or locative case, hence it says “at which time, or during which time.”
Yanti là từ chỉ định cách thuộc cách công cụ (karaṇa) hoặc cách vị trí (adhikaraṇa), với ý nghĩa “yena samayena, yasmiṃ vā samaye” (vào thời điểm nào, hoặc trong thời điểm nào).
Ukkhepakavātāti udakasandhārakavātaṃ upacchinditvā ṭhitaṭṭhānato khepakavātā.
“Ukkhepakavātā” are winds that, having broken through the water-holding wind, cast* from its resting place.
Ukkhepakavātā (những cơn gió nâng lên) là những cơn gió thổi bay nước ra khỏi vị trí mà chúng đã chặn đứng các cơn gió giữ nước.
‘‘Saṭṭhi…pe… bahala’’nti idaṃ tassa vātassa ubbedhappamāṇameva gahetvā vuttaṃ, āyāmavitthārato pana dasasahassacakkavāḷappamāṇampi udakasandhārakavātaṃ upacchindatiyeva.
“Sixty…pe…thick” is said by taking only the height of that wind; however, in terms of length and width, it also breaks through the water-holding wind of the ten-thousandfold world system’s extent.
“Saṭṭhi…pe… bahala” (sáu mươi…pe… dày đặc) này được nói chỉ để lấy kích thước chiều cao của cơn gió đó; nhưng về chiều dài và chiều rộng, nó cũng thổi bay cơn gió giữ nước có kích thước bằng mười ngàn thế giới.
Ākāseti pubbe vātena patiṭṭhitokāse.
“In the sky” means in the space where the wind was previously established.
Ākāse (trên không trung) là ở nơi mà gió đã từng tồn tại trước đây.
Puna vātoti ukkhepakavāte tathākatvā vigate udakasandhārakavāto puna ābandhitvā gaṇhāti yathā taṃ udakaṃ na bhassati, evaṃ utthambhentaṃ ābandhanavitānavasena bandhitvā gaṇhāti.
“Puna vāto” (again the wind): when the lifting winds have acted in that manner and dispersed, the water-holding wind again binds and holds it, binding and holding it as if to prevent the water from falling, propping it up like a canopy.
Puna vāto (lại có gió) là khi những cơn gió nâng lên đã làm như vậy và tan biến, cơn gió giữ nước lại ābandhitvā gaṇhāti (buộc chặt và giữ lấy) nước đó để nó không rơi xuống, bằng cách nâng đỡ và buộc chặt như một tấm màn.
Tato udakaṃ uggacchatīti tato ābandhitvā gahaṇato tena vātena utthambhitaṃ udakaṃ uggacchati upari gacchati.
“Tato udakaṃ uggacchatī” (from that, the water rises): from being bound and held by that wind, the propped-up water rises, it goes upwards.
Tato udakaṃ uggacchatī (từ đó nước dâng lên) là từ việc bị buộc chặt và giữ lấy, nước được gió nâng đỡ đó dâng lên, lên cao.
Hotiyevāti antarantarā hotiyeva.
“Hotiyevā” means it happens intermittently.
Hotiyevā (thật sự xảy ra) là thỉnh thoảng vẫn xảy ra.
Bahalabhāvenāti mahāpathaviyā mahantabhāvena.
“Bahalabhāvenā” means due to the vastness of the great earth.
Bahalabhāvenā (do sự dày đặc) là do sự rộng lớn của đại địa.
Sakalā hi mahāpathavī tadā oggacchati, uggacchati ca, tasmā kampanaṃ na paññāyati.
Indeed, the entire great earth sinks and rises at that time; therefore, the tremor is not perceived.
Toàn bộ đại địa khi ấy chìm xuống và dâng lên, do đó sự rung chuyển na paññāyati (không hiển lộ).
Ijjhanassāti icchitatthasijjhanassa.
“Ijjhanassā” means for the accomplishment of the desired goal.
Ijjhanassā (của sự thành tựu) là của sự thành tựu điều mong muốn.
Anubhavitabbassaissariyasampattiādikassa.
“Anubhavitabbassa” means to be experienced, such as sovereign power and so forth.
Anubhavitabbassa (của điều cần phải trải nghiệm) là của sự thành tựu uy quyền, v.v.
Parittāti paṭiladdhamattā nātisubhāvitā.
“Parittā” means meagerly attained, not well developed.
Parittā (nhỏ bé) là chỉ mới đạt được, chưa được tu tập tốt.
Tathā ca bhāvanā balavatī na hotīti āha ‘‘dubbalā’’ti.
Thus, the development is not powerful, hence it says “dubbalā” (weak).
Và do đó, sự tu tập không mạnh mẽ, nên đã nói “dubbalā” (yếu kém).
Saññāsīsena hi bhāvanā vuttā.
Indeed, development is spoken of with perception (saññā) as its head.
Thật vậy, sự tu tập được nói đến với danh nghĩa của tưởng (saññā).
Appamāṇāti paguṇā subhāvitā.
“Appamāṇā” means well-practiced, well-developed.
Appamāṇā (vô lượng) là được tu tập tốt, thuần thục.
Sā hi thirā daḷhatarā hotīti āha ‘‘balavā’’ti.
Indeed, that is firm and very strong, hence it says “balavā” (strong).
Vì nó vững chắc và kiên cố hơn, nên đã nói “balavā” (mạnh mẽ).
‘‘Parittā pathavīsaññā, appamāṇā āposaññā’’ti desanāmattameva, āposaññāya pana subhāvitāya pathavīkampo sukheneva ijjhatīti ayamettha adhippāyo veditabbo.
The statement “‘The perception of earth is limited; the perception of water is immeasurable’” is merely a teaching. However, when the perception of water is well-developed, the shaking of the earth is easily accomplished. This is the intended meaning here.
‘‘Tri giác đất hạn hẹp, tri giác nước vô lượng’’ chỉ là lời dạy, nhưng khi tri giác nước được tu tập tốt, sự chấn động của đất sẽ dễ dàng thành tựu, đây là ý nghĩa cần được hiểu ở đây.
Saṃvejento dibbasampattiyā pamattaṃ sakkaṃ devarājānaṃ.
Arousing spiritual urgency in Sakka, the king of devas, who was negligent due to his divine splendor.
Khi làm cho kinh sợ vị thiên vương Sakka đang lơ đễnh với sự giàu sang của chư thiên.
Vīmaṃsanto vā tāvadeva samadhigataṃ attano iddhibalaṃ.
Or investigating his own psychic power that was attained at that very moment.
Hoặc khi khảo sát năng lực thần thông của mình đã đạt được ngay lúc đó.
Mahāmoggallānattherassa pāsādakampanaṃ pākaṭanti taṃ anāmasitvā saṅgharakkhitasāmaṇerassa pāsādakampanaṃ dassetuṃ ‘‘so kirāyasmā’’tiādi vuttaṃ.
Since the shaking of the palace by the Elder Mahāmoggallāna is well-known, in order to show the shaking of the palace by Saṅgharakkhita Sāmaṇera without mentioning the former, the phrase “that venerable one” and so on was stated.
Việc Đại Trưởng lão Mahāmoggallāna làm chấn động cung điện là điều hiển nhiên, nên để chỉ ra việc Sa-di Saṅgharakkhita làm chấn động cung điện mà không đề cập đến điều đó, đã nói “vị tôn giả ấy” v.v.
Pūtimisso gandho etassāti pūtigandho, tena pūtigandheneva adhigatamātukucchisambhavaṃ viya gandheneva sīsena, ativiya dārako evāti attho.
That which has a putrid smell is pūtigandha. By that putrid smell as if the smell originating from the mother’s womb was attained, with that head which has only smell, the meaning is that he is just a mere boy.
Mùi hôi thối hòa lẫn trong đó, nên gọi là pūtigandha (mùi hôi thối). Với cái đầu đầy mùi hôi thối như thể mùi hôi thối đã có từ khi còn trong bụng mẹ, ý là: “ngươi vẫn còn là một đứa trẻ con”.
Ācariyanti ācariyūpadesaṃ.
Teacher means the instruction of a teacher.
Ācariya (Thầy) có nghĩa là lời giáo huấn của thầy.
Iddhābhisaṅkhāro nāma iddhividhappaṭipakkhādībhāvena icchitabbo, so ca upāye kosallassa attanā na sammā uggahitattā na tāva sikkhitoti āha ‘‘asikkhitvāva yuddhaṃ paviṭṭhosī’’ti.
The development of psychic power (iddhābhisaṅkhāra) should be desired as the overcoming of obstacles to psychic power, etc., and since one has not properly grasped the skill in the method oneself, it has not yet been learned; thus it is said: “You have entered battle without having learned.”
Sự tạo tác thần thông (iddhābhisaṅkhāro) là điều mong muốn, nhưng vì bản thân chưa học hỏi kỹ lưỡng về phương pháp khéo léo nên chưa được huấn luyện, do đó nói “ngươi đã tham gia chiến đấu mà chưa được huấn luyện”.
‘‘Pilavanta’’nti iminā sakalameva pāsādavatthuṃ udakaṃ katvā adhiṭṭhātabbapāsādova tattha pilavatīti dasseti.
By the word “floating,” it is shown that the entire foundation of the palace is to be made into water by adhiṭṭhāna, and only the palace itself will float thereon.
Với từ “pilavantaṃ” (trôi nổi), ngài chỉ ra rằng toàn bộ nền cung điện được biến thành nước, và chính cung điện được biến hóa đó sẽ trôi nổi trên đó.
Adhiṭṭhānakkamaṃ pana upamāya dassento ‘‘tāta…pe… jānāhī’’ti āha.
Then, illustrating the method of adhiṭṭhāna with an analogy, he said: “Son... (etc.)... know.”
Để chỉ ra trình tự biến hóa bằng ví dụ, ngài nói “Tāta…pe… jānāhi” (Này con… v.v… hãy biết).
Tattha kapallakapūvanti āsittakapūvaṃ, taṃ pacantā kapāle paṭhamaṃ kiñci piṭṭhaṃ ṭhapetvā anukkamena vaḍḍhetvā antantena paricchindanti pūvaṃ samantato paricchinnaṃ katvā ṭhapenti, evaṃ ‘‘āpokasiṇavasena ‘pāsādena patiṭṭhitaṭṭhānaṃ udakaṃ hotū’ti adhiṭṭhahanto samantato pāsādassa yāva pariyantā yathā udakaṃ hoti, tathā adhiṭṭhātabba’’nti upamāya upadisati.
Therein, kapallakapūva means a pancake poured into a pan; when frying it, one first places a little batter in the pan, gradually expands it, and then cuts it off at the edges, making the pancake round and setting it. In the same way, he advises by analogy: “By means of the water kasiṇa, when performing adhiṭṭhāna, thinking ‘May the place where the palace stands be water,’ one should perform adhiṭṭhāna so that there is water all around the palace, up to its very edge.”
Trong đó, kapallakapūvaṃ là bánh đổ khuôn. Khi nướng bánh đó, người ta đặt một ít bột lên chảo trước, rồi dần dần thêm vào và cắt (paricchindanti) các cạnh để làm cho bánh được cắt tròn đều. Tương tự như vậy, ngài dùng ví dụ để chỉ dạy rằng: “Khi biến hóa theo āpokasiṇa (biến nước) rằng ‘nơi cung điện đứng vững hãy thành nước’, phải biến hóa sao cho nước bao phủ toàn bộ cung điện đến tận rìa”.
Idāni nesaṃ pathavīkampanaṃ kāraṇato, pavattiākārato ca vibhāgaṃ dassetuṃ ‘‘iti imesū’’tiādi vuttaṃ.
Now, in order to show the distinction of these earth-shakings according to cause and manner of occurrence, the phrase “thus among these” and so on was stated.
Bây giờ, để chỉ ra sự khác biệt của các trận động đất đó về nguyên nhân và cách thức xảy ra, đã nói “iti imesu” (trong số này) v.v.
Dhātukopenāti ukkhepakadhātusaṅkhātāya vāyodhātuyā pakopena.
Due to the agitation of elements means due to the agitation of the air element, which is characterized as the upward-throwing element.
Do sự rối loạn của các yếu tố (dhātukopena) là do sự rối loạn của phong đại, tức là phong đại có chức năng đẩy lên.
Iddhānubhāvenāti ñāṇiddhiyā vā kammavipākajiddhiyā vā pabhāvena, tejenāti attho.
Due to psychic power means due to the potency or power of the knowledge-based psychic power or the psychic power born of kamma-result.
Do năng lực thần thông (iddhānubhāvena) là do sức mạnh, oai lực của thần thông trí tuệ hoặc thần thông do quả nghiệp, tức là do oai lực.
Puññatejenāti puññānubhāvena, mahābodhisattassa puññabalenāti attho.
Due to the power of merit means due to the efficacy of merit, that is, due to the power of the Great Bodhisatta’s merit.
Do oai lực phước đức (puññatejena) là do năng lực phước đức, tức là do sức mạnh phước đức của Đại Bồ-tát.
Ñāṇatejenāti paṭivedhañāṇānubhāvena.
Due to the power of knowledge means due to the efficacy of penetrative knowledge.
Do oai lực trí tuệ (ñāṇatejena) là do năng lực của trí tuệ thấu triệt.
Sādhukāradānavasenāti yathā anaññasādhāraṇena paṭivedhañāṇānubhāvena abhihatā mahāpathavī abhisambodhiyaṃ akampittha, evaṃ anaññasādhāraṇena desanāñāṇānubhāvena abhihatā mahāpathavī akampittha, taṃ panassā sādhukāradānaṃ viya hotīti ‘‘sādhukāradānavasenā’’ti vuttaṃ.
By way of offering approbation refers to how the great earth, struck by the efficacy of penetrative knowledge unique to him, shook at the time of his enlightenment; likewise, the great earth, struck by the efficacy of his teaching knowledge unique to him, shook, and this shaking was like an offering of approbation from the earth. Hence, it is said “by way of offering approbation.”
Theo cách tán thán (sādhukāradānavasena) có nghĩa là: giống như Đại địa đã chấn động khi Đức Phật giác ngộ do năng lực trí tuệ thấu triệt phi thường, thì Đại địa cũng chấn động do năng lực trí tuệ thuyết pháp phi thường. Điều đó giống như sự tán thán của Đại địa, nên đã nói “theo cách tán thán”.
Yena pana bhagavā asītianubyañjanapaṭimaṇḍitadvattiṃsamahāpurisalakkhaṇa- (dī. ni. 2.33; 3.198; ma. ni. 2.385) vicitrarūpakāyo sabbākāraparisuddhasīlakkhandhādiguṇaratanasamiddhidhammakāyo puññamahattathāmamahattayasamahaāiddhimahattapaññāmahattānaṃ paramukkaṃsagato asamo asamasamo appaṭipuggalo arahaṃ sammāsambuddho attano attabhāvasaññitaṃ khandhapañcakaṃ kappaṃ vā kappāvasesaṃ vā ṭhapetuṃ samatthopi saṅkhatadhammaṃ paṭijigucchanākārappavattena ñāṇavisesena tiṇāyapi amaññamāno āyusaṅkhārossajjanavidhinā nirapekkho ossajji.
Because the Blessed One, whose beautiful form-body was adorned with the thirty-two marks of a Great Man and eighty minor characteristics, whose Dhamma-body was endowed with the complete purity of virtue-aggregates and other jewel-like qualities, having reached the pinnacle of greatness in merit, strength, fame, psychic power, and wisdom, being unparalleled, uniquely unparalleled, and without peer, the Arahant, the Fully Self-Enlightened One, though capable of sustaining his own five aggregates, known as his personal existence, for an eon or the remainder of an eon, dispassionately relinquished it through the method of relinquishing the life-sustaining volitions, by means of a special knowledge that expressed revulsion towards conditioned phenomena, considering them less than a blade of grass.
Mặc dù Đức Thế Tôn, với thân tướng trang nghiêm bởi ba mươi hai tướng tốt của bậc Đại nhân và tám mươi tướng phụ, với pháp thân đầy đủ các phẩm chất quý báu như giới uẩn hoàn toàn thanh tịnh, đạt đến tột đỉnh của sự vĩ đại về phước đức, sức mạnh, uy danh, thần thông và trí tuệ, là bậc Vô Song, Vô Song Tuyệt Luân, Vô Thượng Sĩ, bậc A-la-hán, Chánh Đẳng Chánh Giác, có khả năng duy trì năm uẩn được gọi là tự thân của Ngài trong một kiếp hoặc phần còn lại của một kiếp, nhưng Ngài đã từ bỏ nó một cách vô ngần, không xem thường pháp hữu vi như một cọng cỏ, với trí tuệ đặc biệt biểu hiện sự ghê tởm đối với pháp hữu vi, bằng phương pháp xả bỏ thọ hành.
Tadanubhāvābhihatā mahāpathavī āyusaṅkhārossajjane akampittha, taṃ panassā kāruññasabhāvasaṇṭhitā viya hotīti vuttaṃ ‘‘kāruññasabhāvenā’’ti.
The great earth, struck by the efficacy of that act, shook at the relinquishing of the life-sustaining volitions, and this shaking of the earth was as if it arose from a compassionate nature. Therefore, it is said “by a compassionate nature.”
Đại địa, bị ảnh hưởng bởi năng lực đó, đã chấn động khi Đức Phật xả bỏ thọ hành. Điều đó giống như sự biểu hiện của lòng bi mẫn của Đại địa, nên đã nói “do bản chất bi mẫn”.
Yasmā bhagavā parinibbānasamaye catuvīsatikoṭisatasahassasaṅkhyā samāpattiyo samāpajji antarantarā phalasamāpattisamāpajjanena, tassa pubbabhāge sātisayaṃ tikkhaṃ sūraṃ vipassanāñāṇañca pavattesi, ‘‘yadatthañca mayā evaṃ sucirakālaṃ anaññasādhāraṇo paramukkaṃsagato ñāṇasambhāro sambhato, anuttaro ca vimokkho samadhigato, tassa vata me sikhāppattaphalabhūtā accantaniṭṭhā anupādisesanibbānadhātu ajja samijjhatī’’ti bhiyyo ativiya somanassappattassa bhagavato pītivipphārādiguṇavipulatarānubhāvo parehi asādhāraṇañāṇātisayo udapādi, yassa samāpattibalasamupabrūhitassa ñāṇātisayassa ānubhāvaṃ sandhāya idaṃ vuttaṃ ‘‘dveme piṇḍapātā samasamaphalā samasamavipākā’’tiādi (udā. 75), tasmā tassa ānubhāvena samabhihatā mahāpathavī akampittha.
Because, at the time of his Parinibbāna, the Blessed One entered into meditations (samāpatti) totalling two hundred and forty million, entering into the attainment of fruition (phalasamāpatti) intermittently, and in the preceding phase, he developed supremely keen and vigorous insight-knowledge. “Indeed, for the sake of which I have accumulated such a vast and unique store of knowledge, having attained the unsurpassed liberation, that very ultimate, final, and entirely unconditioned Nibbāna-element, which is the culminating fruit, shall be realized today!” — the Blessed One, having attained even greater joy, gave rise to a vastly expansive efficacy of qualities such as the pervading of rapture, and an extraordinary knowledge unique among others. Referring to the efficacy of this extraordinary knowledge, which was augmented by the power of his attainments, it was stated, “These two alms-foods are equal in fruit, equal in result,” and so on. Therefore, the great earth, struck by the efficacy of that knowledge, shook.
Vì khi Đức Thế Tôn nhập Niết-bàn, Ngài đã nhập vào hai mươi bốn vạn bốn ngàn trăm ngàn định, xen kẽ với việc nhập quả định. Trước đó, Ngài đã phát triển tuệ quán sắc bén và dũng mãnh phi thường, và Ngài đã đạt được sự hoan hỷ tột độ, nghĩ rằng: “Vì mục đích này mà ta đã tích lũy trí tuệ phi thường, tột đỉnh, không ai sánh bằng trong một thời gian dài như vậy, và đã đạt được sự giải thoát vô thượng. Nay, quả vị tối thượng, Niết-bàn vô dư y, đã thành tựu cho ta!”. Do đó, một trí tuệ phi thường, không ai sánh bằng, được tăng cường bởi sức mạnh của định, đã phát sinh nơi Đức Thế Tôn. Dựa vào năng lực của trí tuệ phi thường được tăng cường bởi sức mạnh của định này mà đã nói: “Hai món cúng dường này có quả báo như nhau, có dị thục như nhau” (Udāna 75). Vì vậy, Đại địa đã chấn động do năng lực đó.
Taṃ panassā tassaṃ velāyaṃ ārodanākārappatti viya hotīti ‘‘aṭṭhamo ārodanenā’’ti vuttaṃ.
And that shaking of the earth at that time was like an expression of lamentation. Hence, it is said, “the eighth by lamentation.”
Điều đó vào thời điểm đó giống như sự biểu hiện của sự than khóc của Đại địa, nên đã nói “thứ tám là sự than khóc”.
Idāni saṅkhepato vuttamatthaṃ vivaranto ‘‘mātukucchiṃ okkamante’’tiādimāha.
Now, elaborating on the meaning stated in brief, he said: “when entering the mother’s womb” and so on.
Bây giờ, để giải thích ý nghĩa đã được nói tóm tắt, ngài nói “mātukucchiṃ okkamante” (khi nhập vào thai mẹ) v.v.
Ayaṃ panatthoti ‘‘sādhukāradānavasenā’’tiādinā vutto attho.
This meaning, however, is the meaning stated by “by way of offering approbation” and so on.
Ý nghĩa này là ý nghĩa đã được nói đến bởi “sādhukāradānavasena” (theo cách tán thán) v.v.
Pathavīdevatāya vasenāti ettha samuddadevatā viya mahāpathaviyā adhidevatā kira nāma atthi.
In “by way of the earth deity,” there is said to be a presiding deity of the great earth, just like a deity of the ocean.
Trong cụm từ “do vị thần đất” (pathavīdevatāya vasena), có một vị thần chủ quản Đại địa, giống như vị thần biển.
Tādise kāraṇe sati tassā cittavasena ayaṃ mahāpathavī saṅkampati sampakampati sampavedhati, yathā vātavalāhakadevatānaṃ cittavasena vātā vāyanti, sītuṇhaabbhavassavalāhakadevatānaṃ cittavasena sītādayo bhavanti.
When such a cause exists, this great earth shakes, trembles, and quakes according to the will of that deity, just as winds blow according to the will of the wind and cloud deities, and cold, heat, and rain occur according to the will of the cold, hot, and rainy cloud deities.
Khi có nguyên nhân như vậy, Đại địa này chấn động, rung chuyển, lay động theo ý muốn của vị thần đó, giống như gió thổi theo ý muốn của các vị thần gió và mây, và lạnh, nóng, mây mưa xảy ra theo ý muốn của các vị thần mây lạnh, mây nóng, mây mưa.
Tathā hi visākhapuṇṇamāyaṃ abhisambodhiatthaṃ bodhirukkhamūle nisinnassa lokanāthassa antarāyakaraṇatthaṃ upaṭṭhitaṃ mārabalaṃ vidhamituṃ –
Indeed, on the Visākha full moon day, in order to overcome the forces of Māra that had gathered to obstruct the Lord of the World who was seated at the foot of the Bodhi tree for the purpose of complete enlightenment—
Thật vậy, vào ngày rằm tháng Visākhā, để phá tan quân Ma vương đang vây hãm để gây trở ngại cho Đức Thế Tôn, bậc Hộ Thế, khi Ngài đang ngồi dưới cội Bồ-đề để chứng đắc Chánh Đẳng Chánh Giác –
Niddiṭṭhanidassananti niddiṭṭhassa atthassa niyyātanaṃ, nigamananti attho.
Niddiṭṭhanidassana means the rendering of the stated meaning, that is, the conclusion.
Niddiṭṭhanidassana có nghĩa là sự xác nhận ý nghĩa đã được chỉ rõ, tức là kết luận.
Ettāvatāti pathavīkampādiuppādajananena ceva pathavīkampassa bhagavato hetunidassanena ca.
Ettāvatā means by the generation of the production of earthquakes and so forth, and by the Blessed One's demonstration of the cause of the earthquake.
Ettāvatā là do sự phát sinh các trận động đất, v.v., và do Đức Thế Tôn đã chỉ rõ nguyên nhân của trận động đất.
‘‘Addhā ajja bhagavatā āyusaṅkhāro ossaṭṭho’’ti sallakkhesi pārisesañāyena.
" Certainly today the Blessed One has renounced the life-process (āyusaṅkhāra)," he recognized by the method of elimination (pārisesañāya).
Ngài đã nhận ra bằng phép suy luận loại trừ (pārisesañāya) rằng: “Chắc chắn hôm nay Đức Thế Tôn đã xả bỏ hành thọ mạng (āyusaṅkhāra).”
Evañhi tadā thero tamatthaṃ vīmaṃseyya nāyaṃ bhūmikampo dhātuppakopahetuko tassa apaññāyamānarūpattā, bāhirakopi isi evaṃ mahānubhāvo buddhakāle natthi, sāsanikopi satthu anārocetvā evaṃ karonto nāma natthi, sesānaṃ pañcannaṃ idāni asambhavo, evaṃ bhūmikampo cāyaṃ mahābhiṃsanako salomahaṃso ahosi, tasmā pārisesato āha ‘‘ajja bhagavatā āyusaṅkhāro ossaṭṭhoti sallakkhesī’’ti.
For at that time, the Elder would have investigated the matter thus: "This earthquake is not caused by a disturbance of the elements (dhātuppakopahetuko), as its nature is not evident; there is no external ascetic of such great power in the time of the Buddha, nor is there any monastic disciple who would act in this way without informing the Teacher; the other five causes are currently impossible. And this earthquake was exceedingly terrifying and hair-raising. Therefore, by elimination, he said, 'Today the Blessed One has renounced the life-process,' he recognized."
Thật vậy, khi ấy, vị Trưởng lão đã xem xét sự việc ấy rằng: “Trận động đất này không phải do sự rối loạn của các yếu tố (dhātuppakopahetuko), vì bản chất của nó không thể được nhận biết. Cũng không có vị ẩn sĩ ngoại đạo nào có uy lực lớn như vậy trong thời Đức Phật. Cũng không có vị Tỳ-khưu nào trong Giáo pháp lại làm như vậy mà không báo cho Đức Bổn Sư. Năm nguyên nhân còn lại thì hiện tại không thể xảy ra. Và trận động đất này thật là đáng sợ và làm dựng tóc gáy. Vì vậy, do phép suy luận loại trừ, Ngài đã nói: ‘Hôm nay Đức Thế Tôn đã xả bỏ hành thọ mạng (āyusaṅkhāra)’.”
Samāgantabbato, samāgacchatīti vā samāgamo, parisā.
Samāgamo is an assembly (parisā), from the sense of "to be assembled" or "to assemble."
Samāgamo là hội chúng (parisā), vì là nơi cần phải tụ họp, hoặc vì tụ họp.
Bimbisārapamukho samāgamo bimbisārasamāgamo. Sesadvayepi eseva nayo.
An assembly with Bimbisāra as the chief is Bimbisārasamāgamo. The same method applies to the other two.
Hội chúng do vua Bimbisāra đứng đầu là Bimbisārasamāgamo. Tương tự đối với hai nhóm còn lại.
Bimbisāra…pe… samāgamādisadisaṃ khattiyaparisanti yojanā.
The phrasing is "a royal assembly similar to the Bimbisāra... etc... assembly."
Sự kết nối là: hội chúng của các Sát-đế-lợi giống như hội chúng của vua Bimbisāra, v.v.
Aññesu cakkavāḷesupi labbhateyeva satthu khattiyaparisādiupasaṅkamanaṃ.
Aññesu cakkavāḷesupi labbhateyeva means that the Teacher's approach to royal assemblies and so forth is indeed found in other world-systems as well.
Aññesu cakkavāḷesupi labbhateyeva có nghĩa là sự viếng thăm của Đức Bổn Sư đến hội chúng của các Sát-đế-lợi, v.v., cũng được tìm thấy ở các thế giới khác.
Ādito tehi saddhiṃ satthu bhāsanaṃ ālāpo. Kathanapaṭikathanaṃ sallāpo. Dhammupasañhitā pucchā paṭipucchā dhammasākacchā.
The Teacher's ālāpo (address) is speaking with them initially. Sallāpo (conversation) is question and answer. Dhammasākacchā (discussion of Dhamma) is questions and counter-questions related to the Dhamma.
Ālāpo là lời nói của Đức Bổn Sư với họ lúc ban đầu. Sallāpo là sự đối đáp. Dhammasākacchā là sự hỏi đáp liên quan đến Pháp.
Saṇṭhānaṃ paṭicca kathanaṃ saṇṭhānapariyāyattā vaṇṇa-saddassa ‘‘mahantaṃ hatthirājavaṇṇaṃ abhinimminitvā’’tiādīsu (saṃ. ni. 1.138) viya.
Saṇṭhānaṃ paṭicca kathanaṃ means speaking with reference to the appearance, as the word vaṇṇa can mean appearance, as in "having created the appearance of a great king elephant," and so on.
Saṇṭhānaṃ paṭicca kathanaṃ là lời nói liên quan đến hình dạng, như trong các câu “tạo ra một hình dạng voi chúa vĩ đại” (Saṃ. Ni. 1.138), v.v., vì từ “vaṇṇa” (sắc) là một từ đồng nghĩa với “saṇṭhāna” (hình dạng).
‘‘Tesa’’nti padaṃ ubhayapadāpekkhaṃ ‘‘tesampi lakkhaṇasaṇṭhānaṃ viya satthu sarīrasaṇṭhānaṃ, tesaṃ kevalaṃ paññāyati evā’’ti.
The word "tesaṃ" is dependent on both parts: "The Teacher's bodily form is like the distinctive appearance of those people, and for them, it is merely evident."
Từ “tesaṃ” liên quan đến cả hai từ trước và sau, có nghĩa là: “Hình dạng thân thể của Đức Bổn Sư cũng giống như hình dạng và đặc điểm của họ, và tất cả đều được họ nhận biết.”
Nāpi āmukkamaṇikuṇḍalo bhagavā hotīti yojanā.
The phrasing is: "Nor is the Blessed One adorned with jeweled earrings."
Sự kết nối là: Đức Thế Tôn cũng không phải là người đeo trang sức ngọc ngà hay khuyên tai.
Chinnassarāti dvidhābhūtassarā.
Chinnassarā means having fragmented voices.
Chinnassarā là những người có giọng nói bị chia đôi.
Gaggarassarāti jajjaritassarā.
Gaggarassarā means having rough voices.
Gaggarassarā là những người có giọng nói bị vỡ hoặc khàn.
Bhāsantaranti tesaṃ sattānaṃ bhāsato aññaṃ bhāsaṃ.
Bhāsantaraṃ means a language different from the language of those beings.
Bhāsantaraṃ là một ngôn ngữ khác với ngôn ngữ của những chúng sinh ấy.
Vīmaṃsāti cintanā.
Vīmaṃsā means consideration.
Vīmaṃsā là sự suy tư.
‘‘Kimatthaṃ…pe… desetī’’ti idaṃ nanu attānaṃ jānāpetvā dhamme kathite tesaṃ sātisayo pasādo hotīti iminā adhippāyena vuttaṃ?
"For what purpose... etc... does he teach?" Was this not said with the intention that when the Dhamma is taught after making oneself known, their faith is greatly intensified?
“Kimatthaṃ…pe… desetī” – chẳng phải điều này đã được nói với ý định rằng khi Pháp được thuyết giảng sau khi tự giới thiệu, thì họ sẽ có niềm tin đặc biệt sao?
Yesaṃ attānaṃ ajānāpetvāva dhamme kathite pasādo hoti, na jānāpetvā, tādise sandhāya satthā tathā karoti.
Regarding those individuals for whom faith arises when the Dhamma is taught without making oneself known, and not when one makes oneself known, the Teacher acts in that way.
Đối với những người có niềm tin khi Pháp được thuyết giảng mà không cần tự giới thiệu, và không có niềm tin khi tự giới thiệu, Đức Bổn Sư đã hành động như vậy để hướng đến những người như thế.
Tattha payojanamāha ‘‘vāsanatthāyā’’ti.
He states the purpose there as "for the sake of habitual tendencies (vāsanā)."
Ngài nói về mục đích ở đó là “vāsanatthāyā” (để gieo hạt giống).
Evaṃ sutopīti evaṃ aviññātadesako aviññātāgamanopi suto dhammo attano dhammasudhammatāyeva anāgate paccayo hoti suṇantassa.
Evaṃ sutopi means even if heard in this way, even if the Dhamma speaker is unknown or his arrival is unknown, the Dhamma, by its very nature as excellent Dhamma, becomes a condition for the listener in the future.
Evaṃ sutopī có nghĩa là, ngay cả khi Pháp được nghe như vậy, tức là người thuyết giảng không được biết đến và sự đến của Ngài cũng không được biết, thì dhammo (Pháp) ấy, chỉ vì bản chất tốt đẹp của chính Pháp, anāgate paccayo hoti (trở thành một nhân duyên trong tương lai) cho người nghe.
173. Abhibhavatīti abhibhu, parikammaṃ, ñāṇaṃ vā.
173. Abhibhu means one who overcomes or pervades; it refers to preliminary work (parikamma) or knowledge (ñāṇa).
Abhibhu là sự chuẩn bị (parikamma) hoặc trí tuệ (ñāṇa), vì nó chế ngự.
Abhibhu āyatanaṃ etassāti abhibhāyatanaṃ, jhānaṃ.
Abhibhāyatanaṃ (sphere of mastery) is a jhāna, because it has an abhibhu (overcomer) as its base.
Abhibhāyatanaṃ là thiền (jhāna), vì nó có sự chế ngự (abhibhu) làm xứ (āyatana).
Abhibhavitabbaṃ vā ārammaṇasaṅkhātaṃ āyatanaṃ etassāti abhibhāyatanaṃ. Ārammaṇābhibhavanato abhibhu ca taṃ āyatanañca yogino sukhavisesānaṃ adhiṭṭhānabhāvato, manāyatanadhammāyatanabhāvato vātipi sasampayuttaṃ jhānaṃ abhibhāyatanaṃ. Tenāha ‘‘abhibhavanakāraṇānī’’tiādi.
Alternatively, abhibhāyatanaṃ refers to a jhāna, as it has an āyatana (base) in the sense of an object (ārammaṇa) to be overcome. Also, because it overcomes objects (ārammaṇābhibhavana) it is an abhibhu (overcomer), and because it is a foundation for special pleasures of the yogi, or because it is a manāyatana and dhammāyatana, therefore the jhāna together with its concomitants is abhibhāyatanaṃ. Hence, it is said, "abhibhavanakāraṇāni" and so on.
Hoặc abhibhāyatanaṃ là thiền, vì nó có cảnh giới (āyatana) là đối tượng cần được chế ngự (abhibhavitabbaṃ). Hoặc thiền đi kèm với các pháp tương ưng (sasampayuttaṃ jhānaṃ) được gọi là abhibhāyatanaṃ vì nó chế ngự các đối tượng (ārammaṇābhibhavanato abhibhu), và vì nó là cơ sở cho các loại hạnh phúc đặc biệt của hành giả (yogino sukhavisesānaṃ adhiṭṭhānabhāvato), hoặc vì nó là tâm xứ và pháp xứ (manāyatanadhammāyatanabhāvato). Vì vậy, Ngài nói: “abhibhavanakāraṇānī” (các nguyên nhân của sự chế ngự), v.v.
Tāni hīti abhibhāyatanasaññitāni jhānāni.
Tāni hi means those jhāna called abhibhāyatana.
Tāni hi là những thiền định được gọi là thắng xứ (abhibhāyatana).
‘‘Puggalassa ñāṇuttariyatāyā’’ti idaṃ ubhayatthāpi yojetabbaṃ.
"Puggalassa ñāṇuttariyatāya" should be construed in both ways.
Câu “Puggalassa ñāṇuttariyatāyā” nên được kết nối ở cả hai nơi.
Kathaṃ?
How?
Như thế nào?
Paṭipakkhabhāvena paccanīkadhamme abhibhavanti puggalassa ñāṇuttariyatāya ārammaṇāni abhibhavanti.
They overcome opposing states (paccanīkadhamma) by their nature as opponents; they overcome objects due to the superiority of the individual's knowledge.
Chúng chế ngự các pháp đối nghịch (paccanīkadhamma) ở khía cạnh đối lập (paṭipakkhabhāvena), và chúng chế ngự các đối tượng (ārammaṇāni abhibhavanti) nhờ vào trí tuệ vượt trội của hành giả (puggalassa ñāṇuttariyatāya).
Ñāṇabaleneva hi ārammaṇābhibhavanaṃ viya paṭipakkhābhibhavo pīti.
For indeed, the overcoming of opponents is like the overcoming of objects through the power of knowledge.
Thật vậy, sự chế ngự đối tượng cũng như sự chế ngự đối lập đều là do sức mạnh của trí tuệ.
Parittānīti yathāladdhāni suppasarāvamattāni.
Parittāni means those obtained, being just the measure of a basket or bowl.
Parittānī là những gì được nhận biết có kích thước nhỏ như một cái bát hoặc một cái đĩa.
Tenāha ‘‘avaḍḍhitānī’’ti.
Therefore, it is said, "avaḍḍhitāni" (not developed).
Vì vậy, Ngài nói: “avaḍḍhitānī” (không được phát triển).
Parittavasenevāti vaṇṇavasena ābhoge vijjamānepi parittavaseneva idaṃ abhibhāyatanaṃ vuttaṃ. Parittatā hettha abhibhavanassa kāraṇaṃ.
Parittavaseneva means that this abhibhāyatana is spoken of in the sense of being small, even when there is an expanse of color. Smallness here is the cause of mastery.
Parittavasenevā có nghĩa là, mặc dù có sự chú ý đến màu sắc, idaṃ abhibhāyatanaṃ vuttaṃ (thắng xứ này được nói đến) chỉ theo cách nhỏ bé. Ở đây, sự nhỏ bé là nguyên nhân của sự chế ngự.
Vaṇṇābhoge satipi asatipi abhibhāyatanabhāvanā nāma tikkhapaññasseva sambhavati, na itarassāti āha ‘‘ñāṇuttariko puggalo’’ti.
Even when there is or is not an expanse of color, the development of abhibhāyatana is possible only for one with keen wisdom, not for others. Therefore, it is said, "ñāṇuttariko puggalo" (the individual with superior knowledge).
Ngài nói: “ñāṇuttariko puggalo” (người có trí tuệ vượt trội), vì việc tu tập thắng xứ (abhibhāyatanabhāvanā) chỉ có thể xảy ra đối với người có trí tuệ sắc bén, dù có hay không có sự chú ý đến màu sắc, chứ không phải đối với người khác.
Abhibhavitvā samāpajjatīti ettha abhibhavanaṃ, samāpajjanañca upacārajjhānādhigamasamanantarameva appanājhānuppādananti āha ‘‘saha nimittuppādenevettha appanaṃ pāpetī’’ti.
In abhibhavitvā samāpajjati (having mastered, he enters into), the mastery and the entering into absorption mean the production of absorption-jhāna immediately after the attainment of access-jhāna. Therefore, it is said, "saha nimittuppādenevettha appanaṃ pāpetī" (he brings absorption to this* simultaneously with the arising of the sign).
Trong câu Abhibhavitvā samāpajjati (chế ngự rồi nhập định), sự chế ngự và sự nhập định là sự phát sinh của thiền định nhập định (appanājhāna) ngay sau khi đạt được thiền cận định (upacārajjhāna). Vì vậy, Ngài nói: “saha nimittuppādenevettha appanaṃ pāpetī” (ở đây, đạt đến nhập định ngay khi tướng xuất hiện).
Saha nimittuppādenāti ca appanāparivāsābhāvassa lakkhaṇaṃ vacanametaṃ.
And saha nimittuppādenā (simultaneously with the arising of the sign) is a phrase indicating the absence of an interval for absorption.
Và câu saha nimittuppādenā là một biểu hiện đặc trưng cho việc không có thời gian nghỉ giữa các giai đoạn nhập định (appanāparivāsābhāvassa).
Yo ‘‘khippābhiñño’’ti vuccati, tatopi ñāṇuttarasseva abhibhāyatanabhāvanā.
One who is called "khippābhiñño" (swiftly knowing) also achieves abhibhāyatana development only if their knowledge is superior.
Người được gọi là “khippābhiñño” (người chứng ngộ nhanh chóng) cũng chỉ có thể tu tập thắng xứ khi có trí tuệ vượt trội.
Etthāti etasmiṃ nimitte.
Ettha means in this sign.
Etthā là ở tướng ấy.
Appanaṃ pāpetīti bhāvanaṃ appanaṃ neti.
Appanaṃ pāpetī means he brings the development to absorption.
Appanaṃ pāpetī là đưa sự tu tập đến nhập định.
Ettha ca keci ‘‘uppanne upacārajjhāne taṃ ārabbha ye heṭṭhimantena dve tayo javanavārā pavattanti, te upacārajjhānapakkhikā eva, tadanantarañca bhavaṅgaparivāsena, upacārāsevanāya ca vinā appanā hoti, saha nimittuppādeneva appanaṃ pāpetī’’ti vadanti, taṃ tesaṃ matimattaṃ.
Here, some say that "when access-jhāna arises, the two or three javana-impulses that occur immediately after it belong to the access-jhāna; then, without a bhavaṅga-interval or the cultivation of access, absorption occurs, and one attains absorption simultaneously with the arising of the sign." This is merely their opinion.
Ở đây, một số người nói rằng: “Khi thiền cận định (upacārajjhāna) phát sinh, hai hoặc ba sát-na tâm tốc hành (javanavārā) đầu tiên liên quan đến nó thuộc về thiền cận định. Sau đó, nhập định (appanā) xảy ra mà không có bhavaṅga (tâm hữu phần) xen kẽ hoặc sự lặp lại của cận định (upacārāsevanā). Ngài đạt đến nhập định ngay khi tướng xuất hiện.” Điều đó chỉ là ý kiến của riêng họ.
Na hi parivāsitaparikammena appanāvāro icchito, nāpi mahaggatappamāṇajjhānesu viya upacārajjhāne ekantato paccavekkhaṇā icchitabbā, tasmā upacārajjhānādhigamanato paraṃ katipayabhavaṅgacittāvasāne appanaṃ pāpuṇanto ‘‘saha nimittuppādenevettha appanaṃ pāpetī’’ti vutto.
For an absorption sequence is not desired through preliminary work with an interval, nor is a specific review of access-jhāna always desired as in the case of magnified jhānas. Therefore, one who attains absorption after the attainment of access-jhāna, after an interval of a few bhavaṅga-thoughts, is referred to as "saha nimittuppādenevettha appanaṃ pāpetī" (he brings absorption to this* simultaneously with the arising of the sign).
Thật vậy, sát-na nhập định (appanāvāro) không được mong muốn với sự chuẩn bị đã được lặp lại (parivāsitaparikammena). Cũng không nên mong muốn sự quán xét (paccavekkhaṇā) một cách tuyệt đối trong thiền cận định (upacārajjhāna) như trong các thiền định có tầm mức lớn (mahaggatappamāṇajjhānesu). Vì vậy, người đạt đến nhập định sau một vài sát-na tâm hữu phần (katipayabhavaṅgacittāvasāne) sau khi đạt được thiền cận định được gọi là “saha nimittuppādenevettha appanaṃ pāpetī” (ở đây, đạt đến nhập định ngay khi tướng xuất hiện).
Saha nimittuppādenevāti ca adhippāyikamidaṃ vacanaṃ, na nītatthaṃ, adhippāyo vuttanayeneva veditabbo, na antosamāpattiyaṃ tadā tathārūpassa ābhogassa asambhavato.
And the statement " along with the arising of the sign" is intentional, not literal. Its intended meaning should be understood according to the method already explained, for such attention is not possible within the attainment at that time.
Từ ngữ " Saha nimittuppādenevā" này là có ý nghĩa hàm súc, không phải là nghĩa trực tiếp. Ý nghĩa cần được hiểu theo cách đã nói, vì trong nội thiền định (samāpatti), sự chú tâm như vậy là không thể xảy ra vào lúc đó.
Samāpattito vuṭṭhitassa ābhogo pubbabhāgabhāvanāyavasena jhānakkhaṇe pavattaṃ abhibhavanākāraṃ gahetvā pavattoti daṭṭhabbaṃ.
It should be understood that the attention of one who has emerged from attainment proceeds by taking up the aspect of overcoming that occurred at the moment of jhāna by way of preparatory development.
Sự chú tâm của người đã xuất khỏi thiền định (samāpatti) cần được hiểu là diễn ra bằng cách nắm giữ phương thức chế ngự đã xảy ra vào khoảnh khắc thiền định, theo cách thức tu tập sơ khởi (pubbabhāgabhāvanā).
Abhidhammaṭṭhakathāyaṃ pana ‘‘iminā tassa pubbābhogo kathito’’ti (dha. sa. aṭṭha. 204) vuttaṃ.
However, in the Abhidhamma Commentary it is stated: "By this, his prior attention is declared."
Tuy nhiên, trong Abhidhammaṭṭhakathā có nói: "Với điều này, sự chú tâm sơ khởi của người ấy đã được nói đến".
Antosamāpattiyaṃ tathā ābhogābhāve kasmā ‘‘jhānasaññāyapī’’ti vuttanti āha ‘‘abhibhavana…pe… atthī’’ti.
As for why it was stated "even with jhāna perception" when such attention is not possible within the attainment, it says " overcoming…etc…exists."
Vì không có sự chú tâm như vậy trong nội thiền định (samāpatti), tại sao lại nói "jhānasaññāyapī" (cả với tưởng thiền)? Để giải đáp, đã nói " abhibhavana…pe… atthī" (chế ngự...v.v...có).
Bahiddhāva uppannanti bahiddhā vatthusmiṃyeva uppannaṃ.
" Arisen externally" means arisen only in an external object.
Bahiddhāva uppanna có nghĩa là chỉ phát sinh trên đối tượng bên ngoài.
Abhidhamme pana ‘‘ajjhattaṃ arūpasaññī bahiddhā rūpāni passati parittāni suvaṇṇadubbaṇṇāni…pe… appamāṇāni suvaṇṇadubbaṇṇānī’’ti (dha. sa. 220) evaṃ catunnaṃ abhibhāyatanānaṃ āgatattā abhidhammaṭṭhakathāyaṃ (dha. sa. aṭṭha. 204) ‘‘kasmā pana ‘yathā suttante ajjhattaṃ rūpasaññī eko bahiddhā rūpāni passati parittānītiādi vuttaṃ, evaṃ avatvā idha catūsupi abhibhāyatanesu ajjhattaṃ arūpasaññitāva vuttā’ti codanaṃ katvā ‘ajjhattarūpānaṃ anabhibhavanīyato’ti kāraṇaṃ vatvā, tattha vā hi idha vā bahiddhā rūpāneva abhibhavitabbāni, tasmā tāni niyamato vattabbānīti tatrāpi idhāpi vuttāni.
However, in the Abhidhamma, since the four abhibhāyatanas are mentioned as: "Being unperceptive of form internally, he sees external forms, small, beautiful or ugly…etc…large, beautiful or ugly," a question is raised in the Abhidhamma Commentary (dha. sa. aṭṭha. 204): "Why is it, without saying here 'being perceptive of form internally, he sees external forms, small,' etc., as stated in the Suttanta, only internal unperceptiveness of form mentioned for all four abhibhāyatanas?" And giving the reason, 'because internal forms are not to be overcome,' it is said: "For both there and here, it is only external forms that are to be overcome. Therefore, they must necessarily be spoken of, and thus they are mentioned both there and here.
Tuy nhiên, trong Abhidhamma, do bốn loại abhibhāyatana (thắng xứ) được nói đến như "ajjhattaṃ arūpasaññī bahiddhā rūpāni passati parittāni suvaṇṇadubbaṇṇāni…pe… appamāṇāni suvaṇṇadubbaṇṇānī" (dhammasaṅgaṇī 220), nên trong Abhidhammaṭṭhakathā (dhammasaṅgaṇī aṭṭhakathā 204) đã đặt câu hỏi: "Tại sao không nói 'ajjhattaṃ rūpasaññī eko bahiddhā rūpāni passati parittānī' (một người có tưởng về sắc bên trong thấy các sắc bên ngoài nhỏ bé) như đã nói trong các kinh (suttanta), mà ở đây chỉ nói về 'ajjhattaṃ arūpasaññitā' (không có tưởng về sắc bên trong) trong cả bốn abhibhāyatana?" Sau đó, đưa ra lý do "ajjhattarūpānaṃ anabhibhavanīyato" (vì các sắc bên trong không thể bị chế ngự), và nói rằng: "Dù ở đó hay ở đây, chỉ có các sắc bên ngoài mới có thể bị chế ngự. Do đó, chúng nhất thiết phải được nói đến, nên chúng đã được nói đến cả ở đó và ở đây.
‘Ajjhattaṃ rūpasaññī’ti idaṃ pana satthu desanāvilāsamattamevā’’ti vuttaṃ.
But the phrase 'being perceptive of form internally' is merely a stylistic flourish of the Teacher's discourse."
Tuy nhiên, câu 'Ajjhattaṃ rūpasaññī' chỉ là một phong cách thuyết giảng của Đức Phật."
Ettha ca vaṇṇābhogarahitāni, sahitāni ca sabbāni parittāni ‘‘parittāni suvaṇṇadubbaṇṇānī’’ti vuttāni, tathā appamāṇāni ‘‘appamāṇāni suvaṇṇadubbaṇṇānī’’ti.
Here, all small forms, both those without color attention and those with it, are called "small, beautiful or ugly." Similarly, all large forms are called "large, beautiful or ugly."
Ở đây, tất cả các sắc nhỏ bé không có sự chú tâm vào màu sắc và có sự chú tâm vào màu sắc đều được gọi là "parittāni suvaṇṇadubbaṇṇānī" (nhỏ bé, có màu đẹp và xấu), và tương tự, các sắc vô lượng được gọi là "appamāṇāni suvaṇṇadubbaṇṇānī" (vô lượng, có màu đẹp và xấu).
Atthi hi so pariyāyo parittāni abhibhuyya tāni ce kadāci vaṇṇavasena ābhujitāni honti, suvaṇṇadubbaṇṇāni abhibhuyyāti.
For there is such a method: having overcome small forms, if those are sometimes attended to by way of color, then having overcome beautiful or ugly forms.
Thật vậy, có một phương pháp mà sau khi chế ngự các sắc nhỏ bé, nếu đôi khi chúng được chú tâm theo màu sắc, thì đó là chế ngự các sắc có màu đẹp và xấu.
Pariyāyakathā hi suttantadesanāti.
For the Suttanta discourse is a discourse by way of method.
Thật vậy, lời dạy trong kinh (suttanta) là một phương pháp thuyết giảng.
Abhidhamme (dha. sa. 222) pana nippariyāyadesanattā vaṇṇābhogarahitāni visuṃ vuttāni, tathā sahitāni.
In the Abhidhamma, however, since it is a direct discourse, forms without color attention are mentioned separately, as are those with it.
Trong Abhidhamma (dhammasaṅgaṇī 222), do là lời dạy trực tiếp (nippariyāya), các sắc không có sự chú tâm vào màu sắc được nói riêng, và tương tự, các sắc có sự chú tâm vào màu sắc cũng được nói riêng.
Atthi hi ubhayattha abhibhavanavisesoti.
For there is a distinction in overcoming in both cases.
Thật vậy, có sự khác biệt trong việc chế ngự ở cả hai trường hợp.
Tathā idha pariyāyadesanattā vimokkhānampi abhibhavanapariyāyo atthīti ‘‘ajjhattaṃ rūpasaññī’’tiādinā paṭhamadutiyaabhibhāyatanesu paṭhamavimokkho, tatiyacatutthaabhibhāyatanesu dutiyavimokkho, vaṇṇābhibhāyatanesu tatiyavimokkho ca abhibhavanappavattito saṅgahito.
Similarly, here, since it is a discourse by way of method, there is also a method of overcoming even for the vimokkhas; thus, by "being perceptive of form internally," etc., the first vimokkha in the first and second abhibhāyatanas, the second vimokkha in the third and fourth abhibhāyatanas, and the third vimokkha in the color abhibhāyatanas are included due to their occurrence in overcoming.
Tương tự, ở đây, do là lời dạy theo phương pháp (pariyāya), nên cũng có phương pháp chế ngự các giải thoát (vimokkha). Do đó, giải thoát thứ nhất được bao gồm trong hai abhibhāyatana đầu tiên (ajjhattaṃ rūpasaññī, v.v.), giải thoát thứ hai trong abhibhāyatana thứ ba và thứ tư, và giải thoát thứ ba trong các abhibhāyatana về màu sắc, vì chúng đều liên quan đến sự chế ngự.
Abhidhamme pana nippariyāyadesanattā vimokkhābhibhāyatanāni asaṅkarato dassetuṃ vimokkhe vajjetvā abhibhāyatanāni kathitāni; sabbāni ca vimokkhakiccāni jhānāni vimokkhadesanāyaṃ vuttāni.
In the Abhidhamma, however, since it is a direct discourse, to show the vimokkhas and abhibhāyatanas without admixture, the abhibhāyatanas are spoken of, omitting the vimokkhas; and all jhānas that are functions of vimokkha are mentioned in the discourse on vimokkha.
Tuy nhiên, trong Abhidhamma, do là lời dạy trực tiếp (nippariyāya), để trình bày các giải thoát (vimokkha) và abhibhāyatana (thắng xứ) một cách không lẫn lộn, các abhibhāyatana đã được nói đến mà không bao gồm các giải thoát; và tất cả các thiền định có chức năng giải thoát đều được nói đến trong phần thuyết giảng về giải thoát.
Tadetaṃ ‘‘ajjhattaṃ rūpasaññī’’ti āgatassa abhibhāyatanadvayassa abhidhamme abhibhāyatanesu avacanato ‘‘rūpī rūpāni passatī’’tiādīnañca sabbavimokkhakiccasādhāraṇavacanabhāvato vavatthānaṃ katanti viññāyati.
It is thus understood that this classification has been made because the two abhibhāyatanas mentioned as "being perceptive of form internally" are not mentioned among the abhibhāyatanas in the Abhidhamma, and because "perceptive of form sees forms," etc., are common statements for all vimokkha functions.
Do đó, có thể hiểu rằng sự phân biệt này đã được thực hiện vì hai abhibhāyatana được nói đến là "ajjhattaṃ rūpasaññī" không được đề cập trong các abhibhāyatana của Abhidhamma, và vì các câu như "rūpī rūpāni passatī" (người có sắc thấy các sắc) là những câu chung cho tất cả các chức năng giải thoát.
‘‘Ajjhattarūpānaṃ anabhibhavanīyato’’ti idaṃ katthacipi ‘‘ajjhattaṃ rūpāni passatī’’ti avatvā sabbattha yaṃ vuttaṃ ‘‘bahiddhā rūpāni passatī’’ti, tassa kāraṇavacanaṃ, tena yaṃ aññahetukaṃ, taṃ tena hetunā vuttaṃ.
The statement "because internal forms are not to be overcome" is the reason for what is stated everywhere as "sees external forms," without ever saying "sees internal forms" anywhere; thereby showing that what is due to another cause is stated with that cause.
Câu "Ajjhattarūpānaṃ anabhibhavanīyato" (vì các sắc bên trong không thể bị chế ngự) là lời giải thích lý do tại sao không bao giờ nói "ajjhattaṃ rūpāni passatī" (thấy các sắc bên trong) mà luôn nói "bahiddhā rūpāni passatī" (thấy các sắc bên ngoài) ở khắp mọi nơi. Do đó, điều gì có nguyên nhân khác thì được nói đến với nguyên nhân đó.
Yaṃ pana desanāvilāsahetukaṃ ajjhattaṃ arūpasaññitāya eva abhidhamme (dha. sa. 223) vacanaṃ, na tassa aññaṃ kāraṇaṃ maggitabbanti dasseti.
But what is due to a stylistic flourish, the mention of "unperceptive of form internally" in the Abhidhamma, does not require seeking another cause for it.
Tuy nhiên, điều này cho thấy rằng không cần tìm nguyên nhân nào khác cho việc chỉ nói về sự không có tưởng về sắc bên trong (ajjhattaṃ arūpasaññitāya) trong Abhidhamma (dhammasaṅgaṇī 223), điều mà có nguyên nhân là phong cách thuyết giảng.
Ajjhattarūpānaṃ anabhibhavanīyatā ca tesaṃ bahiddhā rūpānaṃ viya abhūtattā.
And the unovercomableness of internal forms is due to their not being manifest like external forms.
Sự không thể chế ngự các sắc bên trong là do chúng không hiển lộ rõ ràng như các sắc bên ngoài.
Desanāvilāso ca yathāvuttavavatthānavasena veditabbo veneyyajjhāsayavasena vijjamānapariyāyakathābhāvato.
The stylistic flourish should be understood by way of the aforementioned classification, because it is a discourse by way of method existing according to the disposition of those to be trained.
Và phong cách thuyết giảng cần được hiểu theo sự phân biệt đã nói ở trên, do có lời dạy theo phương pháp tùy thuộc vào khuynh hướng của người được giáo hóa.
‘‘Suvaṇṇadubbaṇṇānī’’ti eteneva siddhattā na nīlādi abhibhāyatanāni vattabbānīti ce?
If it is argued that blue, etc., abhibhāyatanas need not be mentioned since it is already established by "beautiful or ugly,"
Nếu nói rằng các abhibhāyatana về màu xanh, v.v., không cần phải nói đến vì đã được bao hàm trong "suvaṇṇadubbaṇṇānī" (có màu đẹp và xấu), thì sao?
Taṃ na, nīlādīsu katādhikārānaṃ nīlādibhāvasseva abhibhavanakāraṇattā.
that is not so, because for those who have developed proficiency in blue, etc., the very nature of blue, etc., is the cause of overcoming.
Điều đó không đúng, vì đối với những người đã thực hành về màu xanh, v.v., chính bản chất của màu xanh, v.v., là nguyên nhân của sự chế ngự.
Na hi tesaṃ parisuddhāparisuddhavaṇṇānaṃ parittatā, appamāṇatā vā abhibhavanakāraṇaṃ, atha kho nīlādibhāvo evāti.
For their smallness or largeness of pure or impure colors is not the cause of overcoming, but rather the very nature of blue, etc.
Thật vậy, sự nhỏ bé hay vô lượng của các màu sắc tinh khiết hay không tinh khiết không phải là nguyên nhân của sự chế ngự, mà chính bản chất của màu xanh, v.v., mới là nguyên nhân.
Etesu ca parittādikasiṇarūpesu yaṃ yaṃ caritassa imāni abhibhāyatanāni ijjhanti, taṃ dassetuṃ ‘‘imesu panā’’tiādi vuttaṃ.
And to show for which type of practitioner among these small and other kasiṇa forms these abhibhāyatanas are successful, " among these, however" and so forth, is stated.
Và để cho thấy abhibhāyatana nào thành tựu cho người hành thiền đối với từng loại sắc kasiṇa nhỏ bé, v.v., đã nói " imesu panā" (trong số đó thì) v.v.
183. Ādikehīti evamādīhi mittāmaccasuhajjāhi.
183. Ādikehi means with friends, acquaintances, and well-wishers, and so on.
183. Ādikehī (và những người khác) nghĩa là bởi những người bạn, quan chức, thân hữu và những người tương tự.
Piyāyitabbato piyehi. Manavaḍḍhanato manāpehi.
Piyehi (with the dear ones) means due to being beloved. Manāpehi (with the delightful ones) means due to gladdening the mind.
Do được yêu quý nên là piyehi (những người thân yêu). Do làm tăng trưởng tâm nên là manāpehi (những người dễ thương).
Jātiyāti jātianurūpagamanena.
Jātiyā means by going according to one's birth/species.
Jātiyā (do chủng loại) nghĩa là do sự phù hợp với chủng loại.
Nānābhāvo visuṃbhāvo asambaddhabhāvo.
Nānābhāvo (being separate) means being distinct, being disconnected.
Nānābhāvo (sự khác biệt) là trạng thái riêng biệt, không liên quan.
Maraṇena vinābhāvoti cutiyā tenattabhāvena apunarāvattanato vippayogo.
Maraṇena vinābhāvo (separation by death) means disunion due to passing away with that existence, without returning to it.
Maraṇena vinābhāvo (sự chia lìa do cái chết) nghĩa là sự chia cách do cái chết, không tái sinh trở lại trong trạng thái hiện hữu đó.
Bhavena aññathābhāvoti bhavantaraggahaṇena purimākārato aññākāratā ‘‘kāmāvacarasatto rūpāvacaro hotī’’tiādinā, tatthāpi ‘‘manusso devo hotī’’tiādināpi yojetabbo.
Bhavena aññathābhāvo (alteration by existence) means having a different state from the previous one by taking another existence, as in "a sentient being in the sense-sphere becomes a being in the fine-material sphere," and in that context also, it should be connected with "a human becomes a deva," and so on.
Bhavena aññathābhāvo (sự thay đổi trạng thái do kiếp sống) nghĩa là do thọ nhận một kiếp sống khác, trạng thái khác với trạng thái trước, như “một chúng sinh dục giới trở thành một chúng sinh sắc giới”, và ở đó cũng có thể kết hợp với “một người trở thành một vị trời” và các câu tương tự.
Kutettha labbhāti kuto kuhiṃ kismiṃ nāma ṭhāne ettha etasmiṃ khandhappavatte ‘‘yaṃ taṃ jātaṃ…pe… mā palujjī’’ti laddhuṃ sakkā.
Kutettha labbhā (whence can it be obtained here?) means where, in what place, within this continuous cycle of aggregates, is it possible to obtain "that which is born... (etc.)... may it not perish"?
Kutettha labbhā (làm sao có thể đạt được ở đây) nghĩa là ở đâu, tại nơi nào trong dòng tương tục của các uẩn này, “cái đã sinh ra…pe… không bị hủy hoại” có thể đạt được.
Na sakkā eva tādisassa kāraṇassa abhāvatoti āha ‘‘netaṃ ṭhānaṃ vijjatī’’ti.
It is certainly not possible due to the absence of such a cause, and so it is said: netaṃ ṭhānaṃ vijjatī (this is not possible).
Vì không có nguyên nhân để ước nguyện như vậy, nên Đức Phật nói: “Điều đó không thể xảy ra.”
Evaṃ acchariyabbhutadhammaṃ tathāgatassāpi sarīraṃ, kimaṅgaṃ pana aññesanti adhippāyo.
The intent is: if the body of the Tathāgata, possessing such amazing and wonderful qualities, cannot be wished not to perish, how much more so for others?
Thân của Như Lai, với những pháp kỳ diệu và phi thường như vậy, còn không thể ước nguyện cho không hoại diệt, huống chi thân của những người khác? Đó là ý nghĩa.
‘‘Paccāvamissatī’’ti netaṃ ṭhānaṃ vijjati satiṃ sūpaṭṭhitaṃ katvā ñāṇena paricchinditvā āyusaṅkhārānaṃ ossaṭṭhattā, buddhakiccassa ca pariyosāpitattā.
"I will devour it again" (Paccāvamissatī)—this is not possible because the life-constituents have been relinquished after establishing mindfulness well and discerning with wisdom, and because the Buddha's task has been completed.
“Sẽ thọ nhận lại” – điều đó không thể xảy ra, vì sau khi an trú chánh niệm vững chắc, dùng trí tuệ suy xét và từ bỏ thọ hành (āyusaṅkhāra), và vì Phật sự đã được hoàn tất.
Na hettha māsattayato paraṃ buddhaveneyyā labbhantīti.
For here, after three months, no more individuals to be guided by the Buddha can be found.
Vì từ ba tháng sau đó, không còn những chúng sinh cần được Đức Phật tự thân giáo hóa nữa.
186. Nāgāpalokitanti nāgassa viya apalokitaṃ, hatthināgassa apalokanasadisaṃ apalokananti attho.
186. Nāgāpalokita (elephant-gaze) means a looking back like that of an elephant, that is, a looking back similar to the looking back of a royal elephant.
Nāgāpalokita có nghĩa là nhìn lại như voi chúa (nāga), tức là cái nhìn lại giống như voi chúa nhìn lại.
Āhaccāti phusitvā.
Āhaccā means having touched.
Āhaccā là chạm vào, tiếp xúc.
Aṅkusakalaggāni viyāti aṅkusakāni viya aññamaññasmiṃ laggāni āsattāni hutvā ṭhitāni.
Aṅkusakalaggāni viyā means as if fastened to each other like goad-hooks.
Aṅkusakalaggāni viyā có nghĩa là như những chiếc móc câu (aṅkusa) móc vào nhau, dính chặt vào nhau.
Ekābaddhānīti aññamaññaṃ ekato ābaddhāni.
Ekābaddhānī means bound together as one.
Ekābaddhānī là buộc chặt lại với nhau.
Tasmāti gīvaṭṭhīnaṃ ekagghanānaṃ viya ekābaddhabhāvena, na kevalaṃ gīvaṭṭhīnaṃyeva, atha kho sabbānipi tāni buddhānaṃ ṭhapetvā bāhusandhiādikā dvādasa mahāsandhiyo, aṅgulisandhiyo ca itarasandhīsu ekābaddhāni hutvā ṭhitāni, yato nesaṃ pakatihatthīnaṃ koṭisahassabalappamāṇaṃ kāyabalaṃ hoti.
Tasmā (therefore) means because the neck bones are bound together as one, as if in a single block; and not only the neck bones, but all the bones of the Buddhas, except for the twelve major joints such as the shoulder joints and the finger joints, stand bound together as one in the other joints, because their bodily strength is equal to the strength of thousands of millions of ordinary elephants.
Tasmā là vì các xương cổ được nối liền như một khối, không chỉ các xương cổ mà tất cả các xương của chư Phật, ngoại trừ mười hai khớp lớn như khớp vai và các khớp ngón tay, đều được kết nối chặt chẽ với các khớp khác. Vì thế, sức mạnh thân thể của các Ngài có thể sánh với sức mạnh của hàng ngàn vạn con voi bình thường.
Vesālinagarābhimukhaṃ akāsi kaṇṭakaparivattane viya kapilanagarābhimukhaṃ.
Vesālinagarābhimukhaṃ akāsi (he faced the city of Vesāli) as if turning towards Kapilavastu, like the turning of the horse Kaṇṭhaka.
Vesālinagarābhimukhaṃ akāsi là xoay mặt về thành Vesālī, giống như việc xoay mặt về Kapilavatthu khi cưỡi ngựa Kaṇṭaka.
Yadi evaṃ kathaṃ taṃ nāgāpalokitaṃ nāma jātaṃ?
If so, how did that become known as the elephant-gaze?
Nếu vậy, tại sao lại gọi đó là Nāgāpalokita?
Tadajjhāsayaṃ upādāya.
By reason of his intention.
Do ý định của Ngài.
Bhagavā hi nāgāpalokitavaseneva apaloketukāmo jāto, puññānubhāvena panassa patiṭṭhitaṭṭhānaṃ parivatti, tena taṃ ‘‘nāgāpalokitaṃ’’ tveva vuccati.
For the Bhagavā intended to look back in the manner of an elephant-gaze, but by the power of his merit, the place where he stood turned; hence it is called "Nāgāpalokita."
Đức Thế Tôn thực sự muốn nhìn lại theo cách Nāgāpalokita, nhưng do phước báu của Ngài, nơi Ngài đứng đã xoay chuyển. Vì vậy, điều đó được gọi là "Nāgāpalokita".
‘‘Idaṃ pacchimakaṃ ānanda tathāgatassa vesāliyā dassana’’nti nayidaṃ vesāliyā apalokanassa kāraṇavacanaṃ anekantikattā, bhūtakathanamattaṃ panetaṃ.
"This, Ānanda, is the Tathāgata's last sight of Vesāli"—this is not a causal statement for looking back at Vesāli, because it is not exclusive; it is merely a statement of fact.
“Này Ānanda, đây là lần cuối Như Lai nhìn thấy Vesālī” – đây không phải là lời nói về nguyên nhân của việc nhìn lại Vesālī vì nó không phải là một nguyên nhân duy nhất; đây chỉ là một lời thuật lại sự thật.
Maggasodhanavasena taṃ dassetvā aññadevettha apalokanakāraṇaṃ dassetukāmo ‘‘nanu cā’’tiādimāha.
Having shown that by way of clarifying the path, the commentator, wishing to show another reason for looking back, says nanu cā (but is it not...?) and so on.
Sau khi chỉ ra điều đó theo cách làm rõ con đường, để chỉ ra một nguyên nhân khác cho việc nhìn lại ở đây, Đức Phật nói: “Chẳng phải vậy sao?” và tiếp theo.
Taṃ taṃ sabbaṃ pacchimadassanameva anukkamena kusināraṃ gantvā parinibbātukāmatāya tato tato nikkhantattā.
Taṃ taṃ sabbaṃ pacchimadassanameva (all that was the last sight) because he departed from various places with the intention of proceeding gradually to Kusinārā and attaining Parinibbāna.
Tất cả những lần nhìn lại đó đều là lần nhìn cuối cùng vì Ngài đã tuần tự rời khỏi những nơi đó với ý định đến Kusinārā để nhập Niết Bàn.
‘‘Anacchariyattā’’ti iminā yathāvuttaṃ anekantikattaṃ pariharati, tayidaṃ sodhanamattaṃ.
Anacchariyattā (because it is not extraordinary)—with this, he dismisses the aforementioned non-exclusivity; this is merely a clarification.
Với từ “anacchariyattā” (không phải là điều kỳ diệu), Ngài bác bỏ tính không duy nhất đã được nói đến, và đây chỉ là sự làm rõ.
Idaṃ panettha aviparītaṃ kāraṇanti dassetuṃ ‘‘apicā’’tiādi vuttaṃ.
To show that this is the correct reason in this context, apicā (furthermore) and so on was stated.
Để chỉ ra rằng đây là nguyên nhân không sai lạc ở đây, Đức Phật đã nói “apicā” (hơn nữa) và tiếp theo.
Na hi bhagavā sāpekkho vesāliṃ apalokesi, ‘‘idaṃ pana me gamanaṃ apunarāgamana’’nti dassanamukhena bahujanahitāya bahujanasukhāya lokānukampāya apalokesi.
For the Bhagavā did not look back at Vesāli with attachment, but he looked back for the welfare of many, for the happiness of many, out of compassion for the world, by way of showing, "this departure of mine is a non-return."
Đức Thế Tôn không nhìn lại Vesālī với sự luyến tiếc, mà Ngài nhìn lại qua việc chỉ ra rằng “chuyến đi này của ta là không trở lại” vì lợi ích của nhiều người, vì hạnh phúc của nhiều người, và vì lòng bi mẫn đối với thế gian.
Tenāha ‘‘apica vesālirājāno’’tiādi.
Therefore, it is said: apica vesālirājāno (furthermore, the rulers of Vesāli) and so on.
Vì thế, Đức Phật nói: “Hơn nữa, các vị vua Vesālī…” và tiếp theo.
187. Mahāokāseti mahante okāse.
187. Mahāokāse means in a great expanse.
Mahāokāse có nghĩa là trong một không gian rộng lớn.
Mahantāni dhammassa patiṭṭhāpanaṭṭhānāni.
These are great places for the establishment of the Dhamma.
Những nơi rộng lớn để an lập Pháp.
Yesu patiṭṭhāpito dhammo nicchīyati asandehato, kāni pana tāni?
By which the Dhamma, when established, is determined without doubt. What are these?
Những nơi mà Pháp được an lập có thể được xác định không nghi ngờ gì. Vậy đó là những nơi nào?
Āgamanavisiṭṭhāni suttotaraṇādīni.
They are distinguished by their origin, such as being brought down from the suttas.
Đó là những lời dạy đặc biệt từ kinh điển (āgama) như Suttotaraṇa, v.v.
Dutiyavikappe apadisantīti apadesā, ‘‘sammukhā metaṃ āvuso bhagavato suta’’ntiādinā kenaci ābhatassa ‘‘dhammo’’ti vinicchinane kāraṇaṃ.
In the second interpretation, they are apadesā (authorities) because they point to something; they are the reasons for determining something brought forth by someone, such as "Friend, I heard this directly from the Bhagavā," to be Dhamma.
Trong lựa chọn thứ hai, apadesā là những điều được chỉ ra (apadisantīti), là nguyên nhân để xác định một lời nói nào đó là "Pháp" khi được ai đó mang đến, ví dụ: "Này chư hiền, tôi đã nghe điều này trực tiếp từ Đức Thế Tôn."
Kiṃ pana tanti?
And what is that?
Vậy điều đó là gì?
Tassa yathābhatassa suttotaraṇādi eva.
It is the bringing down from the suttas, etc., of that which was brought forth as it was.
Chính là Suttotaraṇa, v.v., của lời nói được mang đến như vậy.
Yadi evaṃ kathaṃ cattāroti?
If so, how are there four?
Nếu vậy, tại sao lại có bốn?
Yasmā dhammassa dve samparāyā satthā, sāvakā ca, tesu ca sāvakā saṅghagaṇapuggalavasena tividhā, evaṃ ‘‘tumhākaṃ mayā yaṃ dhammo paṭiggahito’’ti apadisitabbānaṃ bhedena cattāro.
Because the Dhamma has two resorts: the Teacher and the disciples. Among these, the disciples are of three kinds: Saṅgha, a group, and an individual. Thus, there are four by the distinction of those to whom it should be attributed, such as "This Dhamma which I have received from you."
Vì Pháp có hai nơi nương tựa (samparāya): Bậc Đạo Sư (satthā) và các đệ tử (sāvakā). Trong số các đệ tử, có ba loại theo nhóm Tăng (saṅgha), nhóm đông Tỳ Khưu (gaṇa) và cá nhân (puggala). Như vậy, có bốn loại dựa trên sự phân loại của những người cần được chỉ ra rằng "Pháp mà các vị đã thọ nhận từ ta".
Tenāha ‘‘sammukhā me taṃ āvuso bhagavato suta’’ntiādi.
Therefore, it is said: "Friend, I heard this directly from the Bhagavā," and so on.
Vì vậy, Đức Phật đã nói: "Này chư hiền, tôi đã nghe điều này trực tiếp từ Đức Thế Tôn" và tiếp theo.
Tathā ca vuttaṃ nettiyaṃ ‘‘cattāro mahāpadesā buddhāpadeso saṅghāpadeso sambahulattherāpadeso ekattherāpadeso.
And so it is said in the Nettiya: "The four great authorities are the Buddha-authority, the Saṅgha-authority, the authority of many elders, and the authority of a single elder. These are the four great authorities."
Như đã nói trong Nettiya: "Tứ đại giáo pháp là Giáo pháp của Đức Phật (Buddhāpadesa), Giáo pháp của Tăng đoàn (Saṅghāpadesa), Giáo pháp của nhiều vị Thượng tọa (Sambahulattherāpadesa), Giáo pháp của một vị Thượng tọa (Ekattherāpadesa). Đây là Tứ đại giáo pháp."
Ime cattāro mahāpadesā’’ti (netti. 18) buddho apadeso etassāti buddhāpadeso. Esa nayo sesesupi.
Buddhāpadeso (Buddha-authority) means the Buddha is its authority. The same method applies to the rest.
Buddhāpadeso là điều mà Đức Phật là nơi nương tựa (apadesa) của nó. Tương tự cho các trường hợp còn lại.
Tenāha ‘‘buddhādayo…pe… mahākāraṇānī’’ti.
Therefore, it is said: buddhādayo...pe... mahākāraṇānī (the Buddha and so on... great causes).
Vì vậy, Đức Phật đã nói: “Buddhādayo…pe… mahākāraṇānī” (Đức Phật và những vị khác… v.v… là những nguyên nhân lớn).
188. Neva abhinanditabbanti na sampaṭicchitabbaṃ.
188. Neva abhinanditabbaṃ (should not be rejoiced in) means should not be accepted.
Neva abhinanditabbaṃ có nghĩa là không nên chấp nhận.
Ganthassa sampaṭicchanaṃ nāma savananti āha ‘‘na sotabba’’nti.
Accepting a text means listening to it, and so it is said, na sotabbaṃ (should not be heard).
Sự chấp nhận kinh điển là lắng nghe, vì vậy Đức Phật nói: “Na sotabbaṃ” (không nên nghe).
Padabyañjanānīti padāni ca byañjanāni ca, atthapadāni, byañjanapadāni cāti attho.
Padabyañjanānī means words and syllables, that is, words of meaning and words of expression.
Padabyañjanānī là các từ (pada) và các chữ cái (byañjana), tức là các từ ngữ ý nghĩa (atthapada) và các từ ngữ biểu âm (byañjanapada).
Pajjati attho etehīti padāni, akkharādīni byañjanapadāni.
They make known the meaning, so they are padāni (words); syllables and so on are words of expression.
Padāni là những gì mà ý nghĩa (attha) được phát sinh từ chúng, tức là các chữ cái (akkhara) và các từ ngữ biểu âm (byañjanapada).
Pajjitabbato padāni, saṅkāsanādīni atthapadāni.
They are to be made known, so they are padāni (words); conveying and so on are words of meaning.
Padāni là những gì cần được phát sinh, tức là các từ ngữ ý nghĩa (atthapada) như saṅkāsana, v.v.
Aṭṭhakathāyaṃpana ‘‘‘padasaṅkhātāni byañjanānī’ti byañjanapadāneva vuttānī’’ti keci, taṃ na, atthaṃ byañjentīti byañjanāni, byañjanapadāni, tehi byañjitabbato byañjanāni, atthapadānīti ubhayasaṅgahato.
However, some say in the Aṭṭhakathā: "'Syllables designated as words' thus refers only to words of expression." That is not so, because they manifest the meaning, they are byañjanāni (expressions), words of expression, and because they are to be manifested by these, they are byañjanāni (expressions), words of meaning, thus encompassing both.
Tuy nhiên, trong Aṭṭhakathā, một số người nói rằng “‘byañjanāni’ (các chữ cái) được nói đến là ‘padasaṅkhātāni byañjanāni’ (các chữ cái được gọi là từ ngữ biểu âm)”. Điều đó không đúng, vì byañjanāni (các chữ cái) là những gì biểu thị ý nghĩa (atthaṃ byañjentīti), tức là các từ ngữ biểu âm (byañjanapada); và byañjanāni (các chữ cái) là những gì cần được biểu thị bởi chúng, tức là các từ ngữ ý nghĩa (atthapada). Như vậy, cả hai đều được bao gồm.
Imasmiṃ ṭhāneti tenābhatasuttassa imasmiṃ padese.
Imasmiṃ ṭhāne (in this place) means in this section of the sutta brought forth by him.
Imasmiṃ ṭhāne có nghĩa là trong phần này của kinh điển được mang đến.
Pāḷi vuttāti kevalo pāḷidhammo pavatto.
Pāḷi vuttā (the Pāḷi text is stated) means the pure Pāḷi Dhamma is presented.
Pāḷi vuttā có nghĩa là Pháp Pali thuần túy đã được thuyết giảng.
Attho vuttoti pāḷiyā attho pavatto niddiṭṭho.
Attho vutto (the meaning is stated) means the meaning of the Pāḷi text is presented and explained.
Attho vutto có nghĩa là ý nghĩa của Pali đã được thuyết giảng, đã được chỉ rõ.
Anusandhi kathitoti yathāraddhadesanāya, upari desanāya ca anusandhānaṃ kathitaṃ sambandho kathito.
Anusandhi kathito (the connection is recounted) means the connection between the discourse as it began and the subsequent discourse is recounted; the relationship is recounted.
Anusandhi kathito có nghĩa là sự liên kết (anusandhāna) giữa lời dạy đã bắt đầu và lời dạy tiếp theo đã được thuyết giảng, tức là mối liên hệ đã được thuyết giảng.
Pubbāparaṃ kathitanti pubbenāparaṃ avirujjhanañceva visesādhānañca kathitaṃ pakāsitaṃ.
Pubbāparaṃ kathitaṃ (the preceding and succeeding are recounted) means the non-contradiction and specific augmentation between the preceding and succeeding parts are recounted and revealed.
Pubbāparaṃ kathita có nghĩa là sự không mâu thuẫn giữa phần trước và phần sau, và sự bổ sung đặc biệt đã được thuyết giảng, đã được công bố.
Evaṃ pāḷidhammādīni sammadeva sallakkhetvā gahaṇaṃ sādhukaṃ uggahaṇanti āha ‘‘suṭṭhu gahetvā’’ti.
Having thus thoroughly considered and apprehended the Pāḷi Dhamma and so on, good learning is called grasping well, and so it is said, suṭṭhu gahetvā (having grasped well).
Như vậy, sau khi xem xét kỹ lưỡng Pháp Pali và các yếu tố khác, việc thọ trì là sự thọ trì tốt đẹp, vì thế Đức Phật nói: “Suṭṭhu gahetvā” (sau khi thọ trì tốt đẹp).
Sutte otāretabbānīti ñāṇena sutte ogāhetvā tāretabbāni, taṃ pana ogāhetvā taraṇaṃ tattha otaraṇaṃ anuppavesanaṃ hotīti vuttaṃ ‘‘sutte otāretabbānī’’ti.
The phrase " should be inserted into the Suttas" means that with knowledge, they should be entered into the Suttas and brought down. And that bringing down, having entered, means entering there, becoming included, therefore it is said " should be inserted into the Suttas."
Nên được đưa vào kinh tạng có nghĩa là nên được đưa vào sau khi đi sâu vào kinh tạng bằng trí tuệ. Việc đi sâu vào và đưa vào đó là việc đi vào, thâm nhập vào đó, nên đã nói "nên được đưa vào kinh tạng".
Saṃsandetvā dassanaṃ sandassananti āha ‘‘vinaye saṃsandetabbānī’’ti.
The seeing by comparing is called sandassana; therefore it says, " should be compared with the Vinaya."
Việc so sánh và trình bày được gọi là sandassana (sự so sánh), nên đã nói "nên được so sánh với Luật tạng".
Kiṃ pana taṃ suttaṃ, ko vā vinayoti vicāraṇāya ācariyānaṃ matibhedamukhena tamatthaṃ dassetuṃ ‘‘ettha cā’’tiādi vuttaṃ.
To reveal that meaning, through the differing opinions of the teachers, in the inquiry as to what that Sutta is and what the Vinaya is, the phrase " and here" and so on was stated.
Để trình bày ý nghĩa đó thông qua sự khác biệt ý kiến của các vị thầy, nhằm xem xét rằng kinh tạng đó là gì, hay luật tạng là gì, nên đã nói "Ở đây và..." vân vân.
Vinayoti vibhaṅgapāṭhamāha.
Vinaya refers to the Vibhaṅga Pāḷi.
Luật tạng (Vinaya) là chỉ cho phần Vibhaṅga-pāṭha (phần Phân tích).
So hi mātikāsaññitassa suttassa atthasūcanato ‘‘sutta’’nti vattabbataṃ arahati.
For it deserves to be called "Sutta" because it indicates the meaning of the Sutta known as the Mātika.
Vì phần đó làm sáng tỏ ý nghĩa của kinh tạng được gọi là Mātika (đề mục), nên nó xứng đáng được gọi là "sutta" (kinh tạng).
Vividhanayattā, visiṭṭhanayattā ca vinayo, khandhakapāṭho.
And because of its varied methods, and its distinctive methods, the Khandhaka Pāḷi is Vinaya.
Do có nhiều phương pháp (vividhanaya), và do có phương pháp đặc biệt (visiṭṭhanaya), nên phần Khandhaka-pāṭha (phần Các chương) là Luật tạng (Vinaya).
Evanti evaṃ suttavinayesu pariggayhamānesu vinayapiṭakampi na pariyādīyati parivārapāḷiyā asaṅgahitattā.
Thus, even when Sutta and Vinaya are understood in this way, the Vinaya Piṭaka itself is not fully encompassed, as the Parivāra Pāḷi is not included.
Như vậy, khi kinh tạng và luật tạng được hiểu theo cách này, ngay cả Luật tạng (Vinayapiṭaka) cũng không được bao hàm hết, vì phần Parivāra-pāḷi (phần Phụ lục) không được bao gồm.
Suttantābhidhammapiṭakāni vā suttaṃ atthasūcanādiatthasambhavato.
Or, the Suttanta and Abhidhamma Piṭakas are Sutta because of the possibility of meanings such as indicating benefit.
Hoặc, Kinh tạng (Sutta) là Tạng Kinh (Suttantapiṭaka) và Tạng Vi Diệu Pháp (Abhidhammapiṭaka), vì có thể làm sáng tỏ ý nghĩa và các lợi ích khác.
Evampīti ‘‘suttantābhidhammapiṭakāni suttaṃ, vinayapiṭakaṃ vinayo’’ti evaṃ suttavinayavibhāge vuccamānepi.
Even so, even when the division of Sutta and Vinaya is stated as "the Suttanta and Abhidhamma Piṭakas are Sutta, and the Vinaya Piṭaka is Vinaya."
Ngay cả như vậy, tức là ngay cả khi Tạng Kinh và Tạng Vi Diệu Pháp được gọi là kinh tạng, và Tạng Luật được gọi là luật tạng, trong sự phân chia kinh tạng và luật tạng như vậy.
Na tāva pariyādīyantīti na tāva anavasesato pariggayhanti, kasmāti āha ‘‘asuttanāmakañhī’’tiādi.
Are not yet fully encompassed means they are not yet completely included. Why not? It says, " because it has no Sutta designation" and so on.
Vẫn chưa được bao hàm hết (na tāva pariyādīyanti) có nghĩa là vẫn chưa được bao hàm một cách toàn diện. Tại sao? Vì vậy, đã nói "Vì có những lời Phật dạy không mang tên kinh tạng" vân vân.
Yasmā ‘‘sutta’’nti imaṃ nāmaṃ anāropetvā saṅgītampi jātakādibuddhavacanaṃ atthi, tasmā vuttanayena tīṇi piṭakāni na pariyādiṇṇānīti.
Since there is also Buddha-word, such as the Jātaka, which was recited but not given the name "Sutta," therefore, by the method stated, the three Piṭakas are not yet fully encompassed.
Vì có những lời Phật dạy như Jātaka (Bổn Sanh) và các kinh khác đã được kết tập nhưng không mang tên "sutta", nên ba tạng không được bao hàm hết theo cách đã nói.
Suttanipātaudānaitivuttakādīni dīghanikāyādayo viya suttanāmaṃ āropetvā asaṅgītānīti adhippāye panettha jātakādīhi saddhiṃ tānipi gahitāni.
Here, Suttanipāta, Udāna, Itivuttaka, and so on are also included with Jātaka and others, with the intention that they were not recited with the designation "Sutta" like the Dīgha Nikāya and so on.
Ở đây, các kinh như Suttanipāta, Udāna, Itivuttaka và các kinh khác cũng được bao gồm cùng với Jātaka, với ý nghĩa rằng chúng không được kết tập với tên "sutta" như Dīghanikāya và các nikāya khác.
Buddhavaṃsacariyāpiṭakānaṃ panettha aggahaṇe kāraṇaṃ maggitabbaṃ, kiṃ vā tena magganena?
The reason for the non-inclusion of Buddhavaṃsa and Cariyāpiṭaka here should be sought, or what is the purpose of seeking it?
Lý do không bao gồm Buddhavaṃsa (Phật Sử) và Cariyāpiṭaka (Hạnh Tạng) ở đây cần được tìm hiểu, nhưng việc tìm hiểu đó có ích gì?
Sabbopāyaṃ vaṇṇanānayo theravādaṃ dassanamukhena paṭikkhitto evāti.
This entire method of exposition has been rejected through the showing of the Theravāda doctrine.
Toàn bộ phương pháp chú giải này đã bị bác bỏ thông qua việc trình bày quan điểm của Thượng Tọa Bộ (Theravāda) rồi.
Atthīti kiṃ atthi, asuttanāmakaṃ buddhavacanaṃ natthi evāti dasseti.
There is, it shows that there is no Buddha-word without the name "Sutta."
Có (atthīti) có nghĩa là gì? Nó chỉ ra rằng không có lời Phật dạy nào không mang tên kinh tạng.
Tathā hi nidānavaṇṇanāyaṃ (dī. ni. ṭī. 1.paṭhamamahāsaṅgītikathāvaṇṇanā; sārattha. ṭī. 1.paṭhamamahāsaṅgītikathāvaṇṇanā) amhehi vuttaṃ ‘‘suttanti sāmaññavidhi, visesavidhayo pare’’ti.
Thus, we have stated in the Nidāna commentary: "Sutta is the general rule, the others are specific rules."
Thật vậy, trong phần chú giải Nidāna (Dī. Ni. Ṭī. 1.paṭhamamahāsaṅgītikathāvaṇṇanā; Sārattha. Ṭī. 1.paṭhamamahāsaṅgītikathāvaṇṇanā), chúng tôi đã nói: "Sutta là phương pháp chung, những cái khác là phương pháp đặc biệt."
Taṃ sabbaṃ paṭikkhipitvā ‘‘suttanti vinayo’’tiādinā vuttaṃ saṃvaṇṇanānayaṃ ‘‘nāyamattho idhādhippeto’’ti paṭisodhetvā.
Having rejected all that, having purified that method of exposition stated with "Sutta is Vinaya" and so on, saying "this meaning is not intended here."
Bác bỏ tất cả điều đó có nghĩa là bác bỏ phương pháp chú giải đã nói bằng cách nói "Kinh tạng là luật tạng" vân vân, và sửa lại rằng "Ý nghĩa này không được chấp nhận ở đây".
Vineti etena kileseti vinayo, kilesavinayanūpāyo, so eva ca naṃ karotīti kāraṇanti āha ‘‘vinayo pana kāraṇa’’nti.
It disciplines defilements by this, therefore it is Vinaya, a means of disciplining defilements, and it itself does that, therefore it is a cause. Thus it says, " the Vinaya is indeed the cause."
Nó điều phục các phiền não bằng điều này, nên đó là Luật tạng (Vinaya), tức là phương tiện để điều phục các phiền não. Và chính nó thực hiện điều đó, nên đó là nguyên nhân (kāraṇa), vì vậy đã nói "Luật tạng là nguyên nhân".
Dhammeti pariyattidhamme.
In the Dhamma means in the Dhamma of study.
Về Pháp (Dhamme) có nghĩa là về Pháp học (pariyattidhamma).
Sarāgāyāti sarāgabhāvāya kāmarāgabhavarāgaparibrūhanāya.
For attachment means for the state of attachment, for the increase of sensual desire and desire for existence.
Để có tham ái (sarāgāya) là để tăng trưởng tham ái dục và tham ái hữu.
Saññogāyāti bhavasaṃyojanāya.
For bondage means for the fetter of existence.
Để có ràng buộc (saññogāya) là để có sự ràng buộc với các cõi hữu.
Ācayāyāti vaṭṭassa vaḍḍhanatthāya.
For accumulation means for the increase of the round of existence.
Để tích lũy (ācayāya) là để tăng trưởng vòng luân hồi.
Mahicchatāyāti mahicchabhāvāya.
For great desire means for the state of having great desire.
Để có nhiều dục vọng (mahicchatāya) là để có trạng thái nhiều dục vọng.
Asantuṭṭhiyāti asantuṭṭhibhāvāya.
For discontent means for the state of discontent.
Để không biết đủ (asantuṭṭhiyā) là để có trạng thái không biết đủ.
Saṅgaṇikāyāti kilesasaṅgaṇagaṇasaṅgaṇavihārāya.
For sociability means for dwelling in the company of defilements or in the company of groups.
Để có sự giao du (saṅgaṇikāya) là để sống chung với nhóm phiền não và nhóm người.
Kosajjāyāti kusītabhāvāya.
For idleness means for the state of laziness.
Để có sự lười biếng (kosajjāya) là để có trạng thái lười biếng.
Dubbharatāyāti dupposatāya.
For being difficult to support means for being difficult to provide for.
Để khó nuôi (dubbharatāya) là để khó nuôi dưỡng.
Virāgāyāti sakalavaṭṭato virajjanatthāya.
For dispassion means for becoming dispassionate from the entire round of existence.
Để ly tham (virāgāya) là để không còn tham ái đối với toàn bộ vòng luân hồi.
Visaññogāyāti kāmabhavādīhi visaṃyujjanatthāya.
For detachment means for being detached from sensual desires, existence, and so on.
Để không còn ràng buộc (visaññogāya) là để không còn ràng buộc với dục giới, hữu giới, vân vân.
Apacayāyāti sabbassāpi vaṭṭassa apacayanāya, nibbānāyāti attho.
For decrease means for the decrease of all existence, i.e., for Nibbāna.
Để tiêu trừ (apacayāya) là để tiêu trừ tất cả vòng luân hồi, tức là để Niết bàn.
Appicchatāyāti paccayappicchatādivasena sabbaso icchāpagamāya.
For little desire means for the complete absence of desire, in terms of having little desire for requisites and so on.
Để ít dục vọng (appicchatāya) là để hoàn toàn loại bỏ dục vọng theo cách ít dục vọng đối với các vật dụng, vân vân.
Santuṭṭhiyāti dvādasavidhasantuṭṭhibhāvāya.
For contentment means for the state of twelvefold contentment.
Để biết đủ (santuṭṭhiyā) là để có mười hai loại biết đủ.
Pavivekāyāti pavivittabhāvāya, kāyavivekāditadaṅgavivekādivivekasiddhiyā.
For seclusion means for the state of seclusion, for the attainment of seclusion such as physical seclusion and seclusion by way of suppression.
Để có sự độc cư (pavivekāya) là để có trạng thái độc cư, đạt được sự độc cư thân, độc cư từng phần, vân vân.
Vīriyārambhāyāti kāyikassa ceva, cetasikassa ca vīriyassa paggahaṇatthāya.
For the exertion of effort means for the exertion of bodily and mental effort.
Để tinh tấn (vīriyārambhāya) là để phát huy tinh tấn thân và tinh tấn tâm.
Subharatāyāti sukhaposanatthāya.
For being easy to support means for being easy to provide for.
Để dễ nuôi (subharatāya) là để dễ nuôi dưỡng.
Evaṃ yo pariyattidhammo uggahaṇadhāraṇaparipucchāmanasikāravasena yoniso paṭipajjantassa sarāgādibhāvaparivajjanassa kāraṇaṃ hutvā virāgādibhāvāya saṃvattati, ekaṃsato eso dhammo.
Thus, the Dhamma of study, which becomes a cause for one who practices correctly in terms of learning, retaining, questioning, and wise attention, to avoid the state of craving and so on, and conduces to the state of dispassion and so on, is unequivocally this Dhamma.
Như vậy, Pháp học nào là nguyên nhân để người thực hành đúng đắn theo cách học hỏi, ghi nhớ, hỏi han và tác ý đúng đắn, tránh xa trạng thái có tham ái, vân vân, và dẫn đến trạng thái ly tham, vân vân, thì một cách chắc chắn Pháp này là Pháp.
Eso vinayo, sammadeva apāyādīsu apatanavasena dhāraṇato, kilesānaṃ vinayanato, satthu sammāsambuddhassa ovādānusiṭṭhibhāvato etaṃ satthusāsananti dhāreyyāsi jāneyyāsi, avabujjheyyāsīti attho.
This Vinaya, which sustains one from falling into woeful states and so on by not falling, disciplines defilements, and is the advice and instruction of the Fully Enlightened Teacher, you should bear in mind that this is the Teacher's teaching, meaning you should know and understand it.
Luật này là Luật, do giữ gìn không rơi vào các khổ cảnh, vân vân, do điều phục các phiền não, và do là lời khuyên răn, giáo huấn của Bậc Đạo Sư Chánh Đẳng Giác. Ngươi nên ghi nhớ giáo pháp của Bậc Đạo Sư này, tức là nên biết, nên hiểu.
Catusaccassa sūcanaṃ suttanti āha ‘‘sutteti tepiṭake buddhavacane’’ti.
He says "in the Sutta" means in the three Piṭakas of the Buddha-word because it indicates the Four Noble Truths.
Kinh tạng là sự chỉ rõ Tứ Diệu Đế, nên đã nói "trong kinh tạng, tức là trong lời Phật dạy ba tạng".
Tepiṭakañhi buddhavacanaṃ saccavinimuttaṃ natthi.
Indeed, there is no Buddha-word in the three Piṭakas that is devoid of the Truths.
Vì lời Phật dạy ba tạng không có gì tách rời Tứ Diệu Đế.
Rāgādivinayanakāraṇaṃ tathāgatena suttapadena pakāsitanti āha ‘‘vinayeti etasmiṃ rāgādivinayakāraṇe’’ti.
He says "in the Vinaya" means in this cause of disciplining craving and so on because the cause for disciplining craving and so on has been expounded by the Tathāgata with the term "Sutta."
Đức Như Lai đã tuyên bố nguyên nhân điều phục tham ái, vân vân, bằng từ "sutta", nên đã nói "trong luật tạng, tức là trong nguyên nhân điều phục tham ái, vân vân này".
Sutte osaraṇañcettha tepiṭake buddhavacane pariyāpannatāvaseneva veditabbaṃ, na aññathāti āha ‘‘suttapaṭipāṭiyā katthaci anāgantvā’’ti.
Here, insertion into the Sutta should be understood as inclusion within the three Piṭakas of the Buddha-word, and not otherwise. Thus, it says, " without coming in any Sutta sequence."
Ở đây, việc đi vào kinh tạng nên được hiểu là chỉ thông qua việc bao gồm trong lời Phật dạy ba tạng, chứ không phải cách khác, nên đã nói "không xuất hiện ở bất cứ đâu trong chuỗi kinh tạng".
Challiṃ uṭṭhapetvāti arogassa mahato rukkhassa tiṭṭhato upakkamena challiyā sakalikāya, papaṭikāya vā uṭṭhapanaṃ viya arogassa sāsanadhammassa tiṭṭhato byañjanamattena tappariyāpannaṃ viya hutvā challisadisaṃ pubbāparaviruddhatādidosaṃ uṭṭhapetvā paridīpetvā, tādisāni pana ekaṃsato guḷhavessantarādipariyāpannāni hontīti āha ‘‘guḷhavessantara…pe…paññāyantīti attho’’ti.
Having peeled off the bark means, just as one peels off flakes or strips of bark from a healthy, large tree by effort while it stands, so too, from the sound Dhamma of the Dispensation while it stands, having produced and revealed a defect similar to bark, such as inconsistency between earlier and later statements, by mere expression as if it were included in it. Such statements are unequivocally included in the Guḷhavessantara Jātaka and so on. Thus, he says, " the meaning is manifest."
Lột vỏ cây có nghĩa là, giống như việc lột vỏ cây hay mảnh vỏ của một cây lớn khỏe mạnh đang đứng bằng nỗ lực, thì việc làm phát sinh và trình bày lỗi lầm như sự mâu thuẫn trước sau, giống như việc một phần của giáo pháp khỏe mạnh đang tồn tại được coi là bao gồm trong đó chỉ bằng từ ngữ. Những điều như vậy chắc chắn thuộc về các kinh ẩn như Guḷhavessantara, vân vân, nên đã nói "có nghĩa là Guḷhavessantara... vân vân... được biết đến".
Rāgādivinayeti rāgādīnaṃ vinayanatthe.
In disciplining craving and so on means for the purpose of disciplining craving and so on.
Trong sự điều phục tham ái, vân vân có nghĩa là trong ý nghĩa điều phục tham ái, vân vân.
Tadākāratāya na paññāyamānāni na dissamānāni chaḍḍetabbāni vajjitabbāni na gahetabbāni.
Not appearing in that form, not seen, should be rejected, should be avoided, should not be taken.
Những điều không được nhận thức (na paññāyamānāni) hoặc không được thấy (na dissamānāni) theo hình thức đó (điều phục tham ái, vân vân) thì nên bị loại bỏ (chaḍḍetabbāni), nên bị từ chối, không nên chấp nhận.
Sabbatthāti sabbavāresu.
Everywhere means on all occasions.
Ở tất cả mọi nơi có nghĩa là trong tất cả các trường hợp.
Imasmiṃ pana ṭhāneti imasmiṃ mahāpadesaniddesaṭṭhāne.
In this context means in this section of the explanation of the Mahāpadesas.
Ở chỗ này có nghĩa là ở chỗ trình bày các Đại Giáo Giới này.
‘‘Sutte cattāro mahāpadesā’’tiādinā vuttampi avuttena saddhiṃ gahetvā pakiṇṇakakathāya mātikaṃ uddisati.
Having taken what is stated with " There are four Mahāpadesas in the Sutta" and so on, along with what is not stated, he outlines the Mātika of the miscellaneous discourse.
Nó liệt kê các đề mục cho các câu chuyện hỗn tạp, bao gồm cả những điều đã nói và chưa nói, bằng cách nói "Bốn Đại Giáo Giới trong kinh tạng" vân vân.
Ñātuṃ icchito attho pañho, tassa vissajjanāni pañhābyākaraṇāni, atthasūcanādiatthena suttaṃ, pāḷi, taṃ suttaṃ anulometi anukūletīti suttānulomaṃ, mahāpadeso.
A meaning desired to be known is a question, its answers are explanations of questions. The Pāḷi is Sutta in the sense of indicating meaning and so on. That Sutta is conducive to, or agrees with, the Sutta; thus it is a Suttānuloma, a Mahāpadesa.
Ý nghĩa muốn biết là vấn đề (pañho), các câu trả lời cho nó là giải đáp vấn đề (pañhābyākaraṇāni). Kinh tạng (sutta) là pāḷi, với ý nghĩa làm sáng tỏ ý nghĩa, vân vân. Điều phù hợp với kinh tạng là suttānulomaṃ (sự tương hợp với kinh tạng), tức là đại giáo giới.
Ācariyā vadanti saṃvaṇṇenti pāḷiṃ etenāti ācariyavādo aṭṭhakathā.
The teachers declare and explain the Pāḷi by this, thus it is the teacher's statement, the Aṭṭhakathā.
Các vị thầy nói và chú giải pāḷi bằng điều này, nên ācariyavādo (lời dạy của các vị thầy) là các bản chú giải (aṭṭhakathā).
Tassa tassa therassa attano eva mati adhippāyoti attanomati.
That is each elder's own opinion or intention, thus it is one's own opinion.
Quan điểm của vị trưởng lão đó là attanomati (quan điểm riêng).
Dhammavinicchaye patteti dhamme vinicchinitabbe upaṭṭhite.
When a decision on the Dhamma is reached means when a decision on the Dhamma is to be made, or when it has arisen.
Khi đến lúc phân định Pháp (dhammavinicchaye patte) có nghĩa là khi việc phân định Pháp đã hiện diện.
Imeti anantaraṃ vuttā cattāro mahāpadesā.
These refer to the four Mahāpadesas mentioned immediately before.
Những điều này là bốn đại giáo giới vừa được nói.
Pamīyati dhammo paricchijjati vinicchīyati etenāti pamāṇaṃ. Tenāha ‘‘yaṃ ettha sametī’’tiādi.
The Dhamma is measured, determined, or decided by this, thus it is a standard. Therefore he says, " what accords with this" and so on.
Pháp được đo lường, được phân định, được quyết định bằng điều này, nên đó là chuẩn mực (pamāṇaṃ). Vì vậy, đã nói "Điều gì phù hợp ở đây" vân vân.
Itaranti mahāpadesesu asamentaṃ.
The other means what does not accord with the Mahāpadesas.
Cái khác là điều không phù hợp với các đại giáo giới.
Puna itaranti akappiyaṃ anulomentaṃ kappiyaṃ paṭibāhantaṃ sandhāyāha.
Again, the other refers to that which accords with what is unsuitable and rejects what is suitable.
Lại nữa, cái khác là điều phù hợp với những gì không hợp lệ và bác bỏ những gì hợp lệ.
Ekaṃseneva byākātabbo vissajjetabboti ekaṃsabyākaraṇīyo.
It should be explained unequivocally, it should be answered, thus it is to be answered unequivocally.
Nên được giải thích một cách dứt khoát, nên được trả lời, đó là ekaṃsabyākaraṇīyo (nên được giải thích dứt khoát).
Vibhajjāti pucchitamatthaṃ avadhāraṇādibhedena vibhajitvā.
By phân tích means by analyzing the asked meaning into distinctions such as affirmation and so on.
Vibhajjā (phân tích) có nghĩa là phân tích ý nghĩa được hỏi bằng cách xác định, vân vân.
Paṭipucchāti pucchantaṃ puggalaṃ paṭipucchitvā.
By counter-questioning means by questioning the questioner back.
Paṭipucchā (hỏi lại) có nghĩa là hỏi lại người hỏi.
Ṭhapanīyoti tidhāpi avissajjanīyattā ṭhapanīyo byākaraṇaṃ akatvā ṭhapetabbo.
To be set aside means to be set aside without answering in any of the three ways.
Ṭhapanīyo (nên để qua một bên) có nghĩa là nên để qua một bên mà không trả lời, vì không thể giải thích theo ba cách.
‘‘Cakkhuṃ anicca’’nti pañhe uttarapadāvadhāraṇaṃ sandhāya ‘‘ekaṃseneva byākātabba’’nti vuttaṃ niccatāya lesassāpi tattha abhāvato.
In the question, "Is the eye impermanent?", referring to the definite assertion of the latter term, it is said, "it should be declared absolutely," because there is not even a trace of permanence in it.
Trong vấn đề “Mắt là vô thường” (Cakkhuṃ aniccaṃ), câu “phải được giải thích nhất quyết” (ekaṃseneva byākātabba) đã được nói đến, là do nhắm vào sự xác định ở hậu từ, vì ở đó không có dù chỉ một chút dấu vết của sự thường hằng.
Purimapadāvadhāraṇe pana vibhajjabyākaraṇīyatā cakkhusotesu visesatthasāmaññatthānaṃ asādhāraṇabhāvato.
However, if the former term were to be definitely asserted, it would be a matter for analytical declaration, because in the eye and ear, the particular and general meanings are not mutually exclusive.
Còn trong trường hợp xác định ở tiền từ, thì cần phải giải thích phân tích (vibhajjabyākaraṇīyatā), vì ở mắt và tai không có sự tương đồng về ý nghĩa đặc biệt và ý nghĩa chung.
Dvinnaṃ tesaṃ sadisatācodanā paṭipucchanamukheneva byākaraṇīyā paṭikkhepavasena, anuññātavasena ca vissajjitabbatoti āha ‘‘yathā cakkhu, tathā sotaṃ…pe… ayaṃ paṭipucchābyākaraṇīyo pañho’’ti.
The assertion of similarity between these two should be declared by way of a counter-question, both in terms of rejection and acceptance, therefore it is said, "As with the eye, so with the ear… this is a question to be declared by counter-question."
Sự chất vấn về sự tương đồng của hai thứ đó phải được giải thích bằng cách hỏi lại, và phải được trả lời theo cách phủ định hoặc chấp thuận, nên đã nói “như mắt, như tai…pe… đây là vấn đề cần được giải thích bằng cách hỏi lại”.
Taṃ jīvaṃ taṃ sarīranti jīvasarīrānaṃ anaññatāpañho.
That which is the living being is the body is the question of the non-difference between the living being and the body.
“Đó là sinh mạng, đó là thân thể” (Taṃ jīvaṃ taṃ sarīraṃ) là vấn đề về sự không khác biệt giữa sinh mạng và thân thể.
Yassa yena anaññatācoditā, so eva paramatthato nupalabbhatīti vañjhātanayassa matteyyatākittanasadisoti abyākātabbatāya ṭhapanīyo vuttoti.
That of which non-difference is asserted with something else, that very thing is not found in the ultimate sense, hence it is like speaking of the motherhood of a barren woman, and thus it is stated that it should be set aside as undeclared.
Điều mà sự không khác biệt được chất vấn, tự nó không thể được nhận thấy theo ý nghĩa tối hậu, nên giống như việc ca ngợi phẩm chất của người mẹ của một người con gái không có con, và đã được nói là cần phải đặt sang một bên vì không thể giải thích được.
Imāni cattāri pañhabyākaraṇāni pamāṇaṃ teneva nayena tesaṃ pañhānaṃ byākātabbato.
These four modes of declaration of questions are the standard, because those questions are to be declared in that very manner.
“Bốn cách giải thích vấn đề này là tiêu chuẩn” (Imāni cattāri pañhabyākaraṇāni pamāṇaṃ) vì những vấn đề đó phải được giải thích theo cùng một phương pháp.
Vinayamahāpadeso kappiyānulomavidhānato nippariyāyato anulomakappiyaṃ nāma, mahāpadesabhāvena pana taṃsadisatāya suttantamahāpadesesupi ‘‘anulomakappiya’’nti ayaṃ aṭṭhakathāvohāro.
The Vinaya Mahāpadesa is called anulomakappiya in a direct sense, due to its provision for what is permissible according to the rule. However, by virtue of its nature as a great principle and its similarity to it, the Suttanta Mahāpadesas are also referred to as “anulomakappiya” in this commentary's terminology.
Đại giới điều (Vinayamahāpadesa) là “điều hợp lệ thuận theo” (anulomakappiyaṃ) một cách trực tiếp do sự quy định về những điều hợp lệ. Còn do bản chất của đại giới điều, và do sự tương đồng với nó, nên trong các đại giới điều của kinh tạng cũng có thuật ngữ chú giải “điều hợp lệ thuận theo” này.
Yadipi tattha tattha bhagavatā pavattitapakiṇṇakadesanāva aṭṭhakathā, sā pana dhammasaṅgāhakehi paṭhamaṃ tīṇi piṭakāni saṅgāyitvā tassa atthavaṇṇanānurūpeneva vācanāmaggaṃ āropitattā ‘‘ācariyavādo’’ti vuccati ācariyā vadanti saṃvaṇṇenti pāḷiṃ etenāti.
Although the scattered teachings expounded by the Blessed One here and there are indeed the Aṭṭhakathā, it is called “ācariyavādo” (the teaching of the teachers) because the Dhamma compilers, after first reciting the three Piṭakas, presented the method of recitation in accordance with its meaning and explanation, meaning that the teachers speak and explain the Pāli by means of it.
Mặc dù chú giải (aṭṭhakathā) là những lời giáo huấn phân tán được Đức Phật thuyết giảng ở nhiều nơi, nhưng vì những vị kết tập Chánh pháp đã kết tập ba tạng Pāli trước tiên và đã đưa vào con đường tụng đọc phù hợp với sự giải thích ý nghĩa của nó, nên được gọi là “lời dạy của các vị thầy” (ācariyavādo), tức là các vị thầy giảng giải, chú giải Pāli bằng cách này.
Tenāha ‘‘ācariyavādo nāma aṭṭhakathā’’ti.
Therefore it is said, “The teaching of the teachers is the Aṭṭhakathā.”
Do đó đã nói “lời dạy của các vị thầy (ācariyavādo) tức là chú giải (aṭṭhakathā)”.
Tisso saṅgītiyo āruḷho eva ca buddhavacanassa atthasaṃvaṇṇanābhūto kathāmaggo mahindattherena tambapaṇṇidīpaṃābhato pacchā tambapaṇṇiyehi mahātherehi sīhaḷabhāsāya ṭhapito nikāyantaraladdhisaṅkarapariharaṇatthaṃ.
And the method of exposition, which explains the meaning of the Buddha’s word and was included in the three recitations, was brought to the island of Tambapaṇṇī by Mahinda Thera and later put into the Sinhala language by the great elders of Tambapaṇṇī, in order to avoid the mixing of doctrines from other sects.
Con đường thuyết giảng, tức là sự chú giải ý nghĩa của Phật ngôn đã được kết tập trong ba kỳ kết tập, đã được Trưởng lão Mahinda mang đến đảo Tambapaṇṇī, sau đó các vị Đại Trưởng lão ở Tambapaṇṇī đã biên soạn bằng tiếng Sinhala để tránh sự pha trộn với các quan điểm của các bộ phái khác.
Attanomati nāma theravādo.
Attanomati means the Theravāda.
“Ý kiến riêng” (Attanomati) là lời dạy của các Trưởng lão (theravādo).
Nayaggāhenāti suttādito labbhamānanayaggahaṇena.
By grasping the method means by grasping the method obtainable from the Suttas and so forth.
“Bằng cách nắm bắt phương pháp” (Nayaggāhenā) tức là bằng cách nắm bắt phương pháp có được từ kinh điển, v.v.
Anubuddhiyāti suttādīniyeva anugatabuddhiyā.
By understanding means by understanding that is consistent with the Suttas and so forth.
“Bằng sự hiểu biết theo sau” (Anubuddhiyā) tức là bằng sự hiểu biết theo sát kinh điển, v.v.
Attano paṭibhānanti attano eva tassa atthassa vuttanayena upaṭṭhānaṃ, yathāupaṭṭhitā atthā eva tathā vuttā.
One's own spontaneous insight means the arising of that meaning in one's own mind in the manner stated, and the meanings that arose are stated just as they appeared.
“Sự sáng kiến của chính mình” (Attano paṭibhānaṃ) tức là sự xuất hiện của ý nghĩa đó theo cách đã nói, chỉ những ý nghĩa xuất hiện như vậy mới được nói ra như thế.
Samentameva gahetabbanti yathā suttena saṃsandati, evaṃ mahāpadesato atthā uddharitabbāti dasseti.
It should be accepted as consistent means that the meanings should be derived from the Mahāpadesas in such a way that they are consistent with the Sutta.
“Cần phải chấp nhận một cách phù hợp” (Samentameva gahetabbaṃ) cho thấy rằng các ý nghĩa phải được rút ra từ đại giới điều sao cho phù hợp với kinh điển.
Pamādapāṭhavasena ācariyavādassa kadāci pāḷiyā asaṃsandanāpi siyā, so na gahetabboti dassento āha ‘‘ācariyavādopi suttena samentoyeva gahetabbo’’ti.
Sometimes, due to a carelessly written text, the Aṭṭhakathā might not be consistent with the Pāli; such a text should not be accepted, thus it is said, “Even the teaching of the teachers should only be accepted if it is consistent with the Sutta.”
Đôi khi lời dạy của các vị thầy (ācariyavādo) có thể không phù hợp với Pāli do lỗi sao chép, điều đó không nên chấp nhận, nên đã nói “ngay cả lời dạy của các vị thầy cũng phải được chấp nhận khi phù hợp với kinh điển” (ācariyavādopi suttena samentoyeva gahetabbo).
Sabbadubbalā puggalassa sayaṃ paṭibhānabhāvato.
Most weak because it is a person's own spontaneous insight.
“Yếu kém nhất” (Sabbadubbalā) là do sự sáng kiến của chính cá nhân.
Tathā ca sāpi gahetabbā, kīdisī?
And thus, that too should be accepted. What kind of insight?
Và điều đó cũng cần được chấp nhận, điều đó như thế nào?
Suttena samentā yevāti yojanā.
The construction is: "only that which is consistent with the Sutta."
Sự kết nối là “chỉ khi nó phù hợp với kinh điển” (suttena samentā yevā).
Tāsūti tīsu saṅgītīsu.
In those refers to the three recitations.
“Trong những điều đó” (Tāsu) tức là trong ba kỳ kết tập.
‘‘Āgatameva pamāṇa’’nti iminā mahākassapādīhi saṅgītameva ‘‘sutta’’nti idhādhippetanti tadaññassa suttabhāvameva paṭikkhipati.
“Only what has been received is the standard” means that only what was recited by Mahākassapa and others is here intended as “Sutta,” thereby rejecting the Sutta nature of anything else.
Với câu “chỉ những gì đã được kết tập là tiêu chuẩn” (Āgatameva pamāṇaṃ), điều này ngụ ý rằng chỉ những gì đã được các vị Đại Ca-diếp (Mahākassapa) và những vị khác kết tập mới được coi là “kinh điển” ở đây, và phủ nhận rằng bất kỳ điều gì khác là kinh điển.
Tadatthā eva hi tisso saṅgītiyo.
Indeed, the three recitations were for that very purpose.
Thật vậy, ba kỳ kết tập là vì mục đích đó.
Tatthāti gārayhasutte.
Therein refers to the censurable Sutta.
“Ở đó” (Tattha) tức là trong kinh bị chỉ trích (gārayhasutte).
Na ceva sutte osaranti, na ca vinaye sandissantīti veditabbāni tassa asuttabhāvato tena ‘‘anulomakappiyaṃ suttena samentameva gahetabba’’nti vuttaṃ evatthaṃ nigamanavasena nidasseti.
It should be understood that they neither enter the Sutta nor correspond with the Vinaya, because it is not Sutta. Therefore, the statement “Anulomakappiya should be accepted only if it is consistent with the Sutta” demonstrates this meaning as a conclusion.
“Cần biết rằng chúng không đi vào kinh điển, và cũng không phù hợp với Luật” (Na ceva sutte osaranti, na ca vinaye sandissantīti veditabbāni) vì nó không phải là kinh điển. Do đó, câu “điều hợp lệ thuận theo phải được chấp nhận khi phù hợp với kinh điển” (anulomakappiyaṃ suttena samentameva gahetabbaṃ) đã được nói ra ở đây như một kết luận.
Sabbattha ‘‘na itara’’nti vacanaṃ tattha tattha gahitāvadhāraṇaphaladassanaṃ daṭṭhabbaṃ.
The phrase "na itaraṃ" (not the other) everywhere should be understood as showing the result of the definite assertion accepted in each specific context.
Ở mọi nơi, câu “không phải điều khác” (na itaraṃ) phải được hiểu là sự trình bày kết quả của sự xác định đã được chấp nhận ở từng nơi.
189. Sūkaramaddavanti vanavarāhassa mudumaṃsaṃ.
189. Sūkaramaddava means soft pork from a wild boar.
189. Thịt heo rừng mềm (Sūkaramaddavaṃ) là thịt mềm của heo rừng.
Yasmā cundo ariyasāvako sotāpanno, aññe ca bhagavato, bhikkhusaṅghassa ca āhāraṃ paṭiyādentā anavajjameva paṭiyādenti, tasmā vuttaṃ ‘‘pavattamaṃsa’’nti.
Since Cunda was an Ariyan disciple, a stream-enterer, and others who prepared food for the Blessed One and the Sangha prepared only blameless food, it is said, “pavattamaṃsaṃ” (meat that is normally available/not specially prepared for mendicants).
Vì Cunda là một đệ tử thánh, một vị Nhập lưu (sotāpanna), và những người khác khi chuẩn bị thức ăn cho Đức Phật và Tăng đoàn đều chuẩn bị những món ăn không có lỗi, nên đã nói “thịt đã được chuẩn bị” (pavattamaṃsaṃ).
Taṃ kirāti ‘‘nātitaruṇassā’’tiādinā vuttavisesaṃ.
That, it is said, refers to the special kind mentioned as "not too young," and so on.
“Điều đó” (Taṃ kira) là điều đặc biệt đã được nói đến như “không quá non”, v.v.
Tathā hi taṃ ‘‘mudu ceva siniddhañcā’’ti vuttaṃ.
Indeed, it is said that it was "both soft and tender."
Thật vậy, điều đó đã được nói là “mềm và béo” (mudu ceva siniddhañca).
Mudumaṃsabhāvato hi abhisaṅkharaṇavisesena ca ‘‘maddava’’nti vuttaṃ.
Because it was soft meat, and due to a special preparation, it was called "maddava" (soft/tender).
Vì là thịt mềm, và do sự chế biến đặc biệt, nên đã được gọi là “maddava” (mềm).
Ojaṃ pakkhipiṃsu ‘‘ayaṃ bhagavato pacchimako āhāro’’ti puññavisesāpekkhāya, taṃ pana tathāpakkhittadibbojatāya garutaraṃ jātaṃ.
They put vitality in it, out of a wish for special merit, thinking, "This is the Buddha's last meal." That food became very heavy due to the divine vitality put into it in that manner.
“Họ đã thêm tinh chất” (Ojaṃ pakkhipiṃsu) với hy vọng đạt được công đức đặc biệt, nghĩ rằng “đây là bữa ăn cuối cùng của Đức Phật”. Nhưng do tinh chất thần thánh được thêm vào như vậy, nó đã trở nên nặng hơn.
190. Kathaṃ panāyaṃ sīhanādo nanu taṃ bhagavatopi sammāpariṇāmaṃ na gatanti?
190. How then is this a lion's roar? Surely that food did not properly digest even for the Blessed One?
190. Nhưng tiếng rống sư tử này như thế nào? Chẳng phải món ăn đó cũng không được tiêu hóa đúng cách đối với Đức Phật sao?
Nayidaṃ evaṃ daṭṭhabbaṃ, yasmā ‘‘sammadeva taṃ bhagavato pariṇāmaṃ gata’’nti vattuṃ arahati tappaccayā uppannassa vikārassa abhāvato, aññapaccayassa ca vikārassa mudubhāvaṃ āpāditattā.
This should not be understood in that way, for it is proper to say that it was indeed fully digested by the Blessed One, as there was no ailment arising from it, and any other ailment was alleviated by it.
Điều này không nên được hiểu như vậy, vì món ăn đó đã được tiêu hóa đúng cách đối với Đức Phật, do không có sự phát sinh của bệnh tật do nó gây ra, và bệnh tật do nguyên nhân khác gây ra đã được làm dịu đi.
Tenāha ‘‘na pana bhuttappaccayā’’tiādi.
Therefore, it is said, "but not due to the consumed food," and so on.
Do đó đã nói “không phải do việc ăn uống” (na pana bhuttappaccayā) v.v.
Na hi bhagavā, aññe vā pana khīṇāsavā navavedanuppādanavasena āhāraṃ paribhuñjanti aṭṭhaṅgasamannāgatameva katvā āhārassa upabhuñjanato.
For the Blessed One, or other arahants, do not consume food with the intention of giving rise to new sensations, because they partake of food only by making it endowed with eight factors.
Thật vậy, Đức Phật, hay các vị A-la-hán khác, không thọ dụng thức ăn với mục đích phát sinh cảm thọ mới, mà chỉ thọ dụng thức ăn với tám yếu tố đầy đủ.
Yadi evaṃ kasmā pāḷiyaṃ ‘‘bhattaṃ bhuttāvissa kharo ābādho uppajjī’’tiādi vuttaṃ?
If that is so, why is it stated in the Pāli, "After the meal was eaten, a severe affliction arose," and so on?
Nếu vậy, tại sao trong Pāli lại nói “sau khi ăn, một bệnh nặng đã phát sinh” (bhattaṃ bhuttāvissa kharo ābādho uppajjīti) v.v.?
Taṃ bhojanuttarakālaṃ uppannattā vuttaṃ.
That was stated because it arose after the meal.
Điều đó được nói vì nó phát sinh sau bữa ăn.
‘‘Na pana bhuttapaccayā’’ti vutto vāyamattho aṭṭhakathāyaṃ. Katupacitassa laddhokāsassa kammassa vasena balavatipi roge uppanne garusiniddhabhojanappaccayā vedanāniggaho jāto, tenāha ‘‘yadi hī’’tiādi.
The meaning, "but not due to the consumed food," as stated, is already explained in the Aṭṭhakathā. Even when a strong illness arose due to accumulated kamma that had found an opportunity, the affliction was suppressed by the heavy and oily food, therefore it is said, "If indeed," and so on.
Ý nghĩa đã nói “không phải do việc ăn uống” (na pana bhuttapaccayā) đã được chú giải trong Chú giải (aṭṭhakathāyaṃ). Ngay cả khi một bệnh nặng phát sinh do nghiệp đã tạo và tích lũy có cơ hội, sự chế ngự cảm thọ đã xảy ra do việc ăn món ăn nặng và béo, do đó đã nói “nếu vậy” (yadi hī) v.v.
Patthitaṭṭhāneti icchitaṭṭhāne, icchā cassa tattha gantvā vinetabbaveneyyāpekkhā daṭṭhabbā.
At the desired place means at the place he wished to go, and his wish should be understood as an expectation of the disciples to be trained there.
“Ở nơi mong muốn” (Patthitaṭṭhāne) tức là ở nơi được ước muốn. Sự ước muốn của Ngài ở đó phải được hiểu là sự mong muốn những người có thể được giáo hóa sẽ được giáo hóa sau khi Ngài đến đó.
Gāthāyampi ‘‘suta’’nti iminā sutamattaṃ, paresaṃ vacanamattametaṃ, na pana bhojanappaccayā ābādhaṃ phusi dhīroti dasseti.
In the verse too, by "heard," it indicates that this is merely what was heard, merely the word of others, but the wise one was not afflicted by an illness due to the food.
Trong kệ ngôn cũng vậy, với từ “đã nghe” (sutaṃ), điều này cho thấy rằng đó chỉ là điều đã được nghe, chỉ là lời nói của người khác, chứ vị Trí giả (dhīro) không phải do việc ăn uống mà mắc bệnh.
191. Pasannabhāvena udakassa acchabhāvo veditabboti āha ‘‘acchodakāti pasannodakā’’ti.
191. The clarity of the water should be understood by its pure state, therefore it is said, "Acchodakā means with clear water."
191. Sự trong sạch của nước phải được hiểu là do sự thanh tịnh, nên đã nói “nước trong sạch tức là nước thanh tịnh” (acchodakāti pasannodakā).
Sādurasattā sātatāti āha ‘‘madhurodakā’’ti.
Because of its sweet taste, it is pleasant, therefore it is said, "madhurodakā" (with sweet water).
Vì có vị ngon, nên đã nói “nước ngọt” (madhurodakā).
Tanukameva salilaṃ visesato sītalaṃ, na bahalanti āha ‘‘tanusītalasalilā’’ti.
The water being especially cool and not thick means it is thin, therefore it is said, "tanusītalasalilā" (with light, cool water).
Nước mỏng và đặc biệt là mát lạnh, không đặc, nên đã nói “nước mỏng và mát lạnh” (tanusītalasalilā).
Nikkaddamāti setabhāvassa kāraṇamāha.
Nikkaddamā states the reason for its purity.
“Không có bùn” (Nikkaddamā) nói về nguyên nhân của sự trắng trong.
Paṅkacikkhallādivasena hi udakassa vivaṇṇatā, sabhāvato pana taṃ setavaṇṇaṃ evāti.
For water's impurity is due to mud and dirt, but naturally, it is white.
Thật vậy, nước bị biến màu do bùn lầy, v.v., nhưng về bản chất nó có màu trắng.
193. Vicarantiyo meghagabbhato niccharantiyo viya hontīti vuttaṃ ‘‘niccharantīsūti vicarantīsū’’ti.
193. They are like issuing forth from a cloud's womb as they wander, therefore it is said, "niccharantīsu means vicarantīsu" (issuing forth means wandering).
193. Chúng như xuất ra từ bụng mây khi di chuyển, nên đã nói “niccharantīsu tức là vicarantīsu” (xuất ra tức là di chuyển).
Navavidhāyāti navappakārāya.
"Of nine kinds" means of nine varieties.
Chín loại nghĩa là chín dạng.
Navasu hi pakāresu ekavidhāpi asani tappariyāpannatāya ‘‘navavidhā’’ tveva vuccati.
Indeed, even a single kind of lightning among the nine kinds is called "ninefold" because it is included within those nine kinds.
Trong chín loại, ngay cả một loại sấm sét cũng được gọi là "chín loại" vì nó thuộc về nhóm đó.
Īdisī hi esā ruḷhi aṭṭhavimokkhapattipi samaññā viya.
For such is this conventional usage, just like the designation "attainment of the eight liberations" (aṭṭhavimokkha-patti).
Đây là một cách dùng từ thông thường, giống như thuật ngữ "đạt được tám giải thoát".
Asaññaṃ karoti, yo tassā saddena, tejasā ca ajjhotthaṭo.
It makes one unconscious, whoever is overwhelmed by its sound and its brilliance.
Làm cho bất tri giác, người bị bao trùm bởi âm thanh và sức nóng của nó.
Ekaṃ cakkanti ekaṃ maṇḍalaṃ.
"One wheel" means one circle.
Một bánh xe nghĩa là một vòng tròn.
Saṅkāraṃ tīrentī paricchijjantī viya dassetīti saterā.
It appears as if cutting through refuse, hence it is called saterā.
Nó được gọi là saterā vì nó xuất hiện như thể đang cắt bỏ, đang phân chia rác rưởi.
Gaggarāyamānāti gaggarātisaddaṃ karontī, anuravadassanañhetaṃ.
"Roaring" means making a roaring sound; this refers to an imitative sound.
Gaggarāyamānā nghĩa là tạo ra âm thanh ồn ào (gaggarā); đây là sự biểu thị của một âm thanh vọng lại.
Kapisīsāti kapisīsākāravatī.
"Monkey-headed" means having the shape of a monkey's head.
Kapisīsā nghĩa là có hình dạng đầu khỉ.
Macchavilolikāti udake paripphandamānamaccho viya viluḷitākārā.
"Fish-like agitation" means having the appearance of agitated movement, like a fish thrashing in water.
Macchavilolikā nghĩa là có hình dạng khuấy động, giống như một con cá đang vùng vẫy trong nước.
Kukkuṭasadisāti pasāritapakkhakukkuṭākārā.
"Cock-like" means having the appearance of a cock with outstretched wings.
Kukkuṭasadisā nghĩa là có hình dạng con gà trống dang cánh.
Naṅgalassa kassanakāle kassakānaṃ hatthena gahetabbaṭṭhāne maṇikā hoti, taṃ upādāya naṅgalaṃ ‘‘daṇḍamaṇikā’’ti vuccati, tasmā daṇḍamaṇikākārā daṇḍamaṇikā. Tenāha ‘‘naṅgalasadisā’’ti.
When a plough is ploughed, there is a knob on the part held by the farmers' hand; taking that as its basis, the plough is called a "daṇḍamaṇikā." Therefore, that which has the shape of a daṇḍamaṇikā is daṇḍamaṇikā. Hence it is said, "like a plough."
Khi cày ruộng, có một cái núm ở chỗ người nông dân cầm bằng tay, dựa vào đó mà cái cày được gọi là "daṇḍamaṇikā". Do đó, cái có hình dạng núm cày được gọi là daṇḍamaṇikā. Vì thế, (văn bản) nói "giống cái cày".
Deve vassantepi sajotibhūtatāya udakena atemetabbato mahāsani ‘‘sukkhāsanī’’ti vuttā.
Even when it rains, a great lightning strike is called "dry lightning" because it is accompanied by light and cannot be dampened by water.
Ngay cả khi trời mưa, sấm sét lớn cũng được gọi là "sukkhāsanī" (sấm sét khô) vì nó có ánh sáng và không bị nước làm ướt.
Tenāha ‘‘patitaṭṭhānaṃ samugghāṭetī’’ti.
Therefore, it is said, "it tears up the place where it falls."
Vì thế, (văn bản) nói "nó làm bật tung nơi nó rơi xuống".
194. Siṅgī nāma kira uttamaṃ ativiya pabhassaraṃ buddhānaṃ chavivaṇṇobhāsaṃ devalokato āgatasuvaṇṇaṃ.
It is said that Siṅgī is excellent, exceedingly brilliant, a gold that came from the deva-world, having the radiance of the Buddhas' skin color.
Người ta nói rằng siṅgī là một loại vàng quý báu, cực kỳ sáng chói, có màu sắc như ánh sáng da của chư Phật, là vàng đến từ cõi trời.
Tenevāha ‘‘siṅgīsuvaṇṇavaṇṇa’’nti.
Therefore, it is said, "Siṅgī-gold colored."
Vì thế, (văn bản) nói "có màu vàng siṅgī".
‘‘Kiṃ pana thero taṃ gaṇhī’’ti sayameva pucchaṃ samuṭṭhāpetvā tattha kāraṇaṃ dassento ‘‘kiñcāpī’’tiādimāha.
Raising the question himself, "But why did the Elder accept it?", he then explains the reason, beginning with "kiñcāpi" and so on.
Tự mình đặt câu hỏi "Nhưng tại sao vị Trưởng lão lại nhận nó?", và để chỉ ra lý do, (văn bản) nói "mặc dù..." và tiếp theo.
Teneva kāraṇenāti upaṭṭhākaṭṭhānassa matthakappatti, paresaṃ vacanokāsapacchedanaṃ, tena vatthena satthu pūjanaṃ, satthu ajjhāsayānuvattananti iminā teneva yathāvuttena catubbidhena kāraṇena.
"For that very reason" means due to reaching the pinnacle of the attendant's role, cutting off opportunities for others' criticism, honoring the Teacher with that cloth, and conforming to the Teacher's inclination—these are the four aforementioned reasons.
Vì lý do đó nghĩa là vì bốn lý do đã nêu: sự đạt đến đỉnh cao của vị trí người thị giả, việc cắt đứt cơ hội để người khác chỉ trích, việc cúng dường Đức Thế Tôn bằng y phục đó, và việc tuân theo ý nguyện của Đức Thế Tôn.
195. Thero ca tāvadeva taṃ siṅgīvaṇṇaṃ maṭṭhadussaṃ bhagavato upanāmesi ‘‘paṭiggaṇhatu me bhante bhagavā imaṃ maṭṭhadussaṃ, taṃ mamassa dīgharattaṃ hitāya sukhāyā’’ti.
And immediately, the Elder offered that smooth cloth of siṅgī-gold color to the Bhagavā, saying, "May the Bhagavā, Bhante, accept this smooth cloth from me; may it be for my long-term welfare and happiness."
Vị Trưởng lão liền dâng tấm y phục mềm mại màu vàng siṅgī đó lên Đức Thế Tôn, thưa rằng: "Bạch Thế Tôn, xin Đức Thế Tôn thọ nhận tấm y phục mềm mại này của con. Điều đó sẽ mang lại lợi ích và an lạc lâu dài cho con."
Paṭiggahesi bhagavā, paṭiggahetvāva naṃ paribhuñji.
The Bhagavā accepted it, and having accepted it, he immediately used it.
Đức Thế Tôn đã thọ nhận, và ngay sau khi thọ nhận, Ngài đã sử dụng nó.
Tena vuttaṃ ‘‘bhagavāpi tato ekaṃ nivāsesi, ekaṃ pārupī’’ti.
Therefore, it is said, "The Bhagavā then wore one and cloaked himself with one."
Vì thế, (văn bản) nói "Đức Thế Tôn đã mặc một cái và khoác một cái".
Tāvadeva kira taṃ bhikkhū ovaṭṭikaraṇamattena tunnakammaṃ niṭṭhāpetvā therassa upanesuṃ, thero bhagavato upanāmesi.
It is said that the bhikkhus completed the sewing of it for the Elder by merely turning up the edges and presented it to him, and the Elder presented it to the Bhagavā.
Người ta nói rằng các tỳ-khưu đã hoàn thành việc may y phục đó chỉ bằng cách khâu lại hai mép vải và dâng lên vị Trưởng lão, và vị Trưởng lão đã dâng lên Đức Thế Tôn.
Hataccikaṃ viyāti paṭihatappabhaṃ, viya-saddo nipātamattaṃ.
"As if extinguished" means with suppressed radiance; the word "viya" is merely a particle.
Như ngọn lửa đã tắt nghĩa là ánh sáng bị dập tắt, từ "viya" chỉ là một tiểu từ.
Bhagavato hi sarīrappabhāhi abhibhuyyamānā tassa vatthayugassa pabhassaratā nāhosi.
Indeed, the brilliance of that pair of garments was overcome by the radiance of the Bhagavā's body, so it was not brilliant.
Thật vậy, ánh sáng rực rỡ của bộ y phục đó không còn nữa vì bị ánh hào quang thân thể của Đức Thế Tôn che lấp.
Antantenevāti anto anto eva, abbhantarato evāti attho.
"Only within" means only inside, meaning only internally.
Chỉ ở bên trong nghĩa là chỉ ở bên trong, chỉ từ bên trong.
Tenāha ‘‘bahipanassa pabhā natthī’’ti.
Therefore, it is said, "Its radiance is not external."
Vì thế, (văn bản) nói "không có ánh sáng bên ngoài".
197. Dānānisaṃsasaṅkhātā lābhāti vaṇṇadānabaladānādibhedā dānassa ānisaṃsasaññitā diṭṭhadhammikā, samparāyikā ca lābhā icchitabbā.
"Gains designated as advantages of giving" means desirable gains, both in this life and the next, which are called advantages of giving, such as giving of beauty, giving of strength, and so on.
Những lợi ích được gọi là quả báo của việc bố thí là những lợi ích đáng mong muốn, cả trong hiện tại và tương lai, được gọi là quả báo của việc bố thí, chẳng hạn như bố thí sắc đẹp, bố thí sức mạnh, v.v.
Te alābhāti te sabbe tuyhaṃ alābhā, lābhā eva na honti.
"Those are not gains" means all those are not gains for you; they are not gains at all.
Chúng là những bất lợi nghĩa là tất cả chúng đều là bất lợi cho bạn, không phải là lợi ích.
Diṭṭheva dhamme paccakkhabhūte imasmiṃyeva attabhāve bhavā diṭṭhadhammikā. Samparetabbato pecca gantabbato ‘‘samparāyo’’ti laddhanāme paraloke bhavā samparāyikā. Diṭṭhadhammikā ca samparāyikā ca diṭṭhadhammikasamparāyikā.
"Diṭṭhadhammikā" refers to those pertaining to this very existence, which are directly visible in this life. "Samparāyikā" refers to those pertaining to the next world, called "samparāya" because it is to be gone to, to be departed to. "Diṭṭhadhammikasamparāyikā" means both those of this life and the next.
Diṭṭhadhammikā là những gì xảy ra trong kiếp sống hiện tại này, được thấy rõ trong hiện pháp. Samparāyikā là những gì xảy ra ở thế giới bên kia, được gọi là "samparāya" vì phải đi đến đó sau khi chết. Diṭṭhadhammikasamparāyikā là cả diṭṭhadhammikā và samparāyikā.
Dānānisaṃsasaṅkhātā lābhāti dānānisaṃsabhūtā lābhā.
"Gains designated as advantages of giving" means gains that are the advantages of giving.
Những lợi ích được gọi là quả báo của việc bố thí là những lợi ích là quả báo của việc bố thí.
Sabbathā samameva hutvā samaṃ phalaṃ etesaṃ na ekadesenāti samasamaphalā.
"Having equal results" means their results are entirely equal, not in part.
Có quả báo đồng đều nghĩa là quả báo của chúng hoàn toàn đồng đều, không phải chỉ một phần.
Piṇḍapātāti tabbisayaṃ dānamayaṃ puññamāha.
"Almsfood" refers to the merit of giving associated with it.
Vật thực khất thực nghĩa là nói về công đức bố thí vật thực.
Yadi khettavasena nesaṃ samaphalatā adhippetā, satipi ekasantānabhāve puthujjanaarahantabhāvasiddhaṃ nanu tesaṃ khettaṃ visiṭṭhanti dassetuṃ ‘‘nanu cā’’tiādimāha.
If their equality of result is intended in terms of the field (khetta), he asks, "Isn't it true," and so on, to show that even with the same continuity (of path), their field differs due to the distinction between an ordinary person and an Arahant.
Nếu ý nghĩa là sự đồng đều về quả báo của chúng theo phương diện ruộng phước, thì để chỉ ra rằng ruộng phước của họ là đặc biệt, mặc dù có sự liên tục trong một dòng dõi, do sự chứng đắc phàm phu và A-la-hán, (văn bản) nói "chẳng phải sao?" và tiếp theo.
Parinibbānasamatāyāti kilesaparinibbānakhandhaparinibbānabhāvena parinibbānasamatāya.
"Equality in Parinibbāna" refers to equality in Parinibbāna in the sense of the final cessation of defilements (kilesa-parinibbāna) and the final cessation of the aggregates (khandha-parinibbāna).
Sự đồng đẳng về Niết-bàn nghĩa là sự đồng đẳng về Niết-bàn do sự Niết-bàn phiền não và Niết-bàn uẩn.
‘‘Paribhuñjitvā parinibbuto’’ti etena yathā paṇītapiṇḍapātaparibhogūpatthambhitarūpakāyasannissayo dhammakāyo sukheneva kilese pariccaji, bhojanasappāyasaṃsiddhiyā evaṃ sukheneva khandhe pariccajīti evaṃ kilesapariccāgassa, khandhapariccāgassa ca sukhasiddhinimittatāya ubhinnaṃ piṇḍapātānaṃ samaphalatā jotitā.
By "having consumed and attained parinibbāna," it is illuminated that the two alms-offerings have equal results. Just as the Dhammakāya, supported by the physical body nourished by the excellent almsfood, easily abandoned defilements due to the suitability of the food, so too did it easily abandon the aggregates. Thus, the ease of abandoning defilements and abandoning the aggregates serves as the cause for the equal results of both alms-offerings.
Bằng câu "sau khi thọ dụng thì nhập Niết-bàn", điều này chỉ ra rằng cũng như Pháp thân nương tựa vào sắc thân được duy trì bởi sự thọ dụng vật thực khất thực cao thượng đã dễ dàng từ bỏ phiền não, và do sự thích hợp của thức ăn, đã dễ dàng từ bỏ các uẩn, như vậy, sự đồng đều về quả báo của hai vật thực khất thực được làm sáng tỏ do sự thành tựu an lạc của việc từ bỏ phiền não và từ bỏ các uẩn.
‘‘Piṇḍapātasīsena ca piṇḍapātadānaṃ jotita’’nti vutto vāyamattho.
Or this meaning is stated: "The giving of almsfood is illuminated by the head of almsfood."
Hoặc ý nghĩa này được nói là "sự bố thí vật thực khất thực được làm sáng tỏ bằng cách dùng từ vật thực khất thực".
Yathā hi sujātāya ‘‘imaṃ āhāraṃ nissāya mayhaṃ devatāya vaṇṇasukhabalādiguṇā sammadeva sampajjeyyu’’nti uḷāro ajjhāsayo tadā ahosi, evaṃ cundassapi kammāraputtassa ‘‘imaṃ āhāraṃ nissāya bhagavato vaṇṇasukhabalādiguṇā sammadeva sampajjeyyu’’nti uḷāro ajjhāsayoti evampi nesaṃ ubhinnaṃ samaphalatā veditabbā.
For just as Sujātā then had a noble aspiration: "May my divine qualities of beauty, happiness, strength, etc., be perfectly accomplished through this food," so too did Cunda the smith's son have a noble aspiration: "May the Bhagavā's divine qualities of beauty, happiness, strength, etc., be perfectly accomplished through this food." Thus, their equal results should be understood in this way as well.
Cũng như vào thời điểm đó, cô Sujātā có ý nguyện cao cả: "Nhờ thức ăn này, các phẩm chất như sắc đẹp, an lạc, sức mạnh, v.v., của vị thần của tôi sẽ được thành tựu một cách trọn vẹn", thì cũng vậy, người thợ rèn Cunda cũng có ý nguyện cao cả: "Nhờ thức ăn này, các phẩm chất như sắc đẹp, an lạc, sức mạnh, v.v., của Đức Thế Tôn sẽ được thành tựu một cách trọn vẹn". Như vậy, sự đồng đều về quả báo của cả hai người cần được hiểu.
Satipi catuvīsatikoṭisatasahassasamāpattīnaṃ devasikaṃ vaḷañjanasamāpattibhāve yathā pana abhisambujjhanadivase abhinavavipassanaṃ paṭṭhapento rūpasattakādi (visuddhi. ṭī. 2.707 vitthāro) vasena cuddasahākārehi sannetvā mahāvipassanāmukhena tā samāpattiyo samāpajji, evaṃ parinibbānadivasepi sabbā tā samāpajjīti evaṃ samāpattisamatāyapi tesaṃ samaphalatā.
Even though there were 24,000,000,000 koṭis of attainments (samāpattis) that were daily entered into, on the day of his full enlightenment, he entered those attainments through the great vipassanā, having arranged them in fourteen ways, such as the sevenfold rūpa (as elaborated in Visuddhimagga-ṭīkā 2.707), as he began new vipassanā. Similarly, on the day of his Parinibbāna, he entered all those attainments. Thus, their equal results are also due to the equality of these attainments.
Mặc dù có bốn trăm nghìn hai mươi bốn triệu lần nhập định được thực hành hàng ngày, nhưng cũng như vào ngày giác ngộ, Ngài đã bắt đầu quán sát mới, kết hợp chúng theo mười bốn cách dựa trên bảy loại sắc, v.v. (chi tiết trong Visuddhimagga ṭīkā 2.707), và nhập các định đó thông qua đại quán sát, thì cũng vậy, vào ngày nhập Niết-bàn, Ngài cũng đã nhập tất cả các định đó. Như vậy, sự đồng đều về quả báo của họ cũng nằm ở sự đồng đều về các định.
Cundassa tāva anussaraṇaṃ uḷārataraṃ hotu bhagavato dinnabhāvena aññathattābhāvato, sujātāya pana kathaṃ devatāya dinnanti?
While Cunda's recollection should be nobler because it was given to the Bhagavā and could not be otherwise, how was it given to a deity in Sujātā's case?
Sự ghi nhớ của Cunda là cao cả hơn vì nó được dâng cho Đức Thế Tôn, không có sự khác biệt. Nhưng làm sao Sujātā lại dâng cho vị thần?
Evaṃsaññibhāvatoti āha ‘‘sujātā cā’’tiādi.
Because it was with such a perception, it is said, "Sujātā also," and so on.
Vì có nhận thức như vậy, nên (văn bản) nói "và Sujātā..." và tiếp theo.
Aparabhāgeti abhisambodhito aparabhāge.
"Later" means after the enlightenment.
Sau đó nghĩa là sau khi giác ngộ.
Puna aparabhāgeti parinibbānato parato.
Again, aparabhāge means after the Parinibbāna.
Puna aparabhāge (sau đó nữa) là sau khi nhập Niết-bàn.
Dhammasīsanti dhammānaṃ matthakabhūtaṃ nibbānaṃ.
Dhammasīsaṃ means Nibbāna, which is the summit of all phenomena (dhammas).
Dhammasīsa (đỉnh pháp) là Niết-bàn, là đỉnh cao của các pháp.
Me gahitanti mama vasena gahitaṃ.
Me gahitaṃ means taken by my will.
Me gahita (được ta nắm giữ) là được nắm giữ theo ý muốn của ta.
Tenāha ‘‘mayhaṃ kirā’’tiādi.
Therefore, he said, “Indeed, mine” and so on.
Do đó,* nói: “Thật vậy, của ta” v.v.
Saṃvareti sīlasaṃvare.
Saṃvare means in moral restraint (sīlasaṃvara).
Saṃvare (sự phòng hộ) là sự phòng hộ giới.
Veranti pāṇātipātādipañcavidhaṃ veraṃ.
Vera means the fivefold hostility, such as taking life.
Vera (sự thù địch) là năm loại thù địch như sát sanh v.v.
Tañhi veridhammabhāvato, verahetutāya ca ‘‘vera’’nti vuccati.
Indeed, it is called “vera” because it is the nature of an enemy's actions and because it is the cause of future hostility.
Thật vậy, điều đó được gọi là “vera” vì nó có trạng thái là pháp thù địch và là nguyên nhân của sự thù địch.
Kosallaṃ vuccati ñāṇaṃ, tena yutto kusaloti āha ‘‘kusalo pana ñāṇasampanno’’ti.
Skill (kosalla) is called knowledge (ñāṇa); thus, one endowed with it is kusalo (skillful), so he said, “kusalo means endowed with knowledge.”
Kosalla (sự thiện xảo) được gọi là tuệ, người có tuệ được gọi là kusalo (người thiện xảo), do đó* nói: “kusalo pana ñāṇasampanno” (người thiện xảo là người có đầy đủ trí tuệ).
Ñāṇasampadā nāma ñāṇapāripūrī, sā ca aggamaggavasena veditabbā, aggamaggo ca niravasesato kilese pajahatīti āha ‘‘ariyamaggena…pe… jahātī’’ti.
The accomplishment of knowledge (ñāṇasampadā) means the perfection of knowledge, and this should be understood as the highest path (aggamagga); and since the highest path abandons defilements (kilesa) without remainder, he said, “by the Noble Path…pe… abandons.”
Ñāṇasampadā (sự thành tựu trí tuệ) là sự viên mãn của trí tuệ, và điều đó cần được hiểu theo nghĩa của đạo lộ tối thượng (ariyamagga), và vì đạo lộ tối thượng diệt trừ phiền não không còn sót lại, nên* nói: “ariyamaggena…pe… jahātī” (bằng đạo lộ thánh… v.v… diệt trừ).
Imaṃ pāpakaṃ jahitvāti dānena tāva lobhamacchariyādipāpakaṃ, sīlena pāṇātipātādipāpakaṃ jahitvā tadaṅgavasena pahāya tato samathavipassanādhammehi vikkhambhanavasena, tato maggapaṭipāṭiyā samucchedavasena anavasesaṃ pāpakaṃ pahāya.
Having abandoned this evil means having first abandoned the evil of greed, avarice, and so on through generosity, and the evil of taking life and so on through sīla, thereby relinquishing them by way of temporary suppression (tadaṅga); then, by means of tranquil abiding (samatha) and insight (vipassanā) practices, by way of suppression (vikkhambhana); and then, by means of the sequence of paths, by way of eradication (samuccheda), having utterly abandoned evil without remainder.
Imaṃ pāpakaṃ jahitvā (sau khi từ bỏ điều ác này) là sau khi từ bỏ điều ác như tham lam, keo kiệt v.v. bằng bố thí, và điều ác như sát sanh v.v. bằng giới, theo phương pháp tadaṅga (tạm thời), sau đó từ bỏ theo phương pháp vikkhambhana (đè nén) bằng các pháp samatha (chỉ) và vipassanā (quán), sau đó từ bỏ hoàn toàn điều ác không còn sót lại theo phương pháp samuccheda (đoạn trừ) bằng sự tuần tự của các đạo lộ.
Tathā pahīnattā eva rāgādīnaṃ khayā kilesanibbānena sabbaso kilesavūpasamena nibbuto parinibbutoti saupādisesāya nibbānadhātuyā desanāya kūṭaṃ gaṇhanto ‘‘iti cundassa…pe… sampassamāno udānaṃ udānesī’’ti.
Since they were thus abandoned, by the destruction of lust and so on, by the Nibbāna of defilements, meaning by the complete calming of defilements, the Nibbuto (calmed one) is one who is totally cool (parinibbuto); taking the climax of the teaching on the element of Nibbāna with a remainder (saupādisesa), he said, “Thus, Cunda…pe… seeing, he uttered an udāna (inspired utterance).”
Vì đã được từ bỏ như vậy, nên rāgādīnaṃ khayā kilesanibbānena (do sự diệt tận tham ái v.v. bằng sự Niết-bàn phiền não) là sự diệt trừ hoàn toàn các phiền não, nibbuto (đã tịch diệt) là đã nhập Niết-bàn, nắm giữ điểm cốt yếu trong sự thuyết giảng về Niết-bàn giới có dư y,* nói: “iti cundassa…pe… sampassamāno udānaṃ udānesī” (như vậy, Cunda… v.v… thấy rõ liền cảm hứng lời cảm đề).
198. Evaṃ taṃ kusinārāyaṃ hotīti yathā anurādhapurassa thūpārāmo dakkhiṇapacchimadisāyaṃ, evaṃ taṃ uyyānaṃ kusinārāya dakkhiṇapacchimadisāyaṃ hoti.
“Thus it was at Kusinārā” means that just as the Thūpārāma (stupa-park) is in the southwest direction of Anurādhapura, so too that park was in the southwest direction of Kusinārā.
198. Evaṃ taṃ kusinārāyaṃ hotī (như vậy, điều đó xảy ra ở Kusinārā) là khu vườn ấy nằm ở hướng tây nam của Kusinārā, giống như Thūpārāma của Anurādhapura nằm ở hướng tây nam.
Tasmāti yasmā nagaraṃ pavisitukāmā uyyānato upecca vattanti gacchanti etenāti ‘‘upavattana’’nti vuccati, taṃ sālapantibhāvena ṭhitaṃ sālavanaṃ.
Therefore (tasmā), because those who wished to enter the city would approach from the park and proceed by way of this*, it is called “Upavattana,” that grove of sāla trees standing in a row of sāla trees.
Tasmā (do đó) là vì những người muốn vào thành phố đi từ khu vườn đến và đi qua đó, nên khu rừng sāla (sālavana) ấy, vốn là một hàng cây sāla, được gọi là “upavattana” (lối đi vòng).
Antarenāti vemajjhe.
Antarenā means in the middle.
Antarenā (ở giữa) là ở chính giữa.
Tassa kira mañcakassāti tattha paññapiyamānassa tassa mañcakassa.
Of that couch, they say (tassa kira mañcakassa), means of that couch which was being spread there.
Tassa kira mañcakassā (thật vậy, của chiếc giường đó) là của chiếc giường được đặt ở đó.
Tatrāpi…pe… eko pādabhāgassa, tasmā ‘‘antarena yamakasālāna’’nti vuttaṃ.
There also…pe… one was near the foot-end, therefore it was said, “between the twin sāla trees.”
Tatrāpi…pe… eko pādabhāgassa, (ở đó cũng… v.v… một ở phía chân,) do đó* nói: “antarena yamakasālānaṃ” (ở giữa hai cây sāla đôi).
Saṃsibbitvāti aññamaññaāsattaviṭapasākhatāya saṃsibbitvā viya.
Saṃsibbitvā means as if woven together by their mutually intertwined branches and twigs.
Saṃsibbitvā (đan xen vào nhau) là như thể đan xen vào nhau do các cành cây và nhánh cây quấn quýt vào nhau.
‘‘Ṭhitasākhā’’tipi vuttaṃ aṭṭhakathāyaṃ.
“With upright branches” was also said in the Commentary.
Trong chú giải cũng nói: “Ṭhitasākhā” (cành cây đứng vững).
Yaṃ pana pāḷiyaṃ ‘‘uttarasīsakaṃ mañcakaṃ paññapehī’’ti vuttaṃ, taṃ pacchimadassanaṃ daṭṭhuṃ āgatānaṃ devatānaṃ daṭṭhuṃ yogyatāvasena vuttaṃ.
However, what was said in the Pāḷi, “Spread the couch with its head to the north,” was said with reference to the suitability for devas who had come to behold the last sight.
Còn điều được nói trong Pāḷi là “uttarasīsakaṃ mañcakaṃ paññapehī” (hãy trải giường với đầu hướng về phía bắc) là được nói theo sự phù hợp để các vị thiên thần đến để nhìn thấy lần cuối cùng.
Keci pana ‘‘uttaradisāvilokanamukhaṃ pubbadisāsīsakaṃ katvā mañcakaṃ paññapehīti attho’’ti vadanti, taṃ tesaṃ matimattaṃ.
Some say, “The meaning is, ‘Spread the couch with its head to the east, facing north,’” but that is merely their opinion.
Một số người nói: “Ý nghĩa là hãy trải giường với đầu hướng về phía đông và mặt hướng về phía bắc,” đó chỉ là ý kiến của họ.
Paribhuttakālato paṭṭhāya…pe… parikkhayaṃ gataṃ, ‘‘na pana paribhuttappaccayā’’ti heṭṭhā vuttanayeneva attho daṭṭhabbo.
From the time of consumption…pe… reached exhaustion, the meaning should be understood in the same way as stated below: “not, however, due to the consumed support (paccaya).”
Paribhuttakālato paṭṭhāya…pe… parikkhayaṃ gataṃ, (kể từ thời điểm thọ dụng… v.v… đã tiêu tán,) ý nghĩa cần được hiểu theo cách đã nói ở trên: “na pana paribhuttappaccayā” (không phải do nhân thọ dụng).
Caṅgavāreti ūmiyaṃ.
Caṅgavāre means in a wave.
Caṅgavāre (trong sóng) là trong sóng nước.
Katokāsassa kammassa vasena yathāsamuṭṭhito rogo ārogyaṃ abhimaddatīti katvā etamatthaṃ dassento ‘‘viyā’’ti vuttaṃ.
Indicating this meaning by saying “as if” (viya), because a disease that arises as determined by a karmic opportunity (katokāsa kamma) crushes health.
Bệnh tật phát sinh theo nghiệp đã tạo cơ hội sẽ hủy hoại sức khỏe, do đó, để chỉ ra ý nghĩa này,* nói: “viyā” (như là).
Yasmā bhagavā heṭṭhā vuttanayena kappaṃ, kappāvasesaṃ vā ṭhātuṃ samattho eva, tattakaṃ kālaṃ ṭhāne payojanābhāvato āyusaṅkhāre ossajjitvā tādisassa kammassa okāsaṃ adāsi, tasmā etamatthaṃ dassento ‘‘viyā’’tipi vattuṃ yujjatiyeva.
Because the Blessed One, as stated below, was indeed capable of remaining for an eon (kappa) or a remainder of an eon (kappāvasesa), but since there was no purpose in remaining for such a long time, he relinquished the life-formations (āyusaṅkhāra) and gave opportunity to such kamma; therefore, saying “as if” (viya) is indeed appropriate to show this meaning.
Vì Đức Thế Tôn, theo cách đã nói ở trên, có khả năng sống hết một kiếp hoặc phần còn lại của kiếp, nhưng vì không có mục đích gì để sống lâu như vậy, Ngài đã từ bỏ các hành thọ mạng và tạo cơ hội cho nghiệp như vậy, do đó, để chỉ ra ý nghĩa này, việc nói “viyā” cũng là hợp lý.
Ayaṃ sīhaseyyāti ayaṃ evaṃ vuttā sīhaseyyā.
This is the lion's posture means this posture described thus is the lion's posture.
Ayaṃ sīhaseyyā (đây là tư thế nằm của sư tử) là tư thế nằm của sư tử được nói như vậy.
‘‘Tejussadattā’’ti iminā sīhassa abhīrubhāvaṃ dasseti.
By “tejussadattā” (filled with vigor), he shows the lion's fearlessness.
“Tejussadattā” (do sự dồi dào oai lực) điều này chỉ ra sự không sợ hãi của sư tử.
Bhīrukā hi sesamigā attano āsayaṃ pavisitvā santāsapubbakaṃ yathā tathā sayanti, sīho pana abhīrubhāvato satokārī bhikkhu viya satiṃ upaṭṭhāpetvāva sayati.
Fearful wild animals enter their lair and lie down somehow, preceded by terror; but a lion, being fearless, lies down having established mindfulness, like a mindful monk.
Các loài thú nhút nhát khác thường đi vào hang ổ của mình và nằm một cách sợ hãi, nhưng sư tử, do không sợ hãi, nằm xuống sau khi an trú chánh niệm, giống như một tỳ-khưu có chánh niệm.
Tenāha ‘‘purimapāde’’tiādi.
Therefore, he said, “with the front paws” and so on.
Do đó* nói: “purimapāde” (hai chân trước) v.v.
Dakkhiṇe purimapāde vāmassa purimapādassa ṭhapanavasena dve purimapāde ekasmiṃ ṭhāne ṭhapetvā.
Placing the right front paw over the left front paw, the two front paws in one place.
Dve purimapāde ekasmiṃ ṭhāne (hai chân trước ở một chỗ) bằng cách đặt chân trước bên phải lên chân trước bên trái.
Pacchimapādeti dve pacchimapāde.
The hind paws means the two hind paws.
Pacchimapāde (hai chân sau) là hai chân sau.
Vuttanayeneva idhāpi ekasmiṃ ṭhāne pādaṭṭhapanaṃ veditabbaṃ, ṭhitokāsasallakkhaṇaṃ abhīrubhāveneva.
Here also, the placing of the paws in one place should be understood in the same manner, the noting of the position out of fearlessness itself.
Ở đây cũng vậy, việc đặt chân ở một chỗ cần được hiểu theo cách đã nói, ṭhitokāsasallakkhaṇaṃ (sự nhận biết vị trí đứng) là do sự không sợ hãi.
‘‘Sīsaṃ pana ukkhipitvā’’tiādinā vuttā sīhakiriyā anutrāsapabujjhanaṃ viya abhīrubhāvasiddhā dhammatāvasenevāti veditabbā.
The lion’s actions described by “lifting its head” and so on should be understood as a natural characteristic of fearlessness, like awakening without terror.
“Sīsaṃ pana ukkhipitvā” (còn ngẩng đầu lên) v.v. hành động của sư tử được nói là sīhakiriyā (hành động của sư tử) cần được hiểu là một bản chất tự nhiên được chứng minh bởi sự không sợ hãi, như là sự thức dậy không hoảng sợ.
Sīhavijambhitavijambhanaṃ ativelaṃ ekākārena ṭhapitānaṃ sarīrāvayavānaṃ gamanādikiriyāsu yogyabhāvāpādanatthaṃ.
The lion’s yawning (sīhavijambhita-vijambhanaṃ) is for the purpose of making the body parts, which have been kept in one position for a very long time, suitable for movements and other activities.
Sīhavijambhitavijambhanaṃ (sự vươn vai của sư tử) là để làm cho các bộ phận cơ thể đã được giữ ở một tư thế quá lâu trở nên thích hợp cho các hoạt động như đi lại v.v.
Tikkhattuṃ sīhanādanadanaṃ appesakkhamigajātapariharaṇatthaṃ.
The roaring of a lion three times (tikkhattuṃ sīhanādanadanaṃ) is for the purpose of keeping away weak animals.
Tikkhattuṃ sīhanādanadanaṃ (ba lần gầm tiếng sư tử) là để xua đuổi các loài thú nhỏ yếu.
Seti abyāvaṭabhāvena pavattati etthāti seyyā, catutthajjhānameva seyyā catutthajjhānaseyyā. Kiṃ pana taṃ catutthajjhānanti?
Lying down is seyyā (posture) because one acts therein without disturbance; the fourth jhāna itself is the posture, the fourth jhāna posture (catutthajjhānaseyyā). What, then, is that fourth jhāna?
Nằm xuống là seyyā (tư thế nằm) vì ở đó diễn ra sự không bận rộn; thiền thứ tư là seyyā, catutthajjhānaseyyā (tư thế nằm của thiền thứ tư). Vậy thiền thứ tư đó là gì?
Ānāpānacatutthajjhānaṃ, tato hi vuṭṭhahitvā vipassanaṃ vaḍḍhetvā bhagavā anukkamena aggamaggaṃ adhigantvā tathāgato jātoti.
It is the fourth jhāna of mindfulness of breathing (ānāpāna); for having arisen from it and developed insight (vipassanā), the Blessed One gradually attained the highest path and thus became a Tathāgata.
Đó là thiền thứ tư của hơi thở vào ra (ānāpāna), vì sau khi xuất khỏi thiền đó và phát triển thiền quán (vipassanā), Đức Thế Tôn đã tuần tự đạt đến đạo quả tối thượng và trở thành Như Lai.
‘‘Tayidaṃ padaṭṭhānaṃ nāma, na seyyā, tathāpi yasmā ‘catutthajjhānā vuṭṭhahitvā samanantarā bhagavā parinibbāyī’ti (dī. ni. 2.219) vakkhati, tasmā lokiyacatutthajjhānasamāpatti eva tathāgataseyyā’’ti keci, evaṃ sati parinibbānakālikāva tathāgataseyyāti āpajjati, na ca bhagavā lokiyacatutthajjhānasamāpajjanabahulo vihāsi.
“This is a proximate cause (padaṭṭhāna), not a posture (seyyā). Nevertheless, since it will be said, ‘Having arisen from the fourth jhāna, the Blessed One immediately attained Parinibbāna,’ some say, ‘Therefore, only the attainment of the worldly fourth jhāna is the Tathāgata’s posture.’ If this were so, the Tathāgata’s posture would apply only to the time of Parinibbāna, and the Blessed One did not habitually dwell in the attainment of the worldly fourth jhāna.”
Một số người nói: “Đó là paṭaṭṭhāna (nguyên nhân gần), không phải seyyā, tuy nhiên, vì* sẽ nói ‘sau khi xuất khỏi thiền thứ tư, Đức Thế Tôn liền nhập Niết-bàn’ (Dī. Ni. 2.219), nên sự nhập thiền thứ tư thế gian (lokiyacatutthajjhāna) chính là tư thế nằm của Như Lai.” Nếu vậy, tư thế nằm của Như Lai chỉ xảy ra vào lúc nhập Niết-bàn, và Đức Thế Tôn không thường xuyên nhập thiền thứ tư thế gian.
Aggaphalavasena pavattaṃ panettha catutthajjhānaṃ veditabbaṃ.
Here, the fourth jhāna should be understood as that which arises by way of the highest fruit (aggaphala).
Ở đây, thiền thứ tư cần được hiểu là thiền thứ tư diễn ra theo nghĩa của quả tối thượng.
Tattha yathā sattānaṃ niddupagamanalakkhaṇā seyyā bhavaṅgacittavasena hoti, sā ca nesaṃ paṭhamajātisamanvayā yebhuyyavuttikā, evaṃ bhagavato ariyajātisamanvayaṃ yebhuyyavuttikaṃ aggaphalabhūtaṃ catutthajjhānaṃ ‘‘tathāgataseyyā’’ti veditabbaṃ.
Therein, just as the sleep (seyyā) of beings, characterized by falling asleep, occurs by way of the bhavaṅga-citta, and that (sleep) is mostly prevalent for them, being associated with the first birth, so too, the fourth jhāna, which is the supreme fruit and is mostly prevalent for the Blessed One, being associated with the noble birth, should be understood as "tathāgataseyyā."
Ở đó, như sự nằm nghỉ có đặc tính là đi vào giấc ngủ của các chúng sinh xảy ra theo tâm Bhavaṅga, và điều đó thường xuyên xảy ra do sự tương ứng với tâm tái tục đầu tiên của họ trong một đời, thì cũng vậy, thiền thứ tư (catutthajjhāna) của Thế Tôn, là quả tối thượng (aggaphala), thường xuyên xảy ra do sự tương ứng với dòng dõi Thánh (ariyajāti), nên được biết là “Tathāgataseyyā” (sự nằm nghỉ của Như Lai).
Sīhaseyyā nāma seṭṭhaseyyāti āha ‘‘uttamaseyyā’’ti.
Sīhaseyyā (lion's posture) means the supreme posture (seṭṭhaseyyā); thus, it is said "uttamaseyyā" (the highest posture).
Sīhaseyyā (sự nằm nghỉ của sư tử) là sự nằm nghỉ tối thượng, vì vậy Ngài nói “uttamaseyyā” (sự nằm nghỉ tối thượng).
Chinnapāto viya chinnapāto, taṃ chinnapātaṃ, bhāvanapuṃsakaniddeso yaṃ.
Chinnapāto (falling broken) is like a fall in which something is broken; that is chinnapātaṃ, which is a verbal noun in the neuter gender.
Chinnapāta (sự rơi vỡ) là sự rơi vỡ như một sự sụp đổ bị cắt đứt, đó là một danh từ trung tính chỉ hành động.
Āvaṭṭantīti abhimukhabhāvena vaṭṭanti.
Āvaṭṭantīti (they revolve) means they roll forward.
Āvaṭṭantī (họ lăn về phía trước) có nghĩa là họ lăn về phía trước.
Yattha patitā, tato katipayaratanaṭṭhānaṃ vaṭṭanavaseneva gantvā puna yathāpatitameva ṭhānaṃ vaṭṭanavasena āgacchanti.
Having fallen in a certain place, they move a few ratanas away by rolling, and then return to the same place where they fell, by rolling.
Nơi nào họ rơi xuống, họ lăn đi một vài ratana rồi lại lăn về chỗ cũ.
Tenāha ‘‘āvaṭṭantiyo patitaṭṭhānameva āgacchantī’’ti.
Therefore, it is said, "āvaṭṭantiyo patitaṭṭhānameva āgacchantī"ti (revolving, they return to the very place they fell).
Do đó, Ngài nói “āvaṭṭantiyo patitaṭṭhānameva āgacchantī” (họ lăn về và đến đúng chỗ đã rơi).
Vivaṭṭantīti yattha patitā, tato vinivaṭṭanti.
Vivaṭṭantīti (they roll away) means they roll away from the place they fell.
Vivaṭṭantī (họ lăn đi) có nghĩa là họ lăn đi khỏi chỗ họ đã rơi.
Tenāha ‘‘patitaṭṭhānato parabhāgaṃ vaṭṭamānā gacchantī’’ti.
Therefore, it is said, "patitaṭṭhānato parabhāgaṃ vaṭṭamānā gacchantī"ti (rolling, they go to a place beyond the place they fell).
Do đó, Ngài nói “patitaṭṭhānato parabhāgaṃ vaṭṭamānā gacchantī” (họ lăn đi đến một phần khác của chỗ đã rơi).
Purato vaṭṭanaṃ āvaṭṭanaṃ, itaraṃ tividhampi vivaṭṭananti dassetuṃ ‘‘apicā’’tiādi vuttaṃ.
To show that rolling forward is āvaṭṭanaṃ (revolving), and the other three kinds are vivaṭṭana (rolling away), "apicā" and so on were stated.
Để chỉ ra rằng sự lăn về phía trước là āvaṭṭanaṃ (sự lăn về) và ba loại khác là vivaṭṭanaṃ (sự lăn đi), Ngài đã nói “apicā” (và hơn nữa) và các từ tiếp theo.
Devatā dhāretuṃ na sakkoti udakaṃ viya osīdanato.
Devatā dhāretuṃ na sakkoti (the deity cannot hold) as they sink like water.
Devatā dhāretuṃ na sakkoti (chư thiên không thể giữ được) vì họ chìm xuống như nước.
Tenāha ‘‘tatthā’’tiādi.
Therefore, it is said, "tatthā" and so on.
Do đó, Ngài nói “tatthā” (ở đó) và các từ tiếp theo.
Tatthāti pakatipathaviyaṃ.
Tatthāti (therein) refers to the natural earth.
Tatthā (Ở đó) có nghĩa là trên mặt đất bình thường.
Devatā osīdanti dhātūnaṃ saṇhasukhumālabhāvato.
Devatā osīdanti (deities sink) because their elements are subtle and fine.
Devatā osīdanti (chư thiên chìm xuống) do các yếu tố (dhātu) của họ rất tinh tế và nhẹ nhàng.
Pathaviyaṃ pathaviṃ māpesunti pakatipathaviyaṃ attano sarīraṃ dhāretuṃ samatthaṃ iddhānubhāvena pathaviṃ māpesuṃ.
Pathaviyaṃ pathaviṃ māpesunti (they created earth on the earth) means they created a new kind of earth by their psychic power, capable of supporting their bodies on the natural earth.
Pathaviyaṃ pathaviṃ māpesuṃ (họ đã tạo ra đất trên đất) có nghĩa là trên mặt đất bình thường, họ đã tạo ra một loại đất bằng thần thông, có khả năng giữ được thân thể của họ.
203. Etthāti mātugāme.
203. Here refers to women.
Ở đây là đối với phụ nữ.
Ayaṃ uttamā paṭipatti, yadidaṃ adassanaṃ, dassanamūlakattā tappaccayānaṃ sabbānatthānaṃ.
This is the supreme practice, namely, not seeing, as all undesirable things stem from seeing.
Đây là thực hành tối thượng, đó là không nhìn thấy, vì tất cả những điều bất lợi đều có nguyên nhân từ việc nhìn thấy.
Lobhoti kāmarāgo.
Greed is kāmarāga (sensual lust).
Lobha (tham) là kāmarāga (ái dục).
Cittacalanā paṭipattiantarāyakaro cittakkhobho.
Agitation of mind is a mental disturbance that obstructs practice.
Cittacalanā là sự xáo động tâm, gây cản trở cho sự thực hành.
Murumurāpetvāti saaṭṭhikaṃ katvā khādane anuravadassanaṃ.
"Murumurāpetvā" refers to the sound of biting when eating something with bone.
Murumurāpetvā là tiếng nhai khi ăn thứ gì đó có xương.
Aparimitaṃ kālaṃ dukkhānubhavanaṃ aparicchinnadukkhānubhavanaṃ.
Experiencing suffering for an immeasurable time is aparicchinnadukkhānubhavanaṃ (experiencing unending suffering).
Trải nghiệm vô lượng khổ đau là aparicchinnadukkhānubhavanaṃ (trải nghiệm khổ đau không giới hạn).
Vissāsoti visaṅgo ghaṭṭanābhāvo.
Familiarity means detachment, the absence of friction.
Vissāsa (tin cậy) là sự không vướng mắc, không va chạm.
Otāroti tattha cittassa anuppaveso.
Entry means the penetration of the mind into that.
Otāra (sự xâm nhập) là sự thâm nhập của tâm vào đó.
Asihatthena verīpurisena, pisācenāpi khāditukāmena.
One should speak even with an enemy man holding a sword or even with a flesh-eating pisāca (demon).
Asihatthena (bởi kẻ thù có kiếm), pisācenāpi (ngay cả bởi quỷ ăn thịt).
Āsīdeti akkamanādivasena bādheyya.
Asīde means to oppress or harm through trampling, etc.
Āsīde (sẽ làm hại) là sẽ làm hại bằng cách giẫm đạp, v.v.
Assāti mātugāmassa.
Assa refers to a woman.
Assā (của cô ấy) là của người phụ nữ.
Pabbajitehi kattabbakammanti āmisapaṭiggahaṇādi pabbajitehi kātabbaṃ kammaṃ.
"Pabbajitehi kattabbakammaṃ" means the duties to be performed by renunciants, such as receiving offerings.
Pabbajitehi kattabbakammaṃ (việc cần làm của người xuất gia) là công việc mà người xuất gia phải làm, như thọ nhận vật phẩm cúng dường, v.v.
Satīti vā kāyagatāsati upaṭṭhāpetabbā.
Or mindfulness, i.e., kāyagatāsati (mindfulness of the body), should be established.
Sati (niệm) hay kāyagatāsati (niệm thân) nên được thiết lập.
Kāyakammassa hitabhāvo hitajjhāsayena pavattitattāti āha ‘‘hitavuddhiyā katenā’’ti.
The beneficial nature of the bodily action is due to its being performed with a mind intent on benefit; therefore, it is said "done with a desire for well-being."
Hành động thân thể là có lợi vì nó được thực hiện với ý định lợi ích, vì vậy* nói “được thực hiện với sự tăng trưởng lợi ích”.
Sukhabhāvo kāyikadukkhābhāvo, cetasikasukhabhāvo cetasikasukhasamuṭṭhitattā cāti vuttaṃ ‘‘sukhasomanasseneva katenā’’ti.
The pleasant nature means the absence of bodily suffering, and the pleasant nature of the mind is due to its arising from mental pleasure. Thus, it is said: "done solely with pleasure and joy."
Sự an lạc là không có khổ đau thân thể, và sự an lạc tinh thần là do phát sinh từ sự an lạc tinh thần, vì vậy đã nói “được thực hiện chỉ với sự an lạc và hỷ lạc”.
Āvirahovibhāgato advayabhāvato advayenāti imamatthaṃ dassetuṃ ‘‘yathā’’tiādi vuttaṃ.
To show this meaning, that it is "advayena" (without duality) because of the distinction between direct and indirect action, and because of its non-dual nature, the phrase starting with "yathā" is stated.
Để chỉ ra ý nghĩa này là advayena (không hai) do không có sự phân biệt về sự vắng mặt và không có tính hai mặt, nên đã nói “yathā” (như) v.v.
Satthu khettabhāvasampattiyā, therassa ajjhāsayasampattiyā ca ‘‘ettakamida’’nti pamāṇaṃ gahetuṃ asakkuṇeyyatāya pamāṇavirahitattā tassa kammassāti āha ‘‘cakkavāḷampī’’tiādi.
Because of the perfection of the Teacher's field of merit and the perfection of the elder's intention, it is impossible to take a measure of that action as "this much." Therefore, that action is immeasurable, and thus it is said: "cakkavāḷampī" (even the cakkavāḷa), etc.
Vì sự thành tựu của Đức Bổn Sư như một cánh đồng phước đức, và sự thành tựu của ý định của Trưởng lão, nên không thể đo lường được công đức đó, vì vậy* nói “cakkavāḷampī” (ngay cả vũ trụ) v.v.
208. Katthaci saṅkucitaṃ hutvā ṭhitaṃ mahāpathaviṃ pattharanto viya, paṭisaṃhaṭaṃ hutvā ṭhitaṃ ākāsaṃ vitthārento viya, catusaṭṭhādhikayojanasatasahassubbedhaṃ cakkavāḷagiriṃ adho osārento viya, aṭṭhasaṭṭhādhikasahassayojanasatasahassubbedhaṃ sineruṃ ukkhipento viya, satayojanāyāmavitthāraṃ mahājambuṃ khandhe gahetvā cālento viyāti pañca hi upamā hi therassa guṇakathā mahantabhāvadassanatthañceva aññesaṃ dukkaṭabhāvadassanatthañca āgatāva.
208. The five similes—as if spreading out the great earth which was contracted in some places, as if extending the sky which was rolled up, as if lowering the Cakkavāḷa mountain which is a hundred thousand yojanas plus sixty-four thousand yojanas high, as if lifting the Sineru mountain which is a hundred thousand yojanas plus sixty-eight thousand yojanas high, as if shaking the great Jambu tree, a hundred yojanas in length and breadth, by its trunk—these indeed came to show the greatness of the elder's qualities and to show the difficulty for others to perform such deeds.
208. Như thể trải rộng đại địa đang co rút lại ở một số nơi, như thể mở rộng không gian đang bị thu hẹp lại, như thể hạ thấp núi vũ trụ cao một trăm nghìn yojana cộng thêm sáu mươi bốn nghìn yojana, như thể nâng núi Sineru cao một trăm nghìn yojana cộng thêm sáu mươi tám nghìn yojana, như thể cầm cây Đại Diêm Phù có chiều dài và chiều rộng một trăm yojana mà lay động — năm ví dụ này được đưa ra để chỉ ra sự vĩ đại của phẩm hạnh của Trưởng lão và sự khó khăn của những người khác.
Eteneva cāti ca-saddena ‘‘ahaṃ etarahi arahaṃ sammāsambuddho’’ (dī. ni. 2.4), ‘‘sadevakasmiṃ lokasmiṃ natthi me paṭipuggalo’’ti (ma. ni. 1.285; 2.341; mahāva. 11; kathā. 405; mi. pa. 5.11) ca evaṃ ādīnaṃ saṅgaho daṭṭhabbo.
"Eteneva cā" (and by this alone)—by the word "ca," the inclusion of phrases like "I am now an Arahant, a Fully Self-Enlightened One" and "There is no one equal to me in this world with its devas" should be understood.
Eteneva cā (và bằng chính điều này) — với từ ca, nên hiểu rằng nó bao gồm các câu như “Hiện tại, Ta là Arahant Sammāsambuddha” (Dī. Ni. 2.4), và “Trong thế giới cùng với chư thiên, không có ai sánh bằng Ta” (Ma. Ni. 1.285; 2.341; Mahāva. 11; Kathā. 405; Mi. Pa. 5.11).
Byattoti khandhakosallādisaṅkhātena veyyattiyena samannāgato.
Byatto means endowed with skillfulness, such as skill in the khandhas.
Byatto (thông thái) là người có sự khéo léo, được gọi là sự thông thạo về các khandha (uẩn), v.v.
Medhāvīti medhāsaṅkhātāya sammābhāvitāya paññāya samannāgato.
Medhāvī means endowed with well-developed wisdom (paññā), which is called medhā.
Medhāvī (trí tuệ) là người có trí tuệ được tu tập đúng đắn, được gọi là medhā (trí tuệ).
210. Khuddaka-saddo patirūpavācī, ka-saddo appatthoti āha ‘‘khuddakanagaraketi nagarapatirūpake sambādhe khuddakanagarake’’ti.
210. The word khuddaka means similar, and the suffix ka means small. Therefore, it is said: "khuddakanagarake, in a small town, in a confined place similar to a town."
210. Từ khuddaka có nghĩa là tương tự, và từ ka có nghĩa là nhỏ, vì vậy* nói “khuddakanagaraketi nagarapatirūpake sambādhe khuddakanagarake” (thành phố nhỏ là thành phố tương tự, chật hẹp, thành phố nhỏ bé).
Dhuparavisālasaṇṭhānatāya taṃ ‘‘ujjaṅgalanagaraka’’nti vuttanti āha ‘‘visamanagarake’’ti.
Because of its vast and uneven shape like saline soil, it was called "ujjaṅgalanagaraka" (a barren or rough town). Thus, it is said: "visamanagarake" (in an uneven town).
Vì nó có hình dạng rộng lớn như đất hoang, nên nó được gọi là “ujjaṅgalanagaraka” (thành phố hoang vu), vì vậy* nói “visamanagarake” (thành phố không bằng phẳng).
Aññesaṃ mahānagarānaṃ ekadesappamāṇatāya sākhāsadise. Ettha ca ‘‘khuddakanagarake’’ti iminā tassa nagarassa appakabhāvo vutto, ‘‘ujjaṅgalanagarake’’ti iminā bhūmivipattiyā nihīnabhāvo, ‘‘sākhānagarake’’ti iminā appadhānabhāvo.
Because it was only a part of other great cities, it was "sākhāsadise" (like a branch). Here, "khuddakanagarake" expresses the smallness of that city, "ujjaṅgalanagarake" expresses its inferior nature due to the unevenness of its ground, and "sākhānagarake" expresses its secondary nature.
Aññesaṃ mahānagarānaṃ (của các thành phố lớn khác) là sākhāsadise (giống như cành cây) vì kích thước chỉ bằng một phần. Ở đây, với “khuddakanagarake” (thành phố nhỏ), sự nhỏ bé của thành phố đó được nói đến; với “ujjaṅgalanagarake” (thành phố hoang vu), sự kém cỏi do đất đai xấu được nói đến; với “sākhānagarake” (thành phố chi nhánh), sự không quan trọng được nói đến.
Sārappattāti vibhavasārādinā sāramahattaṃ pattā.
Sārappattā means those who have attained great essence, through wealth, years, etc.
Sārappattā (đạt được tinh túy) là những người đã đạt được sự vĩ đại của tinh túy, như tinh túy của sự giàu có, v.v.
Subhikkhāti sulabhāhārā, sundarāhārā ca.
Subhikkhā means with easily obtainable food and with excellent food.
Subhikkhā (phong phú) là có thức ăn dễ kiếm và thức ăn ngon.
Tenāha ‘‘khajjabhojjasampannā’’ti.
Therefore, it is said: "khajjabhojjasampannā" (endowed with various foods).
Vì vậy,* nói “khajjabhojjasampannā” (đầy đủ thức ăn và đồ uống).
Saddaṃ karonteti ravasārinā tuṭṭhabhāvena koñcanādaṃ karonte.
"Saddaṃ karonte" means making a koñca-nāda (crane's cry) with a joyous voice.
Saddaṃ karonte (tạo ra âm thanh) là tạo ra tiếng kêu của chim koñca (sếu) với vẻ mặt vui mừng.
Avivittāti asuññā, kadāci ratho paṭhamaṃ gacchati, taṃ añño anubandhanto gacchati, kadāci dutiyaṃ vuttaratho paṭhamaṃ gacchati, itaro taṃ anubandhati evaṃ aññamaññaṃ anubandhamānā.
Avivittā means not deserted; sometimes one chariot goes first, another follows it; sometimes the second mentioned chariot goes first, and the other follows it. Thus, "aññamaññaṃ anubandhamānā" (following one another).
Avivittā (không vắng vẻ) là không trống rỗng, đôi khi một chiếc xe đi trước, chiếc khác đi theo sau; đôi khi chiếc xe thứ hai đi trước, chiếc kia đi theo sau, như vậy aññamaññaṃ anubandhamānā (theo dõi lẫn nhau).
Etthāti kusāvatīnagare.
Here refers to the city of Kusāvatī.
Etthā (ở đây) là ở thành phố Kusāvatī.
Tassa mahantabhāvato ceva iddhādibhāvato ca niccaṃ payojitāneva bheriādīni tūriyāni, samma sammāti vā aññamaññaṃ piyālāpasaddo samma-saddo.
Because of its greatness and prosperity, drums and other musical instruments were always played. The word "samma" refers to the sound of affectionate greetings like "friend, friend," exchanged between people.
Vì sự vĩ đại và sự thịnh vượng của nó, bheriādīni tūriyāni (các loại nhạc cụ như trống, v.v.) luôn được sử dụng; hoặc samma (bạn ơi) là tiếng nói chuyện thân mật giữa nhau.
Kaṃsatāḷādisabbatāḷāvacarasaddo tāḷa-saddo, kūṭabheri-saddo kumbhathūṇasaddo.
The word "tāḷa" refers to the sound of all percussion instruments like cymbals, etc. The word "kūṭabheri" refers to the sound of a pot-drum.
Tāḷa là tiếng của tất cả các nhạc cụ gõ như kaṃsatāḷa (chiêng đồng), v.v.; kūṭabheri là tiếng của trống kumbhathūṇa (trống nồi).
212. Kaṅkhā eva kaṅkhādhammo.
212. Doubt itself is kaṅkhādhammo (the quality of doubt).
212. Kaṅkhā eva kaṅkhādhammo (sự nghi ngờ chính là pháp nghi ngờ).
Ekato vāti bhūmiṃ avibhajitvā sādhāraṇatova.
"Or jointly" (ekato vā) means without dividing the land, simply in common.
Ekato vā (hoặc cùng một chỗ), nghĩa là không chia đất, mà là chung.
Bījato ca aggaṃ gahetvā āhāraṃ sampādetvā dānaṃ bījaggaṃ.
Bījaggaṃ (first fruits of seeds) is a gift made by taking the best (aggaṃ) from the seeds (bījato) and preparing food.
Lấy phần đầu tiên từ hạt giống, chuẩn bị thức ăn và cúng dường được gọi là bījaggaṃ (lễ vật đầu hạt giống).
Gabbhakāleti gabbhadhāraṇato paraṃ khīraggahaṇakāle.
"During the time of gestation" (gabbhakāle) means after the gestation period, during the time of collecting milk (khīraggahaṇakāle).
Gabbhakāle (trong thời kỳ mang thai), nghĩa là sau khi mang hạt, vào thời điểm lấy sữa.
Tenāha ‘‘gabbhaṃ phāletvā khīraṃ niharitvā’’tiādi.
Therefore, it is said, "having split the sheath and extracted the milk" (gabbhaṃ phāletvā khīraṃ niharitvā), and so on.
Vì vậy, nói ‘‘gabbhaṃ phāletvā khīraṃ niharitvā’’ (tách vỏ hạt ra và lấy sữa ra) v.v.
Puthukakāleti sassānaṃ nātipakke puthukayogyaphalakāle.
"During the time of green grains" (puthukakāle) means when the crops are not yet fully ripe, at the time when the fruits are suitable for green grains (puthukayogyaphalakāle).
Puthukakāle (trong thời kỳ làm bánh dẹt), nghĩa là vào thời điểm quả của cây ngũ cốc chưa chín hẳn, thích hợp để làm bánh dẹt.
Lāyanagganti pakkassa sassassa lavane lavanārambhe dānaṃ adāsi.
Lāyanaggaṃ (first fruits of reaping) means a gift given at the beginning of reaping (lavanārambhe) the ripe crop (pakkassa sassassa) during harvest (lavane).
Lāyanaggaṃ (lễ vật đầu mùa gặt): cúng dường vào lúc bắt đầu gặt hái ngũ cốc đã chín.
Lunassa sassassa veṇivasena bandhitvā ṭhapanaṃ veṇikaraṇaṃ. Tassa ārambhe dānaṃ veṇaggaṃ. Veṇiyo pana ekato katvā rāsikaraṇaṃ kalāpo. Tattha aggadānaṃ kalāpaggaṃ. Kalāpato nīharitvā maddane aggadānaṃ khalaggaṃ. Madditaṃ ophuṇitvā dhaññassa rāsikaraṇe aggadānaṃ khalabhaṇḍaggaṃ. Dhaññassa khalato koṭṭhe pakkhipane aggadānaṃ koṭṭhaggaṃ.
The binding of the reaped grain (lunassa sassassa) into bundles (veṇivasena) and setting it aside is veṇikaraṇaṃ (bundling). A gift at the beginning of that is veṇaggaṃ (first fruits of bundling). Arranging the bundles together into a heap is kalāpo (a stack). A gift of the best there is kalāpaggaṃ (first fruits of stacking). A gift of the best at the threshing, after taking it out from the stack, is khalaggaṃ (first fruits of the threshing floor). A gift of the best at heaping the grain after winnowing the threshed grain is khalabhaṇḍaggaṃ (first fruits of the grain heap). A gift of the best at depositing the grain from the threshing floor into the granary is koṭṭhaggaṃ (first fruits of the granary).
Việc bó lúa đã gặt thành bó được gọi là veṇikaraṇaṃ (bó lúa). Cúng dường vào lúc bắt đầu bó lúa là veṇaggaṃ (lễ vật đầu bó lúa). Việc gom các bó lúa lại thành đống được gọi là kalāpo (đống lúa). Cúng dường đầu tiên ở đó là kalāpaggaṃ (lễ vật đầu đống lúa). Cúng dường đầu tiên khi lấy lúa từ đống lúa ra để đập là khalaggaṃ (lễ vật đầu sân đập lúa). Cúng dường đầu tiên khi quạt lúa đã đập và gom thành đống hạt là khalabhaṇḍaggaṃ (lễ vật đầu đống hạt trên sân). Cúng dường đầu tiên khi đổ hạt từ sân vào kho là koṭṭhaggaṃ (lễ vật đầu kho lúa).
Uddharitvāti koṭṭhato uddharitvā.
"Having taken out" (uddharitvā) means having taken out from the granary (koṭṭhato).
Uddharitvā (lấy ra), nghĩa là lấy ra khỏi kho.
213. Aññātukāmova na sandiṭṭhiṃ parāmāsī.
"Wishing only to know" (aññātukāmova), he did not cling to his own views.
213. Aññātukāmova (chỉ muốn biết), không bám víu vào quan điểm của mình.
Abbhaññiṃsūti sandehajātassa pucchāvacananti katvā jāniṃsūti atthamāha.
Abbhaññiṃsū means "they understood" (jāniṃsūti), considering it to be a question from one who was in doubt (sandehajātassa pucchāvacanaṃ).
Abbhaññiṃsū (họ đã hiểu), nghĩa là đã hiểu, vì đó là câu hỏi của người đang nghi ngờ.
Tenāha pāḷiyaṃ ‘‘sabbeva na abbhaññiṃsū’’ti.
Therefore, in the Pāli, it is said, "Sabbeva na abbhaññiṃsū" (All did not understand).
Vì vậy, trong kinh Pali nói ‘‘sabbeva na abbhaññiṃsū’’ (tất cả đều không hiểu).
Nesanti pūraṇādīnaṃ.
"For them" (nesaṃ) means for Purāṇa and others.
Nesaṃ (của họ), nghĩa là của Purāṇa v.v.
Sā paṭiññāti ‘‘karoto kho mahārāja kārayato’’tiādinā (dī. ni. 1.166) paṭiññātā, sabbaññupaṭiññā eva vā.
"That declaration" (sā paṭiññā) is the declaration made with the words "Truly, great king, for one who acts and causes to act" (karoto kho mahārāja kārayato) and so on, or it is the declaration of omniscience itself.
Sā paṭiññā (lời tuyên bố đó), nghĩa là lời tuyên bố như ‘‘karoto kho mahārāja kārayato’’ (khi làm, thưa Đại vương, khi khiến làm) v.v., hoặc chính là lời tuyên bố về sự Toàn Giác.
Niyyānikāti sappāṭihāriyā, tesaṃ vā siddhantasaṅkhātā paṭiññā vaṭṭato nissaraṇaṭṭhena niyyānikāti.
Niyyānikā (leading to liberation) means accompanied by a wonder (sappāṭihāriyā), or their declaration, which is considered their doctrine (siddhantasaṅkhātā paṭiññā), is niyyānikā in the sense of leading out of saṃsāra (vaṭṭato nissaraṇaṭṭhena).
Niyyānikā (dẫn đến sự giải thoát), nghĩa là có thần thông, hoặc lời tuyên bố được xem là giáo lý của họ là niyyānikā (dẫn đến sự giải thoát) theo nghĩa thoát khỏi vòng luân hồi.
Sāsanassa sampattiyā tesaṃ sabbaññutaṃ, tabbipariyāyato ca asabbaññutaṃ gacchatīti daṭṭhabbaṃ.
It should be understood that by the perfection of the Dispensation, their omniscience (tesaṃ sabbaññutaṃ) is established, and conversely, their non-omniscience (asabbaññutaṃ) is established.
Nên hiểu rằng sự Toàn Giác của họ đạt được do sự hoàn hảo của giáo pháp, và ngược lại, sự không Toàn Giác là do sự không hoàn hảo của giáo pháp.
Tenāha ‘‘tasmā’’tiādi.
Therefore, it is said, "Thus" (tasmā), and so on.
Vì vậy, nói ‘‘tasmā’’ (do đó) v.v.
Atthābhāvatoti subhaddassa sādhetabbaatthābhāvato.
"Due to the absence of benefit" (atthābhāvato) means due to the absence of any benefit that Subhadda could realize.
Atthābhāvato (do không có mục đích), nghĩa là do Subhadda không có mục đích cần đạt được.
Okāsābhāvatoti tathā vitthāritaṃ katvā dhammaṃ desetuṃ avasarābhāvato.
"Due to the absence of opportunity" (okāsābhāvato) means due to the absence of an occasion to teach the Dhamma in such an elaborate manner.
Okāsābhāvato (do không có cơ hội), nghĩa là do không có cơ hội để thuyết giảng giáo pháp một cách chi tiết như vậy.
Idāni tameva okāsābhāvaṃ dassetuṃ ‘‘paṭhamayāmasmi’’ntiādi vuttaṃ.
Now, to show that very absence of opportunity, the phrase "paṭhamayāmasmiṃ" (in the first watch), and so on, was spoken.
Giờ đây, để chỉ rõ sự thiếu cơ hội đó, đã nói ‘‘paṭhamayāmasmi’’ (trong canh đầu) v.v.
214. Yesaṃ samaṇabhāvakarānaṃ dhammānaṃ sampādanena samaṇo, te pana ukkaṭṭhaniddesena ariyamaggadhammāti catumaggasaṃsiddhiyā pāḷiyaṃ cattāro samaṇā vuttāti te bāhirasamaye sabbena sabbaṃ natthīti dassento ‘‘paṭhamo sotāpannasamaṇo’’tiādimāha.
214. The Dhamma-qualities, by perfecting which one becomes a recluse (samaṇo) — and those, by way of supreme designation, are the qualities of the Noble Path (ariyamaggadhammā) — thus, it is said in the Pāli that four recluses (cattāro samaṇā) are mentioned in relation to the attainment of the four paths. To show that these are entirely absent in outside doctrines, he speaks of "the first recluse who is a Stream-Enterer" (paṭhamo sotāpannasamaṇo), and so on.
214. Vị Sa-môn là người đã thành tựu các pháp khiến trở thành Sa-môn, và những pháp đó, theo sự chỉ định tối thượng, là các pháp Thánh đạo. Vì vậy, trong kinh Pali, bốn vị Sa-môn được đề cập là do sự thành tựu của Tứ Đạo. Để chỉ ra rằng những vị đó hoàn toàn không có trong các giáo phái bên ngoài, nên nói ‘‘paṭhamo sotāpannasamaṇo’’ (vị Sa-môn Nhập Lưu đầu tiên) v.v.
Purimadesanāyāti ‘‘yasmiñca kho, subhadda, dhammavinaye’’tiādinā vuttāya desanāya.
"By the former discourse" (purimadesanāyā) refers to the discourse spoken with the words, "In whatsoever Dhamma and Discipline, Subhadda," (yasmiñca kho, subhadda, dhammavinaye) and so on.
Purimadesanāya (bằng giáo pháp trước), nghĩa là bằng giáo pháp đã được thuyết giảng như ‘‘yasmiñca kho, subhadda, dhammavinaye’’ (này Subhadda, trong giáo pháp và giới luật nào) v.v.
Byatirekato, anvayato ca adhippeto attho vibhāvīyatīti paṭhamanayopettha ‘‘purimadesanāyā’’ti padena saṅgahito vāti daṭṭhabbo.
It should be understood that the intended meaning is illustrated by both contrast (byatirekato) and concordance (anvayato), and that the first method is also included here by the phrase "purimadesanāyā" (by the former discourse).
Nên hiểu rằng ý nghĩa được mong muốn được làm rõ bằng cả phương pháp loại trừ và phương pháp tương ứng, và phương pháp đầu tiên ở đây cũng được bao gồm trong cụm từ ‘‘purimadesanāya’’.
Attano sāsanaṃ niyamento āha ‘‘imasmiṃ kho’’ti yojanā.
The construction is: the Buddha, determining his own teaching, said, "imasmiṃ kho" (in this).
Yojanā (câu ghép) là: tự mình quy định giáo pháp của mình, nên nói ‘‘imasmiṃ kho’’ (trong giáo pháp này).
Āraddhavipassakehīti samādhikammikavipassakehi, sikhāppattavipassake sandhāya vuttaṃ, na paṭṭhapitavipassane.
"By those who have undertaken vipassanā" (āraddhavipassakehī) refers to those who are vipassanā-practitioners engaged in samādhi (samādhikammikavipassakehi), or those who have reached the pinnacle of vipassanā (sikhāppattavipassake), not those who have just commenced vipassanā (paṭṭhapitavipassane).
Āraddhavipassakehī (bởi những người đã bắt đầu tu tập thiền quán), điều này được nói đến những người tu tập thiền quán đã thành tựu định, những người đã đạt đến đỉnh cao của thiền quán, chứ không phải những người mới bắt đầu thiền quán.
Apare pana ‘‘bāhirakasamaye vipassanārambhassa ganthopi natthevāti avisesavacanameta’’nti vadanti.
Others, however, say, "In outside doctrines, there is not even a text for the commencement of vipassanā; therefore, this is a general statement."
Những người khác nói rằng: ‘‘Trong các giáo phái bên ngoài, thậm chí không có đường lối tu tập thiền quán, nên đây là một lời nói không phân biệt.’’
Adhigataṭṭhānanti adhigatassa kāraṇaṃ, tadatthaṃ pubbabhāgapaṭipadanti attho, yena sotāpattimaggo adhigato, na uparimaggo, so sotāpattimagge ṭhito akuppadhammatāya tassa, tattha vā siddhito ṭhitapubbo bhūtapubbagatiyāti sotāpattimaggaṭṭho sotāpanno, na sesaariyā bhūmantaruppattito.
Adhigataṭṭhānaṃ (the attained stage) means the cause of what has been attained, meaning the preliminary practice (pubbabhāgapaṭipada) for that purpose, by which the Stream-entry Path was attained, not the higher paths. Such a person is established in the Stream-entry Path because of its unshakeable nature, or because of his achievement there, or by former action (bhūtapubbagatiyā). Thus, a Stream-enterer (sotāpanno) is one established in the Stream-entry Path (sotāpattimaggaṭṭho), not other Noble Ones due to their attainment of other stages.
Adhigataṭṭhānaṃ (nơi đã đạt được), nghĩa là nguyên nhân của sự đạt được, tức là con đường tu tập sơ khởi dẫn đến điều đó. Người đã đạt được Sơ quả, chứ không phải các quả cao hơn, là người an trú trong Sơ quả do bản chất bất động của nó, hoặc do sự thành tựu của nó trong quá khứ, nên người an trú trong Sơ quả là một vị Nhập Lưu, chứ không phải các bậc Thánh khác do sự tái sinh vào các cõi khác.
Sotāpanno hi attanā adhigataṭṭhānaṃ sotāpattimaggaṃ aññassa kathetvā sotāpattimaggaṭṭhaṃ kareyya, na aṭṭhamako asambhavato.
Indeed, a Stream-enterer, having described to another the attained stage, the Stream-entry Path, could make that person established in the Stream-entry Path, but an Aṭṭhamaka (eighth person) could not, due to impossibility.
Một vị Nhập Lưu có thể giảng giải Sơ quả mà mình đã đạt được cho người khác để họ cũng đạt được Sơ quả, nhưng một vị Bát nhân (aṭṭhamaka) thì không thể, vì điều đó không thể xảy ra.
Esa nayo sesamaggaṭṭhesūti etthāpi imināva nayena attho veditabbo.
"The same method applies to those established in other paths" (esa nayo sesamaggaṭṭhesū) — here too, the meaning should be understood by this very method.
Esa nayo sesamaggaṭṭhesū (điều này cũng tương tự đối với những người an trú trong các đạo khác), ở đây ý nghĩa cũng nên được hiểu theo cách tương tự.
Paguṇaṃ kammaṭṭhānanti attano paguṇaṃ vipassanākammaṭṭhānaṃ, eteneva ‘‘avisesavacana’’nti vādo paṭikkhittoti daṭṭhabbo.
Paguṇaṃ kammaṭṭhānaṃ (a well-practiced meditation subject) means one's own well-practiced vipassanā meditation subject. By this very fact, the view that it is a "general statement" (avisesavacana) is refuted.
Paguṇaṃ kammaṭṭhānaṃ (đề mục thiền đã thuần thục), nghĩa là đề mục thiền quán của chính mình đã thuần thục. Điều này bác bỏ quan điểm ‘‘không phân biệt’’.
Sabbaññutaññāṇaṃ adhippetaṃ. Tañhi sabbañeyyadhammāvabodhane ‘‘kusalaṃ chekaṃ nipuṇa’’nti vuccati tattha asaṅgaappaṭihataṃ pavattatīti katvā.
Sabbaññutaññāṇaṃ (omniscience) is intended. For it is called "skillful, clever, subtle" (kusalaṃ chekaṃ nipuṇaṃ) in comprehending all knowable phenomena, and in that regard, it operates without attachment and without hindrance.
Sabbaññutaññāṇaṃ (trí Tuệ Toàn Giác) adhippetaṃ (được mong muốn). Trí tuệ đó được gọi là ‘‘kusalaṃ chekaṃ nipuṇaṃ’’ (khéo léo, tinh thông, vi tế) trong việc thấu hiểu tất cả các pháp cần được biết, vì nó vận hành không vướng mắc và không bị cản trở.
Samadhikāni ekena vassena.
Samadhikāni (exceeding) by one year.
Samadhikāni (hơn thế), nghĩa là hơn một năm.
Ñāyanti etena catusaccadhammaṃ yāthāvato paṭivijjhantīti ñāyo, lokuttaramaggoti āha ‘‘ariyamaggadhammassā’’ti.
"By this, they truly penetrate the Four Noble Truths" (Ñāyanti etena catusaccadhammaṃ yāthāvato paṭivijjhanti)—thus, the supramundane path is ñāyo (the method). So, it is said, "of the path-dhamma of the Noble Ones" (ariyamaggadhammassā).
Ñāyo (phương pháp), nghĩa là con đường siêu thế, vì nhờ đó mà người ta thấu hiểu Tứ Thánh Đế một cách chân thật, nên nói ‘‘ariyamaggadhammassā’’ (của pháp Thánh đạo).
Padissati etena ariyamaggo paccakkhato dissatīti padeso, vipassanāti vuttaṃ ‘‘padese vipassanāmagge’’ti.
"By this, the Noble Path is directly seen" (Padissati etena ariyamaggo paccakkhato dissatī)—thus, it is padeso (a part, a way), which is said to be vipassanā (insight), as in "padese vipassanāmagge" (in the way of insight, the path of insight).
Padeso (phần), nghĩa là thiền quán, vì nhờ đó mà Thánh đạo được thấy một cách trực tiếp, nên nói ‘‘padese vipassanāmagge’’ (trong phần thiền quán).
Samaṇopīti ettha pi-saddo ‘‘padesavattī’’ti etthāpi ānetvā sambandhitabboti āha ‘‘padesavatti…pe… natthīti vuttaṃ hotī’’ti.
In "samaṇopī" (even a recluse), the particle pi should also be linked to "padesavattī" (existing in a part). Therefore, it is said, "padesavatti...pe...natthīti vuttaṃ hotī" (existing in a part...and so on...it is said that there is none).
Trong câu Samaṇopī (và cả Sa-môn), từ pi (cũng) nên được liên kết với ‘‘padesavattī’’ (thực hành trong phần), nên nói ‘‘padesavatti…pe… natthīti vuttaṃ hotī’’ (nghĩa là không có người thực hành trong phần…v.v.).
216. Tanti bhikkhusaṅghassa ovādakaṅgaṃ dassetuṃ…pe… vuttaṃ dhammasaṅgāhakehīti adhippāyo.
216. "That" (taṃ) refers to the element of exhortation to the Saṅgha of bhikkhus. The meaning is that it "was spoken" by the compilers of the Dhamma "to demonstrate..." and so on.
216. Taṃ (điều đó), nghĩa là thành phần giáo huấn của Tăng đoàn chư Tỳ-khưu, dassetuṃ…pe… vuttaṃ (đã được nói ra để chỉ rõ…v.v.), ý nghĩa là bởi các vị kết tập Pháp.
Suttābhidhammasaṅgahitassa dhammassa atisajjanaṃ sambodhanaṃ desanā, tasseva pakārato ñāpanaṃ veneyyasantāne ṭhapanaṃ paññāpananti ‘‘dhammopi desito ceva paññatto cā’’ti vuttaṃ.
Teaching (desanā) is the disclosure or elucidation of the Dhamma collected in the Sutta and Abhidhamma. Laying down (paññāpanaṃ) is its explicit declaration, establishing it in the mind-streams of those to be trained. Therefore, it is said, "the Dhamma has been both taught and laid down" (dhammopi desito ceva paññatto cā).
Sự thuyết giảng, sự nhắc nhở về giáo pháp đã được kết tập trong kinh tạng và Abhidhamma tạng là desanā (sự thuyết giảng); sự trình bày chi tiết về giáo pháp đó, việc đặt nó vào tâm thức của những người có thể được giáo hóa là paññāpanaṃ (sự trình bày), nên nói ‘‘dhammopi desito ceva paññatto cā’’ (giáo pháp đã được thuyết giảng và trình bày).
Tathā vinayatantisaṅgahitassa kāyavācānaṃ vinayanato ‘‘vinayo’’ti laddhādhivacanassa atthassa atisajjanaṃ sambodhanaṃ desanā, tasseva pakārato ñāpanaṃ asaṅkarato ṭhapanaṃ paññāpananti ‘‘vinayopi desito ceva paññatto cā’’ti vuttaṃ.
Furthermore, the explanation and instruction of the meaning that has obtained the name "Vinaya" because of restraining the body and speech (or transgressions of body and speech), which is included and encompassed in the Vinaya text, is desanā (discourse). And the clarification and distinct establishment of that very meaning in various ways, without mixing Vinaya rules with each other, is paññāpana (enactment). Thus it is said, " the Vinaya has been both pointed out and laid down."
Hơn nữa, sự tuyên thuyết, sự làm cho hiểu rõ ý nghĩa được gọi là "Vinaya" do sự chế ngự thân và ngữ (hoặc các sự vi phạm về thân và ngữ), được thâu tóm trong tạng Luật, là desanā (thuyết giảng); và sự làm cho hiểu rõ theo nhiều phương cách, sự thiết lập không lẫn lộn (các giới luật) là paññāpana (chế định); vì vậy đã nói rằng: " Luật (Vinaya) đã được thuyết giảng và chế định."
Adhisīlasikkhāniddesabhāvena sāsanassa mūlabhūtattā vinayo paṭhamaṃ sikkhitabboti taṃ tāva ayamuddesaṃ sarūpato dassento ‘‘mayā hi vo’’tiādimāha.
Because the Vinaya forms the root of the Dispensation, being the detailed exposition of the training in higher morality (Adhisīlasikkhā), it should be learned first. Therefore, desiring to show that Vinaya itself as the uddesa (statement of the subject), the teacher said, " For by me..." and so on.
Vì Luật là nền tảng của Giáo Pháp do sự trình bày chi tiết về giới học (adhisīla-sikkhā), nên Luật cần được học trước tiên. Để trình bày bản chất của Luật đó, Sư Phụ đã nói: " Này các tỳ khưu, Ta đã..." và các câu tiếp theo.
Tattha sattāpattikkhandhavasenāti sattannaṃ āpattikkhandhānaṃ avītikkamanīyatāvasena.
Therein, sattāpattikkhandhavasenāti means by way of not transgressing the seven groups of offenses (āpattikkhandha).
Trong đó, sattāpattikkhandhavasenā (theo bảy uẩn tội) có nghĩa là theo sự không vi phạm bảy uẩn tội.
Satthukiccaṃ sādhessati ‘‘idaṃ vo kattabbaṃ, idaṃ vo na kattabba’’nti kattabbākattabbassa vibhāgena anusāsanato.
" Will fulfill the task of the Teacher" because of instructing by distinguishing what should be done and what should not be done, saying, "This should be done by you, this should not be done by you."
Satthukiccaṃ sādhessati (sẽ hoàn thành phận sự của một Bậc Đạo Sư) là do sự giáo huấn phân biệt điều nên làm và không nên làm, rằng: "Điều này các con nên làm, điều này các con không nên làm."
Tena tenākārenāti tena tena veneyyānaṃ ajjhāsayānurūpena pakārena.
Tena tenākārenāti means in such and such a way, according to the inclinations of the trainees.
Tena tenākārenā (bằng nhiều phương cách đó) có nghĩa là bằng những phương cách phù hợp với căn tánh của những người có thể được giáo hóa.
Ime dhammeti ime sattatiṃsabodhipakkhiyadhamme.
Ime dhammeti means these thirty-seven factors of enlightenment (bodhipakkhiyadhamme).
Ime dhamme (các pháp này) là ba mươi bảy pháp trợ Bồ-đề này.
Tappadhānattā suttantadesanāya ‘‘suttantapiṭakaṃ desita’’nti vuttaṃ.
It is said, " the Suttanta Piṭaka has been discoursed" because the Suttanta discourses are primarily concerned with them.
Do sự ưu việt của các pháp này trong giáo pháp kinh tạng, nên đã nói rằng: " Kinh tạng đã được thuyết giảng."
Satthukiccaṃ sādhessati taṃtaṃcariyānurūpaṃ sammāpaṭipattiyā anusāsanato.
" Will fulfill the task of the Teacher" because of instructing in right practice according to their respective dispositions.
Satthukiccaṃ sādhessati (sẽ hoàn thành phận sự của một Bậc Đạo Sư) là do sự giáo huấn về chánh hạnh phù hợp với từng hạnh nghiệp.
Kusalākusalābyākatavasena nava hetū.
Nine roots (hetu) by way of wholesome, unwholesome, and indeterminate.
Nava hetū (chín nhân) là theo ba loại thiện, bất thiện và vô ký.
‘‘Satta phassā’’tiādi sattaviññāṇadhātusampayogavasena vuttaṃ.
" Seven contacts" (satta phassā) and so on, are said by way of their association with the seven consciousness-elements (viññāṇadhātu).
Câu " Satta phassā" (bảy xúc) và các câu tiếp theo được nói theo sự tương ưng của bảy thức giới.
Dhammānulome tikapaṭṭhānādayo cha, tathā dhammapaccanīye, dhammānulomapaccanīye, dhammapaccanīyānulometi catuvīsati samantapaṭṭhānāni etassāti catuvīsatisamantapaṭṭhānaṃ, taṃ pana paccayānulomādivasena vibhajiyamānaṃ aparimāṇanayaṃ evāti āha ‘‘anantanayamahāpaṭṭhānapaṭimaṇḍita’’nti.
There are six beginning with Tika-Paṭṭhāna and so on in Dhammānuloma, similarly in Dhammapaccanīya, Dhammānulomapaccanīya, and Dhammapaccanīyānuloma, making twenty-four comprehensive Paṭṭhānas. This (system) is called catuvīsatisamantapaṭṭhānaṃ. Since this, when analyzed by way of paccayānuloma and so on, has an immeasurable method (naya), it is said, " adorned with the great Paṭṭhāna of infinite methods."
Sáu pháp như Tikapaṭṭhāna (Pháp Tam) trong Dhammānuloma (Thuận Pháp), và tương tự sáu pháp trong Dhammapaccanīya (Nghịch Pháp), Dhammānulomapaccanīya (Thuận Nghịch Pháp), Dhammapaccanīyānuloma (Nghịch Thuận Pháp), như vậy có hai mươi bốn catuvīsatisamantapaṭṭhāna (Pháp Vị Trí Toàn Diện Hai Mươi Bốn) này. Và khi được phân chia theo Paccayānuloma (Thuận Duyên) và các pháp khác, thì đó là vô số phương pháp, nên đã nói rằng: " anantanayamahāpaṭṭhānapaṭimaṇḍita (được trang hoàng bởi Đại Vị Trí Vô Số Phương Pháp)."
Satthukiccaṃ sādhessatīti khandhādivibhāgena ñāyamānaṃ catusaccasambodhāvahattā satthārā sammāsambuddhena kātabbakiccaṃ nipphādessati.
" Will fulfill the task of the Teacher" means it will accomplish the task that should be done by the Teacher, the Perfectly Enlightened One (Sammāsambuddha), because, when understood by way of the analysis of aggregates (khandha) and so on, it brings about the full comprehension of the Four Noble Truths.
Satthukiccaṃ sādhessatīti (sẽ hoàn thành phận sự của một Bậc Đạo Sư) có nghĩa là sẽ hoàn thành phận sự mà Đức Chánh Đẳng Giác, Bậc Đạo Sư, phải làm, vì khi được hiểu rõ qua sự phân chia các uẩn và các pháp khác, thì nó dẫn đến sự giác ngộ Tứ Diệu Đế.
‘‘Ākaṅkhamāno samūhanatū’’ti vutte ‘‘na ākaṅkhamāno na samūhanatū’’tipi vuttameva hotīti āha ‘‘vikappavacaneneva ṭhapesī’’ti.
When it is said, "Should the Sangha so desire, let them abolish them," it is also said, "If they do not desire, let them not abolish them." Therefore, it is said, " He established it with a conditional statement."
Khi nói "Ākaṅkhamāno samūhanatu" (nếu muốn, hãy bãi bỏ), thì cũng có nghĩa là "nếu không muốn, đừng bãi bỏ", nên đã nói rằng: " vikappavacaneneva ṭhapesī (chỉ thiết lập bằng lời nói tùy chọn)."
Balanti ñāṇabalaṃ.
Bala means the power of knowledge (ñāṇabala).
Bala (sức mạnh) là sức mạnh trí tuệ (ñāṇabala).
Yadi asamūhananaṃ diṭṭhaṃ, tadeva ca icchitaṃ, atha kasmā bhagavā ‘‘ākaṅkhamāno samūhanatū’’ti avocāti?
If non-abolition was seen, and that very thing was desired, then why did the Blessed One say, "Should the Sangha so desire, let them abolish them"?
Nếu sự không bãi bỏ đã được thấy, và đó cũng là điều mong muốn, vậy tại sao Đức Thế Tôn lại nói: "Nếu muốn, hãy bãi bỏ"?
Tathārūpapuggalajjhāsayavasena.
It was due to the disposition of such individuals.
Là tùy theo căn tánh của những người như vậy.
Santi hi keci khuddānukhuddakāni sikkhāpadāni samādāya saṃvattituṃ anicchantā, tesaṃ tathā avuccamāne bhagavati vighāto uppajjeyya, taṃ tesaṃ bhavissati dīgharattaṃ ahitāya dukkhāya, tathā pana vutte tesaṃ vighāto na uppajjeyya ‘‘amhākaṃ evāyaṃ doso, yato amhesu eva keci samūhananaṃ na icchantī’’ti.
For there are some who do not desire to practice by undertaking the minor and sub-minor training rules (sikkhāpadāni). If it were not said in that way for them, displeasure might arise in them towards the Blessed One, and that would be for their long-term harm and suffering. However, if it were said in that way, no displeasure would arise in them, thinking, "This fault is ours alone, that some among us do not desire to abolish them."
Thật vậy, có một số người không muốn thọ trì và thực hành các giới luật nhỏ và phụ. Nếu Đức Thế Tôn không nói như vậy, họ có thể phát sinh sự bất mãn đối với Đức Thế Tôn, điều đó sẽ gây hại và đau khổ cho họ trong một thời gian dài. Nhưng khi nói như vậy, họ sẽ không phát sinh sự bất mãn, (họ sẽ nghĩ): "Đây là lỗi của chúng ta, vì trong số chúng ta có một số người không muốn bãi bỏ (các giới luật nhỏ và phụ)."
Keci ‘‘sakalassa pana sāsanassa saṅghāyattabhāvakaraṇatthaṃ tathā vutta’’nti vadanti.
Some say, "It was said in that way to make the entire Dispensation dependent on the Saṅgha."
Một số người nói rằng: "Lời dạy đó được nói để toàn bộ Giáo Pháp thuộc về Tăng đoàn."
Yañca kiñci satthārā sikkhāpadaṃ paññattaṃ, taṃ samaṇā sakyaputtiyā sirasā sampaṭicchitvā jīvitaṃ viya rakkhanti.
Whatever training rule was laid down by the Teacher, the Sakyan recluses (samaṇā sakyaputtiyā) accepted it with their heads and guarded it as their very life.
Bất kỳ giới luật nào Đức Đạo Sư đã chế định, các Sa-môn Thích Tử đều cung kính thọ trì và bảo vệ như mạng sống của mình.
Tathā hi te ‘‘khuddānukhuddakāni sikkhāpadāni ākaṅkhamāno saṅgho samūhanatū’’ti vuttepi na samūhaniṃsu, aññadatthu ‘‘purato viya tassa accayepi rakkhiṃsu evā’’ti satthusāsanassa, saṅghassa ca mahantabhāvadassanatthampi tathā vuttanti daṭṭhabbaṃ.
Thus, even when it was said, "Should the Saṅgha so desire, let them abolish the minor and sub-minor training rules," they did not abolish them; on the contrary, they guarded them even after his passing, just as they would have done in his presence. It should be understood that it was said in that way to show the greatness of both the Teacher's Dispensation and the Saṅgha.
Thật vậy, ngay cả khi Đức Phật nói: "Nếu Tăng đoàn muốn, hãy bãi bỏ các giới luật nhỏ và phụ", họ cũng không bãi bỏ, mà ngược lại, họ đã bảo vệ chúng như thể Đức Phật vẫn còn tại thế, ngay cả sau khi Ngài đã nhập Niết-bàn. Vì vậy, cần phải hiểu rằng lời dạy đó cũng được nói để thể hiện sự vĩ đại của Giáo Pháp của Đức Đạo Sư và của Tăng đoàn.
Tathā hi āyasmā ānando, aññepi vā bhikkhū ‘‘katamaṃ pana bhante khuddakaṃ, katamaṃ anukhuddaka’’nti na pucchiṃsu samūhanajjhāsayasseva abhāvato.
Thus, Venerable Ānanda, and other bhikkhus, did not ask, "Bhante, which are the minor, and which are the sub-minor?" because there was no desire to abolish them.
Thật vậy, Tôn giả Ānanda và các tỳ khưu khác đã không hỏi: "Bạch Đức Thế Tôn, giới luật nhỏ là gì, và giới luật phụ là gì?", vì họ không có ý định bãi bỏ.
Na taṃ evaṃ gahetabbanti ‘‘nāgasenatthero khuddānukhuddakaṃ jānātī’’tiādinā vuttaṃ taṃ nesaṃ vacanaṃ iminā vuttākārena na gahetabbaṃ adhippāyassa aviditattā.
Na taṃ evaṃ gahetabbanti means that statement of those (teachers), which was said, for example, "Venerable Nāgasena knows the minor and sub-minor rules," should not be taken in the manner stated by them, due to not knowing their intention.
Na taṃ evaṃ gahetabba (không nên hiểu như vậy) có nghĩa là lời nói đó của một số vị Sư, được nói rằng "Trưởng lão Nāgasena biết giới luật nhỏ và phụ" và các câu tương tự, không nên được hiểu theo cách mà các vị Sư đó đã nói, vì ý nghĩa thực sự của lời nói đó chưa được biết.
Idāni taṃ adhippāyaṃ vibhāvetuṃ ‘‘nāgasenatthero hī’’tiādi vuttaṃ.
Now, to explain that intention, it is said, " For Venerable Nāgasena," and so on.
Bây giờ, để trình bày rõ ý nghĩa đó, đã nói rằng: " Trưởng lão Nāgasena" và các câu tiếp theo.
Yasmā nāgasenatthero (milindapañhe abhejjavagge vitthāro) paresaṃ vādapathopacchedanatthaṃ saṅgītikāle dhammasaṅgāhakamahātherehi gahitakoṭṭhāsesu ca antimakoṭṭhāsameva gahetvā milindarājānaṃ paññāpesi.
Because Venerable Nāgasena (the detailed account is in the Abhejjavagga of the Milindapañha), for the purpose of cutting off the paths of argument of others, took only the very last portion from the portions taken by the Mahātheras who chanted the Dhamma during the Saṅgīti, and enlightened King Milinda.
Vì Trưởng lão Nāgasena (chi tiết trong Abhejjavagga của Milindapañha) đã chỉ lấy phần cuối cùng trong các phần được các Đại Trưởng lão kết tập Pháp trong thời kỳ kết tập để cắt đứt luận điểm của người khác và đã giải thích cho vua Milinda.
Mahākassapatthero pana ekasikkhāpadampi asamūhanitukāmatāya tathā kammavācaṃ sāveti, tasmā taṃ tesaṃ vacanaṃ tathā na gahetabbaṃ.
However, Venerable Mahākassapa, desiring not to abolish even a single training rule, caused the kammavācā to be recited in that way. Therefore, that statement of theirs should not be taken in that way.
Còn Trưởng lão Mahākassapa thì không muốn bãi bỏ dù chỉ một giới luật, nên đã tuyên đọc Kammavācā (lời tác bạch) như vậy. Do đó, lời nói đó của các vị Sư không nên được hiểu như vậy.
231. Pāvāyāti pāvā nagarato.
231. Pāvāyā means from the city of Pāvā.
231. Pāvāyā (từ Pāvā) là từ thị trấn Pāvā.
Āvajjanapaṭibaddhattā jānanassa anāvajjitattā satthu parinibbānaṃ ajānanto ‘‘dasabalaṃ passissāmī’’ti thero cintesi, satthu sarīre vā satthusaññaṃ uppādento tathā cintesi.
Being bound to attention, due to not attending, the Elder did not know of the Master's Parinibbāna, and thought, ‘‘I will see the Ten-Powered One (Buddha)’’. Or, generating the perception of the Master in the Master's body, he thought that way.
Do sự nhận thức bị ràng buộc bởi sự chú ý, và do không chú ý, Trưởng lão đã không biết về sự viên tịch của Đức Thế Tôn, và nghĩ rằng “con sẽ thấy Đức Thập Lực”. Hoặc Trưởng lão đã nghĩ như vậy, tạo ra ý niệm về Đức Thế Tôn trong nhục thân của Ngài.
Tenevāha ‘‘atha bhagavantaṃ ukkhipitvā’’ti.
It is for this reason that it says, ‘‘Then, having picked up the Blessed One’’.
Vì vậy nói rằng “sau khi nâng Đức Thế Tôn lên”.
‘‘Dhuvaṃ parinibbuto bhavissatī’’ti cintesi pārisesañāyena.
‘‘He must certainly have attained Parinibbāna,’’ he thought, by the method of inference.
“Dhuvaṃ parinibbuto bhavissatī”ti cintesi (chắc chắn Ngài đã viên tịch) là suy nghĩ theo phép suy luận còn lại.
Jānantopi thero ājīvakaṃ pucchiyeva, pucchane pana kāraṇaṃ sayameva pakāsetuṃ ‘‘kiṃ panā’’tiādi āraddhaṃ.
Even though the Elder knew, he still asked the Ājīvaka. The reason for asking, however, is to reveal it himself, thus the passage ‘‘kiṃ panā’’ and so on, has been started.
Mặc dù đã biết, Trưởng lão vẫn hỏi Ajīvaka. Lý do của việc hỏi được chính* bắt đầu bằng “kiṃ panā” (nhưng tại sao) và tiếp tục để làm rõ.
Pañhavārāti pañhā viya vissajjanāni ‘‘yasmiṃ samaye kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hotī’’tiādinā, (dha. sa. 1.1) ‘‘yasmiṃ samaye rūpūpapattiyā maggaṃ bhāvetī’’tiādinā (dha. sa. 1.251) ca pavattāni ekaṃ dve bhūmantarāni. Mūle naṭṭhe pisācasadisā bhavissāmāti yathā rukkhe adhivattho pisāco tassa sākhāparivāre naṭṭhe khandhaṃ nissāya vasati, khandhe naṭṭhe mūlaṃ nissāya vasati, mūle pana naṭṭhe anissayova hoti, tathā bhavissāmāti attho.
Pañhavārā means question-like answers, such as those that appear with ‘‘at what time a wholesome consciousness arises in the sense-sphere’’ and ‘‘at what time one develops the path to rebirth in the fine-material sphere’’, are one or two categories of states. If the root is destroyed, we shall be like pisācas. This means that just as a pisāca residing in a tree lives by clinging to the trunk when its branches and foliage are destroyed, and lives by clinging to the root when the trunk is destroyed, but when the root is destroyed, it becomes without support; we shall be like that.
Pañhavārā (các câu hỏi) là các câu trả lời giống như các câu hỏi, như “vào lúc nào tâm thiện dục giới sinh khởi” (Dhs. 1.1), “vào lúc nào tu tập con đường dẫn đến sự tái sinh trong cõi sắc” (Dhs. 1.251) – đó là một hoặc hai bhūmantara (cảnh giới khác biệt). Mūle naṭṭhe pisācasadisā bhavissāmā (khi gốc bị phá hủy, chúng ta sẽ giống như pisāca) có nghĩa là giống như một pisāca trú ngụ trong cây, khi các cành và tán lá của nó bị phá hủy, nó nương vào thân cây; khi thân cây bị phá hủy, nó nương vào gốc cây; nhưng khi gốc cây bị phá hủy, nó trở nên không có nơi nương tựa. Chúng ta sẽ trở thành như vậy.
Atha vā mūle naṭṭheti pisācena kira rukkhagacchādīnaṃ kañcideva mūlaṃ chinditvā attano puttassa dinnaṃ, yāva taṃ tassa hatthato na vigacchati, tāva so taṃ padesaṃ adissamānarūpo vicarati.
Alternatively, regarding mūle naṭṭhe, it is said that a pisāca cut off some root of a tree or bush and gave it to its son. As long as that root does not leave his hand, he moves about in that area unseen.
Hoặc, mūle naṭṭhe (khi gốc bị phá hủy) – người ta nói rằng một pisāca đã cắt một gốc cây hoặc bụi cây nào đó và đưa cho con trai mình. Chừng nào gốc cây đó chưa rời khỏi tay nó, chừng đó nó vẫn đi lại trong khu vực đó với hình dạng vô hình.
Yadā pana tasmiṃ kenaci acchinnabhāvena vā sativippavāsavasena vā naṭṭhe manussānampi dissamānarūpo vicarati, taṃ sandhāyāha ‘‘mūle naṭṭhe pisācasadisā bhavissāmā’’ti.
But when it is lost, either by someone taking it away or by him losing mindfulness, he moves about visible even to humans. Referring to that, it is said, ‘‘mūle naṭṭhe pisācasadisā bhavissāmā’’ (if the root is destroyed, we shall be like pisācas).
Nhưng khi gốc cây đó bị mất do ai đó cướp đi hoặc do mất cảnh giác, thì nó lại đi lại với hình dạng hữu hình đối với con người. Điều này được ám chỉ khi nói “mūle naṭṭhe pisācasadisā bhavissāmā” (khi gốc bị phá hủy, chúng ta sẽ giống như pisāca).
Dhammakathāva pamāṇanti ativiya acchariyabbhutabhāvato passantānaṃ, suṇantānañca sātisayaṃ pasādāvahabhāvato, savisesaṃ buddhānubhāvadīpanato.
Dhammakathāva pamāṇaṃ means that due to their exceedingly amazing and wondrous nature for those who see and hear them, and their special ability to generate profound confidence, and their specific display of the Buddha’s power.
Dhammakathāva pamāṇaṃ (chỉ có Pháp thoại là tiêu chuẩn) là do sự phi thường và kỳ diệu tột độ, do mang lại sự thanh tịnh đặc biệt cho những người nhìn và nghe, và do thể hiện uy lực đặc biệt của Đức Phật.
Parinibbutassa hi buddhassa bhagavato evarūpo ānubhāvoti taṃ pavattiṃ kathentānaṃ dhammakathikānaṃ attano ñāṇabalānurūpaṃ pavattiyamānā dhammakathā evettha pamāṇaṃ vaṇṇetabbassa atthassa mahāvisayattā, tasmā vaṇṇanābhūmi nāmesāti adhippāyo.
Indeed, such was the power of the Blessed One, the Buddha who had attained Parinibbāna; thus, the Dhamma discourse delivered by the Dhamma preachers, according to the strength of their knowledge, is the standard here, because the subject matter to be described is vast. Therefore, the intention is that it is a basis for description.
Thật vậy, uy lực của Đức Phật đã viên tịch là như vậy, vì vậy đối với các Pháp sư kể lại sự kiện đó, Pháp thoại được thuyết giảng phù hợp với trí tuệ và sức mạnh của họ là tiêu chuẩn ở đây, vì đối tượng cần mô tả là rất rộng lớn. Vì vậy, ý nghĩa là đây là một nền tảng để mô tả.
Catujjātiyagandhaparibhaṇḍaṃ kāretvāti tagarakuṅkumayavanapupphatamālapattāni pisitvā katagandhena paribhaṇḍaṃ kāretvā.
Catujjātiyagandhaparibhaṇḍaṃ kāretvā means having prepared adornments with perfumes made by grinding tagara, kuṅkuma, yavana, flowers, and leaves.
Catujjātiyagandhaparibhaṇḍaṃ kāretvā (sau khi làm đồ trang sức bằng bốn loại hương) là sau khi làm đồ trang sức bằng hương nghiền từ tagara, nghệ tây, hoa lài và lá.
Khacitvāti tattha tattha olambanavasena racetvā, gandhavatthūni gahetvā ganthitamālā gandhadāmāni ratanāvaḷiyo ratanadāmāni. Bahikilañjaparikkhepassa, antosāṇiparikkhepassa karaṇena sāṇikilañjaparikkhepaṃ kāretvā. Vātaggāhiniyo paṭākā vātapaṭākā. Sarabharūpapādako pallaṅko sarabhamayapallaṅko, tasmiṃ sarabhamayapallaṅke.
Khacitvā means having arranged them in various places to hang. Garlands made by taking fragrant substances are gandhadāmāni (garlands of perfume). Rows of jewels are ratanadāmāni (garlands of jewels). By making an outer enclosure of carpets and an inner enclosure of cloth, it is sāṇikilañjaparikkhepaṃ kāretvā (having made an enclosure of cloth and carpets). Banners that catch the wind are vātapaṭākā (wind banners). A couch made of a sarabha (a mythical creature) is a sarabhamayapallaṅko, on that sarabhamayapallaṅke (sarabha-couch).
Khacitvā (sau khi trang trí) là sau khi sắp xếp chúng ở nhiều nơi dưới dạng treo. Các vòng hoa được kết bằng vật liệu thơm là gandhadāmāni (vòng hoa thơm). Các chuỗi ngọc là ratanadāmāni (chuỗi ngọc). Bằng cách làm một hàng rào bên ngoài và một hàng rào bằng vải bên trong, gọi là sāṇikilañjaparikkhepaṃ kāretvā (sau khi làm hàng rào bằng vải và thảm). Các lá cờ đón gió là vātapaṭākā (cờ gió). Một chiếc ghế bành có hình con sarabha là sarabhamayapallaṅka, trên đó sarabhamayapallaṅke (trên chiếc ghế bành bằng sarabha).
237. Doṇagajjitaṃ nāma avoca satthu avatthattayūpasaṃhitaṃ.
237. Dona's roar refers to that which contained three temporal aspects of the Teacher.
237. Doṇagajjitaṃ nāma avoca (đã nói lời rống của Doṇa) liên quan đến ba giai đoạn của Đức Đạo Sư.
Etadatthameva hi bhagavā maggaṃ gacchanto ‘‘pacchato āgacchanto doṇo brāhmaṇo yāva me padavaḷañjaṃ passati, tāva mā vigacchatū’’ti adhiṭṭhāya aññatarasmiṃ rukkhamūle nisīdi.
For this very purpose, the Blessed One, while traveling on the path, sat at the foot of a certain tree, having resolved: "Let not the Brahmin Dona, who is coming from behind, disappear as long as he sees my footprint."
Chính vì mục đích này mà Đức Thế Tôn, khi đang đi trên đường, đã an trú ý nguyện rằng “Doṇa, vị Bà-la-môn đang đi theo sau, chớ có biến mất cho đến khi nhìn thấy dấu chân của ta”, rồi Ngài ngồi dưới gốc cây nào đó.
Doṇopi kho brāhmaṇo ‘‘imāni sadevake loke aggapuggalassa padānī’’ti sallakkhento padānusārena satthu santikaṃ upagacchi, satthāpissa dhammaṃ desesi, tenapi so bhagavati niviṭṭhasaddho ahosi.
The Brahmin Dona, realizing "these are the footprints of the foremost person in the world with its deities," followed the footprints and approached the Teacher, and the Teacher taught him the Dhamma; by that, he became one whose faith was established in the Blessed One.
Vị Bà-la-môn Doṇa, nhận ra rằng “đây là dấu chân của bậc tối thượng trong thế giới có chư thiên”, đã đi theo dấu chân đến gần Đức Đạo Sư, và Đức Đạo Sư đã thuyết Pháp cho ông ấy, nhờ đó ông ấy cũng có niềm tin kiên cố vào Đức Thế Tôn.
Etadavoca, kiṃ avocāti āha ‘‘suṇantu…pe… avocā’’ti.
He uttered this. What did he utter? It is said: "Listen... and so on... he uttered."
Ông ấy đã nói điều này. Ông ấy đã nói điều gì? Câu “Hãy lắng nghe…v.v… đã nói” được nói ra.
Pacchā saṅgītikārakāti dutiyaṃ tatiyaṃ saṅgītikārakā.
Later compilers of the Saṅgīti means the compilers of the second and third Saṅgīti.
Pacchā saṅgītikārakā (những người làm công việc kết tập sau này) có nghĩa là những người làm công việc kết tập lần thứ hai và thứ ba.
Dhātūnaṃ antarāyaṃ disvāti tattha tattha cetiye yathāpatiṭṭhāpitabhāveneva ṭhitānaṃ dhātūnaṃ micchādiṭṭhikānaṃ vasena antarāyaṃ disvā, mahādhātunidhānena sammadeva rakkhitānaṃ anāgate asokena dhammaraññā tato uddharitvā vitthāritabhāve kate sadevakassa lokassa hitasukhāvahabhāvañca disvāti adhippāyo.
Having seen danger to the relics means having seen danger to the relics, which were established in cetiyas here and there just as they had been enshrined, due to those of wrong view, and having seen that it would bring benefit and happiness to the world with its deities if, in the future, King Dhammāsoka were to remove them from there and spread them widely, protected well by a great relic deposit—this is the intention.
Dhātūnaṃ antarāyaṃ disvā (thấy được nguy hiểm cho Xá lợi) có nghĩa là thấy được nguy hiểm cho Xá lợi do những kẻ tà kiến gây ra, khi những Xá lợi đó vẫn còn được an trí trong các tháp thờ ở khắp nơi; và ý nghĩa là, khi vua chánh pháp Asoka sau này đã lấy Xá lợi từ nơi cất giữ Xá lợi lớn được bảo vệ cẩn thận và phân tán rộng rãi, điều đó sẽ mang lại lợi ích và hạnh phúc cho toàn thể thế giới có chư thiên.
Paricaraṇamattamevāti gahetvā paricaritabbadhātumattameva.
Only the portion for veneration means only the quantity of relics to be taken and venerated.
Paricaraṇamattamevā (chỉ để thờ cúng) có nghĩa là chỉ những Xá lợi cần được lấy ra để thờ cúng.
Rājūnaṃ hatthe ṭhapetvā, na cetiyesu.
Having placed them in the hands of kings, not in cetiyas.
Ṭhapetvā (đặt) vào tay các vị vua, không phải trong các tháp thờ.
Tathā hi pacchā asokamahārājā cetiyesu dhātūnaṃ na labhati.
Indeed, afterwards, King Asoka did not obtain relics from the cetiyas.
Thật vậy, sau này vua Asoka Đại đế đã không tìm thấy Xá lợi trong các tháp thờ.