Imissā paṭhamamahāsaṅgītiyā vattamānāya vinayasaṅgahāvasāne suttantapiṭake ādinikāyassa ādisuttaṃ brahmajālaṃ pucchantena āyasmatā mahākassapena – ‘‘brahmajālaṃ, āvuso ānanda, kattha bhāsita’’nti, evamādivuttavacanapariyosāne yattha ca bhāsitaṃ, yañcārabbha bhāsitaṃ, taṃ sabbaṃ pakāsento āyasmā ānando evaṃ me sutantiādimāha.
When this First Great Saṅgīti was taking place, at the end of the Vinaya collection, the Venerable Ānanda, revealing everything concerning where the Brahmajāla Sutta (the first sutta of the first nikāya in the Suttanta Piṭaka) was spoken and with reference to whom it was spoken, stated “Evaṃ me sutaṃ” (Thus have I heard) and so on, after the Venerable Mahākassapa had asked, “Venerable Ānanda, where was the Brahmajāla spoken?” and so on, finishing his words.
Khi Đại Kết Tập lần thứ nhất này đang diễn ra, vào cuối phần kết tập Luật, sau khi Tôn giả Mahākassapa hỏi về kinh Phạm Võng, bài kinh đầu tiên của Bộ Nikāya đầu tiên trong Tạng Kinh, bằng cách nói “Này Hiền giả Ānanda, kinh Phạm Võng được thuyết ở đâu?” v.v., và khi những lời này kết thúc, Tôn giả Ānanda đã nói “Như vầy tôi nghe” v.v., để công bố tất cả những gì đã được thuyết và về ai.
Tena vuttaṃ ‘‘brahmajālassāpi evaṃ me sutantiādikaṃ āyasmatā ānandena paṭhamamahāsaṅgītikāle vuttaṃ nidānamādī’’ti.
Therefore, it is said, “The nidāna (introduction) of the Brahmajāla, beginning with ‘Evaṃ me sutaṃ,’ was spoken by the Venerable Ānanda during the First Great Saṅgīti.”
Do đó, đã nói rằng “Phần mở đầu của kinh Phạm Võng, bắt đầu bằng ‘Như vầy tôi nghe,’ đã được Tôn giả Ānanda nói trong thời điểm Đại Kết Tập lần thứ nhất.”
Atthato pana evaṃ-saddo tāva upamūpadesasampahaṃsanagarahaṇavacanasampaṭiggahākāranidassanāvadhāraṇādianekatthappabhedo.
In terms of meaning, the word evaṃ has many distinctions of meaning, such as simile, instruction, praise, blame, acceptance of a statement, manner, indication, and emphasis.
Về ý nghĩa, từ evaṃ có nhiều nghĩa khác nhau như ví dụ, chỉ dẫn, tán thán, chỉ trích, chấp nhận lời nói, cách thức, minh họa, và khẳng định.
Tathāhesa – ‘‘evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu’’nti (dha. pa. 53) evamādīsu upamāyaṃ āgato.
Thus, it appears in similes in phrases like “evaṃ jātena maccena, kattabbaṃ kusalaṃ bahu (One thus born a mortal should do much good)” and so on.
Quả thật, nó xuất hiện với nghĩa ví dụ trong các câu như “Với một người đã sinh ra như vậy, phải làm nhiều việc thiện” (Dhp. 53).
‘‘Evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabba’’ntiādīsu (a. ni. 4.122) upadese.
In instructions, in phrases like “evaṃ te abhikkamitabbaṃ, evaṃ te paṭikkamitabbaṃ (Thus should you go forward, thus should you retreat)” and so on.
Với nghĩa chỉ dẫn trong các câu như “ Như vậy ngươi phải tiến tới, như vậy ngươi phải lùi lại” (A. IV, 122).
‘‘Evametaṃ bhagavā, evametaṃ sugatā’’tiādīsu (a. ni. 3.66) sampahaṃsane.
In praise, in phrases like “Evametaṃ bhagavā, evametaṃ sugatā (So it is, Blessed One; so it is, Fortunate One)” and so on.
Với nghĩa tán thán trong các câu như “ Đúng vậy, bạch Thế Tôn, đúng vậy, bạch Thiện Thệ” (A. III, 66).
‘‘Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī’’tiādīsu (saṃ. ni. 1.187) garahaṇe.
In blame, in phrases like “Evamevaṃ panāyaṃ vasalī yasmiṃ vā tasmiṃ vā tassa muṇḍakassa samaṇakassa vaṇṇaṃ bhāsatī (Indeed, this wretch speaks praise of that shaven-headed ascetic on every occasion)” and so on.
Với nghĩa chỉ trích trong các câu như “ Như vậy là người tiện nữ này nói lời ca ngợi vị Sa-môn đầu trọc đó ở bất cứ đâu” (S. I, 187).
‘‘Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosu’’ntiādīsu (ma. ni. 1.1) vacanasampaṭiggahe.
In acceptance of a statement, in phrases like “Evaṃ, bhanteti kho te bhikkhū bhagavato paccassosuṃ (The bhikkhus, indeed, replied to the Blessed One, ‘Yes, venerable sir’),” and so on.
Với nghĩa chấp nhận lời nói trong các câu như “ Thưa vâng, bạch Thế Tôn, các Tỳ-khưu ấy đã vâng lời Thế Tôn” (M. I, 1).
‘‘Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādīsu (ma. ni. 1.398) ākāre.
In manner, in phrases like “Evaṃ byā kho ahaṃ, bhante, bhagavatā dhammaṃ desitaṃ ājānāmī (Indeed, venerable sir, I understand the Dhamma taught by the Blessed One in this manner)” and so on.
Với nghĩa cách thức trong các câu như “ Như vậy, bạch Thế Tôn, con hiểu pháp được Thế Tôn thuyết” (M. I, 398).
‘‘Ehi tvaṃ, māṇavaka, yena samaṇo ānando tenupasaṅkama, upasaṅkamitvā mama vacanena samaṇaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ puccha.
“Come, young man, approach the recluse Ānanda, and having approached, ask the recluse Ānanda in my name about his freedom from serious illness, his freedom from minor ailments, his lightness of body, his strength, and his dwelling at ease.
“Này thanh niên, hãy đi đến nơi Sa-môn Ānanda đang ở, sau khi đến đó, hãy thay lời ta hỏi thăm Sa-môn Ānanda về sự không bệnh tật nặng, không đau đớn nhỏ, sự nhẹ nhàng trong đi đứng, sức khỏe, và sự an trú thoải mái.
‘‘Subho māṇavo todeyyaputto bhavantaṃ ānandaṃ appābādhaṃ appātaṅkaṃ lahuṭṭhānaṃ balaṃ phāsuvihāraṃ pucchatī’’ti.
‘The young man Subha, son of Todeyya, asks about Venerable Ānanda’s freedom from serious illness, his freedom from minor ailments, his lightness of body, his strength, and his dwelling at ease.’
Thanh niên Subha, con trai của Todeyya, hỏi thăm Tôn giả Ānanda về sự không bệnh tật nặng, không đau đớn nhỏ, sự nhẹ nhàng trong đi đứng, sức khỏe, và sự an trú thoải mái.”
‘‘Evañca vadehi, sādhu kira bhavaṃ ānando yena subhassa māṇavassa todeyyaputtassa nivesanaṃ, tenupasaṅkamatu anukampaṃ upādāyā’’tiādīsu (dī. ni. 1.445) nidassane.
And say this: ‘May Venerable Ānanda, out of compassion, please approach the residence of the young man Subha, son of Todeyya.’”—in such instances of demonstration.
“Và hãy nói như thế này: ‘Xin Tôn giả Ānanda vì lòng từ bi mà hãy đến tư gia của thanh niên Subha, con trai của Todeyya’.” Trong các ví dụ như vậy, từ evaṃ được dùng để chỉ sự trình bày.
‘‘Taṃ kiṃ maññatha, kālāmā, ime dhammā kusalā vā akusalā vāti?
“What do you think, Kālāmas? Are these things wholesome or unwholesome?”
“Các người nghĩ sao, này các người Kālāma, những pháp này là thiện hay bất thiện?”
Akusalā, bhante.
“Unwholesome, venerable sir.”
“Bạch Thế Tôn, là bất thiện.”
Sāvajjā vā anavajjā vāti?
“Blameworthy or blameless?”
“Có tội hay không có tội?”
Sāvajjā, bhante.
“Blameworthy, venerable sir.”
“Bạch Thế Tôn, có tội.”
Viññugarahitā vā viññuppasatthā vāti?
“Censured by the wise or praised by the wise?”
“Bị người trí khiển trách hay được người trí tán thán?”
Viññugarahitā, bhante.
“Censured by the wise, venerable sir.”
“Bạch Thế Tôn, bị người trí khiển trách.”
Samattā samādinnā ahitāya dukkhāya saṃvattanti no vā, kathaṃ vo ettha hotīti?
“When undertaken and practiced, do they lead to harm and suffering or not? How does it seem to you in this matter?”
“Khi được thực hành và chấp giữ, chúng có đưa đến bất lợi và khổ đau hay không? Các người nghĩ sao về điều này?”
Samattā, bhante, samādinnā ahitāya dukkhāya saṃvattanti, evaṃ no ettha hotī’’tiādīsu (a. ni. 3.66) avadhāraṇe.
“When undertaken and practiced, venerable sir, they lead to harm and suffering. That is how it seems to us in this matter.”—in such instances of ascertainment.
“Bạch Thế Tôn, khi được thực hành và chấp giữ, chúng đưa đến bất lợi và khổ đau. Chúng con nghĩ về điều này như vậy.” Trong các ví dụ như vậy, từ evaṃ được dùng để chỉ sự xác định.
Svāyamidha ākāranidassanāvadhāraṇesu daṭṭhabbo.
Thus, here, this term should be understood in the senses of manner, demonstration, and ascertainment.
Do đó, từ này ở đây nên được hiểu theo nghĩa của cách thức, sự trình bày và sự xác định.
Avadhāraṇatthena – ‘‘etadaggaṃ, bhikkhave, mama sāvakānaṃ bhikkhūnaṃ bahussutānaṃ yadidaṃ ānando, gatimantānaṃ, satimantānaṃ, dhitimantānaṃ, upaṭṭhākānaṃ yadidaṃ ānando’’ti (a. ni. 1.223).
In the sense of ascertainment—‘‘Among my monastic disciples who are learned, Ānanda is foremost; among those with insight, among those with mindfulness, among those with resolve, among those who attend, Ānanda is foremost.”
Theo nghĩa xác định – “Này các Tỳ-khưu, trong số các Tỳ-khưu đệ tử của ta, những người đa văn, Ānanda là bậc tối thắng. Trong số những người có trí tuệ, có niệm, có dũng lực, những người hầu hạ, Ānanda là bậc tối thắng.”
Evaṃ bhagavatā – ‘‘āyasmā ānando atthakusalo, dhammakusalo, byañjanakusalo, niruttikusalo, pubbāparakusalo’’ti (a. ni. 5.169).
Thus, by the Blessed One, “Venerable Ānanda is skilled in meaning, skilled in Dhamma, skilled in phrasing, skilled in language, skilled in sequence.”
Như vậy, Đức Thế Tôn đã nói: “Tôn giả Ānanda thiện xảo về ý nghĩa, thiện xảo về Pháp, thiện xảo về từ ngữ, thiện xảo về ngữ pháp, thiện xảo về trước sau.”
Evaṃ dhammasenāpatinā ca pasatthabhāvānurūpaṃ attano dhāraṇabalaṃ dassento sattānaṃ sotukāmataṃ janeti – ‘evaṃ me sutaṃ’, tañca kho atthato vā byañjanato vā anūnamanadhikaṃ, evameva na aññathā daṭṭhabba’’nti.
And thus, by the Dhamma-general, by displaying his power of retention in accordance with the praised state, he generates the desire to hear in beings, thinking: ‘Thus have I heard,’ and that Sutta should be understood as exactly so, neither deficient nor excessive in meaning or phrasing, and in no other way.
Và như vậy, Đại tướng Pháp (Sāriputta) đã tán thán, phù hợp với sự tán thán, để tạo ra ý muốn lắng nghe cho chúng sinh bằng cách trình bày sức mạnh ghi nhớ của mình: ‘ evaṃ me sutaṃ’ (Như vầy tôi nghe), và điều đó không thiếu, không thừa, không sai lệch về ý nghĩa hay từ ngữ, mà phải được hiểu đúng như vậy, không khác.
Me-saddo tīsu atthesu dissati.
The word me is seen in three meanings.
Từ me được thấy trong ba nghĩa.
Tathā hissa – ‘‘gāthābhigītaṃ me abhojaneyya’’ntiādīsu (su. ni. 81) mayāti attho.
For instance, in phrases like ‘‘Food chanted in verse is not to be eaten by me,” the meaning is ‘by me’.
Như trong “ gāthābhigītaṃ me abhojaneyya” (Thức ăn được tụng bằng kệ không nên dùng cho tôi), nó có nghĩa là ‘bởi tôi’ (mayā).
‘‘Sādhu me, bhante, bhagavā saṅkhittena dhammaṃ desetū’’tiādīsu (saṃ. ni. 4.88) mayhanti attho.
In phrases like ‘‘It would be good, venerable sir, if the Blessed One would teach me the Dhamma in brief,” the meaning is ‘to me’.
Như trong “ Sādhu me, bhante, bhagavā saṅkhittena dhammaṃ desetū” (Bạch Thế Tôn, xin Thế Tôn hãy thuyết Pháp vắn tắt cho tôi), nó có nghĩa là ‘cho tôi’ (mayhaṃ).
‘‘Dhammadāyādā me, bhikkhave, bhavathā’’tiādīsu (ma. ni. 1.29) mamāti attho.
In phrases like ‘‘Be, O monastics, heirs of Dhamma to me,” the meaning is ‘my’.
Như trong “ Dhammadāyādā me, bhikkhave, bhavathā” (Này các Tỳ-khưu, hãy là những người thừa kế Pháp của tôi), nó có nghĩa là ‘của tôi’ (mama).
Idha pana mayā sutanti ca, mama sutanti ca atthadvaye yujjati.
Here, however, it is appropriate in two meanings: ‘it was heard by me’ and ‘it is my hearing’.
Ở đây, nó phù hợp với hai nghĩa: ‘tôi đã nghe’ (mayā sutaṃ) và ‘của tôi là điều đã nghe’ (mama sutaṃ).
Sutanti ayaṃ suta-saddo saupasaggo ca anupasaggo ca – gamanavissutakilinna-upacitānuyoga-sotaviññeyya-sotadvārānusāra-viññātādianekatthappabhedo, tathā hissa ‘‘senāya pasuto’’tiādīsu gacchantoti attho.
The word suta—this word suta, both with and without prefix—has many distinctions of meaning such as going, famous, wet, accumulated, exertion, audible by ear-consciousness, known through the ear-door, understood; for instance, in phrases like ‘‘he went into the army,” the meaning is ‘going’.
Từ suta này, dù có tiền tố hay không có tiền tố, có nhiều nghĩa khác nhau như đi, nổi tiếng, ẩm ướt, tích lũy, chuyên tâm, nhận biết bằng tai, nhận biết qua cửa tai, đã biết, v.v. Như trong “ senāya pasuto”, nó có nghĩa là ‘người đi’.
‘‘Sutadhammassa passato’’tiādīsu (udā. 11) vissutadhammassāti attho.
In phrases like ‘‘one who has heard the Dhamma and sees,” the meaning is ‘one whose Dhamma is famous’.
Trong “ Sutadhammassa passato”, nó có nghĩa là ‘người có Pháp nổi tiếng’.
‘‘Avassutā avassutassā’’tiādīsu (pāci. 657) kilinnākilinnassāti attho.
In phrases like ‘‘one who is wet to one who is wet,” the meaning is ‘wet to wet’.
Trong “ Avassutā avassutassā”, nó có nghĩa là ‘người bị ướt/không bị ướt’ (bởi dục vọng).
‘‘Tumhehi puññaṃ pasutaṃ anappaka’’ntiādīsu (khu. pā. 7.12) upacitanti attho.
In phrases like ‘‘a considerable amount of merit has been accumulated by you,” the meaning is ‘accumulated’.
Trong “ Tumhehi puññaṃ pasutaṃ anappaka”, nó có nghĩa là ‘đã tích lũy’.
‘‘Ye jhānapasutā dhīrā’’tiādīsu (dha. pa. 181) jhānānuyuttāti attho.
In phrases like ‘‘the wise ones who are devoted to jhāna,” the meaning is ‘devoted to jhāna’.
Trong “ Ye jhānapasutā dhīrā”, nó có nghĩa là ‘những người chuyên tâm thiền định’.
‘Diṭṭhaṃ sutaṃ muta’ntiādīsu (ma. ni. 1.241) sotaviññeyyanti attho.
In phrases like ‘seen, heard, sensed,’ the meaning is ‘audible by ear-consciousness’.
Trong “ Diṭṭhaṃ sutaṃ muta”, nó có nghĩa là ‘những gì được nhận biết bằng tai’.
‘‘Sutadharo sutasannicayo’’tiādīsu (ma. ni. 1.339) sotadvārānusāraviññātadharoti attho.
In phrases like ‘‘one who retains what is heard, one who has stored what is heard,” the meaning is ‘one who retains what is known through the ear-door’.
Trong “ Sutadharo sutasannicayo”, nó có nghĩa là ‘người ghi nhớ những gì đã được nhận biết qua cửa tai’.
Idha panassa sotadvārānusārena upadhāritanti vā upadhāraṇanti vāti attho.
Here, however, its meaning is ‘retained through the ear-door’ or ‘retention’.
Ở đây, nó có nghĩa là ‘đã được ghi nhớ qua cửa tai’ hoặc ‘sự ghi nhớ’.
‘Me’ saddassa hi ‘mayā’ti atthe sati ‘evaṃ mayā sutaṃ’ sotadvārānusārena upadhāritanti yujjati.
Indeed, if the word ‘me’ has the meaning ‘by me,’ then ‘thus it was heard by me, retained through the ear-door’ is appropriate.
Nếu từ ‘me’ có nghĩa là ‘bởi tôi’ (mayā), thì ‘ evaṃ mayā sutaṃ’ có nghĩa là ‘tôi đã nghe như vậy, đã được ghi nhớ qua cửa tai’.
‘Mamā’ti atthe sati evaṃ mama sutaṃ sotadvārānusārena upadhāraṇanti yujjati.
If it has the meaning ‘my,’ then ‘thus is my hearing, retention through the ear-door’ is appropriate.
Nếu từ ‘me’ có nghĩa là ‘của tôi’ (mama), thì ‘ evaṃ mama sutaṃ’ có nghĩa là ‘sự ghi nhớ của tôi là như vậy, đã được ghi nhớ qua cửa tai’.
Evametesu tīsu padesu evanti sotaviññāṇādiviññāṇakiccanidassanaṃ.
Thus, in these three words, evaṃ demonstrates the function of consciousness such as ear-consciousness.
Như vậy, trong ba từ này, evaṃ là sự trình bày về chức năng của thức (viññāṇa), như nhĩ thức (sotaviññāṇa) và các thức khác.
Meti vuttaviññāṇasamaṅgipuggalanidassanaṃ.
Me demonstrates the individual endowed with the aforementioned consciousness.
Me là sự trình bày về cá nhân sở hữu thức đã nói.
Sutanti assavanabhāvapaṭikkhepato anūnādhikāviparītaggahaṇanidassanaṃ.
Sutaṃ demonstrates the non-deficient, non-excessive, and non-perverted grasping, by refuting the state of not having heard.
Suta là sự trình bày về sự thấu hiểu không thiếu, không thừa, không sai lệch, bằng cách bác bỏ trạng thái không nghe.
Tathā evanti tassā sotadvārānusārena pavattāya viññāṇavīthiyā nānappakārena ārammaṇe pavattibhāvappakāsanaṃ.
Likewise, evaṃ expresses the state of that consciousness-process, which occurred through the ear-door, operating in various ways with regard to its object.
Tương tự, evaṃ là sự công bố về trạng thái vận hành của tiến trình thức (viññāṇavīthi) đã diễn ra qua cửa tai, vận hành trên đối tượng theo nhiều cách khác nhau.
Meti attappakāsanaṃ.
Me expresses oneself.
Me là sự công bố về bản thân.
Sutanti dhammappakāsanaṃ.
Sutaṃ expresses the Dhamma.
Suta là sự công bố về Pháp.
Ayañhettha saṅkhepo – ‘‘nānappakārena ārammaṇe pavattāya viññāṇavīthiyā mayā na aññaṃ kataṃ, idaṃ pana kataṃ, ayaṃ dhammo suto’’ti.
Here is the summary: “No other task was performed by me with the consciousness-process operating in various ways regarding its object; rather, this task was performed, this Dhamma was heard.”
Tóm lại ở đây là: “Bởi tôi, với tiến trình thức đã vận hành trên đối tượng theo nhiều cách khác nhau, không có gì khác được thực hiện, mà điều này đã được thực hiện, Pháp này đã được nghe.”
Tattha evanti ca meti ca saccikaṭṭhaparamatthavasena avijjamānapaññatti.
Therein, evaṃ and me are designations that do not exist in the ultimate sense of reality.
Trong đó, evaṃ và me là những khái niệm không tồn tại theo nghĩa chân đế (paramattha).
Kiñhettha taṃ paramatthato atthi, yaṃ evanti vā meti vā niddesaṃ labhetha?
For what here exists in the ultimate sense that could be designated as evaṃ or me?
Thật vậy, có gì ở đây tồn tại theo chân đế mà có thể được gọi là evaṃ hay me?
Sutanti vijjamānapaññatti.
Sutaṃ is an existing designation.
Suta là một khái niệm tồn tại.
Yañhi taṃ ettha sotena upaladdhaṃ, taṃ paramatthato vijjamānanti.
For that which is perceived here by the ear, that truly exists in the ultimate sense.
Vì những gì đã được nhận biết bằng tai ở đây là tồn tại theo chân đế.
Tathā ‘eva’nti ca, meti ca, taṃ taṃ upādāya vattabbato upādāpaññatti.
Likewise, evaṃ and me are conventional designations based on referring to this and that.
Tương tự, evaṃ và me là những khái niệm quy ước (upādāpaññatti) vì chúng được nói đến dựa trên những điều đó.
‘Suta’nti diṭṭhādīni upanidhāya vattabbato upanidhāpaññatti.
Sutaṃ is a comparative designation, being spoken in comparison to what is seen and so forth.
Suta là một khái niệm so sánh (upanidhāpaññatti) vì nó được nói đến bằng cách so sánh với những gì đã thấy, v.v.
Ettha ca evanti vacanena asammohaṃ dīpeti.
And here, by the word evaṃ, he indicates non-confusion.
Ở đây, với từ evaṃ, vị ấy biểu thị sự không lầm lẫn.
Na hi sammūḷho nānappakārapaṭivedhasamattho hoti.
For one who is confused is not capable of various kinds of penetration.
Vì người lầm lẫn không thể thâm nhập theo nhiều cách khác nhau.
‘Suta’nti vacanena sutassa asammosaṃ dīpeti.
By the word sutaṃ, he indicates non-forgetfulness of what was heard.
Với từ suta, vị ấy biểu thị sự không quên những gì đã nghe.
Yassa hi sutaṃ sammuṭṭhaṃ hoti, na so kālantarena mayā sutanti paṭijānāti.
For one whose hearing has been forgotten does not acknowledge, after some time, that it was heard by me.
Vì người đã quên những gì đã nghe sẽ không tuyên bố sau một thời gian rằng ‘tôi đã nghe’.
Iccassa asammohena paññāsiddhi, asammosena pana satisiddhi.
Thus, his wisdom is perfected by non-confusion, and his mindfulness is perfected by non-forgetfulness.
Như vậy, nhờ sự không lầm lẫn mà trí tuệ (paññā) được thành tựu, và nhờ sự không quên mà niệm (sati) được thành tựu.
Tattha paññāpubbaṅgamāya satiyā byañjanāvadhāraṇasamatthatā, satipubbaṅgamāya paññāya atthapaṭivedhasamatthatā.
Among those, by mindfulness preceded by wisdom, there is the ability to grasp and remember the syllables; by wisdom preceded by mindfulness, there is the ability to penetrate the meaning.
Trong đó, khả năng ghi nhớ văn tự là nhờ niệm có tuệ dẫn đầu, khả năng thấu hiểu ý nghĩa là nhờ tuệ có niệm dẫn đầu.
Tadubhayasamatthatāyogena atthabyañjanasampannassa dhammakosassa anupālanasamatthato dhammabhaṇḍāgārikattasiddhi.
Due to the combination of these two abilities, through the ability to guard the Dhamma treasury, complete with meaning and syllables, there is the accomplishment of being a Dhamma treasurer.
Nhờ sự kết hợp của hai khả năng đó, thành tựu của vị Thủ kho Pháp (Dhammabhaṇḍāgārika) là khả năng bảo hộ kho tàng Pháp (Dhammakosa) đầy đủ cả ý nghĩa (attha) và văn tự (byañjana).
Aparo nayo, evanti vacanena yoniso manasikāraṃ dīpeti.
Another method: By the word "evaṃ" (thus), he indicates proper attention (yoniso manasikāra).
Một cách khác, với từ “evaṃ” (như vầy), Ngài Ānanda chỉ ra sự chú tâm chân chánh (yoniso manasikāra).
Ayoniso manasikaroto hi nānappakārapaṭivedhābhāvato.
For one who attends improperly, there is no penetration of various kinds.
Vì người không chú tâm chân chánh thì không thể thấu hiểu nhiều khía cạnh khác nhau.
Sutanti vacanena avikkhepaṃ dīpeti, vikkhittacittassa savanābhāvato.
By the word "sutaṃ" (heard), he indicates non-distraction, for one with a distracted mind does not hear.
Với từ “sutaṃ” (tôi đã nghe), Ngài chỉ ra sự không tán loạn, vì người tâm tán loạn thì không thể lắng nghe.
Tathā hi vikkhittacitto puggalo sabbasampattiyā vuccamānopi ‘‘na mayā sutaṃ, puna bhaṇathā’’ti bhaṇati.
Indeed, a person with a distracted mind, even when addressed with all good fortune, says, "I have not heard; please speak again."
Quả thật, một người tâm tán loạn, dù được thuyết giảng mọi điều tốt đẹp, vẫn nói: “Tôi chưa nghe, xin hãy nói lại.”
Yoniso manasikārena cettha attasammāpaṇidhiṃ pubbe ca katapuññataṃ sādheti, sammā appaṇihitattassa pubbe akatapuññassa vā tadabhāvato.
Here, by proper attention (yoniso manasikāra), he accomplishes right self-application and having done merit in the past, for these are absent in one who has not applied himself rightly or has not done merit in the past.
Ở đây, với sự chú tâm chân chánh, Ngài Ānanda thành tựu việc tự mình khéo đặt tâm (attasammāpaṇidhi) và những công đức đã làm trong quá khứ (katapuññatā).
Avikkhepena saddhammassavanaṃ sappurisūpanissayañca sādheti.
By non-distraction, he accomplishes listening to the Saddhamma and reliance on good people.
Vì nếu không khéo đặt tâm hoặc không có công đức đã làm trong quá khứ thì sẽ không có được điều đó.
Na hi vikkhittacitto sotuṃ sakkoti, na ca sappurise anupassayamānassa savanaṃ atthīti.
For a distracted person cannot hear, nor is there hearing for one who does not associate with good people.
Với sự không tán loạn, Ngài thành tựu việc nghe Chánh Pháp (saddhammassavana) và nương tựa bậc Chân nhân (sappurisūpanissaya). Bởi lẽ, người tâm tán loạn không thể lắng nghe, và người không nương tựa bậc Chân nhân thì không có sự lắng nghe.
Aparo nayo, yasmā evanti yassa cittasantānassa nānākārappavattiyā nānatthabyañjanaggahaṇaṃ hoti, tassa nānākāraniddesoti vuttaṃ, so ca evaṃ bhaddako ākāro na sammāappaṇihitattano pubbe akatapuññassa vā hoti, tasmā evanti iminā bhaddakenākārena pacchimacakkadvayasampattimattano dīpeti.
Another method: Because, as stated, "evaṃ" indicates various ways of proceeding for the mental continuum of a person, through which the grasp of various meanings and expressions occurs, and such an excellent manner does not exist for one whose mind is not rightly directed or who has not done meritorious deeds in the past; therefore, by this excellent manner, by "evaṃ," he indicates the accomplishment of the latter two wheels of fortune for himself.
Một cách khác, vì từ “evaṃ” chỉ ra sự thấu hiểu nhiều khía cạnh khác nhau trong dòng tâm thức của một người, và sự thấu hiểu đó không thể có ở người không khéo đặt tâm hoặc không có công đức đã làm trong quá khứ, nên với từ “evaṃ” này, Ngài Ānanda chỉ ra sự thành tựu hai yếu tố sau cùng của Bốn yếu tố hỗ trợ (cakkadvaya) của mình.
Sutanti savanayogena purimacakkadvayasampattiṃ.
By "sutaṃ," he indicates the accomplishment of the former two wheels of fortune through the act of hearing.
Với từ “sutaṃ” (tôi đã nghe), Ngài chỉ ra sự thành tựu hai yếu tố đầu tiên của Bốn yếu tố hỗ trợ, thông qua việc lắng nghe.
Na hi appatirūpadese vasato sappurisūpanissayavirahitassa vā savanaṃ atthi.
For there is no hearing for one who lives in an unsuitable place or who lacks reliance on good people.
Vì người sống ở nơi không thích hợp hoặc không có sự nương tựa bậc Chân nhân thì không có sự lắng nghe.
Iccassa pacchimacakkadvayasiddhiyā āsayasuddhisiddhā hoti, purimacakkadvayasiddhiyā payogasuddhi, tāya ca āsayasuddhiyā adhigamabyattisiddhi, payogasuddhiyā āgamabyattisiddhi.
Thus, by the accomplishment of the latter two wheels, purity of intention is accomplished; by the accomplishment of the former two wheels, purity of practice. And by that purity of intention, the attainment of clear realization is accomplished; by purity of practice, the attainment of scriptural knowledge.
Như vậy, nhờ sự thành tựu hai yếu tố sau cùng, sự thanh tịnh về ý chí (āsayasuddhi) của Ngài được thành tựu; nhờ sự thành tựu hai yếu tố đầu tiên, sự thanh tịnh về thực hành (payogasuddhi) được thành tựu. Nhờ sự thanh tịnh về ý chí đó, sự tinh thông về chứng đắc (adhigamabyattisiddhi) được thành tựu; nhờ sự thanh tịnh về thực hành, sự tinh thông về giáo điển (āgamabyattisiddhi) được thành tựu.
Iti payogāsayasuddhassa āgamādhigamasampannassa vacanaṃ aruṇuggaṃ viya sūriyassa udayato yoniso manasikāro viya ca kusalakammassa arahati bhagavato vacanassa pubbaṅgamaṃ bhavitunti ṭhāne nidānaṃ ṭhapento – ‘‘evaṃ me suta’’ntiādimāha.
Therefore, the words of one whose practice and intention are pure and who is accomplished in both scriptural knowledge and realization, like the dawn preceding the rising of the sun, and like proper attention preceding skillful action, are worthy to be the preface to the word of the Blessed One. Thus, establishing the introduction in its proper place, he said, "Evaṃ me sutaṃ" (Thus have I heard), etc.
Do đó, lời nói của một vị có ý chí và thực hành thanh tịnh, thành tựu cả giáo điển và chứng đắc, xứng đáng là lời dẫn đầu lời dạy của Đức Thế Tôn, giống như rạng đông dẫn đường cho mặt trời mọc, và sự chú tâm chân chánh dẫn đường cho thiện nghiệp. Vì vậy, Ngài Ānanda đã đặt câu dẫn nhập ở vị trí thích hợp – “Evaṃ me sutaṃ” (Như vầy tôi đã nghe), v.v.
Aparo nayo, ‘eva’nti iminā nānappakārapaṭivedhadīpakena vacanena attano atthapaṭibhānapaṭisambhidāsampattisabbhāvaṃ dīpeti.
Another method: By the word "evaṃ," which indicates penetration of various kinds, he reveals the presence of his attainment of paṭisambhidā of meaning and analytical knowledge of expression.
Một cách khác, với từ “evaṃ” này, chỉ ra sự thấu hiểu nhiều khía cạnh khác nhau, Ngài Ānanda chỉ ra sự hiện hữu của sự thành tựu về Thắng giải Nghĩa (atthapaṭisambhidā) và Thắng giải Biện tài (paṭibhānapaṭisambhidā) của mình.
‘Suta’nti iminā sotabbappabhedapaṭivedhadīpakena dhammaniruttipaṭisambhidāsampattisabbhāvaṃ.
By "sutaṃ," which indicates penetration of the distinction of what is to be heard, he reveals the presence of his attainment of paṭisambhidā of Dhamma and language.
Với từ “sutaṃ” này, chỉ ra sự thấu hiểu các loại pháp cần nghe, Ngài chỉ ra sự hiện hữu của sự thành tựu về Thắng giải Pháp (dhammapaṭisambhidā) và Thắng giải Ngôn ngữ (niruttipaṭisambhidā).
‘Eva’nti ca idaṃ yoniso manasikāradīpakaṃ vacanaṃ bhāsamāno – ‘‘ete mayā dhammā manasānupekkhitā, diṭṭhiyā suppaṭividdhā’’ti dīpeti.
And by speaking the word "evaṃ," which indicates proper attention, he reveals, "These Dhammas have been reflected upon by me mentally, and thoroughly penetrated by insight."
Khi nói từ “evaṃ” này, chỉ ra sự chú tâm chân chánh, Ngài Ānanda chỉ ra rằng: “Những pháp này tôi đã quán xét bằng tâm, đã thấu hiểu rõ ràng bằng tuệ tri.”
‘Suta’nti idaṃ savanayogadīpakaṃ vacanaṃ bhāsamāno – ‘‘bahū mayā dhammā sutā dhātā vacasā paricitā’’ti dīpeti.
By speaking the word "sutaṃ," which indicates the act of hearing, he reveals, "Many Dhammas have been heard by me, retained, and practiced orally."
Khi nói từ “sutaṃ” này, chỉ ra sự lắng nghe, Ngài Ānanda chỉ ra rằng: “Nhiều pháp tôi đã nghe, đã ghi nhớ, đã thực hành bằng lời nói.”
Tadubhayenāpi atthabyañjanapāripūriṃ dīpento savane ādaraṃ janeti.
By both of these, showing the completeness of meaning and syllables, he generates respect for listening.
Bằng cả hai từ đó, Ngài Ānanda chỉ ra sự viên mãn của ý nghĩa và văn tự, đồng thời khuyến khích sự chú tâm vào việc lắng nghe.
Atthabyañjanaparipuṇṇañhi dhammaṃ ādarena assuṇanto mahatā hitā paribāhiro hotīti, tasmā ādaraṃ janetvā sakkaccaṃ ayaṃ dhammo sotabboti.
For one who does not listen respectfully to Dhamma complete with meaning and syllables is excluded from great benefit. Therefore, one should listen to this Dhamma respectfully and attentively.
Vì người không lắng nghe Pháp một cách kính trọng, dù Pháp đó đầy đủ ý nghĩa và văn tự, sẽ bị thiệt thòi lớn về lợi ích. Do đó, Ngài Ānanda khuyến khích rằng Pháp này cần được lắng nghe một cách kính trọng và cẩn thận.
‘‘Evaṃ me suta’’nti iminā pana sakalena vacanena āyasmā ānando tathāgatappaveditaṃ dhammaṃ attano adahanto asappurisabhūmiṃ atikkamati.
Furthermore, by the entire statement "Evaṃ me sutaṃ," Venerable Ānanda, by not claiming the Dhamma taught by the Tathāgata as his own, transcends the level of ignoble persons.
Hơn nữa, với toàn bộ câu “Evaṃ me sutaṃ” này, Tôn giả Ānanda đã vượt qua cảnh giới của người không chân chánh (asappurisabhūmi), bằng cách không coi Pháp do Đức Như Lai thuyết giảng là của mình.
Sāvakattaṃ paṭijānanto sappurisabhūmiṃ okkamati.
By declaring himself a disciple, he enters the level of noble persons.
Ngài bước vào cảnh giới của người chân chánh (sappurisabhūmi) bằng cách tự nhận mình là một đệ tử (sāvaka).
Tathā asaddhammā cittaṃ vuṭṭhāpeti, saddhamme cittaṃ patiṭṭhāpeti.
Thus, he raises the mind from unwholesome Dhamma and establishes the mind in wholesome Dhamma.
Như vậy, Ngài đưa tâm thoát khỏi tà pháp và thiết lập tâm trong Chánh Pháp.
‘‘Kevalaṃ sutamevetaṃ mayā, tasseva bhagavato vacana’’nti dīpento attānaṃ parimoceti, satthāraṃ apadisati, jinavacanaṃ appeti, dhammanettiṃ patiṭṭhāpeti.
By showing that "this was merely heard by me, it is indeed the word of the Blessed One himself," he frees himself, indicates the Teacher, establishes the word of the Buddha, and sets up the guidance of the Dhamma.
Bằng cách chỉ ra rằng: “Đây chỉ là điều tôi đã nghe, là lời của chính Đức Thế Tôn,” Ngài tự giải thoát mình, chỉ rõ vị Đạo Sư, truyền bá lời dạy của Đức Phật, và thiết lập nguyên tắc của Pháp (Dhammanetti).
Apica ‘‘evaṃ me suta’’nti attanā uppāditabhāvaṃ appaṭijānanto purimavacanaṃ vivaranto – ‘‘sammukhā paṭiggahitamidaṃ mayā tassa bhagavato catuvesārajjavisāradassa dasabaladharassa āsabhaṭṭhānaṭṭhāyino sīhanādanādino sabbasattuttamassa dhammissarassa dhammarājassa dhammādhipatino dhammadīpassa dhammasaraṇassa saddhammavaracakkavattino sammāsambuddhassa vacanaṃ, na ettha atthe vā dhamme vā pade vā byañjane vā kaṅkhā vā vimati vā kātabbā’’ti sabbesaṃ devamanussānaṃ imasmiṃ dhamme assaddhiyaṃ vināseti, saddhāsampadaṃ uppādeti.
Moreover, by stating "Evaṃ me sutaṃ," not claiming to have produced it himself, and by revealing the previous utterance, he declares: "This word was received by me directly from that Blessed One who is skilled in the four intrepidities, who possesses the ten powers, who stands in the position of the chief, who utters the lion's roar, who is the highest of all beings, the Lord of Dhamma, the King of Dhamma, the Master of Dhamma, the Lamp of Dhamma, the Refuge of Dhamma, the great Cakkavatti of the Saddhamma, the Perfectly Self-Enlightened One. In this Dhamma, regarding its meaning, doctrine, word, or expression, no doubt or perplexity should be entertained." Thus, he destroys the disbelief of all devas and humans in this Dhamma and produces the blessing of faith.
Hơn nữa, với câu “Evaṃ me sutaṃ” (Như vầy tôi đã nghe), Ngài Ānanda không nhận mình là người đã tạo ra Pháp, mà Ngài giải thích lời dạy trước đó rằng: “Đây là lời của Đức Thế Tôn, bậc đã thành tựu Tứ Vô Sở Úy (catuvesārajja), nắm giữ Thập Lực (dasabala), đứng vững ở vị trí Tối Thượng (āsabhaṭṭhāna), rống tiếng sư tử (sīhanāda), tối thượng trong tất cả chúng sinh, là Pháp Chủ (dhammissara), Pháp Vương (dhammarāja), Pháp Tôn (dhammādhipati), Pháp Đăng (dhammadīpa), Pháp Quy (dhammasaraṇa), Chuyển Luân Thánh Vương của Chánh Pháp tối thượng (saddhammavaracakkavatti), là Bậc Chánh Đẳng Giác (sammāsambuddha), lời này tôi đã trực tiếp tiếp nhận từ Ngài. Không nên có bất kỳ nghi ngờ hay do dự nào về ý nghĩa, Pháp, từ ngữ hay văn tự trong lời dạy này.” Như vậy, Ngài tiêu diệt sự bất tín (assaddhiya) và phát sinh sự thành tựu về tín (saddhāsampada) cho tất cả chư thiên và loài người đối với Pháp này.
Tenetaṃ vuccati –
Therefore, it is said:
Vì thế, có câu nói:
Tathā hissa – ‘‘appevanāma svepi upasaṅkameyyāma kālañca samayañca upādāyā’’ti evamādīsu (dī. ni. 1.447) samavāyo attho.
Thus, in such passages as "Perhaps we may approach tomorrow, depending on the time and opportunity," it means conjunction.
Như trong câu: “Appevanāma svepi upasaṅkameyyāma kālañca samayañca upādāyā” (Có lẽ ngày mai chúng ta sẽ đến, tùy theo thời gian và sự hội tụ), v.v., nghĩa là sự hội tụ (samavāya).
‘‘Ekova kho bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā’’tiādīsu (a. ni. 8.29) khaṇo.
In such passages as "There is indeed, bhikkhus, one moment and one opportunity for the practice of the holy life," it means moment.
Trong câu: “Ekova kho bhikkhave, khaṇo ca samayo ca brahmacariyavāsāyā” (Này các Tỳ-kheo, chỉ có một khoảnh khắc, một thời điểm để sống Phạm hạnh), v.v., nghĩa là khoảnh khắc (khaṇa).
‘‘Uṇhasamayo pariḷāhasamayo’’tiādīsu (pāci. 358) kālo.
In such passages as "the hot season, the stifling season," it means time.
Trong câu: “Uṇhasamayo pariḷāhasamayo” (Thời tiết nóng bức, thời tiết oi ả), v.v., nghĩa là thời gian (kāla).
‘‘Mahāsamayo pavanasmi’’ntiādīsu (dī. ni. 2.332) samūho.
In such passages as "A great assembly in the forest," it means collection.
Trong câu: “Mahāsamayo pavanasmi” (Đại hội lớn trong rừng), v.v., nghĩa là tập hợp (samūha).
‘‘Samayopi kho te, bhaddāli, appaṭividdho ahosi, bhagavā kho sāvatthiyaṃ viharati, bhagavāpi maṃ jānissati, bhaddāli nāma bhikkhu satthusāsane sikkhāya aparipūrakārī’ti.
"Also, Bhaddāli, this cause was not penetrated by you: 'The Blessed One is dwelling in Sāvatthī; the Blessed One will know me as 'the bhikkhu named Bhaddāli, who did not complete the training in the Teacher's Dispensation.' "
Trong câu: “Samayopi kho te, Bhaddāli, appaṭividdho ahosi, Bhagavā kho Sāvatthiyaṃ viharati, Bhagavāpi maṃ jānissati, Bhaddāli nāma bhikkhu Satthusāsane sikkhāya aparipūrakārī” (Này Bhaddāli, nguyên nhân đó cũng không được ông thấu hiểu. Đức Thế Tôn đang trú tại Sāvatthī. Đức Thế Tôn cũng sẽ biết về ta: ‘Tỳ-kheo tên Bhaddāli này đã không hoàn thành giới học trong Giáo Pháp của Đạo Sư’).
Ayampi kho, te bhaddāli, samayo appaṭividdho ahosī’’tiādīsu (ma. ni. 2.135) hetu.
"Indeed, Bhaddāli, this cause also was not penetrated by you." In such passages, it means cause.
“Ayampi kho, te Bhaddāli, samayo appaṭividdho ahosī” (Này Bhaddāli, nguyên nhân này cũng không được ông thấu hiểu), v.v., nghĩa là nguyên nhân (hetu).
‘‘Tena kho pana samayena uggahamāno paribbājako samaṇamuṇḍikāputto samayappavādake tindukācīre ekasālake mallikāya ārāme paṭivasatī’’tiādīsu (ma. ni. 2.260) diṭṭhi.
In such passages as "Now at that time, the wandering ascetic Uggāhamāna, son of Samaṇamuṇḍikā, was dwelling in the Ekasālaka, Mallikā’s park, near Tindukācīra, among those who held various views," it means view.
Trong câu: “Tena kho pana samayena Uggahamāno Paribbājako Samaṇamuṇḍikāputto samayappavādake Tindukācīre Ekasālake Mallikāya ārāme paṭivasatī” (Vào lúc bấy giờ, du sĩ Uggahamāna, con trai của Samaṇamuṇḍikā, đang trú tại khu vườn của Mallikā, ở Ekasālaka, gần Tindukācīra, nơi các học thuyết được tranh luận), v.v., nghĩa là quan điểm (diṭṭhi).
Ādīsu paṭilābho.
In such passages, it means acquisition.
Trong các câu trên, nghĩa là đắc được (paṭilābha).
‘‘Sammā mānābhisamayā antamakāsi dukkhassā’’tiādīsu (a. ni. 7.9) pahānaṃ.
In such passages as "By the right penetration of conceit, he made an end of suffering," it means abandonment.
Trong câu: “Sammā mānābhisamayā antamakāsi dukkhassā” (Do thấu hiểu đúng đắn về ngã mạn, đã chấm dứt khổ đau), v.v., nghĩa là đoạn trừ (pahāna).
‘‘Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho’’tiādīsu (paṭi. 108) paṭivedho.
In such passages as "Suffering means the sense of affliction, the sense of being conditioned, the sense of torment, the sense of change, the sense of penetration," it means penetration.
Trong câu: “Dukkhassa pīḷanaṭṭho saṅkhataṭṭho santāpaṭṭho vipariṇāmaṭṭho abhisamayaṭṭho” (Khổ có nghĩa là bị áp bức, có nghĩa là được tạo tác, có nghĩa là bị thiêu đốt, có nghĩa là biến hoại, có nghĩa là được thấu hiểu), v.v., nghĩa là thấu hiểu (paṭivedha).
Idha panassa kālo attho.
Here, however, its meaning is "time."
Ở đây, nghĩa của nó là thời gian (kāla).
Tena saṃvaccharautumāsaḍḍhamāsarattidivapubbaṇhamajjhanhikasāyanhapaṭhamamajjhi-mapacchimayāmamuhuttādīsu kālappabhedabhūtesu samayesu ekaṃ samayanti dīpeti.
By this, it indicates one time among the distinctions of time, such as years, seasons, months, half-months, nights, days, forenoons, noons, afternoons, first, middle, and last watches, and muhuttas.
Với từ đó, Ngài chỉ ra rằng “một thời điểm” (ekaṃ samayaṃ) là một trong những thời điểm được phân loại như năm, mùa, tháng, nửa tháng, đêm, ngày, buổi sáng, buổi trưa, buổi chiều, canh đầu, canh giữa, canh cuối, khoảnh khắc, v.v.
Tattha kiñcāpi etesu saṃvaccharādīsu samayesu yaṃ yaṃ suttaṃ yasmiṃ yasmiṃ saṃvacchare utumhi māse pakkhe rattibhāge vā divasabhāge vā vuttaṃ, sabbaṃ taṃ therassa suviditaṃ suvavatthāpitaṃ paññāya.
Though all suttas, in whichever year, season, month, fortnight, night, or day part they were spoken, were well-known and well-distinguished by the Elder's wisdom,
Mặc dù tất cả các bài kinh được thuyết giảng vào những năm, mùa, tháng, nửa tháng, phần đêm hoặc phần ngày khác nhau trong các thời điểm như đã nêu trên đều được vị Trưởng lão biết rõ và sắp xếp rõ ràng bằng tuệ tri.
Yasmā pana – ‘‘evaṃ me sutaṃ’’ asukasaṃvacchare asukautumhi asukamāse asukapakkhe asukarattibhāge asukadivasabhāge vāti evaṃ vutte na sakkā sukhena dhāretuṃ vā uddisituṃ vā uddisāpetuṃ vā, bahu ca vattabbaṃ hoti, tasmā ekeneva padena tamatthaṃ samodhānetvā ‘‘ekaṃ samaya’’nti āha.
But because, when it is said, "Thus have I heard, in such-and-such a year, in such-and-such a season, in such-and-such a month, in such-and-such a fortnight, in such-and-such a part of the night, or in such-and-such a part of the day," it is not possible to easily remember, or recite, or have it recited, and much would have to be said, therefore, having summarized that meaning with just one word, he said "on one occasion."
Vì nếu nói rằng – "Tôi đã nghe như vầy" vào năm đó, mùa đó, tháng đó, nửa tháng đó, phần đêm đó, hay phần ngày đó – thì không thể dễ dàng ghi nhớ, hoặc tự mình đọc tụng, hoặc khiến người khác đọc tụng, và cũng có nhiều điều phải nói. Do đó, sau khi gom nghĩa đó lại trong một từ duy nhất, Ngài đã nói "ekaṃ samayaṃ" (một thời).
Ye vā ime gabbhokkantisamayo, jātisamayo, saṃvegasamayo, abhinikkhamanasamayo, dukkarakārikasamayo, māravijayasamayo, abhisambodhisamayo diṭṭhadhammasukhavihārasamayo, desanāsamayo, parinibbānasamayoti, evamādayo bhagavato devamanussesu ativiya pakāsā anekakālappabhedā eva samayā.
Or, these occasions of the Blessed One that are extremely well-known among devas and humans are indeed of many different time-periods, such as: the time of conception, the time of birth, the time of spiritual urgency, the time of the great renunciation, the time of the austere practices, the time of conquering Māra, the time of full awakening, the time of dwelling in blissful abiding in the visible world, the time of teaching, and the time of parinibbāna.
Hoặc những thời như thời nhập thai, thời đản sinh, thời khởi tâm xúc động, thời xuất gia, thời khổ hạnh, thời chiến thắng Ma vương, thời chứng đắc Chánh Đẳng Giác, thời an trú lạc trú hiện tại, thời thuyết pháp, thời nhập Niết Bàn – những thời như vậy là những thời gian khác nhau, rất nổi tiếng của Đức Thế Tôn giữa chư thiên và loài người.
Tesu samayesu desanāsamayasaṅkhātaṃ ekaṃ samayanti dīpeti.
Among those occasions, it indicates "on one occasion," that is, the one designated as the occasion of teaching.
Trong những thời đó, từ "ekaṃ samayaṃ" chỉ một thời được gọi là thời thuyết pháp.
Yo cāyaṃ ñāṇakaruṇākiccasamayesu karuṇākiccasamayo, attahitaparahitapaṭipattisamayesu parahitapaṭipattisamayo, sannipatitānaṃ karaṇīyadvayasamayesu dhammikathāsamayo desanāpaṭipattisamayesu desanāsamayo, tesupi samayesu aññataraṃ samayaṃ sandhāya ‘‘ekaṃ samaya’’nti āha.
And among the occasions of the tasks of wisdom and compassion, it is the occasion of the task of compassion; among the occasions of practicing for one's own welfare and for the welfare of others, it is the occasion of practicing for the welfare of others; among the occasions for the two duties of those who have assembled, it is the occasion for a Dhamma talk; among the occasions for teaching and practice, it is the occasion for teaching. With reference to any one of these occasions, he said "on one occasion."
Và trong các thời thực hiện nhiệm vụ trí tuệ và từ bi, đó là thời thực hiện nhiệm vụ từ bi; trong các thời thực hành lợi ích cho mình và lợi ích cho người khác, đó là thời thực hành lợi ích cho người khác; trong các thời có hai việc cần làm cho những người đã hội họp, đó là thời thuyết pháp; trong các thời thực hành thuyết pháp, đó là thời thuyết pháp. Ngài đã nói "ekaṃ samayaṃ" (một thời) để chỉ một trong những thời đó.
Kasmā panettha yathā abhidhamme ‘‘yasmiṃ samaye kāmāvacara’’nti (dha. sa. 1) ca, ito aññesu ca suttapadesu – ‘‘yasmiṃ samaye, bhikkhave, bhikkhu vivicceva kāmehī’’ti ca bhummavacananiddeso kato, vinaye ca – ‘‘tena samayena buddho bhagavā’’ti karaṇavacanena, tathā akatvā ‘‘ekaṃ samaya’’nti upayogavacananiddeso katoti?
Why, here, was it not done as in the Abhidhamma, where the locative case is used, as in "at which time, a sense-sphere*," and in other suttas, "At which time, O bhikkhus, a bhikkhu, secluded from sensual pleasures," or as in the Vinaya, where the instrumental case is used, as in "At that time the Buddha, the Blessed One"? Why instead was the accusative case of utilization used, as in "ekaṃ samayaṃ"?
Vì sao ở đây, không dùng cách chỉ định bằng ngữ cách định sở như trong Abhidhamma: "Vào thời gian mà cõi dục giới..." (Dhs. 1) và trong các đoạn kinh khác: "Này các Tỳ khưu, vào thời gian mà Tỳ khưu ly dục..." và cũng không dùng cách chỉ định bằng ngữ cách công cụ như trong Vinaya: "Vào thời gian đó, Đức Phật, Thế Tôn..." mà lại dùng cách chỉ định bằng ngữ cách đối cách "ekaṃ samayaṃ" (một thời)?
Tattha tathā idha ca aññathā atthasambhavato.
Because in those instances, the meaning is conveyed in that way, whereas here, it is conveyed in another way.
Vì ở đó và ở đây có sự khác biệt về ý nghĩa.
Tattha hi abhidhamme ito aññesu suttapadesu ca adhikaraṇattho bhāvena bhāvalakkhaṇattho ca sambhavati.
For in the Abhidhamma and in other suttas, the meaning of location and the meaning of bhāvena bhāvalakkhaṇa are possible.
Thật vậy, ở đó, trong Abhidhamma và trong các đoạn kinh khác, ý nghĩa định sở và ý nghĩa biểu thị trạng thái có thể xảy ra.
Adhikaraṇañhi kālattho, samūhattho ca samayo, tattha tattha vuttānaṃ phassādidhammānaṃ khaṇasamavāyahetusaṅkhātassa ca samayassa bhāvena tesaṃ bhāvo lakkhīyati, tasmā tadatthajotanatthaṃ tattha bhummavacananiddeso kato.
Indeed, samaya has the meaning of time, which is a location, and the meaning of a collection; the existence of the dhammas such as contact, mentioned in those places, is marked by the existence of the samaya, which is designated as the moment, conjunction, and cause. Therefore, to illuminate that meaning, the locative case is used there.
Thời gian là định sở, và samaya (thời) có nghĩa là tập hợp. Với sự hiện hữu của samaya, được gọi là khoảnh khắc, sự kết hợp và nguyên nhân của các pháp như xúc đã được nói đến ở đó, sự hiện hữu của chúng được biểu thị. Do đó, để làm rõ ý nghĩa đó, cách chỉ định bằng ngữ cách định sở đã được sử dụng ở đó.
Antarā ca rājagahaṃ antarā ca nāḷandanti antarā-saddo kāraṇakhaṇacittavemajjhavivarādīsu dissati.
In between Rājagaha and between Nāḷandā, the word antarā is seen in the senses of reason, moment, mind, middle, interval, and so on.
Từ "antarā" trong "antarā ca Rājagahaṃ antarā ca Nāḷandaṃ" (giữa Rājagaha và Nāḷandā) được thấy trong các ý nghĩa như nguyên nhân, khoảnh khắc, tâm, ở giữa, khoảng trống, v.v.
‘‘Tadantaraṃ ko jāneyya aññatra tathāgatā’’ti (a. ni. 6.44) ca, ‘‘janā saṅgamma mantenti mañca tañca kimantara’’nti (saṃ. ni. 1.228) ca ādīsu hi kāraṇe antarā-saddo.
For in "Who other than the Tathāgata could know the reason for that?" and "People gather and consult, 'What is the reason concerning me and you?'" and so on, the word antarā is in the sense of reason.
Thật vậy, từ "antarā" có nghĩa là nguyên nhân trong các đoạn như: "Ai có thể biết được nguyên nhân đó, ngoại trừ Như Lai?" và "Người ta tụ họp bàn tán về tôi và ông, nguyên nhân là gì?".
‘‘Addasa maṃ, bhante, aññatarā itthī vijjantarikāya bhājanaṃ dhovantī’’tiādīsu (ma. ni. 2.149) khaṇe.
In "Venerable sir, a certain woman, while washing a bowl in a flash of lightning, saw me," and so on, it is in the sense of a moment.
Trong các đoạn như: "Bạch Thế Tôn, một người phụ nữ nào đó đang rửa bát trong khoảnh khắc lóe sáng đã thấy con", có nghĩa là khoảnh khắc.
‘‘Yassantarato na santi kopā’’tiādīsu (udā. 20) citte.
In "In whom there are no angers within the mind," and so on, it is in the sense of the mind.
Trong các đoạn như: "Người mà trong tâm không có sự sân hận", có nghĩa là tâm.
‘‘Antarā vosānamāpādī’’tiādīsu (cūḷava. 350) vemajjhe.
In "He reached a conclusion in the middle," and so on, it is in the sense of the middle.
Trong các đoạn như: "Đã đạt đến sự kết thúc ở giữa", có nghĩa là ở giữa.
‘‘Api cāyaṃ, bhikkhave, tapodā dvinnaṃ mahānirayānaṃ antarikāya āgacchatī’’tiādīsu (pārā. 231) vivare.
In "Moreover, bhikkhus, this Tapodā river flows through the interval between two great hells," and so on, it is in the sense of an interval.
Trong các đoạn như: "Này các Tỳ khưu, dòng Tapodā này chảy qua giữa hai đại địa ngục", có nghĩa là khoảng trống.
Svāyamidha vivare vattati, tasmā rājagahassa ca nāḷandāya ca vivareti evametthattho veditabbo.
Here, that word is used in the sense of an interval. Therefore, the meaning here should be understood as "in the interval of Rājagaha and Nāḷandā."
Ở đây, từ đó có nghĩa là khoảng trống, do đó ý nghĩa ở đây phải được hiểu là "trong khoảng trống giữa Rājagaha và Nāḷandā".
Antarā-saddena pana yuttattā upayogavacanaṃ kataṃ.
However, because it is connected with the word antarā, the accusative case is used.
Tuy nhiên, ngữ cách đối cách đã được sử dụng vì nó đi kèm với từ "antarā".
Īdisesu ca ṭhānesu akkharacintakā ‘‘antarā gāmañca nadiñca yātī’’ti evaṃ ekameva antarāsaddaṃ payujjanti, so dutiyapadenapi yojetabbo hoti, ayojiyamāne upayogavacanaṃ na pāpuṇāti.
And in such places, grammarians use only one antarā word, as in "antarā gāmañca nadiñca yāti" ("he goes between the village and the river"), and it has to be connected with the second word as well; if it is not so connected, the accusative case would not be obtained.
Và trong những trường hợp như vậy, các nhà ngữ pháp chỉ sử dụng một từ "antarā" như "antarā gāmañca nadiñca yāti" (đi giữa làng và sông), nhưng từ đó cũng phải được kết hợp với từ thứ hai; nếu không kết hợp, nó sẽ không đạt được ngữ cách đối cách.
Idha pana yojetvāyeva vuttoti.
Here, however, it has been stated with the connection already made.
Nhưng ở đây, nó đã được nói sau khi kết hợp.
Mahatā bhikkhusaṅghena saddhinti ‘mahatā’ti guṇamahattenapi mahatā, saṅkhyāmahattenapi mahatā.
Together with a great Saṅgha of bhikkhus means 'great' both in terms of greatness of quality and greatness of number.
Mahatā bhikkhusaṅghena saddhiṃ (cùng với một Tăng đoàn Tỳ khưu lớn) có nghĩa là "lớn" về phẩm chất và lớn về số lượng.
So hi bhikkhusaṅgho guṇehipi mahā ahosi, appicchatādiguṇasamannāgatattā.
For that Saṅgha of bhikkhus was great in qualities, being endowed with qualities such as fewness of wishes.
Thật vậy, Tăng đoàn Tỳ khưu đó lớn về phẩm chất, vì họ có đầy đủ các phẩm chất như ít dục.
Saṅkhyāyapi mahā, pañcasatasaṅkhyattā.
Also great in number, because of being five hundred in number.
Về số lượng cũng lớn, vì có số lượng năm trăm.
Bhikkhūnaṃ saṅgho ‘bhikkhusaṅgho’, tena bhikkhusaṅghena.
A community of bhikkhus is ‘bhikkhusaṅgha’; with that community of bhikkhus.
Tăng đoàn của các Tỳ-khưu là ‘Tỳ-khưu Tăng’, với Tỳ-khưu Tăng đó.
Diṭṭhisīlasāmaññasaṅghātasaṅkhātena samaṇagaṇenāti attho.
The meaning is: with the group of ascetics, designated as united by the commonality of view and virtue.
Ý nghĩa là ‘với nhóm Sa-môn được gọi là sự kết hợp của sự đồng nhất về chánh kiến và giới hạnh’.
Saddhinti ekato.
Saddhiṃ means together.
Từ Saddhiṃ (cùng với) là cùng nhau.
Suppiyopi kho paribbājakoti suppiyoti tassa nāmaṃ.
Suppiya the wanderer also: Suppiya is his name.
Từ Suppiyopi kho paribbājako (du sĩ Suppiya) – Suppiyo là tên của vị ấy.
Pi-kāro maggappaṭipannasabhāgatāya puggalasampiṇḍanattho.
The particle pi has the meaning of including a person because of the shared characteristic of being on the same path.
Tiếp đầu ngữ pi có nghĩa là tập hợp các cá nhân do có cùng tính chất là người đang đi trên đường.
Kho-kāro padasandhikaro, byañjanasiliṭṭhatāvasena vutto.
The particle kho is a word-connector, spoken for the sake of euphonic elegance of the consonants.
Tiếp đầu ngữ kho là từ nối câu, được nói đến theo cách liên kết các phụ âm.
Paribbājakoti sañjayassa antevāsī channaparibbājako.
Paribbājako means a wanderer of the six schools, a disciple of Sañjaya.
Paribbājako là du sĩ Sāñjaya, đệ tử của Sañjaya.
Idaṃ vuttaṃ hoti – ‘‘yadā bhagavā taṃ addhānamaggaṃ paṭipanno, tadā suppiyopi paribbājako paṭipanno ahosī’’ti.
This is what is meant: “When the Blessed One set out on that long journey, Suppiya the wanderer also set out.”
Điều này có nghĩa là: “Khi Đức Thế Tôn đang đi trên con đường đó, thì du sĩ Suppiya cũng đang đi trên con đường đó.”
Atītakālattho hettha hoti-saddo.
Here, the word ‘hoti’ has the meaning of past tense.
Ở đây, từ hoti có nghĩa là thì quá khứ.
Ādīsu hi satto māṇavoti vutto.
In such passages, a being is called ‘māṇavo’.
Trong những trường hợp như vậy, chúng sanh được gọi là māṇavo.
‘‘Māṇavehipi samāgacchanti katakammehipi akatakammehipī’’tiādīsu (ma. ni. 2.149) coro.
In passages such as, “They associate even with māṇavā, both those who have committed crimes and those who have not,” it means a thief.
Trong những trường hợp như ‘‘Māṇavehipi samāgacchanti katakammehipi akatakammehipī’’ (họ gặp gỡ cả những kẻ trộm đã gây tội và chưa gây tội), māṇavo được gọi là kẻ trộm.
‘‘Ambaṭṭho māṇavo, aṅgako māṇavo’’tiādīsu (dī. ni. 1.316) taruṇo ‘māṇavo’ti vutto.
In passages such as, “the māṇava Ambaṭṭha, the māṇava Aṅgaka,” a young person is called ‘māṇavo’.
Trong những trường hợp như ‘‘Ambaṭṭho māṇavo, Aṅgako māṇavo’’ (chàng trai Ambaṭṭha, chàng trai Aṅgaka), māṇavo được gọi là người trẻ tuổi.
Idhāpi ayamevattho.
Here too, this is the meaning.
Ở đây cũng là ý nghĩa này.
Idañhi vuttaṃ hoti – brahmadattena nāma taruṇantevāsinā saddhinti.
For this is what is said: with the young disciple named Brahmadatta.
Điều này có nghĩa là: “Cùng với đệ tử trẻ tuổi tên là Brahmadatta.”
Tatrāti tasmiṃ addhānamagge, tesu vā dvīsu janesu.
Tatra means on that long journey, or between those two persons.
Tatrā (ở đó) có nghĩa là trên con đường đó, hoặc trong hai người đó.
Sudanti nipātamattaṃ.
Sudaṃ is a mere particle.
Sudaṃ chỉ là một giới từ.
Anekapariyāyenāti pariyāya-saddo tāva vāradesanākāraṇesu vattati.
Anekapariyāyena: The word ‘pariyāya’ is used in the sense of a turn, a discourse, and a reason.
Từ Anekapariyāyenā (bằng nhiều cách) – từ pariyāya được dùng với ý nghĩa là lượt, lời dạy, và nguyên nhân.
‘‘Kassa nu kho, ānanda, ajja pariyāyo bhikkhuniyo ovaditu’’ntiādīsu (ma. ni. 3.398) hi vāre pariyāyasaddo vattati.
For in passages such as, “Whose turn is it today, Ānanda, to admonish the bhikkhunīs?” the word ‘pariyāya’ is used in the sense of a turn.
Trong những trường hợp như ‘‘Kassa nu kho, Ānanda, ajja pariyāyo bhikkhuniyo ovaditu’’ (Này Ānanda, hôm nay là lượt của ai để giáo huấn các Tỳ-khưu-ni?), từ pariyāya được dùng với ý nghĩa là lượt.
‘‘Madhupiṇḍikapariyāyotveva naṃ dhārehī’’tiādīsu (ma. ni. 1.205) desanāyaṃ.
In passages such as, “Remember it as the Honeyball Discourse (Madhupiṇḍikapariyāya),” it is used in the sense of a discourse.
Trong những trường hợp như ‘‘Madhupiṇḍikapariyāyotveva naṃ dhārehī’’ (Hãy ghi nhớ nó như là lời dạy về Madhupiṇḍika), nó được dùng với ý nghĩa là lời dạy.
‘‘Imināpi kho, te rājañña, pariyāyena evaṃ hotū’’tiādīsu (dī. ni. 2.411) kāraṇe.
In passages such as, “For this reason too, Your Majesty, let it be so for you,” it is used in the sense of a reason.
Trong những trường hợp như ‘‘Imināpi kho, te rājañña, pariyāyena evaṃ hotū’’ (Này vương tử, với lý do này, điều đó cũng nên là như vậy đối với ngài), nó được dùng với ý nghĩa là nguyên nhân.
Svāyamidhāpi kāraṇe vattati, tasmā ayamettha attho – ‘‘anekavidhena kāraṇenā’’ti, ‘‘bahūhi kāraṇehī’’ti vuttaṃ hoti.
Here too, it is used in the sense of a reason, therefore this is the meaning here: “for many kinds of reasons,” which means “for many reasons.”
Ở đây, từ này cũng được dùng với ý nghĩa là nguyên nhân. Do đó, ý nghĩa ở đây là ‘‘bằng nhiều loại nguyên nhân’’, có nghĩa là ‘‘bằng nhiều nguyên nhân’’.
Buddhassa avaṇṇaṃ bhāsatīti avaṇṇavirahitassa aparimāṇavaṇṇasamannāgatassāpi buddhassa bhagavato – ‘‘yaṃ loke jātivuḍḍhesu kattabbaṃ abhivādanādisāmīcikammaṃ ‘sāmaggiraso’ti vuccati, taṃ samaṇassa gotamassa natthi tasmā arasarūpo samaṇo gotamo, nibbhogo, akiriyavādo, ucchedavādo, jegucchī, venayiko, tapassī, apagabbho.
Speaks dispraise of the Buddha: Of the Blessed One, the Buddha, who is devoid of dispraise and endowed with immeasurable praise, he speaks dispraise, fault, and blame in various ways, saying that this and that non-reason is a reason, as follows: “The respectful conduct such as salutation that should be performed in the world towards those senior in birth, which is called the ‘taste of harmony,’ is absent in the ascetic Gotama; therefore, the ascetic Gotama has the nature of being tasteless, is without enjoyment, is a proponent of inaction, a proponent of annihilation, is loathsome, is a disciplinarian, is an ascetic, is without a good rebirth.
Buddhassa avaṇṇaṃ bhāsatī (nói lời phỉ báng Đức Phật) – đối với Đức Phật, Đức Thế Tôn, Đấng vô cấu, Đấng đầy đủ vô lượng công đức, vị ấy nói: “Không có sự tôn kính, lễ bái v.v... đáng được thực hiện đối với những người lớn tuổi về tuổi tác trên thế gian, điều được gọi là ‘hương vị của sự hòa hợp’, đối với Sa-môn Gotama. Do đó, Sa-môn Gotama là người không có hương vị, không có tài sản, là người chủ trương không hành động, là người chủ trương đoạn diệt, là người ghê tởm, là người cần được uốn nắn, là người khổ hạnh, là người không có khả năng.
Natthi samaṇassa gotamassa uttarimanussadhammo alamariyañāṇadassanaviseso.
The ascetic Gotama has no superhuman states, no special knowledge and vision befitting the noble ones.
Sa-môn Gotama không có pháp thượng nhân, không có sự đặc biệt về trí tuệ và cái thấy của bậc Thánh.
Takkapariyāhataṃ samaṇo gotamo dhammaṃ deseti, vīmaṃsānucaritaṃ, sayaṃpaṭibhānaṃ.
The ascetic Gotama teaches a Dhamma hammered out by reasoning, following his own investigations, a product of his own ingenuity.
Sa-môn Gotama thuyết pháp bị suy luận làm tổn hại, bị khảo sát làm tổn hại, là sự ứng biến tự thân.
Samaṇo gotamo na sabbaññū, na lokavidū, na anuttaro, na aggapuggalo’’ti.
The ascetic Gotama is not all-knowing, not a knower of the world, not the unsurpassed, not the foremost person.”
Sa-môn Gotama không phải là bậc Toàn Tri, không phải là bậc Thế Gian Giải, không phải là bậc Vô Thượng, không phải là bậc Tối Thượng.”
Evaṃ taṃ taṃ akāraṇameva kāraṇanti vatvā tathā tathā avaṇṇaṃ dosaṃ nindaṃ bhāsati.
Thus, claiming this and that non-reason as a reason, he speaks dispraise, fault, and blame in various ways.
Nói như vậy, vị ấy lấy những điều không phải là nguyên nhân làm nguyên nhân, và nói lời phỉ báng, lỗi lầm, chỉ trích theo nhiều cách khác nhau.
Antevāsī panassa – ‘‘amhākaṃ ācariyo aparāmasitabbaṃ parāmasati, anakkamitabbaṃ akkamati, svāyaṃ aggiṃ gilanto viya, hatthena asidhāraṃ parāmasanto viya, muṭṭhinā sineruṃ padāletukāmo viya, kakacadantapantiyaṃ kīḷamāno viya, pabhinnamadaṃ caṇḍahatthiṃ hatthena gaṇhanto viya ca vaṇṇārahasseva ratanattayassa avaṇṇaṃ bhāsamāno anayabyasanaṃ pāpuṇissati.
But his disciple thought: “Our teacher is touching what should not be touched, is treading where he should not tread. He will meet with ruin and disaster by speaking dispraise of the three jewels, which are worthy only of praise, just like one swallowing fire, like one touching the blade of a sword with his hand, like one wishing to split Mount Sineru with his fist, like one playing with a row of saw teeth, and like one grabbing a ferocious, musth-crazed elephant with his hand.
Còn đệ tử của vị ấy thì nói: “Thầy của chúng ta chạm vào những điều không nên chạm, bước lên những điều không nên bước. Vị ấy giống như nuốt lửa, như dùng tay chạm vào lưỡi gươm, như muốn đập nát núi Sineru bằng nắm đấm, như đang chơi đùa với hàng răng cưa, như dùng tay nắm lấy con voi hung dữ đang say, đang nói lời phỉ báng Ba Ngôi Báu đáng được ca ngợi, sẽ rơi vào sự hủy hoại và tai ương.
Ācariye kho pana gūthaṃ vā aggiṃ vā kaṇṭakaṃ vā kaṇhasappaṃ vā akkamante, sūlaṃ vā abhirūhante, halāhalaṃ vā visaṃ khādante, khārodakaṃ vā pakkhalante, narakapapātaṃ vā papatante, na antevāsinā taṃ sabbamanukātabbaṃ hoti.
But when a teacher is stepping on excrement, fire, thorns, or a black serpent, or is climbing onto a stake, or is eating deadly poison, or is slipping into a torrent of caustic water, or is falling into a hellish abyss, it is not for the disciple to imitate all of that.
Khi thầy bước lên phân, lửa, gai, hoặc rắn hổ mang, hoặc leo lên cây cọc nhọn, hoặc ăn chất độc halāhala, hoặc trượt chân xuống dòng nước mặn, hoặc rơi xuống vực thẳm địa ngục, thì đệ tử không nên làm theo tất cả những điều đó.
Kammassakā hi sattā attano kammānurūpameva gatiṃ gacchanti.
For beings are owners of their kamma; they go to a destination according to their own kamma.
Vì chúng sanh là chủ nhân của nghiệp, họ đi đến cảnh giới phù hợp với nghiệp của mình.
Neva pitā puttassa kammena gacchati, na putto pitu kammena, na mātā puttassa, na putto mātuyā, na bhātā bhaginiyā, na bhaginī bhātu, na ācariyo antevāsino, na antevāsī ācariyassa kammena gacchati.
A father does not go by the kamma of his son, nor a son by the kamma of his father; nor a mother of her son, nor a son of his mother; nor a brother of his sister, nor a sister of her brother; nor a teacher of his disciple, nor a disciple by the kamma of his teacher.
Cha không đi đến cảnh giới bằng nghiệp của con, con không đi đến cảnh giới bằng nghiệp của cha, mẹ không đi đến cảnh giới bằng nghiệp của con, con không đi đến cảnh giới bằng nghiệp của mẹ, anh/em không đi đến cảnh giới bằng nghiệp của chị/em gái, chị/em gái không đi đến cảnh giới bằng nghiệp của anh/em trai, thầy không đi đến cảnh giới bằng nghiệp của đệ tử, đệ tử không đi đến cảnh giới bằng nghiệp của thầy.
Mayhañca ācariyo tiṇṇaṃ ratanānaṃ avaṇṇaṃ bhāsati, mahāsāvajjo kho panāriyūpavādoti.
And my teacher speaks dispraise of the three jewels, but abuse of the noble ones is indeed a grave offense.”
Thầy của ta nói lời phỉ báng Ba Ngôi Báu, quả thật sự phỉ báng bậc Thánh là một tội lỗi lớn.”
Evaṃ yoniso ummujjitvā ācariyavādaṃ maddamāno sammākāraṇameva kāraṇato apadisanto anekapariyāyena tiṇṇaṃ ratanānaṃ vaṇṇaṃ bhāsitumāraddho, yathā taṃ paṇḍitajātiko kulaputto’’.
Thus, wisely emerging, refuting his teacher’s view, pointing to a proper reason as the reason, he began to speak praise of the three jewels in many ways, just as a wise man of good family would.
Sau khi suy nghĩ như vậy một cách đúng đắn, đè bẹp lời nói của thầy, chỉ ra những nguyên nhân đúng đắn là nguyên nhân, vị ấy bắt đầu nói lời ca ngợi Ba Ngôi Báu bằng nhiều cách khác nhau, giống như một thiện nam tử có trí tuệ.
Tena vuttaṃ – ‘‘suppiyassa pana paribbājakassa antevāsī brahmadatto māṇavo anekapariyāyena buddhassa vaṇṇaṃ bhāsati, dhammassa vaṇṇaṃ bhāsati, saṅghassa vaṇṇaṃ bhāsatī’’ti.
Therefore it was said: “But Suppiya the wanderer’s disciple, the young man Brahmadatta, speaks praise of the Buddha in many ways, speaks praise of the Dhamma, speaks praise of the Saṅgha.”
Do đó, đã nói: “Nhưng đệ tử của du sĩ Suppiya là chàng trai Brahmadatta đã nói lời ca ngợi Đức Phật bằng nhiều cách, nói lời ca ngợi Giáo Pháp, nói lời ca ngợi Tăng đoàn.”
Tattha vaṇṇanti vaṇṇa-saddo saṇṭhāna-jāti-rūpāyatana-kāraṇa-pamāṇa-guṇa-pasaṃsādīsu dissati.
Therein, the word vaṇṇa is seen in the senses of form, caste, visible object, reason, measure, quality, praise, and so on.
Ở đây, từ vaṇṇa (sắc) – từ vaṇṇa được thấy trong các ý nghĩa như hình dáng, chủng tộc, sắc xứ, nguyên nhân, thước đo, phẩm chất, lời khen ngợi v.v...
Tattha ‘‘mahantaṃ sapparājavaṇṇaṃ abhinimminitvā’’tiādīsu (saṃ. ni. 1.142) saṇṭhānaṃ vuccati.
Among these, in passages such as “having created the great form of a serpent king,” it refers to form.
Ở đây, trong những trường hợp như ‘‘mahantaṃ sapparājavaṇṇaṃ abhinimminitvā’’ (sau khi hóa hiện thành hình dáng của một vua rắn vĩ đại), nó được gọi là hình dáng.
‘‘Brāhmaṇova seṭṭho vaṇṇo, hīno añño vaṇṇo’’tiādīsu (ma. ni. 2.402) jāti.
In passages such as “The brahmin caste is the best; the other caste is inferior,” it refers to caste.
Trong những trường hợp như ‘‘Brāhmaṇova seṭṭho vaṇṇo, hīno añño vaṇṇo’’ (chủng tộc Bà-la-môn là tối thượng, các chủng tộc khác là thấp kém), nó được gọi là chủng tộc.
‘‘Paramāya vaṇṇapokkharatāya samannāgato’’tiādīsu (dī. ni. 1.303) rūpāyatanaṃ.
In passages such as “endowed with the highest excellence of complexion,” it refers to a visible object.
Trong những trường hợp như ‘‘Paramāya vaṇṇapokkharatāya samannāgato’’ (đầy đủ vẻ đẹp tối thượng), nó được gọi là sắc xứ.
Ādīsu kāraṇaṃ.
In such passages, it refers to a reason.
Trong những trường hợp như vậy, nó là nguyên nhân.
‘‘Tayo pattassa vaṇṇā’’tiādīsu (pārā. 602) pamāṇaṃ.
In passages such as “three vaṇṇā of a bowl,” it refers to a measure.
Trong những trường hợp như ‘‘Tayo pattassa vaṇṇā’’ (ba loại màu sắc của lá), nó là thước đo.
‘‘Kadā saññūḷhā pana, te gahapati, ime samaṇassa gotamassa vaṇṇā’’tiādīsu (ma. ni. 2.77) guṇo.
In passages such as “When, householder, did you grasp these vaṇṇā of the ascetic Gotama?” it refers to a quality.
Trong những trường hợp như ‘‘Kadā saññūḷhā pana, te gahapati, ime samaṇassa gotamassa vaṇṇā’’ (Này gia chủ, những phẩm chất này của Sa-môn Gotama đã được ngài nhận biết từ khi nào?), nó là phẩm chất.
‘‘Vaṇṇārahassa vaṇṇaṃ bhāsatī’’tiādīsu (a. ni. 2.135) pasaṃsā.
In passages such as, "He speaks the praise of one worthy of praise," it means praise.
Trong các câu như: “Nói lên lời tán thán của người đáng được tán thán”, đó là lời tán thán.
Idha guṇopi pasaṃsāpi.
Here, it means both virtue and praise.
Ở đây, cả phẩm chất (guṇa) và lời tán thán (pasaṃsā) đều được nói đến.
Ayaṃ kira taṃ taṃ bhūtameva kāraṇaṃ apadisanto anekapariyāyena ratanattayassa guṇūpasañhitaṃ pasaṃsaṃ abhāsi.
It is said that this one, pointing out that very true reason, spoke praise connected with the virtues of the Three Jewels in many ways.
Nghe nói, người này (Brahmadatta) đã nói lời tán thán liên quan đến phẩm chất của Tam Bảo (Ratanattaya) bằng nhiều cách khác nhau, chỉ ra những lý do thực sự.
Tattha – ‘‘itipi so bhagavā arahaṃ sammāsambuddho’’tiādinā (pārā. 1) nayena, ‘‘ye bhikkhave, buddhe pasannā agge te pasannā’’tiādinā ‘‘ekapuggalo, bhikkhave, loke uppajjamāno uppajjati…pe… asamo asamasamo’’tiādinā (a. ni. 1.174) ca nayena buddhassa vaṇṇo veditabbo.
Therein, the praise of the Buddha should be understood by the method of "Thus is the Blessed One: an Arahant, a Perfectly Enlightened One," and so on; and by the method of "Monks, those who have confidence in the Buddha have confidence in the supreme," and so on; and by the method of "Monks, one person arising in the world arises... unequalled, equal to the unequalled," and so on.
Trong đó, phẩm chất của Đức Phật (Buddha) cần được hiểu theo cách như: “Đức Thế Tôn ấy là bậc A-la-hán, bậc Chánh Đẳng Giác” và “Này các Tỳ-khưu, những ai có niềm tin nơi Đức Phật, họ có niềm tin nơi điều tối thượng” và “Này các Tỳ-khưu, một cá nhân xuất hiện trên thế gian… (v.v.)… là vô song, không ai sánh bằng.”
‘‘Svākkhāto bhagavatā dhammo’’ti (dī. ni. 2.159) ca ‘‘ālayasamugghāto vaṭṭupacchedo’’ti (iti. 90, a. ni. 4.34) ca, ‘‘ye bhikkhave, ariye aṭṭhaṅgike magge pasannā, agge te pasannā’’ti ca evamādīhi nayehi dhammassa vaṇṇo veditabbo.
The praise of the Dhamma should be understood by methods such as "The Dhamma is well-expounded by the Blessed One," and "It is the uprooting of attachments, the cutting off of the cycle," and "Monks, those who have confidence in the Noble Eightfold Path have confidence in the supreme," and so forth.
Phẩm chất của Giáo Pháp (Dhamma) cần được hiểu theo các cách như: “Giáo Pháp đã được Đức Thế Tôn khéo thuyết giảng” và “là sự nhổ tận gốc ái dục, sự đoạn trừ luân hồi” và “Này các Tỳ-khưu, những ai có niềm tin nơi Bát Chánh Đạo cao quý, họ có niềm tin nơi điều tối thượng.”
‘‘Suppaṭipanno bhagavato sāvakasaṅgho’’ti (dī. ni. 2.159) ca, ‘‘ye, bhikkhave, saṅghe pasannā, agge te pasannā’’ti (a. ni. 4.34) ca evamādīhi pana nayehi saṅghassa vaṇṇo veditabbo.
The praise of the Saṅgha, however, should be understood by methods such as "The Saṅgha of the Blessed One's disciples has practiced well," and "Monks, those who have confidence in the Saṅgha have confidence in the supreme," and so forth.
Phẩm chất của Tăng Đoàn (Saṅgha) cần được hiểu theo các cách như: “Tăng đoàn đệ tử của Đức Thế Tôn là những bậc hành trì chân chánh” và “Này các Tỳ-khưu, những ai có niềm tin nơi Tăng đoàn, họ có niềm tin nơi điều tối thượng.”
Pahontena pana dhammakathikena pañcanikāye navaṅgaṃ satthusāsanaṃ caturāsītidhammakkhandhasahassāni ogāhitvā buddhādīnaṃ vaṇṇo pakāsetabbo.
However, a capable Dhamma-preacher should proclaim the praise of the Buddha and the others after having penetrated the five Nikāyas, the nine-fold teaching of the Master, and the eighty-four thousand aggregates of the Dhamma.
Tuy nhiên, một vị pháp sư (dhammakathika) có khả năng cần phải đi sâu vào năm bộ Nikāya, vào giáo pháp của Đức Đạo Sư với chín chi phần, và vào tám vạn bốn ngàn pháp uẩn để tuyên bố phẩm chất của Đức Phật và các bậc khác.
Imasmiñhi ṭhāne buddhādīnaṃ guṇe pakāsento atitthena pakkhando dhammakathikoti na sakkā vattuṃ.
Indeed, in this matter, it cannot be said of one who proclaims the virtues of the Buddha and the others, that he is a Dhamma-preacher who has rushed into an improper landing-place.
Thật vậy, tại điểm này, không thể nói rằng một vị pháp sư tuyên bố phẩm chất của Đức Phật và các bậc khác là một vị pháp sư đã đi lạc vào bến không đúng.
Īdisesu hi ṭhānesu dhammakathikassa thāmo veditabbo.
For in such matters, the strength of the Dhamma-preacher should be known.
Thật vậy, tại những điểm như thế này, sức mạnh của vị pháp sư cần được biết đến.
Brahmadatto pana māṇavo anussavādimattasambandhitena attano thāmena ratanattayassa vaṇṇaṃ bhāsati.
The young man Brahmadatta, however, speaks the praise of the Three Jewels with his own strength, which is connected only with what has been heard by tradition and so on.
Tuy nhiên, thanh niên Brahmadatta đã nói lên phẩm chất của Tam Bảo (Ratanattaya) bằng sức mạnh của mình, vốn chỉ liên quan đến những gì được nghe kể lại (anussava) và những điều tương tự.
Itiha te ubho ācariyantevāsīti evaṃ te dve ācariyantevāsikā.
Thus, those two, the teacher and the pupil, means: thus those two, the teacher and pupil.
Hai vị thầy trò ấy có nghĩa là hai vị thầy trò đó.
Aññamaññassāti añño aññassa.
Of each other means: one of another.
Của nhau có nghĩa là người này của người kia.
Ujuvipaccanīkavādāti īsakampi apariharitvā ujumeva vividhapaccanīkavādā, anekavāraṃ viruddhavādā eva hutvāti attho.
Speaking in direct opposition means: without avoiding it even a little, they spoke in direct and varied opposition; the meaning is that they repeatedly held conflicting views.
Nói lời đối nghịch trực tiếp có nghĩa là không né tránh dù chỉ một chút, mà nói những lời đối nghịch trực tiếp và đa dạng, tức là đã nói những lời mâu thuẫn nhiều lần.
Ācariyena hi ratanattayassa avaṇṇe bhāsite antevāsī vaṇṇaṃ bhāsati, puna itaro avaṇṇaṃ, itaro vaṇṇanti evaṃ ācariyo sāraphalake visarukkhaāṇiṃ ākoṭayamāno viya punappunaṃ ratanattayassa avaṇṇaṃ bhāsati.
For when the teacher spoke dispraise of the Three Jewels, the pupil spoke praise; then the other spoke dispraise, and the other praise. Thus, like one hammering a poisonous wooden wedge into a plank of heartwood, the teacher repeatedly spoke dispraise of the Three Jewels.
Khi vị thầy nói lời phỉ báng Tam Bảo (Ratanattaya), người đệ tử nói lời tán thán; rồi người kia nói lời phỉ báng, người này nói lời tán thán. Cứ thế, vị thầy nhiều lần nói lời phỉ báng Tam Bảo, như thể đang đóng một cái đinh gỗ độc vào một tấm ván gỗ quý.
Antevāsī pana suvaṇṇarajatamaṇimayāya āṇiyā taṃ āṇiṃ paṭibāhayamāno viya punappunaṃ ratanattayassa vaṇṇaṃ bhāsati.
The pupil, however, like one counteracting that wedge with a wedge made of gold, silver, and jewels, repeatedly spoke praise of the Three Jewels.
Còn người đệ tử thì nhiều lần nói lời tán thán Tam Bảo, như thể đang dùng một cái đinh bằng vàng, bạc, ngọc để đẩy lùi cái đinh đó.
Tena vuttaṃ – ‘‘ujuvipaccanīkavādā’’ti.
Therefore, it was said: "speaking in direct opposition."
Vì thế, đã nói: “Nói lời đối nghịch trực tiếp.”
Kasmā pana bhagavā taṃ addhānaṃ paṭipanno?
But why did the Blessed One set out on that journey?
Tại sao Đức Thế Tôn lại đi trên con đường đó?
Kasmā ca suppiyo anubandho?
And why did Suppiya follow?
Và tại sao Suppiya lại đi theo?
Kasmā ca so ratanattayassa avaṇṇaṃ bhāsatīti?
And why did he speak dispraise of the Three Jewels?
Và tại sao người đó lại nói lời phỉ báng Tam Bảo?
Bhagavā tāva tasmiṃ kāle rājagahaparivattakesu aṭṭhārasasu mahāvihāresu aññatarasmiṃ vasitvā pātova sarīrappaṭijagganaṃ katvā bhikkhācāravelāyaṃ bhikkhusaṅghaparivuto rājagahe piṇḍāya carati.
The Blessed One, at that time, having stayed in one of the eighteen great monasteries surrounding Rājagaha, attended to his body early in the morning, and at the time for the alms round, surrounded by the Saṅgha of monks, went for alms in Rājagaha.
Đức Thế Tôn vào thời điểm đó, sau khi trú tại một trong mười tám đại tinh xá xung quanh Rājagaha, đã dậy sớm để chăm sóc thân thể, rồi vào giờ khất thực, Ngài cùng với Tăng đoàn Tỳ-khưu đi khất thực trong thành Rājagaha.
So taṃ divasaṃ bhikkhusaṅghassa sulabhapiṇḍapātaṃ katvā pacchābhattaṃ piṇḍapātapaṭikkanto bhikkhusaṅghaṃ pattacīvaraṃ gāhāpetvā – ‘‘nāḷandaṃ gamissāmī’’ti, rājagahato nikkhamitvā taṃ addhānaṃ paṭipanno.
On that day, having made alms-food easy to obtain for the Saṅgha of monks, after the meal, having returned from the alms-round, he had the Saṅgha of monks take their bowls and robes, and thinking, "I will go to Nāḷandā," he left Rājagaha and set out on that journey.
Vào ngày hôm đó, sau khi sắp xếp cho Tăng đoàn Tỳ-khưu dễ dàng nhận được vật thực, và sau khi dùng bữa trưa, Đức Thế Tôn đã rời khỏi nơi thọ thực, bảo Tăng đoàn Tỳ-khưu mang y bát, rồi nói: “Ta sẽ đi đến Nāḷandā,” và rời Rājagaha để đi trên con đường đó.
Suppiyopi kho tasmiṃ kāle rājagahaparivattake aññatarasmiṃ paribbājakārāme vasitvā paribbājakaparivuto rājagahe bhikkhāya carati.
Suppiya also, at that time, having stayed in a certain monastery for wanderers surrounding Rājagaha, surrounded by wanderers, went for alms in Rājagaha.
Vào thời điểm đó, Suppiya cũng trú tại một trong những tịnh xá du sĩ (paribbājakārāma) xung quanh Rājagaha, và cùng với nhóm du sĩ của mình đi khất thực trong thành Rājagaha.
Sopi taṃ divasaṃ paribbājakaparisāya sulabhabhikkhaṃ katvā bhuttapātarāso paribbājake paribbājakaparikkhāraṃ gāhāpetvā – nāḷandaṃ gamissāmicceva bhagavato taṃ maggaṃ paṭipannabhāvaṃ ajānantova anubandho.
He too, on that day, having made alms easy to obtain for the assembly of wanderers, and having had his morning meal, had the wanderers take their requisites, and thinking, "I will go to Nāḷandā," he followed, not knowing that the Blessed One had set out on that same path.
Vào ngày hôm đó, sau khi sắp xếp cho nhóm du sĩ của mình dễ dàng nhận được vật thực, và sau khi dùng bữa sáng, người đó đã bảo các du sĩ mang theo vật dụng của du sĩ, rồi nói: “Ta sẽ đi đến Nāḷandā,” và đi theo sau Đức Thế Tôn mà không biết rằng Ngài đã đi trên con đường đó.
Sace pana jāneyya nānubandheyya.
But if he had known, he would not have followed.
Nếu biết, anh ta sẽ không đi theo.
So ajānitvāva gacchanto gīvaṃ ukkhipitvā olokayamāno bhagavantaṃ addasa buddhasiriyā sobhamānaṃ rattakambalaparikkhittamiva jaṅgamakanakagirisikharaṃ.
While going along without knowing, he lifted his neck and looked, and saw the Blessed One, shining with the splendour of a Buddha, like a moving golden mountain peak draped with a red blanket.
Vì không biết, khi đang đi, anh ta ngẩng cổ lên nhìn và thấy Đức Thế Tôn đang tỏa sáng với vẻ uy nghi của một vị Phật, như một đỉnh núi vàng di động được bao phủ bởi một tấm chăn đỏ.
Asīti anubyañjanānurañjitañca pana bhagavato sarīraṃ vikasitakamaluppalamiva, saraṃ sabbapāliphullamiva pāricchattakaṃ, tārāmarīcivikasitamiva, gaganatalaṃ siriyā avahasantamiva, byāmappabhāparikkhepavilāsinī cassa dvattiṃsavaralakkhaṇamālā ganthetvā ṭhapitadvattiṃsacandamālāya dvattiṃsasūriyamālāya paṭipāṭiyā ṭhapitadvattiṃsacakkavattidvattiṃsasakkadevarājadvattiṃsamahābrahmānaṃ siriṃ siriyā abhibhavantimiva.
Furthermore, the Blessed One's body, adorned with the eighty minor characteristics, was like a blooming lotus or water lily, like a pāricchattaka tree in full bloom with all its leaves, like the sky resplendent with the rays of the stars, as if mocking its splendor. And his garland of the thirty-two excellent major characteristics, a thing of beauty with its surrounding aura of a fathom's breadth, seemed to surpass in splendor the splendor of thirty-two universal monarchs, thirty-two Sakkas, kings of the gods, and thirty-two Mahābrahmās, placed in a row like a garland of thirty-two moons or a garland of thirty-two suns.
Thân Đức Thế Tôn được tô điểm bằng tám mươi tướng phụ (anubyañjana), như một hồ sen nở rộ với tất cả các loại hoa sen, như cây pāricchattaka nở hoa khắp nơi, như bầu trời đêm rực rỡ ánh sao; và vầng hào quang một tầm tay của Ngài, như một chuỗi ba mươi hai tướng tốt được kết lại, dường như lấn át vẻ uy nghi của ba mươi hai mặt trăng, ba mươi hai mặt trời, ba mươi hai Chuyển Luân Vương, ba mươi hai vị vua trời Sakka và ba mươi hai vị Đại Phạm Thiên được sắp đặt theo thứ tự.
Tañca pana bhagavantaṃ parivāretvā ṭhitā bhikkhū sabbeva appicchā santuṭṭhā pavivittā asaṃsaṭṭhā codakā pāpagarahino vattāro vacanakkhamā sīlasampannā samādhipaññāvimuttivimuttiññāṇadassanasampannā.
And the monks standing around that Blessed One were all content with little, satisfied, secluded, unentangled, reprovers, censurers of evil, speakers, tolerant of speech, endowed with virtue, concentration, wisdom, liberation, and the knowledge and vision of liberation.
Và các Tỳ-khưu vây quanh Đức Thế Tôn đều là những người thiểu dục, biết đủ, sống độc cư, không giao thiệp, hay khiển trách (người khác), ghét điều ác, hay khuyên răn, chịu đựng lời khuyên, đầy đủ giới hạnh, đầy đủ định, tuệ, giải thoát và tri kiến giải thoát.
Tesaṃ majjhe bhagavā rattakambalapākāraparikkhitto viya kañcanathambho, rattapadumasaṇḍamajjhagatā viya suvaṇṇanāvā, pavāḷavedikāparikkhitto viya aggikkhandho, tārāgaṇaparivārito viya puṇṇacando migapakkhīnampi cakkhūni pīṇayati, pageva devamanussānaṃ.
In their midst, the Blessed One was like a golden pillar surrounded by a rampart of red blankets, like a golden boat in a grove of red lotuses, like a mass of fire surrounded by a coral railing, like the full moon surrounded by a host of stars, delighting the eyes of even animals and birds, let alone gods and humans.
Giữa họ, Đức Thế Tôn, như một cây cột vàng được bao quanh bởi bức tường vải đỏ, như một chiếc thuyền vàng giữa một rừng hoa sen đỏ, như một đống lửa được bao quanh bởi hàng rào san hô, như vầng trăng tròn được vây quanh bởi các vì sao, làm mãn nhãn cả chim muông, huống chi là chư thiên và loài người.
Tasmiñca pana divase yebhuyyena asītimahātherā meghavaṇṇaṃ paṃsukūlaṃ ekaṃsaṃ karitvā kattaradaṇḍaṃ ādāya suvammavammitā viya gandhahatthino vigatadosā vantadosā bhinnakilesā vijaṭitajaṭā chinnabandhanā bhagavantaṃ parivārayiṃsu.
And on that day, for the most part, the eighty great elders, having arranged their cloud-colored rag-robes over one shoulder and taking up their staffs, surrounded the Blessed One like noble elephants clad in fine armor, free from faults, having vomited out faults, with defilements shattered, with tangles untangled, and with bonds cut off.
Và vào ngày hôm đó, phần lớn tám mươi vị Đại Trưởng Lão, khoác y phấn tảo màu mây lên một bên vai và cầm gậy, như những con voi hương được trang bị áo giáp vàng, đã đoạn trừ mọi phiền não, đã nhổ bỏ mọi tham ái, đã phá tan mọi cấu uế, đã gỡ bỏ mọi nút thắt, đã chặt đứt mọi ràng buộc, vây quanh Đức Thế Tôn.
So sayaṃ vītarāgo vītarāgehi, sayaṃ vītadoso vītadosehi, sayaṃ vītamoho vītamohehi, sayaṃ vītataṇho vītataṇhehi, sayaṃ nikkileso nikkilesehi, sayaṃ buddho anubuddhehi parivārito; pattaparivāritaṃ viya kesaraṃ, kesaraparivāritā viya kaṇṇikā, aṭṭhanāgasahassaparivārito viya chaddanto nāgarājā, navutihaṃsasahassaparivārito viya dhataraṭṭho haṃsarājā, senaṅgaparivārito viya cakkavattirājā, devagaṇaparivārito viya sakko devarājā, brahmagaṇaparivārito viya hārito mahābrahmā, aparimitakālasañcitapuññabalanibbattāya acinteyyāya anopamāya buddhalīlāya cando viya gaganatalaṃ taṃ maggaṃ paṭipanno hoti.
He, being himself free from passion, is surrounded by those free from passion; himself free from aversion, surrounded by those free from aversion; himself free from delusion, surrounded by those free from delusion; himself free from craving, surrounded by those free from craving; himself without defilements, surrounded by those without defilements; himself a Buddha, surrounded by those who have become Buddhas after him; like the filament surrounded by its petals, like the pericarp surrounded by its filaments, like Chaddanta the king of elephants surrounded by eight thousand elephants, like Dhataraṭṭha the king of swans surrounded by ninety thousand swans, like a universal monarch surrounded by the constituents of his army, like Sakka the king of gods surrounded by the host of gods, like Hārita the great Brahmā surrounded by the host of Brahmās, he had entered upon that path with the incomparable, unimaginable Buddha-grace produced by the power of merit accumulated over an immeasurable period of time, like the moon entering the expanse of the sky.
Ngài tự mình đã đoạn trừ tham ái, được bao quanh bởi các bậc đã đoạn trừ tham ái; tự mình đã đoạn trừ sân hận, được bao quanh bởi các bậc đã đoạn trừ sân hận; tự mình đã đoạn trừ si mê, được bao quanh bởi các bậc đã đoạn trừ si mê; tự mình đã đoạn trừ tham ái, được bao quanh bởi các bậc đã đoạn trừ tham ái; tự mình đã không còn phiền não, được bao quanh bởi các bậc đã không còn phiền não; tự mình là bậc Giác Ngộ, được bao quanh bởi các bậc tùy giác ngộ (A-la-hán); giống như nhụy hoa được bao quanh bởi các cánh hoa, giống như đài hoa được bao quanh bởi các nhụy hoa, giống như voi chúa Chaddanta được bao quanh bởi tám ngàn con voi, giống như vua thiên nga Dhataraṭṭha được bao quanh bởi chín mươi ngàn con thiên nga, giống như vua Chuyển Luân Thánh Vương được bao quanh bởi bốn binh chủng, giống như Sakka, vua chư Thiên, được bao quanh bởi đoàn chư Thiên, giống như Đại Phạm Thiên Hārita được bao quanh bởi đoàn Phạm Thiên, Ngài đã đi trên con đường đó với phong thái của một Đức Phật không thể nghĩ bàn, vô song, được sinh ra từ sức mạnh công đức tích lũy trong vô lượng thời gian, giống như mặt trăng trên bầu trời.
Athevaṃ bhagavantaṃ anopamāya buddhalīlāya gacchantaṃ bhikkhū ca okkhittacakkhū santindriye santamānase uparinabhe ṭhitaṃ puṇṇacandaṃ viya bhagavantaṃyeva namassamāne disvāva paribbājako attano parisaṃ avalokesi.
Then, upon seeing the Blessed One traveling with such incomparable Buddha-grace, and the bhikkhus with downcast eyes, serene faculties, and peaceful minds, who were paying homage only to the Blessed One, who was like the full moon in the sky above, the wanderer glanced at his own assembly.
Khi Đức Thế Tôn đang đi với phong thái Phật Đà vô song như vậy, vị du sĩ kia nhìn thấy các Tỳ-khưu với mắt nhìn xuống, các căn an tịnh, tâm an tịnh, đang đảnh lễ Đức Thế Tôn như vầng trăng tròn trên bầu trời, liền nhìn lại hội chúng của mình.
Sā hoti kājadaṇḍake olambetvā gahitoluggaviluggapiṭṭhakatidaṇḍamorapiñchamattikāpattapasibbakakuṇḍikādianekaparikkhārabhārabharitā.
That assembly was laden with the burden of many requisites—such as dilapidated and rickety small stools, tripods, peacock-feather fans, clay bowls, small bags, and water pots—which were carried hanging from shoulder-poles.
Hội chúng của ông ta đầy ắp các vật dụng của du sĩ như gậy, ghế ba chân đã cũ nát hư hỏng, lông công, bình bát đất, túi vải, bình nước, v.v., treo lủng lẳng trên cây gậy mang vai.
‘‘Asukassa hatthā sobhaṇā, asukassa pādā’’ti evamādiniratthakavacanā mukharā vikiṇṇavācā adassanīyā apāsādikā.
They were boisterous, speaking useless words such as, "So-and-so's hands are beautiful, so-and-so's feet are beautiful," with scattered speech, unpleasant to see, and uninspiring.
Họ nói những lời vô ích như: “Tay của người kia đẹp quá, chân của người kia đẹp quá”, v.v., ồn ào, lời nói tán loạn, không đáng nhìn, không đáng kính.
Tassa taṃ disvā vippaṭisāro udapādi.
Seeing that, remorse arose in him.
Khi nhìn thấy điều đó, vị du sĩ ấy khởi lên sự hối hận.
Idāni tena bhagavato vaṇṇo vattabbo bhaveyya.
At this point, he should have spoken in praise of the Blessed One.
Đáng lẽ lúc này ông ta phải ca ngợi Đức Thế Tôn.
Yasmā panesa lābhasakkārahāniyā ceva pakkhahāniyā ca niccampi bhagavantaṃ usūyati.
But because of the loss of gains and honor, and the loss of his following, he was always jealous of the Blessed One.
Tuy nhiên, vì ông ta luôn ganh tị với Đức Thế Tôn do sự mất mát lợi lộc và danh tiếng.
Aññatitthiyānañhi yāva buddho loke nuppajjati, tāvadeva lābhasakkārā nibbattanti, buddhuppādato pana paṭṭhāya parihīnalābhasakkārā honti, sūriyuggamane khajjopanakā viya nissirīkataṃ āpajjanti.
For as long as a Buddha does not arise in the world, the other sectarians receive gains and honor, but from the time of a Buddha's arising, their gains and honor diminish; like fireflies at sunrise, they become devoid of splendor.
Quả thật, đối với các ngoại đạo, chừng nào Đức Phật chưa xuất hiện trên thế gian, chừng đó họ còn có được lợi lộc và danh tiếng; nhưng từ khi Đức Phật xuất hiện, lợi lộc và danh tiếng của họ suy giảm, trở nên không còn vẻ vang như đom đóm khi mặt trời mọc.
Upatissakolitānañca sañjayassa santike pabbajitakāleyeva paribbājakā mahāparisā ahesuṃ, tesu pana pakkantesu sāpi tesaṃ parisā bhinnā.
Even at the time when Upatissa and Kolita went forth under Sañjaya, the wanderers had a large following, but when those two left, that following of theirs broke up.
Và khi Upatissa và Kolita còn xuất gia với Sañjaya, hội chúng của ông ta rất đông đảo, nhưng khi họ rời đi, hội chúng đó cũng tan rã.
Iti imehi dvīhi kāraṇehi ayaṃ paribbājako yasmā niccampi bhagavantaṃ usūyati, tasmā taṃ usūyavisuggāraṃ uggiranto ratanattayassa avaṇṇameva bhāsatīti veditabbo.
It should be understood that due to these two reasons, this wanderer was always jealous of the Blessed One; therefore, vomiting out the venom of that jealousy, he spoke only in dispraise of the Triple Gem.
Vì vậy, do hai lý do này, vị du sĩ này luôn ganh tị với Đức Thế Tôn, nên cần phải hiểu rằng ông ta đang phun ra chất độc ganh tị đó, chỉ nói lời phỉ báng Tam Bảo.
Tattha ambalaṭṭhikāti rañño uyyānaṃ.
Therein, Ambalaṭṭhikā is the king's park.
Ở đây, Ambalaṭṭhikā là vườn của nhà vua.
Tassa kira dvārasamīpe taruṇaambarukkho atthi, taṃ ‘‘ambalaṭṭhikā’’ti vadanti.
It is said that near its gate there was a young mango tree, which they called "ambalaṭṭhikā" (the tender mango).
Nghe nói, gần cổng vườn có một cây xoài non, người ta gọi đó là “Ambalaṭṭhikā”.
Tassa avidūre bhavattā uyyānampi ambalaṭṭhikā tveva saṅkhyaṃ gataṃ.
Because it was not far from it, the park also came to be known as Ambalaṭṭhikā.
Vì khu vườn nằm không xa cây xoài đó, nên khu vườn cũng được gọi là Ambalaṭṭhikā.
Taṃ chāyūdakasampannaṃ pākāraparikkhittaṃ suyojitadvāraṃ mañjusā viya suguttaṃ.
It was endowed with shade and water, enclosed by a wall, with a well-fitted gate, and as secure as a chest.
Khu vườn đó có nhiều bóng mát và nước, được bao quanh bởi tường rào, cổng được lắp đặt chắc chắn, được bảo vệ cẩn mật như một chiếc rương.
Tattha rañño kīḷanatthaṃ paṭibhānacittavicittaṃ agāraṃ akaṃsu.
There, they had built a house, exquisitely beautiful with spontaneous and imaginative artistry, for the king's recreation.
Ở đó, người ta đã xây một ngôi nhà lộng lẫy, tinh xảo, đẹp đẽ để nhà vua vui chơi.
Taṃ ‘‘rājāgāraka’’nti vuccati.
It is called the "royal rest house."
Ngôi nhà đó được gọi là “nhà vua” (Rājāgāraka).
Suppiyopi khoti suppiyopi tasmiṃ ṭhāne sūriyaṃ oloketvā – ‘‘akālo dāni gantuṃ, bahū khuddakamahallakā paribbājakā, bahuparissayo ca ayaṃ maggo corehipi vāḷayakkhehipi vāḷamigehipi.
Suppiya also means: Suppiya also, at that place, looked at the sun and thought, "It is now the wrong time to travel. There are many wanderers, both young and old, and this road is very dangerous because of thieves, fierce yakkhas, and wild beasts.
Suppiya cũng vậy, Suppiya cũng nhìn mặt trời ở nơi đó và nghĩ: “Bây giờ không phải lúc để đi nữa, có rất nhiều du sĩ nhỏ tuổi và lớn tuổi, và con đường này rất nguy hiểm bởi cướp bóc, yêu quái và thú dữ.
Ayaṃ kho pana samaṇo gotamo uyyānaṃ paviṭṭho, samaṇassa ca gotamassa vasanaṭṭhāne devatā ārakkhaṃ gaṇhanti, handāhampi idha ekarattivāsaṃ upagantvā sveva gamissāmī’’ti tadevuyyānaṃ pāvisi.
But this recluse Gotama has entered the park, and in the dwelling place of the recluse Gotama, deities provide protection. Well then, I too will take up a one-night stay here and go tomorrow." So he entered that same park.
Sa-môn Gotama này đã vào khu vườn, và ở nơi Sa-môn Gotama trú ngụ, các vị chư Thiên sẽ bảo vệ, vậy thì ta cũng nên ở lại đây một đêm và ngày mai sẽ đi.” Thế là ông ta cũng vào khu vườn đó.
Tato bhikkhusaṅgho bhagavato vattaṃ dassetvā attano attano vasanaṭṭhānaṃ sallakkhesi.
Then the Saṅgha of bhikkhus, having shown their duties towards the Blessed One, each marked out his own dwelling place.
Sau đó, Tăng đoàn đã thực hiện các bổn phận đối với Đức Thế Tôn và chọn chỗ ở cho riêng mình.
Paribbājakopi uyyānassa ekapasse paribbājakaparikkhāre otāretvā vāsaṃ upagacchi saddhiṃ attano parisāya.
The wanderer also, on one side of the park, had the wanderers' requisites unloaded and took up residence with his assembly.
Vị du sĩ kia cũng hạ các vật dụng của du sĩ xuống một bên khu vườn và trú ngụ cùng với hội chúng của mình.
Pāḷiyamārūḷhavaseneva pana – ‘‘saddhiṃ attano antevāsinā brahmadattena māṇavenā’’ti vuttaṃ.
However, it is stated according to the way it is presented in the Pāḷi text: " together with his disciple, the young man Brahmadatta."
Tuy nhiên, trong Pāḷi, chỉ nói theo cách thông thường: “cùng với đệ tử của mình là thanh niên Brahmadatta.”
Evaṃ vāsaṃ upagato pana so paribbājako rattibhāge dasabalaṃ olokesi.
Having thus taken up residence, that wanderer looked at the one of Ten Powers during the night.
Khi đã trú ngụ như vậy, vị du sĩ đó vào ban đêm đã nhìn Đức Thập Lực (Đức Phật).
Tasmiñca samaye samantā vippakiṇṇatārakā viya padīpā jalanti, majjhe bhagavā nisinno hoti, bhikkhusaṅgho ca bhagavantaṃ parivāretvā.
And at that time, lamps were burning all around like scattered stars, and in the middle sat the Blessed One, with the Saṅgha of bhikkhus surrounding him.
Vào lúc đó, các ngọn đèn sáng rực như những vì sao rải rác khắp nơi, Đức Thế Tôn đang ngồi ở giữa, và Tăng đoàn đang vây quanh Đức Thế Tôn.
Tattha ekabhikkhussapi hatthakukkuccaṃ vā pādakukkuccaṃ vā ukkāsitasaddo vā khipitasaddo vā natthi.
There, not even a single bhikkhu made a clumsy movement of the hand or foot, nor was there the sound of coughing or sneezing.
Trong số các Tỳ-khưu đó, không một ai có cử chỉ tay chân lóng ngóng, tiếng ho hay tiếng khạc nhổ.
Sā hi parisā attano ca sikkhitasikkhatāya satthari ca gāravenāti dvīhi kāraṇehi nivāte padīpasikhā viya niccalā sannisinnāva ahosi.
Indeed, for two reasons—their own well-trained discipline and their reverence for the Teacher—that assembly was sitting perfectly still, like the flame of a lamp in a windless place.
Hội chúng đó, do sự tu học đã được rèn luyện của chính mình và sự tôn kính đối với Bậc Đạo Sư, đã ngồi yên lặng như ngọn đèn trong nơi không có gió.
Paribbājako taṃ vibhūtiṃ disvā attano parisaṃ olokesi.
The wanderer saw that splendor and looked at his own assembly.
Vị du sĩ nhìn thấy sự trang nghiêm đó liền nhìn lại hội chúng của mình.
Tattha keci hatthaṃ khipanti, keci pādaṃ, keci vippalapanti, keci nillālitajivhā paggharitakheḷā, dante khādantā kākacchamānā gharugharupassāsino sayanti.
There, some were flinging their arms, some their legs; some were talking deliriously; some were sleeping with their tongues lolling out, saliva dribbling, grinding their teeth, making croaking sounds, and breathing heavily.
Ở đó, một số người vung tay, một số người vung chân, một số người lảm nhảm, một số người lưỡi thè ra, nước dãi chảy ròng, nghiến răng, kêu réo và thở khò khè mà ngủ.
So ratanattayassa guṇavaṇṇe vattabbepi issāvasena puna avaṇṇameva ārabhi.
He, although he should have spoken in praise of the qualities of the Triple Gem, again began to speak only in dispraise due to jealousy.
Mặc dù đáng lẽ phải ca ngợi các đức tính của Tam Bảo, nhưng do sự ganh tị, ông ta lại bắt đầu phỉ báng.
Brahmadatto pana vuttanayeneva vaṇṇaṃ.
Brahmadatta, however, spoke in praise in the way already described.
Còn Brahmadatta thì ca ngợi theo cách đã nói.
Tena vuttaṃ – ‘‘tatrāpi sudaṃ suppiyo paribbājako’’ti sabbaṃ vattabbaṃ.
Because of that, it was said: " There, too, it seems, the wanderer Suppiya," and all of it should be stated.
Vì vậy, có lời nói: “Ở đó, du sĩ Suppiya cũng vậy,” tất cả đều phải được nói.
Tattha tatrāpīti tasmimpi, ambalaṭṭhikāyaṃ uyyāneti attho.
Therein, there, too means: in that very park at Ambalaṭṭhikā; that is the meaning.
Ở đây, tatrāpī có nghĩa là “cũng ở đó, trong khu vườn Ambalaṭṭhikā.”
3. Sambahulānanti bahukānaṃ.
3. A good number of means many.
3. Sambahulānaṃ có nghĩa là “nhiều.”
Tattha vinayapariyāyena tayo janā ‘‘sambahulā’’ti vuccanti.
In this context, according to the Vinaya tradition, three persons are called "a good number."
Trong đó, theo cách nói của Luật tạng, ba người được gọi là “sambahulā” (nhiều).
Tato paraṃ saṅgho.
More than that is a Saṅgha.
Từ đó trở đi là Tăng đoàn.
Suttantapariyāyena pana tayo tayova tato paṭṭhāya sambahulā.
However, according to the Suttanta tradition, from three onwards are a good number.
Còn theo cách nói của Kinh tạng, ba người trở lên được gọi là sambahulā.
Idha suttantapariyāyena ‘‘sambahulā’’ti veditabbā.
Here, "a good number" should be understood according to the Suttanta tradition.
Ở đây, cần phải hiểu là “sambahulā” theo cách nói của Kinh tạng.
Maṇḍalamāḷeti katthaci dve kaṇṇikā gahetvā haṃsavaṭṭakacchannena katā kūṭāgārasālāpi ‘‘maṇḍalamāḷo’’ti vuccati, katthaci ekaṃ kaṇṇikaṃ gahetvā thambhapantiṃ parikkhipitvā katā upaṭṭhānasālāpi ‘‘maṇḍalamāḷo’’ti vuccati.
In the round pavilion: In some places, a hall with a pinnacled roof, made by taking two pinnacles and covering it with a swan-circle pattern, is also called a "round pavilion." In some places, a service hall, made by taking one pinnacle and surrounding it with a row of pillars, is also called a "round pavilion."
Maṇḍalamāḷe – ở một số nơi, một sảnh đường có mái nhọn được làm bằng cách lấy hai đỉnh và lợp bằng hình chim thiên nga được gọi là “maṇḍalamāḷa”; ở một số nơi khác, một sảnh đường phục vụ được làm bằng cách lấy một đỉnh và bao quanh bởi hàng cột cũng được gọi là “maṇḍalamāḷa”.
Idha pana nisīdanasālā ‘‘maṇḍalamāḷo’’ti veditabbo.
Here, however, a sitting hall should be understood as a "round pavilion."
Ở đây, cần phải hiểu “maṇḍalamāḷa” là sảnh đường để ngồi.
Sannisinnānanti nisajjanavasena.
Were sitting together refers to the act of sitting.
Sannisinnānaṃ có nghĩa là “theo cách ngồi xuống.”
Sannipatitānanti samodhānavasena.
Were assembled together refers to the act of coming together.
Sannipatitānaṃ có nghĩa là “theo cách tụ họp.”
Ayaṃ saṅkhiyadhammoti saṅkhiyā vuccati kathā, kathādhammoti attho.
This topic of conversation: saṅkhiyā is said to be talk; the meaning is the substance of the talk.
Ayaṃ saṅkhiyadhammo – saṅkhiyā có nghĩa là lời nói, tức là “pháp thoại”.
Udapādīti uppanno.
Arose means it came up.
Udapādī có nghĩa là “đã phát sinh”.
Katamo pana soti?
But what was it?
Vậy đó là gì?
Acchariyaṃ āvusoti evamādi.
"It is wonderful, friends," and so forth.
Là “Thật hy hữu, thưa chư hiền giả,” v.v.
Tattha andhassa pabbatārohaṇaṃ viya niccaṃ na hotīti acchariyaṃ. Ayaṃ tāva saddanayo.
Therein, it is not something that happens constantly, like a blind person climbing a mountain, thus it is wonderful. This, for now, is the etymological explanation.
Ở đây, điều gì không xảy ra thường xuyên, giống như người mù leo núi, thì được gọi là acchariyaṃ (hy hữu). Đây là cách giải thích theo ngữ pháp.
Ayaṃ pana aṭṭhakathānayo – accharāyogganti acchariyaṃ. Accharaṃ paharituṃ yuttanti attho.
This, however, is the commentarial explanation: it is worthy of a snap of the fingers, thus it is wonderful. The meaning is that it is fitting to snap one's fingers.
Còn đây là cách giải thích của Chú giải: điều gì đáng để vỗ tay thì gọi là acchariyaṃ. Có nghĩa là điều gì phù hợp để vỗ tay.
Abhūtapubbaṃ bhūtanti abbhutaṃ. Ubhayaṃ petaṃ vimhayassevādhivacanaṃ.
What has not been before has come to be, thus it is astounding. Both of these are synonyms for amazement.
Điều gì chưa từng xảy ra trước đây mà nay xảy ra thì gọi là abbhutaṃ (kỳ diệu). Cả hai từ này đều là đồng nghĩa của sự kinh ngạc.
Yāvañcidanti yāva ca idaṃ tena suppaṭividitatāya appameyyattaṃ dasseti.
To what an extent indicates immeasurability on account of its having been so well penetrated.
Yāvañcidaṃ – điều này thể hiện sự vô lượng của sự thấu hiểu hoàn hảo đó.
Idānissa suppaṭividitabhāvaṃ dassetuṃ ayañhītiādimāha.
Now, to show that it was thoroughly penetrated, he said, “For these...” and so on.
Bây giờ, để chỉ ra sự thấu hiểu rõ ràng này, Ngài nói: “ Ayañhi (Thật vậy)...” v.v.
Idaṃ vuttaṃ hoti yā ca ayaṃ bhagavatā ‘‘dhātuso, bhikkhave, sattā saṃsandanti samenti, hīnādhimuttikā hīnādhimuttikehi saddhiṃ saṃsandanti samenti, kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandanti samenti.
This is what was said: That which was known by the Blessed One, this diversity of dispositions, diversity of inclinations, diversity of views, diversity of approvals, and diversity of preferences of beings, known by the knowledge of the diversity of dispositions, by the knowledge of omniscience, as if measuring with a bushel or weighing with a scale, when he said: “Monks, beings associate and come together by way of element. Those of inferior disposition associate and come together with those of inferior disposition. Those of noble disposition associate and come together with those of noble disposition.
Điều này có nghĩa là, sự khác biệt về khuynh hướng (nānādhimuttikatā), sự khác biệt về ý định (nānajjhāsayatā), sự khác biệt về quan điểm (nānādiṭṭhikatā), sự khác biệt về sự chấp nhận (nānākhantitā), sự khác biệt về sở thích (nānārucitā) của chúng sanh, như Đức Thế Tôn đã nói: “Này các Tỳ-khưu, chúng sanh hòa hợp và kết hợp theo giới (dhātu). Những người có khuynh hướng thấp kém hòa hợp và kết hợp với những người có khuynh hướng thấp kém. Những người có khuynh hướng cao thượng hòa hợp và kết hợp với những người có khuynh hướng cao thượng.
Atītampi kho, bhikkhave, addhānaṃ dhātusova sattā saṃsandiṃsu samiṃsu, hīnādhimuttikā hīnādhimuttikehi…pe… kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandiṃsu samiṃsu, anāgatampi kho, bhikkhave, addhānaṃ…pe… saṃsandissanti samessanti, etarahipi kho, bhikkhave, paccuppannaṃ addhānaṃ dhātusova sattā saṃsandanti samenti, hīnādhimuttikā hīnādhimuttikehi…pe… kalyāṇādhimuttikā kalyāṇādhimuttikehi saddhiṃ saṃsandanti samentī’’ti evaṃ sattānaṃ nānādhimuttikatā, nānajjhāsayatā, nānādiṭṭhikatā, nānākhantitā, nānārucitā, nāḷiyā minantena viya tulāya tulayantena viya ca nānādhimuttikatāñāṇena sabbaññutaññāṇena viditā, sā yāva suppaṭividitā.
In the past, too, monks, beings associated and came together by way of element. Those of inferior disposition... those of noble disposition associated and came together with those of noble disposition. In the future, too, monks... they will associate and come together. And now, too, monks, in the present, beings associate and come together by way of element. Those of inferior disposition... those of noble disposition associate and come together with those of noble disposition”—that was so thoroughly penetrated.
Này các Tỳ-khưu, trong thời quá khứ, chúng sanh cũng hòa hợp và kết hợp theo giới. Những người có khuynh hướng thấp kém... v.v... Những người có khuynh hướng cao thượng hòa hợp và kết hợp với những người có khuynh hướng cao thượng. Này các Tỳ-khưu, trong thời vị lai... v.v... sẽ hòa hợp và kết hợp. Này các Tỳ-khưu, ngay cả trong thời hiện tại này, chúng sanh cũng hòa hợp và kết hợp theo giới. Những người có khuynh hướng thấp kém... v.v... Những người có khuynh hướng cao thượng hòa hợp và kết hợp với những người có khuynh hướng cao thượng.” Sự khác biệt về khuynh hướng này đã được Ngài biết bằng trí tuệ về sự khác biệt về khuynh hướng (nānādhimuttikatāñāṇa), tức là Nhất Thiết Chủng Trí (sabbaññutaññāṇa), như người đo bằng ống đong (nāḷi) hoặc cân bằng cân (tulā). Sự khác biệt đó được thấu hiểu một cách rất rõ ràng.
Dvepi nāma sattā ekajjhāsayā dullabhā lokasmiṃ.
Even two beings of the same inclination are rare in the world.
Thật khó tìm thấy hai chúng sanh có cùng một ý định trên thế gian.
Ekasmiṃ gantukāme eko ṭhātukāmo hoti, ekasmiṃ pivitukāme eko bhuñjitukāmo.
When one wants to go, another wants to stay; when one wants to drink, another wants to eat.
Khi một người muốn đi, người kia lại muốn ở lại; khi một người muốn uống, người kia lại muốn ăn.
Imesu cāpi dvīsu ācariyantevāsīsu ayañhi ‘‘suppiyo paribbājako…pe… bhagavantaṃ piṭṭhito piṭṭhito anubandhā honti bhikkhusaṅghañcā’’ti.
And even among these two, the teacher and the disciple, it is said: “For these... the wanderer Suppiya... were following closely behind the Blessed One and the Sangha of monks.”
Trong hai vị thầy và đệ tử này, “Thật vậy, du sĩ Suppiya... v.v... theo sau Đức Thế Tôn và Tăng đoàn”.
Tattha itihameti itiha ime, evaṃ imeti attho.
Therein, itihameti means iti ha ime, the meaning is “thus these.”
Ở đây, “itihame” có nghĩa là “itiha ime”, tức là “những người này như vậy”.
Sesaṃ vuttanayameva.
The rest is in the way already stated.
Phần còn lại cũng theo cách đã nói.
4. Atha kho bhagavā tesaṃ bhikkhūnaṃ imaṃ saṅkhiyadhammaṃ viditvāti ettha viditvāti sabbaññutaññāṇena jānitvā.
4. Then the Blessed One, having known this reasoned talk of those monks: Here, having known means having known with the knowledge of omniscience.
4. Trong câu “Rồi Đức Thế Tôn, sau khi biết được lời bàn luận này của các Tỳ-khưu”, chữ “biết được” (viditvā) có nghĩa là biết bằng Nhất Thiết Chủng Trí.
Bhagavā hi katthaci maṃsacakkhunā disvā jānāti – ‘‘addasā kho bhagavā mahantaṃ dārukkhandhaṃ gaṅgāya nadiyā sotena vuyhamāna’’ntiādīsu (saṃ. ni. 4.241) viya.
For the Blessed One sometimes knows by seeing with the fleshly eye, as in such passages as: “The Blessed One saw a great log being carried along by the current of the river Ganges.”
Đức Thế Tôn đôi khi biết bằng cách thấy bằng nhục nhãn (maṃsacakkhu), như trong các đoạn: “Đức Thế Tôn đã thấy một khúc gỗ lớn đang trôi theo dòng sông Gaṅgā” v.v.
Katthaci dibbacakkhunā disvā jānāti – ‘‘addasā kho bhagavā dibbena cakkhunā visuddhena atikkantamānusakena tā devatāyo sahassasseva pāṭaligāme vatthūni parigaṇhantiyo’’tiādīsu (dī. ni. 2.152) viya.
Sometimes he knows by seeing with the divine eye, as in such passages as: “The Blessed One saw with the divine eye, purified and surpassing the human, those devatās taking possession of sites in the village of Pāṭali.”
Đôi khi Ngài biết bằng cách thấy bằng thiên nhãn (dibbacakkhu), như trong các đoạn: “Đức Thế Tôn đã thấy bằng thiên nhãn thanh tịnh, siêu việt loài người, các vị thiên nữ ấy đang chiếm giữ các khu đất ở làng Pāṭali với số lượng hàng ngàn” v.v.
Katthaci pakatisotena sutvā jānāti – ‘‘assosi kho bhagavā āyasmato ānandassa subhaddena paribbājakena saddhiṃ imaṃ kathāsallāpa’’ntiādīsu (dī. ni. 2.213) viya.
Sometimes he knows by hearing with the ordinary ear, as in such passages as: “The Blessed One heard this conversation of the venerable Ānanda with the wanderer Subhadda.”
Đôi khi Ngài biết bằng cách nghe bằng tai thường (pakatisota), như trong các đoạn: “Đức Thế Tôn đã nghe cuộc đàm thoại này giữa Tôn giả Ānanda và du sĩ Subhadda” v.v.
Katthaci dibbasotena sutvā jānāti – ‘‘assosi kho bhagavā dibbāya sotadhātuyā visuddhāya atikkantamānusikāya sandhānassa gahapatissa nigrodhena paribbājakena saddhiṃ imaṃ kathāsallāpa’’ntiādīsu (dī. ni. 3.54) viya.
Sometimes he knows by hearing with the divine ear, as in such passages as: “The Blessed One heard with the divine ear element, purified and surpassing the human, this conversation of Sandhāna the householder with the wanderer Nigrodha.”
Đôi khi Ngài biết bằng cách nghe bằng thiên nhĩ (dibbasota), như trong các đoạn: “Đức Thế Tôn đã nghe bằng thiên nhĩ giới thanh tịnh, siêu việt loài người, cuộc đàm thoại này giữa gia chủ Sandhāna và du sĩ Nigrodha” v.v.
Idha pana sabbaññutaññāṇena sutvā aññāsi.
Here, however, he knew by hearing with the knowledge of omniscience.
Ở đây, Ngài đã biết bằng cách nghe với Nhất Thiết Chủng Trí.
Kiṃ karonto aññāsi?
While doing what did he know?
Ngài đã biết khi đang làm việc gì?
Pacchimayāmakiccaṃ, kiccañca nāmetaṃ sātthakaṃ, niratthakanti duvidhaṃ hoti.
While performing the duties of the last watch of the night. This duty is of two kinds: beneficial and without benefit.
Đó là công việc của canh cuối (pacchimayāmakicca). Và công việc này có hai loại: có lợi ích (sātthaka) và không có lợi ích (niratthaka).
Tattha niratthakakiccaṃ bhagavatā bodhipallaṅkeyeva arahattamaggena samugghātaṃ kataṃ.
Therein, the duty without benefit was completely eradicated by the Blessed One with the path of Arahantship right at the seat of enlightenment.
Trong đó, công việc không có lợi ích đã được Đức Thế Tôn nhổ tận gốc bằng đạo A-la-hán (arahattamagga) ngay tại Bồ-đề tòa (bodhipallaṅka).
Sātthakaṃyeva pana bhagavato kiccaṃ hoti.
Only beneficial duty remains for the Blessed One.
Nhưng công việc của Đức Thế Tôn chỉ là công việc có lợi ích.
Taṃ pañcavidhaṃ – purebhattakiccaṃ, pacchābhattakiccaṃ, purimayāmakiccaṃ, majjhimayāmakiccaṃ, pacchimayāmakiccanti.
It is fivefold: the duty before the meal, the duty after the meal, the duty of the first watch of the night, the duty of the middle watch of the night, and the duty of the last watch of the night.
Công việc đó có năm loại: công việc trước bữa ăn (purebhattakicca), công việc sau bữa ăn (pacchābhattakicca), công việc canh đầu (purimayāmakicca), công việc canh giữa (majjhimayāmakicca), và công việc canh cuối (pacchimayāmakicca).
Bhagavā hi pātova uṭṭhāya upaṭṭhākānuggahatthaṃ sarīraphāsukatthañca mukhadhovanādisarīraparikammaṃ katvā yāva bhikkhācāravelā tāva vivittāsane vītināmetvā, bhikkhācāravelāyaṃ nivāsetvā kāyabandhanaṃ bandhitvā cīvaraṃ pārupitvā pattamādāya kadāci ekako, kadāci bhikkhusaṅghaparivuto, gāmaṃ vā nigamaṃ vā piṇḍāya pavisati; kadāci pakatiyā, kadāci anekehi pāṭihāriyehi vattamānehi.
The Blessed One, having risen early in the morning and performed bodily care such as washing his face for the well-being of his attendant and for his own physical comfort, would spend the time in a secluded seat until the time for the alms-round. At the time for the alms-round, having dressed, tied his waistband, put on his robe, and taken his bowl, he would enter a village or town for alms, sometimes alone, sometimes surrounded by the Sangha of monks; sometimes in the usual way, sometimes with many miracles occurring.
Đức Thế Tôn, vào buổi sáng sớm, thức dậy, làm các việc vệ sinh thân thể như rửa mặt v.v. để giúp đỡ các thị giả và để thân thể được thoải mái. Sau đó, Ngài an trú trong chỗ vắng vẻ cho đến giờ đi khất thực. Đến giờ khất thực, Ngài đắp y, thắt đai lưng, khoác y, cầm bát, đôi khi một mình, đôi khi có Tăng đoàn vây quanh, đi vào làng hoặc thị trấn để khất thực; đôi khi một cách tự nhiên, đôi khi với nhiều phép lạ xảy ra.
Seyyathidaṃ, piṇḍāya pavisato lokanāthassa purato purato gantvā mudugatavātā pathaviṃ sodhenti, valāhakā udakaphusitāni muñcantā magge reṇuṃ vūpasametvā upari vitānaṃ hutvā tiṭṭhanti, apare vātā pupphāni upasaṃharitvā magge okiranti, unnatā bhūmippadesā onamanti, onatā unnamanti, pādanikkhepasamaye samāva bhūmi hoti, sukhasamphassāni padumapupphāni vā pāde sampaṭicchanti.
For instance, when the Lord of the World enters for alms, gentle winds go before him, cleaning the path. Clouds, releasing drops of water, settle the dust on the road and remain above like a canopy. Other winds gather flowers and scatter them on the path. Raised areas of ground become level, and low areas rise up. At the moment his foot is placed, the ground becomes even. Lotus flowers with a pleasant touch receive his feet.
Như thế này: khi Đức Thế Tôn, vị cứu tinh của thế gian, đi khất thực, những làn gió nhẹ nhàng đi trước dọn sạch mặt đất; những đám mây nhỏ thả những giọt nước làm lắng bụi trên đường, rồi đứng lại như một mái che ở phía trên; những làn gió khác mang hoa đến rải trên đường; những chỗ đất cao thì hạ thấp xuống, những chỗ đất thấp thì nâng cao lên, khi Ngài đặt chân xuống thì mặt đất bằng phẳng; hoặc những bông sen mềm mại đón lấy chân Ngài.
Indakhīlassa anto ṭhapitamatte dakkhiṇapāde sarīrato chabbaṇṇarasmiyo nikkhamitvā suvaṇṇarasapiñjarāni viya citrapaṭaparikkhittāni viya ca pāsādakūṭāgārādīni alaṅkarontiyo ito cito ca dhāvanti, hatthiassavihaṅgādayo sakasakaṭṭhānesu ṭhitāyeva madhurenākārena saddaṃ karonti, tathā bherivīṇādīni tūriyāni manussānañca kāyūpagāni ābharaṇāni.
The moment his right foot is placed within the city-gate post, six-colored rays emanate from his body and dart here and there, adorning palaces, storied dwellings, and so on, making them like golden cages or as if draped with colorful cloths. Elephants, horses, birds, and others, while remaining in their own places, make sounds in a sweet manner, as do drums, lutes, and other musical instruments, and the ornaments worn on people's bodies.
Khi bàn chân phải của Ngài vừa đặt vào ngưỡng cửa (indakhīla), sáu màu hào quang từ thân Ngài phóng ra, chiếu sáng khắp nơi, trang hoàng các cung điện, lầu các v.v. như được bao phủ bởi nước vàng ròng hoặc được trang trí bằng những tấm thảm đầy màu sắc. Voi, ngựa, chim chóc v.v. đang ở chỗ của chúng cũng phát ra tiếng kêu ngọt ngào; các nhạc cụ như trống, đàn vīṇā v.v. và các đồ trang sức trên thân người cũng vậy.
Tena saññāṇena manussā jānanti – ‘‘ajja bhagavā idha piṇḍāya paviṭṭho’’ti.
By this sign, people know: “Today the Blessed One has entered here for alms.”
Nhờ những dấu hiệu đó, mọi người biết: “Hôm nay, Đức Thế Tôn đã vào đây để khất thực”.
Te sunivatthā supārutā gandhapupphādīni ādāya gharā nikkhamitvā antaravīthiṃ paṭipajjitvā bhagavantaṃ gandhapupphādīhi sakkaccaṃ pūjetvā vanditvā – ‘‘amhākaṃ, bhante, dasa bhikkhū, amhākaṃ vīsati, paññāsaṃ…pe… sataṃ dethā’’ti yācitvā bhagavatopi pattaṃ gahetvā āsanaṃ paññapetvā sakkaccaṃ piṇḍapātena paṭimānenti.
They, well-dressed and well-robed, taking perfumes, flowers, and so forth, leave their homes, enter the main street, respectfully worship the Blessed One with perfumes, flowers, and so forth, and having paid homage, they request: “Venerable Sir, give us ten monks; give us twenty, fifty… up to… a hundred.” Taking the Blessed One’s bowl as well, they prepare a seat and respectfully attend to him with almsfood.
Họ, mặc y phục chỉnh tề, khoác áo ngoài cẩn thận, mang theo hương hoa và các vật phẩm khác, rời nhà đi ra con đường giữa, thành kính cúng dường và đảnh lễ Đức Thế Tôn bằng hương hoa và các vật phẩm khác, rồi thỉnh cầu: “Bạch Thế Tôn, xin Ngài ban cho chúng con mười vị Tỳ-khưu, hai mươi vị, năm mươi vị… cho đến một trăm vị.” Sau khi thỉnh cầu như vậy, họ nhận bát của Đức Thế Tôn, sắp đặt chỗ ngồi, và thành kính chờ đợi Ngài thọ thực.
Bhagavā katabhattakicco tesaṃ sattānaṃ cittasantānāni oloketvā tathā dhammaṃ deseti, yathā keci saraṇagamanesu patiṭṭhahanti, keci pañcasu sīlesu, keci sotāpattisakadāgāmianāgāmiphalānaṃ aññatarasmiṃ; keci pabbajitvā aggaphale arahatteti.
The Blessed One, having finished his meal, surveys the mental continuities of those beings and teaches the Dhamma in such a way that some become established in the goings for refuge, some in the five precepts, some in one of the fruits of stream-entry, once-returning, or non-returning; and some, having gone forth, in the highest fruit, Arahantship.
Đức Thế Tôn, sau khi hoàn tất việc thọ thực, quán sát tâm thức của những chúng sinh ấy và thuyết giảng Dhamma sao cho một số người an trú vào Tam quy, một số an trú vào năm giới, một số đạt được một trong các quả vị Dự lưu (Sotāpatti), Nhất lai (Sakadāgāmi), Bất hoàn (Anāgāmi); một số xuất gia và đạt được quả vị tối thượng là A-la-hán (Arahatta).
Evaṃ mahājanaṃ anuggahetvā uṭṭhāyāsanā vihāraṃ gacchati.
Having thus favored the great assembly of people, he rises from his seat and goes to the monastery.
Sau khi độ chúng như vậy, Ngài rời chỗ ngồi và đi về tịnh xá.
Tattha gantvā maṇḍalamāḷe paññattavarabuddhāsane nisīdati, bhikkhūnaṃ bhattakiccapariyosānaṃ āgamayamāno.
Having gone there, he sits on the excellent Buddha-seat prepared in the assembly hall, waiting for the monks to finish their meal duties.
Đến đó, Ngài ngồi trên Phật tòa cao quý đã được sắp đặt trong sảnh đường hình tròn, chờ đợi chư Tỳ-khưu hoàn tất việc thọ thực.
Tato bhikkhūnaṃ bhattakiccapariyosāne upaṭṭhāko bhagavato nivedeti.
Then, when the monks have finished their meal duties, the attendant informs the Blessed One.
Sau đó, khi chư Tỳ-khưu đã hoàn tất việc thọ thực, vị thị giả báo cho Đức Thế Tôn biết.
Atha bhagavā gandhakuṭiṃ pavisati.
Then the Blessed One enters the gandhakuṭi.
Rồi Đức Thế Tôn đi vào Gandhakuṭi.
Idaṃ tāva purebhattakiccaṃ.
This, for now, is the duty before the meal.
Đây là Phật sự trước bữa ăn (purebhattakicca).
Atha bhagavā evaṃ katapurebhattakicco gandhakuṭiyā upaṭṭhāne nisīditvā pāde pakkhāletvā pādapīṭhe ṭhatvā bhikkhusaṅghaṃ ovadati – ‘‘bhikkhave, appamādena sampādetha, dullabho buddhuppādo lokasmiṃ, dullabho manussattapaṭilābho, dullabhā sampatti, dullabhā pabbajjā, dullabhaṃ saddhammassavana’’nti.
Then the Blessed One, having thus completed his duties before the meal, sits in attendance at the gandhakuṭi, washes his feet, and standing on the footstool, admonishes the Saṅgha of monks: “Monks, strive with diligence. Rare is the arising of a Buddha in the world, rare is the attainment of a human state, rare is good fortune, rare is the going forth, rare is the hearing of the true Dhamma.”
Sau khi hoàn tất Phật sự trước bữa ăn như vậy, Đức Thế Tôn ngồi tại tiền sảnh của Gandhakuti, rửa chân, đặt chân lên bệ rửa chân, rồi giáo huấn Tăng đoàn Tỳ-khưu: “Này chư Tỳ-khưu, hãy tinh tấn thành tựu (các pháp lành) với sự không phóng dật (appamāda), sự xuất hiện của chư Phật trong thế gian là khó, sự thành tựu thân người là khó, sự thành tựu (các điều kiện thuận lợi) là khó, sự xuất gia là khó, sự lắng nghe Chánh pháp là khó.”
Tattha keci bhagavantaṃ kammaṭṭhānaṃ pucchanti.
There, some ask the Blessed One for a meditation subject.
Trong số đó, một số vị thỉnh Đức Thế Tôn về đề mục thiền định (kammaṭṭhāna).
Bhagavāpi tesaṃ cariyānurūpaṃ kammaṭṭhānaṃ deti.
The Blessed One gives them a meditation subject suitable to their dispositions.
Đức Thế Tôn cũng ban đề mục thiền định phù hợp với căn tính của họ.
Tato sabbepi bhagavantaṃ vanditvā attano attano rattiṭṭhānadivāṭṭhānāni gacchanti.
Then all of them, having paid homage to the Blessed One, go to their respective night-time and day-time places.
Sau đó, tất cả đều đảnh lễ Đức Thế Tôn và đi đến chỗ ở ban đêm và chỗ ở ban ngày của mình.
Keci araññaṃ, keci rukkhamūlaṃ, keci pabbatādīnaṃ aññataraṃ, keci cātumahārājikabhavanaṃ…pe… keci vasavattibhavananti.
Some go to the forest, some to the foot of a tree, some to one of the mountains or other such places, some to the realm of the Four Great Kings… up to… some to the Vasavatti realm.
Một số đi vào rừng, một số đến gốc cây, một số đến một trong các ngọn núi, v.v., một số đến cõi Tứ Đại Thiên Vương (Cātumahārājika-bhāvana)… cho đến một số đến cõi Hóa Lạc Tự Tại Thiên (Vasavatti-bhāvana).
Tato bhagavā gandhakuṭiṃ pavisitvā sace ākaṅkhati, dakkhiṇena passena sato sampajāno muhuttaṃ sīhaseyyaṃ kappeti.
Then the Blessed One, entering the gandhakuṭi, if he wishes, lies down for a moment on his right side in the lion’s posture, mindful and fully aware.
Sau đó, Đức Thế Tôn đi vào Gandhakuti và nếu muốn, Ngài nằm nghỉ tư thế sư tử (sīhaseyya) trong chốc lát, tỉnh giác và chánh niệm, nghiêng về phía bên phải.
Atha samassāsitakāyo vuṭṭhahitvā dutiyabhāge lokaṃ voloketi.
Then, with his body refreshed, he rises and in the second part surveys the world.
Rồi, với thân thể đã được nghỉ ngơi, Ngài đứng dậy và quán sát thế gian vào phần thứ hai (của buổi chiều).
Tatiyabhāge yaṃ gāmaṃ vā nigamaṃ vā upanissāya viharati tattha mahājano purebhattaṃ dānaṃ datvā pacchābhattaṃ sunivattho supāruto gandhapupphādīni ādāya vihāre sannipatati.
In the third part, the great mass of people from the village or town near which he is staying, having given alms in the morning, gather at the monastery in the afternoon, well-dressed and well-robed, bearing perfumes, flowers, and so forth.
Vào phần thứ ba (của buổi chiều), đại chúng trong làng hay thị trấn mà Ngài đang trú ngụ, sau khi đã bố thí trước bữa ăn, mặc y phục chỉnh tề, khoác áo ngoài cẩn thận, mang theo hương hoa và các vật phẩm khác, tập trung tại tịnh xá.
Tato bhagavā sampattaparisāya anurūpena pāṭihāriyena gantvā dhammasabhāyaṃ paññattavarabuddhāsane nisajja dhammaṃ deseti kālayuttaṃ samayayuttaṃ, atha kālaṃ viditvā parisaṃ uyyojeti, manussā bhagavantaṃ vanditvā pakkamanti.
Then the Blessed One, with a miracle appropriate for the assembled company, goes to the Dhamma hall, sits on the excellent Buddha-seat that has been prepared, and teaches the Dhamma that is suitable for the time and occasion. Then, knowing the time, he dismisses the assembly. The people pay homage to the Blessed One and depart.
Sau đó, Đức Thế Tôn, với thần thông (pāṭihāriya) phù hợp với hội chúng đã tề tựu, đi đến Pháp đường, ngồi trên Phật tòa cao quý đã được sắp đặt và thuyết giảng Dhamma thích hợp với thời gian và hoàn cảnh. Rồi, biết đã đến lúc, Ngài giải tán hội chúng, và mọi người đảnh lễ Đức Thế Tôn rồi ra về.
Idaṃ pacchābhattakiccaṃ.
This is the duty after the meal.
Đây là Phật sự sau bữa ăn (pacchābhattakicca).
So evaṃ niṭṭhitapacchābhattakicco sace gattāni osiñcitukāmo hoti, buddhāsanā vuṭṭhāya nhānakoṭṭhakaṃ pavisitvā upaṭṭhākena paṭiyāditaudakena gattāni utuṃ gaṇhāpeti.
Having thus completed his duties after the meal, if he wishes to bathe his limbs, he rises from the Buddha-seat, enters the bathhouse, and has the attendant apply water that has been prepared to warm his limbs.
Sau khi hoàn tất Phật sự sau bữa ăn như vậy, nếu Ngài muốn tắm rửa thân thể, Ngài rời Phật tòa, đi vào phòng tắm và để thị giả dùng nước đã chuẩn bị sẵn để làm mát thân thể.
Upaṭṭhākopi buddhāsanaṃ ānetvā gandhakuṭipariveṇe paññapeti.
The attendant also brings the Buddha-seat and prepares it in the precincts of the gandhakuṭi.
Vị thị giả cũng mang Phật tòa đến và sắp đặt ở khu vực sân sau của Gandhakuti.
Bhagavā surattadupaṭṭaṃ nivāsetvā kāyabandhanaṃ bandhitvā uttarāsaṅgaṃ ekaṃsaṃ karitvā tattha gantvā nisīdati ekakova muhuttaṃ paṭisallīno, atha bhikkhū tato tato āgamma bhagavato upaṭṭhānaṃ āgacchanti.
The Blessed One, having put on a fine red double-layered robe, tied the waist-band, and arranged his upper robe over one shoulder, goes there and sits for a moment alone in seclusion. Then monks arrive from here and there to attend upon the Blessed One.
Đức Thế Tôn, mặc y phục trong màu đỏ thẫm, thắt đai lưng, khoác y thượng một bên vai, đi đến đó và ngồi một mình trong chốc lát để tịnh cư (paṭisallīna). Sau đó, chư Tỳ-khưu từ các nơi khác đến để hầu hạ Đức Thế Tôn.
Tattha ekacce pañhaṃ pucchanti, ekacce kammaṭṭhānaṃ, ekacce dhammassavanaṃ yācanti.
There, some ask questions, some ask for a meditation subject, and some request to hear the Dhamma.
Tại đó, một số vị thỉnh vấn đề, một số thỉnh đề mục thiền định, một số thỉnh nghe Pháp.
Bhagavā tesaṃ adhippāyaṃ sampādento purimayāmaṃ vītināmeti.
The Blessed One, fulfilling their wishes, passes the first watch of the night.
Đức Thế Tôn, đáp ứng nguyện vọng của họ, trải qua canh đầu (purimayāma).
Idaṃ purimayāmakiccaṃ.
This is the duty of the first watch.
Đây là Phật sự canh đầu (purimayāmakicca).
Pacchimayāmaṃ pana tayo koṭṭhāse katvā purebhattato paṭṭhāya nisajjāya pīḷitassa sarīrassa kilāsubhāvamocanatthaṃ ekaṃ koṭṭhāsaṃ caṅkamena vītināmeti.
Then, having divided the last watch into three parts, he spends one part in walking meditation to relieve the weariness of his body, which has been afflicted by sitting since before the meal.
Đối với canh cuối (pacchimayāma), Ngài chia làm ba phần. Phần thứ nhất, Ngài đi kinh hành để giải tỏa sự mệt mỏi của cơ thể do ngồi lâu từ trước bữa ăn.
Dutiyakoṭṭhāse gandhakuṭiṃ pavisitvā dakkhiṇena passena sato sampajāno sīhaseyyaṃ kappeti.
In the second part, he enters the gandhakuṭi and lies down on his right side in the lion’s posture, mindful and fully aware.
Trong phần thứ hai, Ngài đi vào Gandhakuti và nằm nghỉ tư thế sư tử, tỉnh giác và chánh niệm, nghiêng về phía bên phải.
Tatiyakoṭṭhāse paccuṭṭhāya nisīditvā purimabuddhānaṃ santike dānasīlādivasena katādhikārapuggaladassanatthaṃ buddhacakkhunā lokaṃ voloketi.
In the third part, he rises, and sitting down, surveys the world with his Buddha-eye to see individuals who have made their aspiration in the presence of previous Buddhas through giving, virtue, and so on.
Trong phần thứ ba, Ngài đứng dậy và ngồi xuống, quán sát thế gian bằng Phật nhãn (buddhacakkhu) để thấy những người đã tạo công đức như bố thí, trì giới, v.v., dưới sự hướng dẫn của chư Phật quá khứ.
Idaṃ pacchimayāmakiccaṃ.
This is the duty of the last watch.
Đây là Phật sự canh cuối (pacchimayāmakicca).
Ñatvā ca panassa etadahosi – ‘‘ime bhikkhū mayhaṃ sabbaññutaññāṇaṃ ārabbha guṇaṃ kathenti, etesañca sabbaññutaññāṇakiccaṃ na pākaṭaṃ, mayhameva pākaṭaṃ.
And having known, this occurred to him: “These monks are speaking of the quality of my knowledge of omniscience, but the function of the knowledge of omniscience is not clear to them; it is clear only to me.
Sau khi biết, ý nghĩ này khởi lên trong Ngài: “Chư Tỳ-khưu này đang ca ngợi công đức Toàn giác trí của Ta, nhưng công việc của Toàn giác trí này không hiển lộ đối với họ, mà chỉ hiển lộ đối với riêng Ta.
Mayi pana gate ete attano kathaṃ nirantaraṃ ārocessanti, tato nesaṃ ahaṃ taṃ aṭṭhuppattiṃ katvā tividhaṃ sīlaṃ vibhajanto, dvāsaṭṭhiyā ṭhānesu appaṭivattiyaṃ sīhanādaṃ nadanto, paccayākāraṃ samodhānetvā buddhaguṇe pākaṭe katvā, sineruṃ ukkhipento viya suvaṇṇakūṭena nabhaṃ paharanto viya ca dasasahassilokadhātukampanaṃ brahmajālasuttantaṃ arahattanikūṭena niṭṭhāpento desessāmi, sā me desanā parinibbutassāpi pañcavassasahassāni sattānaṃ amatamahānibbānaṃ sampāpikā bhavissatī’’ti.
When I go there, they will relate their conversation to me without interruption. Then, making that the occasion for the teaching, I will expound on the threefold virtue; roar the lion's roar, which is irrefutable in sixty-two instances; connect the law of dependent origination; clarify the qualities of a Buddha; and, as if lifting up Mount Sineru, as if striking the sky with a golden hammer, I will teach the Brahmajāla Suttanta, which causes the ten-thousandfold world-system to tremble, concluding it with the pinnacle of Arahantship. That teaching of mine, even after I have attained parinibbāna, will for five thousand years lead beings to the deathless, great Nibbāna.”
Nếu Ta đi, họ sẽ tiếp tục kể câu chuyện của mình. Do đó, Ta sẽ lấy câu chuyện đó làm duyên khởi (aṭṭhuppatti), phân tích ba loại giới (sīla), tuyên bố tiếng rống sư tử (sīhanāda) không thể bị phản bác ở sáu mươi hai điểm, tổng hợp các nhân duyên (paccayākāra), làm hiển lộ các đức Phật, và thuyết giảng kinh Phạm Võng (Brahmajāla-suttanta) làm rung chuyển mười ngàn thế giới, như thể nhấc núi Sineru hay dùng búa vàng đập vào bầu trời, kết thúc bằng đỉnh cao A-la-hán (arahatta). Bài pháp đó của Ta, dù Ta đã nhập Niết-bàn, sẽ là phương tiện đưa chúng sinh đến Đại Niết-bàn bất tử trong năm ngàn năm.”
Evaṃ cintetvā yena maṇḍalamāḷo tenupasaṅkamīti.
Having reflected thus, he approached the assembly hall.
Suy nghĩ như vậy, Ngài đi đến sảnh đường hình tròn.
Yenāti yena disābhāgena, so upasaṅkamitabbo.
By which means: by which direction he was to approach.
Yenā (bằng cách nào, nơi nào) có nghĩa là bằng phương hướng nào, nơi đó nên được đến.
Bhummatthe vā etaṃ karaṇavacanaṃ, yasmiṃ padese so maṇḍalamāḷo, tattha gatoti ayamettha attho.
Or, this instrumental phrase is used in the locative sense. The meaning here is: he went to that place where the assembly hall was.
Hoặc từ này (yena) là một từ chỉ công cụ (karaṇavacana) ở nghĩa vị trí (bhummattha), nghĩa là Ngài đã đến nơi mà sảnh đường hình tròn đó ở.
Paññatte āsane nisīdīti buddhakāle kira yattha yattha ekopi bhikkhu viharati sabbattha buddhāsanaṃ paññattameva hoti.
He sat down on the prepared seat: It is said that in the time of the Buddha, wherever even one monk was dwelling, a Buddha-seat was always kept prepared.
Ngồi trên chỗ đã được sắp đặt (paññatte āsane nisīdī): Người ta nói rằng vào thời Đức Phật, bất cứ nơi nào có một Tỳ-khưu trú ngụ, ở đó đều có một Phật tòa được sắp đặt.
Bhagavā kira attano santike kammaṭṭhānaṃ gahetvā phāsukaṭṭhāne viharante manasi karoti – ‘‘asuko mayhaṃ santike kammaṭṭhānaṃ gahetvā gato, sakkhissati nu kho visesaṃ nibbattetuṃ no vā’’ti.
It is said that the Blessed One would bear in mind those who had received a meditation subject from him and were dwelling in a suitable place, thinking: “Such-and-such a person received a meditation subject from me and has gone. Will he be able to produce a special attainment or not?”
Đức Thế Tôn thường quan tâm đến những vị đã nhận đề mục thiền định từ Ngài và đang trú ngụ ở những nơi thuận lợi: “Vị kia đã nhận đề mục thiền định từ Ta và đã đi, liệu có thể thành tựu được sự tiến bộ hay không?”
Atha naṃ passati kammaṭṭhānaṃ vissajjetvā akusalavitakkaṃ vitakkayamānaṃ, tato ‘‘kathañhi nāma mādisassa satthu santike kammaṭṭhānaṃ gahetvā viharantaṃ imaṃ kulaputtaṃ akusalavitakkā abhibhavitvā anamatagge vaṭṭadukkhe saṃsāressantī’’ti tassa anuggahatthaṃ tattheva attānaṃ dassetvā taṃ kulaputtaṃ ovaditvā ākāsaṃ uppatitvā puna attano vasanaṭṭhānameva gacchati.
Then He sees him, having abandoned his meditation subject, thinking an unwholesome thought. Thereupon, thinking, “How can unwholesome thoughts overcome this clansman—who is dwelling after having taken a meditation subject in the presence of a teacher like me—and cause him to transmigrate in the suffering of the round of rebirths, which has an unknown beginning?”, for the sake of helping him, He manifests Himself right there, advises that clansman, rises into the air, and then returns to His own dwelling place.
Rồi Ngài thấy vị ấy đã từ bỏ đề mục thiền, đang tư duy những ác tầm. Thế rồi, Ngài nghĩ: "Làm sao mà ác tầm lại có thể chế ngự và khiến người thiện gia này, người đã thọ nhận đề mục thiền từ một vị Thầy như Ta, phải luân hồi trong khổ đau của vòng luân hồi vô tận?" Vì lợi ích của vị ấy, Ngài hiện thân ngay tại đó, giáo huấn vị thiện gia ấy, rồi bay lên không trung và trở về chỗ ở của mình.
Athevaṃ ovadiyamānā te bhikkhū cintayiṃsu – ‘‘satthā amhākaṃ manaṃ jānitvā āgantvā amhākaṃ samīpe ṭhitaṃyeva attānaṃ dasseti’’.
Then, those bhikkhus, being thus advised, thought: “The Teacher, knowing our minds, comes and reveals Himself standing near us.”
Sau đó, những Tỳ-khưu được giáo huấn như vậy đã suy nghĩ: "Đức Đạo Sư biết tâm ý của chúng ta, Ngài đến và hiện thân ngay bên cạnh chúng ta."
Tasmiṃ khaṇe – ‘‘bhante, idha nisīdatha, idha nisīdathā’’ti āsanapariyesanaṃ nāma bhāroti.
At that moment, the search for a seat, saying, “Venerable sir, sit here, sit here,” is a burden.
Vào khoảnh khắc đó, việc tìm kiếm chỗ ngồi với lời thỉnh cầu "Bạch Thế Tôn, xin Ngài an tọa tại đây, xin Ngài an tọa tại đây" là một gánh nặng.
Te āsanaṃ paññapetvāva viharanti.
They dwell only after having prepared a seat.
Các Tỳ-khưu ấy đã trải chỗ ngồi sẵn và trú ngụ.
Yassa pīṭhaṃ atthi, so taṃ paññapeti.
Whoever has a stool, he prepares it.
Ai có ghế thì trải ghế.
Yassa natthi, so mañcaṃ vā phalakaṃ vā kaṭṭhaṃ vā pāsāṇaṃ vā vālukapuñjaṃ vā paññapeti.
Whoever does not have one, prepares a couch, or a plank, or a piece of wood, or a stone, or a heap of sand.
Ai không có thì trải giường, hoặc ván gỗ, hoặc khúc cây, hoặc tảng đá, hoặc đống cát.
Taṃ alabhamānā purāṇapaṇṇānipi saṅkaḍḍhitvā tattha paṃsukūlaṃ pattharitvā ṭhapenti.
Not obtaining these, they gather even old leaves and, spreading a rag-robe thereon, they place it.
Nếu không tìm được những thứ đó, họ sẽ gom những lá cây cũ, trải tấm vải nhặt từ đống rác lên đó và đặt xuống.
Idha pana rañño nisīdanāsanameva atthi, taṃ papphoṭetvā paññapetvā parivāretvā te bhikkhū bhagavato adhimuttikañāṇamārabbha guṇaṃ thomayamānā nisīdiṃsu.
But here, there was the king's very own seat for sitting. Having shaken it out and prepared it, those bhikkhus sat down surrounding it, praising the quality of the Blessed One, beginning with his adhimuttikañāṇa.
Tại đây, chỉ có chỗ ngồi của nhà vua. Các Tỳ-khưu đã phủi bụi, trải chỗ ngồi đó, vây quanh và ngồi xuống, tán thán công đức của Đức Thế Tôn liên quan đến trí tuệ tùy theo khuynh hướng (adhimuttikañāṇa).
Taṃ sandhāya vuttaṃ – ‘‘paññatte āsane nisīdī’’ti.
Referring to that, it was said: “He sat down on the prepared seat.”
Liên quan đến điều đó, đã được nói: "Ngồi trên chỗ đã được trải."
Evaṃ nisinno pana jānantoyeva kathāsamuṭṭhāpanatthaṃ bhikkhū pucchi.
Having sat down thus, however, though knowing, He asked the bhikkhus in order to raise the topic of conversation.
Đức Thế Tôn sau khi an tọa như vậy, dù đã biết rõ, vẫn hỏi các Tỳ-khưu để khởi đầu câu chuyện.
Te cassa sabbaṃ kathayiṃsu.
And they told Him everything.
Và các vị ấy đã kể lại tất cả cho Ngài.
Tena vuttaṃ – ‘‘nisajja kho bhagavā’’tiādi.
Therefore, it was said: “Having sat down, the Blessed One…,” and so on.
Do đó, đã được nói: "Này các Tỳ-khưu, Đức Thế Tôn đã an tọa," v.v.
Tattha kāya nutthāti katamāya nu kathāya sannisinnā bhavathāti attho.
Therein, kāya nuttha means: for what talk, now, are you assembled?
Trong đó, kāya nutthā có nghĩa là: "Các ngươi đang hội họp với câu chuyện gì?"
Kāya netthātipi pāḷi, tassā katamāya nu etthāti attho kāya notthātipi pāḷi.
There is also the reading kāya nettha; its meaning is: for what talk, now, here? There is also the reading kāya nottha.
Cũng có bản Pali là kāya netthā, có nghĩa là "Các ngươi đang hội họp với câu chuyện gì ở đây?" và cũng có bản Pali là kāya notthā.
Tassāpi purimoyeva attho.
Its meaning is also the same as the former.
Ý nghĩa của bản này cũng giống như bản trước.
Antarākathāti, kammaṭṭhānamanasikārauddesaparipucchādīnaṃ antarā aññā ekā kathā.
Antarākathā means a certain other talk in between the contemplation of the meditation subject, recitation, inquiry, and so on.
Antarākathā có nghĩa là: một câu chuyện khác xen vào giữa việc tác ý đề mục thiền, tụng đọc, hỏi đáp, v.v.
Vippakatāti, mama āgamanapaccayā apariniṭṭhitā sikhaṃ appattā.
Vippakatā means unfinished on account of my arrival, not having reached its culmination.
Vippakatā có nghĩa là: chưa hoàn tất, chưa đạt đến đỉnh điểm do sự hiện diện của Ta.
Tena kiṃ dasseti?
What does He show by this?
Điều đó muốn chỉ ra điều gì?
‘‘Nāhaṃ tumhākaṃ kathābhaṅgatthaṃ āgato, ahaṃ pana sabbaññutāya tumhākaṃ kathaṃ niṭṭhāpetvā matthakappattaṃ katvā dassāmīti āgato’’ti nisajjeva sabbaññupavāraṇaṃ pavāreti.
“I have not come to interrupt your conversation; rather, I have come because, through my omniscience, I will bring your talk to a conclusion and make it reach its culmination.” Thus, having just sat down, He extends the invitation of an omniscient one.
"Ta không đến để ngắt lời các ngươi, mà Ta đến với trí tuệ Toàn Giác để hoàn tất câu chuyện của các ngươi và đưa nó đến đỉnh điểm." Như vậy, ngay khi an tọa, Ngài đã tuyên bố sự toàn tri của mình.
Ayaṃ kho no, bhante, antarākathā vippakatā, atha bhagavā anuppattoti etthāpi ayamadhippāyo.
Also in the passage “This, venerable sir, was our talk in between that was unfinished, and then the Blessed One arrived,” this is the intention:
Trong câu "Này Thế Tôn, câu chuyện này của chúng con chưa hoàn tất, và Đức Thế Tôn đã đến," ý nghĩa cũng là như vậy.
Ayaṃ bhante amhākaṃ bhagavato sabbaññutaññāṇaṃ ārabbha guṇakathā vippakatā, na rājakathādikā tiracchānakathā, atha bhagavā anuppatto; taṃ no idāni niṭṭhāpetvā desethāti.
“Venerable sir, this talk of ours on the qualities concerning the Blessed One’s knowledge of omniscience was unfinished—not an animal talk such as talk about kings. Then the Blessed One arrived. Now, please conclude it for us and teach.”
Bạch Thế Tôn, câu chuyện này của chúng con chưa hoàn tất, đó là câu chuyện tán thán công đức trí tuệ Toàn Giác của Đức Thế Tôn, không phải là những câu chuyện thấp hèn như chuyện vua chúa, v.v. Và Đức Thế Tôn đã đến; xin Ngài hãy hoàn tất và thuyết giảng cho chúng con ngay bây giờ.
Ettāvatā ca yaṃ āyasmatā ānandena kamalakuvalayujjalavimalasādhurasasalilāya pokkharaṇiyā sukhāvataraṇatthaṃ nimmalasilātalaracanavilāsasobhitaratanasopānaṃ, vippakiṇṇamuttātalasadisavālukākiṇṇapaṇḍarabhūmibhāgaṃ titthaṃ viya suvibhattabhittivicitravedikāparikkhittassa nakkhattapathaṃ phusitukāmatāya viya, vijambhitasamussayassa pāsādavarassa sukhārohaṇatthaṃ dantamayasaṇhamuduphalakakañcanalatāvinaddhamaṇigaṇappabhāsamudayujjalasobhaṃ sopānaṃ viya, suvaṇṇavalayanūpurādisaṅghaṭṭanasaddasammissitakathitahasitamadhurassaragehajanavicaritassa uḷārissarivibhavasobhitassa mahāgharassa sukhappavesanatthaṃ suvaṇṇarajatamaṇimuttapavāḷādijutivissaravijjotitasuppatiṭṭhitavisāladvārabāhaṃ mahādvāraṃ viya ca atthabyañjanasampannassa buddhaguṇānubhāvasaṃsūcakassa imassa suttassa sukhāvagahaṇatthaṃ kāladesadesakavatthuparisāpadesapaṭimaṇḍitaṃ nidānaṃ bhāsitaṃ, tassatthavaṇṇanā samattāti.
And by this much, the explanation of the meaning of the introduction—spoken by the Venerable Ānanda, which, for the easy comprehension of this sutta that is endowed with meaning and phrasing and which proclaims the power of the Buddha’s qualities, is adorned with reference to the time, place, speaker, subject, and assembly—is complete. It is like a landing place with a jewel staircase, splendid with the beauty of its flawless stone-slab construction, for the easy descent into a lotus pond with water of fine flavor, clear, brilliant with lotuses and water lilies, and with a ground of white sand strewn with particles resembling scattered pearls. And it is like a staircase, resplendent with the combined radiance of multitudes of gems interwoven with golden creepers on smooth, soft, ivory planks, for the easy ascent to an excellent palace of magnificent height, which appears as if stretching out of a desire to touch the path of the stars, enclosed by variegated railings on well-portioned walls. And it is like a great gateway with well-established, wide doorposts, illuminated by the radiating brilliance of gold, silver, gems, pearls, coral, and so forth, for the easy entry into a great house, resplendent with the wealth of noble opulence, where household members move about, their speech and laughter mingled with the sweet sounds of the clinking of golden bracelets, anklets, and other ornaments.
Cho đến đây, phần giải thích ý nghĩa của Nidāna (phần dẫn nhập) đã hoàn tất. Nidāna này được trang hoàng bằng thời gian, nơi chốn, người thuyết, sự việc và thính chúng, do Tôn giả Ānanda thuyết giảng, nhằm giúp dễ dàng thấu hiểu bản kinh này, vốn đầy đủ ý nghĩa và văn từ, thể hiện oai lực của các phẩm chất Phật Đà. Nó giống như một cầu thang quý báu được trang trí bằng những phiến đá sạch sẽ, tinh khiết, lấp lánh như ngọc, để dễ dàng xuống một hồ sen có nước trong sạch, ngọt ngào, lấp lánh với sen hồng, sen xanh, sen trắng và sen xanh đậm; giống như một cầu thang làm bằng ngà voi, mịn màng, mềm mại, với những tấm ván được gắn chặt bằng dây vàng và tỏa sáng rực rỡ với ánh ngọc quý, để dễ dàng lên một cung điện vĩ đại, cao vút như muốn chạm đến dải ngân hà, được bao quanh bởi những bức tường được phân chia rõ ràng và những lan can trang trí công phu; và giống như một cánh cổng lớn với những trụ cổng vững chắc, rộng lớn, tỏa sáng rực rỡ với ánh vàng, bạc, ngọc, châu báu, san hô, v.v., để dễ dàng bước vào một ngôi nhà lớn được trang hoàng lộng lẫy với sự giàu có và quyền uy, nơi mà những người trong gia đình đi lại với tiếng nói chuyện, tiếng cười và âm thanh ngọt ngào của vòng tay, vòng chân vàng, v.v. va chạm vào nhau.
5. Idāni – ‘‘mamaṃ vā, bhikkhave, pare avaṇṇaṃ bhāseyyu’’ntiādinā nayena bhagavatā nikkhittassa suttassa vaṇṇanāya okāso anuppatto.
5. Now, the occasion has arrived for the commentary on the sutta set forth by the Blessed One in the manner beginning, “Bhikkhus, should others speak in dispraise of me.”
5. Bây giờ, đã đến lúc giải thích bản kinh được Đức Thế Tôn thuyết giảng theo cách "Này các Tỳ-khưu, nếu người khác phỉ báng Ta," v.v.
Sā panesā suttavaṇṇanā.
And this is the commentary on the sutta.
Đây là phần giải thích bản kinh.
Yasmā suttanikkhepaṃ vicāretvā vuccamānā pākaṭā hoti, tasmā suttanikkhepaṃ tāva vicārayissāma.
Since it becomes clear when explained after examining the setting forth of the sutta, we shall therefore first examine the setting forth of the sutta.
Vì việc giải thích bản kinh sẽ trở nên rõ ràng khi xem xét cách thức thuyết giảng, nên trước hết chúng ta sẽ xem xét cách thức thuyết giảng bản kinh.
Cattāro hi suttanikkhepā – attajjhāsayo, parajjhāsayo, pucchāvasiko, aṭṭhuppattikoti.
For there are four ways of setting forth a sutta: due to personal inclination, due to others’ inclination, due to a question, and due to an occasion.
Có bốn cách thức thuyết giảng bản kinh: do tự ý của bậc Đạo Sư (attajjhāsaya), do ý của người khác (parajjhāsaya), do câu hỏi (pucchāvasika), và do sự kiện phát sinh (aṭṭhuppattika).
Bhagavantaṃ pana upasaṅkamitvā catasso parisā, cattāro vaṇṇā, nāgā, supaṇṇā, gandhabbā, asurā, yakkhā, mahārājāno, tāvatiṃsādayo devā, mahābrahmāti evamādayo – ‘‘bojjhaṅgā bojjhaṅgā’’ti, bhante, vuccanti.
Furthermore, having approached the Blessed One, the four assemblies, the four castes, nāgas, supaṇṇas, gandhabbas, asuras, yakkhas, great kings, devas such as those of the Tāvatiṃsa realm, Mahābrahmā, and so on, ask questions in the manner of: “Venerable sir, they are called ‘factors of enlightenment, factors of enlightenment.’”
Nhưng khi bốn chúng hội, bốn giai cấp, chư Nāga, Supaṇṇa, Gandhabba, Asura, Yakkha, các Đại vương, chư thiên Tāvatiṃsa và các vị Đại Phạm thiên, v.v., đến gần Đức Thế Tôn và hỏi:
‘‘Nīvaraṇā nīvaraṇā’’ti, bhante, vuccanti; ‘‘ime nu kho, bhante, pañcupādānakkhandhā’’.
“Venerable sir, they are called ‘hindrances, hindrances’;” “Venerable sir, are these the five aggregates of clinging?”
"Bạch Thế Tôn, người ta nói về các chi phần giác ngộ (bojjhaṅga), các chi phần giác ngộ. Bạch Thế Tôn, người ta nói về các triền cái (nīvaraṇa), các triền cái. Bạch Thế Tôn, phải chăng đây là năm uẩn chấp thủ (pañcupādānakkhandhā)?"
‘‘Kiṃ sūdha vittaṃ purisassa seṭṭha’’ntiādinā nayena pañhaṃ pucchanti.
“What here is a person’s best wealth?” and so forth.
"Tài sản nào là tối thượng của người đời?" v.v., theo cách này, họ đặt câu hỏi.
Evaṃ puṭṭhena bhagavatā yāni kathitāni bojjhaṅgasaṃyuttādīni, yāni vā panaññānipi devatāsaṃyutta-mārasaṃyutta-brahmasaṃyutta-sakkapañha-cūḷavedalla-mahāvedalla-sāmaññaphala-āḷavaka-sūciloma-kharalomasuttādīni; tesaṃ pucchāvasiko nikkhepo.
The setting forth of those suttas spoken by the Blessed One when thus asked—such as the Bojjhaṅga Saṃyutta and so on, or any others like the Devatā Saṃyutta, Māra Saṃyutta, Brahma Saṃyutta, Sakkapañha Sutta, Cūḷavedalla Sutta, Mahāvedalla Sutta, Sāmaññaphala Sutta, Āḷavaka Sutta, Sūciloma Sutta, and Kharaloma Sutta—is due to a question.
Những bản kinh được Đức Thế Tôn thuyết giảng khi được hỏi như vậy, như Bojjhaṅgasaṃyutta và các kinh khác như Devatāsaṃyutta, Mārasaṃyutta, Brahmasaṃyutta, Sakkapañha, Cūḷavedalla, Mahāvedalla, Sāmaññaphala, Āḷavaka, Sūciloma, Kharaloma, v.v.; cách thức thuyết giảng của những kinh này là pucchāvasika.
Evametesu catūsu nikkhepesu imassa suttassa aṭṭhuppattiko nikkhepo.
Among these four ways of setting forth, the setting forth of this sutta is due to an occasion.
Trong bốn cách thức thuyết giảng này, cách thức thuyết giảng của bản kinh này là aṭṭhuppattika.
Aṭṭhuppattiyā hi idaṃ bhagavatā nikkhittaṃ.
For this was set forth by the Blessed One because of an occasion.
Bởi vì bản kinh này được Đức Thế Tôn thuyết giảng do một sự kiện phát sinh.
Katarāya aṭṭhuppattiyā?
Because of what occasion?
Sự kiện phát sinh nào?
Vaṇṇāvaṇṇe.
Praise and dispraise.
Liên quan đến việc khen ngợi và phỉ báng.
Ācariyo ratanattayassa avaṇṇaṃ abhāsi, antevāsī vaṇṇaṃ.
The teacher spoke in dispraise of the Triple Gem; the disciple spoke in its praise.
Vị thầy đã phỉ báng Tam Bảo, còn vị đệ tử thì tán thán.
Iti imaṃ vaṇṇāvaṇṇaṃ aṭṭhuppattiṃ katvā desanākusalo bhagavā – ‘‘mamaṃ vā, bhikkhave, pare avaṇṇaṃ bhāseyyu’’nti desanaṃ ārabhi.
Thus, making this praise and dispraise the occasion for the teaching, the Blessed One, skilled in teaching, began the discourse, "Monks, if others were to speak in dispraise of me..."
Như vậy, sau khi tạo ra sự việc khởi nguyên về khen và chê này, Đức Thế Tôn, bậc thiện xảo trong giáo pháp, đã bắt đầu bài thuyết pháp: ‘Này các Tỳ-khưu, nếu người khác nói lời chê bai Ta…’.
Tattha mamanti, sāmivacanaṃ, mamāti attho.
Therein, mamaṃ is in the genitive case, meaning "of me."
Trong đó, từ mama là thuộc cách (sāmivacanaṃ), có nghĩa là của Ta.
Vāsaddo vikappanattho.
The word vā has the meaning of alternation.
Từ vā có nghĩa là lựa chọn.
Pareti, paṭiviruddhā sattā.
Pare means opposing beings.
Pare là những chúng sanh đối nghịch.
Tatrāti ye avaṇṇaṃ vadanti tesu.
Tatra means among those who speak in dispraise.
Tatra là trong số những người nói lời chê bai đó.
Na āghātotiādīhi kiñcāpi tesaṃ bhikkhūnaṃ āghātoyeva natthi, atha kho āyatiṃ kulaputtānaṃ īdisesupi ṭhānesu akusaluppattiṃ paṭisedhento dhammanettiṃ ṭhapeti.
Although there was indeed no āghāta in those monks, with the words "there should be no āghāta," etc., the Blessed One establishes the method of the Dhamma, prohibiting the arising of the unwholesome for clansmen in the future in such situations.
Mặc dù các Tỳ-khưu đó không có sự oán giận (āghāta) như đã nói trong ‘na āghāto’ và các từ khác, nhưng Ngài thiết lập một nguyên tắc giáo pháp (dhammanetti) để ngăn chặn sự phát sinh các điều bất thiện (akusaluppatti) trong những trường hợp như vậy cho các thiện gia (kulaputta) trong tương lai.
Tattha āhanati cittanti ‘āghāto’; kopassetaṃ adhivacanaṃ.
Therein, it strikes the mind, thus it is ‘āghāta’; this is a synonym for anger.
Trong đó, điều làm cho tâm bị tổn hại (āhanati cittaṃ) là āghāto (oán giận); đây là từ đồng nghĩa với sân hận (kopa).
Appatītā honti tena atuṭṭhā asomanassikāti appaccayo; domanassassetaṃ adhivacanaṃ.
They are not pleased by it, are dissatisfied, are unhappy, thus it is appaccayo; this is a synonym for displeasure.
Không vui vẻ, không hài lòng, không hoan hỷ là appaccayo (không hài lòng); đây là từ đồng nghĩa với ưu phiền (domanassa).
Neva attano na paresaṃ hitaṃ abhirādhayatīti anabhiraddhi; kopassetaṃ adhivacanaṃ.
It accomplishes the welfare neither of oneself nor of others, thus it is anabhiraddhi; this is a synonym for anger.
Không làm lợi ích cho bản thân cũng như cho người khác là anabhiraddhi (không hoan hỷ); đây là từ đồng nghĩa với sân hận (kopa).
Evamettha dvīhi padehi saṅkhārakkhandho, ekena vedanākkhandhoti dve khandhā vuttā.
Thus, herein, the aggregate of mental formations is mentioned by two terms, and the aggregate of feeling by one, so two aggregates are mentioned.
Như vậy, ở đây, hai từ chỉ sắc uẩn (saṅkhārakkhandha), và một từ chỉ thọ uẩn (vedanākkhandha) đã được nói đến.
Tesaṃ vasena sesānampi sampayuttadhammānaṃ kāraṇaṃ paṭikkhittameva.
By means of them, the causing of the remaining associated states is also rejected.
Theo đó, hành động của các pháp đồng sanh khác cũng bị phủ nhận.
Evaṃ paṭhamena nayena manopadosaṃ nivāretvā, dutiyena nayena tattha ādīnavaṃ dassento āha – ‘‘tatra ce tumhe assatha kupitā vā anattamanā vā, tumhaṃ yevassa tena antarāyo’’ti.
Having thus prevented mental corruption with the first method, he showed the danger in it with the second method, saying: "If you were to be angry or displeased on that account, that itself would be an obstacle for you."
Như vậy, sau khi ngăn chặn sự ô nhiễm tâm (manopadosa) bằng phương pháp thứ nhất, Đức Thế Tôn nói để chỉ ra sự nguy hiểm trong đó bằng phương pháp thứ hai: ‘‘tatra ce tumhe assatha kupitā vā anattamanā vā, tumhaṃ yevassa tena antarāyo’’ (Nếu các con tức giận hoặc không hài lòng, thì chính điều đó sẽ là chướng ngại cho các con).
Tattha ‘tatra ce tumhe assathā’ti tesu avaṇṇabhāsakesu, tasmiṃ vā avaṇṇe tumhe bhaveyyātha ce; yadi bhaveyyāthāti attho.
Therein, ‘tatra ce tumhe assatha’ means: if you were to be so, concerning those who speak in dispraise, or in that dispraise; the meaning is "if you were to be."
Trong đó, ‘tatra ce tumhe assathā’ có nghĩa là nếu các con ở trong những lời chê bai đó, hoặc nếu các con ở trong sự chê bai đó; tức là nếu các con có mặt.
‘Kupitā’ kopena, anattamanā domanassena.
‘Kupitā’ is through anger, ‘anattamanā’ is through displeasure.
‘Kupitā’ là do sân hận, ‘anattamanā’ là do ưu phiền.
‘Tumhaṃ yevassa tena antarāyo’ti tumhākaṃyeva tena kopena, tāya ca anattamanatāya paṭhamajjhānādīnaṃ antarāyo bhaveyya.
‘Tumhaṃ yevassa tena antarāyo’ means: for you yourselves, through that anger and that displeasure, there would be an obstacle to the first jhāna and so on.
‘Tumhaṃ yevassa tena antarāyo’ có nghĩa là chính do sự sân hận đó và sự không hài lòng đó mà chướng ngại sẽ xảy ra cho các con đối với các thiền định (jhāna) đầu tiên và các pháp khác.
Tattha tatra tumhehīti, tasmiṃ avaṇṇe tumhehi.
Therein, tatra tumhehi means, in that case of dispraise, by you.
Trong đó, tatra tumhehī có nghĩa là các con trong lời chê bai đó.
Abhūtaṃ abhūtato nibbeṭhetabbanti yaṃ abhūtaṃ, taṃ abhūtabhāveneva apanetabbaṃ.
Abhūtaṃ abhūtato nibbeṭhetabbaṃ means that which is untrue should be refuted by its very untruthfulness.
Abhūtaṃ abhūtato nibbeṭhetabbaṃ có nghĩa là điều không có thật, phải được loại bỏ như là không có thật.
Kathaṃ?
How?
Bằng cách nào?
Itipetaṃ abhūtantiādinā nayena.
By the method beginning with itipetaṃ abhūtaṃ.
Bằng phương pháp ‘‘itipetaṃ abhūta’’ và các từ khác.
Tatrāyaṃ yojanā – ‘‘tumhākaṃ satthā na sabbaññū, dhammo durakkhāto, saṅgho duppaṭipanno’’tiādīni sutvā na tuṇhī bhavitabbaṃ.
Herein, this is the application: upon hearing such things as, "Your teacher is not all-knowing, the Dhamma is badly proclaimed, the Sangha is of bad conduct," one should not remain silent.
Ở đây có sự kết nối như sau: Sau khi nghe những lời như ‘‘Bậc Đạo Sư của các con không phải là bậc Toàn Tri, Giáo Pháp bị thuyết giảng sai lệch, Tăng đoàn hành xử không đúng đắn’’, các con không nên im lặng.
Evaṃ pana vattabbaṃ – ‘‘iti petaṃ abhūtaṃ, yaṃ tumhehi vuttaṃ, taṃ imināpi kāraṇena abhūtaṃ, imināpi kāraṇena atacchaṃ, ‘natthi cetaṃ amhesu’, ‘na ca panetaṃ amhesu saṃvijjati’, sabbaññūyeva amhākaṃ satthā, svākkhāto dhammo, suppaṭipanno saṅgho, tatra idañcidañca kāraṇa’’nti.
Rather, one should speak thus: "For this reason, this is untrue. What you have said is, for this reason, untrue and, for this reason, false. ‘This is not so in us,’ and ‘this is not found in us.’ Our teacher is indeed all-knowing, the Dhamma is well-proclaimed, the Sangha is of good conduct, and for that, this and that is the reason."
Mà phải nói rằng: ‘‘Điều các vị đã nói đó là không có thật, điều đó cũng không có thật vì lý do này, cũng không đúng vì lý do này, ‘điều đó không có ở chúng tôi’, ‘điều đó không tồn tại ở chúng tôi’, Bậc Đạo Sư của chúng tôi là bậc Toàn Tri, Giáo Pháp được thuyết giảng tốt đẹp, Tăng đoàn hành xử đúng đắn, và đây là những lý do cho điều đó’’.
Ettha ca dutiyaṃ padaṃ paṭhamassa, catutthañca tatiyassa vevacananti veditabbaṃ.
And here it should be understood that the second term is a synonym for the first, and the fourth for the third.
Và ở đây, từ thứ hai là từ đồng nghĩa của từ thứ nhất, và từ thứ tư là từ đồng nghĩa của từ thứ ba.
Idañca avaṇṇeyeva nibbeṭhanaṃ kātabbaṃ, na sabbattha.
And this refutation should be done only in cases of dispraise, not in every case.
Và sự giải thích này chỉ nên được thực hiện trong trường hợp bị chê bai, không phải trong mọi trường hợp.
Yadi hi ‘‘tvaṃ dussīlo, tavācariyo dussīlo, idañcidañca tayā kataṃ, tavācariyena kata’’nti vutte tuṇhībhūto adhivāseti, āsaṅkanīyo hoti.
For if, when it is said, "You are immoral, your teacher is immoral, and you have done this and that, your teacher has done this and that," he remains silent and endures it, he becomes an object of suspicion.
Thật vậy, nếu khi bị nói ‘‘Ngươi là người ác giới, thầy của ngươi là người ác giới, ngươi đã làm điều này điều nọ, thầy của ngươi đã làm điều này điều nọ’’, mà người đó im lặng chấp nhận, thì người đó sẽ bị nghi ngờ.
Tasmā manopadosaṃ akatvā avaṇṇo nibbeṭhetabbo.
Therefore, without giving rise to mental corruption, the dispraise should be refuted.
Do đó, phải giải thích lời chê bai mà không để tâm bị ô nhiễm.
‘‘Oṭṭhosi, goṇosī’’tiādinā pana nayena dasahi akkosavatthūhi akkosantaṃ puggalaṃ ajjhupekkhitvā adhivāsanakhantiyeva tattha kātabbā.
But when a person abuses with the ten grounds for abuse, in the manner of saying, "You are a camel, you are an ox," etc., one should just disregard him and practice patient endurance.
Tuy nhiên, đối với người mắng chửi bằng mười loại lời mắng chửi như ‘‘Ngươi là con lạc đà, ngươi là con bò’’ và các từ khác, thì chỉ nên thực hành nhẫn nại chấp nhận, bỏ qua người đó.
6. Evaṃ avaṇṇabhūmiyaṃ tādilakkhaṇaṃ dassetvā idāni vaṇṇabhūmiyaṃ dassetuṃ ‘‘mamaṃ vā, bhikkhave, pare vaṇṇaṃ bhāseyyu’’ntiādimāha.
6. Having thus shown the characteristic of a Tādi in the domain of dispraise, he now, in order to show it in the domain of praise, said: "Monks, if others were to speak in praise of me," etc.
6. Như vậy, sau khi chỉ ra đặc tính của bậc Như Lai trong trường hợp bị chê bai, bây giờ Đức Thế Tôn nói ‘‘mamaṃ vā, bhikkhave, pare vaṇṇaṃ bhāseyyu’’ và các từ khác để chỉ ra đặc tính đó trong trường hợp được khen ngợi.
Tattha pareti ye keci pasannā devamanussā.
Therein, pare means any faithful deities and human beings.
Trong đó, pare là bất kỳ chư thiên và loài người nào có niềm tin.
Ānandanti etenāti ānando, pītiyā etaṃ adhivacanaṃ.
One rejoices through it, thus it is ānando; this is a synonym for joy.
Niềm vui phát sinh từ điều này là ānando (hoan hỷ); đây là từ đồng nghĩa với hỷ (pīti).
Sumanassa bhāvo somanassaṃ, cetasikasukhassetaṃ adhivacanaṃ.
The state of a good mind is somanassaṃ; this is a synonym for mental pleasure.
Trạng thái tâm tốt đẹp là somanassaṃ (hoan hỷ); đây là từ đồng nghĩa với tâm lạc (cetasika sukha).
Uppilāvino bhāvo uppilāvitattaṃ.
The state of being elated is uppilāvitattaṃ.
Trạng thái trôi nổi là uppilāvitattaṃ (tâm trôi nổi).
Kassa uppilāvitattanti?
The elation of what?
Tâm trôi nổi của ai?
Cetasoti.
Of the mind.
Của tâm (cetaso).
Uddhaccāvahāya uppilāpanapītiyā etaṃ adhivacanaṃ.
This is a synonym for elating joy that brings about restlessness.
Đây là từ đồng nghĩa với hỷ làm cho tâm trôi nổi, dẫn đến phóng dật (uddhacca).
Idhāpi dvīhi padehi saṅkhārakkhandho, ekena vedanākkhandho vutto.
Here too, the aggregate of mental formations is mentioned by two terms, and the aggregate of feeling by one.
Ở đây cũng vậy, hai từ chỉ sắc uẩn (saṅkhārakkhandha), và một từ chỉ thọ uẩn (vedanākkhandha) đã được nói đến.
‘‘Ye, bhikkhave, buddhe pasannā, agge te pasannā’’ti ca evamādīhi anekasatehi suttehi ratanattaye pītisomanassameva vaṇṇitanti.
"Monks, those who are faithful in the Buddha are faithful in the supreme," and in many hundreds of suttas such as these, has praised only joy and gladness concerning the Three Jewels?
Niềm hỷ lạc nào phát sinh trong thân người, khi người ấy tán thán ‘Tăng’; niềm hỷ lạc ấy còn cao quý hơn cả toàn bộ Jambudīpa. Và: ‘‘Này các Tỳ-khưu, những ai có niềm tin nơi Phật, những người ấy có niềm tin nơi điều tối thượng’’ và hàng trăm bài kinh khác như vậy đã tán thán niềm hỷ lạc và tâm lạc đối với Tam Bảo hay sao?
Saccaṃ vaṇṇitaṃ, taṃ pana nekkhammanissitaṃ.
It is true that it is praised, but that is based on renunciation.
Đúng vậy, đã được tán thán, nhưng điều đó là nương tựa vào sự xuất ly (nekkhammanissita).
Idha – ‘‘amhākaṃ buddho, amhākaṃ dhammo’’tiādinā nayena āyasmato channassa uppannasadisaṃ gehassitaṃ pītisomanassaṃ adhippetaṃ.
Here, what is meant is joy and gladness based on the household life, similar to that which arose in the venerable Channa in the manner of "Our Buddha, our Dhamma."
Ở đây, niềm hỷ lạc và tâm lạc được đề cập là loại nương tựa vào gia đình (gehassita), giống như niềm hỷ lạc đã phát sinh nơi Tôn giả Channa khi nói ‘‘Phật của chúng ta, Pháp của chúng ta’’ và các từ khác.
Idañhi jhānādipaṭilābhāya antarāyakaraṃ hoti.
For this becomes an obstacle to the attainment of jhāna and so on.
Điều này là chướng ngại cho việc đạt được các thiền định (jhāna) và các pháp khác.
Tenevāyasmā channopi yāva buddho na parinibbāyi, tāva visesaṃ nibbattetuṃ nāsakkhi, parinibbānakāle paññattena pana brahmadaṇḍena tajjito taṃ pītisomanassaṃ pahāya visesaṃ nibbattesi.
For that very reason, the venerable Channa, for as long as the Buddha had not attained Parinibbāna, was unable to bring about a special attainment. But, when admonished with the Brahmadaṇḍa prescribed at the time of the Parinibbāna, he abandoned that joy and gladness and brought about a special attainment.
Chính vì thế, Tôn giả Channa đã không thể đạt được sự đặc biệt nào cho đến khi Đức Phật nhập Niết-bàn; nhưng vào lúc Đức Phật nhập Niết-bàn, khi bị đe dọa bởi hình phạt Brahmadaṇḍa đã được ban hành, Ngài đã từ bỏ niềm hỷ lạc và tâm lạc đó và đạt được sự đặc biệt.
Tasmā antarāyakaraṃyeva sandhāya idaṃ vuttanti veditabbaṃ.
Therefore, it should be understood that this was said with reference only to what is an obstacle.
Do đó, phải hiểu rằng điều này được nói ra chỉ để đề cập đến điều gây chướng ngại.
Ayañhi lobhasahagatā pīti.
For this is joy associated with greed.
Thật vậy, niềm hỷ lạc này là niềm hỷ lạc đồng hành với tham ái (lobha).
Lobho ca kodhasadisova.
And greed is just like anger.
Và tham ái (lobha) cũng giống như sân hận (kopa).
Yathāha –
As it is said:
Như đã nói:
Paṭipajjitabbākāradassanavāre panāyaṃ yojanā – ‘‘tumhākaṃ satthā sabbaññū arahaṃ sammāsambuddho, dhammo svākkhāto, saṅgho suppaṭipanno’’tiādīni sutvā na tuṇhī bhavitabbaṃ.
Now, in the section showing the way it should be practiced, this is the connection: Having heard such things as, "Your Teacher is the Omniscient One, the Arahant, the Perfectly Enlightened One; the Dhamma is well-expounded; the Sangha is of good practice," one should not remain silent.
Hơn nữa, trong phần trình bày cách thực hành này, sự kết nối là: không nên im lặng sau khi nghe những điều như “Vị Đạo Sư của các ông là bậc Toàn Giác, A-la-hán, Chánh Đẳng Giác; Pháp được thuyết giảng khéo léo; Tăng chúng thực hành tốt.”
Evaṃ pana paṭijānitabbaṃ – ‘‘itipetaṃ bhūtaṃ, yaṃ tumhehi vuttaṃ, taṃ imināpi kāraṇena bhūtaṃ, imināpi kāraṇena tacchaṃ.
Instead, one should acknowledge it thus: " For this reason, it is true. What you have said is true for this reason and correct for that reason.
Mà nên xác nhận như sau: “Quả thật là như vậy; điều các ông nói là đúng, là chân thật vì lý do này, và cũng chân thật vì lý do này.
So hi bhagavā itipi arahaṃ, itipi sammāsambuddho; dhammo itipi svākkhāto, itipi sandiṭṭhiko; saṅgho itipi suppaṭipanno, itipi ujuppaṭipanno’’ti.
For the Blessed One is an Arahant for this reason, a Perfectly Enlightened One for that reason; the Dhamma is well-expounded for this reason, directly visible for that reason; the Sangha is of good practice for this reason, of upright practice for that reason."
Vì Đức Thế Tôn là bậc A-la-hán vì lý do này, và là bậc Chánh Đẳng Giác vì lý do này; Pháp được thuyết giảng khéo léo vì lý do này, và là Pháp thiết thực hiện tại vì lý do này; Tăng chúng thực hành tốt vì lý do này, và thực hành ngay thẳng vì lý do này.”
‘‘Tvaṃ sīlavā’’ti pucchitenāpi sace sīlavā, ‘‘sīlavāhamasmī’’ti paṭijānitabbameva.
Even when asked, "Are you virtuous?", if one is virtuous, one should indeed acknowledge, "I am virtuous."
Nếu được hỏi “Ông có giới hạnh không?” và nếu có giới hạnh, thì nên xác nhận “Tôi có giới hạnh.”
‘‘Tvaṃ paṭhamassa jhānassa lābhī…pe… arahā’’ti puṭṭhenāpi sabhāgānaṃ bhikkhūnaṃyeva paṭijānitabbaṃ.
Even when asked, "Are you an attainer of the first jhana... and so on... an Arahant?", one should acknowledge it only to bhikkhus of a similar nature.
Nếu được hỏi “Ông có đắc sơ thiền không?... cho đến... là bậc A-la-hán không?”, thì chỉ nên xác nhận với các Tỳ-khưu đồng hạnh.
Evañhi pāpicchatā ceva parivajjitā hoti, sāsanassa ca amoghatā dīpitā hotīti.
In this way, evil desire is avoided, and the non-futility of the teaching is demonstrated.
Vì làm như vậy sẽ tránh được ác dục, và làm sáng tỏ sự không vô ích của giáo pháp.
Sesaṃ vuttanayeneva veditabbaṃ.
The rest should be understood in the manner already stated.
Phần còn lại nên được hiểu theo cách đã nói.
7. Appamattakaṃ kho panetaṃ, bhikkhaveti ko anusandhi?
7. This, bhikkhus, is but a trifling matter. What is the connection?
7. Này các Tỳ-khưu, điều này thật nhỏ bé — sự kết nối là gì?
Idaṃ suttaṃ dvīhi padehi ābaddhaṃ vaṇṇena ca avaṇṇena ca.
This sutta is bound by two terms: praise and dispraise.
Kinh này được kết nối bởi hai phần: tán thán (vaṇṇa) và không tán thán (avaṇṇa).
Tattha avaṇṇo – ‘‘iti petaṃ abhūtaṃ iti petaṃ ataccha’’nti, ettheva udakantaṃ patvā aggiviya nivatto.
Therein, the dispraise—"For this reason it is untrue, for this reason it is incorrect"—stops right there, like a fire that has reached the water's edge and is extinguished.
Trong đó, phần không tán thán — “Điều này không đúng, điều này không chân thật” — đã dừng lại như lửa gặp nước.
Vaṇṇo pana bhūtaṃ bhūtato paṭijānitabbaṃ – ‘‘iti petaṃ bhūta’’nti evaṃ anuvattatiyeva.
Praise, however—that what is true should be acknowledged as true with "For this reason it is true"—continues on.
Còn phần tán thán thì tiếp tục xác nhận sự thật là chân thật — “Điều này là chân thật” — như vậy.
So pana duvidho brahmadattena bhāsitavaṇṇo ca bhikkhusaṅghena acchariyaṃ āvusotiādinā nayena āraddhavaṇṇo ca.
It is twofold: the praise spoken by Brahmadatta, and the praise initiated by the Saṅgha of bhikkhus in the manner of "It is wonderful, friends," and so on.
Phần đó lại có hai loại: sự tán thán do thanh niên Brahmadatta nói, và sự tán thán do Tăng chúng khởi xướng với lời “Thật kỳ diệu thay, thưa Tôn giả!” và tương tự.
Tesu bhikkhusaṅghena vuttavaṇṇassa upari suññatāpakāsane anusandhiṃ dassessati.
Of these, he will show the connection regarding the praise spoken by the Saṅgha of bhikkhus later, in the exposition of emptiness.
Trong số đó, sự kết nối đối với lời tán thán của Tăng chúng sẽ được trình bày ở phần trên về sự hiển lộ của tánh không.
Idha pana brahmadattena vuttavaṇṇassa anusandhiṃ dassetuṃ ‘‘appamattakaṃ kho panetaṃ, bhikkhave’’ti desanā āraddhā.
Here, however, the discourse beginning with "This, bhikkhus, is but a trifling matter" was initiated to show the connection to the praise spoken by Brahmadatta.
Còn ở đây, để trình bày sự kết nối đối với lời tán thán của Brahmadatta, bài thuyết pháp “Này các Tỳ-khưu, điều này thật nhỏ bé” đã được khởi xướng.
Tattha appamattakanti parittassa nāmaṃ.
Therein, trifling matter is a name for what is insignificant.
Trong đó, appamattakaṃ là tên gọi của cái nhỏ bé.
Oramattakanti tasseva vevacanaṃ.
A minor matter is a synonym for the same.
Oramattakaṃ là từ đồng nghĩa của nó.
Mattāti vuccati pamāṇaṃ.
Measure is said of quantity.
Mattā được gọi là thước đo.
Appaṃ mattā etassāti appamattakaṃ. Oraṃ mattā etassāti oramattakaṃ. Sīlameva sīlamattakaṃ. Idaṃ vuttaṃ hoti – ‘appamattakaṃ kho, panetaṃ bhikkhave, oramattakaṃ sīlamattakaṃ’ nāma yena ‘‘tathāgatassa vaṇṇaṃ vadāmī’’ti ussāhaṃ katvāpi vaṇṇaṃ vadamāno puthujjano vadeyyāti.
That which has a trifling measure is a trifling matter. That which has a minor measure is a minor matter. Morality itself is a mere matter of morality. This is what is meant: ‘This, bhikkhus, is but a trifling matter, a minor matter, a mere matter of morality,’ by which a worldling, even after making an effort to ‘speak the praise of the Tathāgata,’ might speak his praise.
Appaṃ mattā etassāti appamattakaṃ. Oraṃ mattā etassāti oramattakaṃ. Sīlameva sīlamattakaṃ. Điều này có nghĩa là: ‘Này các Tỳ-khưu, đây là một điều nhỏ bé, tầm thường, chỉ là giới hạnh’ mà một phàm phu có thể nói khi cố gắng tán thán Đức Như Lai.
Tattha siyā – nanu idaṃ sīlaṃ nāma yogino aggavibhūsanaṃ?
Regarding this, it might be said: Is not this thing called morality the supreme adornment of a yogī?
Ở đây có thể có câu hỏi: Chẳng phải giới hạnh này là trang sức tối thượng của hành giả sao?
Yathāhu porāṇā –
As the ancients have said:
Như các bậc cổ xưa đã nói:
‘‘Seyyathāpi, bhikkhave, ye keci bījagāmabhūtagāmā vuḍḍhiṃ virūḷhiṃ vepullaṃ āpajjanti, sabbe te pathaviṃ nissāya, pathaviyaṃ patiṭṭhāya; evamete bījagāmabhūtagāmā vuḍḍhiṃ virūḷhiṃ vepullaṃ āpajjanti.
“Bhikkhus, just as whatever kinds of seed-growth and plant-growth achieve growth, increase, and abundance, they all do so in dependence on the earth, established on the earth; in that way those kinds of seed-growth and plant-growth achieve growth, increase, and abundance.
“Này các Tỳ-khưu, ví như tất cả các loại hạt giống và cây cối đều phát triển, tăng trưởng, và đạt đến sự sung mãn nhờ nương tựa vào đất, đứng vững trên đất; cũng vậy, các loại hạt giống và cây cối này phát triển, tăng trưởng, và đạt đến sự sung mãn.
Evameva kho, bhikkhave, bhikkhu sīlaṃ nissāya sīle patiṭṭhāya sattabojjhaṅge bhāvento sattabojjhaṅge bahulīkaronto vuḍḍhiṃ virūḷhiṃ vepullaṃ pāpuṇāti dhammesū’’ti (saṃ. ni. 5.150) ca.
So too, bhikkhus, a bhikkhu, in dependence on morality, established in morality, by developing the seven factors of enlightenment and cultivating them, attains growth, increase, and abundance in the dhammas.” and
Cũng vậy, này các Tỳ-khưu, một Tỳ-khưu nương tựa vào giới, đứng vững trên giới, tu tập bảy chi phần giác ngộ, làm cho bảy chi phần giác ngộ trở nên sung mãn, sẽ đạt đến sự phát triển, tăng trưởng, và sung mãn trong các pháp.”
Evaṃ aññānipi anekāni suttāni daṭṭhabbāni.
Thus, many other suttas should be seen.
Và nhiều bài kinh khác cũng nên được xem xét.
Evamanekesu suttasatesu sīlaṃ mahantameva katvā kathitaṃ.
In this way, in many hundreds of suttas, morality has been spoken of as something great.
Như vậy, trong hàng trăm bài kinh, giới hạnh đã được nói là điều vĩ đại.
Taṃ ‘‘kasmā imasmiṃ ṭhāne appamattaka’’nti āhāti?
So "Why in this place did he say it is a 'trifling matter'?"
Vậy tại sao ở đây lại nói “nhỏ bé”?
Upari guṇe upanidhāya.
In comparison with higher qualities.
Là để so sánh với các phẩm chất cao hơn.
Sīlañhi samādhiṃ na pāpuṇāti, samādhi paññaṃ na pāpuṇāti, tasmā uparimaṃ upanidhāya heṭṭhimaṃ oramattakaṃ nāma hoti.
For morality does not attain to concentration; concentration does not attain to wisdom. Therefore, in comparison with what is higher, what is lower is called a minor matter.
Giới hạnh không đạt đến định, định không đạt đến tuệ; do đó, so với cái cao hơn, cái thấp hơn được gọi là tầm thường.
Kathaṃ sīlaṃ samādhiṃ na pāpuṇāti?
How is it that morality does not attain to concentration?
Giới hạnh không đạt đến định như thế nào?
Bhagavā hi abhisambodhito sattame saṃvacchare sāvatthinagara – dvāre kaṇḍambarukkhamūle dvādasayojane ratanamaṇḍape yojanappamāṇe ratanapallaṅke nisīditvā tiyojanike dibbasetacchatte dhāriyamāne dvādasayojanāya parisāya attādānaparidīpanaṃ titthiyamaddanaṃ – ‘‘uparimakāyato aggikkhandho pavattati, heṭṭhimakāyato udakadhārā pavattati…pe… ekekalomakūpato aggikkhandho pavattati, ekekalomakūpato udakadhārā pavattati, channaṃ vaṇṇāna’’ntiādinayappavattaṃ yamakapāṭihāriyaṃ dasseti.
In the seventh year after his full enlightenment, the Blessed One, at the foot of the Kaṇḍamba tree near the gate of the city of Sāvatthī, seated on a jeweled throne one yojana in size within a jeweled pavilion of twelve yojanas, while a divine white parasol of three yojanas was being held over him, in front of an assembly of twelve yojanas, displayed the Twin Miracle—which demonstrates the taking up of a challenge and crushes the heretics—in the manner beginning: “A mass of fire proceeds from the upper part of his body, a stream of water proceeds from the lower part of his body... and so on... a mass of fire proceeds from each and every hair follicle, a stream of water proceeds from each and every hair follicle, of the six colors.”
Đức Thế Tôn, vào năm thứ bảy sau khi thành đạo, tại cổng thành Sāvatthī, dưới gốc cây xoài Kaṇḍamba, đã ngồi trên bảo tọa bằng ngọc rộng một dojana trong bảo tháp bằng ngọc rộng mười hai dojana, trong khi chiếc lọng trắng thần diệu ba dojana được giữ, và trước hội chúng mười hai dojana, Ngài đã trình bày thần thông song đôi (yamaka-pāṭihāriya) để chứng tỏ sự tự chủ của mình và trấn áp các ngoại đạo — “Từ phần thân trên, lửa bốc lên; từ phần thân dưới, dòng nước chảy ra... cho đến... từ mỗi lỗ chân lông, lửa bốc lên; từ mỗi lỗ chân lông, dòng nước chảy ra, với sáu màu sắc,” và tương tự.
Tassa suvaṇṇavaṇṇasarīrato suvaṇṇavaṇṇā rasmiyo uggantvā yāva bhavaggā gacchanti, sakaladasasahassacakkavāḷassa alaṅkaraṇakālo viya hoti, dutiyā dutiyā rasmiyo purimāya purimāya yamakayamakā viya ekakkhaṇe viya pavattanti.
From his golden-colored body, golden-colored rays emanate, extending up to the highest state of existence. It is like a time of adornment for the entire ten-thousand-fold world system. Successive rays proceed like pairs upon pairs of the preceding ones, as if in a single moment.
Từ thân Ngài có màu vàng kim, các tia sáng màu vàng kim phóng ra, bay lên đến tận Bhavagga, giống như thời điểm trang hoàng toàn bộ mười ngàn thế giới. Các tia sáng thứ hai, thứ hai, dường như song đôi với các tia sáng trước, trước, xuất hiện như thể trong cùng một khoảnh khắc.
Nīlarasmiatthāya hi bhagavā nīlakasiṇaṃ samāpajjati, pītarasmiatthāya pītakasiṇaṃ, lohitaodātarasmiatthāya lohitaodātakasiṇaṃ, aggikkhandhatthāya tejokasiṇaṃ, udakadhāratthāya āpokasiṇaṃ samāpajjati.
For a blue ray, the Blessed One enters the blue kasiṇa; for a yellow ray, the yellow kasiṇa; for a red and white ray, the red and white kasiṇas; for a mass of fire, the fire kasiṇa; for a stream of water, he enters the water kasiṇa.
Để có tia sáng màu xanh, Đức Thế Tôn nhập vào kasiṇa màu xanh; để có tia sáng màu vàng, Ngài nhập vào kasiṇa màu vàng; để có tia sáng màu đỏ và trắng, Ngài nhập vào kasiṇa màu đỏ và trắng; để có khối lửa, Ngài nhập vào kasiṇa lửa; để có dòng nước, Ngài nhập vào kasiṇa nước.
Satthā caṅkamati, nimmito tiṭṭhati vā nisīdati vā seyyaṃ vā kappetīti sabbaṃ vitthāretabbaṃ.
The Teacher walks, while a created image stands, sits, or lies down—all this should be elaborated.
Vị Đạo Sư đi kinh hành, hóa thân đứng, hoặc ngồi, hoặc nằm — tất cả đều nên được giải thích chi tiết.
Ettha ekampi sīlassa kiccaṃ natthi, sabbaṃ samādhikiccameva.
Herein, there is not a single function of morality; it is all the function of concentration.
Ở đây, giới hạnh không có vai trò gì, tất cả đều là vai trò của định.
Evaṃ sīlaṃ samādhiṃ na pāpuṇāti.
In this way, morality does not attain to concentration.
Như vậy, giới hạnh không đạt đến định.
Yaṃ pana bhagavā kappasatasahassādhikāni cattāri asaṅkhyeyyāni pāramiyo pūretvā, ekūnatiṃsavassakāle cakkavattisirīnivāsabhūtā bhavanā nikkhamma anomānadītīre pabbajitvā, chabbassāni padhānayogaṃ katvā, visākhapuṇṇamāyaṃ uruvelagāme sujātāya dinnaṃ pakkhittadibbojaṃ madhupāyāsaṃ paribhuñjitvā, sāyanhasamaye dakkhiṇuttarena bodhimaṇḍaṃ pavisitvā assatthadumarājānaṃ tikkhattuṃ padakkhiṇaṃ katvā, pubbuttarabhāge ṭhito tiṇasanthāraṃ santharitvā, tisandhipallaṅkaṃ ābhujitvā, caturaṅgasamannāgataṃ mettākammaṭṭhānaṃ pubbaṅgamaṃ katvā, vīriyādhiṭṭhānaṃ adhiṭṭhāya, cuddasahatthapallaṅkavaragato suvaṇṇapīṭhe ṭhapitaṃ rajatakkhandhaṃ viya paññāsahatthaṃ bodhikkhandhaṃ piṭṭhito katvā, upari maṇichattena viya bodhisākhāya dhāriyamāno, suvaṇṇavaṇṇe cīvare pavāḷasadisesu bodhiaṅkuresu patamānesu, sūriye atthaṃ upagacchante mārabalaṃ vidhamitvā, paṭhamayāme pubbenivāsaṃ anussaritvā, majjhimayāme dibbacakkhuṃ visodhetvā, paccūsakāle sabbabuddhānamāciṇṇe paccayākāre ñāṇaṃ otāretvā, ānāpānacatutthajjhānaṃ nibbattetvā, tadeva pādakaṃ katvā vipassanaṃ vaḍḍhetvā, maggapaṭipāṭiyā adhigatena catutthamaggena sabbakilese khepetvā sabbabuddhaguṇe paṭivijjhi, idamassa paññākiccaṃ.
Furthermore, the Blessed One—having fulfilled the perfections for four incalculables and over one hundred thousand aeons; having, at the age of twenty-nine, gone forth from the palace that was the abode of a universal monarch's splendor and become a renunciant on the bank of the Anomā river; having engaged in the great striving for six years; on the full moon day of Visākha, in the village of Uruvelā, having consumed the milk-rice mixed with divine essence given by Sujātā; in the evening, having entered the Bodhimaṇḍa by the south-north path and circumambulated the king of the Assattha trees three times; standing in the northeast quarter, having spread out the grass mat; having formed the cross-legged posture with its three points of contact; having made the meditation subject of loving-kindness endowed with four factors the forerunner; having made the resolution of energy; seated on the excellent fourteen-cubit throne, having placed the fifty-cubit Bodhi tree trunk at his back like a silver trunk set on a golden pedestal; being canopied by the Bodhi branches as if by a jeweled umbrella, while Bodhi shoots like coral fell upon his golden-hued robes; as the sun was setting, having vanquished the forces of Māra; in the first watch, having recollected past lives; in the middle watch, having purified the divine eye; at dawn, having directed his knowledge to the conditional relations practiced by all Buddhas; having produced the fourth jhāna of mindfulness of breathing, and having made that very jhāna the basis for developing insight; having, by means of the fourth path attained in sequence with the other paths, destroyed all defilements—that he penetrated all the qualities of a Buddha, this is the function of his wisdom.
Tuy nhiên, Đức Thế Tôn đã viên mãn Bốn A-tăng-kỳ và một trăm ngàn đại kiếp Ba-la-mật, vào năm hai mươi chín tuổi, Ngài rời bỏ cung điện là nơi trú ngụ của vinh quang Chuyển Luân Vương, xuất gia bên bờ sông Anomā, thực hành khổ hạnh trong sáu năm, vào ngày trăng tròn tháng Visākha, thọ thực món sữa gạo mật ong có thần vị do nàng Sujātā cúng dường tại làng Uruvelā, vào buổi chiều, Ngài đi vào Bồ-đề-mạn-đala từ phía nam và phía bắc, nhiễu quanh cây Bồ-đề vương ba lần, đứng ở phía đông bắc, trải tọa cụ cỏ, kiết già ba khớp, lấy thiền định từ bi (mettākammaṭṭhāna) có bốn chi làm tiền đạo, phát nguyện tinh tấn (vīriyādhiṭṭhāna), ngồi trên tòa kim cương cao mười bốn khuỷu tay, lưng tựa vào thân cây Bồ-đề cao năm mươi khuỷu tay như một trụ bạc đặt trên ngai vàng, được cành Bồ-đề che chở như một lọng ngọc, trong khi những chồi Bồ-đề màu san hô rơi xuống y phục vàng óng, khi mặt trời lặn, Ngài đã đánh bại quân Ma-vương, trong canh đầu nhớ lại các kiếp sống quá khứ, trong canh giữa làm thanh tịnh thiên nhãn (dibbacakkhu), vào lúc rạng đông, Ngài đã đưa trí tuệ vào duyên khởi (paccayākāra) mà tất cả các vị Phật đều thực hành, thành tựu thiền thứ tư về hơi thở vào ra (ānāpāna), lấy đó làm nền tảng phát triển tuệ quán (vipassanā), và bằng Tứ Thánh Đạo đã đạt được theo thứ tự của đạo lộ, Ngài đã diệt trừ tất cả phiền não và chứng đạt tất cả các công đức của chư Phật; đây là công việc của trí tuệ Ngài.
Evaṃ samādhi paññaṃ na pāpuṇāti.
In this way, concentration does not attain to wisdom.
Như vậy, định không đạt đến tuệ.
Tattha yathā hatthe udakaṃ pātiyaṃ udakaṃ na pāpuṇāti, pātiyaṃ udakaṃ ghaṭe udakaṃ na pāpuṇāti, ghaṭe udakaṃ kolambe udakaṃ na pāpuṇāti, kolambe udakaṃ cāṭiyaṃ udakaṃ na pāpuṇāti, cāṭiyaṃ udakaṃ mahākumbhiyaṃ udakaṃ na pāpuṇāti, mahākumbhiyaṃ udakaṃ kusobbhe udakaṃ na pāpuṇāti, kusobbhe udakaṃ kandare udakaṃ na pāpuṇāti, kandare udakaṃ kunnadiyaṃ udakaṃ na pāpuṇāti, kunnadiyaṃ udakaṃ pañcamahānadiyaṃ udakaṃ na pāpuṇāti, pañcamahānadiyaṃ udakaṃ cakkavāḷamahāsamudde udakaṃ na pāpuṇāti, cakkavāḷamahāsamudde udakaṃ sinerupādake mahāsamudde udakaṃ na pāpuṇāti.
Herein, just as the water in the hand does not attain to the water in the drinking cup, the water in the drinking cup does not attain to the water in the pot, the water in the pot does not attain to the water in the small water jar, the water in the small water jar does not attain to the water in the large water jar, the water in the large water jar does not attain to the water in the great storage jar, the water in the great storage jar does not attain to the water in the pond, the water in the pond does not attain to the water in the mountain gorge, the water in the mountain gorge does not attain to the water in the small river, the water in the small river does not attain to the water in the five great rivers, the water in the five great rivers does not attain to the water in the great ocean of the Cakkavāḷa, the water in the great ocean of the Cakkavāḷa does not attain to the water in the great ocean at the foot of Sineru.
Ở đây, ví như nước trong lòng bàn tay không đạt đến nước trong chén, nước trong chén không đạt đến nước trong bình, nước trong bình không đạt đến nước trong vại, nước trong vại không đạt đến nước trong chum, nước trong chum không đạt đến nước trong vạc lớn, nước trong vạc lớn không đạt đến nước trong ao nhỏ, nước trong ao nhỏ không đạt đến nước trong khe núi, nước trong khe núi không đạt đến nước trong sông nhỏ, nước trong sông nhỏ không đạt đến nước trong năm con sông lớn, nước trong năm con sông lớn không đạt đến nước trong đại dương bao quanh thế giới, nước trong đại dương bao quanh thế giới không đạt đến nước trong đại dương dưới chân núi Sineru.
Pātiyaṃ udakaṃ upanidhāya hatthe udakaṃ parittaṃ…pe… sinerupādakamahāsamudde udakaṃ upanidhāya cakkavāḷamahāsamudde udakaṃ parittaṃ.
Compared to the water in the drinking cup, the water in the hand is little… and so on… compared to the water in the great ocean at the foot of Sineru, the water in the great ocean of the Cakkavāḷa is little.
So với nước trong chén, nước trong lòng bàn tay thì ít ỏi… cho đến so với nước trong đại dương dưới chân núi Sineru, nước trong đại dương bao quanh thế giới thì ít ỏi.
Iti uparūpari udakaṃ bahukaṃ upādāya heṭṭhā heṭṭhā udakaṃ parittaṃ hoti.
Thus, by considering the greater amounts of water in the higher categories, the water in the lower categories is found to be little.
Như vậy, lấy nước ở trên cao hơn thì nhiều, còn nước ở dưới thấp hơn thì ít ỏi.
‘‘Puthu kilese janentīti puthujjanā, puthu avihatasakkāyadiṭṭhikāti puthujjanā, puthu satthārānaṃ mukhullokikāti puthujjanā, puthu sabbagatīhi avuṭṭhitāti puthujjanā, puthu nānābhisaṅkhāre abhisaṅkharontīti puthujjanā, puthu nānāoghehi vuyhanti, puthu santāpehi santappanti, puthu pariḷāhehi pariḍayhanti, puthu pañcasu kāmaguṇesu rattā giddhā gathitā mucchitā ajjhopannā laggā laggitā palibuddhāti puthujjanā, puthu pañcahi nīvaraṇehi āvutā nivutā ovutā pihitā paṭicchannā paṭikujjitāti puthujjanā’’ti.
“They generate (janenti) many (puthu) defilements, thus they are puthujjanas. They have many (puthu) identity views that have not been abandoned. They look up (ullokika) to the faces of many (puthu) teachers. They have not risen out of all (sabba) the many (puthu) destinies. They concoct (abhisaṅkharonti) many (puthu) diverse concoctions (nānābhisaṅkhāre). They are swept away by many (puthu) diverse floods (nānāoghehi). They are afflicted by many (puthu) torments (santāpehi). They are consumed by many (puthu) fevers (pariḷāhehi). They are impassioned, greedy, attached, infatuated, clinging, stuck, bound to the five strands of sensual pleasure in many ways (puthu). They are obstructed, hindered, enmeshed, blocked, covered, and overturned by the five hindrances in many ways (puthu), thus they are puthujjanas.”
“Vì sinh ra nhiều phiền não nên gọi là phàm phu; vì có tà kiến thân kiến (sakkāyadiṭṭhi) chưa bị diệt trừ nên gọi là phàm phu; vì nhìn mặt nhiều bậc Đạo Sư nên gọi là phàm phu; vì chưa thoát khỏi mọi nẻo luân hồi nên gọi là phàm phu; vì tạo tác nhiều loại hành (saṅkhāra) khác nhau nên gọi là phàm phu; vì bị cuốn trôi bởi nhiều dòng nước lũ (ogha) khác nhau; vì bị nung đốt bởi nhiều sự khổ đau (santāpa) khác nhau; vì bị thiêu đốt bởi nhiều sự nóng bức (pariḷāha) khác nhau; vì bị tham đắm, ham muốn, chấp trước, say mê, chìm đắm, dính mắc, ràng buộc vào năm dục lạc nên gọi là phàm phu; vì bị che chắn, bao phủ, bao bọc, đóng kín, che giấu, vùi lấp bởi năm triền cái nên gọi là phàm phu.”
Puthūnaṃ gaṇanapathamatītānaṃ ariyadhammaparammukhānaṃ nīcadhammasamācārānaṃ janānaṃ antogadhattāpi puthujjano, puthuvāyaṃ visuṃyeva saṅkhyaṃ gato visaṃsaṭṭho sīlasutādiguṇayuttehi ariyehi janehīti puthujjanoti.
He is also a puthujjana from being included among the many folk who have surpassed enumeration, who have turned away from the noble Dhamma, and who practice base conduct. Or, this folk (jano) is separate (puthu), that is, accounted for separately, unmixed with the noble folk endowed with virtues such as morality and learning; thus, he is a puthujjana.
Cũng là phàm phu vì nằm trong số đông những người vượt quá số đếm, quay lưng lại với các pháp cao thượng (ariyadhamma), và có hành vi thấp kém; hoặc người này là phàm phu vì được tính riêng biệt, không hòa lẫn với những bậc Thánh nhân có các đức tính như giới, tuệ, v.v.
Kathaṃ bhagavā tathā āgatoti tathāgato? Yathā sabbalokahitāya ussukkamāpannā purimakā sammāsambuddhā āgatā, yathā vipassī bhagavā āgato, yathā sikhī bhagavā, yathā vessabhū bhagavā, yathā kakusandho bhagavā, yathā koṇāgamano bhagavā, yathā kassapo bhagavā āgato.
How is the Blessed One a Tathāgata in the sense of having come in such a way (tathā āgato)? Just as the Perfectly Enlightened Ones of the past, who were intent on the welfare of all the world, came—as the Blessed One Vipassī came, as the Blessed One Sikhī, as the Blessed One Vessabhū, as the Blessed One Kakusandha, as the Blessed One Koṇāgamana, as the Blessed One Kassapa came.
Đức Thế Tôn đến như vậy nên là Như Lai (Tathā āgato) như thế nào? Như các vị Chánh Đẳng Giác đời trước đã đến vì lợi ích của tất cả chúng sanh, như Đức Thế Tôn Vipassī đã đến, như Đức Thế Tôn Sikhī, như Đức Thế Tôn Vessabhū, như Đức Thế Tôn Kakusandha, như Đức Thế Tôn Koṇāgamana, như Đức Thế Tôn Kassapa đã đến.
Kiṃ vuttaṃ hoti?
What is meant by this?
Điều đó có nghĩa là gì?
Yena abhinīhārena ete bhagavanto āgatā, teneva amhākampi bhagavā āgato.
By that same aspiration by which those Blessed Ones came, by that very same way our Blessed One also came.
Bằng sự phát nguyện mà các vị Thế Tôn ấy đã đến, Đức Thế Tôn của chúng ta cũng đã đến bằng sự phát nguyện ấy.
Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā dānapāramiṃ pūretvā, sīlanekkhammapaññāvīriyakhantisaccaadhiṭṭhānamettāupekkhāpāramiṃ pūretvā, imā dasa pāramiyo, dasa upapāramiyo, dasa paramatthapāramiyoti samatiṃsapāramiyo pūretvā aṅgapariccāgaṃ, nayanadhanarajjaputtadārapariccāganti ime pañca mahāpariccāge pariccajitvā pubbayogapubbacariyadhammakkhānañātatthacariyādayo pūretvā buddhicariyāya koṭiṃ patvā āgato; tathā amhākampi bhagavā āgato.
Or else, just as the Blessed One Vipassī… and so on… as the Blessed One Kassapa came, having fulfilled the perfection of giving, having fulfilled the perfections of morality, renunciation, wisdom, energy, patience, truth, resolve, loving-kindness, and equanimity—having fulfilled these ten perfections, ten subsidiary perfections, and ten ultimate perfections, thus thirty perfections in total; having made the five great relinquishments, namely, the relinquishment of limbs, eyes, wealth, kingdom, and wife and children; having fulfilled the former practices, former conducts, teaching of the Dhamma, conduct for the welfare of relatives, and so on; and having reached the pinnacle of the conduct for wisdom; in such a way our Blessed One also came.
Hoặc, như Đức Thế Tôn Vipassī… cho đến Đức Thế Tôn Kassapa đã viên mãn mười Ba-la-mật là bố thí Ba-la-mật, giới Ba-la-mật, xuất ly Ba-la-mật, trí tuệ Ba-la-mật, tinh tấn Ba-la-mật, nhẫn nại Ba-la-mật, chân thật Ba-la-mật, quyết định Ba-la-mật, từ bi Ba-la-mật, xả Ba-la-mật, mười Ba-la-mật phụ (upapāramī), mười Ba-la-mật tối thượng (paramatthapāramī), tổng cộng ba mươi Ba-la-mật; đã thực hành năm đại hy sinh là hy sinh thân thể, hy sinh mắt, hy sinh tài sản, hy sinh vương quốc, hy sinh vợ con; đã viên mãn các hạnh như hạnh tu tập trước, hạnh hành trì trước, hạnh thuyết pháp, hạnh vì lợi ích người thân, v.v., đạt đến đỉnh cao của hạnh Bồ-đề và đã đến; Đức Thế Tôn của chúng ta cũng đã đến như vậy.
Atha vā yathā vipassī bhagavā…pe… kassapo bhagavā cattāro satipaṭṭhāne, cattāro sammappadhāne, cattāro iddhipāde, pañcindriyāni, pañca balāni, satta bojjhaṅge, ariyaṃ aṭṭhaṅgikaṃ maggaṃ bhāvetvā brūhetvā āgato, tathā amhākampi bhagavā āgato.
Or else, just as the Blessed One Vipassī… and so on… the Blessed One Kassapa came, having developed and cultivated the four foundations of mindfulness, the four right strivings, the four bases of psychic power, the five faculties, the five powers, the seven factors of enlightenment, and the Noble Eightfold Path, in such a way our Blessed One also came.
Hoặc, như Đức Thế Tôn Vipassī… cho đến Đức Thế Tôn Kassapa đã tu tập và phát triển Tứ Niệm Xứ (cattāro satipaṭṭhāne), Tứ Chánh Cần (cattāro sammappadhāne), Tứ Như Ý Túc (cattāro iddhipāde), Ngũ Căn (pañcindriyāni), Ngũ Lực (pañca balāni), Thất Giác Chi (satta bojjhaṅge), Bát Chánh Đạo (ariyaṃ aṭṭhaṅgikaṃ maggaṃ) và đã đến; Đức Thế Tôn của chúng ta cũng đã đến như vậy.
Evaṃ tathā āgatoti tathāgato.
Thus, he has come in such a way (tathā āgato), so he is a Tathāgata.
Như vậy, đến như vậy nên là Như Lai.
Kathañca so bhagavā gato?
And how did that Blessed One go?
Và Đức Thế Tôn ấy đã đi như thế nào?
So hi sampati jātova samehi pādehi pathaviyaṃ patiṭṭhāya uttarābhimukho sattapadavītihārena gato.
For he, just after being born, having stood on the earth with even feet, went with a stride of seven steps facing north.
Quả thật, Ngài vừa mới đản sinh, đã đứng vững bằng đôi chân bằng phẳng trên mặt đất, hướng về phía Bắc và đi bảy bước.
Yathāha – ‘‘sampatijāto kho, ānanda, bodhisatto samehi pādehi patiṭṭhahitvā uttarābhimukho sattapadavītihārena gacchati, setamhi chatte anudhāriyamāne sabbā ca disā anuviloketi, āsabhiṃ vācaṃ bhāsati – ‘aggohamasmi lokassa, jeṭṭhohamasmi lokassa, seṭṭhohamasmi lokassa, ayamantimā jāti, natthidāni punabbhavo’ti’’ (dī. ni. 2.31).
As it is said: “Indeed, Ānanda, the Bodhisatta, just after being born, having stood with even feet, goes with a stride of seven steps facing north, while a white parasol is being held over him, and he surveys all the directions and utters a bull-like utterance: ‘I am the chief in the world, I am the eldest in the world, I am the foremost in the world. This is my last birth. Now there is no more renewed existence.’”
Như đã nói: “Này Ānanda, Bồ Tát vừa mới đản sinh, đứng vững bằng đôi chân bằng phẳng, hướng về phía Bắc, đi bảy bước, trong khi lọng trắng được che, Ngài nhìn khắp các phương, và Ngài nói lời hùng tráng: ‘Ta là tối thượng của thế gian, Ta là trưởng thượng của thế gian, Ta là tối thắng của thế gian. Đây là kiếp cuối cùng, không còn tái sinh nữa.’”
Atha vā yathā vipassī bhagavā…pe… yathā kassapo bhagavā, ayampi bhagavā tatheva nekkhammena kāmacchandaṃ pahāya gato, abyāpādena byāpādaṃ, ālokasaññāya thinamiddhaṃ, avikkhepena uddhaccakukkuccaṃ, dhammavavatthānena vicikicchaṃ pahāya ñāṇena avijjaṃ padāletvā, pāmojjena aratiṃ vinodetvā, paṭhamajjhānena nīvaraṇakavāṭaṃ ugghāṭetvā, dutiyajjhānena vitakkavicāraṃ vūpasametvā, tatiyajjhānena pītiṃ virājetvā, catutthajjhānena sukhadukkhaṃ pahāya, ākāsānañcāyatanasamāpattiyā rūpasaññāpaṭighasaññānānattasaññāyo samatikkamitvā, viññāṇañcāyatanasamāpattiyā ākāsānañcāyatanasaññaṃ, ākiñcaññāyatanasamāpattiyā viññāṇañcāyatanasaññaṃ, nevasaññānāsaññāyatanasamāpattiyā ākiñcaññāyatanasaññaṃ samatikkamitvā gato.
Or else, just as the Blessed One Vipassī... and so on... just as the Blessed One Kassapa, so too this Blessed One has gone: by renunciation, abandoning sensual desire; by non-ill-will, ill-will; by the perception of light, sloth and torpor; by non-distraction, restlessness and worry; by the determination of dhammas, doubt; by knowledge, having shattered ignorance; by joy, having dispelled discontent; by the first jhānic state, having opened the door of the hindrances; by the second jhānic state, having calmed applied and sustained thought; by the third jhānic state, having become dispassionate towards rapture; by the fourth jhānic state, abandoning pleasure and pain; by the attainment of the base of the infinity of space, having transcended perceptions of form, perceptions of resistance, and perceptions of diversity; by the attainment of the base of the infinity of consciousness, the perception of the base of the infinity of space; by the attainment of the base of nothingness, the perception of the base of the infinity of consciousness; by the attainment of the base of neither-perception-nor-non-perception, having transcended the perception of the base of nothingness, he has gone.
Hoặc là, như Đức Thế Tôn Vipassī… (tương tự)… như Đức Thế Tôn Kassapa, Đức Thế Tôn này cũng đã đi như thế, Ngài đã từ bỏ dục ái bằng sự xuất ly (nekkhammena), đã từ bỏ sân hận bằng sự vô sân (abyāpādena), đã từ bỏ hôn trầm thụy miên bằng tưởng ánh sáng (ālokasaññāya), đã từ bỏ trạo cử hối hận bằng sự không phóng dật (avikkhepena), đã từ bỏ nghi ngờ bằng sự phân biệt pháp (dhammavavatthānena), đã phá tan vô minh bằng trí tuệ (ñāṇena), đã xua tan sự bất mãn bằng niềm hoan hỷ (pāmojjena), đã mở cánh cửa che chướng ngại bằng sơ thiền (paṭhamajjhānena), đã làm lắng dịu tầm tứ bằng nhị thiền (dutiyajjhānena), đã ly hỷ bằng tam thiền (tatiyajjhānena), đã từ bỏ lạc khổ bằng tứ thiền (catutthajjhānena), đã vượt qua sắc tưởng, chướng ngại tưởng, dị biệt tưởng bằng định Không Vô Biên Xứ (ākāsānañcāyatanasamāpattiyā), đã vượt qua Không Vô Biên Xứ tưởng bằng định Thức Vô Biên Xứ (viññāṇañcāyatanasamāpattiyā), đã vượt qua Thức Vô Biên Xứ tưởng bằng định Vô Sở Hữu Xứ (ākiñcaññāyatanasamāpattiyā), đã vượt qua Vô Sở Hữu Xứ tưởng bằng định Phi Tưởng Phi Phi Tưởng Xứ (nevasaññānāsaññāyatanasamāpattiyā).
Aniccānupassanāya niccasaññaṃ pahāya, dukkhānupassanāya sukhasaññaṃ, anattānupassanāya attasaññaṃ, nibbidānupassanāya nandiṃ, virāgānupassanāya rāgaṃ, nirodhānupassanāya samudayaṃ, paṭinissaggānupassanāya ādānaṃ, khayānupassanāya ghanasaññaṃ, vayānupassanāya āyūhanaṃ, vipariṇāmānupassanāya dhuvasaññaṃ, animittānupassanāya nimittaṃ, appaṇihitānupassanāya paṇidhiṃ, suññatānupassanāya abhinivesaṃ, adhipaññādhammavipassanāya sārādānābhinivesaṃ, yathābhūtañāṇadassanena sammohābhinivesaṃ, ādīnavānupassanāya ālayābhinivesaṃ, paṭisaṅkhānupassanāya appaṭisaṅkhaṃ, vivaṭṭānupassanāya saṃyogābhinivesaṃ, sotāpattimaggena diṭṭhekaṭṭhe kilese bhañjitvā, sakadāgāmimaggena oḷārike kilese pahāya, anāgāmimaggena aṇusahagate kilese samugghāṭetvā, arahattamaggena sabbakilese samucchinditvā gato.
By contemplation of impermanence, abandoning the perception of permanence; by contemplation of suffering, the perception of pleasure; by contemplation of non-self, the perception of self; by contemplation of disenchantment, delight; by contemplation of dispassion, passion; by contemplation of cessation, the origin; by contemplation of relinquishment, grasping; by contemplation of destruction, the perception of solidity; by contemplation of vanishing, accumulation; by contemplation of change, the perception of stability; by contemplation of the signless, the sign; by contemplation of the desireless, desire; by contemplation of emptiness, adherence; by insight into things through higher wisdom, the adherence of grasping at a core; by the knowledge and vision of things as they really are, the adherence of delusion; by contemplation of danger, the adherence of attachment; by contemplation of reflection, non-reflection; by contemplation of turning away, the adherence of fetters, he has gone. By the path of stream-entry, having destroyed the defilements that are of the same station as views; by the path of a once-returner, abandoning the gross defilements; by the path of a non-returner, uprooting the subtle defilements; by the path of Arahantship, having completely cut off all defilements, he has gone.
Ngài đã từ bỏ thường tưởng bằng quán vô thường (aniccānupassanāya), đã từ bỏ lạc tưởng bằng quán khổ (dukkhānupassanāya), đã từ bỏ ngã tưởng bằng quán vô ngã (anattānupassanāya), đã từ bỏ sự hoan hỷ bằng quán yếm ly (nibbidānupassanāya), đã từ bỏ tham ái bằng quán ly tham (virāgānupassanāya), đã từ bỏ sự sinh khởi bằng quán diệt (nirodhānupassanāya), đã từ bỏ sự chấp thủ bằng quán xả ly (paṭinissaggānupassanāya), đã từ bỏ kiên cố tưởng bằng quán hoại diệt (khayānupassanāya), đã từ bỏ sự tích lũy bằng quán tiêu vong (vayānupassanāya), đã từ bỏ thường hằng tưởng bằng quán biến hoại (vipariṇāmānupassanāya), đã từ bỏ tướng bằng quán vô tướng (animittānupassanāya), đã từ bỏ sự ước muốn bằng quán vô nguyện (appaṇihitānupassanāya), đã từ bỏ sự chấp trước bằng quán không (suññatānupassanāya), đã từ bỏ sự chấp trước vào việc nắm giữ tinh túy bằng quán pháp tuệ quán ưu việt (adhipaññādhammavipassanāya), đã từ bỏ sự chấp trước vào sự si mê bằng trí tuệ thấy biết như thật (yathābhūtañāṇadassanena), đã từ bỏ sự chấp trước vào sự bám víu bằng quán nguy hiểm (ādīnavānupassanāya), đã từ bỏ sự không suy xét bằng quán suy xét (paṭisaṅkhānupassanāya), đã từ bỏ sự chấp trước vào sự ràng buộc bằng quán thoát ly (vivaṭṭānupassanāya), đã phá tan các phiền não gắn liền với tà kiến bằng Sơ quả Tu-đà-hoàn (sotāpattimaggena), đã từ bỏ các phiền não thô thiển bằng Nhị quả Tư-đà-hàm (sakadāgāmimaggena), đã nhổ tận gốc các phiền não vi tế bằng Tam quả A-na-hàm (anāgāmimaggena), đã đoạn trừ tất cả các phiền não bằng Tứ quả A-la-hán (arahattamaggena) và đã đi đến giải thoát.
Evampi tathā gatoti tathāgato.
In this way too, “thus gone” is Tathāgata.
Như vậy là “đã đi như thế” nên gọi là Tathāgata.
Satisambojjhaṅgassa upaṭṭhānalakkhaṇaṃ.
by restlessness, of the power of concentration; the characteristic of being unshakable by ignorance, of the power of wisdom.
Tướng an trú của niệm giác chi (satisambojjhaṅga).
Dhammavicayasambojjhaṅgassa pavicayalakkhaṇaṃ.
The characteristic of establishment of the enlightenment factor of mindfulness.
Tướng phân tích của trạch pháp giác chi (dhammavicayasambojjhaṅga).
Vīriyasambojjhaṅgassa paggahalakkhaṇaṃ.
The characteristic of investigation of the enlightenment factor of investigation of dhammas.
Tướng tinh tấn của cần giác chi (vīriyasambojjhaṅga).
Pītisambojjhaṅgassa pharaṇalakkhaṇaṃ.
The characteristic of exertion of the enlightenment factor of energy.
Tướng lan tỏa của hỷ giác chi (pītisambojjhaṅga).
Passaddhisambojjhaṅgassa vūpasamalakkhaṇaṃ.
The characteristic of pervading of the enlightenment factor of rapture.
Tướng lắng dịu của khinh an giác chi (passaddhisambojjhaṅga).
Samādhisambojjhaṅgassa avikkhepalakkhaṇaṃ.
The characteristic of calming of the enlightenment factor of tranquility.
Tướng không tán loạn của định giác chi (samādhisambojjhaṅga).
Upekkhāsambojjhaṅgassa paṭisaṅkhānalakkhaṇaṃ.
The characteristic of non-distraction of the enlightenment factor of concentration.
Tướng suy xét của xả giác chi (upekkhāsambojjhaṅga).
Sammādiṭṭhiyā dassanalakkhaṇaṃ.
The characteristic of reflection of the enlightenment factor of equanimity.
Tướng thấy biết của chánh kiến (sammādiṭṭhi).
Sammāsaṅkappassa abhiniropanalakkhaṇaṃ.
The characteristic of seeing of Right View.
Tướng đặt tâm vào đối tượng của chánh tư duy (sammāsaṅkappa).
Sammāvācāya pariggahalakkhaṇaṃ.
The characteristic of directing the mind of Right Thought.
Tướng gìn giữ của chánh ngữ (sammāvācā).
Sammākammantassa samuṭṭhānalakkhaṇaṃ.
The characteristic of embracing of Right Speech.
Tướng sinh khởi của chánh nghiệp (sammākammanta).
Sammāājīvassa vodānalakkhaṇaṃ.
The characteristic of originating of Right Action.
Tướng thanh tịnh của chánh mạng (sammāājīva).
Sammāvāyāmassa paggahalakkhaṇaṃ.
The characteristic of cleansing of Right Livelihood.
Tướng tinh tấn của chánh tinh tấn (sammāvāyāma).
Sammāsatiyā upaṭṭhānalakkhaṇaṃ.
The characteristic of exertion of Right Effort.
Tướng an trú của chánh niệm (sammāsati).
Sammāsamādhissa avikkhepalakkhaṇaṃ.
The characteristic of establishment of Right Mindfulness.
Tướng không tán loạn của chánh định (sammāsamādhi).
Avijjāya aññāṇalakkhaṇaṃ.
The characteristic of non-distraction of Right Concentration.
Tướng không biết của vô minh (avijjā).
Saṅkhārānaṃ cetanālakkhaṇaṃ.
The characteristic of ignorance of ignorance.
Tướng tư tác của hành (saṅkhāra).
Viññāṇassa vijānanalakkhaṇaṃ.
The characteristic of volition of formations.
Tướng nhận biết của thức (viññāṇa).
Nāmassa namanalakkhaṇaṃ.
The characteristic of cognizing of consciousness.
Tướng nghiêng về đối tượng của danh (nāma).
Rūpassa ruppanalakkhaṇaṃ.
The characteristic of bending of name.
Tướng biến hoại của sắc (rūpa).
Saḷāyatanassa āyatanalakkhaṇaṃ.
The characteristic of being afflicted of form.
Tướng sinh khởi của sáu xứ (saḷāyatana).
Phassassa phusanalakkhaṇaṃ.
The characteristic of being a base of the six sense bases.
Tướng xúc chạm của xúc (phassa).
Vedanāya vedayitalakkhaṇaṃ.
The characteristic of touching of contact.
Tướng cảm thọ của thọ (vedanā).
Taṇhāya hetulakkhaṇaṃ.
The characteristic of feeling of feeling.
Tướng nguyên nhân của ái (taṇhā).
Upādānassa gahaṇalakkhaṇaṃ.
The characteristic of being a cause of craving.
Tướng chấp thủ của thủ (upādāna).
Bhavassa āyūhanalakkhaṇaṃ.
The characteristic of grasping of clinging.
Tướng tạo tác của hữu (bhava).
Jātiyā nibbattilakkhaṇaṃ.
The characteristic of accumulating of existence.
Tướng sinh khởi của sinh (jāti).
Jarāya jīraṇalakkhaṇaṃ.
The characteristic of being produced of birth.
Tướng già nua của lão (jarā).
Maraṇassa cutilakkhaṇaṃ.
The characteristic of aging of aging.
Tướng hoại diệt của tử (maraṇa).
Dhātūnaṃ suññatālakkhaṇaṃ.
The characteristic of passing away of death.
Tướng không của các giới (dhātu).
Āyatanānaṃ āyatanalakkhaṇaṃ.
The characteristic of emptiness of the elements.
Tướng sinh khởi của các xứ (āyatana).
Satipaṭṭhānānaṃ upaṭṭhānalakkhaṇaṃ.
The characteristic of being a base of the sense bases.
Tướng an trú của các niệm xứ (satipaṭṭhāna).
Sammappadhānānaṃ padahanalakkhaṇaṃ.
The characteristic of establishment of the foundations of mindfulness.
Tướng tinh tấn của các chánh cần (sammappadhāna).
Iddhipādānaṃ ijjhanalakkhaṇaṃ.
The characteristic of striving of the right strivings.
Tướng thành tựu của các thần túc (iddhipāda).
Indriyānaṃ adhipatilakkhaṇaṃ.
The characteristic of success of the bases of spiritual power.
Tướng làm chủ của các căn (indriya).
Balānaṃ akampiyalakkhaṇaṃ.
Of the powers, the characteristic is unshakability.
Đặc tính của các Ba-la (Lực) là không bị lay chuyển.
Bojjhaṅgānaṃ niyyānalakkhaṇaṃ.
Of the factors of enlightenment, the characteristic is leading out.
Đặc tính của các Bojjhaṅga (Giác chi) là đưa đến sự giải thoát.
Maggassa hetulakkhaṇaṃ.
Of the path, the characteristic is being a cause.
Đặc tính của Magga (Đạo) là nhân tố dẫn đến Niết Bàn.
Chandassa mūlalakkhaṇaṃ.
Of zeal, the characteristic is being the root.
Đặc tính của Chanda (Dục) là gốc rễ.
Manasikārassa samuṭṭhāpanalakkhaṇaṃ.
Of attention, the characteristic is arousing.
Đặc tính của Manasikāra (Tác ý) là sự khởi lên.
Phassassa samodhānalakkhaṇaṃ.
Of contact, the characteristic is coordinating.
Đặc tính của Phassa (Xúc) là sự hội tụ.
Vedanāya samosaraṇalakkhaṇaṃ.
Of feeling, the characteristic is being what is converged upon.
Đặc tính của Vedanā (Thọ) là sự quy tụ.
Samādhissa pamukhalakkhaṇaṃ.
Of concentration, the characteristic is being foremost.
Đặc tính của Samādhi (Định) là sự đứng đầu.
Satiyā ādhipateyyalakkhaṇaṃ.
Of mindfulness, the characteristic is sovereignty.
Đặc tính của Sati (Niệm) là sự thống trị.
Paññāya tatuttariyalakkhaṇaṃ.
Of wisdom, the characteristic is being superior to them.
Đặc tính của Paññā (Tuệ) là sự vượt trội hơn thế.
Vimuttiyā sāralakkhaṇaṃ… amatogadhassa nibbānassa pariyosānalakkhaṇaṃ tathaṃ avitathaṃ.
Of liberation, the characteristic is being the essence… of Nibbāna, which is the immersion in the deathless, the characteristic is being the culmination—this is true and not otherwise.
Đặc tính của Vimutti (Giải thoát) là tinh túy... Đặc tính của Nibbāna (Niết Bàn) là sự chấm dứt của Brahma-cariya (phạm hạnh) - Niết Bàn, nơi bất tử (amata) được đạt đến, là chân thật, không sai lạc.
Evaṃ tathalakkhaṇaṃ ñāṇagatiyā āgato avirajjhitvā patto anuppattoti tathāgato.
Thus, having come to the true characteristic by the way of knowledge, having reached and attained it without error, he is the Tathāgata.
Như vậy, Ngài đã đến với sự vận hành của trí tuệ đến các đặc tính chân thật này, không sai lệch mà đạt được, nên gọi là Tathāgata.
Evaṃ tathalakkhaṇaṃ āgatoti tathāgato.
Thus, because he has gone to the true characteristic, he is the Tathāgata.
Như vậy, Ngài đã đến với các đặc tính chân thật này, nên gọi là Tathāgata.
Kathaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato? Tathadhammā nāma cattāri ariyasaccāni.
How is he the Tathāgata because he has perfectly awakened to true dhammas as they really are? True dhammas are the Four Noble Truths.
Làm thế nào mà Ngài là Tathāgata vì đã giác ngộ đúng như thật các pháp chân thật? Các pháp chân thật là Tứ Diệu Đế.
Yathāha – ‘‘cattārimāni, bhikkhave, tathāni avitathāni anaññathāni.
As it is said: “Bhikkhus, these four things are true, not false, not otherwise.
Như đã nói – “Này các Tỳ-khưu, có bốn điều này là chân thật, không sai lạc, không khác biệt.
Katamāni cattāri?
What four?
Bốn điều nào?
‘Idaṃ dukkha’nti bhikkhave, tathametaṃ avitathametaṃ anaññathameta’’nti (saṃ. ni. 5.1090) vitthāro.
‘This is suffering,’ bhikkhus, this is true, this is not false, this is not otherwise,” and so on in detail.
Này các Tỳ-khưu, ‘Đây là Khổ’ – điều này là chân thật, điều này không sai lạc, điều này không khác biệt” – và cứ thế (Saṃ. Ni. 5.1090) là phần mở rộng.
Tāni ca bhagavā abhisambuddho, tasmā tathānaṃ dhammānaṃ abhisambuddhattā tathāgatoti vuccati.
The Blessed One has perfectly awakened to these; therefore, because of having perfectly awakened to true dhammas, he is called the Tathāgata.
Và Thế Tôn đã giác ngộ các điều đó, do đó, vì đã giác ngộ các pháp chân thật, Ngài được gọi là Tathāgata.
Abhisambuddhattho hettha gatasaddo.
Here, the word ‘gata’ has the meaning of ‘perfectly awakened’.
Ở đây, từ "gata" có nghĩa là "abhisambuddha" (đã giác ngộ).
Api ca jarāmaraṇassa jātipaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe…, saṅkhārānaṃ avijjāpaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho…pe…, tathā avijjāya saṅkhārānaṃ paccayaṭṭho, saṅkhārānaṃ viññāṇassa paccayaṭṭho…pe…, jātiyā jarāmaraṇassa paccayaṭṭho tatho avitatho anaññatho.
Moreover, the state of old age and death, being well-produced and arisen from birth as its condition, is true, not false, not otherwise… The state of formations, being well-produced and arisen from ignorance as their condition, is true, not false, not otherwise… Likewise, the state of ignorance as a condition for formations, the state of formations as a condition for consciousness… the state of birth as a condition for old age and death, is true, not false, not otherwise.
Hơn nữa, sự sanh khởi và tập khởi của già chết do duyên sanh là chân thật, không sai lạc, không khác biệt… (cứ thế)… sự sanh khởi và tập khởi của các hành do duyên vô minh là chân thật, không sai lạc, không khác biệt… (cứ thế)… cũng vậy, vô minh là duyên cho các hành, các hành là duyên cho thức… (cứ thế)… sanh là duyên cho già chết là chân thật, không sai lạc, không khác biệt.
Taṃ sabbaṃ bhagavā abhisambuddho, tasmāpi tathānaṃ dhammānaṃ abhisambuddhattā tathāgatoti vuccati.
The Blessed One has perfectly awakened to all of that; therefore, too, because of having perfectly awakened to true dhammas, he is called the Tathāgata.
Thế Tôn đã giác ngộ tất cả những điều đó, do đó, vì đã giác ngộ các pháp chân thật, Ngài cũng được gọi là Tathāgata.
Evaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato.
Thus, he is the Tathāgata because he has perfectly awakened to true dhammas as they really are.
Như vậy, Ngài là Tathāgata vì đã giác ngộ đúng như thật các pháp chân thật.
Kathaṃ tathadassitāya tathāgato? Bhagavā yaṃ sadevake loke…pe…, sadevamanussāya pajāya aparimāṇāsu lokadhātūsu aparimāṇānaṃ sattānaṃ cakkhudvāre āpāthamāgacchantaṃ rūpārammaṇaṃ nāma atthi, taṃ sabbākārato jānāti passati.
How is he the Tathāgata because of seeing what is true? Whatever visible object there is in the world with its devas… for the generation with its devas and humans, that comes into the range of the eye-door of innumerable beings in innumerable world systems, the Blessed One knows and sees it in all its aspects.
Làm thế nào mà Ngài là Tathāgata vì đã thấy biết đúng như thật? Thế Tôn biết và thấy tất cả các sắc cảnh giới khả kiến hiện hữu trong thế gian này cùng với chư thiên… (cứ thế)… trong vô số thế giới của vô số chúng sanh cùng với chư thiên và loài người, hiện ra trước nhãn căn.
Evaṃ jānatā passatā ca, tena taṃ iṭṭhāniṭṭhādivasena vā diṭṭhasutamutaviññātesu labbhamānakapadavasena vā.
And by him who knows and sees thus, that visible object—whether by way of being desirable, undesirable, etc., or by way of the term applicable among what is seen, heard, sensed, and cognized—
Khi biết và thấy như vậy, dù là theo ý muốn hay không muốn, hoặc theo các từ ngữ có thể tìm thấy trong những gì đã thấy, đã nghe, đã cảm nhận, đã biết.
‘‘Katamaṃ taṃ rūpaṃ rūpāyatanaṃ?
“What is that form which is the form base?
“Sắc đó, sắc xứ đó là gì?
Yaṃ rūpaṃ catunnaṃ mahābhūtānaṃ upādāya vaṇṇanibhā sanidassanaṃ sappaṭighaṃ nīlaṃ pītaka’’ntiādinā (dha. sa. 616) nayena anekehi nāmehi terasahi vārehi dvepaññāsāya nayehi vibhajjamānaṃ tathameva hoti, vitathaṃ natthi.
That form derived from the four great elements, which is of the nature of color, visible and impinging, blue, yellow,” and so on, when analyzed by way of many names, thirteen sections, and fifty-two methods, is just so, and there is nothing false.
Sắc nương vào bốn đại chủng, có vẻ ngoài và màu sắc, có thể thấy, có thể chạm, màu xanh, màu vàng,” v.v. (Dhamma. Sa. 616) theo cách này, được phân loại bằng nhiều tên gọi, mười ba lần, năm mươi hai cách, thì nó vẫn là như vậy, không có gì sai khác.
Esa nayo sotadvārādīsupi āpāthaṃ āgacchantesu saddādīsu.
This is the method also for sounds and so on that come into the range of the ear-door and so on.
Nguyên tắc này cũng áp dụng cho âm thanh và các đối tượng khác xuất hiện ở nhĩ căn, v.v.
Vuttañcetaṃ bhagavatā – ‘‘yaṃ bhikkhave, sadevakassa lokassa…pe… sadevamanussāya pajāya diṭṭhaṃ sutaṃ mutaṃ viññātaṃ pattaṃ pariyesitaṃ anuvicaritaṃ manasā, tamahaṃ jānāmi.
And this was said by the Blessed One: “Bhikkhus, whatever in the world with its devas… for the generation with its devas and humans, is seen, heard, sensed, cognized, attained, sought, and mentally pondered upon, that I know.
Và điều này đã được Thế Tôn nói: “Này các Tỳ-khưu, những gì đã được thấy, đã được nghe, đã được cảm nhận, đã được biết, đã được đạt tới, đã được tìm kiếm, đã được suy xét bằng tâm của thế gian này cùng với chư thiên… (cứ thế)… của loài người cùng với chư thiên, Ta đều biết.
Tamahaṃ abbhaññāsiṃ, taṃ tathāgatassa viditaṃ, taṃ tathāgato na upaṭṭhāsī’’ti (a. ni. 4.24).
That I have fully understood. That is known to the Tathāgata, but the Tathāgata has not clung to it.”
Ta đã giác ngộ điều đó, điều đó đã được Tathāgata biết rõ, Tathāgata không bám víu vào điều đó” (A. Ni. 4.24).
Evaṃ tathadassitāya tathāgato.
Thus, he is the Tathāgata because of seeing what is true.
Như vậy, Ngài là Tathāgata vì đã thấy biết đúng như thật.
Tattha tathadassī atthe tathāgatoti padasambhavo veditabbo.
Therein, the derivation of the term ‘Tathāgata’ should be understood in the sense of one who sees what is true.
Ở đây, cần hiểu rằng sự hình thành từ "Tathāgata" là từ nghĩa "Tathādassī" (người thấy biết đúng như thật).
Kathaṃ tathavāditāya tathāgato? Yaṃ rattiṃ bhagavā bodhimaṇḍe aparājitapallaṅke nisinno tiṇṇaṃ mārānaṃ matthakaṃ madditvā anuttaraṃ sammāsambodhiṃ abhisambuddho, yañca rattiṃ yamakasālānamantare anupādisesāya nibbānadhātuyā parinibbāyi, etthantare pañcacattālīsavassaparimāṇe kāle paṭhamabodhiyāpi majjhimabodhiyāpi pacchimabodhiyāpi yaṃ bhagavatā bhāsitaṃ – suttaṃ, geyyaṃ…pe… vedallaṃ, taṃ sabbaṃ atthato ca byañjanato ca anupavajjaṃ, anūnamanadhikaṃ, sabbākāraparipuṇṇaṃ, rāgamadanimmadanaṃ, dosamohamadanimmadanaṃ.
How is he the Tathāgata because of speaking what is true? On the night the Blessed One, sitting on the unconquered throne at the Bodhi-maṇḍa, having crushed the heads of the three Māras, perfectly awakened to the supreme, perfect enlightenment, and on the night he attained final Nibbāna with the Nibbāna-element that has no residue remaining, between these two, during the period of forty-five years, whatever was spoken by the Blessed One in the first, middle, and final periods of awakening—Sutta, Geyya… Vedalla—all of it is blameless in meaning and phrasing, neither deficient nor excessive, completely perfect in every aspect, subduing the intoxication of lust, subduing the intoxication of hatred and delusion.
Làm thế nào mà Ngài là Tathāgata vì đã nói đúng như thật? Trong đêm mà Thế Tôn ngồi trên bồ đoàn bất bại tại Bồ Đề Đạo Tràng, đã chế ngự ba ma, và đã giác ngộ Vô Thượng Chánh Đẳng Giác; và đêm mà Ngài nhập Niết Bàn vô dư y giới giữa hai cây sālā song thọ, trong khoảng thời gian bốn mươi lăm năm đó, những gì Thế Tôn đã thuyết giảng – kinh, kệ… (cứ thế)… vedalla – dù là trong thời kỳ giác ngộ đầu tiên, giữa hay cuối, tất cả đều không có lỗi lầm về nghĩa và văn tự, không thiếu không thừa, hoàn hảo về mọi phương diện, làm tiêu tan sự say đắm của tham, sân, si.
Natthi tattha vālaggamattampi avakkhalitaṃ, sabbaṃ taṃ ekamuddikāya lañchitaṃ viya, ekanāḷiyā mitaṃ viya, ekatulāya tulitaṃ viya ca, tathameva hoti avitathaṃ anaññathaṃ.
Therein, there is not even a hair’s tip of error; all of it is as if stamped with a single seal, as if measured with a single nāḷi, as if weighed with a single scale; it is just so, not false, not otherwise.
Không có một lời nào dù nhỏ như đầu sợi lông bị sai sót, tất cả đều giống như được đóng một con dấu, như được đo bằng một ống, như được cân bằng một cái cân, đều là như vậy, không sai lạc, không khác biệt.
Tenāha – ‘‘yañca, cunda, rattiṃ tathāgato anuttaraṃ sammāsambodhiṃ abhisambujjhati, yañca rattiṃ anupādisesāya nibbānadhātuyā parinibbāyati, yaṃ etasmiṃ antare bhāsati lapati niddisati, sabbaṃ taṃ tatheva hoti, no aññathā.
Therefore he said: “Cunda, on the night the Tathāgata perfectly awakens to the supreme, perfect enlightenment, and on the night he attains final Nibbāna with the Nibbāna-element that has no residue remaining, whatever he speaks, utters, and points out in between, all of it is just so and not otherwise.
Do đó, Ngài nói: “Này Cunda, đêm mà Như Lai giác ngộ Vô Thượng Chánh Đẳng Giác, và đêm mà Ngài nhập Niết Bàn vô dư y giới, những gì Ngài thuyết giảng, nói ra, chỉ dạy trong khoảng thời gian đó, tất cả đều là như vậy, không khác.
Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23).
Therefore he is called ‘Tathāgata’.”
Do đó, Ngài được gọi là ‘Tathāgata’” (A. Ni. 4.23).
Gadattho hettha gatasaddo.
Here, the word ‘gata’ has the meaning of ‘spoken’.
Ở đây, từ "gata" có nghĩa là "gadā" (đã nói).
Evaṃ tathavāditāya tathāgato.
Thus, he is the Tathāgata because of speaking what is true.
Như vậy, Ngài là Tathāgata vì đã nói đúng như thật.
Kathaṃ tathākāritāya tathāgato? Bhagavato hi vācāya kāyo anulometi, kāyassapi vācā, tasmā yathāvādī tathākārī, yathākārī tathāvādī ca hoti.
How is he the Tathāgata because he acts in that way? Indeed, the Blessed One's body conforms to his speech, and his speech to his body; therefore, as he speaks, so he acts, and as he acts, so he speaks.
Làm thế nào mà Ngài là Tathāgata vì đã hành động đúng như thật? Đối với Thế Tôn, thân Ngài phù hợp với lời nói, và lời nói Ngài cũng phù hợp với thân. Do đó, Ngài nói sao làm vậy, làm sao nói vậy.
Evaṃbhūtassa cassa yathāvācā, kāyopi tathā gato pavattoti attho.
For him who is thus, the meaning is: as his speech proceeded, so also his body proceeded and occurred.
Đối với một vị như vậy, lời nói như thế nào, thân cũng vận hành như thế đó.
Yathā ca kāyo, vācāpi tathā gatā pavattāti tathāgato.
And as his body, so also his speech proceeded and occurred; thus, he is the Tathāgata.
Và thân như thế nào, lời nói cũng vận hành như thế đó, nên gọi là Tathāgata.
Tenevāha – ‘‘yathāvādī, bhikkhave, tathāgato tathākārī, yathākārī tathāvādī.
Therefore he said: “Bhikkhus, as the Tathāgata speaks, so he acts; as he acts, so he speaks.
Do đó, Ngài nói: “Này các Tỳ-khưu, Như Lai nói sao làm vậy, làm sao nói vậy.
Iti yathāvādī tathākārī yathākārī tathāvādī.
Thus, as he speaks, so he acts; as he acts, so he speaks.
Như vậy, nói sao làm vậy, làm sao nói vậy.
Tasmā ‘tathāgato’ti vuccatī’’ti (a. ni. 4.23).
Therefore he is called ‘Tathāgata’.”
Do đó, Ngài được gọi là ‘Tathāgata’” (A. Ni. 4.23).
Evaṃ tathākāritāya tathāgato.
Thus, he is the Tathāgata because he acts in that way.
Như vậy, Ngài là Tathāgata vì đã hành động đúng như thật.
Kathaṃ abhibhavanaṭṭhena tathāgato? Upari bhavaggaṃ heṭṭhā avīciṃ pariyantaṃ katvā tiriyaṃ aparimāṇāsu lokadhātūsu sabbasatte abhibhavati sīlenapi samādhināpi paññāyapi vimuttiyāpi, vimuttiñāṇadassanenapi na tassa tulā vā pamāṇaṃ vā atthi; atulo appameyyo anuttaro rājātirājā devadevo sakkānaṃ atisakko brahmānaṃ atibrahmā.
How is he the Tathāgata in the sense of overcoming? Having set the highest existence above and the Avīci hell below as the limits, across innumerable world systems, he overcomes all beings by virtue, by concentration, by wisdom, by liberation, and by the knowledge and vision of liberation. There is no equal or measure for him; he is unequaled, immeasurable, supreme, king of kings, deva of devas, supreme among Sakkas, supreme among Brahmās.
Làm thế nào mà Ngài là Tathāgata vì đã vượt trội? Ngài vượt trội hơn tất cả chúng sanh về giới, định, tuệ, giải thoát và giải thoát tri kiến, từ Bhavagga (đỉnh hữu) ở trên đến Avīci (địa ngục Vô gián) ở dưới, và ở các thế giới vô biên theo chiều ngang; không có ai sánh bằng hay đo lường được với Ngài; Ngài là vô song, vô lượng, vô thượng, vua của các vua, thiên của các thiên, Sakka (Đế Thích) của các Sakka, Brahma của các Brahma.
Tenāha – ‘‘sadevake, bhikkhave, loke…pe… sadevamanussāya pajāya tathāgato abhibhū anabhibhūto aññadatthudaso vasavattī, tasmā ‘tathāgato’ti vuccatī’’ti.
Therefore he said: “Bhikkhus, in the world with its devas… for the generation with its devas and humans, the Tathāgata is the overcomer, the unconquered, the all-seeing, the wielder of power. Therefore, he is called ‘Tathāgata’.”
Do đó, Ngài nói: “Này các Tỳ-khưu, trong thế gian này cùng với chư thiên… (cứ thế)… trong loài người cùng với chư thiên, Tathāgata là người vượt trội, không bị ai vượt trội, thấy biết tất cả, làm chủ mọi thứ, do đó, Ngài được gọi là ‘Tathāgata’.”
Tatrevaṃ padasiddhi veditabbā.
Therein, the formation of the term should be understood thus.
Ở đây, sự hình thành từ ngữ cần được hiểu như sau:
Agado viya agado.
Like a medicine, he is an agada (antidote).
Agado giống như agado.
Ko panesa?
What is this?
Vậy cái gì là điều này?
Desanāvilāsamayo ceva puññussayo ca.
It consists of the splendor of his teaching and the accumulation of his merit.
Đó là sự phong phú của giáo pháp và sự tích lũy công đức.
Tena hesa mahānubhāvo bhisakko dibbāgadena sappe viya sabbaparappavādino sadevakañca lokaṃ abhibhavati.
For he, this physician of great power, overcomes all holders of other views and the world with its devas with the divine antidote, just as one overcomes snakes.
Do đó, vị thầy thuốc vĩ đại này, với thần dược, đã vượt trội hơn tất cả các giáo phái khác và thế gian cùng với chư thiên, giống như người chữa rắn độc.
Iti sabbālokābhibhavane tatho aviparīto desanāvilāsamayo ceva puññussayo ca agado assāti.
Thus, in overcoming all the world, this is the true, uncorrupted medicine, which consists of the grace of the teaching and an abundance of merit.
Do đó, trong việc chế ngự tất cả các thế gian, Pháp thoại huy hoàng và công đức tích lũy của Ngài là một loại thuốc thần kỳ chân thật, không sai lệch.
Da-kārassa ta-kāraṃ katvā tathāgatoti veditabbo.
By changing the letter 'da' to the letter 'ta', it should be understood as tathāgata.
Bằng cách biến âm chữ ‘da’ thành ‘ta’, nên hiểu là Tathāgata.
Evaṃ abhibhavanaṭṭhena tathāgato.
Thus, by the meaning of 'overcoming', he is the Tathāgata.
Như vậy, theo nghĩa chế ngự, Ngài là Tathāgata.
‘‘Loko, bhikkhave, tathāgatena abhisambuddho, lokasmā tathāgato visaṃyutto.
"Bhikkhus, the world has been fully understood by the Tathāgata; the Tathāgata is disjoined from the world.
“Này các Tỳ-khưu, thế gian đã được Như Lai giác ngộ hoàn toàn; Như Lai đã thoát ly khỏi thế gian.
Lokasamudayo, bhikkhave, tathāgatena abhisambuddho, lokasamudayo tathāgatassa pahīno.
Bhikkhus, the origin of the world has been fully understood by the Tathāgata; the origin of the world has been abandoned by the Tathāgata.
Này các Tỳ-khưu, nguồn gốc của thế gian đã được Như Lai giác ngộ hoàn toàn; nguồn gốc của thế gian đã được Như Lai đoạn trừ.
Lokanirodho, bhikkhave, tathāgatena abhisambuddho, lokanirodho tathāgatassa sacchikato.
Bhikkhus, the cessation of the world has been fully understood by the Tathāgata; the cessation of the world has been realized by the Tathāgata.
Này các Tỳ-khưu, sự diệt tận của thế gian đã được Như Lai giác ngộ hoàn toàn; sự diệt tận của thế gian đã được Như Lai chứng ngộ.
Lokanirodhagāminī paṭipadā, bhikkhave, tathāgatena abhisambuddhā, lokanirodhagāminī paṭipadā tathāgatassa bhāvitā.
Bhikkhus, the path leading to the cessation of the world has been fully understood by the Tathāgata; the path leading to the cessation of the world has been developed by the Tathāgata.
Này các Tỳ-khưu, con đường dẫn đến sự diệt tận của thế gian đã được Như Lai giác ngộ hoàn toàn; con đường dẫn đến sự diệt tận của thế gian đã được Như Lai tu tập.
Yaṃ bhikkhave, sadevakassa lokassa…pe… sabbaṃ taṃ tathāgatena abhisambuddhaṃ.
Bhikkhus, whatever in the world with its devas... and so on... all that has been fully understood by the Tathāgata.
Này các Tỳ-khưu, bất cứ điều gì thuộc về thế gian có chư thiên…pe… tất cả những điều đó đã được Như Lai giác ngộ hoàn toàn.
Tasmā, tathāgatoti vuccatī’’ti (a. ni. 4.23).
Therefore, he is called the Tathāgata."
Vì vậy, Ngài được gọi là Như Lai.”
Iti imāsu pañcasu pucchāsu adiṭṭhassa tāva kassaci dhammassa abhāvato tathāgatassa adiṭṭhajotanā pucchā natthi.
Among these five questions, since there is no dhamma whatsoever that is unseen by the Tathāgata, there is no question to illuminate the unseen for him.
Như vậy, trong năm loại câu hỏi này, không có câu hỏi để làm sáng tỏ điều chưa biết đối với Như Lai, vì không có bất kỳ pháp nào chưa được Ngài thấy biết.
‘‘Idaṃ nāma aññehi paṇḍitehi samaṇabrāhmaṇehi saddhiṃ saṃsanditvā desessāmī’’ti samannāhārasseva anuppajjanato diṭṭhasaṃsandanā pucchāpi natthi.
Since the thought, "I will teach this after comparing it with other wise ascetics and brahmins," never arises, there is also no question to compare the seen.
Cũng không có câu hỏi để so sánh điều đã biết, vì ý nghĩ “Ta sẽ giảng giải điều này sau khi so sánh với các bậc hiền trí, các Sa-môn, Bà-la-môn khác” không hề khởi lên.
Yasmā pana buddhānaṃ ekadhammepi āsappanā parisappanā natthi, bodhimaṇḍeyeva sabbā kaṅkhā chinnā; tasmā vimaticchedanā pucchāpi natthiyeva.
And since for Buddhas there is no wavering or vacillation regarding even a single dhamma, as all doubt was cut off at the seat of Awakening itself, there is also no question to cut off uncertainty.
Vì chư Phật không có sự nghi ngờ hay do dự dù chỉ về một pháp, tất cả mọi nghi ngờ đều đã được đoạn trừ ngay tại Bồ-đề đạo tràng; do đó, câu hỏi để đoạn trừ nghi ngờ cũng không có.
Avasesā pana dve pucchā buddhānaṃ atthi, tāsu ayaṃ kathetukamyatā pucchā nāma.
However, the remaining two questions do exist for Buddhas. Among them, this is a question out of a desire to speak.
Tuy nhiên, hai loại câu hỏi còn lại thì có đối với chư Phật. Trong số đó, đây là câu hỏi để mong muốn giảng giải.
Tattha pāṇassa atipāto pāṇātipāto, pāṇavadho, pāṇaghātoti vuttaṃ hoti.
Therein, the destruction of a living being's life is pāṇātipāta; it means the slaying of a living being, the killing of a living being.
Trong đó, sự sát hại sinh mạng là pāṇātipāta, tức là giết hại sinh mạng, làm hại sinh mạng.
Pāṇoti cettha vohārato satto, paramatthato jīvitindriyaṃ, tasmiṃ pana pāṇe pāṇasaññino jīvitindriyupacchedakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā vadhakacetanā pāṇātipāto.
Here, a living being (pāṇo) conventionally means a creature; in the ultimate sense, it means the life-faculty. When there is perception of a living being as a living being, the murderous volition—arising from an effort that brings about the cutting off of the life-faculty and occurring through one of the two doors of body or speech—is pāṇātipāta.
Ở đây, sinh mạng (pāṇa) theo cách gọi thông thường là chúng sinh, theo nghĩa tối hậu là sinh mạng căn (jīvitindriya). Hành vi sát sinh (pāṇātipāta) là ý muốn giết hại khởi lên từ một trong hai cửa thân hoặc khẩu, nhằm mục đích cắt đứt sinh mạng căn của một chúng sinh mà người đó nhận thức là một chúng sinh.
So guṇavirahitesu tiracchānagatādīsu pāṇesu khuddake pāṇe appasāvajjo, mahāsarīre mahāsāvajjo, kasmā?
This is slightly blameworthy in the case of small beings, such as animals, which are devoid of special qualities, and very blameworthy in the case of large-bodied beings. Why?
Hành vi sát sinh đó, đối với các loài vật không có phẩm hạnh như súc sinh, nếu là sinh vật nhỏ thì tội nhẹ, nếu là sinh vật lớn thì tội nặng. Tại sao?
Payogamahantatāya.
Because of the greatness of the effort.
Vì hành động có mức độ lớn.
Payogasamattepi vatthumahantatāya.
Even if the effort is the same, it is due to the greatness of the object.
Ngay cả khi hành động có mức độ tương đương, thì cũng do đối tượng lớn.
Guṇavantesu manussādīsu appaguṇe pāṇe appasāvajjo, mahāguṇe mahāsāvajjo.
In the case of virtuous beings, such as humans, it is slightly blameworthy in the case of a being with few virtues and very blameworthy in the case of one with great virtues.
Đối với loài người có phẩm hạnh, nếu là người ít phẩm hạnh thì tội nhẹ, nếu là người có nhiều phẩm hạnh thì tội nặng.
Sarīraguṇānaṃ pana samabhāve sati kilesānaṃ upakkamānañca mudutāya appasāvajjo, tibbatāya mahāsāvajjoti veditabbo.
However, it should be understood that when the body and virtues are equal, it is slightly blameworthy if the defilements and effort are gentle, and very blameworthy if they are intense.
Tuy nhiên, khi phẩm chất thân thể và phẩm hạnh tương đương, thì tội nhẹ do phiền não và hành động yếu ớt, và tội nặng do phiền não và hành động mãnh liệt.
Tassa pañca sambhārā honti – pāṇo, pāṇasaññitā, vadhakacittaṃ, upakkamo, tena maraṇanti.
It has five constituents: a living being, the perception of it as a living being, a murderous thought, the effort, and its death as a result.
Hành vi sát sinh có năm yếu tố cấu thành: chúng sinh (pāṇa), nhận thức về chúng sinh (pāṇasaññitā), ý định giết hại (vadhakacittaṃ), hành động giết hại (upakkamo), và cái chết do hành động đó (tena maraṇaṃ).
Cha payogā – sāhatthiko, āṇattiko, nissaggiyo, thāvaro, vijjāmayo, iddhimayoti.
There are six kinds of effort: by one's own hand, by command, by releasing, by establishing a permanent trap, by magical incantation, and by psychic power.
Có sáu phương thức hành động: tự tay giết (sāhatthiko), sai khiến giết (āṇattiko), ném vật để giết (nissaggiyo), cố định vật để giết (thāvaro), dùng bùa chú để giết (vijjāmayo), và dùng thần thông để giết (iddhimayo).
Imasmiṃ panatthe vitthāriyamāne ativiya papañco hoti, tasmā taṃ na vitthārayāma, aññañca evarūpaṃ.
If this matter were to be elaborated, it would become very diffuse; therefore, we will not elaborate on it, nor on other similar matters.
Nếu mở rộng ý nghĩa này thì sẽ rất dài dòng, do đó chúng ta sẽ không giải thích chi tiết, cũng như những trường hợp tương tự khác.
Atthikehi pana samantapāsādikaṃ vinayaṭṭhakathaṃ oloketvā gahetabbaṃ.
Those who are interested should look it up and grasp it from the Samantapāsādikā, the commentary on the Vinaya.
Những ai quan tâm có thể tham khảo từ chú giải Vinaya tên là Samantapāsādikā.
Nihitadaṇḍo nihitasatthoti parūpaghātatthāya daṇḍaṃ vā satthaṃ vā ādāya avattanato nikkhittadaṇḍo ceva nikkhittasattho cāti attho.
He has laid down the rod, laid down the weapon: Because he does not act with a rod or a weapon for the purpose of harming others, he has put down the rod and put down the weapon—this is the meaning.
Nihitadaṇḍo nihitasattho có nghĩa là đã đặt xuống gậy và vũ khí, tức là không dùng gậy hay vũ khí để làm hại người khác.
Ettha ca ṭhapetvā daṇḍaṃ sabbampi avasesaṃ upakaraṇaṃ sattānaṃ viheṭhanabhāvato satthanti veditabbaṃ.
Here, it should be known that, apart from a rod, any remaining instrument is a "weapon" (sattha) because it is a means of harassing beings.
Ở đây, cần hiểu rằng tất cả các dụng cụ còn lại, ngoại trừ gậy, đều được gọi là vũ khí nếu chúng có khả năng gây hại cho chúng sinh.
Yaṃ pana bhikkhū kattaradaṇḍaṃ vā dantakaṭṭhaṃ vā vāsiṃ pipphalikaṃ vā gahetvā vicaranti, na taṃ parūpaghātatthāya.
But when bhikkhus go about carrying a cutting-stick, a tooth-stick, an adze, or a small axe, it is not for the purpose of harming others.
Tuy nhiên, khi các Tỳ-khưu mang theo gậy cắt cỏ, tăm xỉa răng, dao hoặc cái đục, thì đó không phải là để làm hại người khác.
Tasmā nihitadaṇḍo nihitasattho tveva saṅkhyaṃ gacchati.
Therefore, he is reckoned only as one who has laid down the rod, one who has laid down the weapon.
Do đó, chỉ có người đã đặt gậy xuống, đã đặt vũ khí xuống mới được xem là như vậy.
Lajjīti pāpajigucchanalakkhaṇāya lajjāya samannāgato.
Conscientious: he is endowed with a sense of shame, which has the characteristic of despising evil.
Lajjī (tàm) có nghĩa là người có sự tàm quý, với đặc tính ghê tởm tội lỗi.
Dayāpannoti dayaṃ mettacittataṃ āpanno.
Compassionate: he has attained compassion, a mind of loving-kindness.
Dayāpanno (bi mẫn) có nghĩa là người đã đạt được lòng bi mẫn, tâm từ ái.
Sabbapāṇabhūtahitānukampīti; sabbe pāṇabhūte hitena anukampako.
Sympathetic for the welfare of all living beings: he is one who has sympathy for the welfare of all living beings.
Sabbapāṇabhūtahitānukampī (thương xót vì lợi ích của tất cả chúng sinh hữu tình) có nghĩa là người thương xót tất cả chúng sinh hữu tình vì lợi ích của họ.
Tāya dayāpannatāya sabbesaṃ pāṇabhūtānaṃ hitacittakoti attho.
The meaning is that, because he has attained that compassion, his mind is intent on the welfare of all living beings.
Nghĩa là, do lòng bi mẫn đó, vị ấy có tâm mong cầu lợi ích cho tất cả chúng sinh hữu tình.
Viharatīti iriyati yapeti yāpeti pāleti.
Dwells: he maintains his posture, he sustains himself, he carries on, he preserves.
Viharatī (an trú) có nghĩa là sống, duy trì, tiếp tục tồn tại.
Iti vā hi, bhikkhaveti evaṃ vā bhikkhave.
Or again, monks: or in this way, monks.
Iti vā hi, bhikkhave (này các Tỳ-khưu, hoặc là như vậy) —
Vā saddo upari ‘‘adinnādānaṃ pahāyā’’tiādīni apekkhitvā vikappattho vutto, evaṃ sabbattha purimaṃ vā pacchimaṃ vā apekkhitvā vikappabhāvo veditabbo.
The word 'or' is spoken with an alternative meaning in anticipation of the following phrases, such as "having abandoned taking what is not given." Thus, in every case, the alternative sense should be understood in relation to what comes before or after.
Từ vā ở đây được nói với nghĩa lựa chọn, liên quan đến các điều như “từ bỏ sự lấy của không cho” (adinnādānaṃ pahāya) ở trên; tương tự, ở mọi nơi, ý nghĩa lựa chọn nên được hiểu bằng cách liên hệ với điều trước hoặc điều sau.
Ayaṃ panettha saṅkhepo – bhikkhave, puthujjano tathāgatassa vaṇṇaṃ vadamāno evaṃ vadeyya – ‘‘samaṇo gotamo pāṇaṃ na hanati, na ghāteti, na tattha samanuñño hoti, virato imasmā dussīlyā; aho, vata re buddhaguṇā mahantā’’ti, iti mahantaṃ ussāhaṃ katvā vaṇṇaṃ vattukāmopi appamattakaṃ oramattakaṃ ācārasīlamattakameva vakkhati.
Herein, this is the summary: monks, a worldling, when speaking in praise of the Tathāgata, would speak thus: "The ascetic Gotama does not kill living beings, does not cause them to be killed, and does not approve of it; he is abstinent from this immorality. Ah, indeed, the virtues of the Buddha are great!" In this way, even if he wishes to speak praise with great effort, he will speak only of the small and inferior matter of conduct-based virtue.
Đây là tóm tắt về vấn đề này: Này các Tỳ-khưu, một phàm nhân khi tán thán Thế Tôn có thể nói như sau: “Sa-môn Gotama không sát sinh, không khiến người khác sát sinh, không hoan hỷ trong việc đó, đã từ bỏ sự ác hạnh này; ôi, thật vĩ đại thay những đức tính của bậc Phật!” Dù rất cố gắng để tán thán, vị ấy cũng chỉ có thể nói về một chút, một phần nhỏ của giới hạnh và hành vi đạo đức.
Upari asādhāraṇabhāvaṃ nissāya vaṇṇaṃ vattuṃ na sakkhissati.
He will not be able to speak praise based on the higher, uncommon qualities.
Vị ấy sẽ không thể tán thán những phẩm chất phi thường ở cấp độ cao hơn.
Na kevalañca puthujjanova sotāpannasakadāgāmianāgāmiarahantopi paccekabuddhāpi na sakkontiyeva; tathāgatoyeva pana sakkoti, taṃ vo upari vakkhāmīti, ayamettha sādhippāyā atthavaṇṇanā.
And it is not only a worldling who is unable; even stream-enterers, once-returners, non-returners, arahants, and paccekabuddhas are unable. Only the Tathāgata himself is able. I will explain this to you further on. This is the meaningful explanation here.
Không chỉ phàm nhân, mà cả các bậc Dự Lưu, Nhất Lai, Bất Hoàn, A-la-hán và cả các vị Độc Giác Phật cũng không thể làm được; chỉ có Thế Tôn mới có thể, điều mà ta sẽ nói với các con ở phần trên – đây là lời giải thích ý nghĩa có chủ đích ở đây.
Ito paraṃ pana apubbapadameva vaṇṇayissāma.
From here on, we will explain only the new terms.
Từ đây trở đi, chúng ta sẽ chỉ giải thích những từ chưa được giải thích trước đó.
Adinnādānaṃ pahāyāti ettha adinnassa ādānaṃ adinnādānaṃ, parasaṃharaṇaṃ, theyyaṃ, corikāti vuttaṃ hoti.
Having abandoned taking what is not given: here, the taking of what is not given is adinnādāna. This is called carrying away what belongs to another, theft, or larceny.
Trong cụm từ Adinnādānaṃ pahāya (từ bỏ sự lấy của không cho), adinnādāna (lấy của không cho) có nghĩa là lấy của người khác, trộm cắp, hành vi trộm cắp.
Tattha adinnanti parapariggahitaṃ, yattha paro yathākāmakāritaṃ āpajjanto adaṇḍāraho anupavajjo ca hoti.
Therein, what is not given is what is possessed by another, regarding which the owner, in acting as he pleases, is not liable to punishment and is blameless.
Trong đó, adinna (của không cho) là vật thuộc sở hữu của người khác, mà đối với vật đó, người chủ có quyền tùy ý sử dụng mà không bị phạt hay bị khiển trách.
Tasmiṃ parapariggahite parapariggahitasaññino, tadādāyakaupakkamasamuṭṭhāpikā theyyacetanā adinnādānaṃ.
Regarding that which is possessed by another, the thievish intention—of one who perceives it as possessed by another and which gives rise to the effort of taking it—is adinnādāna.
Adinnādāna là ý muốn trộm cắp, phát sinh từ hành vi chiếm đoạt vật thuộc sở hữu của người khác, khi người đó nhận thức rằng đó là vật thuộc sở hữu của người khác.
Taṃ hīne parasantake appasāvajjaṃ, paṇīte mahāsāvajjaṃ, kasmā?
It is a minor offense with regard to another's inferior property, and a grave offense with regard to superior property. Why?
Hành vi này ít tội lỗi nếu vật thuộc sở hữu của người khác là thấp kém, và rất tội lỗi nếu vật đó là cao quý, tại sao?
Vatthupaṇītatāya.
Because of the superiority of the object.
Vì sự cao quý của vật.
Vatthusamatte sati guṇādhikānaṃ santake vatthusmiṃ mahāsāvajjaṃ.
When the objects are equal, it is a grave offense regarding property belonging to those of superior virtue.
Khi các vật có giá trị tương đương, hành vi này rất tội lỗi nếu vật đó thuộc về những người có phẩm hạnh cao hơn.
Taṃ taṃ guṇādhikaṃ upādāya tato tato hīnaguṇassa santake vatthusmiṃ appasāvajjaṃ.
Depending on that person of superior virtue, it is a minor offense regarding property belonging to a person of inferior virtue.
Tùy thuộc vào phẩm hạnh cao hơn đó, hành vi này ít tội lỗi hơn nếu vật đó thuộc về người có phẩm hạnh thấp hơn.
Tassa pañca sambhārā honti – parapariggahitaṃ, parapariggahitasaññitā, theyyacittaṃ, upakkamo, tena haraṇanti.
It has five constituents: property possessed by another, perception that it is possessed by another, a thievish mind, effort, and the taking of it through that effort.
Có năm yếu tố cấu thành của hành vi này: vật thuộc sở hữu của người khác, nhận thức rằng đó là vật thuộc sở hữu của người khác, ý muốn trộm cắp, hành vi trộm cắp, và việc lấy đi vật đó.
Cha payogā – sāhatthikādayova.
There are six modes of application, namely, sāhatthika and so on.
Có sáu phương pháp: chỉ là tự tay thực hiện, v.v.
Te ca kho yathānurūpaṃ theyyāvahāro, pasayhāvahāro, paṭicchannāvahāro, parikappāvahāro, kusāvahāroti imesaṃ avahārānaṃ vasena pavattā, ayamettha saṅkhepo.
And these occur, as is appropriate, by way of these types of taking: taking by stealth, taking by force, taking what is concealed, taking by stratagem, and taking by means of a lot.
Và chúng được thực hiện theo các loại trộm cắp tương ứng như: trộm cắp bằng cách giấu giếm, trộm cắp bằng vũ lực, trộm cắp bằng cách che đậy, trộm cắp bằng mưu mẹo, trộm cắp bằng cách đánh tráo (thẻ bài) – đây là tóm tắt về vấn đề này.
Vitthāro pana samantapāsādikāyaṃ vutto.
A detailed account is given in the Samantapāsādikā.
Phần mở rộng đã được trình bày trong Samantapāsādikā.
Dinnameva ādiyatīti dinnādāyī. Cittenapi dinnameva paṭikaṅkhatīti dinnapāṭikaṅkhī. Thenetīti theno.
He takes only what is given, thus he is a taker of what is given. He expects only what is given even in his mind, thus he is one who waits for what is given. One who steals is a thief.
Dinnādāyī (chỉ lấy những gì được cho) có nghĩa là chỉ nhận những gì đã được cho. Dinnapāṭikaṅkhī (chỉ mong cầu những gì được cho) có nghĩa là ngay cả trong tâm cũng chỉ mong cầu những gì đã được cho. Theneti (trộm cắp) có nghĩa là kẻ trộm.
Na thenena athenena. Athenattāyeva sucibhūtena.
Not by a thief, thus not by thievishness. Because of not being a thief, he is pure.
Athenena (không phải kẻ trộm) có nghĩa là không phải kẻ trộm. Chính vì không phải kẻ trộm mà sucibhūtena (trong sạch).
Attanāti attabhāvena.
With himself: means with his own being.
Attanā (tự thân) có nghĩa là với thân này.
Athenaṃ sucibhūtaṃ attānaṃ katvā viharatīti vuttaṃ hoti.
It is said that he dwells having made himself not thievish and pure.
Nghĩa là, vị ấy sống bằng cách giữ cho thân mình không trộm cắp và trong sạch.
Sesaṃ paṭhamasikkhāpade vuttanayeneva yojetabbaṃ.
The rest should be connected in the same way as was explained in the first training rule.
Phần còn lại nên được liên kết theo cách đã nói trong giới thứ nhất.
Yathā ca idha, evaṃ sabbattha.
And as it is here, so it is everywhere else.
Và như ở đây, cũng vậy ở mọi nơi.
Aparo nayo, ‘musā’ti abhūtaṃ atacchaṃ vatthu.
Another method: falsehood is a non-existent, untrue matter.
Một cách khác, ‘musā’ (dối trá) là một sự việc không có thật, không đúng sự thật.
‘Vādo’ti tassa bhūtato tacchato viññāpanaṃ.
Speech is making that known as if it were existent and true.
‘Vādo’ (lời nói) là việc làm cho người khác biết sự việc đó là có thật, là đúng sự thật.
Lakkhaṇato pana atathaṃ vatthuṃ tathato paraṃ viññāpetukāmassa tathāviññattisamuṭṭhāpikā cetanā musāvādo.
By its characteristic, however, the volition of one who desires to make another know an untrue matter as true, which gives rise to that communication, is false speech.
Tuy nhiên, theo định nghĩa, musāvāda là ý muốn phát sinh sự thông báo như vậy, của người muốn làm cho người khác biết một sự việc không đúng sự thật là có thật.
So yamatthaṃ bhañjati, tassa appatāya appasāvajjo, mahantatāya mahāsāvajjo.
In accordance with the welfare it destroys, it is a minor offense if the welfare is small, and a grave offense if it is great.
Lời nói dối đó ít tội lỗi nếu nó phá hoại một lợi ích nhỏ, và rất tội lỗi nếu nó phá hoại một lợi ích lớn.
Tassa cattāro sambhārā honti – atathaṃ vatthu, visaṃvādanacittaṃ, tajjo vāyāmo, parassa tadatthavijānananti.
It has four constituents: an untrue matter, a mind set on deceiving, the corresponding effort, and another's understanding of that meaning.
Có bốn yếu tố cấu thành của hành vi này: sự việc không đúng sự thật, ý muốn lừa dối, nỗ lực tương ứng, và việc người khác hiểu được ý nghĩa đó.
Eko payogo sāhatthikova.
There is one mode of application: the personal one (sāhatthika).
Chỉ có một phương pháp: tự tay thực hiện.
So kāyena vā kāyapaṭibaddhena vā vācāya vā paravisaṃvādanakiriyākaraṇena daṭṭhabbo.
It should be understood as the act of deceiving another through the body, something connected to the body, or speech.
Và điều đó nên được hiểu là việc lừa dối người khác bằng thân, bằng vật liên quan đến thân, hoặc bằng lời nói.
Tāya ce kiriyāya paro tamatthaṃ jānāti, ayaṃ kiriyasamuṭṭhāpikacetanākkhaṇeyeva musāvādakammunā bajjhati.
If, by that action, the other person understands that meaning, then this person is bound by the kamma of false speech at the very moment of the volition that gave rise to the action.
Nếu người khác hiểu được ý nghĩa đó thông qua hành động đó, người này bị ràng buộc bởi nghiệp nói dối ngay tại khoảnh khắc ý muốn phát sinh hành động đó.
Yasmā pana yathā kāyakāyapaṭibaddhavācāhi paraṃ visaṃvādeti, tathā ‘‘idamassa bhaṇāhī’’ti āṇāpentopi paṇṇaṃ likhitvā purato nissajjantopi, ‘‘ayamattho evaṃ daṭṭhabbo’’ti kuḍḍādīsu likhitvā ṭhapentopi.
However, just as one deceives another by body, things connected to the body, and speech, so too does one who gives an order, saying, "Tell him this," or who writes a letter and places it before another, or who writes on a wall, "This matter is to be understood thus," and leaves it there.
Tuy nhiên, vì một người có thể lừa dối người khác bằng thân, bằng vật liên quan đến thân, bằng lời nói, cũng như bằng cách ra lệnh “hãy nói điều này cho người đó”, hoặc bằng cách viết thư và đặt trước mặt, hoặc bằng cách viết và đặt trên tường, v.v., rằng “ý nghĩa này nên được hiểu như thế này” –
Tasmā ettha āṇattikanissaggiyathāvarāpi payogā yujjanti, aṭṭhakathāsu pana anāgatattā vīmaṃsitvā gahetabbā.
Therefore, the modes of application by command, by relinquishment, and by permanent fixture are also appropriate here. However, as they are not found in the commentaries, they should be accepted after careful examination.
Do đó, ở đây, các phương pháp như āṇattika (ra lệnh), nissaggiya (từ bỏ), thāvara (ổn định) cũng phù hợp, nhưng vì chúng không được đề cập trong các chú giải, nên cần phải xem xét và chấp nhận.
Saccaṃ vadatīti saccavādī. Saccena saccaṃ sandahati ghaṭetīti saccasandho. Na antarantarā musā vadatīti attho.
He speaks the truth, thus he is a truth-speaker. He joins truth with truth, he connects them, thus he is one who joins with truth. The meaning is that he does not lie in between.
Saccavādī (người nói sự thật) có nghĩa là người nói sự thật. Saccasandho (người gắn kết sự thật) có nghĩa là người gắn kết sự thật với sự thật. Nghĩa là, vị ấy không nói dối xen kẽ.
Yo hi puriso kadāci musā vadati, kadāci saccaṃ, tassa musāvādena antaritattā saccaṃ saccena na ghaṭīyati; tasmā so na saccasandho.
Indeed, for a person who sometimes lies and sometimes speaks the truth, his truth is not connected with truth, being interrupted by falsehood; therefore, he is not one who joins with truth.
Vì một người nào đó đôi khi nói dối, đôi khi nói sự thật, thì sự thật của người đó không gắn kết với sự thật vì bị lời nói dối xen vào; do đó, người đó không phải là saccasandho.
Ayaṃ pana na tādiso, jīvitahetupi musā avatvā saccena saccaṃ sandahati yevāti saccasandho.
But this one is not like that; not telling a lie even for the sake of his life, he joins truth with truth, and so he is one who joins with truth.
Nhưng vị này không như vậy, ngay cả vì mạng sống cũng không nói dối, mà luôn gắn kết sự thật với sự thật, nên được gọi là saccasandho.
Paccayikoti pattiyāyitabbako, saddhāyitabbakoti attho.
Trustworthy: means one who can be believed, one who can be trusted.
Paccayiko (đáng tin cậy) có nghĩa là người đáng tin cậy, đáng tin tưởng.
Ekacco hi puggalo na paccayiko hoti, ‘‘idaṃ kena vuttaṃ, asukenā’’ti vutte ‘‘mā tassa vacanaṃ saddahathā’’ti vattabbataṃ āpajjati.
Indeed, a certain person is not trustworthy; when it is said, "Who said this? So-and-so," he becomes one of whom it should be said, "Do not believe his words."
Một số người không đáng tin cậy, khi được hỏi “điều này ai nói?”, và trả lời “người kia”, thì người ta sẽ nói “đừng tin lời người đó”.
Eko paccayiko hoti, ‘‘idaṃ kena vuttaṃ, asukenā’’ti vutte ‘‘yadi tena vuttaṃ, idameva pamāṇaṃ, idāni upaparikkhitabbaṃ natthi, evameva ida’’nti vattabbataṃ āpajjati, ayaṃ vuccati paccayiko.
One person is trustworthy (paccayiko). When asked, "Who said this?" and it is answered, "So-and-so," he becomes one who should be told, "If it was said by him, this itself is the standard. There is nothing to investigate now. This is exactly so." This person is called trustworthy (paccayiko).
Một người đáng tin cậy là người mà khi được hỏi, "Điều này ai nói?", và được trả lời, "Người kia nói", thì người đó nói rằng, "Nếu người kia đã nói, thì đây chính là chuẩn mực, không cần phải xem xét thêm nữa, sự việc là như vậy." Người như vậy được gọi là paccayiko (đáng tin cậy).
Avisaṃvādako lokassāti tāya saccavāditāya lokaṃ na visaṃvādetīti attho.
Not deceptive to the world means he does not deceive the world because of that truthfulness.
Không lừa dối thế gian có nghĩa là, do sự nói lời chân thật ấy, người đó không lừa dối thế gian.
Bhinnānaṃ vā sandhātāti dvinnaṃ mittānaṃ vā samānupajjhāyakādīnaṃ vā kenacideva kāraṇena bhinnānaṃ ekamekaṃ upasaṅkamitvā ‘‘tumhākaṃ īdise kule jātānaṃ evaṃ bahussutānaṃ idaṃ na yutta’’ntiādīni vatvā sandhānaṃ kattā anukattā.
Or a reconciler of those who are divided: One who, by approaching each of two friends or those with the same preceptor who have been divided by some cause and saying things like, "This is not proper for you who are born in such a family and are so learned," becomes a creator and facilitator of reconciliation.
Hoặc là người hòa giải những người đã chia rẽ có nghĩa là người đi đến từng người trong hai người bạn hoặc những người cùng thầy, v.v., đã chia rẽ vì một lý do nào đó, và nói những lời như "điều này không phù hợp với những người sinh ra trong gia đình như các bạn, những người có nhiều học vấn như vậy", rồi làm cho họ hòa giải, là người khuyến khích hòa giải.
Anuppadātāti sandhānānuppadātā.
A promoter: a promoter of reconciliation.
Anuppadātā có nghĩa là người khuyến khích hòa giải.
Dve jane samagge disvā – ‘‘tumhākaṃ evarūpe kule jātānaṃ evarūpehi guṇehi samannāgatānaṃ anucchavikameta’’ntiādīni vatvā daḷhīkammaṃ kattāti attho.
The meaning is that, upon seeing two people in harmony, one strengthens their bond by saying such things as, "This is fitting for you, who are born in such a family and endowed with such virtues."
Nghĩa là, khi thấy hai người hòa hợp, người ấy nói những lời như "điều này phù hợp với các bạn, những người sinh ra trong gia đình như vậy, có những đức tính như vậy", và làm cho sự hòa hợp đó vững chắc.
Samaggo ārāmo assāti samaggārāmo. Yattha samaggā natthi, tattha vasitumpi na icchatīti attho.
One who delights in harmony is samaggārāmo. The meaning is that where there are no harmonious people, he does not wish even to dwell.
Samaggārāmo có nghĩa là nơi trú ngụ của sự hòa hợp. Nghĩa là, nơi nào không có sự hòa hợp, người ấy cũng không muốn ở.
Samaggarāmotipi pāḷi, ayamevettha attho.
The reading is also samaggarāmo; this is the very same meaning here.
Pāḷi cũng có Samaggarāmo, nghĩa ở đây cũng vậy.
Samaggaratoti samaggesu rato, te pahāya aññattha gantumpi na icchatīti attho.
Delighting in harmony means he delights in those who are harmonious; he does not wish to leave them and go elsewhere.
Samaggarato có nghĩa là hoan hỷ với những người hòa hợp, nghĩa là người ấy không muốn rời bỏ họ để đi nơi khác.
Samagge disvāpi sutvāpi nandatīti samagganandī, samaggakaraṇiṃ vācaṃ bhāsitāti yā vācā satte samaggeyeva karoti, taṃ sāmaggiguṇaparidīpikameva vācaṃ bhāsati, na itaranti.
He rejoices upon seeing or hearing of the harmonious, thus he is samagganandī; one who speaks words that create harmony means he speaks only that speech which makes beings harmonious, which illuminates the quality of concord, and no other.
Samagganandī có nghĩa là hoan hỷ khi thấy hoặc nghe về những người hòa hợp, nói lời làm cho hòa hợp có nghĩa là người ấy nói lời chỉ làm cho chúng sinh hòa hợp, lời chỉ làm nổi bật đức tính hòa hợp, chứ không nói lời khác.
Parassa mammacchedakakāyavacīpayogasamuṭṭhāpikā ekantapharusacetanā pharusāvācā.
The completely harsh volition (cetanā) that originates bodily and verbal effort that cuts to the quick of another is harsh speech.
Lời nói thô ác (pharusāvācā) là ý chí thô ác tuyệt đối, phát sinh từ hành động thân và khẩu gây tổn thương sâu sắc cho người khác.
Tassā āvibhāvatthamidaṃ vatthu – eko kira dārako mātuvacanaṃ anādiyitvā araññaṃ gacchati, taṃ mātā nivattetumasakkontī – ‘‘caṇḍā taṃ mahiṃsī anubandhatū’’ti akkosi.
To illustrate this, there is this story: A certain boy, not heeding his mother's word, goes to the forest. His mother, unable to make him return, cursed him, saying, "May a fierce buffalo chase you."
Để làm rõ điều này, có một câu chuyện: Một cậu bé nọ không vâng lời mẹ mà đi vào rừng. Người mẹ không thể ngăn cản được cậu, bèn nguyền rủa: "Mong cho con bị một con trâu cái hung dữ đuổi theo!"
Athassa tatheva araññe mahiṃsī uṭṭhāsi.
Then, just so, a buffalo rose up against him in the forest.
Thế rồi, một con trâu cái xuất hiện trong rừng đúng như lời mẹ cậu đã nguyền rủa.
Dārako ‘‘yaṃ mama mātā mukhena kathesi, taṃ mā hotu, yaṃ cittena cintesi taṃ hotū’’ti, saccakiriyamakāsi.
The boy made an act of truth, saying, "What my mother spoke with her mouth, let that not be; what she thought with her mind, let that be."
Cậu bé lập lời chân thật rằng: "Mong cho lời mẹ con nói bằng miệng đừng thành hiện thực, mong cho ý mẹ con nghĩ trong lòng được thành hiện thực!"
Mahiṃsī tattheva baddhā viya aṭṭhāsi.
The buffalo stood right there as if bound.
Con trâu cái liền đứng yên như bị trói.
Evaṃ mammacchedakopi payogo cittasaṇhatāya na pharusā vācā hoti.
Thus, even an effort that cuts to the quick is not harsh speech if the mind is gentle.
Như vậy, ngay cả một hành động gây tổn thương sâu sắc cũng không phải là lời nói thô ác nếu tâm ý dịu dàng.
Mātāpitaro hi kadāci puttake evaṃ vadanti – ‘‘corā vo khaṇḍākhaṇḍaṃ karontū’’ti, uppalapattampi ca nesaṃ upari patantaṃ na icchanti.
Indeed, parents sometimes say to their children, "May thieves cut you to pieces," but they do not wish even a lotus petal to fall upon them.
Cha mẹ đôi khi nói với con cái rằng: "Mong cho bọn cướp chặt các con thành từng mảnh!", nhưng họ không muốn ngay cả một chiếc lá sen rơi trên người con.
Ācariyupajjhāyā ca kadāci nissitake evaṃ vadanti – ‘‘kiṃ ime ahirīkā anottappino caranti, niddhamatha ne’’ti, atha ca nesaṃ āgamādhigamasampattiṃ icchanti.
And teachers and preceptors sometimes say this to their dependents: "Why do these shameless and reckless ones wander about? Expel them!" yet they desire their accomplishment in learning and realization.
Các vị thầy và thầy tế lễ đôi khi nói với các đệ tử của mình: "Tại sao những người vô liêm sỉ, không hổ thẹn này lại đi lang thang? Hãy đuổi chúng đi!", nhưng họ lại mong muốn sự thành tựu về học vấn và chứng đắc cho các đệ tử.
Yathā ca cittasaṇhatāya pharusā vācā na hoti, evaṃ vacanasaṇhatāya apharusā vācā na hoti.
And just as it is not harsh speech due to the gentleness of the mind, so it is not non-harsh speech due to the gentleness of the words.
Cũng như lời nói thô ác không phải là thô ác do tâm ý dịu dàng, thì lời nói không thô ác cũng không phải là không thô ác do lời nói dịu dàng.
Na hi mārāpetukāmassa – ‘‘imaṃ sukhaṃ sayāpethā’’ti vacanaṃ apharusā vācā hoti, cittapharusatāya panesā pharusā vācāva.
Indeed, for one who wishes to have someone killed, the words, "Let this person sleep comfortably," do not constitute non-harsh speech; rather, because of the harshness of the mind, this is harsh speech indeed.
Lời nói của người muốn giết người khác rằng "Hãy cho người này ngủ yên vui" không phải là lời nói không thô ác; do tâm ý thô ác, đó vẫn là lời nói thô ác.
Sā yaṃ sandhāya pavattitā, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
It is of little fault if the person toward whom it is directed is of little virtue, and of great fault if he is of great virtue.
Lời nói ấy được phát ra nhằm vào ai, thì nếu người đó có ít đức hạnh thì tội lỗi ít, nếu có nhiều đức hạnh thì tội lỗi lớn.
Tassā tayo sambhārā – akkositabbo paro, kupitacittaṃ, akkosanāti.
Its three components are: another person to be reviled, an angry mind, and the reviling.
Có ba yếu tố cấu thành của lời nói thô ác: người bị mắng chửi (paro akkositabbo); tâm sân hận (kupitacittaṃ); và hành động mắng chửi (akkosanā).
Nelāti elaṃ vuccati doso, nāssā elanti nelā, niddosāti attho.
Faultless (nelā): Ela is said to be a fault; for this speech, there is no ela, thus it is nelā, meaning faultless.
Nelā có nghĩa là không có lỗi (niddosā), vì "ela" có nghĩa là lỗi, và "nāssā elaṃ" có nghĩa là không có lỗi.
‘‘Nelaṅgo setapacchādo’’ti, (udā. 65) ettha vuttanelaṃ viya.
It is like the word nela spoken in the passage, "nelaṅgo setapacchādo".
Giống như "nela" được nói đến trong câu "Nelaṅgo setapacchādo".
Kaṇṇasukhāti byañjanamadhuratāya kaṇṇānaṃ sukhā, sūcivijjhanaṃ viya kaṇṇasūlaṃ na janeti.
Pleasing to the ear: It is pleasant to the ears due to the sweetness of its phrasing; it does not cause ear-pain like the piercing of a needle.
Kaṇṇasukhā có nghĩa là êm tai do sự ngọt ngào của âm điệu, không gây đau tai như kim châm.
Atthamadhuratāya sakalasarīre kopaṃ ajanetvā pemaṃ janetīti pemanīyā. Hadayaṃ gacchati, appaṭihaññamānā sukhena cittaṃ pavisatīti hadayaṅgamā. Guṇaparipuṇṇatāya pure bhavāti porī pure saṃvaḍḍhanārī viya sukumārātipi porī. Purassa esātipi porī. Nagaravāsīnaṃ kathāti attho.
Because of the sweetness of its meaning, it generates affection throughout the entire body instead of generating anger, thus it is endearing (pemanīyā). It goes to the heart, it enters the mind easily without being obstructed, thus it is heart-touching (hadayaṅgamā). Because of being complete in virtues, it is excellent in the city, thus it is urbane (porī); like a well-bred woman in the city, it is very refined, thus it is urbane (porī). It is of the city, thus it is urbane (porī). The meaning is, it is the speech of city-dwellers.
Pemanīyā có nghĩa là dễ thương, vì sự ngọt ngào của ý nghĩa, nó không gây ra sự giận dữ mà tạo ra tình yêu thương trong toàn bộ cơ thể. Hadayaṅgamā có nghĩa là đi vào lòng, vì nó dễ dàng đi vào tâm mà không bị cản trở. Porī có nghĩa là cổ xưa (pure bhavā) do sự đầy đủ của các đức tính; hoặc porī cũng có nghĩa là mềm mại như một người phụ nữ được nuôi dưỡng trong thành phố; hoặc porī cũng có nghĩa là của thành phố (purassa esā), tức là lời nói của những người sống trong thành phố.
Nagaravāsino hi yuttakathā honti.
City-dwellers indeed have proper speech.
Thật vậy, những người sống trong thành phố thường có lời nói hợp lý.
Pitimattaṃ pitāti vadanti, bhātimattaṃ bhātāti vadanti, mātimattaṃ mātāti vadanti.
They call someone the age of a father, "father"; someone the age of a brother, "brother"; someone the age of a mother, "mother."
Họ gọi người ngang hàng với cha là cha, người ngang hàng với anh là anh, người ngang hàng với mẹ là mẹ.
Evarūpī kathā bahuno janassa kantā hotīti bahujanakantā. Kantabhāveneva bahuno janassa manāpā cittavuḍḍhikarāti bahujanamanāpā.
Speech of this kind is dear to many people, thus it is dear to many people (bahujanakantā). By its very dearness, it is pleasing to many people and brings growth to the mind, thus it is pleasing to many people (bahujanamanāpā).
Lời nói như vậy được nhiều người yêu thích (kantā), nên được gọi là bahujanakantā. Do được yêu thích, nó làm cho nhiều người hài lòng, làm tăng trưởng tâm ý (cittavuḍḍhikarā), nên được gọi là bahujanamanāpā.
Nidhānaṃ vuccati ṭhapanokāso, nidhānamassā atthīti nidhānavatī. Hadaye nidhātabbayuttakaṃ vācaṃ bhāsitāti attho.
A treasure means a place for storing; her speech has a treasure, thus it is containing a treasure (nidhānavatī). The meaning is that he speaks words that are worthy of being treasured in the heart.
Nidhāna có nghĩa là nơi cất giữ; nidhānavatī có nghĩa là có nơi cất giữ. Nghĩa là, người nói lời đáng được cất giữ trong lòng.
Kālenāti evarūpiṃ bhāsamānopi ca – ‘‘ahaṃ nidhānavatiṃ vācaṃ bhāsissāmī’’ti na akālena bhāsati, yuttakālaṃ pana apekkhitvāva bhāsatīti attho.
At the right time: And even when speaking such speech, he does not speak at an improper time thinking, "I will speak words containing a treasure," but rather he speaks only after considering the proper time. This is the meaning.
Kālenā có nghĩa là ngay cả khi nói những lời như vậy, người ấy không nói "Tôi sẽ nói lời đáng cất giữ" một cách không đúng lúc, mà chỉ nói khi đã cân nhắc thời điểm thích hợp.
Sāpadesanti saupamaṃ, sakāraṇanti attho.
With a reason (sāpadesa): with a simile, with a cause. This is the meaning.
Sāpadesaṃ có nghĩa là có ví dụ, có lý do.
Pariyantavatinti paricchedaṃ dassetvā yathāssā paricchedo paññāyati, evaṃ bhāsatīti attho.
With a limit (pariyantavati): By showing the limit, he speaks in such a way that its boundary is understood. This is the meaning.
Pariyantavatiṃ có nghĩa là nói lời có giới hạn, để giới hạn của lời nói được hiểu rõ.
Atthasaṃhitanti anekehipi nayehi vibhajantena pariyādātuṃ asakkuṇeyyatāya atthasampannaṃ bhāsati.
Connected with the goal (atthasaṃhita): He speaks what is endowed with meaning, which cannot be fully grasped even by analyzing it in many ways.
Atthasaṃhitaṃ có nghĩa là nói lời đầy đủ ý nghĩa, đến mức không thể phân tích hết bằng nhiều cách.
Yaṃ vā so atthavādī atthaṃ vadati, tena atthena sahitattā atthasaṃhitaṃ vācaṃ bhāsati, na aññaṃ nikkhipitvā aññaṃ bhāsatīti vuttaṃ hoti.
Or, it means that whatever benefit that speaker on benefits speaks of, he speaks speech connected with that benefit because it is accompanied by that benefit; he does not set aside one thing and speak of another.
Hoặc, điều lợi ích mà vị thuyết pháp về lợi ích ấy nói ra, vì lời nói ấy phù hợp với điều lợi ích đó, nên Ngài nói lời có liên hệ đến lợi ích, không phải bỏ điều này mà nói điều khác, là ý đã được nói đến.
Mālādīsu mālāti yaṃ kiñci pupphaṃ.
Among garlands and so on, garland means any kind of flower.
Trong các loại trang sức như vòng hoa, v.v., mālā (vòng hoa) là bất cứ loại hoa nào.
Gandhanti yaṃ kiñci gandhajātaṃ.
Scent means any kind of fragrant substance.
Gandha (hương) là bất cứ loại hương liệu nào.
Vilepananti chavirāgakaraṇaṃ.
Ointment means that which beautifies the complexion.
Vilepana (xoa thoa) là việc làm cho da có màu sắc.
Tattha piḷandhanto dhāreti nāma, ūnaṭṭhānaṃ pūrento maṇḍeti nāma, gandhavasena chavirāgavasena ca sādiyanto vibhūseti nāma.
In this context, one who wears them is said to ‘bear’ them; one who fills a deficient spot is said to ‘adorn’ them; one who delights in them through scent and beautifying the complexion is said to ‘embellish’ them.
Trong đó, người đeo trang sức được gọi là dhāreti (đeo), người lấp đầy chỗ trống được gọi là maṇḍeti (trang điểm), và người thích thú với hương thơm và màu sắc của da được gọi là vibhūseti (làm đẹp).
Ṭhānaṃ vuccati kāraṇaṃ.
Occasion is said to mean the cause.
Ṭhānaṃ được gọi là nguyên nhân.
Tasmā yāya dussīlyacetanāya tāni mālādhāraṇādīni mahājano karoti, tato paṭiviratoti attho.
Therefore, the meaning is that he refrains from that immoral volition with which the populace engages in wearing garlands and so on.
Vì vậy, ý nghĩa là vị ấy từ bỏ những hành vi đeo vòng hoa, v.v., mà đại chúng thường làm với tâm ý bất thiện.
Āmakadhaññapaṭiggahaṇāti, sālivīhiyavagodhūmakaṅguvarakakudrūsakasaṅkhātassa sattavidhassāpi āmakadhaññassa paṭiggahaṇā.
From accepting uncooked grain means from accepting the seven kinds of uncooked grain, identified as sāli rice, vīhi rice, barley, wheat, millet, varaka, and kudrūsaka.
Āmakadhaññapaṭiggahaṇā là từ bỏ việc nhận các loại ngũ cốc thô chưa được chế biến, gồm bảy loại: lúa (sāli), lúa mạch (vīhi), yava (lúa mì/đại mạch), godhūma (lúa mì), kaṅgu (kê), varaka (hạt kê nhỏ), kudrūsaka (lúa mì dại).
Na kevalañca etesaṃ paṭiggahaṇameva, āmasanampi bhikkhūnaṃ na vaṭṭatiyeva.
And not only is the acceptance of these not allowed for monks, but even touching them is not allowed.
Không chỉ việc nhận những thứ này, mà ngay cả việc chạm vào chúng cũng không thích hợp cho các tỳ-khưu.
Āmakamaṃsapaṭiggahaṇāti ettha aññatra odissa anuññātā āmakamaṃsamacchānaṃ paṭiggahaṇameva bhikkhūnaṃ na vaṭṭati, no āmasanaṃ.
Regarding from accepting uncooked meat, except for what is specifically allowed, the acceptance of uncooked meat and fish is not allowed for monks, but touching them is.
Āmakamaṃsapaṭiggahaṇā: Trong trường hợp này, ngoại trừ những trường hợp được phép đặc biệt, việc nhận thịt và cá sống là không thích hợp cho các tỳ-khưu, nhưng việc chạm vào thì không sao.
Ajeḷakādīsu khettavatthupariyosānesu kappiyākappiyanayo vinayavasena upaparikkhitabbo.
Regarding goats and sheep up to fields and lands, the rule of what is proper and improper should be examined according to the Vinaya.
Đối với các loại động vật như dê, cừu, v.v., cho đến ruộng đất, cần phải xem xét quy tắc thích hợp và không thích hợp theo Vinaya.
Tattha khettaṃ nāma yasmiṃ pubbaṇṇaṃ ruhati.
Therein, a field is where early-ripening grain grows.
Trong đó, khettaṃ là nơi trồng các loại ngũ cốc chính (lúa).
Vatthu nāma yasmiṃ aparaṇṇaṃ ruhati.
A plot of land is where late-ripening grain grows.
Vatthu là nơi trồng các loại đậu (aparaṇṇa).
Yattha vā ubhayampi ruhati, taṃ khettaṃ.
Or, where both grow, that is a field.
Hoặc nơi cả hai đều có thể trồng, đó là khetta.
Tadatthāya akatabhūmibhāgo vatthu. Khettavatthusīsena cettha vāpitaḷākādīnipi saṅgahitāneva.
An unprepared piece of ground for that purpose is a plot of land. And here, under the heading of fields and plots of land, reservoirs, tanks, and so on are also included.
Phần đất chưa được chuẩn bị cho mục đích đó là vatthu. Ở đây, dưới tiêu đề khetta và vatthu, các loại ao hồ, kênh mương, v.v., cũng được bao gồm.
Kayavikkayāti kayā ca vikkayā ca.
From buying and selling means from buying and from selling.
Kayavikkayā là mua và bán.
Tulākūṭādīsu kūṭanti vañcanaṃ.
Among false weights and so on, false means deception.
Trong các loại cân gian lận, v.v., kūṭaṃ là sự lừa dối.
Tattha tulākūṭaṃ nāma rūpakūṭaṃ aṅgakūṭaṃ, gahaṇakūṭaṃ, paṭicchannakūṭanti catubbidhaṃ hoti.
Therein, false scales are of four kinds: deception by appearance, deception by limb, deception by handling, and hidden deception.
Trong đó, cân gian lận (tulākūṭaṃ) có bốn loại: rūpakūṭaṃ (gian lận hình thức), aṅgakūṭaṃ (gian lận bằng tay), gahaṇakūṭaṃ (gian lận cách cầm), paṭicchannakūṭaṃ (gian lận che giấu).
Tattha rūpakūṭaṃ nāma dve tulā samarūpā katvā gaṇhanto mahatiyā gaṇhāti, dadanto khuddikāya deti.
Therein, deception by appearance is when, having made two scales of the same appearance, one takes with the larger one and gives with the smaller one.
Trong đó, rūpakūṭaṃ là làm hai cái cân có hình dạng giống nhau, khi nhận thì dùng cái cân lớn, khi cho thì dùng cái cân nhỏ.
Aṅgakūṭaṃ nāma gaṇhanto pacchābhāge hatthena tulaṃ akkamati, dadanto pubbabhāge.
Deception by limb is when taking, one presses down on the back part of the scale with the hand, and when giving, on the front part.
Aṅgakūṭaṃ là khi nhận thì dùng tay đè lên phần sau của cân, khi cho thì đè lên phần trước.
Gahaṇakūṭaṃ nāma gaṇhanto mūle rajjuṃ gaṇhāti, dadanto agge.
Deception by handling is when taking, one holds the string at the base, and when giving, at the tip.
Gahaṇakūṭaṃ là khi nhận thì cầm dây ở gốc, khi cho thì cầm ở ngọn.
Paṭicchannakūṭaṃ nāma tulaṃ susiraṃ katvā anto ayacuṇṇaṃ pakkhipitvā gaṇhanto taṃ pacchābhāge karoti, dadanto aggabhāge.
Hidden deception is when, having made the scale hollow, one puts iron powder inside; when taking, one puts it in the back part, and when giving, in the front part.
Paṭicchannakūṭaṃ là làm cho cân rỗng ruột, bỏ bột sắt vào trong, khi nhận thì để phần có bột sắt ở phía sau, khi cho thì để ở phía trước.
Kaṃso vuccati suvaṇṇapāti, tāya vañcanaṃ kaṃsakūṭaṃ. Kathaṃ?
A kaṃsa is said to be a golden bowl; deception with it is deception with a kaṃsa. How?
Kaṃso được gọi là chén vàng, sự lừa dối bằng chén đó là kaṃsakūṭaṃ (gian lận bằng chén). Như thế nào?
Ekaṃ suvaṇṇapātiṃ katvā aññā dve tisso lohapātiyo suvaṇṇavaṇṇe karoti, tato janapadaṃ gantvā kiñcideva aḍḍhaṃ kulaṃ pavisitvā – ‘‘suvaṇṇabhājanāni kiṇathā’’ti vatvā agghe pucchite samagghataraṃ dātukāmā honti.
Having made one golden bowl, one makes two or three other copper bowls of a golden color. Then, going to the countryside and entering a certain wealthy household, one says, "Will you buy golden vessels?" When asked the price, they are willing to give it for a very reasonable price.
Làm một chén vàng, rồi làm hai ba chén đồng khác có màu vàng giống như vàng, sau đó đi đến một vùng quê, vào một gia đình giàu có nào đó và nói: "Ông bà có muốn mua chén vàng không?", khi được hỏi về giá, họ muốn bán với giá rẻ hơn.
Tato tehi – ‘‘kathaṃ imesaṃ suvaṇṇabhāvo jānitabbo’’ti vutte, ‘‘vīmaṃsitvā gaṇhathā’’ti suvaṇṇapātiṃ pāsāṇe ghaṃsitvā sabbā pātiyo datvā gacchati.
Then, when they say, "How can we know that these are gold?" one replies, "Examine them and take them." Having rubbed the golden bowl on a touchstone, one gives them all the bowls and leaves.
Sau đó, khi những người đó hỏi: "Làm sao để biết đây là vàng thật?", người bán nói: "Hãy kiểm tra rồi lấy", rồi mài chén vàng thật lên đá thử vàng, sau đó đưa tất cả các chén (vàng và đồng) rồi bỏ đi.
Mānakūṭaṃ nāma hadayabhedasikhābhedarajjubhedavasena tividhaṃ hoti.
Deception with measures is of three kinds: by way of heart-breaking, peak-breaking, and rope-breaking.
Mānakūṭaṃ (gian lận bằng đo lường) có ba loại: hadayabheda (gian lận bên trong), sikhābheda (gian lận trên ngọn), rajjubheda (gian lận bằng dây).
Tattha hadayabhedo sappitelādiminanakāle labbhati.
Therein, heart-breaking occurs when measuring ghee, oil, and so on.
Trong đó, hadayabhedo được dùng khi đong dầu bơ, dầu, v.v.
Tāni hi gaṇhanto heṭṭhāchiddena mānena – ‘‘saṇikaṃ āsiñcā’’ti vatvā antobhājane bahuṃ paggharāpetvā gaṇhāti, dadanto chiddaṃ pidhāya sīghaṃ pūretvā deti.
When taking these, using a measure with a hole at the bottom, one says, "Pour it in slowly," and lets a large amount flow into a container underneath while taking it. When giving, one closes the hole, fills it up quickly, and gives it.
Khi nhận những thứ đó, người gian lận dùng cái đo có lỗ ở đáy, nói: "Hãy đổ từ từ", rồi để chảy nhiều vào trong vật chứa rồi nhận; khi cho thì bịt lỗ lại, đổ đầy nhanh chóng rồi đưa đi.
Ukkoṭanādīsu ukkoṭananti assāmike sāmike kātuṃ lañjaggahaṇaṃ.
Among bribery and so on, bribery is taking a bribe to make a non-owner the owner.
Trong các loại gian lận như ukkoṭana, v.v., ukkoṭana là nhận hối lộ để biến tài sản vô chủ thành có chủ.
Vañcananti tehi tehi upāyehi paresaṃ vañcanaṃ.
Deception is the deceiving of others by various means.
Vañcana là lừa dối người khác bằng nhiều thủ đoạn khác nhau.
Tatridamekaṃ vatthu – eko kira luddako migañca migapotakañca gahetvā āgacchati, tameko dhutto – ‘‘kiṃ bho, migo agghati, kiṃ migapotako’’ti āha.
Here is one story on this: A certain hunter was coming along, having caught a deer and a fawn. A rogue said to him, "Hey, what is the price of the deer, and what is the price of the fawn?"
Đây là một câu chuyện về một trường hợp: Có một người thợ săn bắt được một con nai và một con nai con, rồi mang về. Một tên lừa đảo hỏi: "Này anh, con nai này giá bao nhiêu, con nai con giá bao nhiêu?".
‘‘Migo dve kahāpaṇe, migapotako eka’’nti ca vutte ekaṃ kahāpaṇaṃ datvā migapotakaṃ gahetvā thokaṃ gantvā nivatto – ‘‘na me bho, migapotakena attho, migaṃ me dehī’’ti āha.
When it was said, “The deer is two kahāpaṇas, the fawn is one,” he gave one kahāpaṇa, took the fawn, and after going a short distance, returned and said, “Sir, I have no use for the fawn. Give me the deer.”
Khi được nói rằng ‘con hươu giá hai đồng kahāpaṇa, hươu con giá một đồng’, người ấy đã đưa một đồng kahāpaṇa, bắt hươu con, đi một đoạn ngắn rồi quay lại nói: ‘Này bạn, tôi không cần hươu con, hãy đưa con hươu lớn cho tôi’.
Tena hi – dve kahāpaṇe dehīti.
“In that case, give me two kahāpaṇas.”
Vậy thì, hãy đưa hai đồng kahāpaṇa.
So āha – ‘‘nanu te bho, mayā paṭhamaṃ eko kahāpaṇo dinno’’ti?
He said, “Sir, did I not already give you one kahāpaṇa before?”
Người ấy nói: ‘Này bạn, chẳng phải tôi đã đưa cho bạn một đồng kahāpaṇa trước rồi sao?’
‘‘Āma, dinno’’ti.
“Yes, you did.”
‘Vâng, đã đưa rồi’.
‘‘Idaṃ migapotakaṃ gaṇha, evaṃ so ca kahāpaṇo, ayañca kahāpaṇagghanako migapotakoti dve kahāpaṇā bhavissantī’’ti.
“Then take this fawn. In this way, that kahāpaṇa and this fawn, which is worth one kahāpaṇa, will make two kahāpaṇas.”
‘Hãy bắt hươu con này, như vậy đồng kahāpaṇa đó và hươu con giá trị một đồng kahāpaṇa này sẽ thành hai đồng kahāpaṇa’.
So ‘‘kāraṇaṃ vadatī’’ti sallakkhetvā migapotakaṃ gahetvā migaṃ adāsīti.
Thinking, “He speaks reasonably,” the hunter took the fawn and gave him the deer.
Người ấy nhận thấy ‘người này nói có lý’ và sau khi bắt hươu con, đã đưa con hươu lớn.
Nikatīti yogavasena vā māyāvasena vā apāmaṅgaṃ pāmaṅganti, amaṇiṃ maṇinti, asuvaṇṇaṃ suvaṇṇanti katvā patirūpakena vañcanaṃ.
Nikatī is deception with a counterfeit item, by means of spells or illusion, making what is not a sacred thread appear to be a sacred thread, what is not a gem appear to be a gem, and what is not gold appear to be gold.
Nikatī (lừa dối) là sự lừa gạt bằng cách giả mạo, hoặc bằng cách sử dụng các phương pháp ma thuật hoặc ảo thuật, biến cái không phải dây đeo vai thành dây đeo vai, cái không phải ngọc thành ngọc, cái không phải vàng thành vàng.
Sāciyogoti kuṭilayogo, etesaṃyeva ukkoṭanādīnametaṃ nāmaṃ.
Sāciyoga is crooked practice; it is a name for these very things, such as bribery and so on.
Sāciyogo (hành vi gian xảo) là hành vi gian xảo, đây là tên gọi của những hành vi như hối lộ, lừa gạt, v.v.
Tasmā – ukkoṭanasāciyogo, vañcanasāciyogo, nikatisāciyogoti, evamettha attho daṭṭhabbo.
Therefore, the meaning here should be understood as: the crooked practice of bribery, the crooked practice of deception, and the crooked practice of fraud.
Do đó, ở đây cần hiểu ý nghĩa là: hối lộ gian xảo, lừa gạt gian xảo, lừa dối gian xảo.
Keci aññaṃ dassetvā aññassa parivattanaṃ sāciyogoti vadanti.
Some say that sāciyoga is exchanging one thing for another after having shown something different.
Một số người nói rằng sāciyogo là việc đổi một vật khác sau khi đã cho xem một vật khác.
Taṃ pana vañcaneneva saṅgahitaṃ.
But that is included under deception.
Tuy nhiên, điều đó đã được bao gồm trong sự lừa gạt.
Chedanādīsu chedananti hatthacchedanādi.
In the section on cutting and so on, chedana refers to the cutting off of hands and the like.
Trong các hành vi cắt xẻ, v.v., chedana (cắt xẻ) là cắt tay, v.v.
Vadhoti māraṇaṃ.
Vadha is killing.
Vadho (sát hại) là giết chết.
Bandhoti rajjubandhanādīhi bandhanaṃ.
Bandha is binding with ropes and other such bonds.
Bandho (trói buộc) là trói buộc bằng dây thừng, v.v.
Viparāmosoti himaviparāmoso, gumbaviparāmosoti duvidho.
Viparāmoso is of two kinds: highway robbery in the mist and highway robbery from a thicket.
Viparāmoso (cướp đoạt) có hai loại: cướp đoạt do tuyết và cướp đoạt do bụi cây.
Yaṃ himapātasamaye himena paṭicchannā hutvā maggappaṭipannaṃ janaṃ musanti, ayaṃ himaviparāmoso.
When, during the season of falling mist, robbers conceal themselves in the mist and plunder people traveling on the road, this is highway robbery in the mist.
Khi tuyết rơi, những kẻ ẩn mình trong tuyết cướp bóc những người đi đường, đó là cướp đoạt do tuyết.
Yaṃ gumbādīhi paṭicchannā musanti, ayaṃ gumbaviparāmoso.
When they conceal themselves in thickets and the like to plunder, this is highway robbery from a thicket.
Những kẻ ẩn mình trong bụi cây, v.v., cướp bóc, đó là cướp đoạt do bụi cây.
Ālopo vuccati gāmanigamādīnaṃ vilopakaraṇaṃ.
Ālopo is the plundering of villages, towns, and the like.
Ālopo (cướp phá) được gọi là việc cướp phá làng mạc, thị trấn, v.v.
Sahasākāroti sāhasikakiriyā.
Sahasākāro is a violent act.
Sahasākāro (hành vi bạo lực) là hành vi bạo lực.
Gehaṃ pavisitvā manussānaṃ ure satthaṃ ṭhapetvā icchitabhaṇḍānaṃ gahaṇaṃ.
It is entering a house, placing a weapon on the chests of the occupants, and taking whatever goods one desires.
Vào nhà, đặt dao vào ngực người rồi lấy đi những tài sản mong muốn.
Evametasmā chedana…pe… sahasākārā paṭivirato samaṇo gotamoti.
Thus, the recluse Gotama abstains from this cutting... and so on... up to violent acts.
Như vậy, Sa-môn Gotama đã từ bỏ việc cắt xẻ... và hành vi bạo lực.
Iti vā hi, bhikkhave, puthujjano tathāgatassa vaṇṇaṃ vadamāno vadeyyāti.
In this way, bhikkhus, should an ordinary person speak when speaking in praise of the Tathāgata.
Này các Tỳ-khưu, phàm phu khi tán thán Đức Như Lai có thể tán thán như vậy.