Pasannakāranti pasannehi kātabbaṃ sakkāraṃ.
Act of faith means the honour to be rendered by those with faith.
Hành động của người có niềm tin có nghĩa là sự tôn kính phải được thực hiện bởi những người có niềm tin.
Saraṇanti paṭisaraṇaṃ.
Refuge means a place of refuge.
Nơi nương tựa có nghĩa là nơi nương tựa.
Tenāha ‘‘parāyaṇa’’nti.
Therefore, it is said: "the ultimate resort."
Do đó, Ngài nói “nơi nương tựa tối thượng”.
Parāyaṇabhāvo ca anatthanisedhanena atthasampaṭipādanena ca hotīti āha ‘‘aghassa tātā hitassa ca vidhātā’’ti.
And the state of being the ultimate resort arises through the prevention of harm and the realization of benefit, thus it is said: "O Father, the dispeller of evil and the bestower of benefit."
Sự là nơi nương tựa tối thượng xảy ra bằng cách ngăn chặn những điều bất lợi và mang lại lợi ích, vì vậy Ngài nói: “Này con, là người loại bỏ điều bất lợi và mang lại điều lợi ích”.
Aghassāti dukkhatoti vadanti, pāpatoti pana yuttaṃ.
Of evil means of suffering, some say, but of demerit is more appropriate.
Điều bất lợi (aghassa) có người nói là khổ (dukkha), nhưng nói là tội lỗi (pāpa) thì thích hợp hơn.
Nissakke cetaṃ sāmivacanaṃ.
And this is a genitive of separation.
Đây là một từ sở hữu cách trong trường hợp không có sở hữu.
Ettha ca nāyaṃ gami-saddo nī-saddādayo viya dvikammako, tasmā yathā ‘‘ajaṃ gāmaṃ netī’’ti vuccati, evaṃ ‘‘gotamaṃ saraṇaṃ gacchāmī’’ti vattuṃ na sakkā, ‘‘saraṇanti gacchāmī’’ti pana vattabbaṃ.
Here, the word gami (go) is not a double transitive verb like nī (lead) and so forth; therefore, just as one says, "leads the goat to the village," it is not possible to say, "I go Gotama refuge," but rather, "I go into refuge."
Trong trường hợp này, từ “gami” không phải là động từ hai tân ngữ như “nī” và các động từ khác, vì vậy không thể nói “gotamaṃ saraṇaṃ gacchāmī” như cách nói “ajaṃ gāmaṃ netī”, mà phải nói “saraṇanti gacchāmī”.
Iti-saddo cettha luttaniddiṭṭho, tassa cāyamattho – gamanañca tadadhippāyena bhajanaṃ, tathā jānanaṃ vāti dassento ‘‘iti iminā adhippāyenā’’tiādimāha.
Here the word iti is omitted; its meaning is this – indicating that going is also resorting with that intention, and knowing thus, he says: "thus with this intention" and so forth.
Ở đây, từ “iti” được lược bỏ, và ý nghĩa của nó là – việc đi đến và việc nương tựa với ý định đó, cũng như việc hiểu biết như vậy – để chỉ điều đó, Ngài nói “với ý định này” và các từ tương tự.
Tattha bhajāmītiādīsu purimassa purimassa pacchimaṃ pacchimaṃ atthavacanaṃ.
Among resorting and so forth, the latter is the meaning of the former.
Trong đó, đối với “bhajāmī” (tôi nương tựa) và các từ tương tự, từ sau giải thích ý nghĩa của từ trước.
Bhajanaṃ vā saraṇādhippāyena upasaṅkamanaṃ, sevanaṃ santikāvacaratā, payirupāsanaṃ vattapaṭivattakaraṇena upaṭṭhānanti evaṃ sabbathāpi anaññasaraṇataṃyeva dīpeti.
Resorting is approaching with the intention of refuge; serving is being in constant attendance; attending is waiting upon by performing duties and services; in all these ways, it demonstrates non-reliance on any other refuge.
Hoặc bhajanaṃ (nương tựa) là đến gần với ý định quy y, sevanaṃ (phụng sự) là ở gần, payirupāsanaṃ (cung kính) là phục vụ bằng cách thực hiện các bổn phận và đối ứng – bằng mọi cách này, nó đều chỉ ra sự không có nơi nương tựa nào khác.
‘‘Gacchāmī’’ti padassa kathaṃ ‘‘bujjhāmī’’ti ayamattho labbhatīti āha ‘‘yesañhī’’tiādi.
How is the meaning "I understand" obtained for the word "I go"? In response, he says: "For those..." and so forth.
Đối với từ “gacchāmī” (tôi đi), làm thế nào mà ý nghĩa “bujjhāmī” (tôi hiểu) có thể được hiểu? Ngài nói “yesañhī” và các từ tương tự.
Adhigatamagge, sacchikatanirodheti padadvayenapi phalaṭṭhā eva dassitā, na maggaṭṭhāti te dassento ‘‘yathānusiṭṭhaṃ paṭipajjamāne cā’’ti āha.
By the two phrases, "those who have attained the path" and "those who have realized cessation," only those who have attained the fruits are indicated, not those on the path; showing them, he says: "and those who practice according to instruction."
Bằng hai cụm từ “đạt được đạo” và “chứng ngộ diệt”, chỉ những bậc A-la-hán được chỉ ra, không phải những bậc đang ở trên đạo. Để chỉ ra những bậc đó, Ngài nói “và những người đang thực hành theo lời giáo huấn”.
Nanu ca kalyāṇaputhujjanopi yathānusiṭṭhaṃ paṭipajjatīti vuccatīti?
But is it not also said that even an ordinary noble person practices according to instruction?
Chẳng phải người phàm phu thiện lành cũng được gọi là đang thực hành theo lời giáo huấn sao?
Kiñcāpi vuccati, nippariyāyena pana maggaṭṭhā eva tathā vattabbā, na itare niyāmokkamanābhāvato.
Although it is said, properly speaking, only those on the path should be referred to thus, not the others, because there is no certainty of their emancipation.
Mặc dù được gọi như vậy, nhưng một cách trực tiếp, chỉ những bậc đang ở trên đạo mới nên được gọi như vậy, không phải những người khác vì họ chưa đi vào sự chắc chắn (niyāma).
Tathā hi te eva ‘‘apāyesu apatamāne dhāretī’’ti vuttā.
Indeed, only they are spoken of as "those who prevent falling into the planes of misery."
Thật vậy, chỉ những vị đó mới được nói là “giữ cho không rơi vào các cõi khổ”.
Sammattaniyāmokkamanena hi apāyavinimuttisambhavo.
For emancipation from the planes of misery is possible only through entering the certainty of rightness.
Vì sự giải thoát khỏi các cõi khổ chỉ có thể xảy ra khi đi vào sự chắc chắn của chánh kiến.
Akkhāyatīti ettha iti-saddo ādiattho, pakārattho vā.
In "is declared," the word iti is either an initial particle or a particle indicating kind.
Trong “Akkhāyatī” (được nói đến), từ “iti” có nghĩa là “và vân vân” hoặc là “loại này”.
Tena ‘‘yāvatā, bhikkhave, dhammā saṅkhatā vā asaṅkhatā vā, virāgo tesaṃ aggamakkhāyatī’’ti suttapadaṃ (a. ni. 4.34; itivu. 90) saṅgaṇhāti, vitthāroti vā iminā.
Thereby it includes the sutta passage (A.N. 4.34; Itiv. 90): "Bhikkhus, among all dhammas, conditioned or unconditioned, dispassion is declared to be the foremost," or "expansion" by this (word).
Do đó, nó bao gồm câu kinh (A. IV, 34; Itv. 90): “Này các Tỳ-kheo, trong số tất cả các pháp, dù là hữu vi hay vô vi, sự ly tham được nói là tối thượng”, hoặc sự mở rộng (vitthāro) của điều này.
Ettha ca ariyamaggo niyyānikatāya, nibbānaṃ tassa tadatthasiddhihetutāyāti ubhayamevettha nippariyāyena dhammoti vutto.
Here, the Noble Path is called Dhamma in the ultimate sense because of its leading to liberation, and Nibbāna is called Dhamma in the ultimate sense because it is the cause of the accomplishment of that path's goal.
Trong trường hợp này, Bát Chánh Đạo được gọi là Pháp một cách trực tiếp vì nó dẫn đến giải thoát, và Niết Bàn cũng vậy vì nó là nguyên nhân thành tựu mục đích của đạo.
Nibbānañhi ārammaṇapaccayabhūtaṃ labhitvā ariyamaggassa tadatthasiddhi, ariyaphalānaṃ ‘‘yasmā tāya saddhāya avūpasantāyā’’tiādivacanato maggena samucchinnānaṃ kilesānaṃ paṭippassaddhipahānakiccatāya niyyānānuguṇatāya niyyānapariyosānatāya ca.
For the accomplishment of the goal of the Noble Path is achieved by obtaining Nibbāna as the object condition, and the Noble Fruits, as stated in the saying "since by that faith which is not yet subsided" and so forth, are conducive to liberation, ending in liberation, and perform the function of subsiding and abandoning the defilements eradicated by the path.
Vì khi đạt được Niết Bàn làm đối tượng hỗ trợ, Bát Chánh Đạo mới thành tựu mục đích của nó, và các Thánh quả là do sự lắng dịu và đoạn trừ các phiền não đã được đoạn tận bởi đạo, như lời dạy “vì niềm tin đó chưa lắng dịu”, và vì nó phù hợp với sự giải thoát và là mục đích cuối cùng của sự giải thoát.
Pariyattidhammassa pana niyyānadhammasamadhigamahetutāyāti iminā pariyāyena dhammabhāvo labbhati eva, svāyamattho pāṭhāruḷho evāti dassento ‘‘na kevala’’ntiādimāha.
However, the Dhamma of study is certainly attained as Dhamma by this method, due to its being the cause for the attainment of the Dhamma of liberation; showing that this meaning is clearly stated in the text itself, he says: "not merely" and so forth.
Còn đối với Pháp học, nó có Pháp tính vì nó là nguyên nhân để đạt được Pháp giải thoát – bằng phương tiện này, Pháp tính được hiểu, và để chỉ rằng ý nghĩa này đã có sẵn trong kinh điển, Ngài nói “không chỉ” và các từ tương tự.
Kāmarāgo bhavarāgoti evamādibhedo sabbopi rāgo virajjati pahīyati etenāti rāgavirāgoti maggo kathito.
All lust, such as sensual lust and lust for existence, ceases and is abandoned by this; therefore, the path is called "dispassion from lust."
Tất cả tham ái, như tham dục (kāmarāga), tham hữu (bhavarāga), v.v., đều được ly tham (virajjati) và đoạn trừ (pahīyati) bởi đạo này, vì vậy đạo được gọi là ly tham.
Ejāsaṅkhātāya taṇhāya antonijjhānalakkhaṇassa sokassa ca taduppattiyaṃ sabbaso parikkhīṇattā anejamasokanti phalaṃ kathitaṃ.
Because craving, which is called agitation, and sorrow, whose characteristic is internal burning, are completely exhausted at its arising, the fruit is called "unagitated and sorrowless."
Vì khát ái (ejā), tức là tham ái, và sầu muộn (soka), tức là sự thiêu đốt nội tâm, hoàn toàn bị diệt trừ khi chúng phát sinh, nên quả được gọi là không khát ái, không sầu muộn.
Appaṭikūlanti avirodhadīpanato kenaci aviruddhaṃ, iṭṭhaṃ paṇītanti vā attho.
Not disagreeable means not opposed by anyone, by indicating no conflict, or the meaning is desirable and excellent.
Không chướng ngại (appaṭikūlaṃ) có nghĩa là không đối nghịch với bất kỳ ai, vì nó chỉ sự không đối kháng, hoặc ý nghĩa là dễ chịu, cao quý.
Paguṇarūpena pavattitattā, pakaṭṭhaguṇavibhāvanato vā paguṇaṃ.
Skilful either because it functions in a well-practiced way, or because it manifests excellent qualities.
Thuần thục (paguṇaṃ) vì nó được thực hành một cách thuần thục, hoặc vì nó biểu lộ những phẩm chất ưu việt.
Yathāha ‘‘vihiṃsasaññī paguṇaṃ na bhāsiṃ, dhammaṃ paṇītaṃ manujesu brahme’’ti.
As it is said: "I, being of violent intent, spoke not skilfully, O Brahmā, the noble Dhamma among men."
Như đã nói: “Brahma, tôi không nói ra những ý nghĩ làm hại một cách thuần thục, Pháp cao quý giữa loài người.”
Sabbadhammakkhandhā kathitāti yojanā.
All aggregates of Dhamma are expounded—this is the connection.
Ý nghĩa là tất cả các uẩn pháp đã được nói đến.
Diṭṭhisīlasaṅghātenāti ‘‘yāyaṃ diṭṭhi ariyā niyyānikā niyyāti takkarassa sammā dukkhakkhayāya, tathārūpāya diṭṭhiyā diṭṭhisāmaññagato viharatī’’ti (dī. ni. 3.324, 356; ma. ni. 1.492; 3.54) evaṃ vuttāya diṭṭhiyā, ‘‘yāni tāni sīlāni akhaṇḍāni acchiddāni asabalāni akammāsāni bhujissāni viññuppasatthāni aparāmaṭṭhāni samādhisaṃvattanikāni, tathārūpehi sīlehi sīlasāmaññagato viharatī’’ti (dī. ni. 3.324; ma. ni. 1.492; 3.54; a. ni. 6.12; pari. 274) evaṃ vuttānaṃ sīlānañca saṃhatabhāvena, diṭṭhisīlasāmaññenāti attho.
By the aggregation of view and virtue means by the unified state of the view, which is "that noble, emancipating view which leads its practitioner to the right destruction of suffering" (D.N. 3.324, 356; M.N. 1.492; 3.54), and the virtues, which are "unbroken, untorn, unblemished, unspotted, free, praised by the wise, untainted, conducive to concentration" (D.N. 3.324; M.N. 1.492; 3.54; A.N. 6.12; Par. 274); that is to say, by sharing the same view and virtue.
Bằng sự kết hợp của kiến và giới có nghĩa là bằng sự kết hợp của kiến được nói đến như “kiến này là Thánh, dẫn đến giải thoát, dẫn đến sự chấm dứt khổ đau một cách chân chính cho người thực hành, người sống với sự tương đồng về kiến như vậy” (D. III, 324, 356; M. I, 492; III, 54), và giới được nói đến như “những giới ấy không bị sứt mẻ, không bị rách nát, không bị pha tạp, không bị ô uế, tự do, được người trí khen ngợi, không bị chấp thủ, dẫn đến định, người sống với sự tương đồng về giới như vậy” (D. III, 324; M. I, 492; III, 54; A. VI, 12; Parivāra 274), tức là bằng sự tương đồng về kiến và giới.
Saṃhatoti ghaṭito.
Aggregated means combined.
Kết hợp (saṃhato) có nghĩa là gắn kết.
Ariyapuggalā hi yattha katthaci dūre ṭhitāpi attano guṇasāmaggiyā saṃhatā eva.
For Noble Ones, even if far apart, are aggregated by the harmony of their qualities.
Các bậc Thánh nhân, dù ở xa cách nhau, vẫn kết hợp nhờ sự toàn vẹn phẩm chất của họ.
Aṭṭha ca puggala dhammadasā teti te purisayugavasena cattāropi puggalavasena aṭṭheva ariyadhammassa paccakkhadassāvitāya dhammadasā.
And those eight individuals who see the Dhamma means those four pairs of persons, or eight individuals, are "Dhamma-seers" because they directly perceive the Noble Dhamma.
Tám người là những người thấy Pháp (aṭṭha ca puggala dhammadasā te) có nghĩa là tám vị Thánh nhân, tức là bốn đôi người, là những người thấy Pháp vì họ trực tiếp chứng kiến Thánh Pháp.
Tīṇi vatthūni saraṇanti gamanena tikkhattuṃ gamanena ca tīṇi saraṇagamanāni.
Three acts of going for refuge refers to going for refuge to the three objects and going three times.
Ba lần quy y (tīṇi saraṇagamanāni) là do quy y ba đối tượng và do quy y ba lần.
Paṭivedesīti attano hadayagataṃ vācāya pavedesi.
Paṭivedesī means he expressed what was in his heart through speech.
Paṭivedesī (đã trình bày) có nghĩa là đã bày tỏ những điều ẩn chứa trong lòng mình bằng lời nói.
Saraṇagamanassa visayapabhedaphalasaṃkilesabhedānaṃ viya kattu ca vibhāvanā tattha kosallāya hotīti ‘‘saraṇagamanesu kosallatthaṃ saraṇaṃ…pe… veditabbo’’ti vuttaṃ tena vinā saraṇagamanasseva asambhavato.
Just as the elucidation of the range, classifications, results, and defilements of going for refuge is for skillfulness therein, so too is the elucidation of its agent. Thus, it is said: " for skillfulness in going for refuge, refuge... should be understood," since without it, going for refuge itself is impossible.
Việc phân tích về các loại đối tượng, các loại quả, các loại ô nhiễm của sự quy y, và về người thực hành, cũng trở nên có ích cho sự khéo léo trong đó; do đó đã được nói là “để khéo léo trong việc quy y… cần phải biết” vì nếu không có điều đó thì sự quy y không thể xảy ra.
Kasmā panettha vodānaṃ na gahitaṃ, nanu vodānavibhāvanāpi tattha kosallāvahāti?
Why is purification not included here? Does not the elucidation of purification also lead to skillfulness therein?
Tại sao ở đây sự thanh tịnh (vodāna) không được đề cập? Chẳng phải việc phân tích về sự thanh tịnh cũng mang lại sự khéo léo trong đó sao?
Saccametaṃ, taṃ pana saṃkilesaggahaṇeneva atthato dīpitaṃ hotīti na gahitaṃ.
That is true, but it is implicitly indicated by the inclusion of defilement, so it is not explicitly taken.
Điều đó đúng, nhưng điều đó đã được ngụ ý về mặt ý nghĩa thông qua việc đề cập đến sự ô nhiễm (saṃkilesa), nên không được đề cập riêng.
Yāni hi tesaṃ saṃkilesakāraṇāni aññāṇādīni, tesaṃ sabbena sabbaṃ anuppannānaṃ anuppādanena, uppannānañca pahānena vodānaṃ hotīti.
For purification occurs through the non-arising of all the causes of those defilements, such as ignorance, that have not yet arisen, and through the abandonment of those that have arisen.
Vì những nguyên nhân gây ô nhiễm như vô minh, v.v., thì sự thanh tịnh chính là việc không cho chúng phát sinh hoàn toàn nếu chúng chưa phát sinh, và đoạn trừ chúng nếu chúng đã phát sinh.
Hiṃsatthassa sara-saddassa vasenetaṃ padaṃ daṭṭhabbanti ‘‘hiṃsatīti saraṇa’’nti vatvā taṃ pana hiṃsanaṃ kesaṃ, kathaṃ, kassa vāti codanaṃ sodhento ‘‘saraṇagatāna’’ntiādimāha.
This word should be understood by means of the root sara (to harm, destroy); thus, having stated " it harms, therefore it is refuge," and resolving the question of whose harm, how, and by whom, he says " of those who have gone for refuge," and so on.
Từ này cần được hiểu theo nghĩa của từ gốc sara mang nghĩa làm hại, nên đã nói “làm hại nên là saraṇa”; và để giải đáp câu hỏi việc làm hại đó là của ai, bằng cách nào, và của cái gì, đã nói “của những người đã quy y” v.v.
Tattha bhayanti vaṭṭabhayaṃ.
Therein, fear means the fear of saṃsāra.
Trong đó, bhaya (sợ hãi) là sự sợ hãi luân hồi (vaṭṭabhaya).
Santāsanti cittutrāsaṃ.
Terror means mental agitation.
Santāsa (kinh hoàng) là sự kinh hoàng trong tâm.
Teneva cetasikadukkhassa gahitattā dukkhanti idha kāyikaṃ dukkhaṃ.
Since mental suffering is thereby included, dukkha here refers to bodily suffering.
Vì đã bao gồm khổ tâm (cetasikadukkha) với từ đó, nên dukkha (khổ) ở đây là khổ thân (kāyikaṃ dukkhaṃ).
Duggatiparikilesanti duggatipariyāpannaṃ sabbaṃ dukkhaṃ.
Misery of a bad destination means all suffering belonging to a bad destination.
Duggatiparikilesa (sự ô nhiễm của khổ cảnh) là tất cả khổ thuộc về khổ cảnh.
Tayidaṃ sabbaṃ parato phalakathāyaṃ āvi bhavissati.
All of this will become clear later in the section on results.
Tất cả những điều này sẽ được làm rõ trong phần giải thích về quả sau này.
Etanti ‘‘saraṇa’’nti padaṃ.
This refers to the word "refuge."
Etaṃ (điều này) là từ “saraṇa”.
Evaṃ avisesato saraṇasaddassa atthaṃ dassetvā idāni visesato dassetuṃ ‘‘atha vā’’tiādi vuttaṃ.
Having thus shown the meaning of the word saraṇa in general, now, to show it in particular, he states " or alternatively," and so on.
Sau khi giải thích ý nghĩa của từ saraṇa một cách tổng quát như vậy, bây giờ để giải thích một cách đặc biệt, đã nói “hoặc là” v.v.
Hite pavattamānenāti ‘‘sampannasīlā, bhikkhave, viharathā’’tiādinā (ma. ni. 1.64, 69) atthe niyojanena.
By causing one to engage in what is beneficial means by enjoining one to good, as in "Monks, dwell possessed of accomplished virtue," and so on.
Hite pavattamānenā (bằng cách thúc đẩy vào điều lợi ích) có nghĩa là bằng cách hướng dẫn vào điều lợi ích với câu “Này các tỳ khưu, hãy sống với giới hạnh đầy đủ” v.v. (Ma. Ni. 1.64, 69).
Ahitā ca nivattanenāti ‘‘pāṇātipātassa kho pāpako vipāko pāpakaṃ abhisamparāya’’ntiādinā ādīnavadassanādimukhena anatthato vinivattanena.
And by turning away from what is harmful means by turning away from what is detrimental through showing its disadvantages, as in "killing has an evil result, an evil future destiny," and so on.
Ahitā ca nivattanenā (và bằng cách ngăn chặn khỏi điều bất lợi) có nghĩa là bằng cách ngăn chặn khỏi điều bất lợi thông qua việc chỉ ra tai hại với câu “Này các tỳ khưu, quả báo của việc sát sinh là ác, là ác cho đời sau” v.v.
Bhayaṃ hiṃsatīti hitāhitesu appavattipavattihetukaṃ byasanaṃ appavattikaraṇena vināseti.
It harms fear means it destroys suffering caused by engaging in or refraining from beneficial and harmful acts, by preventing its occurrence.
Bhayaṃ hiṃsatī (làm hại sự sợ hãi) có nghĩa là tiêu diệt sự bất hạnh do việc không thực hành điều lợi ích và thực hành điều bất lợi gây ra, bằng cách không cho chúng phát sinh.
Bhavakantārā uttāraṇena maggasaṅkhāto dhammo, itaro assāsadānena sattānaṃ bhayaṃ hiṃsatīti yojanā.
The Dharma, which is the path, by leading across the wilderness of existence, and the other, by providing solace, harms the fear of beings—this is the connection.
Pháp được gọi là con đường bằng cách đưa ra khỏi sa mạc luân hồi (bhavakantārā uttāraṇena), và cái kia bằng cách ban sự an ủi (assāsadānena) làm hại sự sợ hãi của chúng sinh – đây là cách kết hợp.
Kārānanti dānavasena pūjāvasena ca upanītānaṃ sakkārānaṃ.
Of honors refers to the honors presented by way of giving and by way of veneration.
Kārānaṃ (của những sự cung kính) là của những sự cung kính được dâng lên dưới hình thức bố thí và cúng dường.
Vipulaphalapaṭilābhakaraṇena sattānaṃ bhayaṃ hiṃsati anuttaradakkhiṇeyyabhāvatoti adhippāyo.
The intention is that it harms the fear of beings by causing the attainment of abundant results due to being an unsurpassed field of merit (dakkhiṇeyya).
Vipulaphalapaṭilābhakaraṇena (bằng cách tạo ra sự thành tựu quả lớn) có nghĩa là làm hại sự sợ hãi của chúng sinh vì là ruộng phước vô thượng.
Imināpi pariyāyenāti imināpi vibhajitvā vuttena kāraṇena.
By this method also means by this reason, stated through division.
Imināpi pariyāyenā (bằng cách giải thích này) là bằng nguyên nhân đã được nói rõ ràng này.
‘‘Sammāsambuddho bhagavā, svākkhāto dhammo, suppaṭipanno saṅgho’’ti evaṃ pavatto tattha ratanattaye pasādo tappasādo, tadeva ratanattayaṃ garu etassāti taggaru, tassa bhāvo taggarutā, tappasādo ca taggarutā ca tappasādataggarutā, tāhi.
"The Blessed One is the Perfectly Self-Enlightened One, the Dhamma is well-expounded, the Saṅgha is of good practice"—the serene faith in the Triple Gem that arises thus is tappasāda. That Triple Gem is honored by this (person), thus taggaru; its state is taggarutā. Tappasāda and taggarutā together are tappasādataggarutā, by these.
“Đức Thế Tôn là Bậc Chánh Đẳng Giác, Giáo Pháp được thuyết giảng khéo léo, Tăng Đoàn thực hành đúng đắn” – sự tịnh tín phát sinh như vậy đối với Tam Bảo là sự tịnh tín đó (tappasāda). Tam Bảo đó là đáng tôn kính đối với người này nên là taggaru (người tôn kính Tam Bảo), trạng thái của người đó là taggarutā (sự tôn kính Tam Bảo). Sự tịnh tín đó và sự tôn kính đó là tappasādataggarutā (sự tịnh tín và tôn kính Tam Bảo), do đó.
Vidhutadiṭṭhivicikicchāsammohaassaddhiyāditāya vihatakileso.
Vihatakileso means one whose defilements are overcome due to the expulsion of wrong views, doubt, delusion, lack of faith, and so on.
Vihatakileso (người đã đoạn trừ phiền não) là do đã đoạn trừ tà kiến, hoài nghi, si mê, vô tín, v.v.
‘‘Tadeva ratanattayaṃ parāyaṇaṃ gati tāṇaṃ leṇa’’nti evaṃ ākārena pavattiyā tapparāyaṇatākārapavatto cittuppādo saraṇagamanaṃ ‘‘saraṇanti gacchati etenā’’ti.
The mind-moment that arises in the manner of having the Triple Gem as one's ultimate refuge—that is, "the Triple Gem is my ultimate support, my destination, my protection, my shelter"—is going for refuge, as in "one goes for refuge by this."
Tapparāyaṇatākārapavatto cittuppādo saraṇagamanaṃ (tâm sinh khởi phát sinh dưới hình thức nương tựa vào đó là sự quy y) có nghĩa là “nương tựa vào đó mà đi đến sự quy y”.
Taṃsamaṅgīti tena yathāvuttacittuppādena samannāgato.
Taṃsamaṅgī means endowed with that mind-moment as stated.
Taṃsamaṅgī (người có đầy đủ điều đó) là người có đầy đủ tâm sinh khởi đã nói trên.
Evaṃ upetīti evaṃ bhajati sevati payirupāsati, evaṃ vā jānāti bujjhatīti evamattho veditabbo.
Thus goes to means thus worships, attends, serves, or thus knows and understands—this meaning should be understood.
Evaṃ upetī (đến gần như vậy) có nghĩa là phụng sự, phục tùng, tôn kính như vậy, hoặc hiểu biết, giác ngộ như vậy – ý nghĩa này cần được hiểu.
Ettha ca pasādaggahaṇena lokiyasaraṇagamanamāha.
Here, by the inclusion of serene faith, worldly going for refuge is meant.
Ở đây, việc đề cập đến sự tịnh tín ám chỉ sự quy y thế gian (lokiyasaraṇagamana).
Tañhi pasādappadhānaṃ, na ñāṇappadhānaṃ.
For it is predominated by serene faith, not by knowledge.
Vì điều đó chủ yếu là tịnh tín, không phải chủ yếu là trí tuệ.
Garutāgahaṇena lokuttaraṃ.
By the inclusion of reverence, supramundane (going for refuge) is meant.
Việc đề cập đến sự tôn kính (garutā) ám chỉ sự quy y siêu thế (lokuttaraṃ).
Ariyā hi ratanattayaṃ guṇābhiññātāya pāsāṇacchattaṃ viya garuṃ katvā passanti, tasmā tappasādena vikkhambhanavasena vihatakileso taggarutāya samucchedavasenāti yojetabbaṃ.
For the Noble Ones, having fully understood the virtues of the Triple Gem, see it as weighty, like a parasol of rock. Therefore, it should be connected thus: defilements are overcome by suppression through serene faith, and by eradication through reverence.
Vì các bậc Thánh thấy Tam Bảo là đáng tôn kính như một cây dù bằng đá do sự thấu hiểu các phẩm chất, do đó cần kết hợp rằng phiền não bị đoạn trừ bằng cách trấn áp nhờ sự tịnh tín đó, và bằng cách đoạn tận nhờ sự tôn kính đó.
Tapparāyaṇatā panettha taggatikatāti tāya catubbidhampi vakkhamānaṃ saraṇagamanaṃ gahitanti daṭṭhabbaṃ.
Here, tapparāyaṇatā means taggatikatā (making it one's goal). It should be understood that by this, all four kinds of going for refuge, which will be described, are included.
Ở đây, tapparāyaṇatā (sự nương tựa vào đó) là taggatikatā (sự đi đến đó), do đó cần hiểu rằng cả bốn loại quy y sẽ được nói đến đều được bao gồm bởi điều này.
Avisesena vā pasādagarutā jotitāti pasādaggahaṇena aveccappasādassa itarassa ca gahaṇaṃ, tathā garutāgahaṇenāti ubhayenapi ubhayaṃ saraṇagamanaṃ yojetabbaṃ.
Alternatively, serene faith and reverence are signified without distinction. Thus, by the inclusion of serene faith, both unshakable faith and other kinds are included; similarly, by the inclusion of reverence. In this way, both types of going for refuge should be connected with both (serene faith and reverence).
Hoặc là, sự tịnh tín và tôn kính được làm nổi bật một cách không phân biệt, nên việc đề cập đến sự tịnh tín bao gồm cả sự tịnh tín bất động (aveccappasāda) và các loại khác, và tương tự như vậy với việc đề cập đến sự tôn kính – do đó, cả hai loại quy y đều cần được kết hợp với cả hai.
Maggakkhaṇe ijjhatīti yojanā.
It is accomplished at the moment of the path—this is the connection.
Kết hợp rằng nó thành tựu vào khoảnh khắc Đạo (magga).
Nibbānārammaṇaṃ hutvāti etena atthato catusaccādhigamoyeva lokuttaraṃ saraṇagamananti dasseti.
By having Nibbāna as its object—by this, it shows that the attainment of the Four Noble Truths itself, in essence, is supramundane going for refuge.
Nibbānārammaṇaṃ hutvā (trở thành đối tượng là Nibbāna) – điều này cho thấy rằng về mặt ý nghĩa, sự thành tựu Tứ Thánh Đế chính là sự quy y siêu thế.
Tattha hi nibbānadhammo sacchikiriyābhisamayavasena, maggadhammo bhāvanābhisamayavasena paṭivijjhiyamānoyeva saraṇagamanattaṃ sādheti, buddhaguṇā pana sāvakagocarabhūtā pariññābhisamayavasena, tathā ariyasaṅghaguṇā.
For there, the Dhamma of Nibbāna, by way of realization and penetration, and the Dhamma of the path, by way of development and penetration, only accomplish the state of going for refuge when being penetrated. The virtues of the Buddha, however, being within the scope of disciples, are by way of comprehension and penetration, as are the virtues of the Noble Saṅgha.
Trong đó, pháp Nibbāna thành tựu tính chất quy y chỉ khi được thấu hiểu bằng cách chứng ngộ (sacchikiriyābhisamayavasena), và pháp Đạo thành tựu tính chất quy y chỉ khi được thấu hiểu bằng cách tu tập (bhāvanābhisamayavasena); còn các phẩm chất của Đức Phật được các đệ tử thấu hiểu bằng cách liễu tri (pariññābhisamayavasena), và tương tự như vậy với các phẩm chất của Tăng đoàn Thánh.
Tenāha ‘‘kiccato sakalepi ratanattaye ijjhatī’’ti, ijjhantañca saheva ijjhati, na lokiyaṃ viya paṭipāṭiyā asammohapaṭivedhena paṭividdhattāti adhippāyo.
Therefore, he says, " it is accomplished with respect to the entire Triple Gem in terms of function." And when it is accomplished, it is accomplished simultaneously, not sequentially like the worldly, due to being penetrated by undistracted penetration—this is the intention.
Do đó đã nói “về mặt hành động, nó thành tựu trong toàn bộ Tam Bảo”, và khi thành tựu, nó thành tựu đồng thời, không phải tuần tự như quy y thế gian, vì đã được thấu hiểu bằng sự thấu hiểu không mê lầm – đó là ý nghĩa.
Ye pana vadanti ‘‘na saraṇagamanaṃ nibbānārammaṇaṃ hutvā pavattati, maggassa adhigatattā pana adhigatameva hoti ekaccānaṃ tevijjādīnaṃ lokiyavijjādayo viyā’’ti, tesaṃ lokiyameva saraṇagamanaṃ siyā, na lokuttaraṃ, tañca ayuttaṃ duvidhassapi icchitabbattā.
But for those who say, "going for refuge does not arise with Nibbāna as its object; rather, because the path has been attained, it is already attained for some, like the worldly attainments of the Three Knowledges and so on," for them, it would be only worldly going for refuge, not supramundane, and that is inappropriate because both types are desirable.
Những ai nói rằng “sự quy y không phát sinh với Nibbāna làm đối tượng, mà là do Đạo đã được thành tựu, nên nó đã được thành tựu đối với một số người như tam minh, v.v., giống như các loại minh thế gian”, thì sự quy y của họ sẽ chỉ là thế gian, không phải siêu thế, và điều đó là không hợp lý vì cả hai loại đều được mong muốn.
Tanti lokiyasaraṇagamanaṃ.
That refers to worldly going for refuge.
Taṃ (điều đó) là sự quy y thế gian.
Saddhāpaṭilābho ‘‘sammāsambuddho bhagavā’’tiādinā.
The attainment of faith is indicated by "The Blessed One is the Perfectly Self-Enlightened One," and so on.
Saddhāpaṭilābho (sự thành tựu tín tâm) là “Đức Thế Tôn là Bậc Chánh Đẳng Giác” v.v.
Saddhāmūlikāti yathāvuttasaddhāpubbaṅgamā sammādiṭṭhi buddhasubuddhataṃ dhammasudhammataṃ saṅghasuppaṭipatiñca lokiyāvabodhavaseneva sammā ñāyena dassanato.
Rooted in faith means right view preceded by faith as described, because it correctly understands the Buddha's perfect enlightenment, the Dhamma's perfect exposition, and the Saṅgha's good practice through worldly comprehension.
Saddhāmūlikā (có tín tâm làm gốc) là chánh kiến có tín tâm đã nói trên làm tiền đề, do thấy sự giác ngộ tối thượng của Đức Phật, sự thù thắng của Giáo Pháp, và sự thực hành đúng đắn của Tăng đoàn bằng sự hiểu biết thế gian một cách đúng đắn.
‘‘Saddhāmūlikā sammādiṭṭhī’’ti etena saddhūpanissayā yathāvuttalakkhaṇā paññā lokiyasaraṇagamananti dasseti.
By "right view rooted in faith," he shows that the wisdom characterized as described and supported by faith is worldly going for refuge.
“Chánh kiến có tín tâm làm gốc” – điều này cho thấy rằng trí tuệ có đặc tính đã nói trên, có tín tâm làm chỗ nương tựa, chính là sự quy y thế gian.
Tenāha ‘‘diṭṭhijukammanti vuccatī’’ti ‘‘diṭṭhi eva attano paccayehi ujuṃ karīyatī’’ti katvā.
Therefore, he says, " it is called 'rectification of view'," meaning "view is made straight by its own conditions."
Do đó đã nói “được gọi là diṭṭhijukammaṃ” (hành động làm cho kiến giải ngay thẳng) vì “kiến giải được làm cho ngay thẳng bởi các duyên của chính nó”.
Diṭṭhi vā ujuṃ karīyati etenāti diṭṭhijukammaṃ, tathā pavatto cittuppādo.
Or, rectification of view is that by which view is made straight, and the mind-moment that arises thus.
Hoặc là, kiến giải được làm cho ngay thẳng bởi điều này nên là diṭṭhijukammaṃ (hành động làm cho kiến giải ngay thẳng), và tâm sinh khởi phát sinh như vậy.
Evañca katvā ‘‘tapparāyaṇatākārapavatto cittuppādo’’ti idañca vacanaṃ samatthitaṃ hoti.
And having done so, this statement, "the mind-moment that arises in the manner of having the Triple Gem as one's ultimate refuge," is also substantiated.
Và khi làm như vậy, câu “tâm sinh khởi phát sinh dưới hình thức nương tựa vào đó” cũng được chứng minh là đúng.
Saddhāpubbaṅgamasammādiṭṭhiggahaṇaṃ pana cittuppādassa tappadhānatāyāti daṭṭhabbaṃ.
However, the inclusion of right view preceded by faith should be understood as due to the predominance of the mind-moment (by these qualities).
Việc đề cập đến chánh kiến có tín tâm làm tiền đề cần được hiểu là do tâm sinh khởi đó chủ yếu là tín tâm.
‘‘Saddhāpaṭilābho’’ti iminā mātādīhi ussāhitadārakādīnaṃ viya ñāṇavippayuttasaraṇagamanaṃ dasseti, ‘‘sammādiṭṭhī’’ti iminā ñāṇasampayuttasaraṇagamanaṃ.
By "attainment of faith," he indicates going for refuge unconnected with knowledge, like that of children encouraged by their mothers; by "right view," he indicates going for refuge connected with knowledge.
Với “saddhāpaṭilābho” (sự thành tựu tín tâm), điều này cho thấy sự quy y không kèm theo trí tuệ, giống như của trẻ con được mẹ, v.v. khuyến khích; với “sammādiṭṭhī” (chánh kiến), điều này cho thấy sự quy y kèm theo trí tuệ.
Tayidaṃ lokiyaṃ saraṇagamanaṃ.
This refers to worldly going for refuge.
Tayidaṃ (điều này) là sự quy y thế gian.
Attā sanniyyātīyati appīyati pariccajīyati etenāti attasanniyyātanaṃ, yathāvuttaṃ diṭṭhijukammaṃ.
Attasanniyyātanaṃ means the surrender of oneself, being given up, abandoned, or sacrificed by this, which is the aforementioned rectification of view.
Attasanniyyātanaṃ (sự phó thác bản thân) là điều mà nhờ đó bản thân được phó thác, được dâng hiến, được từ bỏ – đó là diṭṭhijukammaṃ đã nói trên.
Taṃ ratanattayaṃ parāyaṇaṃ paṭisaraṇaṃ etassāti tapparāyaṇo, puggalo, cittuppādo vā, tassa bhāvo tapparāyaṇatā, yathāvuttadiṭṭhijukammameva.
That Triple Gem is its ultimate support, its refuge, hence tapparāyaṇo (one who has that as ultimate refuge), whether a person or a mind-moment; its state is tapparāyaṇatā, which is the same as the aforementioned rectification of view.
Tam Bảo đó là chỗ nương tựa, chỗ ẩn náu của người này nên là tapparāyaṇo (người nương tựa vào đó), là cá nhân, hoặc là tâm sinh khởi; trạng thái của người đó là tapparāyaṇatā (sự nương tựa vào đó), chính là diṭṭhijukammaṃ đã nói trên.
Saraṇanti adhippāyena sissabhāvaṃ antevāsikabhāvaṃ upagacchati etenāti sissabhāvūpagamanaṃ.
Sissabhāvūpagamanaṃ means the assumption of the state of a disciple or pupil, with the intention of taking refuge, by this.
Sissabhāvūpagamanaṃ (sự chấp nhận địa vị đệ tử) là điều mà nhờ đó người ta chấp nhận địa vị đệ tử, địa vị học trò, với ý nghĩa quy y.
Saraṇagamanādhippāyeneva paṇipatati etenāti paṇipāto.
One bows down with the intention of taking refuge, hence it is called prostration (paṇipāta).
Với ý định quy y mà lạy xuống, nên gọi là paṇipāto (đảnh lễ).
Sabbattha yathāvuttadiṭṭhijukammavaseneva attho veditabbo.
In all cases, the meaning should be understood in terms of the straightening of views as described.
Ở mọi nơi, ý nghĩa nên được hiểu theo cách làm cho chánh kiến trở nên ngay thẳng như đã nói.
Attapariccajananti saṃsāradukkhanittharaṇatthaṃ attano attabhāvassa pariccajanaṃ.
Sacrificing oneself (attapariccajana) means the abandoning of one's own existence (attabhāva) for the purpose of escaping the suffering of saṃsāra.
Attapariccajana (từ bỏ tự ngã) là sự từ bỏ tự thân của mình vì mục đích thoát khỏi khổ đau luân hồi.
Esa nayo sesesupi.
This method applies to the remaining ones as well.
Đây cũng là nguyên tắc cho những điều còn lại.
Buddhādīnaṃyevāti avadhāraṇaṃ itaresupi saraṇagamanavisesesu yathārahaṃ vattabbaṃ.
The emphatic particle " only of the Buddha and others" should be applied appropriately to other specific forms of taking refuge as well.
Sự nhấn mạnh chỉ đối với Đức Phật và những bậc khác (Buddhādīnaṃyevā) cũng nên được nói một cách thích hợp trong các loại quy y đặc biệt khác.
Evañhi tadaññanivattanaṃ kataṃ hoti.
For in this way, the exclusion of all others is accomplished.
Như vậy, sự loại bỏ những điều khác đã được thực hiện.
Evaṃ attasanniyātanādīni ekena pakārena dassetvā idāni aparehipi pakārehi dassetuṃ ‘‘apicā’’tiādi āraddhaṃ.
Having thus shown self-resignation and so on in one way, now the phrase " furthermore" and so on is begun to show them in other ways.
Sau khi trình bày sự phó thác tự ngã và những điều tương tự theo một cách, bây giờ để trình bày theo những cách khác, câu ‘‘apicā’’ (hơn nữa) và những câu tiếp theo đã được bắt đầu.
Tena pariyāyantarehipi attasanniyyātanādi katameva hoti atthassa abhinnattāti dasseti.
By this, it shows that self-resignation and so on are accomplished through other modes as well, as the meaning is not different.
Điều này cho thấy rằng sự phó thác tự ngã và những điều tương tự vẫn được thực hiện theo các phương pháp khác, vì ý nghĩa không khác biệt.
Āḷavakādīnanti ādi-saddena sātāgirihemavatādīnaṃ saṅgaho daṭṭhabbo.
In " Āḷavaka and others," the term " and others" should be understood to include Sātāgiri, Hemavata, and so on.
Trong Āḷavakādīna (những người như Āḷavaka), từ ādi (vân vân) nên được hiểu là bao gồm Sātāgiri, Hemavata và những vị khác.
Nanu cete āḷavakādayo maggeneva āgatasaraṇagamanā, kathaṃ tesaṃ tapparāyaṇatāsaraṇagamanaṃ vuttanti?
But surely, these Āḷavaka and others had refuge obtained through the path (magga), so how is their refuge of sole reliance mentioned?
Chẳng phải Āḷavaka và những vị này đã quy y thông qua Đạo sao? Làm sao có thể nói rằng sự quy y nương tựa họ đã được nói đến?
Maggenāgatasaraṇagamanehipi ‘‘so ahaṃ vicarissāmi gāmā gāma’’ntiādinā (saṃ. ni. 1.246) tehi tapparāyaṇatākārassa paveditattā tathā vuttaṃ.
Even in the case of refuge obtained through the path, it is stated thus because they declared the characteristic of sole reliance, as in "Therefore, I shall wander from village to village" and so on.
Mặc dù sự quy y đến từ Đạo, nhưng vì họ đã tuyên bố sự nương tựa đó bằng câu ‘‘so ahaṃ vicarissāmi gāmā gāma’’ (Ta sẽ du hành từ làng này sang làng khác) và những câu tương tự (Saṃ. Ni. 1.246), nên đã được nói như vậy.
Ñāti…pe… vasenāti ettha ñātivasena bhayavasena ācariyavasena dakkhiṇeyyavasenāti paccekaṃ ‘‘vasenā’’ti padaṃ yojetabbaṃ.
In "by kin…pe… by means of", the word "by means of" should be connected individually with "by means of kin," "by means of fear," "by means of a teacher," and "by means of one worthy of offerings."
Ở đây, trong ñāti…pe… vasenā (theo cách thân thuộc… vân vân), từ ‘‘vasenā’’ (theo cách) nên được ghép riêng với ñātivasena (theo cách thân thuộc), bhayavasena (theo cách sợ hãi), ācariyavasena (theo cách thầy), dakkhiṇeyyavasena (theo cách đáng cúng dường).
Tattha ñātivasenāti ñātibhāvavasena.
Therein, by means of kin means by way of kinship.
Trong đó, ñātivasenā (theo cách thân thuộc) là theo cách của thân thuộc.
Evaṃ sesesupi.
The same applies to the remaining ones.
Tương tự cho những điều còn lại.
Dakkhiṇeyyapaṇipātenāti dakkhiṇeyyatāhetukena paṇipātena.
By the prostration of one worthy of offerings means by prostration due to being worthy of offerings.
Dakkhiṇeyyapaṇipātena (bằng sự đảnh lễ đáng cúng dường) là sự đảnh lễ do đáng cúng dường.
Itarehīti ñātibhāvādivasappavattehi tīhi paṇipātehi.
By others means by the three prostrations arising from kinship and so on.
Itarehī (bởi những cái khác) là bởi ba sự đảnh lễ phát sinh do cách thân thuộc và những điều tương tự.
Itarehītiādinā saṅkhepato vuttamatthaṃ vitthārato dassetuṃ ‘‘tasmā’’tiādi vuttaṃ.
To explain in detail the meaning stated concisely by " by others" and so on, the phrase " therefore" and so on is mentioned.
Để trình bày chi tiết ý nghĩa đã được nói tóm tắt bằng itarehī (bởi những cái khác) và những câu tương tự, câu ‘‘tasmā’’ (do đó) và những câu tiếp theo đã được nói.
Vandatīti paṇipātassa lakkhaṇavacanaṃ.
Worships is a term indicating the characteristic of prostration.
Vandatī (kính lễ) là từ chỉ đặc tính của sự đảnh lễ.
Evarūpanti diṭṭhadhammikaṃ sandhāya vadati.
Such a kind of refers to what is seen in this present life.
Evarūpa (như vậy) nói đến điều thuộc hiện tại.
Samparāyikañhi niyyānikaṃ vā anusāsanaṃ paccāsīsanto dakkhiṇeyyapaṇipātameva karotīti adhippāyo.
For the intention is that one who aspires to beneficial teaching for the future or leading to liberation performs only the prostration due to one worthy of offerings.
Ý nghĩa là: người mong cầu lời giáo huấn đưa đến lợi ích ở đời sau hoặc sự giải thoát thì thực hiện sự đảnh lễ đáng cúng dường.
Saraṇagamanappabhedoti saraṇagamanavibhāgo.
Division of taking refuge means the classification of taking refuge.
Saraṇagamanappabhedo (phân loại quy y) là sự phân chia quy y.
Niccato anupagamanādivasenāti niccanti aggahaṇādivasena.
By means of non-approaching as permanent and so on means by way of not grasping as permanent and so on.
Niccato anupagamanādivasenā (theo cách không chấp thủ thường hằng) là theo cách không chấp thủ là thường hằng, vân vân.
Aṭṭhānanti hetupaṭikkhepo.
It is impossible is the rejection of the cause.
Aṭṭhāna (không thể có) là sự phủ nhận nguyên nhân.
Anavakāsoti paccayapaṭikkhepo.
It is impossible is the rejection of the condition.
Anavakāso (không có cơ hội) là sự phủ nhận duyên.
Ubhayenapi kāraṇameva paṭikkhipati.
By both, the reason itself is rejected.
Cả hai đều phủ nhận nguyên nhân.
Yanti yena kāraṇena.
That means by which reason.
Yaṃ (điều gì) là do nguyên nhân nào.
Diṭṭhisampannoti maggadiṭṭhiyā sampanno sotāpanno.
Endowed with right view is a stream-enterer (sotāpanna) endowed with path-view.
Diṭṭhisampanno (người thành tựu chánh kiến) là bậc Dự lưu đã thành tựu chánh kiến Đạo.
Kañci saṅkhāranti catubhūmakesu saṅkhatasaṅkhāresu ekasaṅkhārampi.
Any conditioned phenomenon means even one conditioned phenomenon among the conditioned phenomena in the four planes of existence.
Kañci saṅkhāra (bất kỳ hành nào) là dù chỉ một hành trong các hành hữu vi thuộc bốn cõi.
Niccato upagaccheyyāti ‘‘nicco’’ti gaṇheyya.
He would approach as permanent means he would grasp as "permanent."
Niccato upagaccheyyā (có thể chấp thủ là thường hằng) là chấp thủ là ‘‘thường hằng’’.
Sukhato upagaccheyyāti ‘‘ekantasukhī attā hoti arogo paraṃ maraṇā’’ti (dī. ni. 1.76) evaṃ attadiṭṭhivasena sukhato gāhaṃ sandhāyetaṃ vuttaṃ.
He would approach as pleasant refers to grasping as pleasant by way of the view of self, as in "the self is absolutely happy, free from illness after death."
Sukhato upagaccheyyā (có thể chấp thủ là lạc) là điều này được nói đến sự chấp thủ là lạc theo tà kiến về tự ngã, như ‘‘tự ngã hoàn toàn an lạc, không bệnh tật sau khi chết’’ (Dī. Ni. 1.76).
Diṭṭhivippayuttacittena pana ariyasāvako pariḷāhavūpasamanatthaṃ mattahatthiparittāsito viya cokkhabrāhmaṇo ukkārabhūmiṃ kañci saṅkhāraṃ sukhato upagacchati.
However, a noble disciple, with a mind disassociated from views, approaches some conditioned phenomenon as pleasant, just as a clean brahmin, terrified by a rogue elephant, approaches a heap of rubbish for the sake of calming distress.
Tuy nhiên, một Thánh đệ tử với tâm không bị tà kiến chi phối, để xoa dịu sự nóng nảy, chấp thủ một hành nào đó là lạc, giống như một Bà-la-môn thanh tịnh bị voi điên hăm dọa trên bãi rác.
Attavāre kasiṇādipaññattisaṅgahaṇatthaṃ ‘‘saṅkhāra’’nti avatvā ‘‘kañci dhamma’’nti vuttaṃ.
To include the designation of kasiṇa and so on in the case of self-views, it is stated as " any phenomenon" instead of "conditioned phenomenon."
Để bao gồm sự chế định về đề mục kasiṇa, vân vân, trong trường hợp tự ngã, đã nói ‘‘kañci dhamma’’ (bất kỳ pháp nào) thay vì ‘‘saṅkhāra’’ (hành).
Imesupi vāresu catubhūmakavaseneva paricchedo veditabbo tebhūmakavaseneva vā.
In these cases also, the classification should be understood in terms of the four planes of existence or in terms of the three planes of existence.
Trong những trường hợp này, sự phân định cũng nên được hiểu theo cách bốn cõi hoặc theo cách ba cõi.
Yaṃ yañhi puthujjano gāhavasena gaṇhāti, tato tato ariyasāvako gāhaṃ viniveṭheti.
For whatever a worldling (puthujjana) grasps by way of grasping, from that the noble disciple disentangles the grasping.
Phàm phu chấp thủ điều gì bằng sự chấp thủ, thì Thánh đệ tử tháo gỡ sự chấp thủ đó khỏi điều đó.
Mātarantiādīsu janikā mātā, janako pitā, manussabhūto khīṇāsavo arahāti adhippeto.
In " mother" and so on, "mother" is the birth-giver, "father" is the progenitor, and the human Arahant, whose defilements are destroyed, is intended by arahā.
Trong Mātara (mẹ) và những từ tương tự, mẹ là người sinh ra, cha là người sinh ra, Arahā là bậc A-la-hán đã diệt tận các lậu hoặc, người đã thành tựu nhân loại.
Kiṃ pana ariyasāvako aññaṃ jīvitā voropeyyāti?
Would a noble disciple deprive another of life?
Vậy Thánh đệ tử có thể tước đoạt mạng sống của người khác không?
Etampi aṭṭhānaṃ, puthujjanabhāvassa pana mahāsāvajjabhāvadassanatthaṃ ariyasāvakassa phaladīpanatthañcevaṃ vuttaṃ.
This too is impossible, but it is stated thus to show the great culpability of being a worldling and to highlight the fruit of a noble disciple.
Điều này cũng là không thể có, nhưng để cho thấy sự nguy hiểm lớn của trạng thái phàm phu và để làm sáng tỏ quả vị của Thánh đệ tử, đã nói như vậy.
Duṭṭhacitto vadhakacittena paduṭṭhacitto.
With a corrupt mind means with a mind corrupted by the intention to kill.
Duṭṭhacitto (tâm ác) là tâm bị ô nhiễm với ý định giết hại.
Lohitaṃ uppādeyyāti jīvamānakasarīre khuddakamakkhikāya pivanamattampi lohitaṃ uppādeyya.
He would cause blood to flow means he would cause even a small amount of blood, enough for a tiny fly to drink, to flow from a living body.
Lohitaṃ uppādeyyā (có thể làm chảy máu) là làm chảy dù chỉ một lượng máu nhỏ như một con ruồi hút trên cơ thể đang sống.
Saṅghaṃ bhindeyyāti samānasaṃvāsakaṃ samānasīmāyaṃ ṭhitaṃ saṅghaṃ ‘kammena uddesena voharanto anussāvanena salākaggāhenā’’ti (pari. 458) evaṃ vuttehi pañcahi kāraṇehi bhindeyya.
He would split the Saṅgha means he would split the Saṅgha, who dwell in harmony and within the same boundary, by these five methods mentioned as "by action, by purpose, by speaking, by announcement, by voting."
Saṅghaṃ bhindeyyā (có thể phá hòa hợp Tăng) là phá hòa hợp Tăng đang sống chung và ở trong cùng một giới hạn, bằng năm nguyên nhân đã được nói đến: ‘‘bằng hành động, bằng mục đích, bằng lời nói, bằng sự nhắc nhở, bằng cách lấy phiếu bầu’’ (Pari. 458).
Aññaṃ satthāranti aññaṃ titthakaraṃ ‘‘ayaṃ me satthā’’ti evaṃ gaṇheyyāti netaṃ ṭhānaṃ vijjatīti attho.
Another teacher means that he would accept another sect leader as "this is my teacher" – that is not possible is the meaning.
Aññaṃ satthāra (một vị thầy khác) là chấp nhận một vị ngoại đạo khác là ‘‘vị thầy của tôi’’, ý nghĩa là netaṃ ṭhānaṃ vijjatī (điều đó không thể có).
Dasahi ṭhānehīti dasahi kāraṇehi.
By ten points means by ten reasons.
Dasahi ṭhānehī (bằng mười điều) là bằng mười nguyên nhân.
Adhiggaṇhantīti adhibhavanti.
They excel means they surpass.
Adhiggaṇhantī (vượt trội) là chiến thắng.
Velāmasuttādivasenāpīti ettha ‘‘caturāsītisahassasaṅkhānaṃ suvaṇṇapātirūpiyapātikaṃsapātīnaṃ yathākkamaṃ rūpiyasuvaṇṇahiraññapūrānaṃ karīsassa catutthabhāvappamāṇānaṃ sabbālaṅkārapaṭimaṇḍitānaṃ caturāsītiyā hatthisahassānaṃ caturāsītiyā assasahassānaṃ caturāsītiyā rathasahassānaṃ caturāsītiyā dhenusahassānaṃ caturāsītiyā kaññāsahassānaṃ caturāsītiyā pallaṅkasahassānaṃ caturāsītiyā vatthakoṭisahassānaṃ aparimāṇassa ca khajjabhojjādibhedassa āhārassa pariccajanavasena sattamāsādhikāni satta saṃvaccharāni nirantaraṃ pavattavelāmamahādānato ekassa sotāpannassa dinnadānaṃ mahapphalataraṃ, tato sataṃ sotāpannānaṃ dinnadānato ekassa sakadāgāmissa, tato ekassa anāgāmissa, tato ekassa arahato, tato ekassa paccekabuddhassa, tato sammāsambuddhassa, tato buddhappamukhassa saṅghassa dinnadānaṃ mahapphalataraṃ, tato cātuddisaṃ saṅghaṃ uddissa vihārakaraṇaṃ, tato saraṇagamanaṃ mahapphalatara’’nti imamatthaṃ dīpentassa velāmasuttassa (a. ni. 9.20) vasena.
Also by means of the Velāma Sutta and so on refers to the Velāma Sutta, which illustrates this meaning: "A donation given to a stream-enterer is more fruitful than the great donation of Velāma the brahmin, which he gave continuously for seven years and seven months, consisting of 84,000 golden, silver, and bronze bowls filled with silver, gold, and jewels respectively, and an amount of excrement equal to a fourth part of the earth, and 84,000 elephants adorned with all ornaments, 84,000 horses, 84,000 chariots, 84,000 cows, 84,000 maidens, 84,000 couches, 84,000 million garments, and immeasurable food of various kinds. More fruitful than that is a donation to a hundred stream-enterers. More fruitful than that is a donation to a once-returner. More fruitful than that is a donation to a non-returner. More fruitful than that is a donation to an Arahant. More fruitful than that is a donation to a Paccekabuddha. More fruitful than that is a donation to a Sammāsambuddha. More fruitful than that is a donation to the Saṅgha headed by the Buddha. More fruitful than that is the construction of a monastery for the Saṅgha of the four directions. More fruitful than that is taking refuge."
Velāmasuttādivasenāpī (cũng theo kinh Velāma và những kinh khác) ở đây, theo kinh Velāma (A. Ni. 9.20) đã làm sáng tỏ ý nghĩa này: ‘‘Bố thí cho một bậc Dự lưu có quả lớn hơn đại thí của Bà-la-môn Velāma, người đã liên tục cúng dường trong bảy năm và bảy tháng, với 84.000 bát vàng, bát bạc, bát đồng, chứa đầy vàng, bạc, châu báu tương ứng, với số lượng phân bón bằng một phần tư, 84.000 con voi được trang sức đầy đủ, 84.000 con ngựa, 84.000 cỗ xe, 84.000 con bò cái, 84.000 thiếu nữ, 84.000 chiếc giường, 84.000 vạn y phục, và thức ăn không giới hạn bao gồm các loại thực phẩm ăn và uống. Bố thí cho một bậc Nhất lai có quả lớn hơn bố thí cho một trăm bậc Dự lưu. Bố thí cho một bậc Bất lai có quả lớn hơn bố thí cho một bậc Nhất lai. Bố thí cho một bậc A-la-hán có quả lớn hơn bố thí cho một bậc Bất lai. Bố thí cho một vị Độc Giác Phật có quả lớn hơn bố thí cho một bậc A-la-hán. Bố thí cho một vị Chánh Đẳng Giác có quả lớn hơn bố thí cho một vị Độc Giác Phật. Bố thí cho Tăng chúng do Phật dẫn đầu có quả lớn hơn bố thí cho một vị Chánh Đẳng Giác. Xây dựng một ngôi chùa cho Tăng chúng bốn phương có quả lớn hơn bố thí cho Tăng chúng do Phật dẫn đầu. Quy y có quả lớn hơn xây dựng chùa’’.
Vuttañhetaṃ ‘‘yaṃ gahapati, velāmo brāhmaṇo dānaṃ adāsi mahādānaṃ, yo ekaṃ diṭṭhisampannaṃ bhojeyya, idaṃ tato mahapphalatara’’ntiādi (a. ni. 9.20).
Indeed, this was said: "Whatever great donation Velāma the brahmin gave, householder, if one feeds a person endowed with right view, this is more fruitful than that," and so on.
Điều này đã được nói: ‘‘Này gia chủ, đại thí mà Bà-la-môn Velāma đã cúng dường, ai cúng dường cho một người thành tựu chánh kiến, điều đó có quả lớn hơn’’ và những câu tương tự (A. Ni. 9.20).
Velāmasuttādīti ādi-saddena aggappasādasuttādīnaṃ (a. ni. 4.34; itivu. 90) saṅgaho daṭṭhabbo.
In " Velāma Sutta and so on," the term " and so on" should be understood to include the Aggappasāda Sutta and others.
Trong Velāmasuttādī (kinh Velāma và những kinh khác), từ ādi (vân vân) nên được hiểu là bao gồm kinh Aggappasāda (A. Ni. 4.34; Itivu. 90) và những kinh khác.
Aññāṇaṃ vatthuttayassa guṇānaṃ ajānanaṃ tattha sammoho, ‘‘buddho nu kho, na nu kho buddho’’tiādinā vicikicchā saṃsayo, micchāñāṇaṃ tassa guṇānaṃ aguṇabhāvaparikappanena viparītaggāho.
Ignorance is not knowing the qualities of the Triple Gem, confusion about them. Doubt is indecision as in "Is he a Buddha or not a Buddha?" Wrong knowledge is the perverse grasping by conceiving his qualities as non-qualities.
Aññāṇaṃ (vô minh) là sự không biết các phẩm chất của Tam Bảo, sự si mê về điều đó; saṃsayo (nghi ngờ) là sự hoài nghi ‘‘Phật có phải là Phật không, không phải là Phật không’’ và những điều tương tự; micchāñāṇaṃ (tà kiến) là sự chấp thủ sai lầm bằng cách suy diễn phẩm chất của Ngài thành không phẩm chất.
Ādi-saddena anādarāgāravādīnaṃ saṅgaho.
The term " and so on" includes disrespect, lack of reverence, and so on.
Từ ādi (vân vân) bao gồm sự không tôn kính, không cung kính và những điều tương tự.
Na mahājutikanti na ujjalaṃ, aparisuddhaṃ apariyodātanti attho.
"Not greatly resplendent" means not brilliant, impure, not purified.
Na mahājutika (không rực rỡ) nghĩa là không chói sáng, không trong sạch, không thanh tịnh.
Na mahāvipphāranti anuḷāraṃ.
"Not greatly widespread" means not extensive.
Na mahāvipphāra (không rộng lớn) nghĩa là không vĩ đại.
Sāvajjoti diṭṭhitaṇhādivasena sadoso.
"Faulty" means defiled due to wrong views, craving, and so on.
Sāvajjo (có lỗi) nghĩa là có khuyết điểm do tà kiến, tham ái, v.v.
Lokiyaṃ saraṇagamanaṃ sikkhāsamādānaṃ viya aggahitakālaparicchedaṃ jīvitapariyantameva hoti, tasmā tassa khandhabhedena bhedoti āha ‘‘anavajjo kālakiriyāyā’’ti.
Worldly going for refuge, like the undertaking of precepts, has no set time limit but lasts only until the end of one's life. Therefore, it is broken by the breaking of the aggregates. Thus, it says "faultless at the time of death".
Sự quy y thế gian, giống như việc thọ trì giới, không có giới hạn thời gian mà chỉ kéo dài đến hết đời; do đó, nó bị hủy diệt khi thân hoại. Vì vậy, (văn bản) nói: “anavajjo kālakiriyāyā” (không có lỗi về sự chết).
Soti anavajjo saraṇagamanabhedo.
"That" refers to the faultless breaking of going for refuge.
So (nó) nghĩa là sự hủy diệt của quy y không có lỗi.
Satipi anavajjatte iṭṭhaphalopi na hotīti āha ‘‘aphalo’’ti.
Even if it is faultless, it does not yield a desired fruit. Thus, it says "fruitless".
Mặc dù không có lỗi, nhưng cũng không có quả mong muốn, vì vậy (văn bản) nói: “aphalo” (không có quả).
Ko upāsakoti sarūpapucchā, tasmā kiṃlakkhaṇo upāsakoti vuttaṃ hoti.
"Who is a lay follower?" is a question about its nature; therefore, it means "what are the characteristics of a lay follower?"
Ko upāsako (Ai là cư sĩ?) là câu hỏi về bản chất, do đó nó có nghĩa là "cư sĩ có đặc điểm gì?".
Kasmāti hetupucchā.
"Why?" is a question about the reason.
Kasmā (Tại sao?) là câu hỏi về nguyên nhân.
Tena kena pavattinimittena upāsakasaddo tasmiṃ puggale niruḷhoti dasseti.
It shows by what originating cause the term "lay follower" is established in that person.
Điều này cho thấy từ "upāsaka" (cư sĩ) được dùng để chỉ người đó dựa trên nguyên nhân nào.
Kimassa sīlanti kīdisaṃ assa upāsakassa sīlaṃ, kittakena sīlenāyaṃ sīlasampanno nāma hotīti attho.
"What is his virtue?" means what kind of virtue does this lay follower possess, and by how much virtue is he called endowed with virtue?
Kimassa sīla (Giới của người đó là gì?) nghĩa là giới của cư sĩ đó như thế nào, người này được gọi là người đầy đủ giới hạnh với bao nhiêu giới.
Ko ājīvoti ko assa sammāājīvo, so pana micchājīvassa parivajjanena hotīti sopi vibhajīyatīti.
"What is his livelihood?" means what is his right livelihood. This is achieved by avoiding wrong livelihood, and thus it is also explained.
Ko ājīvo (Sinh kế là gì?) nghĩa là sinh kế chân chánh của người đó là gì, và nó được phân tích bằng cách tránh tà mạng.
Kā vipattīti kā assa sīlassa, ājīvassa vā vipatti.
"What is his downfall?" means what is the downfall of his virtue or livelihood.
Kā vipattī (Sự bại hoại là gì?) nghĩa là sự bại hoại của giới hoặc sinh kế của người đó.
Anantarassa hi vidhi vā paṭisedho vā.
For what is immediately subsequent, there is either a rule or a prohibition.
Vì ngay sau đó là quy tắc hoặc sự cấm đoán.
Kā sampattīti etthāpi eseva nayo.
"What is his success?" — the same applies here.
Kā sampattī (Sự thành tựu là gì?) cũng theo cách tương tự.
Yo kocīti khattiyādīsu yo koci.
"Whoever" means any person among khattiyas and so on.
Yo kocī (Bất cứ ai) nghĩa là bất cứ ai trong các giai cấp như Khattiya (sát đế lợi).
Tena saraṇagamanamevettha kāraṇaṃ, na jātiādivisesoti dasseti.
It thus shows that going for refuge alone is the cause here, not distinctions of birth and so on.
Điều này cho thấy rằng sự quy y là nguyên nhân ở đây, chứ không phải các đặc điểm như giai cấp.
Upāsanatoti teneva saraṇagamanena tattha ca sakkaccakāritāya ādaragāravabahumānādiyogena payirupāsanato.
"By associating" means by associating, by diligent practice, by showing respect, reverence, and high esteem through that very going for refuge.
Upāsanato (Do phụng sự) nghĩa là do phụng sự với sự tôn kính, quý trọng và ngưỡng mộ, v.v., thông qua sự quy y đó và sự thực hành cẩn trọng.
Veramaṇiyoti veraṃ vuccati pāṇātipātādidussīlyaṃ, tassa maṇanato hananato vināsanato veramaṇiyo, pañca viratiyo viratippadhānattā tassa sīlassa.
"Abstinences" (veramaṇiyo) refers to the abstinences from hostility (vera), which is misconduct like killing living beings; it is the abstaining from, eliminating, and destroying of this hostility, meaning the five abstinences, because virtue (sīla) is principally comprised of these abstinences.
Veramaṇiyo (Các sự kiêng cữ) nghĩa là sự kiêng cữ, sự đoạn trừ, sự hủy diệt của "vera" (oán thù), tức là sự ác hạnh như sát sinh, v.v. Đó là năm sự kiêng cữ, vì giới đó chủ yếu là sự kiêng cữ.
Tenevāha tattha tattha ‘‘paṭivirato hotī’’ti.
For this reason, it is said in various places, "he abstains".
Vì vậy, ở nhiều nơi (văn bản) nói: “paṭivirato hotī” (người ấy kiêng cữ).
Micchāvaṇijjāti na sammāvaṇijjā ayuttavaṇijjā asāruppavaṇijjā.
"Wrong livelihood" means not right livelihood, improper livelihood, unsuitable livelihood.
Micchāvaṇijjā (Tà nghiệp) nghĩa là nghiệp không chân chánh, nghiệp không phù hợp, nghiệp không thích đáng.
Pahāyāti akaraṇeneva pajahitvā.
"Abandoning" means abandoning by not engaging in it.
Pahāyā (Từ bỏ) nghĩa là từ bỏ bằng cách không thực hiện.
Dhammenāti dhammato anapetena.
"Righteously" means not deviating from the Dhamma.
Dhammenā (Theo pháp) nghĩa là không sai lệch khỏi pháp.
Tena aññampi adhammikaṃ jīvikaṃ paṭikkhipati.
Thereby, any other unrighteous livelihood is also rejected.
Điều này cũng bác bỏ các sinh kế phi pháp khác.
Samenāti avisamena.
"Equitably" means without unfairness.
Samenā (Bình đẳng) nghĩa là không bất bình đẳng.
Tena kāyavisamādiduccaritaṃ vajjetvā kāyasamādinā sucaritena jīvanaṃ dasseti.
Thereby, it shows living a good life with bodily rectitude, avoiding bodily misconduct and other wrong conduct.
Điều này cho thấy cuộc sống bằng thiện hạnh, tránh các ác hạnh như thân bất bình đẳng.
Satthavaṇijjāti āvudhabhaṇḍaṃ katvā vā kāretvā vā yathākataṃ vā paṭilabhitvā tassa vikkayo.
"Weapon trading" is the selling of weapons, whether one makes them, has them made, or acquires them as they are.
Satthavaṇijjā (Buôn bán vũ khí) nghĩa là chế tạo, hoặc sai người chế tạo, hoặc nhận vũ khí đã chế tạo rồi bán.
Satthavaṇijjāti manussavikkayo.
"Living beings trading" is the selling of human beings.
Sattavaṇijjā (Buôn bán chúng sinh) nghĩa là buôn bán người.
Maṃsavaṇijjāti sūnakārādayo viya migasūkarādike posetvā maṃsaṃ sampādetvā vikkayo.
"Meat trading" is the selling of meat, having acquired it by raising deer, pigs, etc., like butchers do.
Maṃsavaṇijjā (Buôn bán thịt) nghĩa là nuôi các loài vật như hươu, heo, v.v., rồi làm thịt và bán, giống như những người bán thịt.
Majjavaṇijjāti yaṃ kiñci majjaṃ yojetvā tassa vikkayo.
"Intoxicant trading" is the selling of any kind of intoxicant, having prepared it.
Majjavaṇijjā (Buôn bán rượu) nghĩa là chế biến bất kỳ loại rượu nào rồi bán.
Visavaṇijjāti visaṃ yojetvā, visaṃ gahetvā vā tassa vikkayo.
"Poison trading" is the selling of poison, having prepared it or acquired it.
Visavaṇijjā (Buôn bán chất độc) nghĩa là chế biến chất độc, hoặc lấy chất độc rồi bán.
Tattha satthavaṇijjā paroparodhanimittatāya akaraṇīyā vuttā, sattavaṇijjā abhujissabhāvakaraṇato, maṃsavisavaṇijjā vadhahetuto, majjavaṇijjā pamādaṭṭhānato.
Among these, weapon trading is said to be prohibited because it causes harm to others; living beings trading because it causes unfreedom; meat and poison trading because they are causes of killing; and intoxicant trading because it is a cause of heedlessness.
Trong đó, buôn bán vũ khí được nói là không nên làm vì gây hại cho người khác; buôn bán chúng sinh vì biến thành nô lệ; buôn bán thịt và chất độc vì là nguyên nhân của sự giết hại; buôn bán rượu vì là nguyên nhân của sự phóng dật.
Tassevāti pañcaveramaṇilakkhaṇassa sīlassa ceva pañcamicchāvaṇijjālakkhaṇassa ājīvassa ca.
"Of that very thing" means of the virtue characterized by the five abstinences and the livelihood characterized by the five wrong trades.
Tassevā (Của chính nó) nghĩa là của giới có đặc điểm năm sự kiêng cữ và của sinh kế có đặc điểm năm tà nghiệp.
Vipattīti bhedo pakopo ca.
"Downfall" means breaking and corruption.
Vipattī (Sự bại hoại) nghĩa là sự hủy hoại và sự rối loạn.
Yāyāti yāya paṭipattiyā.
"By which" means by which practice.
Yāyā (Bằng sự thực hành nào) nghĩa là bằng sự thực hành nào.
Caṇḍāloti upāsakacaṇḍālo.
"Outcaste" means a lay follower outcaste.
Caṇḍālo (Kẻ hạ tiện) nghĩa là cư sĩ hạ tiện.
Malanti upāsakamalaṃ.
"Stain" means a lay follower's stain.
Mala (Uế tạp) nghĩa là uế tạp của cư sĩ.
Patikiṭṭhoti upāsakanihīno.
"Degenerate" means a low-grade lay follower.
Patikiṭṭho (Kẻ thấp kém) nghĩa là cư sĩ thấp kém.
Buddhādīsu kammakammaphalesu ca saddhāvipariyāyo assaddhiyaṃ micchādhimokkho.
In the Buddhas and others, and in actions and their results, a reversal of faith is lack of faith, wrong conviction.
Sự bất tín, tà kiến về đức Phật và các vị khác, về nghiệp và quả của nghiệp.
Yathāvuttena assaddhiyena samannāgato assaddho.
"Faithless" is one endowed with the aforementioned lack of faith.
Người đầy đủ sự bất tín như đã nói được gọi là assaddho (không có tín tâm).
Yathāvutta sīlavipatti ājīvavipattivasena dussīlo.
"Unvirtuous" by means of the aforementioned downfall of virtue and downfall of livelihood.
Người dussīlo (giới hạnh xấu) do sự bại hoại về giới và sự bại hoại về sinh kế như đã nói.
‘‘Iminā diṭṭhādinā idaṃ nāma maṅgalaṃ bhavissatī’’ti evaṃ bālajanaparikappitakotūhalasaṅkhātena diṭṭhasutamutamaṅgalena samannāgato kotūhalamaṅgaliko.
"Superstitious about omens and rituals" is one endowed with omens and rituals seen, heard, and imagined, which are foolishly conjectured as "this auspicious sign will bring such and such good fortune."
Người kotūhalamaṅgaliko (tin vào điềm lành) là người đầy đủ các điềm lành được thấy, nghe, biết, được những người ngu tưởng tượng như "nhờ điềm lành này sẽ có điềm lành nọ".
Maṅgalaṃ paccetīti diṭṭhamaṅgalādibhedaṃ maṅgalameva pattiyāyati.
"Believes in omens" means he believes in omens, which are of the various kinds of omens seen and so on.
Maṅgalaṃ paccetī (Tin vào điềm lành) nghĩa là tin tưởng vào các điềm lành như điềm lành được thấy.
No kammanti kammassakataṃ no pattiyāyati.
"Not in kamma" means he does not believe in the ownership of kamma.
No kamma (Không nghiệp) nghĩa là không tin vào nghiệp báo.
Ito bahiddhāti ito sabbaññubuddhasāsanato bahiddhā bāhirakasamaye.
"Outside of this" means outside of this teaching of the Omniscient Buddha, in external doctrines.
Ito bahiddhā (Bên ngoài đây) nghĩa là bên ngoài giáo pháp của Đức Phật Toàn Giác, trong các học thuyết ngoại đạo.
Dakkhiṇeyyaṃ pariyesatīti duppaṭipannaṃ dakkhiṇārahasaññī gavesati.
"Seeks for those worthy of offerings" means he searches for those who are wrongly practiced, believing them to be worthy of offerings.
Dakkhiṇeyyaṃ pariyesatī (Tìm kiếm người đáng cúng dường) nghĩa là tìm kiếm người hành ác nhưng lại cho là đáng cúng dường.
Pubbakāraṃ karotīti dānamānanādikaṃ kusalakiriyaṃ paṭhamaṃ karoti.
"Performs the initial act" means he first performs wholesome actions such as giving and honoring.
Pubbakāraṃ karotī (Thực hiện sự ưu tiên) nghĩa là thực hiện trước các hành động thiện như bố thí, tôn kính.
Ettha ca dakkhiṇeyyapariyesanapubbakāre ekaṃ katvā pañca dhammā veditabbā.
Here, taking the seeking of worthy recipients and the initial act as one, five qualities should be understood.
Ở đây, cần hiểu năm pháp bằng cách gộp sự tìm kiếm người đáng cúng dường và sự ưu tiên thành một.
Pāṇehi upetanti iminā tassa saraṇagamanassa āpāṇakoṭikataṃ dassento ‘‘yāva me jīvitaṃ pavattatī’’tiādinā vatvā puna jīvitena taṃ vatthuttayaṃ paṭipūjento ‘‘saraṇagamanaṃ rakkhāmī’’ti uppannaṃ tassa brāhmaṇassa adhippāyaṃ vibhāvento ‘‘ahañhī’’tiādimāha.
"Endowed with life": by this, showing that his going for refuge is until the end of his life, having said "as long as my life continues" and so on, then honoring the Triple Gem with his life, he explains the intention that arose in that Brahmin, "I will protect my going for refuge," and thus he says "for I" and so on.
Pāṇehi upeta (Đầy đủ sự sống) – bằng điều này, để cho thấy sự quy y đó kéo dài đến cuối đời, sau khi nói "chừng nào tôi còn sống", v.v., rồi lại cúng dường Tam Bảo bằng sinh mạng, làm rõ ý định của vị Bà-la-môn đó là "tôi sẽ giữ gìn sự quy y", (văn bản) nói "ahañhī" (chính tôi), v.v.
Pāṇehi upetanti hi yāva me pāṇā dharanti, tāva saraṇaṃ upetaṃ, upento ca na vācāmattena, na ekavāraṃ cittuppādanamattena, atha kho pāṇe pariccajitvāpi yāvajīvaṃ upetanti evamettha attho veditabboti.
Indeed, "endowed with life" means that as long as my life persists, I have gone for refuge. And one goes for refuge not merely by word, nor by a single thought, but by sacrificing life, for as long as one lives. This is how the meaning here should be understood.
Pāṇehi upeta (Đầy đủ sự sống) nghĩa là chừng nào tôi còn sống, chừng đó tôi quy y, và sự quy y đó không chỉ bằng lời nói, không chỉ bằng một lần khởi tâm, mà là quy y suốt đời, ngay cả khi phải từ bỏ sinh mạng. Nghĩa là như vậy cần được hiểu ở đây.
57. Āyasmā sāriputtoti ettha iti-saddo ādiattho, evamādikanti attho.
57. In "Venerable Sāriputta", the word iti has the sense of 'and so on', meaning 'and so forth'.
57. Trong Āyasmā Sāriputto (Đại đức Sāriputta), từ iti có nghĩa là "vân vân", tức là "và những điều tương tự".
Tena ‘‘bhikkhū āmantesī’’tiādikaṃ sabbaṃ suttaṃ saṅgaṇhāti.
Thereby, it encompasses the entire Sutta, starting with "He addressed the bhikkhus" and so on.
Điều này bao gồm toàn bộ bài kinh, bắt đầu bằng "bhikkhū āmantesī" (Đức Phật gọi các Tỳ-kheo), v.v.
Tenāha ‘‘anaṅgaṇasutta’’nti.
Therefore, it says "the Anaṅgaṇa Sutta".
Vì vậy, (văn bản) nói: "anaṅgaṇasutta" (kinh Anaṅgaṇa).
Tassa ko nikkhepo?
What is its deposit?
Sự trình bày của nó là gì?
Attajjhāsayo.
His own resolve.
Là ý định của chính mình.
Parehi anajjhiṭṭhoyeva hi mahāthero imaṃ desanaṃ ārabhi.
Indeed, the Mahāthera initiated this teaching without being requested by others.
Vì Đại Trưởng lão đã bắt đầu bài thuyết pháp này mà không được người khác thỉnh cầu.
Keci panāhu ‘‘ekacce bhikkhū saṃkiliṭṭhacitte disvā tesaṃ cittasaṃkilesappahānāya ceva ekaccānaṃ āyatiṃ anuppādanāya ca ayaṃ desanā āraddhā’’ti.
However, some say, "Seeing some bhikkhus with defiled minds, this teaching was initiated for the removal of their mental defilements and for preventing their recurrence in the future for others."
Tuy nhiên, một số người nói rằng "bài thuyết pháp này được bắt đầu để loại bỏ sự ô nhiễm tâm của một số Tỳ-kheo khi thấy tâm họ bị ô nhiễm, và để ngăn chặn sự phát sinh (ô nhiễm) trong tương lai của một số người khác".
Evaṃ sabbasuttesūti yathā ettha anaṅgaṇasutte, evaṃ ito paresūti sabbesupi suttesu anuttānaapubbapadavaṇṇanā eva karīyati.
"Thus in all suttas": just as in this Anaṅgaṇa Sutta, so in the suttas that follow, only explanations of obscure and new terms are given.
Evaṃ sabbasuttesu (Như vậy trong tất cả các kinh) nghĩa là như trong kinh Anaṅgaṇa này, và trong các kinh sau đó, chỉ giải thích những từ không rõ nghĩa và chưa từng xuất hiện.
Tenāha ‘‘tasmā’’tiādi.
Therefore, it says "hence" and so on.
Vì vậy, (văn bản) nói: "tasmā" (do đó), v.v.
Gaṇanaparicchedoti gaṇanena paricchindanaṃ.
"Enumeration and classification" means division by enumeration.
Gaṇanaparicchedo (Sự phân loại bằng cách đếm) nghĩa là sự phân chia bằng cách đếm.
Idañhi apparajakkhamahārajakkhatāvasena duvidhe satte paccekaṃ atthaññutānatthaññutāvasena dvidhā katvā ‘‘cattāro’’ti anavasesapariyādānaṃ.
This indeed is the exhaustive classification of beings into two types based on having little dust and much dust, then each of these into two based on understanding the meaning and not understanding the meaning, totaling "four" types.
Điều này là sự phân loại hoàn toàn "bốn" loại chúng sinh bằng cách chia chúng sinh thành hai loại dựa trên mức độ ít hay nhiều bụi trần, và mỗi loại lại được chia thành hai dựa trên sự hiểu biết ý nghĩa hoặc không hiểu biết ý nghĩa.
Vajjīputtakādayo viya puggalavādīti na gahetabbaṃ lokasamaññānusārena atthaṃ paṭivijjhituṃ samatthānaṃ vasena desanāya āraddhattā, ayañca desanānayo satthu nissāya evāti dassento ‘‘ayañhī’’tiādimāha.
It should not be understood as a personalist, like the Vajjīputtakas and others, because the teaching was initiated for those capable of comprehending the meaning according to conventional usage. And showing that this method of teaching is indeed based on the Teacher, he says "For this is indeed..." and so on.
Không nên hiểu là người chấp ngã (puggalavādī) như các phái Vajjīputtaka và những người khác, vì bài giảng được bắt đầu theo cách mà những người có khả năng thấu hiểu ý nghĩa theo quy ước thế gian. Và để chỉ ra rằng phương pháp giảng dạy này chỉ dựa vào Đức Đạo Sư, nên Ngài đã nói ‘Vì điều này’ và tiếp theo.
Tattha (a. ni. ṭī. 1.1.170) sammutiyā desanā sammutidesanā, paramatthassa desanā paramatthadesanā.
There, the teaching by way of convention is sammutidesanā, and the teaching by way of ultimate truth is paramatthadesanā.
Ở đây, bài giảng theo quy ước là bài giảng quy ước (sammutidesanā), bài giảng về chân đế là bài giảng chân đế (paramatthadesanā).
Tatthāti sammutiparamatthadesanāsu, na sammutiparamatthesu.
"There" refers to sammutidesanā and paramatthadesanā, not to conventional and ultimate truths themselves.
Ở đây (Tatthā) là trong các bài giảng quy ước và chân đế, không phải trong các quy ước và chân đế.
Tenāha ‘‘evarūpā sammutidesanā, evarūpā paramatthadesanā’’ti.
Therefore, he says, "Such is sammutidesanā, such is paramatthadesanā."
Vì vậy, Ngài nói: ‘Đây là bài giảng quy ước, đây là bài giảng chân đế’.
Tatridaṃ sammutiparamatthānaṃ lakkhaṇaṃ – yasmiṃ bhinne, buddhiyā avayavavinibbhoge vā kate na taṃsamaññā, sā ghaṭapaṭādippabhedā sammuti, tabbipariyāyato paramattho.
Here is the definition of conventional and ultimate truths: that which, when broken down or analyzed into its component parts by wisdom, does not retain its designation, is conventional, belonging to categories such as a pot or a cloth; the opposite of that is ultimate truth.
Đây là định nghĩa về quy ước và chân đế: Khi một vật bị phân chia, hoặc khi các bộ phận của nó được phân tích bằng trí tuệ, nếu danh xưng đó không còn, thì đó là quy ước, như các loại bình, vải, v.v. Ngược lại, đó là chân đế.
Na hi kakkhaḷaphusanādisabhāve ayaṃ nayo labbhati, tattha rūpādidhammaṃ samūhasantānavasena pavattamānaṃ upādāya puggalavohāroti āha ‘‘puggaloti sammutidesanā’’ti.
Indeed, this method is not applicable to characteristics like hardness or contact; rather, the designation "person" is used based on the aggregation and continuity of phenomena such as form, etc. Therefore, he says, "Person is sammutidesanā."
Thật vậy, nguyên tắc này không được áp dụng cho bản chất cứng rắn, xúc chạm, v.v. Ở đó, Ngài nói: ‘Người (puggalo) là bài giảng quy ước’ để chỉ rằng danh xưng cá nhân (puggalavohāro) được hình thành dựa trên sự tập hợp và dòng chảy liên tục của các pháp sắc, v.v.
Sesapadesupi eseva nayo.
The same method applies to the remaining terms.
Nguyên tắc này cũng tương tự trong các trường hợp khác.
Uppādavayavanto sabhāvadhammā na niccāti āha ‘‘aniccanti paramatthadesanā’’ti.
Phenomena with their own intrinsic nature, having arising and ceasing, are not permanent. Therefore, he says, "Impermanent is paramatthadesanā."
Các pháp bản chất có sự sinh diệt thì không thường còn, vì vậy Ngài nói: ‘Vô thường (aniccaṃ) là bài giảng chân đế’.
Esa nayo sesapadesupi.
The same method applies to the remaining terms.
Nguyên tắc này cũng tương tự trong các trường hợp khác.
Nanu khandhadesanāpi sammutidesanāva.
But is not the teaching of aggregates (khandha) also sammutidesanā?
Há chẳng phải bài giảng về các uẩn cũng là bài giảng quy ước sao?
Khandhaṭṭho hi rāsaṭṭho, koṭṭhāsaṭṭho vāti?
For the meaning of khandha is "heap" or "component part", is it not?
Vì ý nghĩa của uẩn là sự tích tụ, hay sự phân chia?
Saccametaṃ, ayaṃ pana khandhasamaññā phassādīsu tajjāpaññatti viya paramatthasannissayā tassa āsannatarā, puggalasamaññādayo viya na dūreti paramatthasaṅgahatā vuttā, khandhasīsena vā tadupādānā sabhāvadhammā eva gahitā.
This is true. However, this designation of khandha, like the designation of specific mental factors such as contact (phassa) and so on, is based on ultimate truth and is closer to it, not remote like the designations of "person" and so on. Therefore, it is said to be included in ultimate truth, or by the term khandha, the intrinsic phenomena that are its constituents are themselves taken.
Điều này đúng, nhưng danh xưng uẩn này gần với chân đế hơn, vì nó dựa trên chân đế, giống như sự chế định về xúc, v.v., không xa như các danh xưng cá nhân, v.v. Nó được nói là bao gồm chân đế, hoặc các pháp bản chất dựa trên các uẩn đã được chấp nhận.
Nanu ca sabhāvadhammā sabbepi sammutimukheneva desanaṃ ārohanti, na samukhenāti sabbāpi desanā sammutidesanāva siyāti?
But do not all intrinsic phenomena ascend to being taught only through the medium of convention, and not directly? If so, would not all teachings be sammutidesanā?
Há chẳng phải tất cả các pháp bản chất đều được giảng dạy thông qua quy ước, chứ không phải trực tiếp, vậy thì tất cả các bài giảng đều là bài giảng quy ước sao?
Nayidamevaṃ desetabbadhammavibhāgena desanāvibhāgassa adhippetattā, na ca saddo kenaci pavattinimittena vinā atthaṃ pakāsetīti.
No, this is not the case, because the division of teaching is intended by the division of phenomena to be taught, and a word does not reveal meaning without some reason for its usage.
Không phải vậy, vì sự phân chia bài giảng được dự định theo sự phân chia các pháp được giảng dạy, và không có từ nào có thể biểu lộ ý nghĩa mà không có một dấu hiệu khởi nguồn nào.
Sammutivasena desanaṃ sutvāti ‘‘idhekacco puggalo attantapo hoti attaparitāpānuyogamanuyutto’’tiādinā (ma. ni. 2.413; pu. pa. 10.25 mātikā) sammutimukhena pavattitaṃ desanaṃ sutamayañāṇuppādanavasena sutvā.
"Having heard the teaching by way of convention" means having heard, in the sense of producing knowledge acquired through hearing, the teaching presented by way of convention, such as "Here, a certain individual practices self-mortification, devoted to the practice of afflicting himself" and so on.
Sau khi nghe bài giảng theo quy ước nghĩa là sau khi nghe bài giảng được trình bày theo quy ước, như: “Ở đây, có một số người tự hành khổ, chuyên chú vào việc tự làm khổ mình và người khác” và tiếp theo, theo cách làm phát sinh trí tuệ nghe (sutamayañāṇa).
Atthaṃ paṭivijjhitvāti tadanusārena catusaccasaṅkhātaṃ atthaṃ saha vipassanāya maggena paṭivijjhitvā.
"Having penetrated the meaning" means having penetrated the meaning, consisting of the Four Noble Truths, together with insight by means of the path, in accordance with that.
Sau khi thấu hiểu ý nghĩa nghĩa là sau khi thấu hiểu ý nghĩa bao gồm Tứ Thánh Đế cùng với tuệ quán (vipassanā) thông qua con đường (magga) tương ứng.
Mohaṃ pahāyāti tadekaṭṭhehi kilesehi saddhiṃ anavasesaṃ mohaṃ pajahitvā.
"Having abandoned delusion" means having completely abandoned delusion together with its co-existent defilements.
Sau khi đoạn trừ si mê nghĩa là sau khi loại bỏ hoàn toàn si mê cùng với các phiền não đồng nhất với nó.
Visesanti nibbānasaṅkhātaṃ arahattasaṅkhātañca visesaṃ.
"Distinction" refers to the distinction that is Nibbāna and Arahantship.
Sự thù thắng nghĩa là Niết Bàn và sự thù thắng của A-la-hán quả.
Tesanti tādisānaṃ vineyyānaṃ.
"For them" refers to such disciples.
Của những người đó nghĩa là của những người có thể giáo hóa như vậy.
Paramatthavasenāti ‘‘pañcimāni, bhikkhave, indriyānī’’tiādinā (saṃ. ni. 5.472-474) paramatthadhammavasena.
"By way of ultimate truth" means by way of ultimate phenomena, such as "Bhikkhus, there are these five faculties" and so on.
Theo chân đế nghĩa là theo các pháp chân đế, như: “Này các Tỳ-kheo, có năm căn này” và tiếp theo.
Sesaṃ anantaranaye vuttasadisameva.
The rest is similar to what was stated in the preceding method.
Phần còn lại tương tự như đã nói trong phương pháp trước.
Tatthāti tassaṃ sammutivasena paramatthavasena ca desanāyaṃ.
"Therein" refers to that teaching by way of convention and by way of ultimate truth.
Trong đó (Tatthā) nghĩa là trong bài giảng theo quy ước và theo chân đế đó.
Desabhāsākusaloti nānādesabhāsāsu kusalo.
"Skilled in regional languages" means skilled in various regional languages.
Giỏi ngôn ngữ địa phương nghĩa là giỏi nhiều ngôn ngữ địa phương khác nhau.
Tiṇṇaṃ vedānanti nidassanamattaṃ, tiṇṇaṃ vedānaṃ sippaganthānampīti adhippāyo sippuggahaṇañhi parato vakkhati.
"Of the three Vedas" is merely an example; the intention is also the arts and treatises of the three Vedas, for the acquisition of arts will be mentioned later.
Ba bộ Veda chỉ là một ví dụ, ý muốn nói là ba bộ Veda và cả các môn nghệ thuật. Vì việc học các môn nghệ thuật sẽ được nói đến sau.
Sippāni vā vedantogadhe katvā ‘‘tiṇṇaṃ vedāna’’nti vuttaṃ.
Or, the expression "of the three Vedas" is used by including the arts within the scope of the Vedas.
Hoặc là các môn nghệ thuật được bao gồm trong Veda nên nói ‘ba bộ Veda’.
Kathetabbabhāvena ṭhitāni, na katthaci sannihitabhāvenāti vedānampi kathetabbabhāveneva avaṭṭhānaṃ dīpento ‘‘guyhā tayī nihitā gayhatī’’ti micchāvādaṃ paṭikkhipati.
"Existing as something to be expounded," not as something hidden somewhere; thus, by illustrating the existence of the Vedas themselves as something to be expounded, he refutes the false doctrine "the secret threefold knowledge is hidden and grasped."
Được thiết lập để được giảng dạy, không phải được cất giữ ở bất cứ đâu. Do đó, việc làm rõ rằng các Veda cũng chỉ được thiết lập để được giảng dạy, bác bỏ quan điểm sai lầm rằng “ba bộ Veda bí mật được cất giữ và nắm giữ”.
Nānāvidhā desabhāsā etesanti nānādesabhāsā.
"Various regional languages" means those that have various regional languages.
Nhiều ngôn ngữ địa phương (nānādesabhāsā) là những ngôn ngữ có nhiều loại khác nhau.
Paramo uttamo attho paramattho, dhammānaṃ yathābhūtasabhāvo.
The highest, supreme meaning is paramattha, the true nature of phenomena as they are.
Ý nghĩa tối thượng, cao nhất là chân đế (paramattha), tức bản chất thực sự của các pháp.
Lokasaṅketamattasiddhā sammuti.
Sammuti is that which is established merely by worldly convention.
Quy ước (sammuti) là những gì chỉ được thiết lập theo quy ước thế gian.
Yadi evaṃ kathaṃ sammutikathāya saccatātiāha ‘‘lokasammutikāraṇā’’ti, lokasamaññaṃ nissāya pavattanato.
If so, how can the conventional discourse be true? He says, "due to worldly convention," meaning it proceeds relying on worldly designations.
Nếu vậy, làm sao lời nói quy ước lại là sự thật? Ngài nói: ‘Vì lý do quy ước thế gian’, tức là vì nó diễn ra dựa trên quy ước thế gian.
Lokasamaññāya hi abhinivesena vinā ñāpanā ekaccassa sutassa sāvanā viya na musā anatidhāvitabbato tassā.
Indeed, a designation, without attachment to worldly convention, is not false, because it should not be transgressed, just like informing a person who has heard something.
Thật vậy, việc truyền đạt kiến thức cho một số người đã nghe, nếu không có sự chấp thủ vào quy ước thế gian, thì không phải là nói dối, vì nó không bị vượt quá.
Tenāha bhagavā ‘‘janapadaniruttiṃ nābhiniveseyya, samaññaṃ nātidhāveyyā’’ti (ma. ni. 3.332).
Therefore, the Blessed One said, "One should not cling to regional expressions; one should not deviate from designations" (MN 3.332).
Vì vậy, Đức Thế Tôn đã nói: “Không nên chấp thủ vào ngôn ngữ địa phương, không nên vượt quá quy ước” (Ma. Ni. 3.332).
Dhammānanti sabhāvadhammānaṃ.
"Of phenomena" refers to intrinsic phenomena.
Của các pháp nghĩa là của các pháp bản chất.
Bhūtakāraṇāti yathābhūtasabhāvaṃ nissāya pavattanato.
"Due to the actual cause" means proceeding by relying on the true nature of reality.
Vì lý do thực tại nghĩa là vì nó diễn ra dựa trên bản chất thực sự.
Sammutiṃ voharantassāti ‘‘puggalo satto’’tiādinā lokasamaññaṃ kathentassa.
"One who speaks conventionally" refers to one who uses worldly designations such as "person," "being," and so on.
Người sử dụng quy ước nghĩa là người nói quy ước thế gian, như: “một cá nhân, một chúng sinh” và tiếp theo.
Hirottappadīpanatthanti lokapālanakicce hirottappadhamme kiccato pakāsetuṃ.
"For the purpose of illustrating hiri and ottappa" means to reveal the virtues of hiri (shame) and ottappa (dread), which are essential for the protection of the world.
Để làm sáng tỏ hổ thẹn và ghê sợ nghĩa là để làm sáng tỏ các pháp hổ thẹn và ghê sợ, vốn là chức năng bảo vệ thế gian.
Tesañhi kiccaṃ sattasantāneyeva pākaṭaṃ hotīti puggalādhiṭṭhānāya kathāya taṃ vattabbaṃ.
Indeed, their function is evident only in the continuum of beings, so this must be stated in a discourse based on the concept of a person.
Thật vậy, chức năng của chúng chỉ hiển lộ trong dòng tương tục của chúng sinh, vì vậy điều đó phải được nói trong bài giảng dựa trên cá nhân.
Esa nayo sesesupi.
The same method applies to the rest.
Nguyên tắc này cũng tương tự trong các trường hợp khác.
Yasmiñhi cittuppāde kammaṃ uppannaṃ, taṃsantāne eva tassa phalassa uppatti kammassakatā.
"Ownership of kamma" refers to the arising of the fruit of an action in the very continuum where the thought-moment generating that action arose.
Nghiệp của chính mình (kammassakatā) là sự phát sinh quả của nghiệp trong cùng dòng tương tục mà tâm đã phát sinh nghiệp đó.
Evañhi kataviññāṇanāso akatāgamo vā natthīti sā puggalādhiṭṭhānāya eva kathāya dīpetabbā.
For thus there is no destruction of an action performed, nor is there the arrival of an unperformed one; therefore, this must be illustrated through a discourse based on the concept of a person.
Như vậy, không có sự mất đi của nhận thức đã tạo ra hoặc sự phát sinh của những gì chưa tạo ra. Vì vậy, điều đó phải được làm sáng tỏ bằng bài giảng dựa trên cá nhân.
Tehi sattehi kātabbā puññādikiriyā paccattapurisakāropi santānavasena nipphādetabbato puggalādhiṭṭhānāya eva kathāya dīpetabbo.
"Individual effort," which is meritorious action and so on, to be performed by those beings, must also be illustrated through a discourse based on the concept of a person, as it is to be accomplished through a continuum.
Sự nỗ lực của chính người đó (paccattapurisakāro), tức là các hành động thiện, v.v., phải được thực hiện bởi những chúng sinh đó, cũng phải được làm sáng tỏ bằng bài giảng dựa trên cá nhân, vì chúng phải được hoàn thành theo dòng tương tục.
Ānantariyadīpanatthanti cutianantaraṃ phalaṃ anantaraṃ nāma, tasmiṃ anantare niyuttāni, tannibbattanena anantarakaraṇasīlāni, anantarapayojanāni vāti ānantariyāni, mātughātādīni, tesaṃ dīpanatthaṃ.
"For the purpose of illustrating ānantariya" - ānantariya means "immediate," referring to a result that is immediate after death, or actions that are determined to be immediate in their consequences, or have the nature of causing an immediate result, or have an immediate purpose; these are actions such as matricide and so on. This is for the purpose of illustrating them.
Để làm sáng tỏ các nghiệp vô gián nghĩa là quả ngay sau khi chết được gọi là vô gián (anantaraṃ), những nghiệp được chỉ định cho sự vô gián đó, những nghiệp có thói quen tạo ra sự vô gián, hoặc những mục đích vô gián, đó là các nghiệp vô gián (ānantariyāni), như giết mẹ, v.v., để làm sáng tỏ chúng.
Tānipi hi santānavasena nipphādetabbato ‘‘mātaraṃ jīvitā voropetī’’tiādinā (paṭṭhā. 1.1.423) puggalādhiṭṭhānāya eva kathāya dīpetabbāni, tathā ‘‘so mettāsahagatena cetasā ekaṃ disaṃ pharitvā viharatī’’tiādinā (dī. ni. 1.556; 3.308; ma. ni. 1.77; 2.309; 3.230; vibha. 642, 643) ‘‘so anekavihitaṃ pubbenivāsaṃ anussarati ekampi jāti’’ntiādinā (dī. ni. 1.244, 245; ma. ni. 1.148, 384, 431; pārā. 12) ‘‘atthi dakkhiṇā dāyakato visujjhati, no paṭiggāhakato’’tiādinā (ma. ni. 3.381) ca pavattā brahmavihārapubbenivāsadakkhiṇāvisuddhikathā puggalādhiṭṭhānāya eva kathāya dīpetabbā sattasantānavisayattā.
Indeed, these, being actions to be performed through a continuum, must be illustrated through a discourse based on the concept of a person, such as "He takes the life of his mother" and so on. Similarly, the "Discourse on the Brahmavihāras, Recollection of Past Lives, and Purification of Offerings," which proceeds with statements such as "He dwells pervading one direction with a mind imbued with loving-kindness" and so on, "He recollects his manifold past lives, one birth..." and so on, and "There is a gift that is purified on the part of the giver, but not on the part of the recipient" and so on, must also be illustrated through a discourse based on the concept of a person, as they pertain to the continuum of beings.
Thật vậy, những điều đó cũng phải được làm sáng tỏ bằng bài giảng dựa trên cá nhân, như: “giết hại mẹ” và tiếp theo, vì chúng phải được hoàn thành theo dòng tương tục. Tương tự, bài giảng về Tứ Vô Lượng Tâm (brahmavihāra), túc mạng (pubbenivāsa) và sự thanh tịnh của sự bố thí (dakkhiṇāvisuddhikathā), như: “Người đó an trú, trải khắp một phương với tâm từ bi” và tiếp theo, “Người đó nhớ lại nhiều loại túc mạng khác nhau, thậm chí một kiếp” và tiếp theo, “Có sự bố thí được thanh tịnh từ người cho, không phải từ người nhận” và tiếp theo, cũng phải được làm sáng tỏ bằng bài giảng dựa trên cá nhân, vì chúng thuộc về dòng tương tục của chúng sinh.
‘‘Aṭṭha purisapuggalā (saṃ. ni. 1.249), na samayavimutto puggalo’’tiādinā (pu. pa. 1) ca paramatthaṃ kathentopi lokasammutiyā appahānatthaṃ puggalakathaṃ kathesi.
Even when speaking of ultimate truth, the Buddha used personal terms like "eight types of noble individuals" and "a person not liberated in due time" and so on, so as not to abandon worldly conventions.
Ngay cả khi Đức Phật giảng về chân đế, như: “Tám hạng người (purisapuggala)” và “Người không được giải thoát theo thời gian (na samayavimutto puggalo)”, Ngài vẫn nói về cá nhân để không từ bỏ quy ước thế gian.
Etena vuttāvasesāya kathāya puggalādhiṭṭhānabhāve payojanaṃ sāmaññavasena saṅgahitanti daṭṭhabbaṃ.
By this, it should be understood that the purpose of the remaining discourses being based on the concept of a person is inclusively stated in a general sense.
Với điều này, mục đích của bài giảng còn lại dựa trên cá nhân được bao gồm theo nghĩa chung.
Kāmañcetaṃ sabbaṃ apariññātavatthukānaṃ vasena vuttaṃ, pariññātavatthukānampi pana evaṃ desanā sukhāvahā hoti.
Although all this is stated for those who do not comprehend the underlying reality, such a teaching also leads to ease for those who do comprehend the underlying reality.
Mặc dù tất cả những điều này được nói cho những người chưa hiểu rõ đối tượng, nhưng đối với những người đã hiểu rõ đối tượng, bài giảng như vậy cũng mang lại lợi ích.
Mahājanoti lokiyamahājano.
"The great multitude" refers to the worldly great multitude.
Đại chúng nghĩa là đại chúng thế gian.
Na jānāti ghanavinibbhogābhāvena dhammakiccassa asallakkhaṇena.
"Does not know" due to the absence of distinction of aggregates and the inability to discern the function of phenomena.
Không biết do không có sự phân tích sâu sắc, không nhận ra chức năng của pháp.
Tattha ‘‘kiṃ nāmetaṃ, kathaṃ nāmeta’’nti saṃsayapakkhandatāya sammohaṃ āpajjati.
There, due to being overcome by doubt,* "What is this? How is this?", he falls into bewilderment.
Ở đó, do rơi vào sự nghi ngờ “cái này tên là gì, cái này như thế nào”, nên rơi vào sự mê lầm.
Viruddhābhinivesitāya paṭisattu hoti.
Due to clinging to opposing views, he becomes an opponent.
Do sự chấp thủ trái ngược, nên trở thành kẻ thù.
Jānāti ciraparicitatthā vohārakathāya.
He knows by means of discourse about long-familiar things.
Biết do lời nói thông thường đã quen thuộc từ lâu.
Tato eva na sammohamāpajjati, na paṭisattu hoti.
For that very reason, he does not fall into bewilderment, nor does he become an opponent.
Chính vì thế mà không rơi vào sự mê lầm, không trở thành kẻ thù.
Nappajahanti vohāramukhena paramatthassa dīpanato.
They do not abandon* because the ultimate meaning is revealed through conventional usage.
Không từ bỏ vì đã thuyết minh chân nghĩa qua phương tiện quy ước.
Samaññāgahaṇavasena lokena ñāyati samaññāyati voharīyatīti lokasamaññā, tāya lokasamaññāya.
By conventional designation, which is known, designated, or spoken of by people by way of adopting a designation.
Theo cách nắm bắt quy ước, được thế gian biết đến, gọi tên, xưng hô là quy ước thế gian (lokasamaññā), bởi quy ước thế gian đó.
Tassa tassa atthassa vibhāvane lokena nicchitaṃ, niyataṃ vā vuccati voharīyatīti lokanirutti, tassaṃ lokaniruttiyaṃ.
In that conventional expression, which is determined or fixed by people in explaining each meaning, or is spoken of and referred to.
Trong việc làm sáng tỏ từng ý nghĩa đó, được thế gian quyết định, hoặc được nói là cố định, được xưng hô là cách diễn đạt thế gian (lokanirutti), trong cách diễn đạt thế gian đó.
Tathā lokena abhilapīyatīti lokasamaññatāya lokābhilāpo, tasmiṃ lokābhilāpe ṭhitāyeva appahānato.
Similarly, remaining in that conventional discourse—which is speech by way of conventional designation, being spoken of by people—because it is not abandoned.
Cũng vậy, được thế gian nói đến là lời nói thế gian (lokābhilāpa) do là quy ước thế gian, do vẫn còn tồn tại trong lời nói thế gian đó nên không từ bỏ.
Puggalavādino viya paramatthavasena aggahetvā.
Without taking* in the ultimate sense, like the Pudgalavādins.
Không nắm bắt theo chân nghĩa như những người chủ trương thuyết ngã.
Santoti ettha santasaddo ‘‘dīghaṃ santassa yojana’’ntiādīsu (dha. pa. 70) kilantabhāve āgato, ‘‘ayañca vitakko ayañca vicāro santā honti samitā’’tiādīsu (vibha. 576) niruddhabhāve āgato, ‘‘adhigato kho myāyaṃ dhammo gambhīro duddaso duranubodho santo paṇīto’’tiādīsu (dī. ni. 2.67; ma. ni. 1.281; 2.337; saṃ. ni. 2.172; mahāva. 7) santañāṇagocaratāya, ‘‘upasantassa sadā satimato’’tiādīsu (udā. 27) kilesavūpasame, ‘‘santo have sabbhi pavedayantī’’tiādīsu (dha. pa. 15) sādhūsu, ‘‘pañcime, bhikkhave, mahācorā santo saṃvijjamānā’’tiādīsu (pārā. 195) atthibhāve, idhāpi atthibhāveyeva.
Here, the word santa in "santo" (existing) appears in the sense of weariness in phrases like "a league is long for one who is weary," in the sense of cessation in phrases like "this thought and this discursive thought are ceased, calmed," in phrases like "this Dhamma I have attained is profound, hard to see, hard to comprehend, calm, excellent" in the sense of being within the range of calm knowledge, in phrases like "for one who is calmed, always mindful" in the sense of the calming of defilements, in phrases like "the good indeed declare among the good" in the sense of the good people, and in phrases like "Monks, there are these five great thieves, existing, present" in the sense of existing. Here too, it means existing.
Trong từ santo ở đây, từ santa được dùng với nghĩa mệt mỏi trong các câu như “đường dài đối với người mệt mỏi” (dīghaṃ santassa yojanaṃ), được dùng với nghĩa diệt trong các câu như “tư duy này và quán sát này đã lắng dịu, đã vắng lặng” (ayañca vitakko ayañca vicāro santā honti samitā), được dùng với nghĩa đối tượng của trí tuệ an tịnh trong các câu như “Pháp này mà ta đã chứng ngộ thật sâu xa, khó thấy, khó thấu hiểu, tịch tịnh, vi diệu” (adhigato kho myāyaṃ dhammo gambhīro duddaso duranubodho santo paṇīto), được dùng với nghĩa sự lắng dịu phiền não trong các câu như “người đã an tịnh, luôn chánh niệm” (upasantassa sadā satimato), được dùng với nghĩa những người thiện lành trong các câu như “những người thiện lành thường tiết lộ cho người thiện lành” (santo have sabbhi pavedayanti), được dùng với nghĩa tồn tại trong các câu như “Này các tỳ khưu, có năm tên đại trộm cướp này đang tồn tại, đang hiện hữu” (pañcime, bhikkhave, mahācorā santo saṃvijjamānā), và ở đây cũng có nghĩa là tồn tại.
So ca puggalasambandhena vuttattā lokasamaññāvasenāti dassento ‘‘lokasaṅketavasena atthī’’ti āha.
And showing that it is by way of conventional designation, being stated in connection with an individual, he says: "it exists by way of worldly convention".
Và vì điều đó được nói liên quan đến cá nhân, nên để chỉ rõ là theo quy ước thế gian, Ngài nói “tồn tại theo quy ước thế gian”.
Atthīti cetaṃ nipātapadaṃ daṭṭhabbaṃ ‘‘atthi imasmiṃ kāye kesā’’tiādīsu (dī. ni. 2.373-374; ma. ni. 1.110; 3.154; a. ni. 6.29; 10.60) viya.
This particle atthi should be understood as in phrases like "there are hairs in this body."
Và từ atthī này cần được xem là một giới từ, như trong các câu “có tóc trên thân này” (atthi imasmiṃ kāye kesā) v.v.
Saṃvijjamānāti padassa atthaṃ dassento ‘‘upalabbhamānā’’ti āha.
Showing the meaning of the word saṃvijjamānā (present), he says: "upalabbhamānā" (perceivable).
Để chỉ rõ ý nghĩa của từ saṃvijjamānā, Ngài nói “đang được nhận biết”.
Yañhi saṃvijjati, taṃ upalabbhatīti.
For whatever exists, that is perceivable.
Bởi vì cái gì tồn tại thì cái đó được nhận biết.
Aṅganti etehi taṃsamaṅgipuggalā nihīnabhāvaṃ gacchantīti aṅgaṇāni, rāgādayo.
These* cause individuals endowed with them to go to a lowly state, hence aṅgaṇāni (stains), such as lust.
Những thứ mà do chúng, những người cá nhân có chúng trở nên thấp kém, nên gọi là aṅgaṇāni (nhơ bẩn), tức là tham ái v.v.
Añjati makkhetīti aṅgaṇaṃ, malādi.
It smears or fouls, hence aṅgaṇaṃ (stain), such as dirt.
Cái gì làm ô nhiễm, làm nhơ bẩn, thì gọi là aṅgaṇaṃ, tức là cấu uế v.v.
Añjeti tattha ṭhitaṃ ahundaratāya abhibyañjetīti aṅgaṇaṃ, vivaṭo bhūmipadeso.
It manifests what is there due to its openness, hence aṅgaṇaṃ (open space), an uncovered plot of land.
Cái gì làm hiển lộ cái đang ở đó do sự không che giấu, thì gọi là aṅgaṇaṃ, tức là một khoảng đất trống.
Dosādīnaṃ pavattiākāravisesatāya nānappakārā bahulappavattiyā tibbakilesā.
Intense defilements due to their diverse and frequent manifestation as particular modes of occurrence of faults, etc.
Do sự đặc biệt của cách thức phát sinh các lỗi lầm v.v., do sự phát sinh nhiều loại khác nhau, nên gọi là phiền não mãnh liệt.
Pāpakānanti lāmakānaṃ.
Pāpakānaṃ means of evil things.
Pāpakānaṃ (của những ác pháp) là của những điều xấu xa.
Akusalānanti akosallasambhūtānaṃ.
Akusalānaṃ means born of unskillfulness.
Akusalānaṃ (của những bất thiện pháp) là của những điều sinh ra từ sự không khéo léo.
Icchāvacarānanti icchāvasena pavattānaṃ.
Icchāvacarānaṃ means occurring due to desire.
Icchāvacarānaṃ (của những pháp thuộc về dục) là của những điều phát sinh do dục vọng.
Saha aṅgaṇenāti aṅgaṇanti laddhanāmena yathāvuttakilesena saha vattati.
Saha aṅgaṇena means that it occurs together with the aforementioned defilement, which is given the name aṅgaṇa.
Saha aṅgaṇenāti (cùng với cấu uế) nghĩa là tồn tại cùng với phiền não đã được gọi tên là aṅgaṇaṃ như đã nói.
Atthītipi na jānāti tādisassa yonisomanasikārassa abhāvā.
He does not even know that it exists due to the absence of such appropriate attention.
Cũng không biết là có (atthītipi na jānāti) do không có sự tác ý như lý như vậy.
Yesaṃ kilesānaṃ atthitā, tesaṃ sappaṭibhayatā visesato jānitabbāti dassetuṃ ‘‘ime kilesā nāmā’’tiādi vuttaṃ.
To show that the danger of these defilements must be known in particular, it is said: "these are called defilements", etc.
Để chỉ rõ rằng sự tồn tại của những phiền não đó, đặc biệt là sự đáng sợ hãi của chúng, cần phải được biết, nên đã nói “những phiền não này tên là” v.v.
Tattha kakkhaḷāti pharusā.
There, kakkhaḷā means harsh.
Trong đó, kakkhaḷā (thô cứng) là thô ác.
Vāḷāti kururā.
Vāḷā means cruel.
Vāḷā (hung bạo) là tàn nhẫn.
Na gahitabbāti na uppādetabbā.
Na gahitabbā means should not be produced.
Na gahitabbā (không nên nắm giữ) là không nên phát sinh.
Yāthāvasarasatoti yathābhūtasabhāvato.
Yāthāvasarasato means according to its true nature.
Yāthāvasarasato (theo bản chất thực sự) là theo bản chất chân thật.
Evañcāti ‘‘ime kilesā nāmā’’tiādinā vuttappakārena.
Evañcā means in the manner stated in "these are called defilements," etc.
Evañcā (và như vậy) là theo cách đã nói trong “những phiền não này tên là” v.v.
Yena vā tena vāti navakammesu vā pariyattidhutaṅgādīsu vā yena vā tena vā.
Yena vā tena vā means by this or that, whether in new kamma or in study, ascetic practices, etc.
Yena vā tena vā (bằng cách này hay cách khác) là bằng cách này hay cách khác, hoặc trong các công việc mới, hoặc trong học tập, thực hành hạnh đầu đà v.v.
Tatrāti niddhāraṇe bhummaṃ.
Tatrā is the locative case for determination.
Tatrā (trong đó) là thuộc cách định rõ.
Taṃ pana niddhāraṇaṃ saṅgaṇānaṅgaṇasamudāyatoti dassento ‘‘catūsu puggalesū’’ti vatvā puna tadekadesato dassento ‘‘tesu vā dvīsu sāṅgaṇesū’’ti āha.
Showing that this determination is from the aggregate of those with and without stains, he says "among the four individuals", and then showing a part of that, he says "or among those two stained ones".
Và để chỉ rõ rằng sự định rõ đó là từ tổng thể của những người có cấu uế và không có cấu uế, Ngài nói “trong bốn hạng người”, rồi lại chỉ rõ từ một phần của chúng, Ngài nói “hoặc trong hai hạng người có cấu uế đó”.
Tañhi dvayaṃ paṭhamaṃ hīnaseṭṭhabhāvena niddhārīyati paṭhamaṃ uddiṭṭhattā.
For those two are first determined as superior and inferior, being mentioned first.
Bởi vì hai hạng người đó được định rõ trước tiên theo sự thấp kém và ưu việt, vì chúng đã được nêu ra trước tiên.
Niddhāraṇañhi kvaci kutoci kenaci hotīti.
For determination occurs sometimes from somewhere, by something.
Bởi vì sự định rõ có thể là từ một cái gì đó, từ một nơi nào đó, bởi một cái gì đó.
58. Kiñcāpi aññattha ‘‘janako hetu, pariggāhato paccayo, asādhāraṇo hetu, sādhāraṇo paccayo, sabhāgo hetu, asabhāgo paccayo, pubbakāliko hetu, sahappavatto paccayo’’tiādinā hetupaccayā vibhajja vuccanti, idha pana ‘‘cattāro kho, bhikkhave, mahābhūtā hetū, cattāro mahābhūtā paccayā rūpakkhandhassa paññāpanāyā’’tiādīsu (ma. ni. 3.85) viya hetupaccayasaddā samānatthāti dassetuṃ ‘‘ubhayenapi kāraṇameva pucchatī’’ti vuttaṃ.
58. Although elsewhere causes and conditions are divided and spoken of with statements like "a generator is a cause, a receiver is a condition; an uncommon cause, a common condition; a homogenous cause, a heterogeneous condition; a prior cause, a co-arising condition," etc., here, to show that the words hetu (cause) and paccaya (condition) have the same meaning, as in phrases like "Monks, these four great elements are the cause, these four great elements are the condition for the manifestation of the form aggregate," etc., it is said: "by both, only the reason is asked".
58. Mặc dù ở nơi khác, nhân và duyên được phân biệt và nói đến như “nhân là nguyên nhân sinh ra, duyên là điều kiện hỗ trợ; nhân là nguyên nhân không chung, duyên là điều kiện chung; nhân là nguyên nhân tương tự, duyên là điều kiện không tương tự; nhân là nguyên nhân trước đó, duyên là điều kiện đồng thời phát sinh” v.v., nhưng ở đây, để chỉ rõ rằng các từ hetu và paccaya (nhân và duyên) có cùng ý nghĩa, như trong các câu “Này các tỳ khưu, bốn đại chủng là nhân, bốn đại chủng là duyên cho sự nhận biết sắc uẩn” (cattāro kho, bhikkhave, mahābhūtā hetū, cattāro mahābhūtā paccayā rūpakkhandhassa paññāpanāyā) v.v., nên đã nói “cả hai đều hỏi về nguyên nhân”.
Tattha ubhayenāti hetupaccayavacanadvayena.
There, ubhayenā means by the two terms, hetu and paccaya.
Trong đó, ubhayenā (bằng cả hai) là bằng hai từ hetu và paccaya.
Pucchati āyasmā mahāmoggallāno desanaṃ vaḍḍhetukāmo.
Pucchati (asks) means Venerable Mahāmoggallāna, wishing to extend the teaching.
Pucchati (hỏi) là Tôn giả Mahāmoggallāna muốn mở rộng bài pháp.
Kiñcāpīti anujānanasambhāvanatthe nipāto.
Kiñcāpi is a particle in the sense of concession or possibility.
Kiñcāpī (mặc dù) là một giới từ có nghĩa là cho phép hoặc có thể xảy ra.
Kiṃ anujānāti?
What does it concede?
Cho phép điều gì?
Samānepi dvinnaṃ sāṅgaṇabhāve tassā pajānanāppajānanahetukataṃ tesaṃ seṭṭhahīnataṃ.
Even though both are stained, their superiority and inferiority are caused by their knowing and not knowing it.
Mặc dù cả hai đều có cấu uế, nhưng sự ưu việt và thấp kém của họ là do việc biết hay không biết điều đó.
Kiṃ sambhāveti?
What does it make possible?
Có thể xảy ra điều gì?
Therassa vicittapaṭibhānatāya nānāhetūpamāhi alaṅkatvā yathāpucchitassa atthassa pākaṭakaraṇaṃ.
Due to the Elder's varied wisdom, the clarification of the inquired meaning, adorned with various causes and similes.
Do trí tuệ sắc sảo của vị Trưởng lão, làm cho ý nghĩa của câu hỏi trở nên rõ ràng bằng cách trang trí nó với nhiều nguyên nhân và ví dụ.
Tenāha ‘‘nappajānātī’’tiādi.
Therefore, he says: "nappajānāti" (does not know), etc.
Vì thế Ngài nói “nappajānātī” (không biết) v.v.
Hetu ceva paccayo ca seṭṭhahīnabhāve.
Cause and condition in terms of superiority and inferiority.
Hetu ceva paccayo ca (nhân và duyên) là về sự ưu việt và thấp kém.
Tathāakkhātabbatāpi hi tesaṃ tannimittā evāti.
For their being described as such is also due to those very reasons.
Và việc chúng được thuyết minh như vậy cũng chính là do những nguyên nhân đó.
59. Tanti tesaṃ dvinnaṃ puggalānaṃ hīnaseṭṭhatāya kāraṇaṃ.
59. Taṃ means the reason for the inferiority and superiority of those two individuals.
59. Taṃ (điều đó) là nguyên nhân của sự thấp kém và ưu việt của hai hạng người đó.
Opammehi pākaṭataraṃ katvā dassetuṃ.
To show it more clearly with similes.
Để làm cho rõ ràng hơn bằng các ví dụ.
Etanti sutte anantaraṃ vuccamānaṃ vīriyārambhābhāvena aṅgaṇassa appahānaṃ.
Etaṃ means the non-abandonment of stains in the sutta immediately following, due to the absence of the initiation of effort.
Etaṃ (điều này) là sự không từ bỏ cấu uế do không tinh tấn, được nói đến ngay sau đó trong kinh.
Tenāha ‘‘na chandaṃ…pe… sandhāyāhā’’ti.
Therefore, he says: "na chandaṃ…pe… sandhāyāhā" (does not refer to desire… etc.).
Vì thế Ngài nói “na chandaṃ…pe… sandhāyāhā” (không ý muốn… v.v… Ngài đã nói đến).
Kattukamyatāchandhanti kattukamyatāsaṅkhātaṃ aṅgaṇassa pahātukamyatāvasena uppajjanakakusaladhammacchandaṃ.
Kattukamyatāchandhaṃ means the wholesome desire (chanda) arising by way of wishing to abandon the stain, which is called the desire to do.
Kattukamyatāchandhaṃ (ý muốn làm) là ý muốn thiện pháp phát sinh do ý muốn từ bỏ cấu uế, được gọi là ý muốn làm.
Na janessatīti na uppādessati.
Na janessati means will not produce.
Na janessatīti (sẽ không sinh ra) là sẽ không phát sinh.
Kusalo vāyāmo nāma chandato balavāti āha ‘‘tato balavataraṃ vāyāmaṃ na karissatī’’ti, chandampi anuppādento kathaṃ tajjaṃ vāyāmaṃ karissatīti adhippāyo.
Wholesome effort is stronger than desire, so he says: "tato balavataraṃ vāyāmaṃ na karissatī" (he will not make a stronger effort than that). The intention is, how will he make such an effort if he does not even produce desire?
Vì sự tinh tấn thiện lành mạnh hơn ý muốn, nên Ngài nói “tato balavataraṃ vāyāmaṃ na karissatī” (sẽ không tạo ra sự tinh tấn mạnh mẽ hơn thế), ý là, nếu không phát sinh cả ý muốn, thì làm sao có thể tạo ra sự tinh tấn liên quan đến nó?
Thāmagatavīriyaṃ ussoḷhībhāvappattaṃ daḷhaṃ vīriyaṃ.
Thāmagatavīriyaṃ means firm effort, which has reached the state of vigorous exertion.
Thāmagatavīriyaṃ (tinh tấn mạnh mẽ) là sự tinh tấn kiên cố đã đạt đến trạng thái kiên cường.
Sāṅgaṇaggahaṇeneva aṅgaṇānaṃ kilesavatthutāya cittassa saṃkiliṭṭhatāya saddhāya puna saṃkiliṭṭhaggahaṇaṃ savisesaṃ kiliṭṭhabhāvavibhāvananti āha ‘‘suṭṭhutaraṃ kiliṭṭhacitto’’ti.
By taking "sāṅgaṇa" (with stains), the renewed statement "saṃkiliṭṭha" (defiled) for the mind due to the stains being objects of defilement is a distinct clarification of the state of defilement, so he says: "suṭṭhutaraṃ kiliṭṭhacitto" (a mind exceedingly defiled).
Chỉ riêng việc nắm giữ cấu uế đã chỉ ra rằng tâm bị ô nhiễm do cấu uế là đối tượng của phiền não, nên việc nắm giữ sự ô nhiễm một lần nữa là để làm sáng tỏ trạng thái ô nhiễm một cách đặc biệt, vì thế Ngài nói “suṭṭhutaraṃ kiliṭṭhacitto” (tâm bị ô nhiễm trầm trọng hơn).
Malinacittotiādīsupi ‘‘tehiyevā’’ti ānetvā sambandhitabbaṃ.
In malinacitto (foul-minded), etc., it should also be brought in and connected with "by those very*".
Trong các từ malinacitto (tâm dơ bẩn) v.v. cũng cần được liên kết bằng cách thêm vào “bởi chính những điều đó”.
Ukkhalipucchanacoḷakassa viya vasāpītapilotikā viya ca dummocanīyabhāvena malaggahaṇaṃ malīnatā, pīḷanaṃ hiṃsanaṃ avipphārikatākaraṇaṃ vibādhanaṃ darathapariḷāhuppādanena paridahanaṃ upatāpanaṃ, kālanti kālanaṃ, yathāgahitassa attabhāvassa khepanaṃ āyukkhayanti attho.
Malīnatā means foulness, like the lamp wick that has absorbed oil, making it difficult to remove, like the cleaning rag for a pot; vibādhanaṃ means affliction, torment, causing it not to flourish; kālaṃ means time, meaning the wasting of the acquired existence, the exhaustion of life.
Sự nắm giữ ô nhiễm do khó loại bỏ, như giẻ lau nồi hay vải dính mỡ, là malīnatā (sự dơ bẩn); sự ép buộc, làm hại, làm cho không nở rộ là vibādhanaṃ (sự quấy nhiễu); sự thiêu đốt, làm nóng bức bằng cách gây ra sự sợ hãi và nóng bức, là kālaṃ (thời gian); kālaṃ là sự tiêu hủy, ý nghĩa là sự tiêu hao tuổi thọ, sự tiêu hao tự thân đã được nắm giữ.
Karissatīti pavattessati, pāpuṇissatīti vuttaṃ hoti.
Karissatī means he will cause to occur, he will attain, it is said.
Karissatīti (sẽ làm) là sẽ phát sinh, ý là sẽ đạt được.
Tathābhūto ca pāṇaṃ cajissati nāmāti āha ‘‘marissatī’’ti.
And such a person will surely give up life, so he says: "marissatī" (will die).
Và một người như vậy sẽ từ bỏ sinh mạng, vì thế Ngài nói “marissatī” (sẽ chết).
Seyyathāpīti upamānidassane nipāto.
Seyyathāpi is a particle indicating a simile.
Seyyathāpīti (ví như) là một giới từ để chỉ ví dụ.
Tadatthaṃ dassento ‘‘yathā nāmā’’ti āha.
Showing its meaning, he says: "yathā nāmā" (just as, indeed).
Để chỉ rõ ý nghĩa đó, Ngài nói “yathā nāmā” (như là).
Paṃsuādināti ādi-saddena jallādīnaṃ saṅgaho, ghaṃsanādīhīti ādi-saddena chārikāparimajjanādīnaṃ saṅgahoti.
By 'dirt, etc.': the word 'etc.' includes filth and others. By 'rubbing, etc.': the word 'etc.' includes wiping with ash and others.
Paṃsuādinā (bằng bụi bẩn, v.v.) có nghĩa là từ ādi (v.v.) bao gồm các loại vết bẩn, v.v. ghaṃsanādīhi (bằng cách cọ xát, v.v.) có nghĩa là từ ādi (v.v.) bao gồm việc lau chùi bằng tro, v.v.
‘‘Abhirūpāya kaññā dātabbā’’tiādīsu viya antarenapi atisayatthabodhakasaddena atisayattho ñāyatīti āha ‘‘malaggahitatarāti vuttaṃ hotī’’ti.
Just as in phrases like "a beautiful maiden should be given," the superlative meaning is understood even without an explicit superlative word, so it is said, " it means more covered with dirt."
Như trong câu ‘‘Abhirūpāya kaññā dātabbā’’ (phải gả cho cô gái xinh đẹp), v.v., dù không có từ chỉ ý nghĩa đặc biệt, ý nghĩa đặc biệt vẫn được hiểu. Do đó, đã nói ‘‘malaggahitatarāti vuttaṃ hotī’’ (có nghĩa là đã bị dơ bẩn hơn).
Paṭipucchāvacananti anumatipucchāviseso.
'Paṭipucchāvacana' is a specific type of question for permission.
Paṭipucchāvacana (lời hỏi lại) là một loại câu hỏi xin phép.
Evaṃ kariyamānāti aparibhoga-apariyodapanarajopathanikkhipanehi kiliṭṭhabhāvaṃ āpādiyamānā.
'Being done in this way' means being brought to a state of defilement through non-use, uncleaned dirt, and being left on the path.
Evaṃ kariyamānā (được làm như vậy) có nghĩa là bị làm cho dơ bẩn do không được sử dụng, không được làm sạch, và bị bụi bẩn phủ lên.
Opammaṃ sampaṭipādentoti yathūpanītaṃ upamaṃ upameyyatthena samaṃ katvā paṭipādento, saṃsandentoti attho.
'Making the simile correspond' means making the presented simile correspond in meaning to that which is being compared, that is, comparing it.
Opammaṃ sampaṭipādento (khi đưa ra ví dụ) có nghĩa là khi làm cho ví dụ được đưa ra tương đồng với đối tượng được ví, tức là so sánh.
Sāṅgaṇo puggaloti sāṅgaṇo tasmiṃ attabhāve asujjhanakapuggalo.
'A person with a blemish' means a person who cannot be purified in that very existence due to a blemish.
Sāṅgaṇo puggalo (người có vết nhơ) là người không thể thanh tịnh trong đời sống đó.
Āpaṇādito kulagharaṃ ānītassa malaggahitakaṃsabhājanassa tattha laddhabbāya visuddhiyā alābhato yathā anukkamena saṃkiliṭṭhatarabhāvo, evaṃ gharato nikkhantassa puggalassa pabbajjāya laddhabbāya visuddhiyā alābhato anukkamena saṃkiliṭṭhatarabhāvoti dassento ‘‘saṃkiliṭṭhakaṃsapātiyā’’tiādimāha.
Just as a bronze vessel covered with dirt, brought from a shop or similar place to a house, becomes progressively more defiled due to not attaining the purification it should receive there, so too, to show how a person who has gone forth from a household life becomes progressively more defiled due to not attaining the purification that should be obtained through ordination, he says, "with a defiled bronze bowl," and so on.
Để chỉ ra rằng, giống như một cái bát đồng bị dơ bẩn được mang về nhà từ chợ, v.v., không đạt được sự thanh tịnh cần có ở đó, dần dần trở nên dơ bẩn hơn; thì một người xuất gia rời nhà, do không đạt được sự thanh tịnh cần có trong đời sống xuất gia, dần dần trở nên dơ bẩn hơn. Do đó, đã nói ‘‘saṃkiliṭṭhakaṃsapātiyā’’ (bằng cái bát đồng bị dơ bẩn), v.v.
Saṃkiliṭṭhatarabhāvo ca nāma pabbajitassa ājīvavipattivasena vā siyā ācāradiṭṭhisīlavipattīsu aññataravasena vāti taṃ sabbaṃ saṅgahetvā dassetuṃ ‘‘tassa puggalassā’’tiādi vuttaṃ.
The state of becoming more defiled might arise for an ordained person due to a downfall in livelihood, or due to one of the downfalls in conduct, views, or morality; to encompass and show all this, "for that person," and so on, is stated.
Và trạng thái dơ bẩn hơn của người xuất gia có thể là do sự thất bại trong sinh kế (ājīvavipatti) hoặc do một trong các sự thất bại về hành vi (ācāra), quan điểm (diṭṭhi), hoặc giới luật (sīla). Để bao gồm và chỉ ra tất cả những điều đó, đã nói ‘‘tassa puggalassā’’ (của người đó), v.v.
Pācittiyavītikkamanaggahaṇena hi ekaccadiṭṭhivipattiyāpi saṅgaho hotīti.
Indeed, by the inclusion of transgressing a pācittiya, some downfall in views is also encompassed.
Vì việc đề cập đến sự vi phạm Pācittiya cũng bao gồm một số thất bại về quan điểm.
Ettha ṭhitassāti etissaṃ ājīvavipattiyaṃ ṭhitassa.
'Standing in this' means standing in this downfall of livelihood.
Ettha ṭhitassā (đối với người đứng ở đây) có nghĩa là đối với người đứng trong sự thất bại về sinh kế này.
Iminā nayena sesesupi yathārahaṃ vattabbaṃ.
In this manner, it should be stated similarly for the rest as appropriate.
Theo cách này, cũng cần nói tương tự đối với những trường hợp còn lại.
Sabbaparisasādhāraṇā mahātherassa desanā, tasmā gahapativasenapi yojetabbaṃ.
The Mahāthera's teaching is common to all assemblies; therefore, it should also be applied to householders.
Lời dạy của Đại Trưởng lão là dành cho tất cả các hội chúng, do đó cũng cần liên hệ với cư sĩ.
Tattha ukkaṃsagatasaṃkiliṭṭhatarabhāvaṃ dassento ‘‘mātughātādiānantariyakaraṇa’’nti āha.
There, to show the extremely defiled state, he says, "committing acts leading to immediate retribution, such as matricide."
Ở đó, để chỉ ra trạng thái dơ bẩn hơn ở mức độ cao nhất, đã nói ‘‘mātughātādiānantariyakaraṇa’’ (việc làm các tội Ānantariya như giết mẹ, v.v.).
Avisodhetvāti yathā attano sīle vā diṭṭhiyā vā visuddhi hoti, evaṃ kilesamalinacittasantānaṃ avisodhetvā.
'Without purifying' means without purifying one's mental continuum, which is defiled by klesas, in such a way that there is purity in one's morality or views.
Avisodhetvā (không làm cho thanh tịnh) có nghĩa là không làm cho dòng tâm thức bị ô nhiễm bởi phiền não trở nên thanh tịnh, giống như giới luật hay quan điểm của mình.
Bhabbapuggaloti upanissayādisampattiyā tasmiṃ attabhāve visuddhapuggalo.
'A capable person' means a person purified in that very existence through the attainment of support (upanissaya) and so forth.
Bhabbapuggalo (người có khả năng) là người thanh tịnh trong đời sống đó do có đầy đủ các điều kiện như Upnissaya.
Ādiṃ katvāti iminā dhovanaghaṃsanādīhi pariyodapanaṃ ādimantaṃ katvā vadati.
'Beginning with': by this, he speaks of purification as having a beginning, through washing, rubbing, and so forth.
Ādiṃ katvā (lấy làm khởi đầu) có nghĩa là nói rằng việc làm sạch bằng cách rửa, cọ xát, v.v., là khởi đầu.
Suddhaṭṭhānaṃ yattha vā na rajena okirīyati.
'A pure place' is where it is not covered with dust.
Suddhaṭṭhānaṃ (nơi sạch sẽ) là nơi không bị bụi bẩn phủ lên.
Daṇḍakammaṃ katvāti ‘‘ettakā udakā, vālukā vā ānetabbā’’ti daṇḍakammaṃ katvā.
'Having imposed a penalty' means having imposed a penalty such as "so much water or sand must be brought."
Daṇḍakammaṃ katvā (sau khi thực hiện việc phạt) có nghĩa là sau khi thực hiện việc phạt ‘‘phải mang về một lượng nước hoặc cát nhất định’’.
Ettha ṭhitassāti parisuddhe sīle ṭhitassa.
'Standing in this' means standing in pure morality.
Ettha ṭhitassā (đối với người đứng ở đây) có nghĩa là đối với người đứng trong giới luật thanh tịnh.
Sammāvattapaṭipattisīlehi sīlavisuddhi dassitā.
Purity of morality is shown by proper observances and practices.
Sự thanh tịnh của giới luật được chỉ ra bằng các giới luật về hành vi đúng đắn (sammāvatta) và sự thực hành đúng đắn (paṭipatti).
Vattapaṭipattiyāpi hi aṅgaṇānaṃ vikkhambhanaṃ siyā.
Indeed, even by the practice of observances, blemishes might be removed.
Ngay cả việc thực hành đúng đắn (vattapaṭipatti) cũng có thể loại bỏ các vết nhơ.
Tathā hissā saṃkiliṭṭhakaṃsapātiyā parisuddhapariyodātabhāvo upamābhāvena vutto.
Similarly, the state of purity and cleansing of that defiled bronze bowl is stated as a simile.
Giống như sự thanh tịnh và trong sạch của cái bát đồng bị dơ bẩn đã được ví von.
Pantasenāsanavāso kilesavikkhambhanaṃ kilesānaṃ tadaṅganivāraṇaṃ.
'Dwelling in secluded lodging' is the suppression of klesas, the temporary prevention of klesas.
Pantasenāsanavāso (sự sống ở chỗ ở thanh vắng) là sự loại bỏ phiền não, sự ngăn chặn phiền não tạm thời.
Sotāpattiphalādhigamo…pe… arahattasacchikiriyāti sattasupi ṭhānesu ‘‘parisuddhapariyodātabhāvo viyā’’ti padaṃ ānetvā sambandhitabbaṃ.
'Attainment of the fruit of stream-entry... etc. ... the realization of arahantship': in all seven instances, the phrase "is like the state of purity and cleansing" should be brought in and connected.
Sotāpattiphalādhigamo…pe… arahattasacchikiriyā (sự chứng đắc quả Dự Lưu… v.v… sự chứng ngộ A-la-hán) – trong cả bảy trường hợp, cần đưa thêm cụm từ ‘‘giống như trạng thái thanh tịnh và trong sạch’’ vào và liên hệ.
Pabbajitassa hi visuddhi nāma heṭṭhimantena sīlavisuddhiyā vā siyā kammaṭṭhānānuyogavasena vivekavāsena jhānassādhigamena vā vipassanābhāvanāya vā sāmaññaphalādhigamena vāti.
Indeed, for one gone forth, purification can be, at its lowest, through purity of morality, or through diligence in meditation, through dwelling in seclusion, through the attainment of jhānas, through the development of insight (vipassanā), or through the attainment of the fruits of recluseship (sāmaññaphala).
Vì sự thanh tịnh của người xuất gia, ở mức thấp nhất, có thể là sự thanh tịnh của giới luật, hoặc do chuyên tâm tu tập đề mục thiền định (kammaṭṭhānānuyoga), do sống viễn ly (vivekavāsa), do chứng đắc thiền định (jhānassādhigama), hoặc do tu tập thiền quán (vipassanābhāvanā), hoặc do chứng đắc các quả Sa-môn (sāmaññaphala).
Rāgaṭṭhāniyanti rāguppattihetubhūtaṃ.
'Conducive to lust' means that which is a cause for the arising of lust.
Rāgaṭṭhāniya (chỗ của tham) là nguyên nhân phát sinh tham ái.
Visabhāgārammaṇaṃ sandhāya vadati ‘‘iṭṭhārammaṇa’’nti.
Referring to an unsuitable object, he says, "a pleasing object."
Để chỉ đến đối tượng không tương thích, đã nói ‘‘iṭṭhārammaṇa’’ (đối tượng khả ái).
Tasminti iṭṭhārammaṇe.
'In that' means in that pleasing object.
Tasmi (trong đó) có nghĩa là trong đối tượng khả ái.
Vipannassatīti muṭṭhassati.
'One whose mindfulness is lost' means one who has forgotten mindfulness.
Vipannassatī (mất chánh niệm) có nghĩa là quên mất chánh niệm.
Taṃ nimittanti subhanimittaṃ.
'That sign' means the beautiful sign.
Taṃ nimitta (tướng ấy) là tướng đẹp (subhanimitta).
Āvajjissatīti ayoniso āvajjissati.
'Will attend' means will attend unwisely.
Āvajjissatī (sẽ chú ý) có nghĩa là sẽ chú ý một cách phi như lý (ayoniso).
Sayameva aññena avomisso.
'By oneself': unmixed with another.
Sayameva (chính mình) có nghĩa là không bị trộn lẫn với người khác.
Kusalavārapacchindanameva cettha anuddhaṃsanaṃ daṭṭhabbaṃ.
Here, 'annihilation' should be understood as the cutting off of the sphere of wholesome states.
Ở đây, việc cắt đứt dòng thiện pháp được xem là anuddhaṃsanaṃ (sự hủy hoại).
Sesanti ‘‘sāṅgaṇo saṃkiliṭṭhacitto’’tiādi.
'The rest' means "he is one with a blemish, with a defiled mind," and so on.
Sesa (phần còn lại) là ‘‘sāṅgaṇo saṃkiliṭṭhacitto’’ (người có vết nhơ, tâm ô nhiễm), v.v.
Vuttanayānusārenāti paṭhamavāre vuttanayānusārena.
'According to the method stated' means according to the method stated in the first section.
Vuttanayānusārena (theo cách đã nói) có nghĩa là theo cách đã nói ở lần đầu tiên.
Sabbanti mātughātādiānantariyakaraṇapariyosānaṃ sabbaṃ upamāsaṃsandanavacanaṃ.
'All' means all the similes and comparison statements, ending with the committing of acts leading to immediate retribution, such as matricide.
Sabba (tất cả) là tất cả các lời so sánh ví dụ, kết thúc bằng việc làm các tội Ānantariya như giết mẹ, v.v.
Ativirahābhāvatoti satisammosābhāvato, upaṭṭhitassati bhāvatoti attho.
'Due to the absence of excessive remoteness' means due to the absence of forgotten mindfulness; the meaning is the state of present mindfulness.
Ativirahābhāvato (do không có sự vắng mặt quá mức) có nghĩa là do không có sự lãng quên chánh niệm, tức là do có chánh niệm hiện hữu.
Sesanti ‘‘so arāgo’’tiādi.
'The rest' means "he is without lust," and so on.
Sesa (phần còn lại) là ‘‘so arāgo’’ (người ấy không tham), v.v.
‘‘Dhovanaghaṃsanasaṇhachārikāparimajjanādīhī’’tiādinā dutiyavārānusārena.
'According to the second section' through "by washing, rubbing, fine ash wiping, and so on."
‘‘Dhovanaghaṃsanasaṇhachārikāparimajjanādīhī’’ (bằng cách rửa, cọ xát, lau chùi bằng tro mịn, v.v.) theo lần thứ hai.
‘‘Ko nu kho’’tiādi pucchāvasena āgataṃ, idaṃ nigamanavasenāti ayameva viseso.
"Who, indeed?" and so on, came in the form of a question; this (statement) is in the form of a conclusion, and this is the only difference.
‘‘Ko nu kho’’ (ai vậy?) v.v. xuất hiện dưới dạng câu hỏi, còn đây là dưới dạng kết luận. Đó chính là sự khác biệt.
60. Aṅgaṇanti tattha tattha nāmato eva vibhāvitaṃ, na pana sabhāvato, pabhedato vāti sabhāvādito vibhāvanaṃ sandhāyāha ‘‘nānappakārato pākaṭaṃ kārāpetukāmenā’’ti.
60. 'Blemish' is described by its name in various places, but not by its intrinsic nature or classifications. Referring to the elucidation of its intrinsic nature and so forth, he says, "wishing to make it manifest in various ways."
60. Aṅgaṇa (vết nhơ) đã được giải thích theo tên gọi ở từng chỗ, nhưng không phải theo bản chất hay phân loại. Để chỉ ra sự giải thích từ bản chất, v.v., đã nói ‘‘nānappakārato pākaṭaṃ kārāpetukāmenā’’ (do muốn làm cho nó hiển lộ theo nhiều cách khác nhau).
Icchāya avacarānanti icchāvasena avacaraṇānaṃ.
'Pertaining to desire' means that which is involved with desire.
Icchāya avacarāna (những gì đi vào do tham muốn) có nghĩa là những gì đi vào do tham muốn.
Otiṇṇānanti cittasantānaṃ anupaviṭṭhānaṃ.
'Having entered' means having entered the mental continuum.
Otiṇṇāna (những gì đã đi vào) có nghĩa là những gì đã đi vào dòng tâm thức.
Te pana tattha paccayavasena nibbattattā pavattā nāma hontīti āha ‘‘pavattāna’’nti.
Since they arise there conditionally, they are called arisen, so he says, "arisen."
Vì những điều đó phát sinh ở đó do duyên và tồn tại, nên đã nói ‘‘pavattāna’’ (những gì tồn tại).
Nānappakārānanti visayabhedena pavattiākārabhedena ca nānāvidhānaṃ.
'Of various kinds' means of diverse types, due to differences in objects and differences in modes of arising.
Nānappakārāna (nhiều loại khác nhau) có nghĩa là đa dạng về đối tượng và đa dạng về cách thức tồn tại.
Yenakāraṇena.
'By which' means for which reason.
Yena (do nguyên nhân nào).
Na kevalaṃ lābhatthikatā eva, atha kho puññavantatā sakkatagarukatā ca ettha kāraṇabhāvena gahetabbāti dassento ‘‘pakatiyāpi cā’’tiādimāha.
Not only the desire for gain, but also meritoriousness and being esteemed and respected should be taken as reasons here, so he says, "and also naturally," and so on.
Không chỉ là sự khao khát lợi lộc, mà còn là sự có phước báu và được tôn kính, kính trọng cũng cần được xem là nguyên nhân ở đây. Để chỉ ra điều đó, đã nói ‘‘pakatiyāpi cā’’ (và về bản chất), v.v.
Tena lābhatthikopi na yo koci evaṃ cittaṃ uppādeti puññavā sambhāvanīyoti dasseti.
Thereby, he shows that even one desirous of gain is not just anyone who would thus generate a thought; he is one who is meritorious and worthy of respect.
Điều đó cho thấy rằng, ngay cả người khao khát lợi lộc cũng không phải ai cũng phát sinh tâm như vậy, mà là người có phước báu và đáng được kính trọng.
Therā avajjapaṭicchādanabhayena majjhimānaṃ ārocenti, tathā majjhimā navakānaṃ, navakā pana attano navakabhāvena vighāsādādīnaṃ ārocenti ‘‘passatha tumhākaṃ therassa kamma’’nti.
Elder monks report to middle monks out of fear of being blameworthy or concealing; similarly, middle monks report to junior monks, and junior monks, because of their junior status, report to those who pick up scraps, saying, "See the deed of your elder."
Các Trưởng lão vì sợ bị che giấu tội lỗi mà báo cho các vị Trung niên, và các vị Trung niên cũng báo cho các vị Tân học. Các vị Tân học thì do còn là tân học nên báo cho các vị Vighāsāda (những người ăn thức ăn thừa), v.v., rằng ‘‘hãy xem hành động của Trưởng lão của các ông’’.
Vighāsādādayo nāma ‘‘īdisassa santike ovādatthaṃ tumhe āgatā’’ti bhikkhunīnaṃ ārocenti.
Those who pick up scraps and others, saying, "You came to such a one for advice," report to the bhikkhunis.
Các vị Vighāsāda, v.v., thì báo cho các Tỳ-khưu-ni rằng ‘‘các cô đã đến để nghe lời khuyên từ một người như thế này’’.
Na ca maṃ bhikkhū jāneyyunti na ca vata maṃ bhikkhū jāneyyuṃ, aho vata maṃ bhikkhū na jāneyyunti yojanā.
'And may the bhikkhus not know me': the construction is, "May the bhikkhus not know me, oh, may the bhikkhus not know me."
Na ca maṃ bhikkhū jāneyyu (và các Tỳ-khưu không biết tôi) có nghĩa là ‘‘mong sao các Tỳ-khưu không biết tôi, ôi mong sao các Tỳ-khưu không biết tôi’’.
Ṭhānaṃ kho panetanti ettha kho-saddo avadhāraṇattho, pana-saddo vacanālaṅkāroti āha ‘‘atthiyevā’’ti.
'And this is a proper occasion': here, the word 'kho' has the meaning of emphasis, and the word 'pana' is a rhetorical embellishment, so he says, "it is indeed."
Ṭhānaṃ kho paneta (điều này có thể xảy ra) – ở đây, từ kho có nghĩa là nhấn mạnh, từ pana là một từ trang sức cho câu nói. Do đó, đã nói ‘‘atthiyevā’’ (thực sự có).
Pubbe icchuppādavāravaṇṇanāya vuttanayena.
'Previously': according to the method stated in the description of the arising of desire.
Pubbe (trước đây) là theo cách đã nói trong phần mô tả về sự phát sinh tham muốn.
Iti -saddo idha āsannakāraṇatthoti taṃ dassento ‘‘iminā kāraṇenā’’ti āha.
The word 'iti' here means proximate cause, so showing that, he says, "for this reason."
Từ Iti ở đây có nghĩa là nguyên nhân gần. Để chỉ ra điều đó, đã nói ‘‘iminā kāraṇenā’’ (do nguyên nhân này).
Idañca kopaappaccayānameva gahaṇaṃ.
And this is the inclusion of anger and displeasure themselves.
Idañca (và điều này) là sự nắm bắt chỉ riêng các nguyên nhân của sự tức giận và bất mãn.
Tādisānanti kopaappaccayādhibhūtānanti adhippāyo.
'Of such ones' is the intention, meaning those overcome by anger, displeasure, etc.
Tādisāna (những người như vậy) có nghĩa là những người bị chi phối bởi sự tức giận và bất mãn, v.v.
Codanāya paṭipuggalabhāvo, codanā ca āpattiyāti cuditakena codakassa samānabhāvo āpattiāpannatāyāti āha ‘‘samānoti sāpattiko’’ti.
The state of being an opponent in a charge, and the charge concerns an offense, thus the charged person is equal to the accuser in being subject to an offense, so he says, "equal means having an offense."
Sự buộc tội có một đối tượng bị buộc tội. Và sự buộc tội là một tội lỗi. Do đó, người bị buộc tội và người buộc tội có sự tương đồng về việc mắc tội. Do đó, đã nói ‘‘samānoti sāpattiko’’ (tương đồng có nghĩa là mắc tội).
Sappaṭipuggalenevassa codanicchāya kāraṇaṃ vibhāvetuṃ ‘‘aya’’ntiādi vuttaṃ.
To elucidate the reason for his desire to make a charge against an opponent, "this," and so on, is stated.
Để giải thích nguyên nhân của ý muốn buộc tội người khác, đã nói ‘‘aya’’ (người này), v.v.
Na cāyaṃ sāpattikatāya eva samānataṃ icchati, atha kho aññathāpīti dassento ‘‘apicā’’tiādimāha.
And this* does not desire equality only in terms of offense, but also in other ways, as shown by the statement starting with "apicā" (moreover).
Và người này không chỉ muốn sự bình đẳng vì có phạm lỗi, mà còn muốn theo cách khác nữa, khi chỉ ra điều này, đã nói "hơn nữa" v.v.
Aññena vā paṭipuggalena sappaṭipuggalo.
One who has a counterpart (sappaṭipuggalo)* with another individual.
Hoặc với một đối tượng khác là có đối tượng.
Ayañhi ‘‘sappaṭipuggalova maṃ codeyyā’’ti icchati ‘‘evāhaṃ tassa paṭipuggalehi saddhiṃ ekajjhāsayo hutvā tassa upari kiñci vattuṃ kātuṃ vā labhissāmī’’ti maññamāno.
Indeed, this* desires, "May only a counterpart question me," thinking, "Thus, being of the same intention as his counterparts, I will be able to say or do something regarding him."
Chính người này muốn rằng "chỉ có người có đối tượng mới được quở trách tôi", nghĩ rằng "như vậy tôi sẽ có cùng ý định với những người có đối tượng đó và sẽ có thể nói hoặc làm điều gì đó với người đó".
Imasmiṃ pana pakkhe no appaṭipuggaloti natthi etassa paṭipuggaloti appaṭipuggaloti evamattho veditabbo.
However, in this context, "no appaṭipuggalo" (not without a counterpart) should be understood to mean "he has no counterpart," thus "appaṭipuggalo" (without a counterpart).
Nhưng trong trường hợp này, "không phải là người không có đối tượng" được hiểu là "người này không có đối tượng", tức là "người không có đối tượng".
‘‘Aho vatā’’ti idaṃ padaṃ dissatīti sambandho, imassa puggalassa icchācāre ṭhitattā bhikkhūnaṃ dhammaṃ deseyyāti vacanato ‘‘tañca kho anumatipucchāyā’’ti vuttaṃ.
The connection is that this word, "Aho vata" (Oh, if only!), appears, and because this person's conduct is based on desire that he might teach Dhamma to the bhikkhus, it is said, "and indeed, by asking for permission."
"Aho vatā" (Ôi ước gì) là có liên quan đến "câu này được thấy", và vì người này có ý muốn như vậy, nên theo nguyên tắc "nên thuyết pháp cho các Tỳ-khưu", đã nói "và điều đó là do hỏi ý kiến".
Na hesa ‘‘saccaṃ kira tvaṃ bhikkhū’’tiādinā kiñci vītikkamaṃ uddissa bhagavatā pucchitabbataṃ icchati.
For he does not desire to be questioned by the Blessed One concerning any transgression, starting with "Is it true, bhikkhu, that you...".
Người này không muốn Đức Thế Tôn hỏi mình về bất kỳ sự vi phạm nào bằng cách nói "Này các Tỳ-khưu, có thật là các ông..." v.v.
No maggaṃ vā phalaṃ vā vipassanaṃ vā antaraṃ katvāti maggabhāvanaṃ vā phalasacchikiriyaṃ vā sikhāppattavipassanānuyogaṃ vā nirodhasamāpajjanaṃ vā jhānasamāpajjanameva vā antaraṃ kāraṇaṃ katvā bhagavatā attānaṃ paṭipucchitabbaṃ no icchati.
No maggaṃ vā phalaṃ vā vipassanaṃ vā antaraṃ katvā (not by making the path, fruit, or insight an intermediate factor): he does not desire that the Blessed One should question him by making the cultivation of the path, or the realization of the fruit, or the advanced practice of insight, or the attainment of cessation, or even the attainment of jhāna, an intermediate cause.
"Không phải lấy đạo quả hay thiền quán làm trung gian" nghĩa là người ấy không muốn Đức Thế Tôn hỏi mình bằng cách lấy sự tu tập đạo, sự chứng đắc quả, sự thực hành thiền quán đạt đến đỉnh cao, sự nhập Diệt tận định, hoặc chỉ sự nhập thiền làm nguyên nhân.
Niccaṃ aniccantiādinā anumatiggahaṇavasena pucchitabbaṃ icchati, uttānameva katvā pucchitabbaṃ icchatīti attho.
He desires to be questioned by way of receiving approval, as in "niccaṃ aniccaṃ" (permanent as impermanent), meaning he desires to be questioned openly.
Người ấy muốn được hỏi theo cách chấp nhận ý kiến, như "thường hay vô thường" v.v., nghĩa là muốn được hỏi một cách rõ ràng.
Upaharante passatīti sambandho.
The connection is: he sees them bringing it.
Có liên quan đến việc thấy những người mang đến.
Abhabbaṭṭhānabhikkhutāya niharissanti sāsanato.
Because he is a bhikkhu unfit for that state, they will expel him from the Dispensation.
Vì là Tỳ-khưu không có khả năng (tu tập), họ sẽ "trục xuất" khỏi Giáo pháp.
Dakkhiṇodakanti aggato upanīyamānaṃ dakkhiṇodakaṃ.
Dakkhiṇodakaṃ (water for offerings) means the water for offerings presented first.
"Nước cúng dường" là nước cúng dường được dâng lên trước.
Yato eva-kāro, tato aññattha niyamo icchito.
Since there is the particle 'eva', the restriction is desired elsewhere.
Vì có từ "eva" (chỉ), nên có sự quy định được mong muốn ở nơi khác.
Avadhāraṇatthaṃ vā eva-kāraggahaṇanti katvā ahameva labheyyanti ahaṃ labheyyamevāti evametaṃ avadhāraṇaṃ daṭṭhabbanti adhippāyenāha ‘‘ahameva labheyyanti icchā nātimahāsāvajjā’’ti, aññathā yathārutavasena avadhāraṇe gayhamāne ‘‘na aññe labheyyu’’nti ayamevettha attho siyāti.
Or, taking the particle 'eva' as emphatic, "ahameva labheyya" (may I alone obtain) should be understood as "may I indeed obtain," and with this intention of emphasis, it says, "the desire 'may I alone obtain' is not a very serious offense"; otherwise, if taken as a strict emphasis according to the literal meaning, the meaning here would be "may others not obtain."
Hoặc cho rằng từ "eva" được dùng để nhấn mạnh, nên đã nói với ý nghĩa rằng "tôi sẽ nhận được" phải được hiểu là "chỉ tôi mới nhận được" theo cách nhấn mạnh này, nếu không, nếu được hiểu theo nghĩa đen của sự nhấn mạnh, thì ý nghĩa sẽ là "người khác sẽ không nhận được".
Pāsādiko hotīti idaṃ tassa aggāsanādipaccāsīsanāya kāraṇadassanaṃ.
He is charming (pāsādiko hotī) is given as the reason for his aspiring to the chief seat and so on.
"Đẹp đẽ" là sự chỉ ra lý do cho việc mong muốn chỗ ngồi cao nhất v.v. của người ấy.
Sakkaccañca kareyyunti bhikkhū yaṃ mama abhivādanapaccuṭṭhānañjalikammasāmīcikammādiṃ karonti.
And they should respectfully perform (sakkaccañca kareyyuṃ) means the bhikkhus should perform with reverence whatever acts of salutation, rising, anjali, and proper conduct they do for me.
"Và sẽ làm một cách cẩn trọng" là những gì các Tỳ-khưu làm cho tôi như đảnh lễ, đứng dậy chào, chắp tay, hành lễ đúng phép v.v.
Taṃ ādareneva kareyyuṃ, yañca me parikkhārajātaṃ paṭiyādenti, tampi sundaraṃ sammadeva abhisaṅkhataṃ kareyyunti attho.
And whatever requisites they prepare for me, they should make them beautiful and well-made; this is the meaning.
Nghĩa là họ sẽ làm điều đó một cách kính trọng, và những vật dụng mà họ chuẩn bị cho tôi, họ cũng sẽ làm cho đẹp đẽ và đúng cách.
Bhāriyanti pāsāṇacchattaṃ viya garukātabbaṃ.
Burden (bhāriyaṃ) means to be regarded as weighty, like a stone parasol.
"Nặng nề" là đáng được tôn trọng như một chiếc dù đá.
Etaṃ vidhinti etaṃ ‘‘sakkareyyu’’ntiādinā vuttasakkārādividhiṃ.
This method (etaṃ vidhiṃ) means this method of honor and so on, as stated in "they should honor," etc.
"Cách thức này" là cách thức cung kính v.v. đã được nói đến bằng cách "sẽ cung kính" v.v.
Tenāti tena kāraṇena, bāhusaccādiguṇavisesavato eva sakkārādīnaṃ arahattāti attho.
Therefore (tenā) means for that reason; the meaning is that only one endowed with special qualities like great learning is worthy of honor and so on.
"Do đó" là do nguyên nhân đó, nghĩa là sự cung kính v.v. chỉ xứng đáng với người có phẩm chất đặc biệt như đa văn v.v.
Evarūpanti īdisaṃ ‘‘piyo garū’’tiādinā (a. ni. 7.37) vuttappakāraṃ.
Such (evarūpaṃ) refers to the kind described in "dear and respected," etc. (A.N. 7.37).
"Như vậy" là loại đã được nói đến bằng "được yêu quý, được tôn trọng" v.v. (A.N. 7.37).
Evaṃ kareyyunti evaṃ ‘‘sakkareyyu’’ntiādinā vuttappakāraṃ sakkārādiṃ kareyyuṃ.
They should do thus (evaṃ kareyyuṃ) means they should perform such honor and so on as described in "they should honor," etc.
"Sẽ làm như vậy" là sẽ làm sự cung kính v.v. đã được nói đến bằng "sẽ cung kính" v.v.
Esa nayoti yoyaṃ bhikkhuvāre vuttavidhi, eseva nayo.
This is the method (esa nayo) means this is the same method as stated in the section on bhikkhus.
"Đây là nguyên tắc" là nguyên tắc đã được nói đến trong phần Tỳ-khưu, đây chính là nguyên tắc.
Ito paresu bhikkhunīvārādīsu vāresu.
In the later sections (ito paresu vāresu), such as the section on bhikkhunīs.
"Trong các lượt" tiếp theo, trong các lượt Tỳ-khưu-ni v.v.
Ahameva lābhī assanti etthāpi heṭṭhā vuttanayeneva avadhāraṇaṃ gahetabbaṃ.
Ahameva lābhī assa (may I alone be the recipient): here too, the emphasis should be understood in the manner explained above.
Ở đây cũng vậy, sự nhấn mạnh "chỉ tôi mới là người có lợi" phải được hiểu theo cách đã nói ở trên.
Piṇḍapātassa paṇītatā upasecanādivasenāti āha ‘‘sappitelamadhusakkharādipūritāna’’nti.
He states the deliciousness of the alms food as being by way of sauces and so on, "full of ghee, oil, honey, sugar, etc."
Sự tinh khiết của vật thực tùy thuộc vào các món ăn kèm v.v., nên đã nói "được làm đầy đủ với dầu, mật, đường v.v.".
Mañcapīṭhādīnanti nidassanamattaṃ utusappāyānaṃ nivātānaṃ phassitatalānaṃ pihitadvārakavāḷavātapānādīnampi paṇītasenāsanabhāvato.
Couches, chairs, etc. (mañcapīṭhādīnaṃ) is merely an example, as even places of lodging that are suitable for the season, sheltered from wind, with soft surfaces, and with closed doors, windows, and so on, are considered refined lodgings.
"Giường, ghế v.v." chỉ là ví dụ, vì các chỗ ở phù hợp với thời tiết, kín gió, có sàn được xoa bóp, có cửa ra vào, cửa sổ v.v. được che chắn cũng là chỗ ở tinh khiết.
Ādi-saddena vā tesampi gahaṇaṃ daṭṭhabbaṃ.
Or, their inclusion should be understood by the word "ādi" (etc.).
Hoặc có thể hiểu rằng từ "v.v." bao gồm cả những thứ đó.
Sabbatthāpīti sabbesu tesu catūsupi paccayavāresu.
In all cases (sabbatthāpī) means in all those four sections on requisites.
"Ở tất cả mọi nơi" là ở tất cả bốn lượt vật dụng đó.
61. Kāyakammaṃ disvāti idaṃ na kāyakammaṃ cakkhuviññeyyaṃ, kāyakammunā pana saha pavattaṃ oṭṭhaparipphandanaṃ bhākuṭikaraṇaṃ kāyaṅgādidassanaṃ kāyakammadassanaṃ viya hotīti katvā vuttaṃ.
61. Seeing bodily action (kāyakammaṃ disvā): this is said because bodily action itself is not visible by the eye-consciousness, but the trembling of the lips, frowning, and showing of bodily parts that occur together with bodily action are like seeing bodily action.
61. "Thấy hành động thân" - điều này không có nghĩa là hành động thân có thể được thấy bằng mắt, nhưng vì sự rung động của môi, sự nhíu mày, sự biểu lộ các bộ phận cơ thể v.v. xảy ra cùng với hành động thân, nên đã nói rằng nó giống như việc thấy hành động thân.
Vacīkammaṃ sutvāti etthāpi eseva nayo, tasmā kāyavikārajanakā dhammā ‘‘dissantī’’ti vuttā, vacīvikārajanakā ‘‘sūyantī’’ti.
The same method applies to "vacīkammaṃ sutvā" (hearing verbal action); therefore, phenomena that produce bodily changes are said to be "seen," and those that produce verbal changes are said to be "heard."
Ở đây cũng vậy, đối với "nghe hành động lời nói" cũng theo nguyên tắc tương tự, do đó, những pháp tạo ra sự biến đổi của thân được nói là "được thấy", những pháp tạo ra sự biến đổi của lời nói được nói là "được nghe".
Tato eva ca te paccakkhakāle sammukhakāle dissanti nāma.
And because of that, they are called "seen" in "paccakkhakāle" (the present time), the time of direct perception.
Và chính vì thế, chúng được gọi là "được thấy" trong "thời gian hiện tại", tức là thời gian đối diện.
Tirokkhakāle asammukhakāle sūyanti nāma.
They are called "heard" in "tirokkhakāle" (the past time), the time of indirect perception.
Chúng được gọi là "được nghe" trong "thời gian khuất mặt", tức là thời gian không đối diện.
Anurūpato gahaṇaṃ anuggaho.
Taking in accordance with what is proper is anuggaho (support).
Sự chấp nhận phù hợp là "sự ủng hộ".
Āraññikattanti tassa bhikkhuno dhutaguṇattānurūpato gaṇhāti.
Āraññikattaṃ (the state of being a forest dweller) means he takes it in accordance with that bhikkhu's dhutaṅga (austere practice) quality.
"Hạnh ở rừng" là chấp nhận phù hợp với các pháp đầu đà của Tỳ-khưu đó.
Tenāha ‘‘āraññikattaṃ anuggaṇhātī’’ti.
Therefore, it says, "āraññikattaṃ anuggaṇhātī" (he supports the state of being a forest dweller).
Do đó đã nói "ủng hộ hạnh ở rừng".
Araññe nivāso assāti āraññiko.
Āraññiko (forest dweller) is one who dwells in a forest.
"Người ở rừng" là người có nơi ở trong rừng.
Pantaṃ pariyantaṃ dūrataraṃ senāsanaṃ assāti pantasenāsano.
Pantasenāsano (one who dwells in a secluded dwelling) is one whose dwelling is remote, on the periphery, far away.
"Người có chỗ ở xa lánh" là người có chỗ ở xa xôi, hẻo lánh.
Taṃ pana atthamattena dassentena ‘‘pantasenāsane vasatī’’ti vuttaṃ.
This, however, is stated "pantasenāsane vasatī" (he dwells in a secluded dwelling) to show merely the meaning.
Và điều đó đã được nói bằng "ở chỗ ở xa lánh" chỉ để chỉ ý nghĩa.
Bhikkhāsaṅkhātānaṃ piṇḍānaṃ pāto piṇḍāpāto, taṃ piṇḍapātaṃ uñchati gavesatīti piṇḍapātiko.
Piṇḍāpāta is the falling of alms, called piṇḍa; piṇḍapātiko (alms-gatherer) is one who seeks that alms food.
"Piṇḍapāta" là sự rơi xuống của các vật thực gọi là khất thực; "piṇḍapātika" là người đi khất thực, tìm kiếm piṇḍapāta đó.
Piṇḍāya patituṃ carituṃ vatametassāti vā piṇḍapāti, so eva piṇḍapātiko.
Or piṇḍapāti is one for whom it is a vow to go seeking alms; that same one is piṇḍapātiko.
Hoặc "piṇḍapāti" là người có hạnh đi khất thực, người ấy chính là "piṇḍapātika".
Dānato avakhaṇḍanato apetaṃ apadānaṃ, saha apadānena sapadānaṃ, anavakhaṇḍanaṃ.
Apadāna is devoid of breaking off from giving; sapadāna is with unbroken giving, meaning continuous.
"Apadāna" là không bị cắt xén từ sự bố thí; "sapadāna" là cùng với apadāna, không bị cắt xén.
Anugharaṃ caraṇasīlo sapadānacārī.
Sapadānacārī (one who walks continuously for alms) is one whose habit is to walk from house to house.
"Sapadānacārī" là người có thói quen đi từng nhà.
Unnatabhāvena paṃsukūlaṃ viya paṃsukūlaṃ, paṃsu viya vā kucchitabhāvaṃ ulati gacchatīti paṃsukūlaṃ, tassa dhāraṇaṃ idha paṃsukūlaṃ, taṃ sīlamassāti paṃsukūliko.
Paṃsukūla (rag-robe) is like a rag by its exalted nature, or paṃsukūla is that which goes to a despicable state like dust; wearing that is paṃsukūla here; one who has that as a habit is paṃsukūliko (rag-robe wearer).
"Paṃsukūla" là vật y như y phấn tảo vì sự nổi bật, hoặc "paṃsukūla" là vật đi đến sự xấu xí như bụi bặm; "paṃsukūla" ở đây là sự mặc y đó; "paṃsukūliko" là người có hạnh đó.
Tīhi kāraṇehi lūkhaṃ veditabbaṃ agghaphassavaṇṇaparihānito apaṃsukūlampi, ko pana vādo paṃsukūlanti adhippāyo.
It should be understood as coarse for three reasons (tīhi kāraṇehi lūkhaṃ veditabbaṃ): even a non-rag-robe is coarse due to deterioration in value, touch, and color; what then to speak of a rag-robe? This is the intention.
"Y phục thô xấu phải được hiểu theo ba lý do" là ngay cả y không phải phấn tảo cũng thô xấu do sự suy giảm về giá trị, xúc chạm và màu sắc, huống chi là y phấn tảo.
Thūladīghasuttakenāti thūlena olambamānena dīghasuttakena.
With a thick, long thread (thūladīghasuttakenā) means with a thick, dangling, long thread.
"Với sợi chỉ dài thô" là với sợi chỉ dài, thô, buông thõng.
Vaṇṇenāti ettha phassenapi parihāyatīti vattabbaṃ.
By color (vaṇṇenā): here it should also be said, "it deteriorates by touch."
Ở đây, đối với "màu sắc", cũng phải nói là suy giảm về xúc chạm.
Tañhi tattha kharaphassampi hotiyevāti.
For it can also be rough to the touch there.
Vì nó cũng có thể có xúc chạm thô ráp ở đó.
Kasmā pana pāḷiyaṃ āraññikādiggahaṇena cattārova dhutaguṇā vuttāti?
Why are only four dhutaguṇas (austere practices) mentioned in the Pāḷi, through the inclusion of the forest-dweller, etc.?
Tại sao trong Pāḷi, chỉ có bốn pháp đầu đà được nói đến qua việc đề cập đến người ở rừng, v.v.?
Padhānattā, taggahaṇeneva ca ito paresampi sukhaparibhogatāya gahaṇasambhavato.
Because of their pre-eminence, and because by their inclusion, the others beyond these can also be understood as practices leading to ease of experience.
Bởi vì chúng là chính yếu, và bởi vì chỉ cần nắm giữ chúng, thì cũng có thể nắm giữ những pháp khác, do sự dễ dàng thọ hưởng.
Yo hi āraññiko pantasenāsano, tassa abbhokāsika-rukkhamūlika-nesajjika-yathāsanthatika-sosānikaṅgāni suparipūrāni.
Indeed, for one who is a forest-dweller and uses a secluded lodging, the practices of dwelling in the open air, at the foot of a tree, of sitting, of sleeping where one is placed, and of frequenting a charnel ground are well fulfilled.
Quả thật, người nào là vị ở rừng và ở chỗ ẩn dật, thì đối với vị ấy, các chi phần của người ở ngoài trời, người ở gốc cây, người ngồi, người tùy nghi chỗ nằm chỗ ngồi, và người ở nghĩa địa đều được hoàn mãn.
Yo ca piṇḍapātiko sapadānacārī ca, tassa pattapiṇḍikakhalupacchābhattikaekāsanikaṅgāni.
And for one who is an alms-food eater and walks for alms in unbroken sequence, the practices of eating from one bowl, of refusing food received later, and of eating one meal a day are (fulfilled).
Và người nào là vị khất thực và đi khất thực theo thứ tự, thì đối với vị ấy, các chi phần của người chỉ dùng bát, người không ăn thêm sau khi đã dùng bữa, và người chỉ dùng một chỗ ngồi đều được hoàn mãn.
Yo pana paṃsukūliko, tassa tecīvarikaṅgaṃ supariharamevāti.
As for one who is a rag-robe wearer, the practice of wearing three robes is very easy to maintain.
Còn người nào là vị mặc y phấn tảo, thì đối với vị ấy, chi phần của người chỉ có ba y là rất dễ thực hành.
Padhānattā hi bhagavatāpi ‘‘kadāhaṃ nandaṃ passeyyaṃ, āraññaṃ paṃsukūlika’’ntiādinā (saṃ. ni. 2.242; netti. 100) tattha tattha āraññikādayo eva gayhanti.
Indeed, due to their pre-eminence, even by the Blessed One, the forest-dweller and rag-robe wearer, etc., are mentioned here and there, as in "When shall I see Nanda, the forest-dweller, the rag-robe wearer?" and so on.
Vì là chính yếu, nên chính Đức Thế Tôn cũng đã đề cập đến các vị ở rừng, v.v. ở chỗ này chỗ kia qua câu: “Này Nanda, bao giờ ta sẽ thấy vị ở rừng, mặc y phấn tảo?” v.v.
Ettakāti pāḷiyaṃ āgatānaṃ paricchijja gahaṇametaṃ, na ettakā sabbepi ekassa ekaṃsato sambhavanti, nāpi ettakāyeva pāpadhammā pahātabbā.
So many—this is a restrictive mention of those found in the Pāḷi; not all of these necessarily occur in one person, nor are only these evil qualities to be abandoned.
Chừng ấy là sự nắm giữ có giới hạn những gì đã được nói đến trong Pāḷi, không phải tất cả những điều này đều có thể xảy ra một cách dứt khoát cho một người, cũng không phải chỉ chừng ấy ác pháp cần phải đoạn trừ.
Na hi makkhapaḷāsādīnaṃ appahīnabhāvepi sabrahmacārī neva sakkaronti…pe… na pūjentīti.
For, even if envy and hypocrisy, etc., are not abandoned, fellow monastics do not respect… (pe) … do not revere (them).
Không phải khi các pháp như che giấu, lật lọng, v.v. chưa được đoạn trừ thì “ các vị đồng phạm hạnh không tôn kính…pe… không cúng dường”.
Tamatthanti ‘‘yassa kassacī’’tiādinā vuttamatthaṃ.
That meaning—the meaning stated by "whosoever," and so forth.
Ý nghĩa đó là ý nghĩa đã được nói đến qua câu “người nào đó” v.v.
Upamāya pākaṭaṃ karontoti anvayato byatirekato ca udāharaṇena vibhāvento.
Making it manifest by an analogy—clarifying by way of example, both directly and by contrast.
Làm cho rõ ràng bằng ví dụ là làm cho rõ ràng bằng ví dụ theo cách thuận và nghịch.
Ahikuṇapādīnaṃ atipaṭikūlajigucchanīyatā ativiya duggandhatāya.
The extreme loathsomeness and detestability of snake corpses, etc. is due to their extreme foul smell.
Sự ghê tởm, đáng kinh tởm tột độ của xác rắn, v.v. là do mùi hôi thối cực độ.
Sā ca ahīnaṃ tikhiṇakopatāya, kukkuramanussānaṃ odanakummāsūpacayatāya sarīrassa hotīti vadanti.
And they say that this (foulness) in snakes is due to their intense anger, and in dogs and humans, it is due to the accumulation of rice and sour gruel in the body.
Và người ta nói rằng, điều đó xảy ra ở rắn do sự độc ác sắc bén, còn ở chó và người do sự tích tụ của cơm và cháo đặc trong thân.
Imesanti ahiādīnaṃ.
Of these—of snakes, etc.
Của những thứ này là của rắn, v.v.
Vaḍḍhetvāti uparūpari khipanena racitaṃ katvā.
Having heaped up—having made it by throwing one thing upon another.
Chất đống là làm cho thành đống bằng cách ném chồng lên nhau.
Taṃ pana vaḍḍhitaṃ tena ca bhājanaṃ pūritaṃ hotīti āha ‘‘vaḍḍhetvā paripūretvā’’ti.
And that which is heaped up fills the vessel, so he says, "having heaped up and filled."
Và cái đống đó được chất đầy cái bát, nên nói “chất đống và làm cho đầy”.
Janassa dassanayogyaṃ dassanīyaṃ jaññaṃ, taṃ paramaparisuddhaṃ manoharañca hotīti āha ‘‘cokkhacokkha’’nti.
That which is suitable for people to see, beautiful, "jaññaṃ" (pure offering), and which is extremely pure and delightful, he says, "spotlessly clean."
Jaññaṃ là cái đáng xem, có thể cho người ta xem, và cái đó là cái rất thanh tịnh và đẹp lòng, nên nói “rất sạch sẽ”.
Abhinavaniviṭṭhā mahāmātā vadhukā.
A newly installed chief minister is a "vadhukā" (bride).
Các vị đại thần mới nhậm chức là vadhukā (cô dâu).
Sā pana puttalābhayogyataṃ upādāya maṅgalavacanena ‘‘janī’’ti vuccati, tassā niyyamānaṃ paṇṇākāraṃ janiyā haratīti jaññaṃ.
But she is called "janī" (mother-to-be) by an auspicious word due to her suitability for bearing children; the tribute being brought to her is called "jaññaṃ" (a pure offering).
Và vị đó được gọi là “janī” (người mẹ) bằng lời chúc phúc do có khả năng sinh con, jaññaṃ là lễ vật được mang đến cho janī khi vị ấy được rước đi.
Ubhayatthāti atthadvaye.
In both senses—in two meanings.
Ở cả hai ý nghĩa là ở hai ý nghĩa.
Punaruttanti āmeḍitavacanamāha.
Repetition—refers to a reduplicated word.
Lặp lại là nói lời lặp lại.
Na manāpaṃ etassāti amanāpo, tassa bhāvo amanāpatā, tathāpavatto cittuppādoti āha ‘‘amanāpaṃ idanti…pe… adhivacana’’nti.
That which is not pleasing to him is unpleasant; its state is unpleasantness, and a mind-moment that proceeds thus, so he says, "This is unpleasant… (pe) … an appellation."
Không vừa ý đối với người này thì là amanāpo (không vừa ý), trạng thái của nó là amanāpatā (sự không vừa ý), tâm sinh khởi vận hành như vậy, nên nói “đây là điều không vừa ý…pe… là tên gọi”.
Buddhavesattā liṅgassa parisuddhakaṃsapātisadisakā.
Like a clean bronze bowl—due to the appearance of a Buddha.
Do mang tướng của Phật, nên giống như cái bát đồng rất sạch.
Kuṇaparacanaṃ viya icchāvacarehi santānassa bharitabhāvo.
Like filling with a corpse—the being filled of the mind-stream with inclinations.
Giống như sự chất đầy xác chết là sự đầy ắp của dòng tâm thức với các pháp dục giới.
So pana tesaṃ appahīnatāyāti āha ‘‘icchāvacarānaṃ appahāna’’nti.
And this is due to their not being abandoned, so he says, "the non-abandonment of inclinations."
Và điều đó là do sự chưa đoạn trừ các pháp dục giới, nên nói “sự chưa đoạn trừ các pháp dục giới”.
62. ‘‘Tena gāmantavihāraṃ anuggaṇhātī’’ti vattabbe ‘‘āraññikatta’’nti pana potthake likhitaṃ.
62. While it should be said, "thereby he favors the village-dwelling," in the text it is written "āraññikatta" (the state of being a forest-dweller).
62. Khi đáng lẽ phải nói “vị ấy giúp đỡ tịnh xá ở làng” thì trong sách lại viết “āraññikatta” (sự ở rừng).
Na hi sukkapakkhe pāḷiyaṃ āraññikaggahaṇaṃ atthi, sati ca icchāvacarappahāne gāmantavihāro ekantena na paṭikkhipitabbo, icchitabbova tādisānaṃ uttarimanussadhammapaṭicchādanato.
For, there is no mention of "āraññika" in the Pāḷi for the bright side, and if inclinations are abandoned, village-dwelling should not be rejected absolutely; rather, it should be desired for such persons, as it conceals their superhuman qualities.
Quả thật, trong Pāḷi của phần thiện không có việc đề cập đến người ở rừng, và khi có sự đoạn trừ các pháp dục giới, thì không nên hoàn toàn bác bỏ việc ở tịnh xá trong làng, mà nên mong muốn điều đó, vì những người như vậy che giấu các pháp siêu nhân.
Tathā hi vakkhati ‘‘appicchatāsamuṭṭhānehī’’tiādi.
Thus he will say, "arising from fewness of wishes," and so forth.
Cũng vậy, Ngài sẽ nói “do khởi lên sự ít dục” v.v.
Sālivarabhattaracanaṃ viya icchāvacarappahānaṃ manuññabhāvato tittihetuto ca.
The abandonment of inclinations is like an arrangement of excellent rice—due to its pleasantness and being a cause of satisfaction.
Sự đoạn trừ các pháp dục giới giống như việc sắp đặt món cơm ngon thượng hạng là do sự dễ chịu và là nguyên nhân của sự no đủ.
63. Maṃ tanti ca upayogavacanaṃ paṭi-saddayogena, attho pana sampadānamevāti āha ‘‘mayhaṃ tuyha’’nti ca.
63. "Maṃ" and "taṃ" are words indicating usage in conjunction with the preposition "paṭi-", but the meaning is that of the dative case, so he says "to me" and "to you."
63. Ta và ngươi là từ chỉ cách dùng với giới từ “paṭi”, nhưng ý nghĩa lại là sở hữu cách, nên nói “của tôi, của bạn”.
‘‘Samaye’’ti bhummatthe ‘‘samaya’’nti upayogavacanaṃ.
"Samaye"—the word "samaya" in the locative case, for the meaning of "time."
“Samaye” là từ chỉ cách dùng “samaya” ở nghĩa sở thuộc.
Gijjhakūṭapaṇḍavaisigilivebhāravepullapabbatānaṃ vasena samantato giriparikkhepena.
Completely surrounded by mountains—by way of the mountains Gijjhakūṭa, Paṇḍava, Isigili, Vebhāra, and Vepulla.
Được bao quanh bởi núi ở khắp nơi theo các ngọn núi Gijjhakūṭa, Paṇḍava, Isigili, Vebhāra, Vepulla.
Rājagaheti samīpatthe bhummavacananti āha ‘‘taṃ nissāya viharāmī’’ti.
In Rājagaha—this is a locative case in the sense of proximity, so he says, "I dwell relying on it."
Ở Rājagaha là từ sở thuộc ở nghĩa gần, nên nói “ta trú nương vào đó”.
Purāṇayānakāraputtoti purāṇe pabbajitato pubbe yānakāraputto tathāpaññāto.
Son of a former cartwright—one so known, a son of a cartwright before his ordination in ancient times.
Con trai của người thợ xe cũ là con trai của người thợ xe được biết đến như vậy trước khi xuất gia.
Jimhanti gomuttakuṭilaṃ.
Crooked—curved like cow's urine.
Jimha là cong queo như nước tiểu bò.
Tenāha ‘‘sappagatamaggasadisa’’nti.
Therefore he says, "like a snake's path."
Vì vậy, Ngài nói “giống như con đường của rắn”.
Soti paṇḍuputto.
He—Panduputta.
Vị đó là Paṇḍuputta.
Itaroti samiti.
The other—Samiti.
Người kia là Samiti.
Cintitaṭṭhānamevāti cintitacintitaṭṭhānameva tacchati, tañca kho na tassa cittānusārena, atha kho attano suttānusārena tacchanto yānakāraputto.
Just the conceived place—he carves just the place that was conceived; and this is not according to his own mind, but the cartwright carves according to his own texts.
Chính là chỗ đã nghĩ là chính là chỗ đã nghĩ, đã nghĩ đến, và người thợ xe đó gọt đẽo không phải theo ý muốn của mình, mà theo ý của kinh điển.
Cittanti attano cittena mama cittaṃ jānitvā viya.
Mind—as if knowing my mind with his own mind.
Tâm là như biết tâm của ta bằng tâm của mình.
‘‘Na saddhāya pabbajito’’ti imināva kammaphalasaddhāya abhāvo nesaṃ pakāsitoti āha ‘‘assaddhāti buddhadhammasaṅghesu saddhāvirahitā’’ti.
By "not ordained out of faith," the absence of faith in the result of kamma is revealed in them, so he says, "disbelieving are those devoid of faith in the Buddha, Dhamma, and Sangha."
“Không xuất gia với niềm tin” – chính điều này đã cho thấy sự không có niềm tin vào quả nghiệp của họ, nên nói “assaddhā là không có niềm tin vào Phật, Pháp, Tăng”.
Pabbajitānaṃ jīvikā attho etesanti jīvikatthā.
Living for a livelihood—these are those for whom the livelihood of ordained ones is the goal.
Jīvikatthā là những người có mục đích là cuộc sống của các vị xuất gia.
Tenāha ‘‘iṇabhayādīhī’’tiādi.
Therefore he says, "from fear of debt," and so forth.
Vì vậy, Ngài nói “do sợ nợ nần” v.v.
Kerāṭikaṃ vuccati sāṭheyyaṃ.
Kerāṭikaṃ means deceit.
Kerāṭikaṃ được gọi là sự lừa dối.
Saṭhānaṃ guṇavāṇijakānaṃ kammaṃ sāṭheyyanti āha ‘‘sāṭheyyañhī’’tiādi.
The action of cunning merchants is deceit, so he says, "for deceit," and so forth.
Hành động của những kẻ lừa dối, những kẻ buôn bán phẩm chất là sự lừa dối, nên nói “sāṭheyyaṃ” v.v.
Tucchasabhāvena māno naḷo viyāti naḷo, mānasaṅkhāto uggato naḷo etesanti unnaḷā.
Arrogant—like a reed, due to its empty nature, so naḷo (reed); those in whom the arisen reed of conceit (māna) is present are unnaḷā.
Ngã mạn như cây sậy do bản chất trống rỗng là naḷo, unnaḷā là những người có cây sậy ngã mạn đã trỗi dậy.
Tenāha ‘‘uṭṭhitatucchamānā’’ti.
Therefore he says, "having risen, empty conceit."
Vì vậy, Ngài nói “có ngã mạn trống rỗng đã trỗi dậy”.
Lahukatāya vā capalā.
Or fickle due to lightness.
Hoặc capalā do sự nhẹ dạ.
Pharusavacanatāya kharavacanā.
Harsh-voiced due to speaking rough words.
Kharavacanā do lời nói thô ác.
Tiracchānakathābahulatāya niratthakavacanapalāpino.
Speaking idle chatter of useless talk due to an abundance of animal talk.
Niratthakavacanapalāpino do nói nhiều chuyện tầm phào.
Asaṃvutakammadvārāti idaṃ kammadvārādīnaṃ asaṃvutabhāvo uppattidvārānaṃ asaṃvutatāya eva hotīti katvā vuttaṃ.
Unrestrained in the doors of action—this is stated because the unrestrained nature of the doors of action, etc., arises only from the unrestrained nature of the doors of origination.
Asaṃvutakammadvārā – điều này được nói vì sự không phòng hộ các cửa nghiệp, v.v. là do sự không phòng hộ các cửa sinh khởi.
Atha vā chasu indriyesūti nimitte bhummaṃ, chasu indriyesu nimittabhūtesu asaṃvutakammadvārāti attho.
Alternatively, in the six sense faculties—the locative case is used for the object; the meaning is, unrestrained in the doors of action when the six sense faculties are the objects.
Hoặc chasu indriyesu là sở thuộc ở nghĩa dấu hiệu, ý nghĩa là các cửa nghiệp không phòng hộ khi sáu căn là dấu hiệu.
Yā mattāti bhojane ayuttapariyesana-ayuttapaṭiggahaṇa-ayuttaparibhoge vajjetvā yuttapariyesana-yuttapaṭiggahaṇa-yuttaparibhogasaṅkhātā yā mattā appamattehi jānitabbā.
That measure—that measure in food, which is avoiding improper seeking, improper receiving, and improper consuming, and instead seeking properly, receiving properly, and consuming properly; this measure should be known by the heedful.
Yā mattā là sự chừng mực mà những người không phóng dật cần phải biết, bao gồm việc tìm kiếm đúng cách, nhận lãnh đúng cách, thọ dụng đúng cách, tránh việc tìm kiếm sai cách, nhận lãnh sai cách, thọ dụng sai cách trong bữa ăn.
Tenāha ‘‘yuttatā’’ti.
Therefore he says, "propriety."
Vì vậy, Ngài nói “sự đúng mức”.
Jāgareti rattindivaṃ āvaraṇiyehi dhammehi cittaparisodhanasaṅkhāte jāgare.
In vigilance—in vigilance, which is the purification of the mind from obstructing defilements day and night.
Jāgare là sự tỉnh thức, tức là sự thanh lọc tâm khỏi các pháp chướng ngại suốt ngày đêm.
Tesaṃ jāgaritāya adhisīlasikkhāya gāravarahitānaṃ itarasikkhāsu patiṭṭhā eva natthīti dassento ‘‘sikkhāpadesu bahulagāravā na hontī’’ti vatvā tameva gāravābhāvaṃ sarūpena vibhāvento ‘‘āpattivītikkamabahulā’’ti āha.
Showing that those who lack respect for the training in higher virtue through their vigilance have no foundation in the other trainings, he says, "they are not greatly respectful of the precepts," and then clarifying this lack of respect in its true nature, he says, "abounding in transgressions."
Để cho thấy rằng những người không có sự tôn kính đối với giới học do sự tỉnh thức của họ thì không có chỗ đứng trong các học khác, Ngài nói “không có nhiều sự tôn kính đối với các học giới”, và để làm rõ sự không tôn kính đó bằng hình thức, Ngài nói “phạm nhiều giới”.
Pakatiyāpi siddhāya ratanattayasaddhāya kammaphalasaddhāya ca saddhā.
Faith is a natural faith in the Triple Gem and faith in the results of kamma.
Saddhā là niềm tin vào Tam Bảo đã có sẵn một cách tự nhiên và niềm tin vào quả nghiệp.
Pivanti maññe yathā taṃ dravabhūtaṃ amataṃ laddhā.
They drink, I think—as if they had received that liquid ambrosia.
Như thể uống như thể đã nhận được cam lồ ở dạng chất lỏng.
Ghasanti maññe yathā taṃ bahalapiṇḍikasudhābhojanaṃ laddhā.
They eat, I think—as if they had received that solid, substantial sweet food.
Như thể ăn như thể đã nhận được món ăn ngon lành, đặc quánh.
Attamanavācaṃ nicchārentā ‘‘sādhu sādhū’’ti.
Uttering joyous speech—"Excellent! Excellent!"
Thốt ra lời hoan hỷ “lành thay, lành thay”.
Tameva pana sādhukāraṃ hadaye ṭhapetvā abbhanumodantā. Ettha ca attamanavācānicchāraṇaṃ pivanasadisaṃ katvā vuttaṃ bahiddhābhāvato, manasā abbhanumodanaṃ pana abbhantarabhāvato ghasanasadisaṃ vuttaṃ.
And placing that approval in their hearts, they approve. Here, the utterance of joyous speech is likened to drinking because it is external, while mental approval is likened to eating because it is internal.
Và hoan hỷ bằng cách giữ lời tán thán đó trong lòng. Ở đây, việc thốt ra lời hoan hỷ được nói là giống như uống vì là hành động bên ngoài, còn việc hoan hỷ trong tâm được nói là giống như ăn vì là hành động bên trong.
Saṅkhādanajjhoharaṇañhi ghasananti.
For eating means chewing and swallowing.
Vì ghasana là ăn và nuốt.
Rassañca ekavacanaṃ hotīti āha ‘‘rasse sati sāriputtassa upari hotī’’ti.
And the short vowel is singular, so he says, "when short, it is over Sāriputta."
Và khi là âm ngắn thì là số ít, nên nói “khi là âm ngắn thì là của Sāriputta”.
Dīghañca bahuvacanaṃ hotīti āha ‘‘dīghe sati sabrahmacārīna’’nti.
And the long vowel is plural, so he says, "when long, it is of the fellow monastics."
Và khi là âm dài thì là số nhiều, nên nói “khi là âm dài thì là của các vị đồng phạm hạnh”.
‘‘Upari hotī’’ti ānetvā sambandho.
"Is over" is to be supplied and connected.
“Ở trên” được mang đến để liên kết.
Ālasiyabyasanādīhīti ālasiyena vā ñātibyasanādīhi vā.
By idleness and calamities, etc. means either by idleness or by calamities concerning relatives, etc.
Do lười biếng, v.v. là do lười biếng hoặc do tai họa liên quan đến thân quyến, v.v.
‘‘Mahānāgāti vuccantī’’ti vatvā tattha kāraṇaṃ vibhāvento ‘‘tatrā’’tiādimāha.
Having said "They are called great nāgas," he then explained the reason for it by starting with "There..."
Sau khi nói “được gọi là Mahānāga (Đại Long)”, để giải thích lý do ở đó,* nói bắt đầu bằng “ở đó”.
Tattha ‘‘na gacchantīti nāgā, na āgacchantīti nāgā, na āguṃ karontīti nāgā’’ti yo vividho vacanattho icchito, taṃ vicāretvā dassetuṃ ‘‘chandādīhī’’tiādi vuttaṃ, taṃ pana ñeyyāvabodhāya vacanato appamattakāraṇaṃ.
There, to examine and show the various meanings of the word intended, such as "they do not go, thus nāgas; they do not come, thus nāgas; they do not commit evil, thus nāgas," the phrase "by desire, etc." and so on was stated, but that is a minor reason relating to the understanding of what is to be known.
Ở đó, ý nghĩa lời nói đa dạng được mong muốn là “không đi thì là nāga, không đến thì là nāga, không làm điều ác thì là nāga”. Để xem xét và chỉ ra điều đó,* đã nói bắt đầu bằng “do dục, v.v.”, nhưng đó chỉ là một lý do nhỏ để hiểu biết.
Sayameva āguṃ na karoti sabbathā maggena pahīnaāguttā.
He does not commit evil himself, being one whose evil has been entirely abandoned by the path.
Tự mình không làm điều ác vì đã đoạn trừ hoàn toàn mọi điều ác bằng con đường.
So kāmayogādike sabbasaṃyoge dasavidhasaṃyojanappabhedāni ca sabbabandhanāni visajja jahitvā sabbattha yakkhādīsu, sabbesu vā bhavesu kenaci saṅgena na sajjati tīhi ca vimuttīhi vimutto, tato eva iṭṭhādīsu tādibhāvappattiyā tādi, so vuttalakkhaṇena tathattā taṃsabhāvattā nāgo pavuccateti attho veditabbo.
Such a one releases all fetters, meaning the ten kinds of fetters and all bonds like the bonds of sense desires, etc., and does not cling anywhere, to devas and other beings, or to any existence, due to any attachment, being released by the three liberations. Therefore, having attained the state of equanimity in pleasant things, etc., he is equanimous (tādi). Such a one, by virtue of such a nature as described, is called a nāga—this meaning should be understood.
Vị ấy đã đoạn trừ tất cả các kiết sử, tức là mười loại kiết sử và tất cả các trói buộc, như các kiết sử dục, v.v. Vị ấy không dính mắc vào bất cứ điều gì ở mọi nơi, dù là các loài quỷ, v.v., hay ở tất cả các cõi tồn tại, và đã giải thoát bằng ba sự giải thoát. Vì thế, vị ấy là bậc như vậy do đạt được trạng thái như vậy đối với những điều ưa thích, v.v. Ý nghĩa cần được hiểu là vị ấy được gọi là nāga do bản chất như vậy với đặc tính đã nêu.
Tenāha ‘‘evamettha attho veditabbo’’ti.
Therefore, he said, "Thus, the meaning here should be understood."
Vì vậy,* nói “ý nghĩa cần được hiểu ở đây là như vậy”.
Aññehi khīṇāsavanāgehi aggasāvakattā guṇavisesayogato pujjatarā ca pāsaṃsatarā ca.
They are more venerable and more praiseworthy than other Arahant nāgas due to their superior qualities as chief disciples.
So với các vị nāga đã đoạn tận lậu hoặc khác,* đáng được tôn kính hơn và đáng được khen ngợi hơn do có phẩm chất đặc biệt của bậc Thượng Thủ Thanh Văn.
Samaṃ anumodisunti aññamaññassa subhāsitato sampaṭicchanena samappavattamodatāya samaṃ sadisaṃ abbhanumodiṃsu.
They rejoiced equally means they equally and mutually approved, showing similar delight, accepting each other's well-spoken words.
Đồng thanh hoan hỷ là cùng nhau hoan hỷ, đồng lòng chấp thuận những lời lẽ tốt đẹp của nhau.
Taṃ pana samanumodanaṃ ‘‘tatthā’’tiādinā pāḷivaseneva dasseti.
He shows that approval "There..." and so on, following the Pali text itself.
Sự đồng thanh hoan hỷ đó được chỉ ra bằng chính văn Pāḷi bắt đầu bằng “ở đó”.
64. Sampannanti paripuṇṇaṃ, samantato pannaṃ pattanti sampannaṃ.
Perfected (sampannaṃ) means complete, fully attained.
64. Hoàn hảo là đầy đủ, hoàn toàn đạt được, tức là sampanna.
Tenāha ‘‘idaṃ paripuṇṇasampannaṃ nāmā’’ti.
Therefore, he said, "This is called complete and perfected."
Vì vậy,* nói “cái này được gọi là hoàn toàn đầy đủ”.
Nanti ‘‘suvā’’ti vuttaṃ suvagaṇaṃ.
It (naṃ) refers to the group of parrots mentioned as "parrots."
Không là tập hợp chim két được gọi là “suvā”.
Sampannoti sammadeva panno gato upagato.
Perfected (sampanno) means one who has gone or approached well.
Hoàn hảo là đã đạt đến, đã thâm nhập một cách đúng đắn.
Tenāha ‘‘samannāgato’’ti.
Therefore, he said, "endowed with."
Vì vậy,* nói “đã đầy đủ”.
Sampannanti sampattiyuttaṃ.
Perfected (sampannaṃ) means endowed with excellence.
Hoàn hảo là có sự thành tựu.
Sā panettha rasasampatti adhippetā sāmaññajotanāya visese avaṭṭhānato.
Here, the excellence of taste is intended, as it stands apart in particular by illuminating the general meaning.
Ở đây, ý muốn nói đến sự thành tựu về hương vị, vì nó được xác định trong tính chất chung để làm nổi bật sự đặc biệt.
Tenāha ‘‘seyyathāpi khuddamadhuṃ aneḷaka’’nti, niddosanti attho.
Therefore, he said, "just as pure honey," meaning faultless.
Vì vậy,* nói “ví như mật ong rừng không có tạp chất”, nghĩa là không có lỗi.
Tena vuttaṃ ‘‘idaṃ madhurasampannaṃ nāmā’’ti.
Thus, it is said, "This is called perfected in taste."
Vì vậy,* nói “cái này được gọi là hoàn hảo về hương vị mật”.
Sīlassa anavasesasamādānena akhaṇḍādibhāvāpattiyā ca paripuṇṇasīlā.
Perfected in virtue (paripuṇṇasīlā) by undertaking it completely and by its becoming unbroken, etc.
Giới hạnh đầy đủ là do thọ trì giới không sót và đạt đến trạng thái không bị phá hoại, v.v.
Samādānato paṭṭhāya acchindanato sīlasamaṅgino.
Endowed with virtue (sīlasamaṅgino) by not breaking it from the moment of undertaking.
Đầy đủ giới hạnh là do không bị gián đoạn kể từ khi thọ trì.
Samādānato hi accantavirodhidhammānuppattiyā sīlasamaṅgitā veditabbā, cetanādīnaṃ pana sīlanalakkhaṇānaṃ dhammānaṃ pavattikkhaṇe vattabbameva natthi.
Indeed, being endowed with virtue should be understood from the non-arising of diametrically opposed states after undertaking it; there is no need to speak of the moment of occurrence of states like volition, etc., which are characterized by virtue.
Thật vậy, sự đầy đủ giới hạnh cần được hiểu là do không phát sinh các pháp đối nghịch hoàn toàn kể từ khi thọ trì. Còn đối với các pháp có đặc tính là giới như ý chí, v.v., thì không cần phải nói đến trong khoảnh khắc phát sinh.
Visuddhimagge (visuddhi. 1.9) vuttā, tasmā tattha vuttanayeneva vitthārakathā veditabbāti adhippāyo.
It is stated in the Visuddhimagga ; therefore, the detailed explanation should be understood in the manner stated there—this is the intention.
Đã được nói đến trong Thanh Tịnh Đạo, do đó, ý nghĩa là câu chuyện chi tiết cần được hiểu theo cách đã nói ở đó.
Khettapāripūrīti nissitapāripūriyā nissayapāripūrimāha nissitakammavipattisampattivisayattā yathā ‘‘mañcā ukkuṭṭhiṃ karontī’’ti.
Completeness of the field refers to the completeness of the basis by means of the completeness of the dependent, because it relates to the failure or success of the dependent action, just as "the couches are shouting."
Sự đầy đủ của ruộng đất là nói về sự đầy đủ của nơi nương tựa thông qua sự đầy đủ của người nương tựa, vì nó là đối tượng của sự thất bại và thành công của nghiệp phụ thuộc, giống như “các giường đang la hét” (mañcā ukkuṭṭhiṃ karontī).
Tathā hi khettena khaṇḍapūtiādidoso vutto.
Thus, a defect such as brokenness or rottenness is mentioned in relation to the field.
Thật vậy, ruộng đất được nói đến với các lỗi như bị hư hại, thối rữa, v.v.
Khettaṃ khaṇḍaṃ hotīti aparipūraṃ hoti sassapāripūriyā abhāvato.
The field is broken means it is incomplete due to the absence of the completeness of the crop.
Ruộng đất bị hư hại là không đầy đủ vì không có sự đầy đủ của mùa màng.
Tenevāha ‘‘sassaṃ na uṭṭhetī’’ti.
Therefore, he said, "the crop does not grow."
Vì vậy,* nói “mùa màng không phát triển”.
Pādamattassapi anekambaṇaphalanato mahapphalaṃ hoti.
It yields great fruit as even a small measure produces many bushels.
Có quả lớn là do một phần nhỏ cũng cho ra nhiều giạ quả.
Kisalayapalālādibahutāya mahānisaṃsaṃ.
It is of great benefit due to the abundance of sprouts, straw, etc.
Có lợi ích lớn là do có nhiều chồi non, rơm rạ, v.v.
Evamevanti yathā khittaṃ bījaṃ khaṇḍādicatudosavasena aparipuṇṇaṃ hoti, tadabhāvena ca paripuṇṇaṃ, evaṃ sīlaṃ khaṇḍādicatudosavasena aparipuṇṇaṃ hoti, tadabhāvena ca paripuṇṇanti, catudosatadabhāvasāmaññameva nidassananidassitabbavipattisampattīsu dasseti.
Similarly, just as sown seed is incomplete due to the four defects of brokenness, etc., and complete in their absence, so too is virtue incomplete due to the four defects of brokenness, etc., and complete in their absence; thus, he shows the commonality of the four defects and their absence in both the example and the exemplified failure and success.
Cũng vậy là ví như hạt giống gieo xuống không đầy đủ do bốn lỗi hư hại, v.v., và đầy đủ khi không có chúng; cũng vậy, giới hạnh không đầy đủ do bốn lỗi hư hại, v.v., và đầy đủ khi không có chúng. Điều này chỉ ra sự tương đồng của bốn lỗi và sự không có chúng trong sự thất bại và thành công được ví dụ.
Mahapphalaṃ hoti vipākaphalena.
It yields great fruit in terms of resultant fruit.
Có quả lớn là về quả báo.
Mahānisaṃsanti vipulānisaṃsaṃ.
It is of great benefit meaning of immense benefit.
Có lợi ích lớn là có lợi ích rộng lớn.
Svāyaṃ ānisaṃso idha pāḷiyaṃ nānappakārena vitthārīyati.
This benefit is expounded in various ways in the Pali text here.
Lợi ích này được giải thích chi tiết theo nhiều cách trong văn Pāḷi ở đây.
Ettāvatā kirāti (a. ni. ṭī. 2.2.37; a. ni. ṭī. 3.10.71-74) kira-saddo arucisūcanattho.
By this much, it is said... The word kira here indicates a sense of dislike.
Đến mức này, kỳ lạ thay – từ kira (kỳ lạ thay) có ý nghĩa chỉ sự không hài lòng.
Tenettha ācariyavādassa attano aruccanabhāvaṃ dīpeti.
Here, it implies his disapproval of the teacher's statement.
Vì vậy, ở đây, nó chỉ ra sự không hài lòng của mình đối với quan điểm của vị thầy.
Sampannasīlāti anāmaṭṭhavisesaṃ sāmaññato sīlasaṅkhepena gahitaṃ.
Perfected in virtue (sampannasīlā) grasps virtue in general, without mentioning any specific distinction.
Giới hạnh đầy đủ là giới hạnh được nắm giữ một cách chung chung, không đề cập đến chi tiết đặc biệt nào.
Tañca catubbidhanti ācariyatthero ‘‘catupārisuddhisīlaṃ uddisitvā’’ti āha.
And since it is fourfold, the Venerable Teacher said, "having designated the fourfold pure virtue."
Vị Thầy Trưởng lão đã nói “sau khi chỉ ra Tứ Thanh Tịnh Giới” rằng giới hạnh đó có bốn loại.
Tatthāti catupārisuddhisīle.
There (tattha) means in the fourfold pure virtue.
Ở đó là trong Tứ Thanh Tịnh Giới.
Jeṭṭhakasīlanti (saṃ. ni. ṭī. 3.5.412) padhānasīlaṃ.
Principal virtue (jeṭṭhakasīlaṃ) means fundamental virtue.
Giới hạnh chính yếu là giới hạnh chủ yếu.
Ubhayatthāti uddesaniddese.
In both instances means in both the designation (uddesa) and the explanation (niddesa).
Ở cả hai nơi là trong phần tóm tắt và phần giải thích.
Idha niddese viya uddesepi pātimokkhasaṃvaro bhagavatā vutto ‘‘sampannasīlā’’ti vuttattāti adhippāyo.
The intention is that the Pātimokkha restraint was stated by the Blessed One in the designation as well as in the explanation, as implied by the phrase "perfected in virtue."
Ý nghĩa là, như trong phần giải thích, trong phần tóm tắt cũng Phật đã nói về sự phòng hộ theo giới bổn Pātimokkha vì đã nói “giới hạnh đầy đủ”.
Sīlaggahaṇañhi pāḷiyaṃ pātimokkhasaṃvaravasena āgataṃ.
Indeed, the mention of virtue in the Pali text refers to Pātimokkha restraint.
Thật vậy, sự nắm giữ giới trong văn Pāḷi được đề cập theo cách phòng hộ theo giới bổn Pātimokkha.
Tenāha ‘‘pātimokkhasaṃvaroyevā’’tiādi.
Therefore, he said, "only Pātimokkha restraint," and so on.
Vì vậy,* nói “chính là sự phòng hộ theo giới bổn Pātimokkha”, v.v.
Tattha avadhāraṇena itaresaṃ tiṇṇaṃ ekadesena pātimokkhantogadhabhāvaṃ dīpeti.
Here, the emphasizing particle indicates that the other three are included within the Pātimokkha to some extent.
Ở đó, bằng cách nhấn mạnh,* chỉ ra rằng ba loại giới còn lại là một phần của giới bổn Pātimokkha.
Tathā hi anolokiyolokane ājīvahetu chasikkhāpadavītikkame gilānapaccayassa apaccavekkhitaparibhoge ca āpatti vihitāti.
For instance, an offense is incurred for looking without reflection, for transgression of the six training rules for livelihood, and for consuming requisites for the sick without reflection.
Thật vậy, lỗi được quy định trong việc nhìn không đúng đắn, trong việc vi phạm sáu giới điều vì mục đích sinh kế, và trong việc sử dụng các vật dụng cho người bệnh mà không quán chiếu.
Tīṇīti indriyasaṃvarasīlādīni.
The three refer to virtue of sense-restraint, etc.
Ba là giới phòng hộ các căn, v.v.
Sīlanti vuttaṭṭhānaṃ nāma atthīti sīlapariyāyena tesaṃ katthaci sutte gahitaṭṭhānaṃ nāma kiṃ atthi yathā pātimokkhasaṃvaroti ācariyassa sammukhattā apaṭikkhipantova upacārena pucchanto viya vadati.
Is there any place where it is called virtue? This means: is there any place in a Sutta where these (other virtues) are taken as synonymous with virtue, like Pātimokkha restraint? He asks this as if questioning courteously, without refuting it directly, since he is facing the teacher.
Có nơi nào được gọi là giới hạnh không? là có nơi nào trong các kinh mà chúng được đề cập theo cách giới hạnh, giống như sự phòng hộ theo giới bổn Pātimokkha không? Vị ấy nói như đang hỏi một cách lịch sự, không phản đối vì đang đối diện với vị thầy.
Tenāha ‘‘ananujānanto’’ti.
Therefore, he said, "not agreeing."
Vì vậy,* nói “không chấp nhận”.
Chadvārarakkhāmattakamevāti tassa sallahukabhāvamāha cittādhiṭṭhānamattena paṭipākatikabhāvāpattito.
Merely guarding the six doors means he states its lightness, as it becomes natural simply by the determination of the mind.
Chỉ là sự bảo vệ sáu căn là nói về sự nhẹ nhàng của nó, vì nó trở thành một hành vi thông thường chỉ với sự hỗ trợ của tâm.
Itaradvayepi eseva nayo.
The same method applies to the other two (virtues).
Đối với hai loại còn lại, cũng theo cách này.
Paccayuppattimattakanti phalena hetuṃ dasseti.
Mere arising of requisites means he shows the cause by the effect.
Chỉ là sự phát sinh của các duyên là chỉ ra nguyên nhân bằng kết quả.
Uppādanahetukā hi paccayānaṃ uppatti.
For the arising of requisites has the production of them as its cause.
Thật vậy, sự phát sinh của các duyên là do nguyên nhân tạo ra.
Idamatthanti idaṃ payojanaṃ imassa paccayassa paribhuñjaneti adhippāyo.
This purpose means this is the objective of consuming this requisite—this is the intention.
Ý nghĩa này là ý nghĩa của việc sử dụng duyên này, đó là mục đích này.
Nippariyāyenāti iminā indriyasaṃvarādīni tīṇi padhānassa sīlassa parivāravasena pavattiyā pariyāyasīlāni nāmāti dasseti.
Without metaphorical meaning means by this he shows that the three, such as sense-restraint, etc., are metaphorical virtues, as they function as attendants to the principal virtue.
Không theo cách gián tiếp là bằng cách này, ba loại giới như giới phòng hộ các căn, v.v., được chỉ ra là giới gián tiếp vì chúng hoạt động như các giới phụ thuộc của giới chính yếu.
Idāni pātimokkhasaṃvarasseva padhānabhāvaṃ byatirekato anvayato ca upamāya vibhāvetuṃ ‘‘yassā’’tiādimāha.
Now, to illustrate the primary nature of Pātimokkha restraint through both antithesis and synthesis, using an analogy, he begins with "When his..."
Bây giờ, để giải thích tính chất chính yếu của riêng giới phòng hộ theo giới bổn Pātimokkha bằng cách so sánh từ cả hai mặt thuận và nghịch,* nói bắt đầu bằng “của ai”.
Tattha soti pātimokkhasaṃvaro.
There, he (so) refers to Pātimokkha restraint.
Ở đó, nó là sự phòng hộ theo giới bổn Pātimokkha.
Sesānīti indriyasaṃvarādīni.
The others (sesānī) refer to sense-restraint, etc.
Còn lại là giới phòng hộ các căn, v.v.
Tassevāti ‘‘sampannasīlā’’ti ettha yaṃ sīlaṃ vuttaṃ, tasseva.
Of that very one (tasseva) means of the virtue mentioned in "perfected in virtue."
Của chính nó là của giới hạnh đã được nói đến trong “giới hạnh đầy đủ”.
Sampannapātimokkhāti ettha pātimokkhaggahaṇena vevacanaṃ vatvā taṃ vitthāretvā…pe… ādimāha.
In "perfected in Pātimokkha," by taking Pātimokkha, he states a synonym and then elaborates upon it... and so on, he begins.
Trong Pātimokkha đầy đủ ở đây, bằng cách nắm giữ Pātimokkha,* nói một từ đồng nghĩa và giải thích nó… v.v… nói bắt đầu.
Yathā aññathāpi ‘‘idha bhikkhu sīlavā hotī’’ti (mahāni. 199) puggalādhiṭṭhānāya desanāya uddiṭṭhaṃ sīlaṃ ‘‘pātimokkhasaṃvarasaṃvuto viharatī’’ti (vibha. 508; mahāni. 199) niddiṭṭhaṃ.
Similarly, elsewhere, the virtue designated in a teaching based on an individual, such as "Here, a monk is virtuous," is explained as "he dwells endowed with Pātimokkha restraint."
Cũng vậy, một cách khác, giới hạnh được chỉ ra trong lời thuyết giảng dựa trên cá nhân “ở đây, một tỳ khưu có giới hạnh” được giải thích là “sống với sự phòng hộ theo giới bổn Pātimokkha” .
Aparo nayo (udā. aṭṭha. 31; itivu. aṭṭha. 97) – kilesānaṃ balavabhāvato, pāpakiriyāya sukarabhāvato, puññakiriyāya ca dukkarabhāvato bahukkhattuṃ apāyesu patanasīloti pātī, puthujjano.
Another method: Due to the strong nature of defilements, the ease of performing unwholesome deeds, and the difficulty of performing wholesome deeds, one who is prone to falling into lower realms many times is pātī, a worldling (puthujjana).
Một cách giải thích khác (Udā. Aṭṭha. 31; Itivu. Aṭṭha. 97) – Vì các phiền não có sức mạnh, việc làm ác dễ dàng, và việc làm phước khó khăn, nên phàm nhân (puthujjano) có khuynh hướng sa đọa nhiều lần vào các cõi khổ (apāya), do đó gọi là Pātī.
Aniccatāya vā bhavādīsu kammavegakkhitto ghaṭīyantaṃ viya anavaṭṭhānena paribbhamanato gamanasīloti pātī, maraṇavasena vā tamhi tamhi sattanikāye attabhāvassa pātanasīloti pātī, sattasantāno, cittameva vā, taṃ pātiṃ saṃsāradukkhato mokkhetīti pātimokkhaṃ.
Or, due to impermanence, it is pātī (that which goes), wandering without stability, like a pot thrown by the force of kamma in existences and so forth; or, it is pātī (that which falls) because it is of the nature to cause the falling of existence in each group of beings due to death; this refers to the stream of beings, or indeed, the mind itself. That which liberates that pātī from the suffering of saṃsāra is Pātimokkha.
Hoặc vì sự vô thường, bị nghiệp lực thúc đẩy trong các cõi hữu, lang thang không ngừng như bị kéo lê, nên có khuynh hướng đi (gamana-sīla), do đó gọi là Pātī, tức là dòng dõi chúng sinh (sattasantāna), hoặc chính tâm thức (citta), điều giải thoát cái Pātī đó khỏi khổ luân hồi (saṃsāra-dukkha) thì gọi là Pātimokkha.
Cittassa hi vimokkhena satto vimuttoti vuccati.
For a being is said to be liberated by the liberation of the mind.
Thật vậy, nhờ sự giải thoát của tâm thức mà chúng sinh được gọi là giải thoát.
Vuttañhi ‘‘cittavodānā visujjhantī’’ti, ‘‘anupādāya āsavehi cittaṃ vimutta’’nti (mahāva. 28) ca.
Indeed, it is said: "They are purified by the cleansing of the mind," and "The mind is liberated from the taints without clinging."
Như đã nói: ‘‘nhờ sự thanh tịnh của tâm mà được thanh tịnh’’ và ‘‘tâm giải thoát khỏi các lậu hoặc không còn chấp thủ’’ (Mahāva. 28).
Atha vā avijjādinā hetunā saṃsāre patati gacchati pavattatīti pātī.
Or, pātī is that which falls, goes, or proceeds in saṃsāra due to causes such as ignorance.
Hoặc, vì các nguyên nhân như vô minh, chúng sinh rơi vào (patati), đi (gacchati), tiếp diễn (pavattati) trong luân hồi, nên gọi là Pātī.
‘‘Avijjānīvaraṇānaṃ sattānaṃ taṇhāsaṃyojanānaṃ sandhāvataṃ saṃsarata’’nti (saṃ. ni. 2.125) hi vuttaṃ.
For it is said: "Beings veiled by ignorance, bound by craving, run on and transmigrate."
Thật vậy, đã nói: ‘‘Chúng sinh bị vô minh che lấp, bị tham ái trói buộc, cứ mãi trôi lăn, luân chuyển’’ (Saṃ. Ni. 2.125).
Tassa pātino sattassa taṇhādisaṃkilesattayato mokkho etenāti pātimokkho.
The liberation of that pātī being from the triple defilement of craving and so forth is by this; hence, Pātimokkha.
Điều giải thoát chúng sinh Pātī đó khỏi ba loại phiền não như tham ái thì gọi là Pātimokkha.
‘‘Kaṇṭhekālo’’tiādīnaṃ viya samāsasiddhi veditabbā.
The formation of the compound should be understood like "Kaṇṭhekālo" (black-throated) and so forth.
Sự thành lập hợp từ cần được hiểu như trong các trường hợp ‘‘Kaṇṭhekālo’’ (có cổ màu xanh) v.v.
Atha vā pāteti vinipāteti dukkheti pāti, cittaṃ.
Or, pātī is that which causes to fall, causes to perish, causes suffering—the mind.
Hoặc, làm cho sa đọa (pāteti), làm cho rơi rụng (vinipāteti), làm cho đau khổ (dukkheti) là Pātī, tức là tâm thức.
Vuttañhi ‘‘cittena nīyati loko, cittena parikassatī’’ti (saṃ. ni. 1.62).
For it is said: "The world is led by the mind, the world is dragged along by the mind."
Thật vậy, đã nói: ‘‘Thế gian bị tâm thức dẫn dắt, thế gian bị tâm thức lôi kéo’’ (Saṃ. Ni. 1.62).
Tassa pātino mokkho etenāti pātimokkho.
The liberation from that pātī is by this; hence, Pātimokkha.
Điều giải thoát khỏi cái Pātī đó thì gọi là Pātimokkha.
Patati vā etena apāyadukkhe saṃsāradukkhe cāti pātī, taṇhādisaṃkileso.
Or, pātī is that by which one falls into the suffering of the lower realms and the suffering of saṃsāra—craving and other defilements.
Hoặc, vì nhờ nó mà rơi vào khổ cõi dữ và khổ luân hồi, nên gọi là Pātī, tức là các phiền não như tham ái.
Vuttañhi ‘‘taṇhā janeti purisaṃ (saṃ. ni. 1.57), taṇhādutiyo puriso’’ti (itivu. 15, 105; a. ni. 4.9) ca ādi.
For it is said: "Craving generates a person," and "A person is accompanied by craving," and so forth.
Thật vậy, đã nói: ‘‘Tham ái sinh ra con người’’ (Saṃ. Ni. 1.57), ‘‘Con người có tham ái làm bạn đồng hành’’ (Itivu. 15, 105; A. Ni. 4.9) v.v.
Tato pātito mokkhoti pātimokkho.
The liberation from that pātī is Pātimokkha.
Giải thoát khỏi cái Pātī đó thì gọi là Pātimokkha.
Atha vā patati etthāti pātī, cha ajjhattikabāhirāni āyatanāni.
Or, pātī is that into which one falls—the six internal and external sense bases.
Hoặc, vì người ta rơi vào đó (patati ettha), nên gọi là Pātī, tức là sáu nội và ngoại xứ.
Vuttañhi ‘‘chasu loko samuppanno, chasu kubbati santhava’’nti (saṃ. ni. 1.70; su. ni. 171).
For it is said: "The world has arisen in six, in six it makes intimacy."
Thật vậy, đã nói: ‘‘Thế gian khởi lên từ sáu, thế gian tạo sự thân thiện với sáu’’ (Saṃ. Ni. 1.70; Su. Ni. 171).
Tato ajjhattikabāhirāyatanasaṅkhātato pātito mokkhoti pātimokkho.
The liberation from that pātī, which consists of the internal and external sense bases, is Pātimokkha.
Giải thoát khỏi cái Pātī đó, tức là các nội và ngoại xứ, thì gọi là Pātimokkha.
Atha vā pāto vinipāto assa atthīti pātī, saṃsāro.
Or, pātī is that which has falling or perishing—saṃsāra.
Hoặc, vì có sự sa đọa (pāto), sự rơi rụng (vinipāto) trong đó, nên gọi là Pātī, tức là luân hồi.
Tato mokkhoti pātimokkho.
The liberation from that is Pātimokkha.
Giải thoát khỏi điều đó thì gọi là Pātimokkha.
Atha vā sabbalokādhipatibhāvato dhammissaro bhagavā ‘‘patī’’ti vuccati, muccati etenāti mokkho, patino mokkho tena paññattattāti pātimokkho.
Or, the Blessed One, the Lord of Dhamma, is called "Pati" due to his sovereignty over all worlds; mokkha is that by which one is liberated; the liberation of the Lord is by this, because it is promulgated by him, hence Pātimokkha.
Hoặc, vì là bậc chủ tể của tất cả thế gian, bậc Pháp chủ, nên Đức Thế Tôn được gọi là ‘‘Pati’’; điều nhờ đó mà được giải thoát (muccati) thì gọi là mokkha; sự giải thoát của bậc chủ tể (patino mokkho) vì được Ngài chế định, nên gọi là Pātimokkha.
Pātimokkho eva pātimokkho.
Pātimokkha is indeed Pātimokkha.
Pātimokkha chính là Pātimokkha.
Sabbaguṇānaṃ vā mūlabhāvato uttamaṭṭhena pati ca so yathāvuttatthena mokkho cāti pātimokkho.
Or, due to being the root of all good qualities, and being supreme, it is Pati, and it is Mokkha in the aforementioned sense; thus, Pātimokkha.
Hoặc, vì là nền tảng của tất cả các đức tính, là bậc tối thượng (uttamaṭṭhena pati) và là sự giải thoát theo nghĩa đã nói, nên gọi là Pātimokkha.
Pātimokkho eva pātimokkho.
Pātimokkha is indeed Pātimokkha.
Pātimokkha chính là Pātimokkha.
Tathā hi vuttaṃ ‘‘pātimokkhantiādimetaṃ mukhametaṃ pamukhameta’’nti (mahāva. 135) vitthāro.
Thus, it is said in detail: "Pātimokkha means this is the beginning, this is the mouth, this is the foremost."
Thật vậy, đã nói: ‘‘Pātimokkha là khởi đầu này, là cửa ngõ này, là cổng chính này’’ (Mahāva. 135) v.v.
Atha vā pa-iti pakāre, atīti accantatthe nipāto, tasmā pakārehi accantaṃ mokkhetīti pātimokkho.
Or, pa is a particle signifying manner, ati is a particle signifying extreme; therefore, that which liberates completely in various ways is Pātimokkha.
Hoặc, Pa- là giới từ chỉ cách thức, atī là giới từ chỉ ý nghĩa tuyệt đối, do đó, điều giải thoát một cách tuyệt đối bằng nhiều cách thức thì gọi là Pātimokkha.
Idañhi sīlaṃ sayaṃ tadaṅgavasena, samādhisahitaṃ paññāsahitañca vikkhambhanavasena, samucchedavasena ca accantaṃ mokkheti mocetīti pātimokkho.
For this Sīla itself, by way of its constituent parts, and accompanied by Samādhi and accompanied by Paññā, by way of suppression, and by way of eradication, completely liberates and sets free; hence, Pātimokkha.
Thật vậy, giới này tự nó giải thoát một cách tuyệt đối theo phương pháp từng phần; khi đi kèm với định và tuệ, nó giải thoát theo phương pháp trấn áp; và nó giải thoát một cách tuyệt đối theo phương pháp đoạn trừ, nên gọi là Pātimokkha.
Pati pati mokkhoti vā pātimokkho, tamhā tamhā vītikkamadosato paccekaṃ mokkhoti attho.
Or, pati pati mokkha (liberation from each and every*) is Pātimokkha; meaning, liberation from each specific fault of transgression.
Hoặc, giải thoát từng điều (pati pati mokkho) thì gọi là Pātimokkha, có nghĩa là giải thoát khỏi từng lỗi vi phạm riêng lẻ.
Pātimokkho eva pātimokkho.
Pātimokkha is indeed Pātimokkha.
Pātimokkha chính là Pātimokkha.
Mokkho vā nibbānaṃ, tassa mokkhassa patibimbabhūtoti pātimokkho.
Or, mokkha is Nibbāna, and this is the reflection of that liberation; hence, Pātimokkha.
Hoặc, giải thoát là Niết Bàn, điều là hình ảnh phản chiếu của Niết Bàn đó thì gọi là Pātimokkha.
Sīlasaṃvaro hi nibbedhabhāgiyo sūriyassa aruṇuggamanaṃ viya nibbānassa udayabhūto tappaṭibhāgo viya hoti yathārahaṃ kilesanibbāpanatoti pātimokkho.
For sīla-restraint, being conducive to penetration, is like the dawn of the sun, an arising of Nibbāna, and is like its counterpart, appropriately extinguishing defilements; hence, Pātimokkha.
Thật vậy, sự phòng hộ giới luật là phần hướng đến sự xuyên thấu (nibbedhabhāgiya), giống như sự mọc lên của mặt trời đối với Niết Bàn, là sự khởi đầu (udayabhūta), giống như hình ảnh phản chiếu của nó, làm dập tắt phiền não một cách thích đáng, nên gọi là Pātimokkha.
Pātimokkhoyeva pātimokkho.
Pātimokkha is indeed Pātimokkha.
Pātimokkha chính là Pātimokkha.
Atha vā mokkhaṃ pati vattati mokkhābhimukhanti vā pātimokkhaṃ.
Or, that which proceeds towards liberation, or is directed towards liberation, is Pātimokkha.
Hoặc, điều hướng đến giải thoát (mokkhaṃ pati vattati) hay hướng về giải thoát (mokkhābhimukhaṃ) thì gọi là Pātimokkha.
Pātimokkhameva pātimokkhanti evamettha pātimokkhasaddassa attho veditabbo.
Thus, the meaning of the word Pātimokkha here should be understood as Pātimokkha itself.
Ý nghĩa của từ Pātimokkha ở đây cần được hiểu như vậy: Pātimokkha chính là Pātimokkha.
Ācāragocarasampannāti kāyikavācasikaavītikkamasaṅkhātena ācārena ceva navesiyagocaratādisaṅkhātena gocarena ca sampannā, sampannaācāragocarāti attho.
Accomplished in conduct and resort means accomplished in conduct (ācāra), which is non-transgression in bodily and verbal actions, and in resort (gocara), which is like resorting to new villages and so forth; meaning, one who has accomplished conduct and resort.
Ācāragocarasampannā (đầy đủ oai nghi và phạm hạnh) có nghĩa là đầy đủ về oai nghi (ācāra), tức là không vi phạm thân và khẩu, và đầy đủ về phạm hạnh (gocara), tức là không đi đến những nơi không thích hợp (navesiyagocara) v.v., tức là đầy đủ oai nghi và phạm hạnh.
Appamattesūti atiparittakesu anāpattigamanīyesu, dukkaṭadubbhāsitamattesūti apare.
In minor faults means in very small ones, those that do not lead to an offense; others say, in mere dukkaṭa and dubbhāsita offenses.
Appamattesū (trong những lỗi nhỏ) có nghĩa là trong những lỗi rất nhỏ, những lỗi không dẫn đến phạm giới; những người khác nói là chỉ trong những lỗi Dukkata và Dubbhāsita.
Vajjesūti gārayhesu.
Faults means blameworthy actions.
Vajjesū (trong những lỗi) có nghĩa là trong những lỗi đáng khiển trách.
Te pana ekantato akusalasabhāvā hontīti āha ‘‘akusaladhammesū’’ti.
Since these are entirely unwholesome in nature, it says "in unwholesome states."
Những điều đó hoàn toàn là những pháp bất thiện, nên đã nói ‘‘akusaladhammesu’’ (trong các pháp bất thiện).
Bhayadassinoti bhayato dassanasīlā, paramāṇumattampi vajjaṃ sineruppamāṇaṃ viya katvā bhāyanasīlā.
Seeing danger means having the nature to see danger, having the nature to fear even a fault as tiny as an atom, making it seem like Mount Sineru.
Bhayadassino (thấy sự nguy hiểm) có nghĩa là có thói quen thấy sự nguy hiểm, có thói quen sợ hãi ngay cả một lỗi nhỏ như hạt nguyên tử, xem nó như núi Sineru.
Sammā ādiyitvāti sammadeva sakkaccaṃ sabbaso ca ādiyitvā.
“Sammā ādiyitvā” means having undertaken properly, carefully, and completely.
Sammā ādiyitvā (đã thọ trì đúng đắn) có nghĩa là đã thọ trì một cách đúng đắn, một cách chân thành và hoàn toàn.
Sikkhāpadesūti niddhāraṇe bhummanti samudāyato avayavaniddhāraṇaṃ dassento ‘‘sikkhāpadesu taṃ taṃ sikkhāpadaṃ samādiyitvā sikkhathā’’ti atthamāha.
“Sikkhāpadesu” is in the locative case of determination, indicating the specification of a part from the whole, thus stating the meaning: “among the training rules, having undertaken each and every training rule, one should train.”
Sikkhāpadesū (trong các giới điều) là chỉ cách thức của sở cách trong sự phân biệt, khi chỉ ra sự phân biệt từng phần từ toàn bộ, nên đã giải thích ý nghĩa là ‘‘sikkhāpadesu taṃ taṃ sikkhāpadaṃ samādiyitvā sikkhathā’’ (trong các giới điều, thọ trì từng giới điều đó và học tập).
Sikkhāpadameva hi samādātabbaṃ sikkhitabbañcāti adhippāyo.
For indeed, the intention is that the training rule itself is to be undertaken and trained in.
Ý nghĩa là giới điều cần được thọ trì và học tập.
Yaṃ kiñci sikkhākoṭṭhāsesūti sikkhākoṭṭhāsesu mūlapaññattianupaññatisabbatthapaññattipadesapaññattiādibhedaṃ yaṃ kiñci sikkhitabbaṃ paṭipajjitabbaṃ pūretabbaṃ sīlaṃ.
“Yaṃ kiñci sikkhākoṭṭhāsesu” refers to whatever virtue is to be trained in, practiced, and fulfilled among the divisions of training, such as those of the original rule, supplementary rule, general rule, and specific rule.
Yaṃ kiñci sikkhākoṭṭhāsesū (bất cứ điều gì trong các phần học tập) có nghĩa là bất cứ giới luật nào cần được học tập, thực hành, và hoàn thành trong các phần học tập, bao gồm các loại như giới điều căn bản, giới điều bổ sung, giới điều chung cho tất cả, giới điều riêng biệt v.v.
Taṃ pana dvāravasena duvidhamevāti āha ‘‘kāyikaṃ vācasikañcā’’ti.
This, however, is of two kinds based on the doors of action, thus he states: “bodily and verbal.”
Điều đó, xét về phương diện cửa ngõ, chỉ có hai loại, nên đã nói ‘‘kāyikaṃ vācasikañcā’’ (thân nghiệp và khẩu nghiệp).
Imasmiṃ atthavikappe sikkhāpadesūti ādhāre bhummaṃ sikkhābhāgesu kassaci visuṃ aggahaṇato.
In this interpretation of the meaning, “sikkhāpadesu” is in the locative case of the basis, because nothing is grasped separately among the parts of training.
Trong cách giải thích ý nghĩa này, sikkhāpadesū (trong các giới điều) là sở cách chỉ nơi chốn, vì không có sự nắm giữ riêng biệt nào của bất kỳ phần học tập nào.
Tenāha ‘‘taṃ sabba’’nti.
Therefore, he says: “all that.”
Do đó đã nói ‘‘taṃ sabba’’ (tất cả điều đó).
65. Kasmā āraddhanti (a. ni. ṭī. 3.10.71-74) desanāya kāraṇapucchā.
65. “Kasmā āraddhaṃ” is a question about the reason for the discourse.
65. Kasmā āraddhaṃ (vì sao được khởi xướng) (A. Ni. Ṭī. 3.10.71-74) là câu hỏi về nguyên nhân của bài thuyết pháp.
Sīlānisaṃsadassanatthanti payojananiddeso.
“Sīlānisaṃsadassanatthaṃ” is the statement of purpose.
Sīlānisaṃsadassanatthaṃ (để chỉ ra lợi ích của giới luật) là sự chỉ định mục đích.
Ko attho kva attho kva nipātitāti?
What is the meaning? Where is the meaning? Where is it placed?
Ý nghĩa là gì? Ý nghĩa ở đâu? Nó được đặt ở đâu?
Nayidamevaṃ daṭṭhabbaṃ.
It should not be seen this way.
Không nên thấy như vậy.
Sīlānisaṃsadassanatthanti hi ettha byatirekato yaṃ sīlānisaṃsassa adassanaṃ, taṃ imissā desanāya kāraṇanti kasmā āraddhanti vineyyānaṃ sīlānisaṃsassa adassanatoti atthato āpanno eva hotīti.
For here, in “sīlānisaṃsadassanatthaṃ,” by way of exclusion, the non-seeing of the benefit of virtue is the reason for this discourse; thus, "Why was it undertaken?" means "because the trainees did not see the benefit of virtue," which is already implied by the meaning.
Thật vậy, ở đây, Sīlānisaṃsadassanatthaṃ (để chỉ ra lợi ích của giới luật) có nghĩa là sự không thấy lợi ích của giới luật theo cách phủ định là nguyên nhân của bài thuyết pháp này, nên theo ý nghĩa, nó đã bao hàm rằng ‘‘vì các đệ tử không thấy lợi ích của giới luật, nên vì sao được khởi xướng?’’
Tenāha ‘‘sacepī’’tiādi.
Therefore, he says: “sacepi” and so on.
Do đó đã nói ‘‘sacepī’’ v.v.
Sīlānisaṃsadassanatthanti pana imassa atthaṃ vivarituṃ ‘‘tesa’’ntiādi vuttaṃ.
However, to explain the meaning of “sīlānisaṃsadassanatthaṃ,” “tesaṃ” and so on was stated.
Và để giải thích ý nghĩa của Sīlānisaṃsadassanatthaṃ, đã nói ‘‘tesa’’ v.v.
Ānisaṃsoti udayo.
“Ānisaṃso” means rise or growth.
Ānisaṃso (lợi ích) có nghĩa là sự khởi lên.
‘‘Sīlavā sīlasampanno kāyassa bhedā paraṃ maraṇā sugatiṃ saggalokaṃ upapajjatī’’tiādīsu (dī. ni. 2.150; 3.316; a. ni. 5.213; mahāva. 285) pana vipākaphalampi ‘‘ānisaṃso’’ti vuttaṃ.
But in phrases like “The virtuous one, endowed with virtue, after the dissolution of the body, after death, reappears in a good destination, in the heavenly world” and so on, the resultant fruit is also called “ānisaṃso.”
Tuy nhiên, trong các câu như ‘‘Người giữ giới, đầy đủ giới luật, sau khi thân hoại mạng chung, được sinh vào cõi thiện, cõi trời’’ (Dī. Ni. 2.150; 3.316; A. Ni. 5.213; Mahāva. 285) v.v., quả dị thục cũng được gọi là ‘‘ānisaṃso’’ (lợi ích).
Ko visesoti ko phalaviseso.
“Ko viseso” means what is the special fruit?
Ko viseso (có gì đặc biệt) có nghĩa là có gì đặc biệt về quả báo.
Kā vaḍḍhīti ko abbhudayo.
“Kā vaḍḍhī” means what is the increase?
Kā vaḍḍhī (có gì tăng trưởng) có nghĩa là có gì phát triển.
Vijjamānopi guṇo yāthāvato vibhāvito eva abhiruciṃ uppādeti, na avibhāvito, tasmā ekantato ānisaṃsakittanaṃ icchitabbamevāti dassetuṃ visakaṇṭakavāṇijo udāhaṭo.
Even an existing quality, when truly revealed, produces delight, not when unrevealed. Therefore, to show that the praise of benefits is absolutely desirable, the example of the poison-thorn merchant is cited.
Ngay cả một đức tính hiện có, chỉ khi được trình bày đúng đắn mới tạo ra sự thích thú, chứ không phải khi không được trình bày; do đó, để chỉ ra rằng việc ca ngợi lợi ích là điều hoàn toàn mong muốn, đã đưa ra ví dụ về người buôn bán thuốc độc.
Tattha guḷo nāma ucchurasaṃ pacitvā cuṇṇādīhi missitvā sampiṇḍane piṇḍībhūtaṃ.
Among these, guḷa is a solidified mass formed by cooking sugarcane juice and mixing it with powders and so on.
Ở đây, guḷo (đường viên) là thứ được cô đặc thành viên sau khi nấu nước mía và trộn với bột v.v.
Phāṇitaṃ apiṇḍitaṃ dravībhūtaṃ.
Phāṇita is liquid, not solidified.
Phāṇitaṃ (đường lỏng) là chất lỏng không cô đặc thành viên.
Khaṇḍaṃ bhijjanakkhamaṃ.
Khaṇḍa is breakable.
Khaṇḍaṃ (đường cục) là thứ có thể bẻ gãy.
Sakkharā nāma phalikasadisā.
Sakkharā is like crystal.
Sakkharā (đường phèn) là thứ giống như pha lê.
Sakkharādīniti ādi-saddena macchaṇḍikānaṃ saṅgaho.
Sugars and so on – by the word ‘and so on,’ candied sugar is included.
Đường cục, v.v. (Sakkharādīni) — với từ “v.v.” bao gồm đường phèn.
Tasmiṃ kāle guḷādīsu visakaṇṭakavohāro apaccantadese pacuroti ‘‘paccantagāmaṃ gantvā’’ti vuttaṃ.
At that time, the use of poison thorns in molasses and so on was prevalent in the inner regions; therefore, it was said, “having gone to a border village.”
Vào thời ấy, sự nói về chất độc trong đường mật, v.v. phổ biến ở vùng biên giới, nên đã được nói là “đi đến làng biên giới”.
Dārake ca palāpesuṃ ‘‘visakaṇṭakaṃ mā gaṇhantū’’ti.
And the children were sent away, thinking, “Lest they take the poison thorns.”
Và đã đuổi bọn trẻ đi (Dārake ca palāpesuṃ) với ý rằng “chớ lấy chất độc.”
Piyoti piyāyitabbo.
Dear means to be held dear.
Đáng yêu (Piyo) có nghĩa là đáng được yêu mến.
Piyassa nāma dassanaṃ ekantato abhinanditabbaṃ hotīti āha ‘‘viyacakkhūhi sampassitabbo’’ti.
The sight of one who is dear is always to be rejoiced in; thus it is said, “to be seen with loving eyes.”
Sự thấy người đáng yêu nhất định phải được hoan hỷ, nên đã nói “đáng được nhìn thấy với con mắt yêu m mến” (piyacakkhūhi sampassitabbo).
Pītisamuṭṭhānapasannasommarūpapariggahañhi cakkhu ‘‘piyacakkhū’’ti vuccati.
Indeed, an eye that perceives a pleasant, joyful, and serene form born of joy is called a “loving eye.”
Con mắt nắm giữ hình tướng an tịnh, hoan hỷ, khởi lên từ hỷ được gọi là “con mắt đáng yêu.”
Tesanti sabrahmacārīnaṃ.
Of them means of the co-practitioners.
Của họ (Tesaṃ) có nghĩa là của các vị đồng Phạm hạnh.
Manavaḍḍhanakoti pītimanassa paribrūhanato uparūpari pīticittassa uppādako.
A joy-enhancer means one who promotes a joyful mind, generating an ever-increasing joyous state of mind.
Làm tăng trưởng tâm (Manavaḍḍhanako) có nghĩa là vị làm cho tâm hỷ tăng trưởng, làm khởi lên tâm hỷ hết lần này đến lần khác, do làm tăng trưởng tâm hỷ.
Garuṭṭhāniyoti garukaraṇassa ṭhānabhūto.
Worthy of reverence means a ground for respect.
Đáng được tôn kính (Garuṭṭhāniyo) có nghĩa là nơi đáng được tôn kính.
Jānaṃ jānātīti ñāṇena jānitabbaṃ jānāti.
Knowing, he knows means he knows what is to be known by knowledge.
Biết điều đáng biết (Jānaṃ jānāti) có nghĩa là biết điều đáng biết bằng tuệ.
Yathā vā aññe ajānantāpi jānantā viya pavattanti, na evamayaṃ, ayaṃ pana jānanto eva jānāti.
Or, just as others, though not knowing, act as if knowing, this one is not like that; this one, however, knows truly knowing.
Hoặc như những người khác dù không biết nhưng lại hành xử như biết, vị này thì không như vậy; vị này chỉ biết khi thực sự biết.
Passaṃ passatīti dassanabhūtena paññācakkhunā passitabbaṃ passati, passanto eva vā passati.
Seeing, he sees means he sees what is to be seen by the eye of wisdom, which is the act of seeing; or, he sees truly seeing.
Thấy điều đáng thấy (Passaṃ passati) có nghĩa là thấy điều đáng thấy bằng tuệ nhãn là sự thấy, hoặc chỉ thấy khi thực sự thấy.
Evaṃ sambhāvanīyoti evaṃ viññutāya paṇḍitabhāvena sambhāvetabbo.
Thus to be regarded means thus to be honored for his understanding and wisdom.
Đáng được kính trọng như vậy (Evaṃ sambhāvanīyo) có nghĩa là đáng được kính trọng như vậy bởi sự hiểu biết và trí tuệ.
Sīlesvevassa paripūrakārīti sīlesu paripūrakārī eva bhaveyyāti evaṃ uttarapadāvadhāraṇaṃ daṭṭhabbaṃ.
He should be perfect only in virtue – thus the emphasis on the latter part should be understood, meaning he should be perfect only in virtue.
Vị này chỉ là người thực hành viên mãn các giới (Sīlesvevassa paripūrakārī) — nên phải hiểu rằng sự nhấn mạnh được đặt ở hậu tố như vậy.
Evañhi iminā padena uparisikkhādvayaṃ anivattitameva hoti.
For in this way, the two higher trainings above are not excluded.
Quả thật, với từ này, hai học pháp cao hơn không bị loại bỏ.
Yathā pana sīlesu paripūrakārī nāma hoti, taṃ phalena dassetuṃ ‘‘ajjhatta’’ntiādi vuttaṃ.
However, to show by its result how one becomes perfect in virtue, “internally” and so on are stated.
Nhưng để chỉ ra rằng vị ấy là người thực hành viên mãn các giới bằng quả, đã nói “nội phần” (ajjhatta) v.v.
Vipassanādhiṭṭhānasamādhisaṃvattanikatāya hi idha sīlassa pāripūrī, na kevalaṃ akhaṇḍādibhāvamattaṃ.
Indeed, the perfection of virtue here lies in its conduciveness to Samādhi, which is the basis for Vipassanā, and not merely in its unbroken state and so on.
Thật vậy, ở đây, sự viên mãn của giới là do có khả năng dẫn đến định làm nền tảng cho thiền quán, chứ không chỉ đơn thuần là sự không bị vi phạm, v.v.
Tenāha ‘‘yāni kho pana tāni akhaṇḍāni…pe… samādhisaṃvattanikānī’’ti.
Therefore, it is said, “For those virtues which are unbroken…pe… conducive to Samādhi.”
Do đó, đã nói: “Này các tỳ khưu, những giới ấy không bị vi phạm… v.v… có khả năng dẫn đến định.”
Evañca katvā upari sikkhādvayaṃ sīlassa sambhārabhāvena gahitanti sīlassevettha padhānaggahaṇaṃ siddhaṃ hoti.
And having done so, the two higher trainings above are taken as constituents of virtue, and thus the primary acceptance of virtue here is established.
Và khi đã làm như vậy, hai học pháp cao hơn được xem là thành phần của giới, nên sự nắm giữ giới là chính ở đây được thành tựu.
Tathā hi cittekaggatāsaṅkhārapariggahānaṃ sīlassānurakkhaṇabhāvaṃ vakkhati.
For he will explain that one-pointedness of mind and the comprehension of formations are safeguards of virtue.
Thật vậy, vị ấy sẽ nói rằng sự nhất tâm và nắm giữ các hành là sự bảo vệ giới.
Yaṃ pana vakkhati ‘‘sikkhattayadesanā jātā’’ti (ma. ni. aṭṭha. 1.65), taṃ itarāsampi sikkhānaṃ idha gahitatāmattaṃ sandhāya vuttaṃ, na padhānabhāvena gahitataṃ.
But what will be said, “The teaching of the three trainings has arisen” (MN.A. 1.65), is said with reference to the mere inclusion of the other trainings here, not their acceptance as primary.
Còn điều sẽ nói rằng “sự thuyết giảng ba học pháp đã xảy ra” (Ma. Ni. Aṭṭha. 1.65), điều đó được nói để chỉ sự bao gồm các học pháp khác ở đây, chứ không phải được nắm giữ với tư cách là chính yếu.
Yadi evaṃ kathaṃ sīlassa appamattakatāvacanaṃ.
If so, how can virtue be said to be minor?
Nếu vậy, tại sao lại nói giới là nhỏ nhặt?
Vuttañhetaṃ ‘‘appamattakaṃ kho panetaṃ, bhikkhave, oramattaka’’nti (dī. ni. 1.7).
For it is said, “Indeed, O monks, this is minor, insignificant” (DN. 1.7).
Điều này đã được nói: “Này các Tỳ khưu, điều này là nhỏ nhặt, là tầm thường” (Dī. Ni. 1.7).
Taṃ puthujjanagocaraṃ sandhāya vuttaṃ.
That was said with reference to the realm of ordinary people.
Điều đó được nói để chỉ phạm vi của phàm nhân.
Tathā hi tattha na nippadesato sīlaṃ vibhattaṃ, evaṃ katvā tattha sīlamattakanti mattaggahaṇaṃ samatthitanti daṭṭhabbaṃ.
Indeed, there, virtue is not fully expounded in all its parts; thus, it should be understood that the word ‘mere’ in ‘mere virtue’ there is justified.
Thật vậy, ở đó giới không được phân loại một cách chi tiết; khi đã làm như vậy, sự nắm giữ giới ở đó như một điều nhỏ nhặt được xem là hợp lý.
Anūnenāti akhaṇḍādibhāvena, kassaci vā ahāpanena upapannena.
Undeficient means in an unbroken state and so on, or by not abandoning anything, being complete.
Không thiếu sót (Anūnena) có nghĩa là không bị vi phạm, v.v., hoặc không bỏ sót bất cứ điều gì.
Ākārenāti karaṇena sampādanena.
By way of action means by the means, by the accomplishment.
Cách thức (Ākārena) có nghĩa là bằng phương tiện, bằng sự thành tựu.
Cittasamatheti cittasamādhāne.
In mental tranquility means in mental composure.
Trong sự an tịnh tâm (Cittasamathe) có nghĩa là trong sự định tâm.
Yuttoti aviyutto pasuto.
Engaged means connected, diligent.
Chuyên cần (Yutto) có nghĩa là không tách rời, chuyên tâm.
Yo sabbena sabbaṃ jhānabhāvanaṃ ananuyutto, so taṃ bahi nīharati nāma.
He who is not entirely devoted to jhāna practice is said to carry it out externally.
Vị nào hoàn toàn không chuyên tâm tu tập thiền, vị ấy được gọi là đưa thiền ra ngoài.
Yo ārabhitvā antarā saṅkocaṃ āpajjati, so taṃ vināseti nāma.
He who, having started, shrinks back midway, is said to destroy it.
Vị nào đã bắt đầu nhưng giữa chừng lại co rút, vị ấy được gọi là hủy hoại thiền.
Yo pana īdiso ahutvā jhānaṃ upasampajja viharati, so anirākatajjhānoti dassento ‘‘bahi anīhaṭajjhāno’’tiādimāha.
But he who, not being such, enters upon and dwells in jhāna, showing him to be one whose jhāna is not abandoned, says “one whose jhāna is not carried out externally” and so on.
Nhưng vị nào không như vậy mà chứng đắc và an trú trong thiền, vị ấy là người không bỏ thiền (anirākatajjhāno), cho thấy điều đó, đã nói “người không đưa thiền ra ngoài” (bahi anīhaṭajjhāno) v.v.
Aniccassa tebhūmakadhammassa, aniccanti vā anupassanā aniccānupassanā.
The impermanence of the three realms of existence, or the contemplation of impermanence as impermanent, is contemplation of impermanence.
Sự quán xét vô thường, tức là sự quán xét các pháp ba cõi là vô thường, hoặc sự quán xét là vô thường, đó là quán vô thường (aniccānupassanā).
Tathā dukkhānupassanā anattānupassanā ca.
Similarly, contemplation of suffering and contemplation of non-self.
Tương tự, quán khổ (dukkhānupassanā) và quán vô ngã (anattānupassanā).
Tasseva nibbindanākārena pavattā anupassanā nibbidānupassanā.
The contemplation that proceeds by way of disgust with that very thing is contemplation of disgust.
Sự quán xét diễn ra theo cách nhàm chán đối với chính điều đó là quán nhàm chán (nibbidānupassanā).
Virajjanākārena pavattā anupassanā virāgānupassanā.
The contemplation that proceeds by way of dispassion is contemplation of dispassion.
Sự quán xét diễn ra theo cách ly tham là quán ly tham (virāgānupassanā).
Nirodhassa anupassanā nirodhānupassanā.
The contemplation of cessation is contemplation of cessation.
Sự quán xét sự đoạn diệt là quán đoạn diệt (nirodhānupassanā).
Paṭinissajjanavasena pavattā anupassanā paṭinissaggānupassanā.
The contemplation that proceeds by way of relinquishment is contemplation of relinquishment.
Sự quán xét diễn ra theo cách xả bỏ là quán xả bỏ (paṭinissaggānupassanā).
Suññāgāragato bhikkhu tattha laddhakāyavivekatāya samathavipassanāvasena cittavivekaṃ paribrūhento yathānusiṭṭhaṃ paṭipattiyā lokaṃ sāsanañca attano visesādhigamaṭṭhānabhūtaṃ suññāgārañca upasobhayamāno guṇavisesādhiṭṭhānabhāvāpādanena viññūnaṃ atthato taṃ brūhento nāma hotīti vuttaṃ ‘‘brūhetā suññāgārāna’’nti.
A bhikkhu gone to an empty dwelling, fostering mental seclusion there by means of tranquility and insight due to the bodily seclusion he has gained, adorns the world, the Dispensation, and his own empty dwelling, which is the place of his special attainment, by practicing as instructed; by bringing about the state of being a ground for special qualities, he is said to augment it for the wise in terms of its purpose; thus it is said, “an augmenter of empty dwellings.”
Vị Tỳ khưu đi đến chỗ độc cư, ở đó, do đạt được sự độc cư về thân, vị ấy làm tăng trưởng sự độc cư về tâm bằng cách tu tập chỉ và quán, và bằng sự thực hành theo lời dạy, vị ấy trang nghiêm thế gian và giáo pháp, cũng như chỗ độc cư là nơi đạt được các pháp đặc biệt của mình; bằng cách làm cho nó trở thành nơi nương tựa của các đặc tính tốt đẹp, vị ấy được gọi là người làm tăng trưởng chỗ độc cư cho những người trí, nên đã nói “người làm tăng trưởng các chỗ độc cư” (brūhetā suññāgārānaṃ).
Tenāha ‘‘ettha cā’’tiādi.
Therefore, he says, “And here” and so on.
Do đó, đã nói “và ở đây” (ettha cā) v.v.
Ayameva suññāgārānubrūhanaviññuppasatthānaṃ bhājanaṃ, na senāsanapatiṭṭhāpananti dassento āha ‘‘ekabhūmakādi…pe… daṭṭhabbo’’ti.
This alone is the recipient of the praise of the wise for augmenting empty dwellings, not the establishment of a lodging; thus he says, “from a single-storied…pe… should be understood.”
Chính điều này là đối tượng của sự tán thán của những người trí về việc làm tăng trưởng chỗ độc cư, chứ không phải sự thiết lập chỗ ở, v.v. nên đã nói “chỗ một tầng, v.v… phải hiểu” (ekabhūmakādi…pe… daṭṭhabbo).
Suññāgāraggahaṇena cettha araññarukkhamūlādi sabbaṃ padhānānuyogakkhamaṃ senāsanaṃ gahitanti daṭṭhabbaṃ.
And here, by the mention of empty dwelling, all lodgings suitable for primary exertion, such as forests and roots of trees, should be understood as included.
Và ở đây, với việc nắm giữ chỗ độc cư (suññāgāra), phải hiểu rằng tất cả các chỗ ở thích hợp cho việc tinh tấn, như rừng, gốc cây, v.v. đều được bao gồm.
Taṇhāvicaritadesanāti ‘‘ajjhattikassa upādāyā’’ti (vibha. 937) ādinayappavattaṃ taṇhāvicaritasuttaṃ.
The teaching of the wanderings of craving refers to the Discourse on the Wanderings of Craving, which proceeds in the manner beginning with “from internal clinging” (Vibh. 937).
Sự thuyết giảng về sự lang thang của ái (Taṇhāvicaritadesanā) có nghĩa là kinh Taṇhāvicarita diễn ra theo phương pháp “do nương tựa vào nội phần” (Vibha. 937) v.v.
Taṇhāpadaṭṭhānattāti taṇhāsannissayattā.
Due to craving being its proximate cause means due to being dependent on craving.
Do có ái làm nền tảng (Taṇhāpadaṭṭhānattā) có nghĩa là do có ái làm chỗ nương tựa.
Na hi taṇhāvirahitā mānadiṭṭhipavatti atthi.
For there is no arising of conceit and wrong views without craving.
Thật vậy, không có sự diễn ra của kiêu mạn và tà kiến mà không có ái.
Mānadiṭṭhiyo osaritvāti dassetabbatāya mānadiṭṭhiyo ogāhetvāti attho.
Having descended into conceit and wrong views means having immersed oneself in conceit and wrong views for the purpose of demonstrating them.
Đi sâu vào kiêu mạn và tà kiến (Mānadiṭṭhiyo osaritvā) có nghĩa là đi sâu vào kiêu mạn và tà kiến để chỉ ra chúng.
Gahaṇatthameva hi desetabbadhammassa desanāya osaraṇaṃ.
For the descent of a phenomenon to be taught through teaching is for the very purpose of grasping it.
Thật vậy, sự đi sâu của pháp cần được thuyết giảng vào bài thuyết giảng là để nắm giữ nó.
Taṇhāmānadiṭṭhiyo papañcattayaṃ sattasantānassa saṃsāre papañcanato anuppabandhanavasena vitthāraṇato.
Craving, conceit, and wrong views are the three proliferations, because they proliferate in the continuum of beings in Saṃsāra, extending it by way of continuous succession.
Ái, kiêu mạn và tà kiến là ba pháp hý luận (Taṇhāmānadiṭṭhiyo papañcattayaṃ) do chúng làm hý luận (làm cho lan rộng) trong dòng tương tục của chúng sanh trong luân hồi, tức là do chúng làm lan rộng theo cách không ngừng nghỉ.
Sīlapadaṭṭhānattāti sīlādhiṭṭhānattā.
Due to virtue being its proximate cause means due to being based on virtue.
Do có giới làm nền tảng (Sīlapadaṭṭhānattā) có nghĩa là do có giới làm chỗ nương tựa.
Adhicittasikkhā vuttāti ānetvā sambandho.
The training in higher mind is mentioned – thus connecting it.
Sự liên kết là “học pháp về tâm cao hơn đã được nói.”
Vipassanāvasena suññāgāravaḍḍhaneti yojanā.
The construction is: augmenting empty dwellings by way of insight.
Sự phối hợp là “làm tăng trưởng chỗ độc cư bằng thiền quán.”
Dvepi sikkhāti adhicittādhipaññāsikkhā.
Both trainings refer to the training in higher mind and higher wisdom.
Hai học pháp (Dvepi sikkhā) có nghĩa là học pháp về tâm cao hơn và học pháp về tuệ cao hơn.
Saṅgahetvāti adhisīlasikkhāya saddhiṃ saṅgahetvā vuttā.
Having included means mentioned having included them along with the training in higher virtue.
Đã được bao gồm (Saṅgahetvā) có nghĩa là đã được nói khi bao gồm cả học pháp về giới cao hơn.
Yadi evamayaṃ sikkhattayadesanā jātāti sikkhattayānisaṃsappakāsanī siyāti anuyogaṃ sandhāyāha ‘‘ettha cā’’tiādi.
If so, this teaching of the three trainings has arisen—is it meant to be a proclamation of the benefits of the three trainings? With reference to this inquiry, he says, “And here” and so on.
Nếu vậy, đây là sự thuyết giảng ba học pháp, vậy thì đây sẽ là sự công bố lợi ích của ba học pháp, do đó, để trả lời câu hỏi, đã nói “và ở đây” (ettha cā) v.v.
Tattha yaṃ vattabbaṃ, taṃ heṭṭhā vuttameva.
What is to be said there has already been said below.
Điều cần nói ở đó đã được nói ở phần dưới.
Indriyasaṃvaro viya pātimokkhasaṃvarassa catupārisuddhisīlassa ārakkhabhūtā cittekaggatā vipassanā ca idha gahitāti tadubhayaṃ appadhānaṃ, sīlameva pana padhānabhāvena gahitanti veditabbaṃ.
Just as sense restraint is a safeguard for the Pātimokkha restraint and the fourfold pure virtue, so too one-pointedness of mind and insight are included here; thus, both of these are secondary, while virtue alone is accepted as primary; this should be understood.
Phải hiểu rằng sự nhất tâm và thiền quán, là sự bảo vệ giới Bát-đề-mộc-xoa thanh tịnh bốn phần, giống như sự phòng hộ các căn, đã được nắm giữ ở đây, và cả hai điều đó là phụ, còn giới là chính yếu.
Tenāha ‘‘sīlānurakkhikā evā’’tiādi.
Therefore, he says, “are safeguards of virtue only” and so on.
Do đó, đã nói “chỉ là sự bảo vệ giới” (sīlānurakkhikā evā) v.v.
Balavatarasukhanti samuppannabyādhidukkhato balavataraṃ, taṃ abhibhavituṃ samatthaṃ jhānasukhaṃ uppajjati.
More powerful happiness refers to the happiness of jhāna that arises, which is more powerful than the pain of illness that has arisen, capable of overcoming it.
Hạnh phúc mạnh mẽ hơn (Balavatarasukhaṃ) có nghĩa là hạnh phúc thiền định mạnh mẽ hơn nỗi khổ bệnh tật đã phát sinh, có khả năng chế ngự nó, sẽ khởi lên.
Balavamamattaṃ hoti, tena daḷhaattasinehena viluttahadayo kusaladhamme chaḍḍento so tathārūpesu…pe… posetā hoti.
Strong possessiveness arises, and with a heart corrupted by intense self-love, abandoning wholesome states, he is an augmenter of such…pe…
Trở thành sự chấp ngã mạnh mẽ, do đó, với tình yêu bản thân mãnh liệt, với trái tim tan nát, vị ấy từ bỏ các thiện pháp, vị ấy là người nuôi dưỡng những điều như vậy… v.v.
Balavamamattaṃ vā sineho na hoti ‘‘suddho saṅkhārapuñjo’’ti yāthāvadassanena ahaṃkāramamaṃkārābhāvato.
Or strong possessiveness does not arise, due to the absence of 'I-making' and 'mine-making' from the true seeing that it is “a mere heap of formations.”
Hoặc tình yêu bản thân không phải là sự chấp ngã mạnh mẽ, vì không có ngã mạn và sở hữu ngã do cái thấy chân thật rằng “chỉ là một đống hành thanh tịnh.”
Dubbhikkhabhaye khudābhibhavaṃ sandhāyāha ‘‘sacepissa antāni bahi nikkhamantī’’ti.
Referring to being overcome by hunger during a famine, he says, “even if his intestines come out.”
Để chỉ sự đói khát do nạn đói, đã nói “nếu ruột của vị ấy lòi ra ngoài” (sacepissa antāni bahi nikkhamantī).
Byādhibhayaṃ sandhāyāha ‘‘ussussati visussanī’’ti.
Referring to the fear of illness, he says, “he wastes away, becomes emaciated.”
Để chỉ nỗi sợ bệnh tật, đã nói “khô héo, héo mòn” (ussussati visussanī).
Ādi-saddena gahitaṃ corabhayaṃ sandhāyāha ‘‘khaṇḍākhaṇḍiko vā’’ti.
Referring to the fear of robbers included by the word ‘and so on,’ he says, “or cut into pieces.”
Để chỉ nỗi sợ trộm cướp được bao gồm bởi từ “v.v.”, đã nói “hoặc bị chặt thành từng mảnh” (khaṇḍākhaṇḍiko vā).
Ubhayassāti samathavipassanādvayassa.
Of both refers to the two, tranquility and insight.
Của cả hai (Ubhayassā) có nghĩa là của cả hai pháp chỉ và quán.
Ettha ca ‘‘ajjhattaṃ ceto…pe… suññāgārāna’’nti imehi visesanibbedhabhāgiyabhāvāpādanena sīlaṃ rakkhituṃ samatthā eva cittekaggatāvipassanā gahitā.
And here, by causing these, "the mind internally...pe... empty abodes", to be especially conducive to penetration, one-pointedness of mind and insight, which are indeed capable of protecting sīla, are included.
Và ở đây, bằng cách làm cho có phần đặc biệt và nhàm chán (đối với các pháp bất thiện), sự định tâm và tuệ quán có khả năng giữ giới đã được đề cập qua các cụm từ "nội tâm... (v.v.)... các tịnh xá".
Yasmā parato jhānavimokkhaphalābhiññāṇaadhiṭṭhānabhāvo sīlassa uddhaṭo, tasmā tassa bhiyyopi sambhārabhūtā eva cittekaggatā vipassanā tattha tattha gahitāti veditabbā.
Because later the state of being the foundation for jhāna, liberation, the fruits (of the path), and higher knowledge is brought forth for sīla, therefore, it should be understood that one-pointedness of mind and insight, which are indeed its further requisites, are included here and there.
Vì sau đó, trạng thái căn bản của giới là các thiền, giải thoát, quả và các thắng trí đã được đề cập, nên cần phải hiểu rằng sự định tâm và tuệ quán, vốn là yếu tố hỗ trợ cho giới, đã được đề cập ở những chỗ đó.
Sīlādīti ādi-saddena yathāvuttacittekaggatāvipassanā saṅgaṇhāti, sīlassa vā mūlakāraṇabhūtaṃ sabbaṃ kammassakatañāṇañca saṅgaṇhāti kammapathasammādiṭṭhiṃ vā.
By the term ‘Sīlādi’ (etc.) the aforementioned one-pointedness of mind and insight are included, or all knowledge of the ownership of kamma, which is the root cause of sīla, is included, or right view in the path of kamma.
Giới v.v. – với từ v.v. (ādi) bao gồm sự định tâm và tuệ quán đã nói ở trên, hoặc bao gồm tất cả tri kiến về nghiệp và quả của nghiệp, là nguyên nhân gốc rễ của giới, hoặc chánh kiến về các đạo nghiệp.
Sīlañhi tadaññampi puññakiriyāvatthu teneva parisodhitaṃ mahapphalaṃ hoti mahānisaṃsanti.
For sīla, having been purified by that, any other basis for meritorious deeds also becomes greatly fruitful and greatly beneficial.
Vì giới, cùng với các việc làm phước khác, được thanh tịnh bởi chính điều đó, sẽ mang lại đại quả và đại lợi ích.
Lābhī assanti lābhā sāya saṃvaraṇasīlaparipūraṇaṃ pāḷiyaṃ āgataṃ kimīdisaṃ bhagavā anujānātīti?
‘Lābhī assa’ means that acquisition, that completion of the sīla of restraint, as stated in the Pāḷi, "What kind does the Blessed One approve of?"
Được lợi lộc – sự viên mãn của giới luật được đề cập trong Pāḷi, là loại lợi lộc nào mà Đức Thế Tôn cho phép?
Na bhagavā sabhāvena īdisaṃ anujānāti, mahākāruṇikatāya pana puggalajjhāsayena evaṃ vuttanti dassento ‘‘na cetthā’’tiādimāha.
The Blessed One does not approve of such by nature; rather, out of great compassion and according to the disposition of individuals, it was said in this way, which he indicates by saying ‘na cetthā’ (there is not here) and so on.
Đức Thế Tôn không cho phép điều này một cách tự nhiên, mà chỉ nói như vậy do lòng đại bi và tùy theo khuynh hướng của cá nhân, thể hiện bằng cách nói "Na cetthā" (không phải ở đây) v.v.
Tattha ghāsesanaṃ chinnakatho na vācaṃ payuttaṃ bhaṇeti chinnakatho mūgo viya hutvā obhāsaparikathānimittaviññattipayuttaṃ ghāsesanaṃ vācaṃ na bhaṇe na katheyyāti attho.
There, ‘ghāsesanaṃ chinnakatho na vācaṃ payuttaṃ bhaṇe’ means "one whose speech is cut off, like a mute person, should not speak words of inquiry for food that express a sign of conversation or illumination," that is the meaning.
Trong đó, "ghāsesanaṃ chinnakatho na" (không nói lời cầu thực như người câm) "vācaṃ payuttaṃ bhaṇe" (không nên nói lời). Nghĩa là, không nên nói lời cầu thực, lời nói có ý định biểu lộ bằng cách nói chuyện hoặc gợi ý, như một người câm.
Puggalajjhāsayavasenāti saṅkhepato vuttamatthaṃ vivaranto ‘‘yesañhī’’tiādimāha.
Expounding the meaning stated concisely ‘puggalajjhāsayavasenā’ (according to the disposition of individuals), he says ‘yesañhī’ (for those who) and so on.
"Tùy theo khuynh hướng của cá nhân" – để làm rõ ý nghĩa đã nói một cách tóm tắt, Ngài nói "Yesañhī" (Vì những ai) v.v.
Raso sabhāvabhūto ānisaṃso rasānisaṃso.
Benefit inherent in the essence is rasānisaṃso (essential benefit).
Rasānisaṃso (lợi ích tự nhiên) là lợi ích tự nhiên.
Sassusasurā ca tappakkhikā ca sassusasurapakkhikā.
Mothers-in-law and fathers-in-law, and those on their side, are sassusasurapakkhikā.
Cha mẹ chồng/vợ và những người thuộc phe của họ là sassusasurapakkhikā.
Te ñātiyonisambandhena āvāhavivāhasambandhavasena sambandhā ñātī.
Those connected by kinship, by marital relations through marriage, are ñātī (relatives).
Những người đó, có liên hệ qua quan hệ huyết thống và hôn nhân, là thân quyến (ñātī).
Sālohitāti yonisambandhavasena.
Sālohitā means by blood relation.
Sālohitā (bà con huyết thống) là những người có liên hệ qua huyết thống.
Ekalohitasambaddhāti ekena samānena lohitasambandhena sambaddhā.
Ekalohitasambaddhā means connected by a single, shared blood relation.
Ekalohitasambaddhā (liên hệ bởi cùng huyết thống) là những người có liên hệ bởi cùng một huyết thống.
Peccabhāvaṃ gatāti petūpapattivasena nibbattiṃ upagatā.
Peccabhāvaṃ gatā means reborn as a peta.
Peccabhāvaṃ gatā (đã đi đến cõi sau) là những người đã tái sinh vào cảnh giới ngạ quỷ (petūpapattivasena nibbattiṃ upagatā).
Te pana yasmā idha katakālakiriyā kālena katajīvitupacchedā honti, tasmā vuttaṃ ‘‘kālakatā’’ti.
Since those who die in this life meet with the cessation of life in due course, it is said ‘‘kālakatā’’ (deceased).
Tuy nhiên, vì những người này đã chết ở đây, đã chấm dứt sự sống đúng lúc, nên được nói là "kālakatā" (đã chết).
Pasannacittoti pasannacittako.
Pasannacitto means one with a clear mind.
Pasannacitto (tâm hoan hỷ) là người có tâm hoan hỷ.
Kālakato pitā vā mātā vā petayoniṃ upapannoti adhikārato viññāyatīti vuttaṃ ‘‘mahānisaṃsameva hotī’’ti, tassa tathā sīlasampannattāti adhippāyo.
It is understood from the context that a deceased father or mother reborn in the peta realm is implied when it is said ‘‘mahānisaṃsameva hotī’’ (it is indeed of great benefit), the intention being that it is because of their perfect sīla in that way.
Vì cha hoặc mẹ đã chết tái sinh vào cảnh giới ngạ quỷ được hiểu từ ngữ cảnh, nên được nói là "mahānisaṃsameva hotī" (chắc chắn là đại lợi ích), ý nói vì người đó có giới hạnh viên mãn như vậy.
Ariyabhāve pana sati vattabbameva natthi.
But if one is an Arahant, there is nothing more to say.
Tuy nhiên, nếu đã là bậc Thánh thì không cần phải nói nữa.
Tenāha ‘‘anekāni kappasatasahassānī’’tiādi.
Therefore, he says ‘‘anekāni kappasatasahassānī’’ (hundreds of thousands of aeons) and so on.
Do đó, Ngài nói "anekāni kappasatasahassānī" (hàng trăm ngàn kiếp) v.v.
Bahukāranti bahupakāraṃ.
Bahukāraṃ means greatly helpful.
Bahukāraṃ (nhiều lợi ích) là nhiều sự giúp đỡ.
Upasaṅkamananti abhivādanādivasena upagamanaṃ.
Upasaṅkamanaṃ means approaching with salutations and so on.
Upasaṅkamanaṃ (sự đến gần) là sự đến gần để đảnh lễ v.v.
Payirupāsananti upaṭṭhānanti.
Payirupāsanaṃ means attending.
Payirupāsanaṃ (sự phụng sự) là sự hầu hạ.
Cittutrāso bhāyatīti bhayaṃ.
Cittutrāso means bhayaṃ (fear), because one fears.
Cittutrāso (sự sợ hãi trong tâm) là bhayaṃ (sự sợ hãi) vì nó sợ hãi.
Ārammaṇaṃ bhāyati etasmāti bhayaṃ.
Ārammaṇaṃ means bhayaṃ (fear), because one fears from it.
Ārammaṇaṃ (đối tượng) là bhayaṃ (sự sợ hãi) vì nó sợ hãi từ đó.
Purimavārasadisattā vuttanayamevāti atidisitvāpi puna taṃ dassetuṃ ‘‘sīlādiguṇayutto hī’’tiādi vuttaṃ.
Although it is referred to by vuttanayamevā (in the manner already stated) due to similarity with the previous section, ‘‘sīlādiguṇayutto hī’’ (for one endowed with virtues such as sīla) and so on is stated again to show it.
Vì giống như lần trước, "vuttanayamevā" (chỉ là cách đã nói) đã được đề cập, nhưng để làm rõ lại điều đó, Ngài nói "sīlādiguṇayutto hī" (vì người có các đức tính như giới hạnh) v.v.
Therassa heṭṭhā nisinnattā devatāya dārakā sakabhāvena saṇṭhātuṃ sukhena vattituṃ asakkontā asamatthā.
Since the Elder was sitting below, the devas' dārakā sakabhāvena saṇṭhātuṃ (children to remain in their own state) were asakkontā (unable), meaning unable to dwell at ease.
Vì vị Trưởng lão ngồi bên dưới, các vị thiên dārakā sakabhāvena saṇṭhātuṃ (các thiên tử không thể ở trong trạng thái tự nhiên của mình) sukhena vattituṃ asakkontā (không thể sống thoải mái) asamatthā (không có khả năng).
Adhikaṃ cetoti abhiceto, upacārajjhānacittaṃ.
More excellent mind is abhiceto, the mind of access concentration.
Tâm vượt trội là abhiceto (tâm cao thượng), là tâm thiền cận định.
Tassa pana adhikatā pākatikakāmāvacaracittehi sundaratāya sapaṭipakkhato visuddhiyā cāti āha ‘‘abhikkantaṃ visuddhicitta’’nti.
Its excellence is due to its beauty compared to ordinary sensuous minds and its purity from opposing factors, so he says ‘‘abhikkantaṃ visuddhicitta’’ (a highly purified mind).
Tuy nhiên, sự vượt trội của nó là do sự thanh tịnh so với các tâm dục giới thông thường và do sự thanh tịnh khỏi các đối thủ, nên Ngài nói "abhikkantaṃ visuddhicitta" (tâm thanh tịnh vượt trội).
Adhicittanti samādhimāha, so ca upacārasamādhi daṭṭhabbo.
Adhicittaṃ refers to samādhi, and that should be understood as access concentration.
Adhicittaṃ (tăng thượng tâm) nói về định, và đó phải được hiểu là cận định.
Vivekajaṃ pītisukhaṃ, samādhijaṃ pītisukhaṃ, apītijaṃ jhānasukhaṃ, satipārisuddhijaṃ jhānasukhanti catubbidhampi jhānasukhaṃ paṭipakkhato nikkhantataṃ upādāya ‘‘nekkhammasukha’’nti vuccatīti āha ‘‘nekkhammasukhaṃ vindantī’’ti.
Since the four kinds of jhāna-sukha—joy and pleasure born of seclusion, joy and pleasure born of concentration, jhāna-pleasure without joy, and jhāna-pleasure purified by mindfulness—are free from opposing factors, they are called ‘‘nekkhammasukha’’ (pleasure of renunciation), so he says ‘‘nekkhammasukhaṃ vindantī’’ (experiencing the pleasure of renunciation).
Bốn loại hỷ lạc thiền: hỷ lạc do viễn ly, hỷ lạc do định, lạc thiền không hỷ, và lạc thiền do tịnh niệm, được gọi là "nekkhammasukha" (lạc viễn ly) vì chúng thoát khỏi các đối thủ, nên Ngài nói "nekkhammasukhaṃ vindantī" (đạt được lạc viễn ly).
Icchiticchitakkhaṇe samāpajjituṃ samatthoti iminā tesu jhānesu samāpajjanavasībhāvamāha, ‘‘nikāmalābhī’’ti pana vacanato āvajjanādhiṭṭhānapaccavekkhaṇavasiyopi vuttā evāti veditabbā.
By ‘‘icchiticchitakkhaṇe samāpajjituṃ samatthoti’’ (capable of attaining at the desired moment), he speaks of the mastery in attaining those jhānas; but by the word ‘‘nikāmalābhī’’ (gainer at will), it should be understood that the mastery of adverting, sustaining, and reviewing is also stated.
Icchiticchitakkhaṇe samāpajjituṃ samatthoti (có khả năng nhập thiền vào bất cứ lúc nào mong muốn) – điều này nói về sự thành thạo trong việc nhập các thiền đó. Và từ lời nói "nikāmalābhī" (người đạt được tùy ý), cần phải hiểu rằng sự thành thạo trong việc tác ý, an trú và quán xét cũng đã được nói đến.
Sukheneva paccanīkadhamme vikkhambhetvāti etena tesaṃ jhānasukhakhippābhiññatañca dasseti.
By ‘‘sukheneva paccanīkadhamme vikkhambhetvā’’ (having suppressed opposing factors with ease), he indicates their quick attainment of jhāna pleasure.
Sukheneva paccanīkadhamme vikkhambhetvā (dễ dàng đẩy lùi các pháp đối nghịch) – điều này cũng cho thấy sự nhanh chóng đạt được lạc thiền của họ.
Vipulānanti vepullaṃ pāpitānaṃ.
Vipulānaṃ means brought to fullness.
Vipulānaṃ (rộng lớn) là những gì đã đạt đến sự rộng lớn.
Jhānānaṃ vipulatā nāma subhāvitabhāvena ciratarappatti, sā ca paricchedānurūpāva icchitabbbāti ‘‘vipulāna’’nti vatvā ‘‘yathāparicchedeyeva vuṭṭhātuṃ samatthoti vuttaṃ hotī’’ti āha.
The fullness of jhānas is long-lasting attainment due to being well-cultivated, and this should be desired according to the delimited period, so after saying ‘‘vipulānaṃ’’, he says ‘‘yathāparicchedeyeva vuṭṭhātuṃ samatthoti vuttaṃ hotī’’ (it means one is capable of emerging precisely at the delimited time).
Sự rộng lớn của các thiền là sự đạt được lâu dài do được tu tập tốt, và điều đó phải được mong muốn theo giới hạn đã định, nên sau khi nói "vipulānaṃ" (rộng lớn), Ngài nói "yathāparicchedeyeva vuṭṭhātuṃ samatthoti vuttaṃ hotī" (có nghĩa là có khả năng xuất thiền đúng theo giới hạn đã định).
Paricchedakālañhi appatvāva vuṭṭhahanto akasiralābhī na hoti yāvadicchakaṃ pavattetuṃ asamatthattā.
For one who emerges before the delimited time is not an easy gainer, being unable to maintain it as long as desired.
Vì người xuất thiền trước khi đạt đến thời gian đã định sẽ không phải là người đạt được dễ dàng, do không có khả năng duy trì thiền tùy ý muốn.
Idāni teyeva yathāvutte samāpajjanādivasībhāve byatirekavasena vibhāvetuṃ ‘‘ekacco hī’’tiādi vuttaṃ.
Now, to elaborate on those same masters of attainment and so on in a negative sense, ‘‘ekacco hī’’ (for some) and so on is stated.
Bây giờ, để làm rõ các sự thành thạo trong việc nhập thiền v.v. đã nói ở trên theo cách phủ định, Ngài nói "ekacco hī" (vì một số người) v.v.
Tattha lābhīyeva hotīti idaṃ paṭiladdhamattassa jhānassa vasena vuttaṃ.
There, lābhīyeva hotī (he is indeed a gainer) is said in reference to the mere attainment of jhāna.
Trong đó, "lābhīyeva hotī" (chỉ là người đạt được) – điều này được nói về thiền đã đạt được.
Tathāti icchiticchitakkhaṇe.
Tathā (in that way) means at the desired moment.
Tathā (như vậy) là vào bất cứ lúc nào mong muốn.
Pāribandhiketi vasībhāvassa paccanīkadhamme.
Pāribandhike refers to the opposing factors to mastery.
Pāribandhike (những chướng ngại) là những pháp đối nghịch với sự thành thạo.
Jhānādhigamassa pana paccanīkadhammā pageva vikkhambhitā, aññathā jhānādhigamo eva na siyā.
But the opposing factors to the attainment of jhāna are already suppressed; otherwise, there would be no attainment of jhāna at all.
Tuy nhiên, các pháp đối nghịch với sự chứng đắc thiền đã bị đẩy lùi từ trước, nếu không thì thiền sẽ không thể được chứng đắc.
Kicchena vikkhambhetīti kicchena visodheti.
Kicchena vikkhambhetī means he purifies with difficulty.
Kicchena vikkhambhetī (khó khăn để đẩy lùi) là khó khăn để thanh lọc.
Kāmādīnavapaccavekkhaṇādīhi kāmacchandādīnaṃ viya aññesampi samādhipāribandhikānaṃ dūrasamussāraṇaṃ idha vikkhambhanaṃ visodhanañcāti veditabbaṃ.
Here, vikkhambhana (suppression) and visodhana (purification) should be understood as the distant removal of sensual desire and other hindrances to concentration, just as in the reflection on the disadvantages of sense-pleasures and so on.
Cần phải hiểu rằng ở đây, sự đẩy lùi và thanh lọc là việc loại bỏ các chướng ngại định khác, như tham dục v.v., bằng cách quán xét sự nguy hiểm của dục lạc v.v., giống như việc loại bỏ tham dục v.v.
Nāḷikāyantanti kālamānanāḷikāyantaṃ āha.
Nāḷikāyantaṃ refers to the clock device for measuring time.
Nāḷikāyantaṃ (dụng cụ đo thời gian) là dụng cụ đo thời gian.
Visesena rūpāvacaracatutthajjhānaṃ sabbaso vasībhāvāpāditaṃ abhiññāpādakanti adhippāyenāha ‘‘abhiññāpādake jhāne vutte’’ti.
With the intention that especially the fourth rūpajjhāna, when fully mastered, is the basis for higher knowledge, he says ‘‘abhiññāpādake jhāne vutte’’ (when jhāna, the basis for higher knowledge, is spoken of).
Với ý rằng thiền Tứ sắc giới, hoàn toàn thành thạo, là nền tảng cho các thắng trí, Ngài nói "abhiññāpādake jhāne vutte" (khi thiền là nền tảng cho các thắng trí đã được nói đến).
Arūpajjhānampi pana adhiṭṭhānatāya pādakameva cuddasadhā cittaparidamanena vinā tadabhāvato.
However, the arūpajjhāna is also a basis as a foundation, because without the fourteen ways of taming the mind, it would not exist.
Tuy nhiên, thiền vô sắc cũng là nền tảng do là yếu tố hỗ trợ, vì không có thiền vô sắc nếu không có sự chế ngự tâm mười bốn cách.
‘‘Evamabhiññāpādake rūpāvacarajjhāne vutte rūpāvacaratāya kiñcāpi abhiññānaṃ lokiyavāro āgato’’ti ayañhettha adhippāyo.
For this is the intention here: "Although the worldly aspect of higher knowledge is discussed when referring to the rūpajjhāna, which is the basis for higher knowledge, due to its nature as rūpajjhāna."
"Do đó, khi thiền sắc giới là nền tảng cho các thắng trí đã được nói đến, mặc dù là sắc giới, nhưng phần thế gian của các thắng trí đã được đề cập" – đây là ý nghĩa ở đây.
Nanti abhiññāvāraṃ.
Naṃ refers to the section on higher knowledge.
Naṃ (nó) là phần thắng trí.
Cattāri…pe… ariyamaggā sīlānaṃ ānisaṃso sampannasīlasseva lābhato.
Cattāri…pe… ariyamaggā sīlānaṃ ānisaṃso (the four...pe... noble paths are the benefit of sīla) because they are obtained only by one of perfect sīla.
Cattāri…pe… ariyamaggā sīlānaṃ ānisaṃso (bốn... (v.v.)... các Đạo Thánh là lợi ích của giới) vì chỉ có người có giới hạnh viên mãn mới đạt được.
Pariyādiyitvāti gahetvā.
Pariyādiyitvā means having taken.
Pariyādiyitvā (thu thập) là lấy.
Aṅgasantatāyāti nīvaraṇādīnaṃ paccanīkadhammānaṃ sudūratarabhāvena jhānaṅgānaṃ vūpasantatāya, nibbutasabbadarathapariḷāhatāyāti attho, yato tesaṃ jhānānaṃ paṇītatarādibhāvo.
Aṅgasantatāya means by the distant removal of opposing factors such as the hindrances, and by the tranquility of the jhāna factors; meaning, by the appeasement of all torment and fever, because of the refined nature of those jhānas.
Aṅgasantatāyā (do các chi phần lắng dịu) là do các pháp đối nghịch như các triền cái v.v. đã ở rất xa, và các chi thiền đã lắng dịu, nghĩa là tất cả sự khổ não và phiền muộn đã được dập tắt, vì các thiền đó có trạng thái cao thượng hơn.
Ārammaṇasantatāyāti rūpapaṭighādivigamanena saṇhasukhumādibhāvappattasantabhāvena.
By the subtlety of the object (ārammaṇasantatā): by the vanishing of the resistance of matter and so forth, through the stillness attained by becoming subtle and refined.
Do sự thanh tịnh của đối tượng (Ārammaṇasantatāya), tức là do sự vượt qua các chướng ngại vật như sắc, đạt đến trạng thái thanh tịnh, vi tế, v.v.
Yadaggena hi nesaṃ bhāvanābhisamayasabbhāvitasaṇhasukhumākārāni ārammaṇāni santāni, tadaggena jhānaṅgānaṃ santatā veditabbā.
For by the peak (degree) to which their objects, made subtle and refined through development and realization, are still, by that peak (degree) the stillness of the jhana factors should be understood.
Bởi vì các đối tượng có trạng thái vi tế, thanh tịnh được phát triển bởi sự tu tập và chứng ngộ của chúng là thanh tịnh, nên sự thanh tịnh của các thiền chi cần được hiểu theo nghĩa đó.
Ārammaṇasantatāya santatā lokuttaradhammārammaṇāhi paccavekkhaṇāhi dīpetabbā.
The stillness due to the subtlety of the object should be illuminated by the reviewing contemplations of supramundane dhamma-objects.
Sự thanh tịnh của đối tượng cần được làm sáng tỏ bằng sự quán xét các đối tượng pháp siêu thế.
Vimuttā visesena muttā.
Vimuttā means especially freed.
Vimutta (giải thoát) có nghĩa là đặc biệt được giải thoát.
Ye hi jhānadhammā tathāpavattapubbabhāgabhāvanāhi tabbisesatāya sātisayaṃ paṭipakkhadhammehi vimuttivasena pavattanti, tato eva tathāvimuttatāya pitu aṅke vissaṭṭhaaṅgapaccaṅgo viya kumāro nirāsaṅkabhāvena ārammaṇe adhimuttā ca pavattanti, te vimokkhāti vuccanti.
Indeed, those jhana-dhamma which arise by way of being exceptionally freed from opposing qualities, due to their distinctiveness through such preceding development, and for that very reason, being thus freed, like a child with limbs and sub-limbs relaxed in its father's lap, they arise with confidence and are devoted to the object; these are called vimokkha.
Những pháp thiền nào, do sự tu tập phần trước đã diễn ra như vậy, do tính đặc biệt của chúng mà diễn ra theo cách được giải thoát đặc biệt khỏi các pháp đối nghịch, và do đó, do sự giải thoát như vậy, chúng được quyết định trên đối tượng một cách không nghi ngại như một đứa trẻ buông thõng tay chân trên lòng cha, thì chúng được gọi là vimokkha (giải thoát).
Tenāha ‘‘vimokkhāti paccanīkadhammehi vimuttattā ārammaṇe ca adhimuttattā’’ti.
Therefore it is said: "Vimokkha are so called because they are freed from opposing qualities and devoted to the object."
Vì vậy, có lời nói: “Vimokkha là do được giải thoát khỏi các pháp đối nghịch và được quyết định trên đối tượng”.
Yadipi ārammaṇasamatikkamavasena pattabbāni āruppāni, na aṅgātikkamavasena, tathāpi yasmā ārammaṇe avirattassa jhānasamatikkamo na hoti, samatikkantesu ca jhānesu ārammaṇaṃ samatikkantameva hoti, tasmā ārammaṇasamatikkamaṃ avatvā ‘‘rūpāvacarajjhāne atikkamitvā’’ti icceva vuttaṃ.
Although the formless attainments (āruppā) are to be attained by transcending the object, not by transcending the factors, yet since for one not disenchanted with the object there is no transcendence of jhana, and when jhanas are transcended, the object is also transcended, therefore, without mentioning the transcendence of the object, it is simply stated: "having transcended the rūpāvacara jhānas."
Mặc dù các tầng thiền vô sắc (āruppa) cần đạt được bằng cách vượt qua đối tượng, chứ không phải bằng cách vượt qua các chi, nhưng vì không thể vượt qua thiền nếu chưa ly tham đối với đối tượng, và khi thiền đã được vượt qua thì đối tượng cũng đã được vượt qua, do đó, thay vì nói vượt qua đối tượng, chỉ nói “vượt qua các thiền sắc giới” (rūpāvacarajjhāne atikkamitvā).
Atikkamma rūpeti pāḷiyaṃ ‘‘sampādetabbā, passitabbā’’ti vā kiñci padaṃ icchitabbaṃ, asutaparikappanena pana payojanaṃ natthīti ‘‘santāti padasambandho’’ti vuttaṃ.
In the Pali phrase "having transcended matter" (atikkamma rūpe), some word such as "should be attained" or "should be seen" is implied, but since there is no purpose in conjecturing what is not heard, it is stated "this is a connection to the word santā" (still/subtle).
Trong đoạn Pāḷi “Atikkamma rūpe” (vượt qua sắc), cần bổ sung một từ như “sampādetabbā” (cần được thành tựu) hoặc “passitabbā” (cần được thấy), nhưng vì không có mục đích gì khi giả định điều không được nghe, nên đã nói “là sự liên kết từ với ‘santa’”.
Evañca katvā tena virāgabhāvena tesaṃ santatāti ayampi attho vibhāvito hoti.
And by doing so, this meaning is also elucidated: their stillness is due to that state of dispassion.
Và khi đã làm như vậy, ý nghĩa “sự thanh tịnh của chúng do trạng thái ly tham đó” cũng được làm rõ.
Rūpajjhānādīnaṃ viya natthi etesaṃ ārammaṇabhūtaṃ vā phalabhūtaṃ vā rūpanti arūpā.
Arūpā (formless) are those for which there is no matter (rūpa), either as an object or as a result, unlike the rūpa-jhānas and so forth.
Không có sắc làm đối tượng hay làm quả của chúng như các thiền sắc giới, v.v., nên chúng là arūpa (vô sắc).
Arūpā eva āruppā.
The āruppā are precisely the arūpā.
Chính các pháp vô sắc là āruppa (tầng thiền vô sắc).
Tenāha ‘‘ārammaṇato ca vipākato ca rūpavirahitā’’ti.
Therefore it is said: "devoid of matter as object and as result."
Vì vậy, có lời nói: “Không có sắc cả về đối tượng lẫn quả”.
Nāmakāyenāti sahajātanāmasamūhena.
By the name-aggregate (nāmakāyena): by the collection of co-arising names.
Bằng danh thân (nāmakāyena) tức là bằng tập hợp các danh pháp đồng sinh.
67. Saṃyojentīti bandhanti.
67. Saṃyojenti means to bind.
67. Saṃyojenti (kết hợp) tức là cột buộc.
Kehīti āha ‘‘khandhagatī’’tiādi.
As to "by what?" it states: "khandha-gati" and so forth.
Bằng những gì? Có lời nói: “khandhagati” (sự đi đến các uẩn), v.v.
Asamucchinnarāgādikassa hi khandhādīnaṃ āyatiṃ khandhādīhi sambandho, samucchinnarāgādikassa pana taṃ natthi katānampi kammānaṃ asamatthabhāvāpattitoti.
For one whose defilements like craving are not eradicated, there is a connection of the aggregates (khandha) etc. with future aggregates etc.; but for one whose defilements like craving are eradicated, that does not exist, due to the powerlessness of even actions performed.
Thật vậy, đối với người chưa đoạn trừ tham ái, v.v., có sự liên kết của các uẩn, v.v. với các uẩn, v.v. trong tương lai; còn đối với người đã đoạn trừ tham ái, v.v., điều đó không còn nữa, vì ngay cả những nghiệp đã tạo cũng trở nên vô hiệu.
Rāgādīnaṃ anvayato ca saṃyojanaṭṭho siddhoti āha ‘‘khandhagati…pe… vuccantī’’ti.
And since the meaning of 'binding' is established by the continuation of craving and so forth, it is said: "khandha-gati... etc... are called."
Và ý nghĩa của sự cột buộc cũng được xác lập do sự tiếp nối của tham ái, v.v., nên có lời nói: “khandhagati…v.v… được gọi là”.
Parikkhayenāti samucchedena sabbaso āyatiṃ anuppajjanena.
By exhaustion (parikkhayena): by complete eradication, by non-arising in the future altogether.
Do sự tiêu diệt (parikkhayena) tức là do sự đoạn diệt, do sự không tái sinh hoàn toàn trong tương lai.
Paṭipakkhadhammānaṃ anavasesato savanato pīḷanato soto, ariyamaggoti āha ‘‘sototi ca maggassetaṃ adhivacana’’nti.
Sota (stream) means the Noble Path, so called because of the complete crushing and tormenting of opposing qualities. Therefore it is said: "sota is a designation for the path."
Do sự lắng nghe không sót lại và sự áp bức của các pháp đối nghịch, nên sota (dòng) là Thánh đạo, vì vậy có lời nói: “Sota là một tên gọi khác của đạo”.
Taṃ sotaṃ ādito panno adhigacchīti sotāpanno, aṭṭhamako.
One who has entered that stream from the beginning, who has attained it, is a Sotāpanna, the eighth person.
Người đã đạt được dòng đó từ ban đầu là Sotāpanna (Nhập Lưu), là người thứ tám.
Tenāha ‘‘taṃsamaṅgīpuggalassā’’ti, paṭhamamaggakkhaṇe puggalassāti adhippāyo.
Therefore it is said: "for the individual endowed with it," meaning, for the individual at the moment of the first path.
Vì vậy, có lời nói: “của người thành tựu dòng đó”, ý muốn nói là của người vào khoảnh khắc Đạo thứ nhất.
Idha pana panna-saddo ‘‘phalasacchikiriyāya paṭipanno’’tiādīsu (a. ni. 8.59) viya vattamānakālikoti āha ‘‘maggena phalassa nāmaṃ dinna’’nti.
Here, however, the word panna (entered) is in the present tense, as in "entered upon the realization of the fruit" (a. ni. 8.59) and so forth. Therefore it is said: "the fruit is named by the path."
Ở đây, từ panna (đã đạt) mang ý nghĩa hiện tại như trong “paṭipanno phalasacchikiriyāya” (đã thực hành để chứng ngộ quả), v.v., nên có lời nói: “Đạo đã ban tên cho Quả”.
Abhītakālikatte pana sarasatova nāmalābho siyā.
Otherwise, if it were in the past tense, the naming would be natural (inherent).
Nếu không có ý nghĩa hiện tại, thì việc đặt tên sẽ tự nhiên hơn.
Virūpaṃ sadukkhaṃ saupāyāsaṃ nipātetīti vinipāto, apāyadukkhe khipanako.
Vinipāta (hell/misery) means that which causes one to fall into undesirable, suffering, and distressful states; that which throws one into the suffering of the lower realms.
Đó là vinipāta (đọa xứ) vì nó đưa đến trạng thái xấu, đau khổ, phiền não; là nơi ném vào khổ cảnh.
Dhammoti sabhāvo.
Dhamma means nature.
Dhamma (pháp) tức là bản chất.
Tenāha ‘‘attāna’’ntiādi.
Therefore it is said: "oneself" and so forth.
Vì vậy, có lời nói: “tự thân”, v.v.
Kasmāti avinipātadhammatāya kāraṇaṃ pucchati.
Why (kasmā) asks the reason for being of the nature of not falling into misery.
Tại sao (kasmā)? Hỏi về nguyên nhân của trạng thái không đọa lạc.
Apāyaṃ gamentīti apāyagamanīyā.
Things that lead to the lower realms are apāyagamanīyā.
Những điều dẫn đến đọa xứ là apāyagamanīya (dẫn đến đọa xứ).
Sambujjhatīti sambodhi, ariyamaggo.
One awakens completely, hence sambodhi, the Noble Path.
Sự giác ngộ là sambodhi (giác ngộ hoàn toàn), là Thánh đạo.
So pana paṭhamamaggassa adhigatattā avasiṭṭho eva adhigandhabbabhāvena icchitabboti āha ‘‘uparimaggattaya’’nti.
Since the first path has been attained, the remaining paths are to be desired as yet to be attained. Therefore it is said: "the remaining three paths."
Và vì Đạo thứ nhất đã được chứng đắc, nên phần còn lại cần được mong muốn như một điều cần được chứng đắc, vì vậy có lời nói: “ba Đạo trên”.
Vaṇṇabhaṇanatthaṃ vuttāni,na pahātabbānīti adhippāyo.
These are spoken in praise, not as things to be abandoned; this is the intention.
Được nói ra để ca ngợi, không phải để đoạn trừ, đó là ý nghĩa.
Oḷārikānaṃ rāgādīnaṃ samucchindanavasena pavattamāno dutiyamaggo avasiṭṭhānaṃ tesaṃ tanubhāvāpattiyā uppanno nāma hotīti vuttaṃ ‘‘rāgadosamohānaṃ tanuttā’’ti.
The second path, operating through the eradication of gross defilements like craving, is said to have arisen when the remaining defilements have become attenuated. Thus it is stated: "due to the attenuation of greed, hatred, and delusion."
Đạo thứ hai, diễn ra bằng cách đoạn trừ các tham ái thô thiển, v.v., được gọi là đã sinh khởi do sự làm mỏng đi của những tham ái còn lại, nên có lời nói: “do sự làm mỏng tham, sân, si”.
Adhiccuppattiyāti kadāci karahaci uppajjanena.
By occasional arising (adhiccuppattiyā): by arising now and then.
Do sự sinh khởi ngẫu nhiên (adhiccuppattiyā) tức là do sự sinh khởi đôi khi, thỉnh thoảng.
Pariyuṭṭhānamandatāyāti samudācāramudutāya.
By the mildness of their obsession (pariyuṭṭhānamandatāya): by the gentleness of their manifestation.
Do sự yếu kém của các phiền não chi phối (pariyuṭṭhānamandatāya) tức là do sự mềm yếu của các phiền não hiện hành.
Abhiṇhaṃ na uppajjanti tajjassa ayonisomanasikārassa anibaddhabhāvato.
They do not arise frequently due to the irregularity of the unskillful attention (ayoniso manasikāra) that causes them.
Không thường xuyên sinh khởi là do sự không liên tục của sự tác ý không như lý tương ứng.
Mandamandā uppajjanti vipallāsānaṃ tappaccayānañca mohamānādīnaṃ mudutarabhāvato.
They arise very mildly due to the subtler nature of the perversions and their concomitant defilements like delusion and conceit.
Sinh khởi yếu ớt là do sự mềm yếu hơn của các biến kiến và các yếu tố liên quan như si mê, kiêu mạn, v.v.
Bahalāva uppajjanti vatthupaṭisevanatoti adhippāyo.
They arise profusely due to the indulgence in the basis (of sense objects); this is the intention.
Sinh khởi mạnh mẽ là do sự chấp thủ đối tượng, đó là ý nghĩa.
Tenāha ‘‘tathā hī’’tiādi.
Therefore it is said: "for thus it is" and so forth.
Vì vậy, có lời nói: “Thật vậy”, v.v.
Sakiṃ āgamanadhammoti paṭisandhivasena sakiṃyeva āgamanasabhāvo.
Of the nature of returning once (sakiṃ āgamanadhammo): having the nature of returning only once by way of rebirth-linking.
Pháp tái lai một lần (sakiṃ āgamanadhammo) tức là bản chất tái sinh một lần duy nhất theo nghĩa tái tục.
Ekavāraṃyeva…pe… āgantvāti iminā pañcasu sakadāgāmīsu cattāro vajjetvā ekoyeva gahitoti dassento ‘‘yopi hī’’tiādimāha.
By "only once... etc... having returned," it shows that among the five Sakadāgāmīs, only one is taken, excluding the other four; therefore, it states "Even the one who..." and so forth.
Bằng cách nói “chỉ một lần…v.v… tái lai”, để chỉ ra rằng trong năm vị Nhất Lai (Sakadāgāmī), bốn vị đã được loại trừ và chỉ một vị được lấy, nên có lời nói: “ngay cả người nào”, v.v.
Tattha yvāyaṃ pañcamako sakadāgāmī ‘‘idha maggaṃ bhāvetvā devaloke nibbatto, tattha yāvatāyukaṃ ṭhatvā puna idhūpapajjitvā parinibbāyatī’’ti vutto, tassa ekabījinā saddhiṃ kiṃ nānākaraṇanti?
Among these, what is the difference between the fifth Sakadāgāmī, who is said to "develop the path here, is reborn in the deva realm, stays there for a lifetime, then returns to this world and attains final Nibbāna," and the Ekabījī?
Trong đó, vị Nhất Lai thứ năm được nói là “đã tu tập Đạo ở đây, tái sinh vào cõi trời, sống trọn tuổi thọ ở đó, rồi tái sinh lại ở đây và nhập Niết Bàn”, thì có gì khác biệt với vị Nhất Chủng (Ekabījī)?
Ekabījissa ekā paṭisandhi, sakadāgāmissa dve paṭisandhiyoti idaṃ tesaṃ nānākaraṇaṃ.
The difference between them is that the Ekabījī has one rebirth-linking, while the Sakadāgāmī has two rebirth-linkings.
Sự khác biệt giữa họ là: vị Nhất Chủng có một lần tái tục, còn vị Nhất Lai có hai lần tái tục.
Yassa hi sotāpannassa ekaṃyeva khandhabījaṃ, na ekaṃ attabhāvaggahaṇaṃ, so ekabījīti.
For the Stream-enterer who has only one aggregate-seed, not one taking of existence, is an Ekabījī.
Thật vậy, vị Nhập Lưu nào chỉ có một hạt giống uẩn, chứ không phải một lần thọ thân, thì đó là vị Nhất Chủng.
Heṭṭhāti ‘‘amahaggatabhūmiya’’nti heṭṭhā sambandhanena.
Below (heṭṭhā): in connection with "in the non-exalted realm" (amahaggatabhūmiya).
Phía dưới (heṭṭhā) tức là liên kết với “ở cõi không phải là đại hành” (amahaggatabhūmiya) ở phía dưới.
Heṭṭhābhāgassa hitāti heṭṭhābhāgiyā, tesaṃ.
Heṭṭhābhāgiyā (lower fetters): meaning, belonging to those that relate to the lower realm.
Heṭṭhābhāgiyā (thuộc phần hạ), tức là những điều có lợi cho phần hạ, của chúng.
Tānīti orabbhāgiyasaṃyojanāni.
Tāni (those): meaning, the lower fetters.
Tāni (chúng) tức là các kiết sử thuộc phần hạ.
Kāmāvacare nibbattatiyeva ajjhattaṃ saṃyojanattā.
He is indeed reborn in the sense-sphere (kāmāvacare nibbattatiyeva) because the fetters are internal.
Chắc chắn tái sinh trong cõi dục giới là do chúng là các kiết sử nội tại.
Tathā hesa dūratopi āvattidhammo evāti dassetuṃ gilabaḷisamacchādayo upamābhāvena vuttā.
And to show that he is of a nature to turn back even from afar, fish in a baited hook and similar examples are used as similes.
Và để chỉ ra rằng chúng có bản chất quay trở lại ngay cả từ xa, các ví dụ như cá bị mắc lưỡi câu đã được nêu ra.
Opapātikoti iminā gabbhavāsadukkhābhāvamāha.
Opapātiko (spontaneously arisen) indicates the absence of the suffering of womb-birth.
Hóa sinh (opapātiko) bằng cách này, nói lên sự không có khổ đau của thai tạng.
Tattha parinibbāyīti iminā sesadukkhābhāvaṃ.
Parinibbāyī there (tattha parinibbāyī) indicates the absence of remaining suffering.
Nhập Niết Bàn ở đó (tattha parinibbāyī) bằng cách này, nói lên sự không có các khổ đau còn lại.
Tattha parinibbānatā cassa kāmaloke khandhabījassa apunārohavasenevāti dassetuṃ ‘‘anāvattidhammo’’ti vuttaṃ.
And to show that his attainment of Nibbāna there is by way of not returning again to the aggregate-seed in the sense-world, it is stated "of a non-returning nature" (anāvattidhammo).
Và để chỉ ra rằng sự nhập Niết Bàn của vị ấy ở đó là do không còn tái sinh hạt giống uẩn trong cõi dục giới, nên có lời nói: “pháp không tái lai” (anāvattidhammo).
68. Kevalāti lokiyābhiññāhi asammissā.
68. Kevalā (pure/solely): unmixed with mundane supernormal powers (lokiyābhiññā).
68. Kevalā (chỉ) tức là không lẫn lộn với các thần thông thế gian.
Lokiyapañcābhiññāyopi sīlānaṃ ānisaṃso tadavinābhāvato.
Even the five mundane supernormal powers are benefits of morality (sīlānaṃ ānisaṃso) because they are inseparable from it.
Ngay cả năm thần thông thế gian cũng là lợi ích của giới là do chúng không thể tách rời khỏi giới.
Tāpi dassetuṃ ākaṅkheyya ce…pe… evamādimāhāti yojanā.
The connection is: "He (the Buddha) said 'if one wishes,' and so forth, to show these (supernormal powers) as well."
Và để chỉ ra chúng, nếu mong muốn…v.v… có lời nói như vậy, đó là sự liên kết.
Āsavānaṃ anavasesappahānato arahattamaggoyeva visesato ‘‘āsavakkhayo’’ti vattabbataṃ arahatīti vuttaṃ ‘‘āsavakkhaye kathite’’ti, aññathā sabbāpi chaḷabhiññā āsavakkhayo evāti.
The Arahant path alone truly deserves to be called "cessation of influxes" (āsavakkhayo) in particular, due to the complete abandonment of influxes; otherwise, all six supernormal powers are indeed cessation of influxes. This is why it is said: "when the cessation of influxes is spoken of."
Vì sự đoạn trừ hoàn toàn các lậu hoặc, chỉ có Đạo A-la-hán mới xứng đáng được gọi đặc biệt là “āsavakkhaya” (diệt tận các lậu hoặc), nên có lời nói: “khi sự diệt tận các lậu hoặc được nói đến”; nếu không, tất cả sáu thần thông cũng đều là sự diệt tận các lậu hoặc.
Imesaṃ guṇānanti lokiyābhiññānaṃ.
These qualities (imesaṃ guṇānaṃ): the mundane supernormal powers.
Của những đức tính này (imesaṃ guṇānaṃ) tức là của các thần thông thế gian.
Yathā purisassa muṇḍitaṃ sīsaṃ sikhāvirahitattā na sobhati, evaṃ desanāya sīsabhūtāpi aggamaggakathā lokiyābhiññārahitā na sobhatīti āha ‘‘ayaṃ kathā muṇḍābhiññākathā nāma bhaveyyā’’ti.
Just as a man's shaven head does not look good because it lacks a topknot, so too the discourse, even if it is the pinnacle-discourse (aggamaggakathā), does not look good without mundane supernormal powers. Thus it is said: "this discourse would be called a bald supernormal power discourse."
Như đầu của một người cạo trọc không đẹp vì không có chỏm tóc, tương tự, bài giảng về Đạo tối thượng, dù là phần đầu của bài giảng, cũng không đẹp nếu thiếu các thần thông thế gian, nên có lời nói: “Bài giảng này sẽ là bài giảng về thần thông trọc đầu”.
Iddhivikubbanāti iddhi ca vikubbanā ca.
Iddhi-vikubbanā (supernormal power and transformation): refers to supernormal power and transformation.
Iddhivikubbanā (thần thông biến hóa) tức là thần thông và biến hóa.
Vikubbanaggahaṇena cettha vikubbaniddhimāha, iddhiggahaṇena tadaññaṃ sabbañca abhiññākiccaṃ.
Here, by the term 'transformation' (vikubbanā), the power of transformation is meant; and by the term 'supernormal power' (iddhi), all other acts of supernormal power.
Ở đây, bằng cách đề cập đến biến hóa, nói đến thần thông biến hóa; bằng cách đề cập đến thần thông, nói đến tất cả các công việc thần thông khác.
Yuttaṭṭhāneyevāti lokiyābhiññānaṃ nibbattanassa viya desanāya yuttaṭṭhāneyeva.
Only in the appropriate place (yuttaṭṭhāneyeva): only in the place appropriate for the discourse, like the manifestation of mundane supernormal powers.
Chỉ ở nơi thích hợp (yuttaṭṭhāneyeva) tức là chỉ ở nơi thích hợp cho bài giảng, giống như sự phát sinh của các thần thông thế gian.
Etena na kevalaṃ desanakkamenevāyaṃ desanā, atha kho paṭipattikkamenapīti dasseti.
By this, it is shown that this teaching is not only by way of exposition but also by way of practice.
Với điều này, (Đức Phật) chỉ ra rằng bài giảng này không chỉ theo trình tự thuyết pháp mà còn theo trình tự thực hành.
Visuddhimagge (visuddhi. 2.369) vuttā, tasmā tattha vuttanayeneva veditabbāti adhippāyo.
It is stated in the Visuddhimagga, therefore the intention is that it should be understood precisely by the method stated there.
(Điều này) đã được nói trong Thanh Tịnh Đạo (visuddhi. 2.369), do đó ý nghĩa là cần phải hiểu theo cách đã nói ở đó.
69. Āsavānaṃ khayāti heṭṭhimamaggena khepitāvasiṭṭhānaṃ āsavānaṃ arahattamaggena samucchindanato.
69. By the destruction of the āsavas means from utterly eradicating, by the path of arahantship, those āsavas that remain after being eradicated by the lower paths.
69. Do sự diệt trừ các lậu hoặc (āsava): là do sự đoạn trừ tận gốc các lậu hoặc còn sót lại sau khi đã được diệt trừ bằng các đạo lộ thấp hơn, bằng đạo lộ A-la-hán.
Yasmā arahattamaggo na kevalaṃ āsaveyeva khepeti, atha kho avasiṭṭhe sabbakilesepi, tasmā āha ‘‘sabbakilesānaṃ khayā’’ti.
Because the path of arahantship not only eradicates merely the āsavas, but also all other remaining defilements, therefore it is said, "by the destruction of all defilements."
Vì đạo lộ A-la-hán không chỉ diệt trừ các lậu hoặc mà còn diệt trừ tất cả các phiền não còn sót lại, do đó (kinh) nói “do sự diệt trừ tất cả các phiền não”.
Lakkhaṇamattañhettha āsavaggahaṇaṃ, āsavānaṃ ārammaṇabhāvassapi anupagamanato anāsavaṃ.
Here, the mention of āsavas is merely for characteristic; being anāsava means not being approached even by the objects of the āsavas.
Ở đây, việc nắm giữ các lậu hoặc chỉ là một dấu hiệu, (Niết Bàn) là vô lậu (anāsava) vì các lậu hoặc không còn là đối tượng.
Yasmā pana tattha āsavānaṃ lesopi natthi, tasmā vuttaṃ ‘‘āsavavirahita’’nti.
However, since there is not even a trace of āsavas there, it is said, "devoid of āsavas."
Vì ở đó không có dù chỉ một chút lậu hoặc, do đó đã nói “không có lậu hoặc (āsavavirahita)”.
Samādhi vutto cetosīsena yathā ‘‘cittaṃ paññañca bhāvaya’’nti (saṃ. ni. 1.23, 192; peṭako. 22; mi. pa. 2.1.9) adhippāyo.
Samādhi is spoken of by way of cetosīsa (mind's summit), just as in "develop mind and wisdom" is the intention.
Ý nghĩa là định (samādhi) đã được nói đến qua phần tâm (ceto), như trong câu “Hãy tu tập tâm và tuệ” (saṃ. ni. 1.23, 192; peṭako. 22; mi. pa. 2.1.9).
Rāgato vimuttattā avijjāya vimuttattāti idaṃ ujuvipaccanīkapaṭippassaddhidassanaṃ daṭṭhabbaṃ, na tadaññesaṃ pāpadhammānaṃ appaṭippassaddhattā.
"Liberation from greed, liberation from ignorance"—this should be seen as demonstrating the direct counteracting appeasement, and not that other evil states are not appeased.
Do giải thoát khỏi tham (rāga), do giải thoát khỏi vô minh (avijjā): điều này cần được xem là sự an tịnh đối nghịch trực tiếp, chứ không phải do các pháp ác khác không được an tịnh.
Idāni tameva samādhipaññānaṃ rāgāvijjāpaṭipakkhataṃ āgamena dassetuṃ ‘‘vuttaṃ ceta’’ntiādi vuttaṃ.
Now, in order to demonstrate the antagonism of samādhi and wisdom towards greed and ignorance by means of scriptural reference, "and it is said" and so forth is stated.
Bây giờ, để chỉ ra sự đối nghịch của định và tuệ với tham và vô minh bằng kinh điển, đã nói “và điều này đã được nói” v.v.
Samathaphalanti samathassa phalaṃ lokiyasamathabhāvanāya hi vipassanāgatāya āhitaphalassa lokuttarasamathassa sarikkhakaphalo cetovimutti.
The fruit of tranquility means the fruit of tranquility. The liberation of mind (cetovimutti) is a fruit similar to the supramundane tranquility, which is a fruit produced by the development of mundane tranquility that has reached insight.
Quả của tịnh chỉ (samathaphala): quả của tịnh chỉ là sự giải thoát tâm (cetovimutti) có quả tương tự như tịnh chỉ siêu thế, tức là quả được sinh ra từ sự tu tập tịnh chỉ thế gian khi đi kèm với tuệ quán.
Vipassanāphalanti etthāpi eseva nayo.
The same applies to the fruit of insight.
Quả của tuệ quán (vipassanāphala): ở đây cũng theo cùng một cách.
Attanoyevāti sutamayañāṇādinā viya parapaccayataṃ nayaggāhañca muñcitvā paratoghosānugatabhāvanādhigamabhūtatāya attanoyeva paññāya paccakkhaṃ katvā sayambhuñāṇabhūtāyāti adhippāyo.
"By oneself" means by actualizing with one's own wisdom, which is self-cognizant knowledge, by letting go of reliance on others, like in knowledge gained from hearing, and avoiding misapprehension, in the sense of being an attainment of development that follows internal reflection.
Tự mình (attanoyevā): nghĩa là tự mình chứng ngộ bằng tuệ (paññāya paccakkhaṃ katvā), tức là bằng tuệ tự sinh, thoát khỏi sự phụ thuộc vào người khác như trong tri kiến do nghe, và thoát khỏi sự chấp thủ các quan điểm.
Tenāha ‘‘aparappaccayena ñatvā’’ti.
Therefore, it is said, "knowing it independently of others."
Do đó (kinh) nói “biết mà không cần người khác”.
Sabbampi tanti sabbampi sattarasavidhaṃ taṃ yathāvuttaṃ sīlānisaṃsaṃ.
All that means all seventeen kinds of advantages of virtue mentioned.
Tất cả điều đó (sabbampi taṃ): tất cả mười bảy loại lợi ích của giới đã nói.
Yathā ānisaṃsavante sammadeva sampādite tadānisaṃsā dassitā eva honti tadāyattabhāvato, evaṃ ānisaṃsapadhānayogyabhāvena dassite tadānisaṃsā dassitā eva hontīti āha ‘‘sampiṇḍetvā dassento’’ti.
Just as when one possesses advantages and has properly accomplished them, those advantages are shown (to exist) because they depend on that accomplishment, so too, when they are shown as suitable for the cultivation of advantages, those advantages are indeed shown; therefore, it is said, "compressing and showing."
Như khi những điều có lợi ích được thực hiện đúng đắn, thì những lợi ích đó tự nhiên được chỉ ra vì chúng phụ thuộc vào điều đó; cũng vậy, khi những điều có lợi ích được chỉ ra một cách thích hợp, thì những lợi ích đó tự nhiên được chỉ ra. Do đó (kinh) nói “tóm tắt và chỉ ra”.
Vuttasseva atthassa punavacanaṃ nigamananti vuttaṃ ‘‘nigamanaṃ āhā’’ti.
The repetition of an already stated meaning is a conclusion, therefore it is said, "says the conclusion."
Việc lặp lại ý nghĩa đã nói được gọi là kết luận, do đó (kinh) nói “nói lời kết luận”.
Pubbeti desanārambhe.
Before means at the beginning of the discourse.
Trước đây (pubbe): khi bắt đầu bài giảng.
Evaṃ vuttanti ‘‘sampannasīlā’’ti evamādinā ākārena vuttaṃ.
Thus stated means stated in such a way as "those who are accomplished in virtue" and so forth.
Đã nói như vậy (evaṃ vutta): đã nói theo cách như “người có giới hạnh viên mãn” v.v.
Idaṃ sabbampīti idaṃ ‘‘sampannasīlā’’tiādikaṃ sabbampi vacanaṃ.
All this means all these words, "those who are accomplished in virtue" and so forth.
Tất cả điều này (idaṃ sabbampī): tất cả những lời nói như “người có giới hạnh viên mãn” v.v.
Etaṃ paṭiccāti etaṃ sampannasīlassa bhikkhuno yathāvuttasattarasavidhānisaṃsabhāgitaṃ sandhāya vuttaṃ.
Concerning this means with reference to this, the sharing of the seventeen kinds of advantages of a bhikkhu accomplished in virtue, as stated.
Liên quan đến điều này (etaṃ paṭiccā): điều này được nói liên quan đến việc một tỳ khưu có giới hạnh viên mãn được hưởng mười bảy loại lợi ích đã nói.
Idameva hi ‘‘iti yaṃ taṃ vuttaṃ, idametaṃ paṭicca vutta’’nti vacanaṃ sandhāya ‘‘sabbampi taṃ sīlānisaṃsaṃ sampiṇḍetvā dassento’’ti vuttaṃ.
Indeed, with reference to this very statement, "thus what was said, this was said concerning this," it is said, "compressing and showing all those advantages of virtue."
Chính câu nói “Do đó, điều đã nói, điều này được nói liên quan đến điều đó” đã được nói liên quan đến “tóm tắt và chỉ ra tất cả những lợi ích của giới đó”.
Etthaādito chahi ānisaṃsehi parittabhūmikā sampatti gahitā, tadantaraṃ pañcahi lokiyābhiññāhi ca mahaggatabhūmikā, itarehi lokuttarabhūmikāti evaṃ catubhūmikasampadānisaṃsasīlaṃ nāmetaṃ mahantaṃ mahānubhāvaṃ, tasmā taṃsampādane sakkaccakāritā appamattena bhavitabbaṃ.
Here, the accomplishment of the limited plane is taken with the first six advantages; then, the accomplishment of the exalted plane with the five mundane supernormal powers; and with the others, the supramundane plane. Thus, this virtue, which leads to the advantages of accomplishment in the four planes, is indeed vast and of great potency. Therefore, one should be diligent in accomplishing it.
Ở đây, sáu lợi ích đầu tiên bao gồm sự thành tựu ở cõi thấp, năm lợi ích ở giữa bao gồm các thần thông thế gian (lokiyābhiññā) ở cõi sắc giới và vô sắc giới, và những lợi ích còn lại thuộc cõi siêu thế. Như vậy, giới hạnh này mang lại sự thành tựu ở bốn cõi, là một điều vĩ đại và có uy lực lớn, do đó cần phải thực hành nó một cách siêng năng và không phóng dật.
70. Chādetabbaṃ ṭhānaṃ vasati paṭicchādetīti vatthaṃ.
Vattha is that which covers a place that should be covered, that protects.
70. Che đậy những chỗ cần che đậy, tức là che thân, nên gọi là y phục (vattha).
Yaṃ samānaṃ viya na sabbaso minoti, mānassa pana samīpe, taṃ upamānaṃ.
That which, though similar, does not measure completely but is close to the measure, is a simile.
Điều gì không hoàn toàn giống như một thước đo nhưng gần với thước đo, đó là ví dụ (upamāna).
Upamīyati etāyāti upamā, upamāya bodhakavacanaṃ upamāvacanaṃ.
Upamā is that by which something is compared; the word that conveys the simile is upamāvacana.
Điều được dùng để ví von là ví dụ (upamā), lời nói dùng để diễn tả ví dụ là lời ví dụ (upamāvacana).
Katthaci sutte.
Katthaci means in some Sutta.
Đôi khi (katthaci) trong kinh.
Atthanti upamiyatthaṃ.
Attha means the meaning to be compared.
Ý nghĩa (atthaṃ): ý nghĩa được ví von.
Paṭhamaṃ upamaṃ vatvā tadanantaraṃ atthaṃ vatvā puna upamaṃ vadanto ‘‘upamāya atthaṃ parivāretvā dassetī’’ti vutto.
One who first states the simile, then the meaning, and then again the simile, is said to be "showing the meaning enveloped by the simile."
Người nói ví dụ trước, sau đó nói ý nghĩa, rồi lại nói ví dụ, được gọi là “chỉ ra ý nghĩa bằng cách bao quanh bởi ví dụ”.
Atthena upamaṃ parivāretvāti etthāpi eseva nayo.
The same method applies to "enveloping the simile with the meaning."
Bao quanh ví dụ bằng ý nghĩa (atthena upamaṃ parivāretvā): ở đây cũng theo cùng một cách.
Idāni te cattāropi pakāre sutte āgatanayeneva dassento ‘‘seyyathāpissu, bhikkhave’’tiādimāha.
Now, in order to demonstrate all four ways as they appear in the Sutta, he says, "Just as, monks," and so forth.
Bây giờ, để chỉ ra bốn cách đó theo cách đã được nói trong kinh, (kinh) nói “Này các tỳ khưu, ví như” v.v.
Tattha dve agārāti dve paṭivissakagharā.
There, two houses means two neighboring houses.
Trong đó, hai ngôi nhà (dve agārā): là hai ngôi nhà hàng xóm.
Sadvārāti sammukhadvārā.
With doors means with doors facing each other.
Có cửa (sadvārā): có cửa đối diện.
Svāyanti so ayaṃ evaṃ upamādassanavasenapi nānānayenapi dhammadesako bhagavā.
This refers to the Fortunate One, the teacher of Dhamma, who shows similes and various methods in this way.
Vị này (svāyaṃ): vị Thế Tôn thuyết pháp này, bằng cách chỉ ra ví dụ như vậy và bằng nhiều cách khác.
Ekaccānaṃ veneyyānaṃ atthassa sukhāvabodho paṭhamaṃ upamādassane hetu, evaṃ paṭhamaṃ atthadassane, upamāya atthaparivāraṇe, atthena upamāparivāraṇe cā’’ti imamatthaṃ dasseti ‘‘esa nayo sabbatthā’’ti iminā.
This means "this method applies everywhere" to show that ease of comprehension of the meaning for some trainees is the reason for showing the simile first, similarly for showing the meaning first, for enveloping the meaning with a simile, and for enveloping the simile with meaning.
Sự dễ dàng thấu hiểu ý nghĩa đối với một số người cần được giáo hóa là lý do để chỉ ra ví dụ trước; cũng vậy, khi chỉ ra ý nghĩa trước, khi bao quanh ý nghĩa bằng ví dụ, và khi bao quanh ví dụ bằng ý nghĩa. (Kinh) chỉ ra ý nghĩa này bằng câu “điều này cũng vậy ở khắp mọi nơi”.
Dhammadhātuyāti sabbaññutaññāṇassa.
Of the Dhamma-element means of the Omniscient Knowledge.
Pháp giới (dhammadhātuyā): của trí tuệ toàn tri (sabbaññutaññāṇa).
Tañhi dhammadhātupariyāpannattā yathāvuttadhamme ca sabbepi ñeyyadhamme ca padahati yathāsabhāvato bujjhati bodheti cāti dhātu, dhīyanti vā dhammā etāya sabbākārato ñāyanti ñāpiyanti cāti dhammadhātu.
For it is included in the Dhamma-element, and it establishes the Dhamma as stated and all knowable dhammas, it understands and makes others understand their true nature, hence Dhātu. Or, the dhammas are held in it, and all knowable dhammas are known and made known by it in every way, hence dhammadhātu.
Vì trí tuệ toàn tri thuộc về pháp giới, nó nắm bắt tất cả các pháp đã nói và tất cả các pháp cần biết, nó thấu hiểu và làm cho người khác thấu hiểu bản chất của chúng, do đó gọi là giới (dhātu); hoặc các pháp được chứa đựng trong đó, tất cả các khía cạnh được biết và được làm cho biết, do đó gọi là pháp giới (dhammadhātu).
Tassā pana suṭṭhu saccasampaṭivedhavasena laddhattā suppaṭividdhattāti, yadaggena vā ñeyyaṃ tāya suppaṭividdhaṃ, tadaggena sāpissa suppaṭividdhā evāti āha ‘‘suppaṭividdhattā’’ti.
And since it is obtained by a thorough penetration of the truth, it is "thoroughly penetrated"; or, the knowable is thoroughly penetrated by it to the highest degree, and it is also thoroughly penetrated by the highest degree, therefore it is said, "thoroughly penetrated."
Vì nó được đạt đến bằng sự thấu hiểu chân lý một cách hoàn hảo, nên gọi là đã thấu hiểu hoàn hảo (suppaṭividdhattā); hoặc vì điều cần biết được thấu hiểu hoàn hảo bởi nó, nên nó cũng được thấu hiểu hoàn hảo, do đó (kinh) nói “đã thấu hiểu hoàn hảo”.
Pakatipariyodātassa cittassa āgantukehi upakkilesehi upakkiliṭṭhabhāvadassanatthaṃ saṃkiliṭṭhavatthadassananti katvā vuttaṃ ‘‘pakatiparisuddhaṃ vattha’’nti.
In order to show that the naturally pure mind is defiled by adventitious corruptions, it is said, by way of showing a defiled cloth, "a naturally pure cloth."
Để chỉ ra trạng thái tâm vốn trong sạch bị ô nhiễm bởi các cấu uế khách trần, (kinh) đã nói “y phục vốn trong sạch” bằng cách chỉ ra y phục bị ô nhiễm.
Rajādināti ettharajo nāma reṇu.
By dust and so forth: here, dust means fine powder.
Bụi bẩn v.v. (rajādinā): ở đây, bụi (rajo) có nghĩa là hạt bụi.
Ādi-saddena aṇutajjāridhūmādikaṃ vatthassa aparisuddhikāraṇaṃ saṅgaṇhāti.
The word "and so forth" includes tiny particles, dust, smoke, and other causes of impurity for a cloth.
Từ v.v. (ādi) bao gồm các nguyên nhân làm cho y phục không trong sạch như bụi mịn, khói v.v.
Sabbaso kilissati vinassati visuddhi etenāti saṃkileso, tena saṃkilesena paṃsurajādinā saṃkiliṭṭhaṃ vaṇṇavināsanena vidūsitaṃ.
Sankilesa is that by which purity is utterly defiled and destroyed; hence, "defiled by that defilement, by dust, fine powder, and so forth," meaning tainted by the destruction of its color.
Điều làm cho hoàn toàn ô nhiễm, hủy hoại sự trong sạch, là sự ô nhiễm (saṃkileso); do đó bị ô nhiễm bởi sự ô nhiễm, bởi bụi bẩn v.v. (saṃkilesena paṃsurajādinā saṃkiliṭṭhaṃ): bị hư hoại do làm mất màu.
Malaṃ masi.
Mala is soot.
Cặn bẩn (malaṃ): là bồ hóng.
Jallikā vuccati loṇapaṭalādi chaviyā upari ṭhitaṃ sarīramalaṃ.
Jallikā refers to body dirt, such as a layer of salt, residing on the skin.
Jallikā được gọi là chất bẩn trên da như lớp muối v.v. (mồ hôi khô).
Ādisaddena sarīrajallameva assukheḷasiṅghāṇikādikaṃ tadaññamalaṃ saṅgaṇhāti.
The word "and so forth" includes body dirt itself, as well as other impurities such as tears, phlegm, and snot.
Từ v.v. (ādi) bao gồm các chất bẩn khác của cơ thể như nước mắt, nước bọt, nước mũi v.v.
Gahitattāti pariyonandhanavasena gahitattā.
"Because it is seized" means because it is seized by enveloping.
Do bị bám vào (gahitattā): do bị bám vào theo cách bao phủ.
Rajanti sattā tenāti raṅgaṃ, raṅgameva raṅgajātaṃ yathā kopameva kopajātaṃ.
That by which one dyes is raṅga; raṅga itself is raṅgajāta, just as kopa itself is kopajāta.
Các chúng sinh bị nhuộm bởi nó nên gọi là màu nhuộm (raṅgaṃ), màu nhuộm chính là loại màu nhuộm (raṅgajātaṃ), giống như sự tức giận chính là loại tức giận.
Upanāmeyyāti pakkhipeyya.
Upanāmeyyā means would apply.
Cho vào (upanāmeyyā): bỏ vào.
Nīlakatthāyāti nīlavaṇṇatthāya.
For blue means for blue color.
Để có màu xanh (nīlakatthāyā): để có màu xanh lam.
Palāsanīlādiketi ādi-saddena kāḷasāmādiṃ saṅgaṇhāti.
By "palāsanīlādike" (blue from palāsa and so forth), the word "and so forth" includes black, dusky, and so forth.
Màu xanh lá cây v.v. (palāsanīlādike ti ādi): từ v.v. bao gồm màu đen, màu xám v.v.
Haliddikakudhaselādike pītakaraṅge.
In yellow dyes from turmeric, kudha, selā, and so forth.
Màu vàng (pītakaraṅge): như nghệ, cây kudha, cây sela v.v.
Lākhāpattaṅgarasādike lohitakaraṅge.
In red dyes from lac, paṭaṅga sap, and so forth.
Màu đỏ (lohitakaraṅge): như cánh kiến, nhựa cây pattaṅga v.v.
Mahārajanaloddakandulādike mandarattaraṅge.
In dull red dyes from great madder, lodda bark, kandula, and so forth.
Màu đỏ sẫm (mandarattaraṅge): như cây mahārajana, vỏ cây lodda, củ kandula v.v.
Duṭṭhu rajitavaṇṇaṃ apabhassaraṃ.
A badly dyed color is dim.
Màu bị nhuộm không tốt là màu không tươi sáng.
Tenāha ‘‘aparisuddhavaṇṇamevassā’’ti.
Therefore, it is said, "its color would be impure."
Do đó (kinh) nói “màu của nó sẽ không trong sạch”.
Īdisanti durattavaṇṇaṃ.
Such means a badly dyed color.
Như vậy (īdisaṃ): màu bị nhuộm xấu.
Tasmiṃ vatthe raṅgajātaṃ sayaṃ suparisuddhaṃ samānaṃ kissa hetu kena rattavaṇṇaṃ aparisuddhaṃ hotīti raṅgajātassa niddosataṃ vadati.
Why is the dye itself, though perfectly pure, impure in its red color on that cloth? He speaks of the blamelessness of the dye.
Trong y phục đó, loại màu nhuộm vốn rất trong sạch, tại sao lại có màu đỏ không trong sạch? (Kinh) nói về sự vô tội của loại màu nhuộm.
Tenāha ‘‘yasmā panā’’tiādi.
Therefore, it is said, "Because," and so forth.
Do đó (kinh) nói “vì” v.v.
Saṃkilesapakkhaṃ dassentena asaṃkiliṭṭhameva vatthaṃ udāharitabbanti pākaṭoyamattho, saṃkiliṭṭhavatthanidassanena pana ‘‘siyā nu kho aññopi koci viseso’’ti adhippāyena pucchati ‘‘kasmā panā’’tiādinā.
Since the defilement side is being shown, a defiled cloth should be cited as an example. This meaning is clear. However, by citing a defiled cloth, one asks, "Is there any other distinction?" with the intention of*, beginning with "But why?"
Ý nghĩa này rõ ràng là khi chỉ ra phe phiền não, phải nêu ví dụ về một tấm vải không nhiễm ô. Nhưng bằng cách nêu ví dụ về tấm vải bị nhiễm ô, người ta hỏi với ý định “liệu có sự khác biệt nào khác không?”, do đó nói “kasmā panā” (Tại sao lại) v.v.
Itaro atthavisesoti dassento ‘‘vāyāmamahapphaladassanattha’’ntiādimāha.
The other one, showing a distinction in meaning, said, beginning with "for the purpose of showing the great fruit of exertion."
Người khác, khi chỉ ra sự khác biệt về ý nghĩa, đã nói bắt đầu bằng câu "để cho thấy quả lớn của sự tinh tấn".
Ettha ca saṃkiliṭṭhacittavisodhanavidhāne saṃkiliṭṭhavatthaṃ nidassatabbanti paṭiññā, vāyāmamahapphaladassanatthanti hetuattho.
Here, the statement that a defiled cloth should be cited as an example in the method of purifying a defiled mind is a proposition, and "for the purpose of showing the great fruit of exertion" is the meaning of the reason.
Và ở đây, trong phương pháp thanh lọc tâm bị ô nhiễm, lời tuyên bố là chỉ ra đối tượng bị ô nhiễm, còn ý nghĩa của lý do là để cho thấy quả lớn của sự tinh tấn.
Yathā hītiādi anvayattho.
"Just as indeed" and so on is the affirmative meaning.
"Như là" v.v... là ý nghĩa thuận.
Na tattha jātikāḷake viyātiādi byatirekattho.
"Not like an inborn black stain there" and so on is the negative meaning.
"Không phải như vết đen bẩm sinh" v.v... là ý nghĩa nghịch.
Sadisūdāharaṇaṃ pana malaggahitakaṃsapātiādi daṭṭhabbaṃ.
A similar example, however, should be understood as a dirty bronze bowl and so on.
Ví dụ tương tự nên được hiểu là cái bát đồng bị dính bẩn v.v...
Evaṃ cittampītiādi opammatthassa upameyyaupanayanaṃ.
"Similarly, the mind" and so on is the application of the simile to the thing being compared.
"Tâm cũng vậy" v.v... là sự so sánh của ý nghĩa ví dụ.
Tattha pakatiyāti akittimena sabhāvena.
There, "by nature" means by its unartificial essence.
Ở đó, "pakatiyā" có nghĩa là theo bản chất tự nhiên, không do tạo tác.
Tanti cittaṃ.
That is the mind.
Đó là tâm.
Sāmaññaggahaṇañcetaṃ cittabhāvāvisesato.
And this is a general apprehension due to the non-distinction of mind-nature.
Và đây là sự nắm bắt chung do không có sự khác biệt về trạng thái tâm.
Tenāha ‘‘sakalepī’’ti.
Therefore, he said, "in all."
Do đó, Ngài nói "sakalepī" (trong tất cả).
Paṇḍarameva na saṃkiliṭṭhaṃ saṃkilesehi asamannāgatabhāvato.
Pure white is not defiled, due to its not being accompanied by defilements.
"Chỉ là trong sáng" chứ không bị ô nhiễm, vì không bị các phiền não ô uế chi phối.
Nanu kiriyāmayacittehi vipākasantāne visesādhānaṃ labbhati, aññathā katavināsā katabbhāgamā āpajjeyyuṃ?
Is it not the case that a distinction in the result-continuum is obtained from operative minds; otherwise, actions performed would be destroyed, and actions not performed would come to fruition?
Há không phải trong dòng tương tục của quả dị thục, sự thêm vào đặc biệt được chấp nhận từ các tâm hành động (kiriyā)? Nếu không, sẽ rơi vào trường hợp việc đã làm bị hủy diệt và việc chưa làm phải chịu quả.
Kiñcāpi labbhati, tassa saṃkileso vaṭṭupanissayo, asuddhi vā na hoti, asaṃkileso vivaṭṭupanissayo, visuddhi vā na hoti eva.
Although it is obtained, its defilement, which is a condition for vaṭṭa, or its impurity, does not exist; its undefilement, which is a condition for vivaṭṭa, or its purity, does not exist either.
Mặc dù được chấp nhận, nhưng sự ô nhiễm của nó không phải là nhân duyên cho vòng luân hồi, hay sự bất tịnh. Sự không ô nhiễm không phải là nhân duyên cho sự thoát ly, hay sự thanh tịnh.
Upakkiliṭṭhanti panetaṃ upakkilesanārahassa cittassa vasena vuttaṃ, na vipākapabandhassa.
However, "defiled" is said with reference to a mind capable of being defiled, not with reference to the result-continuum.
Tuy nhiên, từ "upakkiliṭṭha" (bị nhiễm ô) này được nói theo nghĩa của tâm có thể bị nhiễm ô, chứ không phải của dòng tương tục dị thục.
Tenāha ‘‘pabhassaramidaṃ bhikkhave citta’’nti, ‘‘paṇḍaramevā’’ti ca.
Therefore, he said, "Monks, this mind is luminous," and "pure white."
Do đó, Ngài nói "Này các Tỳ-khưu, tâm này rạng rỡ" và "chỉ là trong sáng".
Tañca khoti pana sakasantatipariyāpannatāya nesaṃ kevalaṃ ekattanayavasena vuttaṃ, na vipākadhammānaṃ kilesāsamaṅgibhāvato.
However, "that too" is said solely by way of unity, because it belongs to one's own continuum, not because resultant phenomena are without defilements.
Tuy nhiên, "Tañca kho" này được nói theo nghĩa chỉ là một cách duy nhất do thuộc dòng tương tục của tự thân, chứ không phải do các pháp dị thục không bị phiền não chi phối.
Atha vā upakkiliṭṭhanti iminā upakkilesahetu tattha vijjamānaṃ visesādhānamāha, na ‘‘saṃkiliṭṭhā dhammā’’tiādīsu (dha. sa. 77.dukamātikā) viya taṃsamaṅgitanti daṭṭhabbaṃ.
Alternatively, by "defiled," it refers to the special condition existing there as a cause of defilement, and should not be understood as "accompanied by defilements" as in phrases like "defiled phenomena" and so on.
Hoặc, nên hiểu rằng với từ "upakkiliṭṭha" này, Ngài nói về sự thêm vào đặc biệt có mặt ở đó do nhân duyên của phiền não, chứ không phải sự chi phối của nó như trong "các pháp bị ô nhiễm" v.v... (dha. sa. 77.dukamātikā).
Visodhiyamānanti vipassanāpaññāya anukkamena sabbupakkilesehi vimociyamānaṃ.
Being purified means being gradually freed from all defilements by wisdom of insight.
"Visodiyamāna" (đang được thanh lọc) có nghĩa là đang được giải thoát dần dần khỏi tất cả các phiền não bằng tuệ quán.
Sakkā aggamaggakkhaṇe pabhassarataraṃ kātuṃ, yato na puna upakkilissati.
It is possible to make it more luminous at the moment of the highest path, because it will not be defiled again.
"Sakkā" (có thể) "kātuṃ pabhassarataraṃ" (làm cho rạng rỡ hơn) vào khoảnh khắc của đạo tối thượng, vì nó sẽ không bị nhiễm ô trở lại.
Evantiādi vuttassevatthassa nigamanaṃ.
Thus and so on is the conclusion of the meaning that has been stated.
"Evaṃ" v.v... là sự kết luận của ý nghĩa đã nói.
Duṭṭhagatiparipūraṇavasena paṭipajjanaṃ paṭipatti.
Performing* by way of completing a bad destination is conduct (paṭipatti).
Sự thực hành để hoàn thành ác nghiệp được gọi là "paṭipatti" (thực hành).
Sā eva kilesadarathapariḷāhādivasena upāyāsadukkhā, kucchitā vā gati pavatti, duggatihetūti vā duggati, duggatiyā pana paṭipattiyā gandhabbato, tassā vā nipphannabhāvato kucchito, dukkhā ca gatīti duggati.
That itself is suffering due to mental anguish and feverishness, or bad conduct, or a cause of a bad destination; this is duggati. However, because duggati is entered by conduct, or because it is the outcome of it, it is called duggati as a bad, painful destination.
Chính sự thực hành đó là "duggati" (ác thú/khổ cảnh) do là sự đau khổ của sự buồn rầu, phiền não, nhiệt não v.v... hoặc là sự thực hành xấu xa, hoặc là nguyên nhân của ác thú. Tuy nhiên, "duggati" còn có nghĩa là cảnh giới xấu xa, đau khổ do sự thực hành ác thú được tạo ra bởi gandhabba (thân trung ấm), hoặc do sự hoàn thành của nó.
Saṃkiliṭṭhacittoti idaṃ tassā paṭipattiyā duggatibhāvadassanatthaṃ, na visesanatthaṃ.
"With a defiled mind" is for the purpose of showing the bad destination aspect of that conduct, not for the purpose of qualifying it.
"Saṃkiliṭṭhacitto" (với tâm bị ô nhiễm) này là để chỉ ra trạng thái ác thú của sự thực hành đó, chứ không phải để làm tính từ.
Na hi asaṃkiliṭṭhacittassa pāṇaghātādivasena pavatti.
For conduct, such as taking life, does not occur with an undefiled mind.
Thật vậy, không có sự thực hành giết hại v.v... của người có tâm không bị ô nhiễm.
Saṃkiliṭṭhacittoti lābhāsāya sabbaso kiliṭṭhacitto.
"With a defiled mind" means a mind completely defiled by the desire for gain.
"Saṃkiliṭṭhacitto" có nghĩa là tâm hoàn toàn bị ô nhiễm vì mong cầu lợi lộc.
Dūteyyapahiṇagamananti dūteyyaṃ vuccati dutakammaṃ, gihīnaṃ paṇṇaṃ vā sāsanaṃ vā gahetvā tattha tattha gamanaṃ, pahiṇagamanaṃ gharāgharaṃ pesitassa khuddakagamanaṃ, dūteyyagamanaṃ pahiṇagamanañca gacchati.
"Going on errands and messages": dūteyyaṃ refers to the work of an envoy, which is taking letters or messages from householders and going here and there. Pahiṇagamanaṃ is minor going when sent from house to house. Both dūteyya and pahiṇagamana are forms of going.
"Dūteyyapahiṇagamanaṃ" có nghĩa là "dūteyya" là công việc của người đưa tin, là việc mang thư hoặc thông điệp của gia chủ đi đây đi đó. "Pahiṇagamanaṃ" là việc đi lại nhỏ nhặt khi được sai đi từ nhà này sang nhà khác. "Dūteyyagamanaṃ" và "pahiṇagamanaṃ" đều là việc đi lại.
Vejjakammanti ananuññāte ṭhāne lābhāsāya gahaṭṭhānaṃ bhesajjaṃ karoti.
"Medical practice" means performing medical treatment for householders in an unauthorized place for the sake of gain.
"Vejjakammaṃ" (nghề y) là làm thuốc cho gia chủ vì mong cầu lợi lộc ở nơi không được phép.
Saṅghabhedakathā parato āgamissati.
The discussion on schism in the Sangha will come later.
Câu chuyện về "Saṅghabheda" (chia rẽ Tăng đoàn) sẽ được nói đến sau.
Veḷudānādīhīti veḷudānapattadānapupphadānādīhi micchājīvena jīvikaṃ kappeti.
"By offering bamboos, etc.": by offering bamboos, offering leaves, offering flowers, etc., he maintains his livelihood through wrong livelihood.
"Veḷudānādīhi" (bằng cách cúng dường tre v.v...) là "jīvikaṃ kappeti" (nuôi mạng sống) bằng tà mạng, như cúng dường tre, lá, hoa v.v...
Sakalampīti ‘‘atthi anācāro, atthi agocaro’’tiādinā vibhaṅge (vibha. 513, 514) āgataṃ sabbampi anācāraṃ agocarañca caraṇavasena paripūreti.
"All of it" means he fulfills all misconduct and improper resorts mentioned in the Vibhaṅga (Vibha. 513, 514) as "there is misconduct, there is improper resort" through his way of living.
"Sakalampī" (tất cả) có nghĩa là hoàn thành tất cả các hành vi không đúng đắn và không phải chỗ hành xử như đã nói trong "Vibhaṅga" (vibha. 513, 514) với câu "có sự không đúng đắn, có sự không phải chỗ hành xử".
Sukkapakkhe parisuddhanti sabbaso visuddhaṃ asaṃkiliṭṭhaṃ.
On the side of purity, "pure" means completely pure, undefiled.
Trong phần trắng, "parisuddhaṃ" (hoàn toàn thanh tịnh) có nghĩa là hoàn toàn trong sạch, không bị ô nhiễm.
Parisuddhattā eva pariyodātaṃ, pabhassaranti attho.
Because it is pure, it is luminous, meaning resplendent.
Do hoàn toàn thanh tịnh nên "pariyodātaṃ" (trong sáng), có nghĩa là rạng rỡ.
Surattavaṇṇamevassāti suṭṭhu rattavaṇṇameva assa.
"Its color is bright red" means its color is indeed very red.
"Surattavaṇṇamevassā" có nghĩa là màu đỏ thắm của nó.
Parisuddhavaṇṇamevassāti nīlavaṇṇopissa parisuddho ca bhaveyyāti evamādiṃ sandhāyāha ‘‘kaṇhapakkhe vuttapaccanīkeneva veditabbā’’ti.
"Its color is pure": implying that its blue color also becomes pure, and so on. In this vein, he said, "should be understood as the opposite of what was stated for the dark side."
"Parisuddhavaṇṇamevassā" có nghĩa là màu xanh của nó cũng trong sạch, và tương tự như vậy, Ngài nói "nên hiểu bằng cách ngược lại với những gì đã nói trong phần đen".
Raṅgajātantiādi pana tattha vuttavaseneva veditabbaṃ.
"Dyeing" and so on, however, should be understood in the way it was stated there.
"Raṅgajāta" v.v... nên được hiểu theo cách đã nói ở đó.
Paṭipattisugatiādīsu yaṃ vattabbaṃ, taṃ paṭipattiduggatiādīsu vuttavipariyāyena veditabbaṃ.
Whatever needs to be said regarding conduct to a good destination and so on, should be understood as the opposite of what was said regarding conduct to a bad destination and so on.
Những gì cần nói về "paṭipattisugati" (thực hành thiện thú) v.v... nên được hiểu theo cách ngược lại với những gì đã nói về "paṭipattiduggati" (thực hành ác thú) v.v...
Parisuddhacittoti suddhāsayo.
"With a pure mind" means with a pure intention.
"Parisuddhacitto" (tâm thanh tịnh) có nghĩa là ý hướng trong sạch.
Dasa kusalakammapathe paripūretīti idaṃ kaṇhapakkhe ‘‘dasa akusalakammapathe paripūretī’’ti vuttassa paṭipakkhadassanavasena vuttaṃ.
"He fulfills the ten wholesome courses of action" is said by way of showing the opposite of what was stated on the dark side: "He fulfills the ten unwholesome courses of action."
"Dasa kusalakammapathe paripūretī" (hoàn thành mười thiện nghiệp đạo) này được nói để chỉ ra mặt đối lập với "hoàn thành mười bất thiện nghiệp đạo" đã nói trong phần đen.
Yathā hi tattha abhijjhābyāpādamicchādiṭṭhiggahaṇena kammapathasaṃsandananayena kammapathaṃ appattāya ca agāriyassa tathārūpāya micchāpaṭipattiyā saṅgaho icchito, evaṃ idhāpi anabhijjhāabyāpādasammādiṭṭhiggahaṇena alobhādosāmohavasena pavattā agāriyassa sammāpaṭipatti saṅgahitāti daṭṭhabbaṃ, na kammapathappattāvāti.
Just as there, by taking covetousness, ill-will, and wrong view, and by the method of correlating them with courses of action, a householder's wrong conduct of that nature, even if it has not reached the course of action, is intended to be included, so too here, by taking non-covetousness, non-ill-will, and right view, the householder's right conduct proceeding by way of non-greed, non-hatred, and non-delusion is to be understood as included, not merely as having attained the course of action.
Như ở đó, việc nắm giữ tham lam, sân hận, tà kiến, và việc thu thập sự thực hành sai lầm như vậy của gia chủ, không đạt đến nghiệp đạo theo cách so sánh nghiệp đạo, được mong muốn. Tương tự, ở đây cũng vậy, sự thực hành đúng đắn của gia chủ, phát sinh do không tham lam, không sân hận, chánh kiến, do không tham, không sân, không si, được bao gồm, chứ không phải là sự đạt đến nghiệp đạo.
Manussamahantatanti jātirūpabhogādhipateyyādivasena manussesu mahantabhāvaṃ.
"Greatness among humans" means being great among humans by way of birth, form, possessions, authority, and so on.
"Manussamahantataṃ" (sự vĩ đại của loài người) là sự vĩ đại trong loài người về mặt địa vị, sắc đẹp, tài sản, quyền lực v.v...
Dasahi ṭhānehi aññesaṃ devānaṃ abhibhavo devamahantatā.
The superiority over other deities by ten aspects is "greatness among devas."
Sự vượt trội của mười vị trời khác là "devamahantatā" (sự vĩ đại của chư thiên).
Paṭipatti sugatiyā bhājiyamānattā ‘‘anāgāmimaggaṃ bhāvetī’’ti tathā anāgāmibhāvanaṃ pāpetvā ṭhapitā.
Since conduct is related to a good destination, "he develops the Anāgāmi path" is stated, establishing the development of the Anāgāmi state in that way.
Do sự thực hành thiện thú được phân chia, "anāgāmimaggaṃ bhāvetī" (tu tập đạo Bất Hoàn) được đặt ra như vậy, sau khi đã đạt được sự tu tập Bất Hoàn.
Gahitaggahaṇena sukhānubhavaṭṭhānassa adhippetattā tadabhāvato asaññibhavaṃ anādiyanto ‘‘dasasu vā brahmabhavanesū’’tiādimāha.
Since the apprehension of the taken implies a place of experiencing happiness, and therefore the absence of such, without considering the non-percipient existence, he said, "or in the ten Brahma realms" and so on.
Do sự nắm giữ được ý nghĩa của nơi trải nghiệm hạnh phúc, nên không chấp nhận trạng thái vô tưởng do không có điều đó, Ngài nói "hoặc trong mười cõi Phạm thiên" v.v...
71. Sakabhaṇḍe chandarāgo abhijjhāyanaṭṭhena abhijjhā, abhijjhāyanāti attho.
71. Desire-and-lust for one's own possessions is covetousness (abhijjhā) in the sense of desiring, meaning the act of coveting.
71. "Sakabhaṇḍe chandarāgo" (tham ái đối với tài sản của mình) là "abhijjhā" (tham lam) theo nghĩa tham muốn, tức là sự tham muốn.
Parabhaṇḍe chandarāgo visamaṃ lubbhatīti visamalobho.
Desire-and-lust for others' possessions is improper greed because one craves improperly.
"Parabhaṇḍe chandarāgo" (tham ái đối với tài sản của người khác) là "visamalobho" (tham lam bất chính) vì tham muốn một cách không công bằng.
Evampi abhijjhāvisamalobhānaṃ viseso hotīti dassento ‘‘atha vā’’tiādimāha.
Thus, showing that there is a distinction between abhijjhā and visamalobha, he said, "Alternatively," and so on.
Để chỉ ra rằng có sự khác biệt giữa tham lam và tham lam bất chính như vậy, Ngài nói "hoặc là" v.v...
Tattha attano santakaṃ taṃsadisañca yuttaṭṭhānaṃ.
There, one's own property and similar things are suitable objects.
Ở đó, "yuttaṭṭhānaṃ" (chỗ thích hợp) là tài sản của mình và những thứ tương tự.
Yaṃ yācitaṃ, appakasirena vā sakkā laddhuṃ, taṃ pattaṭṭhānaṃ.
What is sought, or what can be obtained with little difficulty, is an obtainable object.
"Pattaṭṭhānaṃ" (chỗ đã đạt được) là những gì đã được yêu cầu, hoặc có thể đạt được một cách dễ dàng.
Paradāragarudārāti ayuttaṭṭhānaṃ.
Another's wife, a guru's wife, are unsuitable objects.
Vợ người khác, vợ thầy v.v... là "ayuttaṭṭhānaṃ" (chỗ không thích hợp).
Yaṃ apatthaniyaṃ, yassa vā patthanāya byasanaṃ āpajjati, taṃ appattaṭṭhānaṃ.
What is not to be wished for, or wishing for which leads to misfortune, is an unobtainable object.
Những gì không nên mong muốn, hoặc việc mong muốn nó sẽ dẫn đến tai họa, đó là "appattaṭṭhānaṃ" (chỗ chưa đạt được).
Theroti mahāsaṅgharakkhitatthero, yena aṭṭhakathā potthakaṃ āropitā.
The Elder refers to Mahāsaṅgharakkhita Thera, by whom the Commentary was written down.
"Thero" (Trưởng lão) là "Mahāsaṅgharakkhitatthero" (Trưởng lão Mahāsaṅgharakkhita), người đã ghi chép "Aṭṭhakathā" (Chú giải) vào sách.
So hi antevāsikesu sākacchantesu evamāha.
For he spoke thus when discussing with his disciples.
Thật vậy, Ngài đã nói như vậy khi đàm luận với các đệ tử.
Sopi imasmiṃyeva sutte vinibbhogo na labbhati cittasaṃkilesassa adhippetattā.
Even in this Sutta, such a distinction is not obtained, as the defilement of the mind is what is intended.
Ngay cả trong kinh này, sự phân biệt đó cũng không được chấp nhận vì ý nghĩa là sự ô nhiễm của tâm.
Tenāha ‘‘yutte vā’’tiādi.
Therefore, he said, "whether suitable or not," and so on.
Do đó, Ngài nói "yutte vā" (hoặc là thích hợp) v.v...
Ayonisomanasikāravasena uppajjanato sampatti āyatiñca dukkhasseva uppādanato na koci lobho avisamo nāma.
Since it arises from unwise attention, and since it produces suffering in the present and future, no greed is not improper.
Do phát sinh từ sự tác ý không như lý, và do tạo ra khổ đau trong hiện tại và tương lai, "na koci lobho avisamo nāma" (không có tham lam nào là không bất chính).
Abhijjhāyanaṭṭhenāti yassa kassaci ārammaṇassa yuttassa ayuttassa appattassa ca abhijjāyanavasena abhipatthanāvasena ca pavattā taṇhā abhijjhāti lobhato nibbisesanti dasseti.
By way of coveting: It shows that the craving arising by way of coveting and longing for any object, whether proper or improper, or not yet obtained, is "covetousness" (abhijjhā), and is no different from greed (lobha).
Theo nghĩa tham muốn (abhijjhāyanaṭṭhena) có nghĩa là sự tham ái phát sinh do tham muốn hay khao khát bất kỳ đối tượng nào, dù thích hợp hay không thích hợp, hay không thể đạt được, cho thấy rằng tham muốn (abhijjhā) không khác gì tham lam (lobha).
Tenāha ‘‘ekatthametaṃ byañjanameva nāna’’nti.
Therefore, it is said: "This is one in meaning, only the expression is different."
Do đó, đã nói: “Đây là một nghĩa, chỉ khác nhau về cách diễn đạt.”
Dūsetīti sabhāvasantaṃ asaṃkilesaṃ vināseti avisuddhaṃ karoti.
"It corrupts" means it destroys its naturally existing undefiled state and makes it impure.
Làm ô nhiễm (dūsetī) nghĩa là hủy hoại sự thanh tịnh vốn có, làm cho nó trở nên không trong sạch.
Tenāha ‘‘obhāsituṃ na detī’’ti.
Therefore, it is said: "it does not allow to shine forth."
Do đó, đã nói: “Nó không cho phép chiếu sáng.”
‘‘Ime sattā ucchijjantu vinassantū’’ti sattesu byāpajjanākārappavattiyā byāpādo navavidhaāghātavatthusambhavo vutto.
The arising of the mode of malevolence towards beings, saying, "May these beings be cut off, may they perish," is declared to be "ill-will" (byāpāda), which arises from the nine grounds of resentment.
Ác ý (byāpādo) được nói là phát sinh từ chín căn bản thù hận (navavidhaāghātavatthusambhavo) do sự phát khởi của ý muốn làm hại chúng sinh, như “mong cho những chúng sinh này bị hủy diệt, bị tiêu vong”.
Kodho pana saṅkhāresupi pavattanato dasavidhaāghātavatthusambhavo vutto.
Anger (kodha), however, is declared to arise from the ten grounds of resentment, because it can also occur towards formations.
Còn sân hận (kodho) được nói là phát sinh từ mười căn bản thù hận do nó phát sinh ngay cả đối với các hành (saṅkhāra).
Ubhayampi paṭighameva, pavattanānattato bhinditvā vutto.
Both are resentment (paṭigha) but are distinguished due to the difference in their mode of arising.
Cả hai đều là sự thù hận (paṭigha) nhưng được nói khác nhau do sự khác biệt trong cách phát sinh.
Kujjhanavaseneva cittapariyonandhano ‘‘akkocchi maṃ avadhi ma’’ntiādinā.
"That which binds the mind" (cittapariyonandhana) is by way of getting angry, thinking, "He abused me, he struck me," and so on.
Sự trói buộc tâm (cittapariyonandhano) chỉ theo cách sân hận, như “nó mắng chửi tôi, nó đánh tôi”, v.v.
Suṭṭhu kataṃ karaṇaṃ sukataṃ, tassa pubbakāritālakkhaṇassa guṇassa vināsano udakapuñchaniyā viya sarīrānugataṃ udakaṃ puñchanto makkho.
"Well-done" (sukataṃ) is a good deed; "disparagement" (makkha) is that which destroys this quality of being a doer of good deeds, just as wiping something off the body, like water by a wiping cloth.
Hành động tốt đẹp là việc làm thiện (sukata), sự che giấu (makkho) là sự hủy hoại phẩm chất mang đặc tính của người làm điều thiện trước đó, giống như người dùng khăn lau nước dính trên thân thể.
Tathā hi so paresaṃ guṇānaṃ makkhanaṭṭhena ‘‘makkho’’ti vuccati.
Thus, it is called "disparagement" (makkha) because it disparages the good qualities of others.
Thật vậy, nó được gọi là “che giấu” (makkho) theo nghĩa che giấu phẩm chất của người khác.
Idāni anagāriyassa vātiādinā saṅkhepena vuttatthaṃ vitthārena dassetuṃ ‘‘anagāriyopī’’tiādi vuttaṃ.
Now, in order to elaborate on what was stated briefly with "for a homeless one" (anagāriyassa vā) and so on, it is said, "even for a homeless one" (anagāriyopī) and so on.
Bây giờ, để trình bày chi tiết ý nghĩa đã được nói tóm tắt bằng “của người không gia đình” (anagāriyassa vā), v.v., đã nói “người không gia đình cũng vậy” (anagāriyopī), v.v.
Nisinnakathāparikathādivasena dhammassa kathā dhammakathānayo, ekattādidhammanīti eva vā.
The method of Dhamma-talk is a discourse on the Dhamma by way of seated conversations and other talks, or it is simply the principle of the Dhamma regarding unity and so on.
Cách nói về giáo pháp (dhamma) là cách nói về giáo pháp theo cách ngồi đàm luận, v.v., hoặc chỉ là phương pháp giáo pháp về sự đồng nhất, v.v.
Pakaraṇaṃ satta pakaraṇāni, tattha kosallaṃ dhammakathānayapakaraṇakosallaṃ.
The pakaraṇa refers to the seven treatises; skill therein is "skill in the method of Dhamma-talk and treatises" (dhammakathānayapakaraṇakosallaṃ).
Bộ luận (pakaraṇa) là bảy bộ luận, sự khéo léo trong đó là sự khéo léo trong phương pháp nói về giáo pháp và các bộ luận (dhammakathānayapakaraṇakosallaṃ).
Ādi-saddena vinayakkame catūsu mahānikāyesu ca kosallaṃ saṅgaṇhāti.
The word "and so on" (ādi) includes skill in the order of the Vinaya and the four great Nikāyas.
Với từ “vân vân” (ādi), bao gồm sự khéo léo trong trình tự giới luật (vinaya) và trong bốn bộ Nikāya lớn.
Acittīkatoti cittīkārarahito.
"Unesteemed" (acittīkato) means devoid of esteem.
Không được tôn trọng (acittīkato) nghĩa là không có sự tôn trọng.
Yathā cāyanti iminā yathāyaṃ makkho cittaṃ dūseti, evaṃ paḷāsopi cittaṃ dūseti, tasmā upakkilesoti dasseti.
"And as this" (yathā cāyaṃ) indicates that just as this disparagement corrupts the mind, so too does denigration corrupt the mind; therefore, it is a defilement.
Và như thế này (yathā cāyaṃ) cho thấy rằng, giống như sự che giấu này làm ô nhiễm tâm, sự bất kính (paḷāsa) cũng làm ô nhiễm tâm, do đó nó là một cấu uế.
Aniyatā gati niyāmokkamanābhāvato.
"Undefined" (aniyatā) is the destination (gati), due to the absence of a fixed course.
Sự tái sinh không cố định (aniyatā gati) là do không có sự thoát ly khỏi quy luật.
Ādi-saddena ‘‘rattaññū cirapabbajite puggale ajjhottharitvā ‘tvampi imasmiṃ sāsane pabbajito, ahampi pabbajito, tvampi sīlamatte ṭhito ahampī’ti’’ evamādīnaṃ saṅgaho.
The word "and so on" (ādi) includes such statements as, "when one who has been ordained for a long time, an old hand, is slighted: 'You too are ordained in this dispensation, and I too am ordained; you too are established in mere virtue, and I too am so'."
Với từ “vân vân” (ādi), bao gồm các trường hợp như “người đã xuất gia lâu năm, đã biết đêm, lại tự cho mình ngang hàng với người khác mà nói rằng ‘ông cũng xuất gia trong giáo pháp này, tôi cũng xuất gia, ông cũng giữ giới, tôi cũng vậy’”.
Yugaggāhagāhīti ‘‘tava vā mama vā ko viseso’’ti asamampi samaṃ katvā samadhuraggāhagaṇhanako.
"One who takes hold of the yoke" (yugaggāhagāhī) is one who, making the unequal equal, saying, "What difference is there between you and me?", takes hold of an equal burden.
Người nắm giữ ách cân bằng (yugaggāhagāhī) là người nắm giữ ách cân bằng, làm cho cái không bằng nhau trở nên bằng nhau, như “ông hay tôi có gì khác biệt?”
Khīyanā usūyanā.
"Slight" (khīyanā) is envy.
Sự chê bai (khīyanā) là sự đố kỵ.
Attano sampattiyā nigūhanaṃ tassa parehi sādhāraṇabhāvāsahanena hotīti ‘‘parehi sādhāraṇabhāvaṃ asahamānaṃ’’icceva vuttaṃ.
The concealment of one's own attainments occurs due to an inability to bear their commonality with others; hence, it is said, "unable to bear their commonality with others."
Sự che giấu thành tựu của mình là do không chịu nổi việc người khác chia sẻ, vì vậy đã nói “không chịu nổi việc người khác chia sẻ” (parehi sādhāraṇabhāvaṃ asahamānaṃ).
Kāraṇe hi gahite phalampi gahitameva hotīti.
For when the cause is taken, the result is also taken.
Vì khi nguyên nhân được nắm giữ thì kết quả cũng được nắm giữ.
Aññathā attano pavedanakapuggalo kerāṭiko, ‘‘nekatikavāṇijo’’tipi vadanti.
Otherwise, the person who declares himself is a "deceiver" (kerāṭika); some also call him a "deceitful merchant."
Người tự mình tiết lộ (attano pavedanakapuggalo) là kẻ lừa đảo (kerāṭiko), cũng được gọi là “thương nhân xảo quyệt”.
Sappamukhā macchavālā ekā macchajāti āyatanamaccho.
Snakeskin-headed fish-whiskers are a type of fish called āyatana-fish.
Cá sấu (sappamukhā), cá có lông (macchavālā) là một loại cá, cá āyatana.
Tenāha ‘‘āyatanamaccho nāmā’’tiādi.
Therefore, it is said, "is a kind of āyatana-fish," and so on.
Do đó, đã nói: “Tên là cá āyatana” (āyatanamaccho nāmā), v.v.
Baddhacaroti antevāsī.
"Bound to wander" (baddhacaro) means a pupil.
Người bị trói buộc (baddhacaro) là đệ tử.
Sabbaso amadditasabhāvena vā tabharitabhattasadisassa thaddhabhāvassa anonamitadaṇḍasadisatāya paggahitasiraanivātavuttikārassa ca karaṇato vā tabharita…pe… karaṇo.
Or, by doing that which is absolutely unyielding in nature, or by doing that which resembles stiff rice, or by causing one to be unbending like an unyielding staff with raised veins and no movement—thus, "or, by causing that which resembles stiff rice," and so on.
Hoặc là làm cho (vā tabharita…pe… karaṇo) do bản chất hoàn toàn không bị nghiền nát, hoặc do làm cho cứng rắn như cơm đầy, hoặc do làm cho không cong như cây gậy không cong, hoặc do làm cho tĩnh lặng như tĩnh mạch không rung động.
Taduttarikaraṇoti yaṃ yena kataṃ duccaritaṃ vā sucaritaṃ vā, taduttari, tassa dviguṇaṃ vā karaṇo.
"One who does more than that" (taduttarikaraṇo) means one who does more than that, or double, the bad or good deed committed by another.
Người làm hơn thế nữa (taduttarikaraṇo) là người làm gấp đôi điều thiện hay điều ác mà người khác đã làm.
Attano maṇḍanādiatthaṃ parena kataṃ alaṅkārādiṃ.
"Decoration and so on done by another" (parena kataṃ alaṅkārādiṃ) for the purpose of one's own adornment and so on.
Đồ trang sức, v.v., do người khác làm (parena kataṃ alaṅkārādiṃ) để tự trang điểm, v.v.
Pariyāpuṇāti vā katheti vā attano balānurūpaṃ.
"He learns or he declares" (pariyāpuṇāti vā katheti vā) according to his own strength.
Hoặc học thuộc lòng hoặc giảng giải (pariyāpuṇāti vā katheti vā) tùy theo khả năng của mình.
Kāmaṃ nikāyadvayaggahaṇādivasena pavatto sevitabbamāno eva, tathāpissa saṃkilesapakkhattā vuttaṃ ‘‘mānaṃ anissāyā’’ti.
Although the honor that arises by way of embracing the two collections and so on is māna, yet it is said, "without relying on conceit" (mānaṃ anissāyā), because it belongs to the side of defilement.
Mặc dù sự kiêu mạn (māna) phát sinh do việc nắm giữ hai bộ Nikāya, v.v., là sự kiêu mạn cần được thực hành, nhưng vì nó thuộc về phe cấu uế, nên đã nói “không dựa vào kiêu mạn” (mānaṃ anissāyā).
Tasmā lobhamādiṃ katvā dassetīti lobhassa ādito gahaṇe kāraṇaṃ vibhāvetukāmo pucchati.
"Therefore, he shows by taking greed as the beginning" (tasmā lobhamādiṃ katvā dassetī) means he asks, intending to explain the reason for beginning with greed.
Do đó, bắt đầu bằng tham lam để trình bày (tasmā lobhamādiṃ katvā dassetī) nghĩa là muốn làm rõ lý do tại sao tham lam được đặt ở đầu tiên, nên hỏi.
Paṭhamuppattitoti tattha tattha bhave sabbapaṭhamaṃ uppajjanato.
"From its first arising" (paṭhamuppattito) means because it is the very first to arise in each and every existence.
Do sự phát sinh đầu tiên (paṭhamuppattito) nghĩa là do sự phát sinh đầu tiên trong mỗi kiếp sống.
Sattānañhi yathādhigataṃ jhānādivisesaṃ ārabbha paccavekkhaṇā viya yathāladdhaṃ upapatibhavaṃ ārabbha nikanti eva.
Just as for beings there is retrospection regarding the attainments of jhāna and so on, so too there is attachment (nikanti) regarding the existence obtained, just as it was attained.
Đối với chúng sinh, giống như sự quán xét về những đặc điểm thiền định, v.v., đã đạt được, thì sự ham muốn (nikanti) cũng vậy đối với kiếp sống tái sinh đã đạt được.
Tenāha ‘‘sabbasattāna’’ntiādi.
Therefore, it is said, "of all beings," and so on.
Do đó, đã nói: “của tất cả chúng sinh” (sabbasattāna), v.v.
Yathāsambhavaṃ itareti itare byāpādādayo yathāpaccayaṃ uppajjanti, lobhassa viya ādito asukassa anantaraṃ asukoti vā na nesaṃ niyamo atthīti attho.
"The others as they arise" (yathāsambhavaṃ itare) means the other defilements such as ill-will and so on arise according to their conditions; it means there is no fixed rule for them, such as this one after that one, as there is for greed.
Những cái khác tùy theo sự phát sinh (yathāsambhavaṃ itare) nghĩa là những cái khác như ác ý, v.v., phát sinh tùy theo duyên, không có quy luật nào cho chúng như tham lam, chẳng hạn như cái này sau cái kia.
Kiṃ pana ete soḷaseva cittassa upakkilesā, udāhu aññepi santīti anuyogaṃ sandhāya aññepi santīti dassento ‘‘na ca ete’’tiādimāha.
If it is asked whether there are only these sixteen defilements of the mind, or if there are others, it is said, "not only these," and so on, indicating that there are others.
Nếu vậy, có phải chỉ có mười sáu cấu uế này của tâm, hay còn có những cái khác nữa? Để trả lời câu hỏi này, cho thấy rằng còn có những cái khác nữa, nên nói “và không phải chỉ những cái này” (na ca ete), v.v.
Yadi evaṃ kasmā ettakā eva idha vuttāti.
If so, why are only these mentioned here?
Nếu vậy, tại sao chỉ có bấy nhiêu được nói ở đây?
Nayadassanavasenāti dassento āha ‘‘etena pana…pe… veditabbā’’ti.
Indicating that it is by way of showing the method, it is said, "by this, however... it should be understood."
Để cho thấy rằng đó là theo cách trình bày, nên nói: “Nhưng với điều này…pe… cần phải hiểu.”
Tena thinamiddhauddhaccakukkucca-vicikicchā-attukkaṃsana-paravabbhanachambhitattā- bhīrukatā-ahirikānottappa-atticchatā-pāpicchatā-mahicchatādayo saṅgahitāti veditabbaṃ.
It should be understood that by this are included sloth and torpor, restlessness and remorse, doubt, self-exaltation, denigration of others, timidity, fearfulness, shamelessness, fearlessness, excessive desires, evil desires, great desires, and so on.
Cần phải hiểu rằng với điều đó, các cấu uế như hôn trầm, thụy miên, trạo cử, hối hận, hoài nghi, tự đề cao, hạ thấp người khác, sợ hãi, nhút nhát, vô tàm, vô quý, tham lam quá mức, ác dục, đại dục, v.v., đã được bao gồm.
72. Saṃkilesaṃ dassetvāti saṃkiliṭṭhavattanidassanena saṅkhepena vuttaṃ saṃkilesaṃ vibhāgena dassetvā.
"Having shown the defilements" (saṃkilesaṃ dassetvā) means having shown the defilements stated briefly by demonstrating their defiled nature in detail.
72. Sau khi trình bày sự cấu uế (saṃkilesaṃ dassetvā) nghĩa là sau khi trình bày chi tiết sự cấu uế đã được nói tóm tắt bằng cách trình bày hành vi cấu uế.
Vodānaṃ dassentoti etthāpi eseva nayo.
The same method applies here for "showing the purification" (vodānaṃ dassento).
Khi trình bày sự thanh tịnh (vodānaṃ dassento) cũng theo cách tương tự.
Evaṃ jānitvāti ‘‘abhijjhā visamalobho ekanteneva cittassa uppakkileso’’ti sabhāvato samudayato nirodhato nirodhūpāyato ca pubbabhāgapaññāya ceva heṭṭhimamaggadvayapaññāya ca jānitvā.
"Having thus known" (evaṃ jānitvā) means having known "covetousness and unrighteous greed are absolutely defilements of the mind" by means of preliminary wisdom and the wisdom of the lower two paths, regarding their nature, origin, cessation, and the path to cessation.
Sau khi biết như vậy (evaṃ jānitvā) nghĩa là sau khi biết bằng tuệ phần trước (pubbabhāgapaññā) và tuệ hai đạo thấp hơn (heṭṭhimamaggadvayapaññā) rằng “tham muốn, tham lam bất chính hoàn toàn là cấu uế của tâm” theo bản chất, sự tập khởi, sự đoạn diệt và phương pháp đoạn diệt.
Pajahatīti ettha accantappahānameva adhippetanti dassento ‘‘samucchedappahānavasena ariyamaggena pajahatī’’ti āha.
In "he abandons" (pajahatī), it is intended to mean absolute abandonment; hence, it is said, "he abandons by the noble path, by way of cutting off."
Từ bỏ (pajahatī) ở đây, để cho thấy rằng sự đoạn trừ hoàn toàn được ám chỉ, nên nói “từ bỏ bằng Thánh đạo theo cách đoạn trừ tận gốc” (samucchedappahānavasena ariyamaggena pajahatī).
Ariyamaggenāti anāgāmimaggena.
"By the noble path" (ariyamaggenā) means by the Anāgāmi path.
Bằng Thánh đạo (ariyamaggena) nghĩa là bằng đạo Bất hoàn (Anāgāmimagga).
Tena hi pahānaṃ idha sabbavāresu adhippetaṃ.
Indeed, the abandonment here is intended for all instances.
Vì sự đoạn trừ ở đây được ám chỉ trong tất cả các trường hợp.
Kilesapaṭipāṭi idha kilesānaṃ desanākkamo.
"The sequence of defilements" (kilesapaṭipāṭi) here refers to the order of teaching the defilements.
Trình tự các cấu uế (kilesapaṭipāṭi) ở đây là trình tự giảng dạy các cấu uế.
Maggapaṭipāṭipana catunnaṃ ariyamaggānaṃ desanākkamopi tāya desanāya paṭipajjanakkamopi tāya paṭipattiyā uppattikkamopi.
"The sequence of paths" (maggapaṭipāṭi), however, refers to the order of teaching the four noble paths, and also the order of practicing by that teaching, and the order of arising by that practice.
Còn trình tự các đạo (maggapaṭipāṭi) là trình tự giảng dạy bốn Thánh đạo, hoặc trình tự thực hành theo sự giảng dạy đó, hoặc trình tự phát sinh của sự thực hành đó.
Tattha ye ye kilesā yena yena maggena pahīyanti, maggapaṭipāṭiṃ anoloketvā tesaṃ tesaṃ kilesānaṃ tena tena maggena pahānadassanaṃ kilesapaṭipāṭi na kilesānaṃ uppattikkamo idha desanākkamo cāti dassento ‘‘abhijjhā visamalobho’’tiādimāha.
Here, showing the abandonment of specific defilements by specific paths, without looking at the sequence of paths, is the sequence of defilements, not the order of the arising of defilements, but the order of teaching here; thus, it is said, "covetousness and unrighteous greed," and so on.
Ở đây, để cho thấy rằng trình bày sự đoạn trừ các cấu uế bằng các đạo tương ứng mà không cần xem xét trình tự các đạo là trình tự các cấu uế, không phải là trình tự phát sinh của các cấu uế, mà là trình tự giảng dạy ở đây, nên nói “tham muốn, tham lam bất chính” (abhijjhā visamalobho), v.v.
Yena yena pana maggena ye ye kilesā pahīyanti maggānupubbiyā, tena tena maggena tesaṃ tesaṃ kilesānaṃ pahānadassanaṃ maggapaṭipāṭiyā pahānadassananti dassento ‘‘sotāpattimaggenā’’tiādimāha.
Showing the abandonment of specific defilements by specific paths, in the progressive order of the paths, is the showing of abandonment by the sequence of paths; thus, it is said, "by the Stream-entry path," and so on.
Còn để cho thấy rằng trình bày sự đoạn trừ các cấu uế bằng các đạo tương ứng theo trình tự các đạo là trình bày sự đoạn trừ theo trình tự các đạo, nên nói “bằng đạo Dự lưu” (sotāpattimaggenā), v.v.
Imasmiṃ pana ṭhāneti ‘‘sa kho so, bhikkhave, bhikkhū’’tiādinā āgato imasmiṃ pahānavāre.
"In this context" (imasmiṃ pana ṭhāne) means in this instance of abandonment, which is introduced by "Such a monk, O bhikkhus," and so on.
Trong trường hợp này (imasmiṃ pana ṭhāne) nghĩa là trong trường hợp đoạn trừ này được nói đến trong “này các Tỳ khưu, Tỳ khưu đó”, v.v.
Ime kilesāti ime yathāvuttā kilesā.
"These defilements" (ime kilesā) means these defilements as stated.
Những cấu uế này (ime kilesā) nghĩa là những cấu uế đã nói ở trên.
Sotāpattimaggavajjhā vā hontu sesamaggavajjhā vāheṭṭhā dassitamaggapaṭipāṭivasena.
Whether they are to be abandoned by the Sotāpatti-magga, or to be abandoned by the remaining maggas, according to the sequence of maggas shown below.
Hoặc là những gì được đoạn diệt bởi đạo Tu-đà-hoàn, hoặc là những gì được đoạn diệt bởi các đạo còn lại theo thứ tự các đạo đã được trình bày ở dưới.
Tattha pana ye tatiyamaggavajjhā, tesaṃ anāgāmimaggeneva pahāne vattabbaṃ natthi, yesaṃ panettha heṭṭhimamaggavajjhānaṃ idha saṅgahe kāraṇaṃ pacchā vattukāmena aggamaggavajjhānaṃ anādiyitvā kasmā tatiyamaggavajjhānameva gahaṇaṃ katanti āha ‘‘ayamettha paveṇimaggāgato sambhavo’’ti, ayaṃ imassa suttassa etasmiṃ ṭhāne ācariyapaveṇiyā kathāmaggo tato āgato atthasambhavo atthatatvanti attho.
Among these, concerning those to be abandoned by the third magga, there is nothing to be said about their abandonment only by the Anāgāmi-magga. As for those to be abandoned by the lower maggas, the reason for their inclusion here will be stated later. He says, neglecting those to be abandoned by the highest magga, why were only those to be abandoned by the third magga taken? "This is the possibility that has come down through the traditional path here," meaning this is the traditional path of discourse of the teachers in this place regarding this Sutta, and the possibility of meaning, the true meaning, that has come from there.
Trong đó, đối với những gì được đoạn diệt bởi đạo thứ ba (đạo Bất lai), không có gì để nói về sự đoạn diệt của chúng chỉ bởi đạo Bất lai. Đối với những gì được đoạn diệt bởi các đạo thấp hơn được bao gồm ở đây, và với ý định nói về lý do sau này, tại sao không đề cập đến các đạo cao nhất mà chỉ đề cập đến những gì được đoạn diệt bởi đạo thứ ba? Điều đó được nói là: “Đây là sự phát sinh từ truyền thống đạo ở đây”, nghĩa là con đường giáo pháp theo truyền thống của các bậc đạo sư đã được truyền lại từ đó, là sự phát sinh ý nghĩa, là chân lý về ý nghĩa của kinh này tại chỗ này.
Tattha heṭṭhimamaggavajjhānaṃ idha saṅgahe kāraṇaṃ pacchā vattukāmo aggamaggavajjhānaṃ aggahaṇe yuttiṃ dassento ‘‘so cā’’tiādimāha.
Desiring to state later the reason for the inclusion of those to be abandoned by the lower maggas here, and showing the justification for not including those to be abandoned by the highest magga, he says "and that," etc.
Trong đó, với ý định nói về lý do bao gồm những gì được đoạn diệt bởi các đạo thấp hơn ở đây sau này, và chỉ ra lý do không đề cập đến những gì được đoạn diệt bởi các đạo cao nhất, ngài nói “và đó” v.v..
Tenāti catutthamaggena.
By that means by the fourth magga.
Bởi đó tức là bởi đạo thứ tư.
Sesānanti byāpādādīnaṃ.
Of the remaining means of ill-will, etc.
Các điều còn lại tức là sân hận v.v..
Yepīti makkhādike sandhāyāha.
Even those refers to Makkha, etc.
Những điều nào nữa tức là đề cập đến sự che giấu lỗi lầm (makkha) v.v..
Taṃsamuṭṭhāpakacittānanti tesaṃ makkhādīnaṃ samuṭṭhāpakacittuppādānaṃ.
Of the minds that give rise to them means of the mind-arisings that give rise to those Makkha, etc.
Của các tâm phát sinh chúng tức là của các tâm sở phát sinh sự che giấu lỗi lầm (makkha) v.v..
Tattha makkha-paḷāsa-issā-macchariya-samuṭṭhāpakaṃ paṭighadvayacittaṃ, visesato pañcakāmaguṇalobhena saṭho māyāvī ca hoti, pañcakāmaguṇikarāgo ca anāgāmimaggeneva niravasesato pahīyati, tasmā vuttaṃ ‘‘taṃsamuṭṭhāpakacittānaṃ appahīnattā’’ti.
Among these, the two states of aversion (paṭigha) give rise to Makkha, Paḷāsa, Issā, and Macchariya. Especially, one is deceitful and cunning through attachment to the five sense pleasures, and attachment to the five sense pleasures is abandoned completely by the Anāgāmi-magga alone. Therefore, it is said "due to the non-abandonment of the minds that give rise to them."
Trong đó, tâm sân hận gồm hai loại là tâm phát sinh sự che giấu lỗi lầm (makkha), sự lừa dối (paḷāsa), sự ganh tỵ (issā), sự keo kiệt (macchariya). Đặc biệt, người đó trở nên xảo trá, lừa dối do tham ái năm dục trần, và tham ái năm dục trần được đoạn trừ hoàn toàn chỉ bởi đạo Bất lai. Do đó, đã nói “do các tâm phát sinh chúng chưa được đoạn trừ”.
Tepi suppahīnā hontīti sambandho.
The connection is that they too are well abandoned.
Chúng cũng được đoạn trừ hoàn toàn, đó là sự liên kết.
Tanti paṭhamamaggeneva pahānaṃ pubbāparena na sandhiyati ‘‘yathodhi kho’’ti ettha odhivacanassa maggattayavācakattā.
That abandonment by the first magga does not connect in a sequential manner because the word odhi in "yathodhi kho" denotes the three maggas.
Điều đó tức là sự đoạn trừ bởi đạo thứ nhất không phù hợp với trình tự trước sau vì từ “odhi” trong “yathodhi kho” có nghĩa là ba đạo.
Ratanattaye aveccappasādo nāma ariyakantasīlaṃ viya sotāpannassa aṅgāni, te ca pahānato pacchā niddiṭṭhā, tasmā idha vuttappahānaṃ vikkhambhanapahānamevāti keci vadanti.
Unalterable faith (aveccappasāda) in the Triple Gem, like the noble virtue, is an attribute of a Sotāpanna. And these are specified after abandonment. Therefore, some say that the abandonment mentioned here is merely abandonment by suppression (vikkhambhanapahāna).
Niềm tin bất động vào Tam Bảo, giống như giới hạnh cao quý của bậc Tu-đà-hoàn, là các chi phần của bậc Tu-đà-hoàn, và chúng được nêu ra sau sự đoạn trừ. Do đó, một số người nói rằng sự đoạn trừ được nói ở đây chỉ là sự đoạn trừ bằng cách trấn áp.
Tesaṃ icchāmattameva yathāvuttapahānasseva vasena aveccappasādānaṃ odhiso pahānassa vibhāvitattā, svāyamattho heṭṭhā yuttitopi pakāsitoyeva.
Their mere desire (iccha-matta), since the abandonment of unalterable faith has been explained by way of the aforesaid abandonment itself. And this meaning has already been explained below with reasoning.
Chỉ là ý muốn của chúng theo nghĩa sự đoạn trừ như đã nói, niềm tin bất động được trình bày là sự đoạn trừ theo giới hạn. Ý nghĩa này đã được trình bày rõ ràng ở dưới từ lý lẽ.
74. Ekamekena padena yojetabbaṃ, yato ekamekassapi upakkilesassa sabhāvādito dassanaṃ niyyānamukhaṃ hoti, tathā ceva heṭṭhā saṃvaṇṇitaṃ.
74. It should be connected with each and every word, because the discernment of the nature, etc., of each and every defilement becomes a door to release, and it has been explained below in that manner.
74. Nên phối hợp với từng từ một, vì việc trình bày bản chất v.v. của từng ô nhiễm cũng là cửa ngõ dẫn đến sự giải thoát, và điều đó đã được trình bày ở dưới.
Anāgāmimaggavasena pahānaṃ vatvā pasādassa uddhaṭattā vuttaṃ ‘‘anāgāmimaggena lokuttarappasādo āgato’’ti.
After speaking of abandonment by way of the Anāgāmi-magga, it is said "supramundane faith has arisen by the Anāgāmi-magga" because faith has been introduced.
Sau khi nói về sự đoạn trừ theo đạo Bất lai, vì niềm tin được nêu ra, nên đã nói “niềm tin siêu thế đã đến bởi đạo Bất lai”.
Yadi evaṃ kasmā ‘‘lokiyo uppajjatī’’ti vuttanti?
If so, why is it said "mundane (lokiya) arises"?
Nếu vậy, tại sao lại nói “niềm tin thế gian phát sinh”?
‘‘Itipi so bhagavā’’tiādinayappavattassa lokiyattā.
Because it is mundane, occurring in the manner of "Iti pi so Bhagavā," etc.
Vì niềm tin phát sinh theo cách “Đức Thế Tôn ấy là bậc như vậy” v.v. là thế gian.
Nibbānārammaṇo eva hi lokuttaro pasādo.
For supramundane faith is indeed one that has Nibbāna as its object.
Chỉ có niềm tin siêu thế mới lấy Niết bàn làm đối tượng.
‘‘Itipi so bhagavā’’tiādivacanena lokiyaṃ, aveccappasādavacanena lokuttaranti lokiyalokuttaramissakaṃ pasādaṃ dassento.
The mundane (lokiya) by the words "Iti pi so Bhagavā," etc., and the supramundane (lokuttara) by the word aveccappasāda, thus showing a mixed mundane and supramundane faith.
Trình bày niềm tin hỗn hợp giữa thế gian và siêu thế bằng cách nói “Đức Thế Tôn ấy là bậc như vậy” v.v. là thế gian, và bằng cách nói niềm tin bất động là siêu thế.
Avecca ratanattayaguṇe yāthāvato ñatvā pasādo aveccappasādo.
Faith, having known the qualities of the Triple Gem accurately, is aveccappasāda (unalterable faith).
Niềm tin bất động (aveccappasādo) là niềm tin sau khi đã biết các đức tính của Tam Bảo một cách chân thật.
So pana yasmā maggenāgatattā kenaci akampaniyo appadhaṃsiyo ca hoti, tasmā vuttaṃ ‘‘acalena accutenā’’ti.
And since it is unshakeable and unassailable by anyone, having arisen through the magga, it is therefore said "unshakeable, unassailable."
Vì niềm tin ấy đã đến bởi đạo, không thể lay chuyển bởi bất cứ ai và không thể bị phá hoại, nên đã nói “bất động, bất hoại”.
Tattha lokuttaro sabbaso buddhaguṇādīsu sammohaṃ viddhaṃsento tattha kiccato pavattati, itaro ārammaṇavasena te ārabbha.
Among these, the supramundane functions completely to dispel delusion regarding the Buddha's qualities, etc.; the other functions regarding them by way of the object.
Trong đó, niềm tin siêu thế hoạt động trong việc phá tan hoàn toàn sự mê muội đối với các đức tính của Đức Phật v.v., còn niềm tin kia thì hoạt động theo đối tượng, lấy chúng làm đối tượng.
Taṃ vidhinti taṃ tassa uppannappakāraṃ.
That method means that manner of its arising.
Cách thức đó tức là cách thức phát sinh của niềm tin ấy.
Anussatiṭṭhānānīti anussatikammaṭṭhānāni.
Objects of recollection means meditation objects of recollection.
Các đề mục niệm tức là các đề mục thiền niệm.
Yo yo odhi yathodhi.
Whatever the odhi, that is yathodhi.
Giới hạn nào yathodhi (theo giới hạn).
Yathā-saddo byāpanicchāyaṃ, kho saddo avadhāraṇeti dassento ‘‘sakasakaodhivasena cattameva hotī’’tiādimāha.
Showing that the word yathā indicates pervading desire, and the word kho indicates emphasis, he says "it is indeed abandoned according to its respective limit," etc.
Từ “yathā” (theo) có nghĩa là bao trùm, từ “kho” có nghĩa là xác định, nên đã nói “chỉ có sự từ bỏ theo giới hạn riêng của mình” v.v..
Tena ‘‘vanta’’ntiādīsupi avadhāretabbanti dasseti.
By this, it shows that emphasis should also be applied to "vomited," etc.
Bởi đó, cũng cho thấy rằng trong các từ “vanta” (đã ói bỏ) v.v. cũng cần được xác định.
Sakasakaodhivasenāti saṅkhepato vuttamatthaṃ vivarituṃ ‘‘dve odhī’’tiādi āraddhaṃ.
According to its respective limit means "two limits," etc., are started to explain the meaning stated briefly.
Theo giới hạn riêng của mình để giải thích ý nghĩa đã được nói tóm tắt, đã bắt đầu “hai giới hạn” v.v..
Tattha yaṃmaggavajjhāti yena maggena anavasesato pahātabbā.
Among these, "to be abandoned by which magga" means to be completely abandoned by which magga.
Trong đó, những gì được đoạn diệt bởi đạo nào tức là những gì phải được đoạn trừ hoàn toàn bởi đạo đó.
Anavasesappahānavasena hi taṃtaṃmaggavajjhānaṃ kilesānaṃ tadaññamaggavajjhehi asammissatā, aññathā ye sakasakaodhivasena uparimaggavajjhā, te heṭṭhimamaggehi pahīnāpāyagamanīyādisabhāvā eva tehi pahīyantīti pahānavasena sammissā siyuṃ.
Indeed, the non-mingling of defilements to be abandoned by their respective maggas with those to be abandoned by other maggas is by way of complete abandonment. Otherwise, those defilements to be abandoned by higher maggas according to their respective limits, being such as those which lead to lower realms, abandoned by the lower maggas, would be mixed in terms of abandonment.
Chính theo nghĩa đoạn trừ hoàn toàn mà các phiền não được đoạn diệt bởi đạo này không bị lẫn lộn với những phiền não được đoạn diệt bởi đạo khác. Nếu không, những gì được đoạn diệt bởi các đạo cao hơn theo giới hạn riêng của chúng, thì chúng cũng được đoạn trừ bởi các đạo thấp hơn và có bản chất dẫn đến ác đạo v.v., như vậy chúng sẽ bị lẫn lộn theo nghĩa đoạn trừ.
Tena teyeva pahīnā hontīti etthāpi eseva nayo.
The same principle applies here also in "thereby those very ones are abandoned."
Trong “bởi đó chúng mới được đoạn trừ” cũng theo cách này.
Tatuttaripīti tato pahānanimittasomanassuppattito uddhampi.
Even beyond that means even beyond the arising of joy due to that abandonment.
Và hơn thế nữa tức là hơn cả sự phát sinh hoan hỷ do sự đoạn trừ.
Paṭipakkhesu odhiso pavattikiccattā odhīti heṭṭhā tayo maggā vuccanti.
Because they function as limits (odhi) against their opponents, the three lower maggas are called odhi here.
Vì có chức năng hoạt động theo giới hạn đối với các đối thủ, nên ba đạo dưới được gọi là odhī (giới hạn).
Te hītiādi vuttassevatthassa vivaraṇaṃ.
For those etc., is an explanation of the meaning already stated.
Chúng thật vậy v.v. là sự giải thích ý nghĩa đã được nói.
Imassa bhikkhunoti anāgāmiṃ sandhāyāha.
This bhikkhu refers to the Anāgāmi.
Của vị tỳ khưu này tức là đề cập đến bậc Bất lai.
Tena vuttaṃ ‘‘heṭṭhāmaggattayena catta’’nti.
Therefore it is said "given up by the three lower maggas."
Do đó, đã nói “được từ bỏ bởi ba đạo thấp hơn”.
Keci cattampi gaṇhanti, nayidamevanti dassanatthaṃ ‘‘vanta’’nti vuttaṃ.
Some also take catta (given up), but to show that it is not just this, "vomited" (vanta) is said.
Một số người cũng chấp nhận “cattampi” (cũng từ bỏ), nhưng để cho thấy rằng không phải chỉ có vậy, nên đã nói “vanta” (đã ói bỏ).
Na hi yaṃ yena vantaṃ, so puna taṃ ādiyati.
For what one has vomited, one does not take up again.
Thật vậy, cái gì đã được ói bỏ bởi ai, người đó sẽ không lấy lại nó nữa.
Tenāha ‘‘anādiyanabhāvadassanavasenā’’ti.
Therefore, it is said "to show the state of not taking up."
Do đó, đã nói “theo nghĩa cho thấy sự không lấy lại”.
Vantampi kiñci sasantatilaggaṃ siyā, nayidamevanti dassanatthaṃ ‘‘mutta’’nti vuttaṃ.
Something that is vomited might have some residue remaining in the continuum; to show that this is not so, "released" (mutta) is said.
Cái gì đã được ói bỏ có thể còn lại chút ít dính vào dòng chảy, để cho thấy rằng không phải như vậy, nên đã nói “mutta” (đã được giải thoát).
Tenāha ‘‘santatito vinimocanavasenā’’ti.
Therefore, it is said "to show liberation from the continuum."
Do đó, đã nói “theo nghĩa giải thoát khỏi dòng chảy”.
Muttampi kiñci muttabandhanā viya phalaṃ kuhiñci tiṭṭhati, na evamidanti dassanatthaṃ ‘‘pahīna’’nti vuttaṃ.
Something that is released might, like a released rope, remain somewhere; to show that this is not so, "abandoned" (pahīna) is said.
Cái gì đã được giải thoát, giống như quả đã được giải thoát khỏi dây buộc, có thể còn nằm ở đâu đó, để cho thấy rằng không phải như vậy, nên đã nói “pahīna” (đã được đoạn trừ).
Tenāha ‘‘kvaci anavaṭṭhānadassanavasenā’’ti.
Therefore, it is said "to show non-abiding anywhere."
Do đó, đã nói “theo nghĩa cho thấy sự không còn tồn tại ở bất cứ đâu”.
Yathā kiñci dunnissaṭṭhaṃ puna ādāya sammadeva nissaṭṭhaṃ paṭinissaṭṭhanti vuccati, evaṃ vipassanāya nissaṭṭhaṃ ādinnasadisaṃ maggena pahīnaṃ paṭinissaṭṭhaṃ nāma hotīti dassanatthaṃ ‘‘paṭinissaṭṭha’’nti vuttaṃ.
Just as something badly expelled, if taken up again and then properly expelled, is called paṭinissaṭṭha (re-expelled), so also what is expelled by vipassanā, being similar to what is taken up, when abandoned by the magga, is called paṭinissaṭṭha; to show this, "paṭinissaṭṭha" is said.
Giống như cái gì đó đã được vứt bỏ không tốt, sau đó lại lấy lại và vứt bỏ hoàn toàn, thì được gọi là “paṭinissaṭṭha” (đã được vứt bỏ lại). Để cho thấy rằng phiền não đã được vứt bỏ bởi tuệ quán giống như đã được lấy lại, và được đoạn trừ bởi đạo thì được gọi là “paṭinissaṭṭha”, nên đã nói “paṭinissaṭṭha”.
Tenāha ‘‘ādinnapubbassa paṭinissaggadassanavasenā’’ti.
Therefore, it is said "to show the re-expelling of what was formerly taken up."
Do đó, đã nói “theo nghĩa cho thấy sự từ bỏ lại cái đã từng được lấy trước đó”.
Na kāpurisena viya parammukhena nissaṭṭhaṃ, atha kho abhimukheneva nissaṭṭhanti dassanatthaṃ ‘‘paṭinissaṭṭha’’nti vuttaṃ.
To show that it is not expelled by turning away like a base person, but rather expelled directly facing it, "paṭinissaṭṭha" is said.
Không phải được vứt bỏ một cách ngoảnh mặt đi như kẻ hèn nhát, mà là được vứt bỏ một cách đối diện, để cho thấy điều đó, nên đã nói “paṭinissaṭṭha”.
Tenāha ‘‘paṭimukhaṃ vā’’tiādi.
Therefore, it is said "or facing it," etc.
Do đó, đã nói “hoặc là đối mặt” v.v..
Upagantabbatoti attano hitasukhaṃ paccāsīsantena ekantena adhigantabbato.
To be approached means to be certainly attained by one who aspires for one's own welfare and happiness.
Do phải đạt đến tức là do người mong cầu lợi ích và hạnh phúc cho bản thân nhất định phải đạt đến.
Dhāraṇatoti taṃsamaṅgīnaṃ apāyapātato sandhāraṇena.
By sustaining means by sustaining those endowed with it from falling into lower realms.
Do duy trì tức là do duy trì những người thành tựu nó khỏi sự rơi vào ác đạo.
Gantho ‘‘vedo’’ti vuccati ‘‘vidanti etenā’’ti, vedehi ñāṇehi gato paṭipannoti vedagū.
The text is called "Veda" meaning "by this they know." One who has gone or practiced with knowledge is vedagū (one who has attained the Veda).
Gantho (kiết sử) được gọi là “vedo” (sự hiểu biết) “vì người ta hiểu biết bởi nó”. Người đã đi theo, đã thực hành với các trí tuệ (vedehi ñāṇehi) thì là vedagū.
Abhijaññāti jāneyya.
May he know means may he understand.
Abhijaññā tức là nên biết.
Vedajātāti uppannasomanassā.
Vedajātā means those in whom joy has arisen.
Vedajātā tức là những người đã phát sinh hoan hỷ.
Ñāṇaṃ ‘‘vedo’’ti vuccati ‘‘veditabbaṃ vedetī’’ti.
Knowledge is called "Veda" meaning "it experiences what is to be experienced."
Trí tuệ được gọi là “vedo” “vì nó cảm nhận (vedeti) những gì cần được cảm nhận (veditabbaṃ)” .
Somanassaṃ ‘‘vedo’’ti vuccati ārammaṇarasaṃ vindati anubhavatīti.
Joy is called "Veda" meaning it experiences or feels the taste of the object.
Hoan hỷ được gọi là “vedo” vì nó cảm nhận (vindati), trải nghiệm hương vị của đối tượng.
Uppannanti aveccappasādaṃ nissāya uppannaṃ.
Arisen means arisen depending on unalterable faith.
Phát sinh tức là phát sinh nương vào niềm tin bất động.
Vuttappakārameva vedanti ‘‘somanassaṃ somanassamayañāṇañcā’’ti evaṃ vuttappakārameva.
Veda of the type described means of the type described thus: "joy, and knowledge accompanied by joy."
Sự hiểu biết (veda) như đã nói tức là “hoan hỷ và trí tuệ do hoan hỷ” như đã nói.
Atthavedanti atthe hetuphale vedaṃ.
Atthaveda means Veda in meaning (attha), in cause and effect.
Atthaveda tức là sự hiểu biết (veda) về ý nghĩa, về nhân quả.
Dhammavedanti dhamme hetumhi vedaṃ.
By Dhammaveda means knowledge in the Dhamma, the cause.
Dhammaveda là sự hiểu biết về dhamma, tức về nhân.
Tenāha ‘‘aveccappasādassa hetu’’ntiādi.
Therefore, it is said, “ a cause of unwavering faith,” and so on.
Do đó nói “nhân của niềm tin bất động” và vân vân.
Idha dhammatthasaddā hetuphalapariyāyāti imamatthaṃ pāḷiyā eva dassetuṃ ‘‘vuttañheta’’ntiādi vuttaṃ.
Here, to show that the words Dhamma and attha are synonyms for cause and effect, this meaning is stated in the Pali itself by, “ for it has been said,” and so on.
Ở đây, để chỉ rõ ý nghĩa rằng các từ dhamma và attha là đồng nghĩa với nhân và quả, chính từ kinh điển (Pāḷi), nên đã nói “điều này đã được nói” và vân vân.
Tameva atthañca dhammañcāti attho dhammoti ca vuttaṃ aveccappasādanimittaṃ yathāvuttaṃ kilesappahānañca.
And that very meaning and Dhamma – the meaning, which is also called Dhamma, is the cause of unwavering faith and the aforementioned abandonment of defilements.
Chính attha và dhamma đó, tức là attha được gọi là dhamma, là nguyên nhân của niềm tin bất động và sự đoạn trừ phiền não như đã nói.
Atthadhammānisaṃsabhūtaṃ vedanti yathāvuttaatthadhammānisaṃsabhūtaṃ somanassamayañāṇasaṅkhātaṃ vedañca.
Knowledge that has become the benefit of meaning and Dhamma – knowledge that has become the benefit of the aforementioned meaning and Dhamma, which is called knowledge accompanied by joy.
Atthadhammānisaṃsabhūtaṃ veda là sự hiểu biết về lợi ích của attha và dhamma như đã nói, và sự hiểu biết được gọi là trí tuệ kèm theo hỷ.
Pāmojjanti taruṇapītiṃ āha.
Pāmojja means nascent delight.
Pāmojja là niềm hỷ ban đầu.
Paccavekkhaṇākārappavattenāti etena paccavekkhaṇā evettha anavajjasabhāvatāya dhammoti vuttoti daṭṭhabbaṃ.
By the mode of review – by this, it should be understood that here, review itself is called Dhamma because of its blameless nature.
Với câu “do sự vận hành của tác ý quán xét”, nên cần hiểu rằng ở đây, chính sự quán xét được gọi là dhamma vì bản chất vô tội của nó.
Pīti jāyatīti parappaccayaṃ balavapītimāha.
Delight arises – this refers to strong delight induced by others.
Pīti jāyatī là nói đến niềm hỷ mạnh mẽ do duyên bên ngoài.
Pīṇitamanassāti passaddhiāvahehi uḷārehi pītivegehi tittacittassa.
Of a mind gladdened – of a mind satiated by the exalted surges of delight, which are causes of tranquility.
Pīṇitamanassā là tâm được thỏa mãn bởi những làn sóng hỷ lớn lao, mang lại sự khinh an.
Kāyoti nāmakāyo.
Body refers to the mental body.
Kāyo là danh thân.
Vūpasantadarathoti kilesapariḷāhānaṃ dūrībhāvena suṭṭhu upasantadaratho.
Of removed agitation – thoroughly calmed agitation due to the removal of the fever of defilements.
Vūpasantadaratho là sự nóng bức của phiền não đã hoàn toàn lắng dịu do đã được loại bỏ.
Paccavekkhaṇahetukaṃ cittassa samādhānaṃ idha adhippetanti āha ‘‘appitaṃ viya acalaṃ tiṭṭhatī’’ti.
It is intended here that the mind’s concentration is caused by review, hence it is said, “ it stands motionless as if fastened.”
Sự định tâm do quán xét là điều được đề cập ở đây, nên nói “đứng vững bất động như được cắm chặt”.
76. Kāmaṃ ‘‘buddhe aveccappasādena samannāgatomhi, dhamme saṅghe aveccappasādena samannāgatomhī’’ti idampi tassā paccavekkhaṇāya pavattiākārapakāsanameva, idaṃ pana visesato ratanattaye uppannasomanassādippakāsanapadaṃ.
76. Indeed, saying “I am endowed with unwavering faith in the Buddha, I am endowed with unwavering faith in the Dhamma and the Sangha” is also just a declaration of the mode of that review. However, this is a phrase specifically declaring the joy, etc., that arises in the Triple Gem.
76. Dù cho câu “Tôi có niềm tin bất động nơi Đức Phật, tôi có niềm tin bất động nơi Pháp, nơi Tăng” cũng là sự trình bày về cách thức vận hành của sự quán xét đó, nhưng đây là một đoạn văn đặc biệt trình bày về niềm hoan hỷ phát sinh nơi Tam Bảo.
‘‘Yathodhi kho panā’’ti idampi savisesaṃ paccavekkhaṇākārappakāsanapadanti adhippāyena ‘‘idāni yathodhi…pe… pakāsetvā’’ti vuttaṃ.
“Furthermore, as regards the method,” this is also a phrase declaring a specific mode of review, with this intention it is said, “ now by the method…pe… having declared.”
Với ý nghĩa rằng câu “Yathodhi kho panā” cũng là một đoạn văn đặc biệt trình bày về cách thức quán xét, nên đã nói “nay đã trình bày yathodhi…pe…”.
Cattāropi pana vārā paccavekkhaṇākārappakāsanavasena ceva somanassādiānisaṃsadassanavasena ca vuttāti sakkā viññātuṃ ubhayatthāpi ubhayassa vuttattā.
All four instances, however, can be understood as being stated both in terms of declaring the mode of review and in terms of showing the benefits such as joy, because both are stated in both contexts.
Cả bốn lần đều được nói theo cách trình bày về sự quán xét và cách trình bày về lợi ích của niềm hoan hỷ, v.v., vì cả hai đều được đề cập ở cả hai nơi, nên có thể hiểu được.
Yadipi ariyamaggo ekacittakkhaṇiko na puna uppajjati, paṭipakkhassa pana tena suppahīnattā taṃsamaṅgī aparihānadhammo taṃsīlādibhāveneva vuccatīti āha ‘‘tassa anāgāmimaggasampayuttaṃ sīlakkhandhaṃ dassetī’’tiādi.
Although the noble path is momentary, arising only for a single mind-moment and not arising again, the one possessing it is, by the complete abandonment of the opposing factor by that path, called one whose nature is not to decline, solely by virtue of possessing that virtue, etc., hence it is said, “ it shows the virtue aggregate associated with that Anāgāmi path,” and so on.
Mặc dù Thánh đạo chỉ là một sát-na tâm và không phát sinh trở lại, nhưng vì phiền não đối nghịch đã được đoạn trừ hoàn toàn bởi đạo đó, nên người thành tựu đạo đó là người không bị thoái đọa, và được gọi là người có giới hạnh, v.v., nên nói “chỉ rõ giới uẩn liên hệ với đạo Bất Hoàn” và vân vân.
‘‘Evaṃdhammā te bhagavanto ahesu’’ntiādīsu (dī. ni. 2.13; ma. ni. 3.197-198; saṃ. ni. 5.378) viya idha dhamma-saddo samādhipariyāyoti āha ‘‘samādhikkhandhaṃ paññākkhandhañca dassetī’’ti.
As in “Such were those Blessed Ones by nature” and so on, here the word Dhamma is a synonym for concentration, hence it is said, “ it shows the concentration aggregate and the wisdom aggregate.”
Trong các câu “Các vị Thế Tôn đó có pháp như vậy” và vân vân (Dī. N. 2.13; M. N. 3.197-198; S. N. 5.378), ở đây từ dhamma là đồng nghĩa với samādhi, nên nói “chỉ rõ định uẩn và tuệ uẩn”.
Tathā hi so sampayuttadhamme ekārammaṇe avikkhipamāne avippakiṇṇe avisaṭe katvā samaṃ, sammā ca ādahanto tathā te dhāretīti ca vattabbataṃ arahatīti dhammoti ca vuccati.
Indeed, it is worthy of being called Dhamma because it holds these associated phenomena equally and rightly, by making them undistracted, undivided, and unscattered on a single object.
Thật vậy, định đó xứng đáng được gọi là dhamma vì nó giữ các pháp tương ưng không bị tán loạn, không bị phân tán, không bị phân ly trên một đối tượng, và nó đặt chúng một cách bình đẳng và đúng đắn.
Anekarūpānanti anekappakārānaṃ.
Of many forms – of many kinds.
Anekarūpānaṃ là nhiều loại.
Antarāyo nāma appaṭiladdhassa vā alabbhanavasena, paṭiladdhassa vā parihānavasena, tadubhayampi idha natthīti dassento ‘‘maggassa vā’’tiādimāha.
An obstacle means either not attaining what has not been attained, or losing what has been attained; showing that both of these are absent here, it states, “ of the path, or,” and so on.
Antarāya (chướng ngại) là không đạt được cái chưa đạt, hoặc mất đi cái đã đạt được, và để chỉ rõ rằng cả hai điều đó đều không có ở đây, nên nói “của đạo hay” và vân vân.
Nevassa taṃ hoti antarāyāyāti tassa anāgāmino piṇḍapātabhojanaṃ neva hoti antarāyāya ukkaṃsagatāya paccavekkhaṇāya paccavekkhitvā paribhuñjanato.
That is not an obstacle for him – for that Anāgāmi, eating alms food is not an obstacle because he consumes it after reviewing it with supreme review.
Nevassa taṃ hoti antarāyāyā là việc thọ dụng vật thực khất thực của vị Bất Hoàn không trở thành chướng ngại, vì đã quán xét và thọ dụng bằng sự quán xét đạt đến mức tối thượng.
Tañcassā ukkaṃsagamanaṃ hatapaṭipakkhattāti dassento ‘‘maggena visuddhacittattā’’ti āha.
Showing that his attainment of the supreme path has destroyed the opposing factors, it states, “ because his mind is purified by the path.”
Để chỉ rõ rằng sự đạt đến mức tối thượng đó của vị ấy là do đã đoạn trừ các phiền não đối nghịch, nên nói “do tâm đã thanh tịnh bằng đạo”.
Etthāti etasmiṃ antarāyābhāve.
78. Here – in this absence of obstacles.
77. Etthā là trong sự không có chướng ngại này.
Etadeva visuddhacittattameva kāraṇaṃ.
This very thing – the purification of mind – is the cause.
Chính điều đó, tức là tâm thanh tịnh, là nguyên nhân.
Ettha ca ‘‘nevassa taṃ hoti antarāyāyā’’ti iminā heṭṭhā vuttappahānaṃ anāgāmimaggenevāti siddhaṃ hoti.
And here, by “that is not an obstacle for him,” it is proven that the abandonment mentioned earlier is solely by the Anāgāmi path.
Ở đây, với câu “nevassa taṃ hoti antarāyāyā”, sự đoạn trừ đã nói ở trên được xác định là chỉ bằng đạo Bất Hoàn.
Anāgāmino hi sabbaso kāmarāgo pahīno hoti, rasataṇhāya abhāvato tādisapiṇḍapātaparibhogo aggamaggādhigame kathañcipi antarāyāya na hotīti.
For an Anāgāmi, sensual passion is completely abandoned; due to the absence of craving for flavors, consuming such alms food is in no way an obstacle to the attainment of the highest path.
Vì đối với vị Bất Hoàn, dục ái đã được đoạn trừ hoàn toàn, và do không có vị ái, nên việc thọ dụng vật thực khất thực như vậy không thể trở thành chướng ngại cho sự chứng đắc đạo tối thượng.
‘‘Seyyathāpi, bhikkhave, vattha’’nti vadanto bhagavāādimhi attanā upanītavatthūpamaṃ anusandheti.
Saying, “Just as, bhikkhus, a cloth,” the Blessed One connects it to the simile of the cloth he presented at the beginning.
Khi Đức Thế Tôn nói “Này các tỳ khưu, ví như tấm vải”, Ngài đã liên kết với ví dụ về tấm vải mà Ngài đã đưa ra lúc ban đầu.
Udakassa acchabhāvo paṅkasevālapaṇakādimalābhāvena pasannatāya, tabbipariyāyato bahalatāti āha ‘‘acchanti vippasanna’’nti.
The clarity of water is due to its purity, being free from impurities like mud, algae, and moss; the opposite of this is muddiness, hence it states, “ clear means perfectly pure.”
Sự trong sạch của nước là do không có các cấu uế như bùn, rêu, rong, v.v., và do sự trong trẻo, ngược lại là sự đục ngầu, nên nói “acchanti là trong trẻo”.
Vaṇṇanibhāya vigatasaṃkilesatāya samujjalanaṃ pabhassaratāya vatthassa, taṃ pariyodātanti vattabbataṃ labhatīti āha ‘‘pariyodātaṃ pabhassaratāyā’’ti.
The cloth’s glowing with its color, being free from defilements, and its radiance makes it worthy of being called perfectly pure, hence it states, “ perfectly pure means radiant.”
Sự rực rỡ của tấm vải do không bị nhiễm ô về màu sắc, do sự sáng chói, nên được gọi là thanh tịnh, nên nói “pariyodātaṃ là sáng chói”.
Ukkaṃ bandheyyāti aṅgārakapallaṃ yathā dārughaṭikaṅgārādikena na bhijjati, evaṃ tanumattikālepādinā bandheyya.
He might bind the charcoal – just as a charcoal brazier is not broken by pieces of wood or charcoal, so he might bind it with a thin layer of clay, and so on.
Ukkaṃ bandheyyā là cột một cái chậu than, như không bị vỡ bởi than củi, v.v., mà được cột bằng một lớp đất sét mỏng.
Meghapaṭalato verambhavātadhārāsaṅghaṭṭanato vijjutā viya kevalaṃ vātadhārāsaṅghaṭṭanajanitā pabhā ukkāpabhā, sā pana yasmā dvinnaṃ vātadhārānaṃ vegasambhūtasaṅghaṭṭanahetukā, tasmā kāraṇavasena ‘‘vātavego ukkā’’ti vuttaṃ.
The light of a firebrand is a radiance produced solely by the friction of wind currents, like lightning from the collision of strong wind currents from a cloud mass. Since this is caused by the violent collision of two wind currents, it is called “a strong gust of wind, a firebrand” by way of its cause.
Ánh sáng của ukkā là ánh sáng phát sinh do sự va chạm của luồng gió mạnh, giống như tia chớp từ đám mây do sự va chạm của luồng gió mạnh. Nhưng vì nó là do sự va chạm của hai luồng gió mạnh, nên theo nguyên nhân, đã nói “gió mạnh là ukkā”.
77. Yathānusandhivasenātiādimhi uṭṭhitadesanāya anurūpā anusandhi yathānusandhi, tassā vasena.
77. In accordance with the connection – the connection suitable for the teaching that arose at the beginning is yathānusandhi; by way of that.
77. Trong yathānusandhivasenā và vân vân, sự liên kết phù hợp với lời dạy đã được đưa ra là yathānusandhi, theo sự liên kết đó.
Byatirekadassanaṃ viya hi sādhetabbassa ādimhi uṭṭhitadesanāya paṭipakkhadassanampi anurūpadesanāva sammadeva patiṭṭhāpanabhāvato, yathā taṃ āvattahārayojanāyaṃ visabhāgadhammāvattanti daṭṭhabbaṃ.
Indeed, showing the opposing factor, like showing a contrast, is also a suitable teaching for the teaching that arose at the beginning, due to its proper establishment. It should be understood as the turning of dissimilar phenomena in the application of the recurring arrangement.
Thật vậy, việc trình bày điều đối nghịch với lời dạy đã được đưa ra lúc ban đầu để chứng minh điều cần chứng minh, cũng là một lời dạy phù hợp, vì nó thiết lập một cách đúng đắn, như có thể thấy trong việc sắp xếp các pháp bất tương ưng trong việc sắp xếp theo vòng lặp.
‘‘Yathānusandhivasena desanā āgatā’’ti saṅkhepato vuttamatthaṃ vitthārento tappasaṅgena itarepi anusandhī dassetuṃ ‘‘tayo hī’’tiādimāha.
Expanding on the meaning briefly stated as “ the teaching has come in accordance with the connection,” and to show the other connections in that context, it states, “ for there are three,” and so on.
Để mở rộng ý nghĩa đã nói tóm tắt là “lời dạy đã đến theo yathānusandhi”, và để chỉ rõ các sự liên kết khác theo ngữ cảnh đó, nên đã nói “có ba” và vân vân.
Bahiddhāti bāhiresu vatthūsu.
Externally – in external objects.
Bahiddhā là trong các đối tượng bên ngoài.
Asati paritassanāti taṇhādiṭṭhiparitassanābhāvo.
Absence of anxiety – the absence of anxiety from craving and wrong views.
Asati paritassanā là không có sự lo sợ do ái và tà kiến.
Vissajjitasuttavasenāti ‘‘idha bhikkhu ekaccassā’’tiādinā (ma. ni. 1.242) vissajjitasuttavasena.
In accordance with the explained Sutta – in accordance with the Sutta explained by “Here, bhikkhus, to some extent,” and so on.
Vissajjitasuttavasenā là theo kinh Vissajjita, bắt đầu bằng “Ở đây, này các tỳ khưu, một số” (M. N. 1.242).
Yena dhammenāti sīlādivodānadhammesu akkhantiyādisaṃkilesadhammesu ca yena yena dhammena.
By which Dhamma – by which Dhamma, whether it be the Dhamma of purification like virtue, or the Dhamma of defilement like impatience.
Yena dhammena là với bất kỳ pháp nào trong các pháp thanh tịnh như giới, và các pháp ô nhiễm như không nhẫn nại.
Cha abhiññā āgatāti iminā ‘‘anurūpadhammavasena vā’’ti vuttavikappaṃ dasseti, sesehi ‘‘paṭipakkhavasena vā’’ti vuttavikappaṃ.
The six higher knowledges have come – by this, it shows the alternative stated as “or by way of suitable phenomena”; by the remaining ones, the alternative stated as “or by way of opposing factors.”
Cha abhiññā āgatā là chỉ rõ lựa chọn đã nói “hoặc theo pháp phù hợp”, còn các lựa chọn còn lại là “hoặc theo pháp đối nghịch”.
Akkhantiyā hi kakacūpamovādo (ma. ni. 1.222) paṭipakkho, tathā diṭṭhiyā ‘‘netaṃ mama, nesohamasmi, na meso attā’’ti evaṃ paṭibhāgā suññatākārena.
Indeed, the simile of the saw is the opposing factor to impatience, and similarly, for wrong view, “This is not mine, I am not this, this is not my self” is the counterpart in the mode of emptiness.
Thật vậy, lời khuyên ví như cái cưa (M. N. 1.222) là đối nghịch với sự không nhẫn nại, cũng như đối với tà kiến, là các pháp đối trị dưới hình thức tánh không như “cái này không phải của tôi, tôi không phải là cái đó, cái này không phải tự ngã của tôi”.
Sesadvayepi eseva nayo.
The same method applies to the other two.
Hai điều còn lại cũng tương tự.
‘‘Citte saṃkiliṭṭhe duggati pāṭikaṅkhā’’ti (ma. ni. 1.70) heṭṭhā kilesadesanā āgatā.
“When the mind is defiled, an unfortunate destination is to be expected” – the teaching on defilements came previously.
Lời dạy về phiền não đã được nói ở trên là “Khi tâm bị ô nhiễm, ác thú là điều đáng mong đợi” (M. N. 1.70).
Sabboti anavaseso.
All – without remainder.
Sabbo là toàn bộ, không sót lại.
Sabbākārenāti ādīnavānisaṃsapaccavekkhaṇapuggaladosajānanādinā sabbappakārena.
In all ways – in all manners, such as reviewing drawbacks and benefits, and knowing the individual’s faults.
Sabbākārenā là bằng mọi cách, như quán xét sự nguy hiểm, lợi ích, biết lỗi của người, v.v.
Brahmavihāradhammeti brahmavihāre ceva brahmavihārasahagatadhamme ca.
The Brahmavihāra Dhamma – both the Brahmavihāras and the phenomena associated with the Brahmavihāras.
Brahmavihāradhamme là các brahmavihāra và các pháp tương ưng với brahmavihāra.
Tenāha ‘‘nāmavasenā’’ti.
Therefore, it states, “ by way of name.”
Do đó nói “theo danh pháp”.
Vavatthapetvāti ānetvā sambandhitabbaṃ.
‘Vavatthapetvāti’ means it should be brought and connected.
Vavatthapetvā nghĩa là mang đến và liên kết.
Nāmantipi hi īdisesu ṭhānesu cattāro arūpino khandhā vuccanti.
Indeed, in such places, the four immaterial aggregates are called ‘nāma’ (mentality).
Quả thật, ở những chỗ như vậy, ngay cả danh cũng được gọi là bốn uẩn vô sắc.
Iminā nayenāti etena bhūtanissitānaṃ sesupādāyadhammānaṃ sabbesampi pahātabbataṇhāvajjānaṃ tebhūmakadhammānaṃ pariggahavidhiṃ ulliṅgeti.
‘ By this method’ indicates, by this, the way of comprehending all phenomena of the three planes of existence – those dependent on the elements and the remaining derivative phenomena – all of which are to be abandoned and tainted by craving.
Iminā nayenā nghĩa là với điều này, nó chỉ ra phương pháp bao gồm tất cả các pháp ba cõi còn lại là các pháp sở y nương tựa vào vật chất, ngoại trừ lòng tham cần phải đoạn trừ.
Sabhāvato vijjamānaṃ taṃ attapaccakkhaṃ katvā ñāṇena yāthāvato paṭivijjhiyamānataṃ upādāya ‘‘atthi ida’’nti yathāvavatthāpitaṃ nāmarūpaṃ.
Nāma-rūpa (mentality-materiality) is thus established as ‘this exists,’ having made that which truly exists by nature directly experienced and having been truly penetrated by knowledge as it is.
Danh sắc được xác định như là “có cái này” vì nó hiện hữu theo bản chất, được tự mình chứng nghiệm, và được quán thông một cách chân thật bằng trí tuệ.
Tenevāha ‘‘ettāvatānena dukkhasaccavavatthānaṃ kataṃ hotī’’ti.
That is why it is said, " By this, the ascertainment of the truth of suffering is accomplished."
Vì thế, Ngài nói: “Với điều này, sự xác định Khổ đế đã được thực hiện”.
Sāvadhāraṇañcetaṃ vacanaṃ, lokasamaññāsiddhaṃ sattaitthipurisādi viya, ito bāhirakaparikappitaṃ pakatiādi drabyādi jīvādi kāyādi viya ca na paramatthato natthi, atthevāti vuttaṃ hoti.
This statement is also definitive, meaning that it truly exists, unlike what is established by worldly convention, such as 'being,' 'woman,' 'man,' etc., or what is imagined by externalists, such as 'nature,' 'substance,' 'soul,' 'body,' etc., which do not exist ultimately.
Và lời nói này là khẳng định, không phải là không có theo nghĩa tối hậu, như cách gọi thông thường trong thế gian về chúng sinh, phụ nữ, đàn ông, v.v., hay như những khái niệm ngoại đạo về bản chất, vật chất, sinh mệnh, thân thể, v.v., mà là “có thật”.
Pajānātīti pubbabhāge tāva lakkhaṇarasādivasena ceva paṭiggahavibhāgavasena ca pakārato jānāti, aparabhāge pana pariññābhisamayavasena paṭivijjhanto jānāti.
‘ He discerns’ means that in the initial stage, he knows it in terms of its characteristics, functions, etc., and by way of accepting and distinguishing; in the later stage, he knows it by penetrating it through the comprehension of full understanding (pariññābhisamaya).
Pajānāti nghĩa là, ở giai đoạn đầu, biết theo cách thức qua các đặc tính, chức năng, v.v., và qua sự tiếp nhận và phân chia; ở giai đoạn sau, biết bằng cách quán thông qua sự thấu hiểu (pariññā) và chứng ngộ (abhisamaya).
Ekantahīnā nāma akusaladhammā sampati āyatiñca dukkhamūlattā, tatthāpi visesato taṇhāti āha ‘‘dukkhassa samudayaṃ paṭivijjhanto atthi hīnanti pajānātī’’ti.
Evil phenomena are utterly inferior, being the root of suffering both in the present and in the future, and among them, craving is especially so. Therefore, it is said, " penetrating the origin of suffering, he discerns that there is the inferior."
Các pháp bất thiện được gọi là hoàn toàn thấp kém vì chúng là gốc rễ của khổ đau trong hiện tại và tương lai; đặc biệt trong số đó là lòng tham (taṇhā), nên Ngài nói: “Khi quán thông Khổ tập, Ngài biết rằng có những điều thấp kém”.
Attano paccayehi padhānabhāvaṃ nītattā paṇītanti iminā atthena ariyamaggova ‘‘paṇīta’’nti vuccatīti āha ‘‘pahānupāyaṃ vicinanto atthi paṇītanti pajānātī’’ti.
Since it has been brought to a principal state by its own conditions, it is called ‘supreme.’ By this meaning, the Noble Path itself is called ‘supreme.’ Therefore, it is said, " seeking the means of abandonment, he discerns that there is the supreme."
Vì được đưa lên vị trí chủ yếu bởi các nhân duyên của mình, nên theo nghĩa này, chỉ có Thánh đạo mới được gọi là “thù thắng” (paṇīta), nên Ngài nói: “Khi tìm kiếm phương tiện đoạn trừ, Ngài biết rằng có những điều thù thắng”.
‘‘Uttamaṭṭhena ca paṇīta’’nti vuccamāne nirodhasaccassapi saṅgaho siyā, tassa pana padantarena saṅgahitattā vuttanayenevettha attho veditabbo.
If it were called ‘supreme’ in the sense of being the highest, the truth of cessation would also be included; however, since that is included by another term, the meaning here should be understood in the way stated.
Nếu nói “thù thắng theo nghĩa tối thượng”, thì Diệt đế cũng có thể được bao gồm, nhưng vì nó đã được bao gồm bởi một từ khác, nên ý nghĩa ở đây phải được hiểu theo cách đã nói.
Appamaññāmukhena vipassanābhinivesasseva katattā ‘‘brahmavihārasaññāgatassā’’ti vuttaṃ.
‘ To one whose perception is associated with the Brahmavihāras’ is stated because only the cultivation of insight (vipassanābhinivesa) has been accomplished through the medium of the immeasurables (appamaññā).
Vì sự chuyên chú vào tuệ quán đã được thực hiện thông qua con đường Tứ Vô Lượng Tâm (appamaññā), nên nói “của người có Tưởng về phạm trú”.
‘‘Sabbassapi tebhūmakassa saññāgatassā’’ti vattuṃ vaṭṭatiyeva.
It is appropriate to say, "to one whose perception is associated with all phenomena of the three planes of existence."
Có thể nói “của tất cả những gì có tưởng về ba cõi”.
Na cettha asaṅgaho tassāpi saññāya āgatabhāvato.
There is no non-inclusion here, as even that perception is included.
Và ở đây, điều đó không bị loại trừ vì tưởng về điều đó cũng đã được bao gồm.
Lokaṃ uttaritvā samatikkamitvā nissaritvā visaṃyuttaṃ hutvā ṭhitattā vuttaṃ ‘‘uttari nissaraṇaṃ nibbāna’’nti.
It is stated, " further liberation is Nibbāna," because it transcends, overcomes, escapes, and is disassociated from the world.
Được nói là “sự xuất ly tối thượng là Nibbāna” vì nó vượt qua, vượt lên và giải thoát khỏi thế gian, trở nên không liên hệ.
Catūhi ākārehīti ‘‘atthi hīna’’ntiādīhi catūhi pakārehi.
‘ By four aspects’ means by these four ways, such as ‘there is the inferior.’
Catūhi ākārehī nghĩa là bằng bốn cách thức như “có điều thấp kém”, v.v.
Anvayañāṇatāya anubodhabhūtāya vipassanāpaññāya jānanattho dhammañāṇatāya paṭivedhabhūtāya maggapaññāya dassanattho sabhāvasiddhoti dassento ‘‘vipassanāpaññāya cattāri saccāni jānanato maggapaññāya passato’’ti vuttaṃ.
Showing that the meaning of knowing by analogical knowledge (anvayañāṇa), which is the realization of insight-wisdom, and the meaning of seeing by knowledge of the Dhamma (dhammañāṇa), which is the penetration of path-wisdom, are naturally established, it is said, " knowing the four truths by insight-wisdom and seeing by path-wisdom."
Để chỉ ra rằng ý nghĩa của việc biết bằng tuệ quán là sự hiểu biết theo sau (anubodha) và ý nghĩa của việc thấy bằng tuệ đạo là sự quán thông (paṭivedha) là điều tự nhiên, nên nói “biết Tứ đế bằng tuệ quán và thấy bằng tuệ đạo”.
Bhayabherave vuttanayenevāti bhayabheravasuttavaṇṇanāyaṃ attanā vuttaatthavacanatthapāṭhena idha pāṭhassa sadisattā atidisanto ‘‘kāmāsavāpi…pe… pajānātī’’ti āha.
‘ In the way stated in the Bhayabherava Sutta’ means that the passage here is similar to the words and meanings stated by himself in the commentary on the Bhayabherava Sutta. Thus, referring to it, it is said, " From sensual defilements… and discerns."
Bhayabherave vuttanayenevā nghĩa là “như đã nói trong kinh Bhayabherava”, Ngài nói “kāmāsavāpi…pe… pajānātī” để chỉ ra rằng đoạn văn ở đây tương tự với lời giải thích ý nghĩa mà Ngài đã nói trong chú giải kinh Bhayabherava.
Ettha ca yasmā ‘‘kāmāsavāpi cittaṃ vimuccati…pe… avijjāsavāpi cittaṃ vimuccatī’’ti ‘‘khīṇā jātī’’tiādīni vadatā bhagavatā catutthamaggo niddiṭṭho, tasmā yaṃ heṭṭhā aṭṭhakathāyaṃ vuttaṃ ‘‘so ca upari catutthamaggasseva niddiṭṭhattā yujjatī’’ti, taṃ suvuttamevāti daṭṭhabbaṃ.
Here, since the Blessed One, in saying "the mind is liberated from sensual defilements… the mind is liberated from ignorance defilements" and "Destroyed is birth," etc., indicated the fourth path, what was stated below in the Commentary, "and that is appropriate, since the fourth path is indicated above," should be understood as well said.
Và ở đây, vì Đức Thế Tôn đã chỉ rõ Tứ đạo khi nói “tâm được giải thoát khỏi lậu hoặc dục…pe… tâm được giải thoát khỏi lậu hoặc vô minh” và “sự sinh đã tận”, v.v., nên điều đã nói trong Chú giải ở dưới rằng “điều đó phù hợp vì Tứ đạo đã được chỉ rõ ở trên” là hoàn toàn đúng đắn.
Tassa codanatthāyāti tassa brāhmaṇassa bhagavā attano codanatthāya ‘‘puccha maṃ tvaṃ brāhmaṇa yadettha tayā manasābhisamīhita’’nti codanāya, okāsadānatthāyāti adhippāyo.
‘ For the purpose of admonishing him’ means for the purpose of the Blessed One’s admonition of that brahmin, "Ask me, brahmin, whatever you have conceived in your mind here." The intention is to give an opportunity.
Tassa codanatthāyā nghĩa là để khuyến khích vị Bà-la-môn đó, Đức Thế Tôn đã nói “Này Bà-la-môn, hãy hỏi Ta những gì ngươi đã suy nghĩ trong tâm”, ý là để tạo cơ hội cho ông ta.
Desanāsannissayo brāhmaṇassa tathārūpo ettha ajjhāsayopi natthīti yathāvuttaanusandhittayavinimuttattā ‘‘pāṭiyekkaṃ anusandhiṃ āhā’’ti vuttaṃ.
The brahmin did not have such an inclination for the support of a discourse here. Since he was free from the three kinds of succession mentioned, it is said, " He presented a distinct succession."
Vì vị Bà-la-môn không có ý hướng như vậy để làm chỗ nương tựa cho bài pháp, và vì nó không liên quan đến ba sự liên kết đã nói, nên nói “Ngài đã nói một sự liên kết riêng biệt”.
Cittagatattā abbhantarena.
‘ Within’ because it is in the mind.
Abbhantarena vì nó nằm trong tâm.
Kilesavuṭṭhānasinānenāti kilesamalapavāhanena rāgapariḷāhādivūpasamakarena ca aṭṭhaṅgikaariyamaggasalilasinānena.
‘ By the bathing of the arising of defilements’ means by washing away the stains of defilements, by calming the fever of lust, etc., and by the bathing in the water of the Noble Eightfold Path.
Kilesavuṭṭhānasinānenā nghĩa là bằng sự gột rửa các cấu uế phiền não, và bằng sự làm dịu đi các phiền não như sự nung đốt của tham ái, bằng sự tắm rửa trong dòng nước của Bát Chánh Đạo.
79. Dhammasabhāmaṇḍapaṃ tāvadeva upagatattā bāhukā nadito āgataṃ viya maññamāno.
Having just approached the Dhamma assembly hall, he imagined it was like coming from the Bāhukā River.
79. Ngay khi đến hội trường Pháp, ông ta tưởng như mình đã đến từ sông Bāhukā.
Ariyaphalamaddanacuṇṇādayo telasinehassa vivecanena.
By the separation of oiliness from the powder and other ingredients for grinding Noble Fruits.
Bột nghiền quả Thánh, v.v., bằng cách tách dầu mỡ.
Lūkhabhāvo lokaṃ, taṃ etissā atthīti lokāti sammatā.
The world is roughness; it is called ‘lokā’ because it possesses this roughness.
Sự thô lậu là thế gian, cái có điều đó được gọi là lokā (thế tục).
Lokkhasammataggahaṇena ‘‘tathā sā nadī loke pākaṭā’’ti evaṃ pavattaṃ attano micchāgāhaṃ dīpeti.
By using the term ‘ regarded by the world,’ he exposes his own misconception that "that river is famous in the world" in this way.
Bằng cách dùng từ Lokkhasammata, ông ta chỉ ra sự hiểu lầm của mình rằng “con sông đó nổi tiếng trong thế gian”.
Tenāha ‘‘visuddhabhāvaṃ detīti evaṃ sammatā’’ti.
That is why it is said, " regarded as conferring purity."
Vì thế, Ngài nói: “được xem là ban cho sự thanh tịnh”.
Pāpapavāhanena samparāyikādisampattiāvahato lokassa hitā lokyā.
‘ Lokyā’ means beneficial to the world, as it brings about prosperity in future existences by washing away demerits.
Lokyā là hữu ích cho thế gian vì nó mang lại sự thành tựu ở đời sau, v.v., thông qua việc gột rửa tội lỗi.
Lokyāti sammatāti sabbaṃ purimasadisaṃ.
‘Regarded as lokyā’ is all similar to the preceding explanation.
Lokyāti sammatā (được xem là thuộc về thế gian) là tất cả tương tự như trước.
Tenāha ‘‘seṭṭhaṃ lokaṃ gamayatīti evaṃ sammatā’’ti.
That is why it is said, " regarded as leading to a superior world."
Vì thế, Ngài nói: “được xem là đưa đến thế gian tốt đẹp”.
Puññasammatāti pujjabhavaphalanibbattanena sattānaṃ punanena visodhanena puññāti sammatā.
‘ Regarded as merit’ means regarded as merit by purifying beings through producing results leading to excellent existences, by washing away.
Puññasammatā (được xem là phước báu) là được xem là phước báu vì nó làm thanh tịnh chúng sinh bằng cách tái sinh chúng vào những cảnh giới đáng tôn kính.
Tadatthadīpanatthamevāti tassā pubbe āgatadesanāya atthadīpanatthameva.
‘ Just for the purpose of illuminating that meaning’ means just for the purpose of illuminating the meaning of the discourse previously presented.
Tadatthadīpanatthamevā nghĩa là chỉ để làm sáng tỏ ý nghĩa của lời thuyết pháp đã được nói trước đó.
Vuttassevatthassa puna dīpanaṃ kimatthiyanti āha ‘‘gāthārucikāna’’nti.
Why is there a re-illumination of the same meaning? He says, " for those who delight in verses."
Tại sao lại làm sáng tỏ lại ý nghĩa đã nói? Ngài nói: “cho những người yêu thích kệ”.
Cuṇṇikavacanaṃ asambhāventā tathā ca vutte atthamabujjhanakā pajjavacanaṃ sambhāventā tathā ca vutte bujjhanakā gāthārucikā.
Those who do not appreciate prose statements and do not understand the meaning when spoken thus, but who appreciate verses and understand the meaning when spoken thus, are those who delight in verses.
Những người không tin vào lời văn xuôi và không hiểu ý nghĩa khi được nói như vậy, nhưng tin vào lời thơ và hiểu ý nghĩa khi được nói như vậy, là những người yêu thích kệ.
Visesatthadīpanatthanti visiṭṭhadīpanatthaṃ, purimadesanāya aññadīpanatthanti attho.
‘ For the purpose of illuminating a special meaning’ means for the purpose of a distinguished illumination; the meaning is for the purpose of a different illumination from the previous discourse.
Visesatthadīpanattha nghĩa là để làm sáng tỏ một cách đặc biệt, tức là để làm sáng tỏ một ý nghĩa khác so với lời thuyết pháp trước đó.
‘‘Gacchati pana bhavaṃ gotamo bāhukaṃ nadiṃ sināyitu’’nti (ma. ni. 1.78) heṭṭhā vuttattā bāhukanti idameva ettha tadatthadīpakaṃ.
Since it was stated earlier, "Will Venerable Gotama go to the Bāhukā River to bathe?" (MN 1.78), ‘Bāhukā’ here specifically illuminates that meaning.
Vì đã nói ở dưới rằng “Tôn giả Gotama có đến sông Bāhukā để tắm không?” (Ma. Ni. 1.78), nên chính từ “Bāhukā” ở đây làm sáng tỏ ý nghĩa đó.
Sesāni adhikakkādivacanāni tato visiṭṭhassa atthassa bodhanato visesatthadīpakāni.
The remaining words, such as ‘Adhikakka,’ illuminate a more distinguished meaning from that, and are thus illuminators of a special meaning.
Các từ còn lại như adhikakka, v.v., làm sáng tỏ ý nghĩa đặc biệt vì chúng chỉ ra một ý nghĩa vượt trội hơn.
Kasmā panettha bhagavatā brāhmaṇena avuttāni adhikakkādīni gahitānīti āha ‘‘yatheva hī’’tiādi.
Why did the Blessed One mention Adhikakka and others not spoken by the brahmin? He says, " Just as indeed," etc.
Tại sao Đức Thế Tôn lại dùng các từ adhikakka, v.v., mà vị Bà-la-môn không nói? Ngài nói: “Yatheva hī” (Cũng như vậy).
Kakkanti nhānapiṇḍaṃ adhippetaṃ, nhāyitvā adhikaṃ kakkaṃ ettha gaṇhantīti adhikakkaṃ.
‘Kakka’ here means bathing powder. They take extra powder (adhikaṃ kakkaṃ) there after bathing, hence ‘ Adhikakka’.
Kakka có nghĩa là bánh xà phòng tắm, adhikakkaṃ là nơi người ta tắm xong và lấy thêm bánh xà phòng.
Tenāha ‘‘nhānasambhāravasenā’’tiādi.
That is why it is said, " in terms of bathing supplies," etc.
Vì thế, Ngài nói: “như các vật dụng tắm rửa”, v.v.
Maṇḍalavāpisaṇṭhānanti vaṭṭapokkharaṇīsaṇṭhānaṃ.
‘ In the form of a circular pool’ means in the form of a round pond.
Maṇḍalavāpisaṇṭhāna nghĩa là hình dạng của một ao tròn.
Nadiyoti visuṃ nadiyo, na adhikakkādīni viya titthamattaṃ.
‘ Rivers’ means distinct rivers, not merely bathing places like Adhikakka and others.
Nadiyo là các con sông riêng biệt, không phải chỉ là một bến tắm như adhikakka, v.v.
Tīhi padehīti sundarikāpayāgabāhukāpadehi.
‘ By three terms’ means by the terms Sundarikā, Payāgā, and Bāhukā.
Tīhi padehī nghĩa là bằng các từ Sundarikā, Payāga và Bāhukā.
Cattārīti adhikakkādīni cattāri.
‘ Four’ means the four such as Adhikakka.
Cattārī nghĩa là bốn cái như adhikakka, v.v.
Vuttāneva hontīti lokasammatālakkhaṇena ekalakkhaṇatā brāhmaṇassa adhippāyena, paramatthato pana pāpapavāhalakkhaṇena ekalakkhaṇattā.
‘ Are indeed stated’ because of their single characteristic (ekalakkhaṇatā) in terms of being commonly regarded by the world according to the brahmin’s intention, but in ultimate reality, because of their single characteristic of washing away demerits.
Vuttāneva hontī nghĩa là có cùng một đặc tính theo ý của Bà-la-môn là được thế gian chấp nhận, nhưng theo nghĩa tối hậu thì có cùng một đặc tính là gột rửa tội lỗi.
Tenāha ‘‘tasmā’’tiādi.
That is why it is said, " Therefore," etc.
Vì thế, Ngài nói: “Tasmā” (Do đó), v.v.
Kiñci pāpasuddhiṃ na karontiyeva.
‘ Any’ purification of demerits ‘ do not effect’ at all.
Kiñci (một chút) thanh tịnh tội lỗi na karontiyeva (hoàn toàn không làm).
Na hi naṃ sodhayeti naṃ puggalaṃ na sodhaye.
‘ It does not purify him’ means it does not purify that person.
Na hi naṃ sodhaye nghĩa là không làm thanh tịnh người đó.
Verakibbisabhāvaṃ appattā nāma kammapathabhāvaṃ appattā.
‘ Not having attained the state of enmity and wrongdoing’ means not having attained the state of a path of action (kamma-patha).
Verakibbisabhāvaṃ appattā nghĩa là không đạt đến trạng thái của nghiệp đạo.
Tenāha ‘‘khuddakehī’’ti.
That is why it is said, " by minor ones."
Vì thế, Ngài nói: “khuddakehī” (bằng những điều nhỏ nhặt).
Paṭihanantoti ayuttabhāvadassanena taṃ diṭṭhiṃ paṭibāhanto.
‘ Countering’ means refuting that view by showing its inappropriateness.
Paṭihananto nghĩa là bác bỏ quan điểm đó bằng cách chỉ ra sự không phù hợp của nó.
Tatthāyaṃ paṭibāhanavidhi yathā yaṃ kiñci udakorohanaṃ na pāpapavāhanaṃ, evaṃ yo koci nakkhattayogo pāpahetūnaṃ paṭipakkhābhāvato.
Here is the method of refutation: just as any immersion in water is not a washing away of demerits, so also any astrological conjunction is not an opponent of the causes of demerits.
Phương pháp bác bỏ ở đây là: cũng như bất kỳ sự xuống nước nào không phải là sự gột rửa tội lỗi, thì bất kỳ sự kết hợp của các vì sao nào cũng không phải là đối nghịch với các nhân của tội lỗi.
Yañhi vināseti, so tassa paṭipakkho.
For that which destroys something is its opponent.
Cái gì hủy diệt thì cái đó là đối nghịch của nó.
Yathā āloko andhakārassa vijjā ca avijjāya, na evaṃ udakorohanaṃ nakkhattayogo vā pāpahetūnaṃ lobhādīnaṃ paṭipakkho, tasmā niṭṭhamettha gantabbaṃ ‘‘na udakorohanādi pāpapavāhana’’nti.
Just as light is the opponent of darkness, and wisdom of ignorance, so too is immersion in water or astrological rites not an opponent to the causes of evil such as greed. Therefore, it should be concluded here that 'immersion in water and so forth do not wash away evil.'
Như ánh sáng đối với bóng tối, và minh đối với vô minh, thì việc xuống nước hay việc xem ngày lành tháng tốt không phải là đối nghịch với các nhân của ác pháp như tham, v.v. Do đó, cần phải kết luận ở đây rằng "việc xuống nước, v.v. không phải là việc rửa trôi ác nghiệp."
Niccaṃ phaggunīnakkhattanti suddhasīlādikassa sabbakālaṃ maṅgaladivaso evāti adhippāyo.
" The permanent Phagguṇa constellation" means that for one of pure virtue and so forth, every time is an auspicious day; this is the intention.
"Luôn là sao Phagguni" có nghĩa là đối với người có giới hạnh thanh tịnh, v.v., luôn là ngày tốt lành.
Itaroti sīlādivasena asuddho.
" The other" means impure in terms of virtue and so forth.
"Người khác" là người không thanh tịnh về giới hạnh, v.v.
Niccameva uposatho ariyuposathena upavutthabhāvato.
" The Uposatha is always*" because it is observed with the noble Uposatha.
"Luôn là ngày Uposatha" vì đã giữ giới Uposatha của bậc Thánh.
Suddhassāti parisuddhamanosamācārassa.
" For one who is pure" means for one whose mental conduct is completely pure.
"Của người thanh tịnh" là của người có tâm và hành vi thanh tịnh.
Sucikammassāti parisuddhakāyavacīsamācārassa.
" For one of pure deeds" means for one whose bodily and verbal conduct is completely pure.
"Của người có hành động trong sạch" là của người có thân và khẩu hành trong sạch.
Tenāha ‘‘nikkilesatāyā’’tiādi.
Therefore, it is said, " due to freedom from defilements," and so forth.
Do đó, Ngài nói "do vô nhiễm" v.v.
Kusalūpasañhitanti anavajjabhāvūpagataṃ.
" Connected with wholesome*" means having attained a blameless state.
"Liên quan đến thiện" là liên quan đến sự vô tội.
Vatasamādānanti dhutadhammasamādānādi sampannameva hoti, nāssa vipatti atthīti attho.
" The undertaking of vows," meaning the undertaking of dhuta practices and so forth, " is accomplished," and there is no failure for it; this is the meaning.
"Việc thọ trì giới nguyện" như việc thọ trì các pháp đầu đà, v.v. "được thành tựu hoàn hảo," nghĩa là không có sự thất bại.
Mama sāsaneyeva sināhi, yadi accantameva suddhiṃ icchasīti adhippāyo.
" Bathe only in my teaching," if you truly desire ultimate purity; this is the intention.
"Hãy tắm gội trong giáo pháp của Ta," có nghĩa là "nếu ngươi thực sự muốn sự thanh tịnh tuyệt đối."
Tenāha ‘‘sace’’tiādi.
Therefore, it is said, " If," and so forth.
Do đó, Ngài nói "nếu" v.v.
Khematanti khemabhāvaṃ.
" Safety" means the state of being safe.
"Sự an ổn" là trạng thái an ổn.
Yathā sabbabhūtāni tapavasena khemappattāni abhayappattāni honti, evaṃ karohīti taṃ heṭṭhā dassitaṃ mettādibhāvanaṃ brāhmaṇassa saṅkhepena upadisantenassa ekaccasamādhisampadā tadavinābhāvinī paññāsampadā ca dassitāti daṭṭhabbaṃ.
Just as all beings, through austerity, attain safety and freedom from fear, "Do likewise." By briefly instructing the brahmin in the development of loving-kindness and so forth, as shown earlier, the attainment of a certain concentration and the attainment of wisdom inseparably connected with it are revealed; thus it should be understood.
Như tất cả chúng sinh đạt được sự an ổn, sự vô úy nhờ vào khổ hạnh, thì hãy làm như vậy. Khi Ngài tóm tắt giáo huấn về sự phát triển tâm từ, v.v. đã được trình bày ở trên cho vị Bà-la-môn, cần phải hiểu rằng Ngài đã chỉ ra sự thành tựu định (samādhi) và sự thành tựu tuệ (paññā) không thể tách rời khỏi định.
Tenāha ‘‘manodvārasuddhi dassitā’’ti.
Therefore, it is said, " the purification of the mind-door is shown."
Do đó, Ngài nói "sự thanh tịnh của ý môn đã được chỉ ra."
Tassa pana sampadādvayassa nissayabhūtaṃ sīlasampadaṃ dassetuṃ ‘‘sace musā na bhaṇasī’’tiādi vuttaṃ.
To show the attainment of virtue, which is the basis for that twofold attainment, " If you do not speak falsely" and so forth, was stated.
Để chỉ ra sự thành tựu giới (sīlasampadā) là nền tảng cho hai sự thành tựu đó, Ngài đã nói "nếu ngươi không nói dối" v.v.
Ettha ca yathā ‘‘sace musā na bhaṇasī’’tiādinā musāvāda-pāṇātipāta-adinnādāna-paṭivirativacanena avasesakāyavacīduccaritaviratīpi vuttā eva hoti lakkhaṇahāranayena, evaṃ ‘‘saddahāno amaccharī’’ti saddhādidhanasampadāniyojaneneva avasesaariyadhanasampadāniyojanampi siddhameva hotīti saddhādayo vimuttiparipācanīyadhammā brāhmaṇassa pakāsitā evāti veditabbā.
And here, just as by the statement "If you do not speak falsely" and so forth, the abstention from false speech, the abstention from killing, and the abstention from taking what is not given also implies abstention from the remaining bodily and verbal misconduct through the method of inferring characteristics, so too, by enjoining the attainment of riches such as faith, in "one who is faithful and unselfish," the enjoining of the remaining noble riches is also accomplished; thus it should be understood that the dhammas conducive to liberation, such as faith, have been revealed to the brahmin.
Ở đây, cũng như với "nếu ngươi không nói dối" v.v., bằng cách nói về sự kiêng cữ nói dối, sát sinh, trộm cắp, v.v., sự kiêng cữ các ác hạnh thân và khẩu còn lại cũng được nói đến theo phương pháp suy luận tương tự; thì cũng vậy, với sự áp dụng các tài sản như tín (saddhā), v.v. trong "có lòng tin, không keo kiệt," sự áp dụng các tài sản thánh (ariya-dhana) còn lại cũng được thành tựu. Do đó, cần phải hiểu rằng các pháp làm chín muồi giải thoát như tín, v.v. đã được công bố cho vị Bà-la-môn.
Tenevāha ‘‘imāya eva paṭipattiyā kilesasuddhī’’ti.
Therefore, it is said, " by this practice alone is the purification of defilements."
Chính vì vậy, Ngài nói "chính với sự thực hành này là sự thanh tịnh của phiền não."
Gayā sammatatarā bāhukādīhipīti adhippāyo.
" Gayā is more esteemed" than Bāhukā and others, this is the intention.
"Gayā được coi là tốt hơn" so với Bāhukā, v.v.
80. Ekoti asahāyo, esā panassa asahāyatā ekībhāvenāti.
80. " Alone" means without a companion. This aloneness, however, refers to his being in a state of solitude.
80. "Một mình" (Eko) nghĩa là không có bạn đồng hành; sự không có bạn đồng hành này là do ở một mình.
Na hissa tāva taṇhādutiyatā vigatā.
For his companion, craving, had not yet vanished.
Tuy nhiên, sự đồng hành của tham ái, v.v. của vị ấy vẫn chưa tan biến.
Tenevāha ‘‘na cirassevā’’tiādi.
Therefore, it is said, " not long after," and so forth.
Chính vì vậy, Ngài nói "không lâu sau" v.v.
Ekaggahaṇeneva kāyena vūpakaṭṭhatā vuttāti āha ‘‘vupakaṭṭho cittavivekenā’’ti.
By the word 'alone,' being withdrawn in body is stated, therefore it is said, " withdrawn through mental seclusion."
Chỉ với từ "một mình" đã nói lên sự độc cư thân, nên Ngài nói "độc cư với sự độc cư tâm."
Tena ‘‘divā caṅkamena nisajjāyā’’tiādinā (ma. ni. 1.423; 3.75; vibha. 519; mahāni. 161) āgataṃ jāgariyānuyogamāha.
Thereby, he speaks of diligent practice, as mentioned in "by walking and sitting by day" (M.I.423; M.III.75; Vbh.519; Mhānidd.161).
Với điều đó, Ngài nói về sự tinh cần thức tỉnh (jāgariyānuyoga) được đề cập trong "ban ngày đi kinh hành và ngồi" v.v.
Tathābhūtassa cassa ekādasahi aggīhi āditte tayo bhave passato yathā pamādassa lesopi nāhosi, evaṃ kammaṭṭhānaṃ brūhento sammadeva padahati.
And for one who is such, seeing the three existences burning with the eleven fires, just as there was not a trace of heedlessness, so too, developing the meditation subject, he strives diligently.
Và đối với người như vậy, khi thấy ba cõi đang bốc cháy với mười một ngọn lửa, thì không có một chút xao lãng nào. Như vậy, người ấy phát triển đề mục thiền định và thực hành đúng đắn.
Katthaci saṅkhāragate anapekkhacitto nibbānādhimutto eva vihāsīti dassetuṃ ‘‘appamatto’’tiādi vuttaṃ.
To show that he dwelled with a mind unattached to any conditioned formations, intent only on Nibbāna, " heedful" and so forth, was stated.
Để chỉ ra rằng người ấy an trú với tâm không chấp trước vào các hành, chỉ hướng đến Nibbāna, Ngài đã nói "không phóng dật" v.v.
Khīṇā jātītiādīsu yaṃ vattabbaṃ, taṃ heṭṭhā vuttameva.
What needs to be said regarding " Destroyed is birth" and so forth, has already been stated earlier.
Những gì cần nói về "sự sinh đã tận" v.v. đã được nói ở dưới.
Sesaṃ suviññeyyameva.
The rest is easily understood.
Phần còn lại rất dễ hiểu.
81. ‘‘Cundo’’ti tassa mahātherassa nāmaṃ, pūjāvasena pana mahācundoti vuccati yathā ‘‘mahāmoggallāno’’ti.
81. " Cunda" is the name of that great elder, but he is called " Mahācunda" out of respect, just as " Mahāmoggallāna"*.
81. "Cundo" là tên của Đại Trưởng lão đó, nhưng để tôn kính, Ngài được gọi là "Mahācundo" (Đại Cundo), giống như "Mahāmoggallāna" (Đại Moggallāna).
Attano vā cundaṃ nāma bhāgineyyattheraṃ upādāya āyasmato sāriputtattherassa bhātā ayaṃ mahāthero ‘‘mahācundo’’ti paññāyittha yathā ‘‘mahāpanthako’’ti.
Or this great elder, the brother of the Venerable Sāriputta, became known as " Mahācunda" by taking Cunda, his nephew, as in "Mahāpanthaka."
Hoặc vị Đại Trưởng lão này là anh trai của Trưởng lão Sāriputta, được biết đến là "Mahācundo" vì có một người cháu tên Cunda, giống như "Mahāpanthaka."
Sāyanhasamayanti bhummatthe ekaṃ upayogavacananti āha ‘‘sāyanhakāle’’ti.
" In the evening time" is a locative case expressing use; hence, it is said, " in the evening period."
"Sāyanhasamayaṃ" là một từ ngữ chỉ sự sử dụng ở vị trí sở thuộc, nên Ngài nói "vào buổi chiều."
Na hettha accanta saṃyogo sambhavatīti.
For absolute connection is not possible here.
Vì ở đây không thể có sự liên kết tuyệt đối.
Sattasaṅkhārehīti saddhivihārikaantevāsikaupāsakādisattehi ceva rūpārammaṇādisaṅkhārehi ca.
" From beings" means from beings such as co-residents, pupils, and lay followers, and from conditioned phenomena such as sense objects like visible forms.
"Với bảy hành" là với các chúng sinh như Tỳ-kheo đồng phạm hạnh, đệ tử, cư sĩ, v.v. và với các hành như đối tượng sắc (rūpārammaṇa), v.v.
Paṭinivattitvāti apasakkitvā.
" Having returned" means having withdrawn.
"Rút lui" nghĩa là tránh xa.
Nilīyananti vivecanaṃ kāyacittehi tato vivittatā.
" Withdrawal" means separation, being secluded from them physically and mentally.
"Ẩn mình" là sự độc cư, sự tách biệt thân và tâm khỏi đó.
Ekībhāvoti hi kāyavivekamāha, pavivekoti cittavivekaṃ.
For " solitude" refers to physical seclusion, and " seclusion" to mental seclusion.
"Sự ở một mình" (ekībhāvo) chỉ sự độc cư thân, "sự độc cư" (paviveko) chỉ sự độc cư tâm.
Tato vuṭṭhitoti tato duvidhavivekato bhavaṅguppattiyā, sabrahmacārīhi samāgamena ca apeto.
" Having arisen from that" means having departed from those two kinds of seclusion by the arising of the bhavanga and by associating with fellow celibates.
"Đã rời khỏi đó" nghĩa là đã lìa khỏi hai loại độc cư đó do sự phát sinh của hữu phần (bhavaṅga) và do sự tụ tập với các đồng phạm hạnh.
Abhivādāpetvāti abhivādaṃ kāretvā.
" Having caused to greet" means having caused to pay respects.
"Khi đã cho phép chào hỏi" nghĩa là khi đã cho phép chào.
Evanti yathāvuttaabhivādavasena.
" Thus" means by way of the greeting as stated.
"Như vậy" là theo cách chào hỏi đã nói.
Paggayhāti unnāmetvā.
"Raising up" means to elevate.
"Nâng lên" nghĩa là nâng cao.
Anupacchinnabhavamūlānaṃ tāva evaṃ abhivādo hotu, ucchinnabhavamūlānaṃ kimatthiyoti āha ‘‘etaṃ āciṇṇaṃ tathāgatāna’’nti.
Let the greeting be thus for those whose roots of existence are not yet cut off; what is the purpose for those whose roots of existence are cut off? To this it is said, " This is the custom of the Tathāgatas."
Nếu việc chào hỏi như vậy là cho những người chưa đoạn tận gốc rễ của hữu, thì việc đó có ý nghĩa gì đối với những người đã đoạn tận gốc rễ của hữu? Ngài nói "đây là thói quen của các Đức Như Lai."
Tena na tathāgatā samparāyikaṃyeva sattānaṃ sukhaṃ āsīsanti, atha kho diṭṭhadhammikampīti daṭṭhabbaṃ.
Thus it should be understood that Tathāgatas do not only wish for the future happiness of beings, but also for their happiness in this present life.
Do đó, cần phải hiểu rằng các Đức Như Lai không chỉ mong cầu hạnh phúc cho chúng sinh ở kiếp sau, mà còn mong cầu hạnh phúc trong hiện tại.
Kasmā evaṃ tathāgatā abhivadantīti tattha kāraṇamāha ‘‘sukhakāmā hī’’tiādi.
Why do Tathāgatas greet in this manner? The reason for that is given: " For they are desirous of happiness," and so forth.
Tại sao các Đức Như Lai lại chào hỏi như vậy? Ngài nói lý do ở đó: "Vì chúng sinh mong cầu hạnh phúc" v.v.
Puthukāyāti bahū sattakāyā.
" Numerous bodies" means many groups of beings.
"Nhiều thân" là nhiều thân chúng sinh.
Yakkhāti devā.
" Yakkhas" means devas.
"Yakkha" là chư thiên.
Te hi pūjanīyatāya ‘‘yakkhā’’ti vuccanti.
For they are " called" 'yakkhas' because they are worthy of veneration.
Vì họ đáng được tôn kính nên được gọi là "yakkha."
Abhivadantīti āsīsitamevatthaṃ ñāṇakaruṇāhi abhimukhaṃ katvā vadanti.
" They greet" means they speak, making that very desired meaning present through wisdom and compassion.
"Chào hỏi" nghĩa là dùng trí tuệ và lòng bi mẫn để hướng đến điều đã mong cầu và nói ra.
Yāti aniyamato gahitā niyamato dassento ‘‘imā’’ti āha.
" Which" means taken indiscriminately; showing them definitively, he says, " these."
"Những" (Yā) được lấy một cách không xác định. Để chỉ ra một cách xác định, Ngài nói "những này" (imā).
Imāti ca āsannapaccakkhavacananti āha ‘‘abhimukhaṃ karonto viyā’’ti, taṃ taṃ diṭṭhigatikaṃ cittagataṃ sammukhā viya karontoti attho.
And " these" is a word indicating immediacy and direct perception, so it is said, " as if making present," meaning as if making present face to face that particular view and mental state.
Và "những này" là lời nói chỉ sự gần gũi và trực tiếp, nên Ngài nói "như thể làm cho đối diện," nghĩa là như thể làm cho các tà kiến và các ý niệm đó trở nên đối diện.
Diṭṭhiyoti purimapadalopena pāḷiyaṃ vuttanti dassento ‘‘micchādiṭṭhiyo’’ti āha.
Indicating that " views" is stated in the Pāli by ellipsis of the preceding word, he says, " wrong views."
"Các kiến" (Diṭṭhiyo) được nói trong Pāḷi với sự lược bỏ tiền tố, nên Ngài nói "các tà kiến."
Sattesu diṭṭhigatacittuppādesu uppajjamānā, sattesu vā visayabhūtesu ārabbha uppajjamānā ‘‘sattesu pātubhavantī’’ti vuttā.
Arising in the thought-moments of views concerning beings, or arising with reference to beings as their objects, they are called " arising among beings."
Các kiến phát sinh trong các ý niệm liên quan đến chúng sinh, hoặc phát sinh liên quan đến chúng sinh như là đối tượng, được gọi là "phát sinh trong chúng sinh."
Attavādenāti attānaṃ ārabbha pavattena vacanena.
" Connected with self-doctrine" means with the statement that occurs with reference to a self.
"Liên quan đến thuyết về tự ngã" là lời nói phát sinh liên quan đến tự ngã.
Paṭisaṃyuttāti ‘‘atthi attā’’ti gāhe gāhaṇe ca visayabhāvena paṭisaṃyuttā.
" Connected" means connected by way of being the object in the grasping and holding of "there is a self."
"Liên hệ" là liên hệ như đối tượng trong việc chấp thủ "có tự ngã" và trong sự chấp thủ.
Diṭṭhigatikena diṭṭhiṃ gāhantehi gahaṇe gāhāpaṇe ca diṭṭhi diṭṭhivādassa visayoti tena paṭisaṃyuttā nāma hoti.
A view, when grasped by those holding views, or when caused to be grasped, has the view of the view-doctrine as its object, and is thus called connected with it.
Đối với người có tà kiến, trong việc chấp thủ và làm cho chấp thủ tà kiến, tà kiến là đối tượng của thuyết tà kiến, do đó được gọi là liên hệ.
‘‘Atthi attā’’ti evaṃ pavattā diṭṭhi idha attavādapaṭisaṃyuttā, na tassā visayabhūto attā.
The view that occurs as "there is a self" is here connected with self-doctrine, not the self which is its object.
Tà kiến phát sinh như "có tự ngã" ở đây là liên hệ đến thuyết về tự ngã, chứ không phải tự ngã là đối tượng của nó.
Sā ca visayabhāvato tathāpavattena vādena paṭisaṃyuttā.
And that is connected by way of being an object with a doctrine that occurs in that way.
Và tà kiến đó liên hệ với thuyết phát sinh như vậy do là đối tượng.
Lokavādappaṭisaṃyuttāti etthāpi eseva nayo.
The same method applies to " connected with world-doctrine."
"Liên quan đến thuyết về thế gian" cũng theo nguyên tắc này.
Vīsati bhavanti tato paraṃ attavādavatthuno abhāvā.
" There are twenty" because there is no basis for self-doctrine beyond that.
"Có hai mươi" vì không có đối tượng thuyết về tự ngã nào khác ngoài đó.
Pañcapi hi upādānakkhandhe paccekaṃ ‘‘attā’’ti te ca attano nissayabhāvena gaṇhato etāsaṃ diṭṭhīnaṃ sambhavo, tabbinimutto panāyaṃ visayo attaggahaṇākāro ca natthīti.
For, when one takes any of the five aggregates of clinging individually as "self," and these as the basis of oneself, the possibility of these views arises. However, there is no such object or mode of grasping the self apart from that.
Vì khi chấp thủ từng uẩn thủ (upādānakkhandha) trong năm uẩn thủ là "tự ngã" và chấp thủ chúng như là nền tảng của tự ngã, thì các tà kiến này có thể phát sinh, nhưng không có đối tượng nào khác và không có cách chấp thủ tự ngã nào khác ngoài đó.
Sassato attā ca loko cāti rūpādīsu aññataraṃ ‘‘attā’’ti, ‘‘loko’’ti vā gahetvā taṃ sassato sabbakālabhāvī nicco dhuvoti.
" The self and the world are eternal" means taking one of the rūpas and so forth as "self" or "world," and that being eternal, everlasting, permanent, constant.
"Tự ngã và thế gian là thường còn" nghĩa là chấp thủ một trong các sắc, v.v. là "tự ngã" hoặc "thế gian," và cho rằng nó là thường còn, tồn tại mãi mãi, vĩnh cửu, bất biến.
Yathāha ‘‘rūpī attā ceva loko ca sassato cāti attānañca lokañca paññapetī’’tiādi.
As it is said, "He proclaims the self and the world as 'the self and the world are material and eternal,' and so forth."
Như Ngài đã nói: "Sắc là tự ngã và thế gian là thường còn, người ấy tuyên bố tự ngã và thế gian" v.v.
Sassatotiādīsu paṭhamo sassatavādavasena attaggāho, dutiyo ucchedavādavasena, tatiyo ekaccasassatavādavasena, catuttho takkīvādavasena pavatto, amarāvikkhepavasena vā pavatto attaggāho.
Among Sassato (Eternalist) and so on: the first is the clinging to a self based on eternalism; the second, based on annihilationism; the third, based on partial eternalism; the fourth, based on speculative reasoning, or the clinging to a self based on the 'eel-wriggling' view.
Trong các từ như Sassato (thường còn) v.v., cái chấp ngã đầu tiên phát sinh theo quan điểm thường còn, cái thứ hai theo quan điểm đoạn diệt, cái thứ ba theo quan điểm một phần thường còn, cái thứ tư phát sinh theo quan điểm suy luận, hoặc cái chấp ngã phát sinh theo quan điểm quanh co như lươn.
Antavāti attano paricchedatāvasena.
Antavā (finite): in the sense of one's own limitedness.
Antavā (có giới hạn) là theo nghĩa tự ngã có giới hạn.
Anantavāti aparicchedatāvasena.
Anantavā (infinite): in the sense of unlimitedness.
Anantavā (không giới hạn) là theo nghĩa tự ngã không giới hạn.
Antavā ca anantavā cāti tadubhayavasena, itaro takkīvādavasena pavatto attaggāho.
Antavā ca anantavā ca (finite and infinite): in the sense of both; the other (view) is the clinging to a self based on speculative reasoning.
Antavā ca anantavā cā (có giới hạn và không giới hạn) là theo cả hai nghĩa đó; cái chấp ngã khác phát sinh theo quan điểm suy luận.
Evaṃ pavattattā aṭṭha hontīti yojanā.
Since they thus arise, they are eight (views) – this is the connection.
Giải thích là vì phát sinh như vậy nên có tám (quan điểm).
Ādimevāti ādimanasikārameva.
Ādimeva (the very first): means the very first attention (manasikāra).
Ādimeva (chỉ là sự tác ý ban đầu) là chỉ sự tác ý ban đầu.
Taṃ pana sarūpato dassento ‘‘vipassanāmissakapaṭhamamanasikāramevā’’ti āha.
Explaining it in terms of its nature, he said: "it is the very first attention mixed with insight (vipassanā)."
Ngài trình bày bản chất của nó và nói: “Chỉ là sự tác ý ban đầu có pha lẫn tuệ quán (vipassanāmissakapaṭhamamanasikāra)”.
Appatvāpi sotāpattimagganti iminā avadhāraṇena nivattitaṃ dasseti.
By this restrictive particle appatvāpi sotāpattimaggaṃ (even without attaining the Path of Stream-entry), he shows what is excluded.
Với sự khẳng định “dù chưa đạt đến đạo Tu-đà-hoàn (sotāpattimagga)”, ngài trình bày sự loại bỏ.
Nāmarūpaparicchedato pabhuti yāva udayabbayadassanaṃ, ayaṃ idha ādimanasikāroti adhippeto paññābhāvanāya ārambhabhāvato.
From the discernment of mind-and-matter up to the seeing of rise and fall – this is intended here as the first attention, because it is the beginning of the development of wisdom.
Từ sự phân định danh sắc cho đến sự thấy sinh diệt, đây được hiểu là sự tác ý ban đầu ở đây vì nó là sự khởi đầu cho sự tu tập tuệ.
Udayabbayānupassanāsahitatāya cassa vipassanāmissakatā vacanaṃ.
And because it is accompanied by the contemplation of rise and fall, it is called vipassanāmissakatā (mixed with insight).
Và việc nói có pha lẫn tuệ quán (vipassanāmissakatā) là do nó đi kèm với sự quán chiếu sinh diệt.
Evanti imassa atthavacanaṃ ‘‘ettakeneva upāyenā’’ti, yathāvuttaādimanasikārenāti attho.
The meaning of this word evaṃ (thus) is ettakeneva upāyena (by just this much means), which means by the aforementioned first attention.
Ý nghĩa của từ Evaṃ (như vậy) là “chỉ với phương tiện như vậy”, tức là với sự tác ý ban đầu đã nói.
Etāsanti yathāvuttānaṃ attavādalokavādapaṭisaṃyuttānaṃ diṭṭhīnaṃ.
Etāsaṃ (of these): refers to the aforementioned views connected with self-theories and world-theories.
Etāsaṃ (của những điều này) là của những tà kiến liên quan đến thuyết ngã và thuyết thế gian đã nói.
Kāmañca tāsaṃ tena tadaṅgavasena pahānaṃ hotiyeva, taṃ pana nādhippetaṃ, tasmā samucchedavasena pahānaṃ paṭinissaggo ca hotīti pucchati.
Although their abandonment by that (first attention) does occur through temporary suppression (tadaṅgavasena), that is not what is intended; therefore, it asks whether abandonment by eradication (samucchedavasena) and relinquishment (paṭinissagga) occurs.
Dù sự đoạn trừ những tà kiến đó có xảy ra tạm thời (tadaṅgavasena) bằng cách đó, nhưng điều đó không được đề cập; do đó, câu hỏi là liệu sự đoạn trừ hoàn toàn (samucchedavasena) và sự từ bỏ có xảy ra hay không.
Sabbaso samucchinnasaṃyojanatāya anadhimānikopi samāno.
Anadhimānikopi samāno (even though not conceited): implies complete eradication of defilements.
Do các kiết sử đã bị đoạn trừ hoàn toàn, dù không có sự kiêu mạn quá mức (anadhimānikopi samāno).
‘‘Ariyadhammo adhigato’’ti māno adhimāno, so yesaṃ atthi te adhimānikā, tesaṃ udayabbayañāṇādhigamena adhimānuppatti tadavasāno ca manasikāroti adhippeto.
The conceit "the noble Dhamma has been attained" is adhimāna (over-estimation/conceit); those who have it are adhimānikā (conceited ones); it is intended that conceit arises for them upon the attainment of knowledge of rise and fall, and the attention ceases there.
Sự kiêu mạn rằng “Pháp cao thượng đã được chứng đắc” là sự kiêu mạn quá mức (adhimāno); những người có sự kiêu mạn đó là adhimānikā (những người kiêu mạn quá mức). Ở đây, ý muốn nói là sự phát sinh kiêu mạn quá mức do chứng đắc trí sinh diệt và sự tác ý kết thúc ở đó.
Tena diṭṭhīnaṃ pahānaṃ na hotīti kathāpanatthaṃ ayaṃ pucchāti āha ‘‘adhimānappahānatthaṃ pucchatī’’ti.
To establish that the abandonment of views does not occur by that, this question is asked, as he says: adhimānappahānatthaṃ pucchati (he asks for the purpose of abandoning conceit).
Ngài nói: “Hỏi để đoạn trừ sự kiêu mạn quá mức” là để trình bày rằng bằng cách đó, sự đoạn trừ các tà kiến không xảy ra.
‘‘Ādimeva nu kho…pe… paṭinissaggo hotī’’ti anabhisametāvī viya vadanto adhimāne ṭhito viya hotīti āha ‘‘adhimāniko viya hutvā’’ti.
Saying "Is it only the first attention... or is there relinquishment?" as if not yet having comprehended, he appears to be steeped in conceit, as he says: adhimāniko viya hutvā (having become as if conceited).
Khi nói: “Chỉ là sự tác ý ban đầu… có sự từ bỏ hay không?” như một người chưa chứng ngộ, người đó dường như đang ở trong sự kiêu mạn quá mức, nên ngài nói: “Như thể có sự kiêu mạn quá mức”.
Soti thero.
So (he): refers to the Elder.
So (vị ấy) là vị Trưởng lão.
Tesaṃ atthāyāti tesaṃ attano antevāsikānaṃ bhagavatā etassa micchāgāhassa vivecanatthāya.
Tesaṃ atthāya (for their benefit): for the purpose of the Buddha analyzing this wrong view for his disciples.
Tesaṃ atthāya (vì lợi ích của họ) là để Đức Phật phân tích sự chấp sai lầm này cho các đệ tử của ngài.
Thero kira dhammasenāpati viya saddhiṃ attano antevāsikehi bhagavantaṃ upasaṅkami.
Indeed, the Elder, like the General of the Dhamma, approached the Buddha together with his disciples.
Vị Trưởng lão, giống như Vị Pháp Tướng, đã đến gặp Đức Phật cùng với các đệ tử của mình.
82. Yatthāti visaye bhummaṃ.
82. Yatthā (where): is in the locative case referring to the sphere.
82. Yatthā (nơi nào) là trường hợp định sở.
Diṭṭhīnañhi ārammaṇanidassanametanti.
For this is the demonstration of the object of views.
Vì đây là sự trình bày đối tượng của các tà kiến.
Yasmā diṭṭhīnaṃ anusayanabhūmipi samudācaraṇaṭṭhānampi khandhā eva, tasmā āha ‘‘yattha cetā diṭṭhiyo uppajjantī tiādi pañcakkhandhe sandhāya vutta’’nti.
Since the five aggregates are both the ground for the latent tendencies of views and the place of their manifestation, he says: "The phrase yattha cetā diṭṭhiyo uppajjantī (where these views arise) and so on, is said with reference to the five aggregates."
Vì năm uẩn chính là nền tảng của các tà kiến tiềm ẩn và là nơi chúng phát sinh, nên ngài nói: “Câu ‘Nơi nào những tà kiến này phát sinh’ v.v. được nói liên quan đến năm uẩn”.
Rūpaṃ abhinivissāti ‘‘idaṃ rūpaṃ mama attā’’ti diṭṭhābhinivesavasena abhinivisitvā ārabbha.
Rūpaṃ abhinivissā (clinging to form): means clinging to and relying on it, in the sense of the tenacious clinging of views, thinking "this form is my self."
Rūpaṃ abhinivissā (bám chấp vào sắc) là bám chấp và khởi lên theo cách chấp thủ tà kiến rằng “sắc này là tự ngã của tôi”.
Abhinivisamānā eva hi diṭṭhi naṃ ārammaṇaṃ katvā uppajjati.
Indeed, a view arises by taking that object as its basis, even as it clings.
Thật vậy, tà kiến phát sinh khi bám chấp vào một đối tượng.
‘‘So attā’’tiādīsu yadidaṃ cakkhādisaṅgahaṃ rūpaṃ, sahabuddhinibandhanatāya so me attā, sukhāsukhaṃ ettha lokiyatīti so loko.
Among ‘‘So attā’’ (That is the self) and so on: that which is comprised of the eye and so forth (i.e., form) is so me attā (that is my self) due to being bound with consciousness; in this world, pleasure and pain are experienced, hence so loko (that is the world).
Trong các câu như “So attā” (Đó là tự ngã), cái sắc được bao gồm trong mắt v.v., do sự gắn kết với nhận thức, nên “so me attā” (đó là tự ngã của tôi); nơi nào có sự hạnh phúc và đau khổ được trải nghiệm ở thế gian này, “so loko” (đó là thế gian).
‘‘Soevāhaṃ pecca paraloke bhavissāmīti tathābhāvena nicco, thirabhāvena dhuvo, sabbadābhāvitāya sassato, nibbikāratāya avipariṇāmadhammoti attho.
‘‘So evāhaṃ pecca bhavissāmī’’ (That very same 'I' shall be after death): means nicco (permanent) by being in such a state, dhuvo (stable) by being firm, sassato (eternal) by existing always, avipariṇāmadhammo (not subject to change) by being immutable.
“Soevāhaṃ pecca (chính tôi sau khi chết) bhavissāmī (sẽ tồn tại) ở thế giới khác”, nghĩa là nicco (thường hằng) do tồn tại như vậy, dhuvo (kiên cố) do tính vững chắc, sassato (vĩnh cửu) do tồn tại mãi mãi, avipariṇāmadhammo (không thay đổi) do không biến đổi.
Yadi pañcakkhandhe sandhāya vuttaṃ, kathamekavacananti āha ‘‘ārammaṇavasenā’’tiādi.
If it is said with reference to the five aggregates, why is it in the singular? He says: ‘‘ārammaṇavasenā’’ (in terms of the object) and so on.
Nếu được nói liên quan đến năm uẩn, tại sao lại dùng số ít? Ngài nói: “ārammaṇavasenā” (theo nghĩa đối tượng) v.v.
Nānā karīyati etenāti nānākaraṇaṃ, viseso.
That by which differentiation is made is nānākaraṇaṃ (differentiation), a distinction.
Nānākaraṇaṃ (sự khác biệt) là sự khác biệt bởi cái này.
Jātivasenāti uppattivasena.
Jātivasenā (in terms of origination): in the sense of arising.
Jātivasenā (theo nghĩa sinh khởi) là theo nghĩa phát sinh.
Ye hi anibbattapubbā samānāvatthā, te uppādasaṅkhātavikārasamaṅgitāya uppajjantīti samaññaṃ labhanti.
Indeed, those states that were previously unmanifest and uniform, receive the designation of 'arising' due to being endowed with the alteration called origination.
Những gì chưa từng phát sinh trước đó, ở trạng thái tương tự, được gọi là phát sinh do có sự biến đổi gọi là sự sinh khởi.
Tenāha ‘‘jātivasenā’’tiādi.
Therefore he says: ‘‘jātivasenā’’ (in terms of origination) and so on.
Do đó, ngài nói: “jātivasenā” (theo nghĩa sinh khởi) v.v.
Punappunaṃ āsevitāti anādimati saṃsāre aparāparuppattiyā laddhāsevanā.
Punappunaṃ āsevitā (repeatedly indulged in): means having gained indulgence through repeated origination in beginningless saṃsāra.
Punappunaṃ āsevitā (được thực hành lặp đi lặp lại) là đã được thực hành qua nhiều lần sinh khởi trong vòng luân hồi vô thủy.
Etena kilesānaṃ bhāvanaṭṭhena anusayatthaṃ viseseti.
By this, he specifies the meaning of 'latent' for defilements in the sense of their development.
Bằng cách này, ngài làm rõ ý nghĩa của sự tiềm ẩn (anusaya) bằng cách nói về sự tu tập của các phiền não.
Thāmagatāti thāmabhāvaṃ upagatā.
Thāmagatā (attained strength): attained the state of strength.
Thāmagatā (đã trở nên mạnh mẽ) là đã đạt đến trạng thái mạnh mẽ.
Etena anusaye sabhāvato dasseti.
By this, he shows the latent tendencies in their inherent nature.
Bằng cách này, ngài trình bày bản chất của các phiền não tiềm ẩn.
Thāmagamananti ca kāmarāgādīnaṃ anaññasādhāraṇo sabhāvo.
And thāmagamanaṃ (attainment of strength) is the inherent nature peculiar to sensual lust and so on.
Và thāmagamanaṃ (sự trở nên mạnh mẽ) là bản chất không thể chia sẻ của dục ái v.v.
Tathā hi vuttaṃ ‘‘thāmagato anusaye pajahatī’’ti (paṭi. ma. 3.21).
As it is said: "One abandons latent tendencies that have attained strength."
Như đã nói: “Đoạn trừ các phiền não tiềm ẩn đã trở nên mạnh mẽ” (Paṭi. Ma. 3.21).
Appaṭivinītāti samucchedavinayavasena na paṭivinītā.
Appaṭivinītā (not removed): not removed in the sense of removal by eradication.
Appaṭivinītā (chưa được loại bỏ) là chưa được loại bỏ theo cách đoạn trừ hoàn toàn.
Appahīnā hi thāmagatā kilesā anusentīti vuccanti.
Indeed, defilements that are unabandoned and have gained strength are said to lie latent.
Các phiền não chưa được đoạn trừ và đã trở nên mạnh mẽ được gọi là tiềm ẩn.
Etena tesaṃ kāraṇalābhe sati uppajjanārahataṃ dasseti.
By this, he shows their capacity to arise when conditions are met.
Bằng cách này, ngài trình bày khả năng phát sinh của chúng khi có điều kiện.
Samudācarantīti abhibhavanti.
Samudācarantī (manifest): they overcome.
Samudācarantī (xâm chiếm) là lấn át.
Etena tesaṃ vītikkamappattataṃ dasseti.
By this, he shows their attainment of transgression.
Bằng cách này, ngài trình bày sự đạt đến trạng thái vượt quá giới hạn của chúng.
Uppajjantīti pana imināva pariyuṭṭhānāvatthā dassitā.
However, by uppajjantī (arise), the state of obsession is shown.
Và với từ Uppajjantī (phát sinh), trạng thái quấy nhiễu (pariyuṭṭhāna) được trình bày.
Taṃ pañcakkhandhappabhedaṃ ārammaṇanti yaṃ taṃ ‘‘yattha cetā diṭṭhiyo uppajjantī’’tiādinā vuttaṃ rūpupādānakkhandhādipañcakkhandhapabhedaṃ diṭṭhīnaṃ ārammaṇaṃ.
Taṃ pañcakkhandhappabhedaṃ ārammaṇaṃ (that object distinguished as the five aggregates): refers to that object of views, distinguished as the aggregates of clinging to form and so on, as stated by "where these views arise" and so on.
Taṃ pañcakkhandhappabhedaṃ ārammaṇaṃ (đối tượng là sự phân loại năm uẩn đó) là đối tượng của các tà kiến, được phân loại thành năm uẩn như sắc thủ uẩn v.v., đã được nói bằng câu “Nơi nào những tà kiến này phát sinh” v.v.
Etaṃ mayhaṃ na hotīti etaṃ khandhapañcakaṃ mayhaṃ santakaṃ na hoti mama kiñcanapalibodhabhāvena gahetabbatāya abhāvato.
Etaṃ mayhaṃ na hoti (this is not mine): this group of five aggregates does not belong to me, as there is no state of mine-ness or impediment (kiñcana) by which it should be grasped.
Etaṃ mayhaṃ na hotī (cái này không phải của tôi) là năm uẩn này không thuộc về tôi, vì không có lý do để chấp thủ nó như là của cải hay sự ràng buộc của tôi.
Tenassa paramatthato taṇhāvatthubhāvaṃ paṭikkhipati tāvakālikādibhāvato.
By this, he rejects its status as an object of craving in the ultimate sense, because it is of a temporary nature.
Bằng cách này, ngài phủ nhận bản chất đối tượng của ái dục theo nghĩa tối hậu, do bản chất tạm thời v.v. của nó.
Ahampi eso na asmīti eso pañcakkhandhapabhedo ahampi na asmi, ahanti so gahetabbo na hotīti attho.
Ahampi eso na asmī (I am not this): this object distinguished as the five aggregates, I am not this; it means it should not be grasped as "I am."
Ahampi eso na asmī (tôi cũng không phải là cái đó) là cái được phân loại thành năm uẩn này, tôi cũng không phải là nó, nghĩa là nó không nên được chấp thủ là tôi.
Etenassa mānavatthubhāvaṃ paṭikkhipati aniccadukkhajegucchādibhāvato.
By this, he rejects its status as an object of conceit, because it is impermanent, unsatisfactory, repulsive, and not self.
Bằng cách này, ngài phủ nhận bản chất đối tượng của kiêu mạn, do bản chất vô thường, khổ, ghê tởm v.v. của nó.
Eso me attāpi na hoti attasabhāvassa tattha abhāvato mamañcassa kiñcanapalibodhabhāvena gahetabbatāya abhāvato.
Eso me attāpi na hoti (this is also not my self): because the nature of self is absent there, and there is no state of mine-ness or impediment by which it should be grasped.
Eso me attāpi na hoti (cái đó cũng không phải là tự ngã của tôi) vì không có bản chất tự ngã ở đó, và vì không có lý do để chấp thủ nó như là của cải hay sự ràng buộc của tôi.
Taṇhāva mamanti gaṇhāti etenāti taṇhāgāho.
That by which craving grasps as "mine" is taṇhāgāho (the grasping of craving).
Taṇhāgāho (sự chấp thủ của ái dục) là cái mà ái dục chấp thủ là “của tôi”.
Taṃ gaṇhantoti taṃ uppādento.
Taṃ gaṇhanto (grasping that): means causing it to arise.
Taṃ gaṇhanto (khi chấp thủ cái đó) là khi làm phát sinh cái đó.
Tenāha ‘‘taṇhāpapañcaṃ gaṇhātī’’ti.
Therefore, he says: ‘‘taṇhāpapañcaṃ gaṇhātī’’ (he grasps the proliferation of craving).
Do đó, ngài nói: “Taṇhāpapañcaṃ gaṇhātī” (chấp thủ sự phỉ báng của ái dục).
Papañceti santānaṃ vitthārento satte saṃsāre cirāyatīti papañco.
Papañceti (proliferates): means papañco (proliferation), which prolongs the flow (of existence), causing beings to linger in saṃsāra.
Papañco (sự phỉ báng) là cái làm cho dòng tâm thức lan rộng, làm cho chúng sinh luân hồi lâu dài.
Yathā vuttapabhedanti aṭṭhasatataṇhāvicaritapabhedaṃ.
Yathā vuttapabhedaṃ (of the aforementioned kind): means of the kind of the 108 modes of craving's activity.
Yathā vuttapabhedaṃ (sự phân loại đã nói) là sự phân loại của 108 loại ái dục đã được nói đến.
Taṇhāpapañcaṃ paṭikkhipati khandhapañcakassa taṇhāvatthukābhāvavibhāvanenāti adhippāyo.
Taṇhāpapañcaṃ paṭikkhipati (he rejects the proliferation of craving): the intention is by elucidating the non-existence of the five aggregates as an object of craving.
Ý nghĩa là Taṇhāpapañcaṃ paṭikkhipati (phủ nhận sự phỉ báng của ái dục) bằng cách trình bày rằng năm uẩn không phải là đối tượng của ái dục.
Parato padadvayepi eseva nayo.
The same principle applies to the next two phrases.
Đối với hai từ tiếp theo cũng theo cách này.
Diṭṭhekaṭṭhāti diṭṭhiyā pahānekaṭṭhā.
Diṭṭhekaṭṭhā (having one ground with views): means having one ground with the abandonment of views.
Diṭṭhekaṭṭhā (có cùng một mục đích với tà kiến) là có cùng một mục đích trong việc đoạn trừ với tà kiến.
Tena tesaṃ paṭhamamaggavajjhataṃ dasseti.
By this, he shows that they are to be abandoned by the first path.
Bằng cách này, ngài trình bày rằng chúng bị đoạn trừ bởi đạo quả đầu tiên.
Sahajekaṭṭhā pana diṭṭhiyā taṇhā eva, na māno, sā ca kho apāyagamanīyā.
However, craving alone, not conceit, shares the same ground of arising with views, and that (craving) leads to states of woe.
Nhưng cái có cùng một mục đích đồng thời với tà kiến chính là ái dục, không phải kiêu mạn, và ái dục đó dẫn đến các cõi khổ.
Yathā atthīti yena aniccadukkhāsubhānattākārena atthi, tathā passanto yathābhūtaṃ passati nāma.
Yathā atthi (as it exists): by seeing it as it exists in the manner of impermanence, suffering, impurity, and non-self, one sees it as it really is.
Yathā atthī (như nó là) là khi thấy như nó là, tức là thấy theo bản chất vô thường, khổ, bất tịnh, vô ngã, thì gọi là thấy như thật.
Tenāha ‘‘khandhapañcakañhī’’tiādi.
Therefore, he says: ‘‘khandhapañcakañhī’’ (indeed, the five aggregates) and so on.
Do đó, ngài nói: “khandhapañcakañhī” (năm uẩn) v.v.
Eteneva ākārenāti ruppanādianiccādiākāreneva.
Eteneva ākārena (in this very manner): refers to the manner of being crushed (ruppanādi), impermanent (anicca), and so on.
Eteneva ākārenā (chỉ với cách thức đó) là chỉ với cách thức biến hoại (ruppana) và vô thường v.v.
Gayhamānampi appahīnavipallāsehi.
Gayhamānampi (even when grasped): by those whose perversions are unabandoned.
Gayhamānampi (dù đang bị chấp thủ) bởi những người có sự điên đảo chưa được đoạn trừ.
Tenākārenāti ‘‘etaṃ mama’’ntiādiākārena.
Tenākārena (in that manner): in the manner of "this is mine" and so on.
Tenākārenā (với cách thức đó) là với cách thức “cái này là của tôi” v.v.
Nevatthi yathābhūtadassanavipallāsānaṃ tadabhāvato.
Nevatthi (does not exist): because of the non-existence of true seeing and perversions.
Nevatthi (không có) vì không có sự điên đảo trong việc thấy như thật.
Suṭṭhu passantassāti yathā puna tathā na passitabbaṃ, evaṃ suṭṭhu sātisayaṃ passantassa.
Suṭṭhu passantassā (for one who sees thoroughly): for one who sees so thoroughly that it should not be seen that way again, for one who sees superlatively well.
Suṭṭhu passantassā (đối với người thấy rõ ràng) là đối với người thấy một cách rõ ràng, vượt trội, đến mức không cần phải thấy như vậy nữa.
Na ādimanasikāreneva diṭṭhippahānaṃ hoti, adhimānikānaṃ pana adhimānamattametaṃ dassanaṃ.
The abandonment of views does not occur only by the first attention; for those who are conceited, this seeing is merely a matter of conceit.
Sự đoạn trừ tà kiến không chỉ xảy ra bằng sự tác ý ban đầu; đối với những người kiêu mạn quá mức, sự thấy đó chỉ là sự kiêu mạn quá mức.
Maggeneva taṃ hotīti imamatthaṃ vibhāvento ‘‘sotāpattimaggena diṭṭhippahānaṃ dassetvā’’ti āha.
To elaborate on the meaning of "that occurs only by the path," he stated, "having shown the abandoning of wrong view by the Stream-entry Path."
Để làm sáng tỏ ý nghĩa rằng điều đó xảy ra chỉ bằng con đường,* đã nói: “chỉ ra sự từ bỏ tà kiến bằng con đường Nhập Lưu”.
Vibhajantoti adhimānikānaṃ jhānāni asallekhabhāvena vibhajanto.
"Distinguishing" means distinguishing the absorptions of the conceited due to their non-purificatory nature.
“Vibhajanto” (phân biệt) có nghĩa là phân biệt các thiền của những người kiêu mạn theo cách không phải là sự tinh lọc.
Bālaputhujjanānaṃ neva uppajjati akārakabhāvato.
"It does not arise for foolish ordinary people" because it is ineffectual.
“Đối với những phàm phu ngu si, nó không hề sanh khởi” là do không có nguyên nhân.
Na ariyasāvakānaṃ pahīnādhimānapaccayattā.
"Nor for noble disciples" because their conceit has been abandoned.
“Không phải đối với các bậc Thánh đệ tử” là do đã từ bỏ sự kiêu mạn.
Na aṭṭhānaniyojako sappāyakammaṭṭhāneyeva niyojanato.
"He does not assign to an inappropriate place" because he assigns only to a suitable meditation subject.
“Không phải là người chỉ định vào nơi không thích hợp” là do chỉ định vào đề mục thích hợp.
Thero ‘‘yadatthaṃ saṅgho pakkosati, so attho tattha vāsīnaṃ āgatāgatānaṃ idha ijjhatī’’ti taṃ udikkhanto saṅghena yāvatatiyaṃ pahitopi na gato na agāravena.
The Elder, watching for the meaning, "the purpose for which the Saṅgha calls, that purpose is fulfilled here for those who reside here and those who come," did not go even after being sent by the Saṅgha three times, not out of disrespect.
Vị Trưởng lão, nhìn thấy rằng “mục đích mà Tăng đoàn triệu tập, mục đích đó sẽ được hoàn thành ở đây cho những ai đang cư ngụ và những ai đến”, mặc dù được Tăng đoàn phái đi đến ba lần, nhưng đã không đi, không phải vì bất kính.
Tenāha ‘‘kimeta’’ntiādi.
Therefore, he said, "What is this?" and so on.
Vì thế,* nói: “Kimeta” (Điều gì vậy?) v.v…
Paṇḍito hi tattha attano kiccameva karotīti aññataraṃ vuḍḍhapabbajitaṃ pāhesi.
Indeed, a wise person performs his own duty there, so he sent another aged bhikkhu.
Một người hiền trí thực hiện công việc của chính mình ở đó, vì thế* đã phái một vị tỳ khưu cao tuổi khác.
Kimetanti saṅghassa āṇāya akaraṇaṃ nāma kimetanti karaṇe ādaraṃ dīpento evamāha.
"What is this?" He spoke thus, showing his concern for action, asking what kind of disregard this was for the Saṅgha's command.
“Kimeta” (Điều gì vậy?) – không làm theo mệnh lệnh của Tăng đoàn, điều đó là gì? – vị ấy nói như vậy để bày tỏ sự quan tâm đến việc thực hiện.
Saṭṭhivassātītoti appatte pattasaññī eva saṭṭhivassātīto.
"Sixty years old" means one who is sixty years old, yet conceited about having attained what is not attained.
“Saṭṭhivassātīto” (đã hơn sáu mươi tuổi) là người đã hơn sáu mươi tuổi nhưng vẫn còn tưởng mình chưa đạt được.
Yasmā pesalā pesalehi saddhiṃ saṃsandanti samānādhimuttitāya, tasmā thero ‘‘sādhāvuso’’ti vatvā hatthimāpanādiṃ sabbaṃ akāsi.
Since pure-minded individuals associate with pure-minded individuals due to similar inclination, the Elder, saying "It is good, friend," performed everything including the measuring of the elephant.
Vì những người có phẩm hạnh tốt hòa hợp với những người có phẩm hạnh tốt do có cùng ý chí, nên vị Trưởng lão đã nói “Sādhāvuso” (Lành thay, hiền giả!) rồi thực hiện tất cả, bao gồm cả việc đo voi.
Tādisovāti anantaraṃ vuttattherasadisova appatte pattasaññī eva saṭṭhivassātītoti attho.
"Such a one" means similar to the Elder just mentioned, one who is sixty years old, yet conceited about having attained what is not attained.
“Tādisovā” (Cũng như vậy) có nghĩa là cũng giống như vị Trưởng lão vừa được đề cập, đã hơn sáu mươi tuổi nhưng vẫn còn tưởng mình chưa đạt được.
Padumagumbanti kamalasaṇḍaṃ.
"Lotus thicket" means a clump of lotuses.
“Padumagumbaṃ” (bụi sen) là một cụm hoa sen.
Pāsādaṃ pāvisi vissaṭṭhaṃ olokanenassa puthujjanabhāvo attanāva paññāyissatīti.
"He entered the palace" because by looking closely, his ordinary person status would become apparent by itself.
“Pāsādaṃ pāvisi” (đi vào cung điện) vì khi nhìn một cách tự nhiên, trạng thái phàm phu của người ấy sẽ tự lộ rõ.
Tissamahāvihāre kira therā bhikkhū tadā ‘‘sakacittaṃ pasīdatī’’ti vacanaṃ pūjentā kālasseva cetiyaṅgaṇaṃ sammajjitvā ettakārammaṇameva buddhārammaṇapītiṃ uppādetvā divase divase tathā karonti.
Indeed, in the Great Tissa Monastery, the Elders, the bhikkhus, at that time, honoring the saying "one's own mind becomes clear," would sweep the cetiya ground early, generate only that much joy based on the Buddha as the object, and perform thus day after day.
Nghe nói, vào thời đó, các vị tỳ khưu Trưởng lão tại Tissamahāvihāra, để tôn vinh lời dạy “tâm của mình thanh tịnh”, đã quét dọn sân tháp sớm, rồi chỉ tạo ra niềm hoan hỷ đối với Đức Phật với chừng đó đề mục, và thực hiện như vậy mỗi ngày.
Tena vuttaṃ ‘‘tasmiñca samaye’’tiādi.
Therefore, it is stated, "at that time," and so on.
Vì thế,* đã nói: “Tasmiñca samaye” (Vào thời điểm đó) v.v…
‘‘Dhammadinna, idha pattacīvaraṃ ṭhapetī’’ti vattāpi paṭisanthāravasena kiñci pucchitāpi nāhosi.
Even though someone said, "Dhammadinna, place your bowl and robe here," he was not asked anything by way of welcome.
“Vattāpi” (người nói) “Dhammadinna, hãy đặt y bát ở đây” cũng “nāhosi” (không) được hỏi bất cứ điều gì theo cách chào đón.
Guṇaṃ jānātīti nimujjanādīsu vivaradānādinā guṇaṃ jānāti viya.
"He knows the quality" means as if he knows the quality by giving explanations in matters like immersion and so on.
“Guṇaṃ jānātī” (biết được phẩm chất) giống như biết được phẩm chất qua việc cho phép lặn xuống v.v…
Tumhe pana na jānittha āgantukavattassapi akaraṇato.
"But you did not know" because even the duties towards a guest were not performed.
“Tumhe pana na jānittha” (Nhưng các vị không biết) là do không thực hiện cả bổn phận của khách tăng.
Satthuāṇāvilaṅghinī kīdisī sā saṅghassa katikā?
What kind of agreement of the Saṅgha is that which violates the Teacher's command?
Một quy định của Tăng đoàn như thế nào mà lại vi phạm mệnh lệnh của Đức Đạo Sư?
Katikā ca nāma sikkhāpadāvirodhena anuvattetabbā, ettakampi ajānantehi me saṃvāso natthīti ākāse abbhukkami.
And an agreement should be followed in conformity with the training rules; I will not associate with those who do not even know this much—thus he ascended into the air.
Và quy định phải được tuân thủ mà không trái với các giới luật, tôi không thể sống chung với những người thậm chí không biết điều này – nói rồi vị ấy bay lên không trung.
Yaṃ tassa evamassa sallekhena viharāmīti yo ‘‘paṭhamajjhānaṃ upasampajja vihareyyā’’ti vutto, tassa bhikkhuno yaṃ ‘‘paṭhamajjhānasaṅkhātaṃ paṭipattividhānaṃ kilese sallekhati, tena sallekhena ahaṃ viharāmī’’ti adhimānavasena evamassa evaṃ bhaveyya ṭhānametaṃ vijjatīti evamettha sambandho veditabbo.
"That which for him might be, 'I dwell with purification'": concerning that bhikkhu who was told, "He should enter and dwell in the first jhāna," if for that bhikkhu, regarding the practice of the first jhāna which purifies defilements, there might be such a conceit as "I dwell with that purification," such a possibility exists. This is how the connection here should be understood.
“Yaṃ tassa evamassa sallekhena viharāmī” (mà người ấy nghĩ: ‘Ta đang an trú trong sự tinh lọc’) – đối với vị tỳ khưu được nói là “an trú sau khi chứng đắc sơ thiền”, “sự sắp đặt thực hành gọi là sơ thiền tinh lọc các phiền não, ta an trú trong sự tinh lọc đó” – nếu người ấy có ý nghĩ như vậy do sự kiêu mạn, thì điều đó có thể xảy ra. Mối liên hệ ở đây phải được hiểu như vậy.
Taṃ na yujjatīti taṃ adhimānikassa ‘‘yathāvibhaṅgaṃ paṭhamajjhānaṃ sallekho’’ti parivitakkitaṃ na yujjati yuttaṃ na hoti.
"That is not fitting" means that thought of the conceited person, "the first jhāna, as distinguished, is purification," is not fitting, it is not appropriate.
“Taṃ na yujjatī” (Điều đó không hợp lý) có nghĩa là suy nghĩ của người kiêu mạn rằng “sơ thiền theo cách phân tích là sự tinh lọc” là không hợp lý, không thích đáng.
Tenāha ‘‘na hī’’tiādi.
Therefore, he said, "Indeed not," and so on.
Vì thế,* nói: “Na hī” (Quả thật không) v.v…
Tattha sammā sabbaso ca kilese likhatīti sallekho, ariyamaggo.
Here, that which correctly and entirely eliminates defilements is purification (sallekha), the Noble Path.
Ở đó, “sallekho” (sự tinh lọc) là con đường Thánh, vì nó cạo gọt hoàn toàn các phiền não một cách đúng đắn.
Tadupāyavipassanā sallekhapaṭipadā.
The insight that is the means to that is the path of purification (sallekhapaṭipadā).
Tứ niệm xứ là “sallekhapaṭipadā” (con đường tinh lọc).
Yaṃ pana jhānaṃ vipassanāpādakaṃ, tampi jhānaṃ pariyāyena maggapādakaṃ hotiyeva.
As for the jhāna that is the basis for insight, that jhāna is by implication also the basis for the path.
Còn thiền nào là nền tảng của tuệ quán, thiền đó cũng là nền tảng của con đường theo cách gián tiếp.
Tenāha ‘‘avipassanāpādakattā’’tiādi.
Therefore, he said, "because it is not a basis for insight," and so on.
Vì thế,* nói: “Avipassanāpādakattā” (do không phải là nền tảng của tuệ quán) v.v…
Jhānadhammavasenāti vitakkādipañcakajjhānadhammavasena.
"In terms of jhāna factors" means in terms of the five jhāna factors like initial application and so on.
“Jhānadhammavasenā” (theo phương diện các pháp thiền) là theo phương diện năm pháp thiền như tầm v.v…
Cittuppādavasena anekavāraṃ pavattamānampi jhānaṃ ekāvajjanatāya ekavīthipariyāpannattā ekā samāpatti evāti ‘‘punappunaṃ samāpattivasenā’’ti vuttaṃ.
Even though jhāna occurs many times in terms of thought-moments, due to a single advertence and belonging to a single thought-process, it is a single attainment, hence it is stated, "in terms of repeated attainment."
Mặc dù thiền diễn ra nhiều lần theo phương diện các tâm sanh, nhưng do chỉ có một sự hướng tâm và thuộc về một lộ trình, nên nó chỉ là một sự thành tựu. Vì thế,* đã nói: “Punappunaṃ samāpattivasenā” (theo phương diện thành tựu lặp đi lặp lại).
Cattāri arūpajjhānāni yathāsakaṃ ekekasmiṃyeva ārammaṇe pavattantīti āha ‘‘ārammaṇabhedābhāvato’’ti.
The four formless jhānas occur with respect to their respective single object, thus he said, "due to the absence of distinction in objects."
Bốn thiền vô sắc chỉ diễn ra trên một đề mục riêng biệt. Vì thế,* nói: “Ārammaṇabhedābhāvato” (do không có sự khác biệt về đề mục).
Purimakāraṇadvayavasenevāti ‘‘jhānadhammavasena, punappunaṃ samāpattivasenā’’ti pubbe vuttappakārakāraṇadvayavaseneva.
"Only in terms of the two preceding reasons" means only in terms of the two types of reasons mentioned earlier: "in terms of jhāna factors and in terms of repeated attainment."
“Purimakāraṇadvayavasenevā” (chỉ theo phương diện hai nguyên nhân trước) là chỉ theo phương diện hai nguyên nhân đã được nói trước đó: “theo phương diện các pháp thiền và theo phương diện thành tựu lặp đi lặp lại”.
Aṭṭha samāpattiyo nāma kilesānaṃ vikkhambhanavasena pavattā uttaruttari santapaṇītā dhammā, na tathā lokiyā avihiṃsādayo.
The eight attainments are phenomena that occur by way of suppressing defilements and are successively more tranquil and refined, unlike the mundane non-violence and so on.
Tám thiền chứng là những pháp cao thượng hơn, vi tế hơn, diễn ra theo cách trấn áp các phiền não, không giống như các pháp thế gian như không làm hại v.v…
Tattha kathaṃ avihiṃsādayo eva sallekhabhāvena vuttā, na itarāti imamatthaṃ vibhāvento codako ‘‘kasmā panā’’tiādimāha.
So, how is it that only non-violence and so on are spoken of as purification, and not the others? To clarify this matter, the questioner said, "Why then?" and so on.
Ở đó, tại sao chỉ có không làm hại v.v… được nói là sự tinh lọc, mà không phải là những pháp kia? Để làm sáng tỏ ý nghĩa này, người hỏi đã nói: “Kasmā panā” (Nhưng tại sao) v.v…
Itaro kāmaṃ samāpattiyo santapaṇītasabhāvā, vaṭṭapādakatāya pana kilesānaṃ sallekhapaṭipadā na honti, avihiṃsādayo pana vivaṭṭapādakā sallekhapaṭipadāti imamatthaṃ vibhāvento ‘‘lokuttarapādakattā’’tiādimāha.
The other person replied that although the attainments are by nature tranquil and refined, they are not the path to purification of defilements because they lead to the round of rebirths, whereas non-violence and so on are the path to purification because they lead to the cessation of the round of rebirths. To clarify this matter, he said, "because they are conducive to the supramundane," and so on.
Người kia nói: Mặc dù các thiền chứng có bản chất an tịnh và vi tế, nhưng do là nền tảng của luân hồi, nên chúng không phải là con đường tinh lọc các phiền não. Còn không làm hại v.v… là nền tảng của sự thoát ly luân hồi, là con đường tinh lọc. Để làm sáng tỏ ý nghĩa này,* đã nói: “Lokuttarapādakattā” (do là nền tảng của siêu thế) v.v…
Imināyeva aṭṭhasamāpattīhi avihiṃsādīnaṃ visesadīpakena suttena yathā mahapphalataraṃ hoti, taṃ pakārajātaṃ veditabbaṃ.
By this very sutta, which indicates the distinction between the eight attainments and non-violence and so on, that type of deed which is more greatly fruitful should be understood.
Với kinh này, chỉ ra sự khác biệt giữa tám thiền chứng và không làm hại v.v…, cần phải biết loại công đức nào có quả báo lớn hơn.
Idañhi dakkhiṇeyyataratāya dakkhiṇāya mahapphalatarataṃ sandhāya vuttanti sambandho.
And this, it is understood, is spoken of with reference to the greater fruitfulness of the offering due to its greater worthiness of offerings, thus the connection.
Và điều này được nói là ám chỉ đến sự có quả báo lớn hơn của sự cúng dường do có giá trị cúng dường cao hơn. Mối liên hệ là như vậy.
Nanu tattha ‘‘sotāpattiphalasacchikiriyāya paṭipanno’’ti āgataṃ, na ‘‘saraṇagato’’ti codanaṃ sandhāyāha ‘‘saraṇagamanato paṭṭhāyā’’tiādi.
Indeed, it is stated there, "one who practices for the realization of the fruit of Stream-entry," not "one who has gone for refuge." Referring to this objection, he said, "beginning from going for refuge," and so on.
Chẳng phải ở đó đã nói “người thực hành để chứng đắc quả Nhập Lưu”, chứ không phải “người quy y” sao? Để giải đáp câu hỏi đó,* nói: “Saraṇagamanato paṭṭhāyā” (bắt đầu từ sự quy y) v.v…
Vuttañhetaṃ aṭṭhakathāyaṃ (ma. ni. aṭṭha. 3.379) ‘‘heṭṭhimakoṭiyā tisaraṇaṃ gato upāsakopi sotāpattiphalasacchikiriyāya paṭipanno nāmā’’ti.
For it is said in the commentary (Ma. Ni. Aṭṭha. 3.379), "Even an Upāsaka who has gone for the Triple Refuge, at the lowest level, is named as one who practices for the realization of the fruit of Stream-entry."
Điều này đã được nói trong Aṭṭhakathā (Ma. Ni. Aṭṭha. 3.379): “Ngay cả một cư sĩ đã quy y Tam Bảo ở mức thấp nhất cũng được gọi là người thực hành để chứng đắc quả Nhập Lưu”.
Yo hi vaṭṭadukkhaṃ samatikkamitukāmo pasannacitto ratanattayaṃ saraṇaṃ gacchati, tassa taṃ adhisīlādīnaṃ upanissayo hutvā anukkamena dassanamaggādhigamāya saṃvatteyyāti.
For whoever, desiring to overcome the suffering of Saṃsāra, with a serene mind goes for refuge to the Triple Gem, that refuge becomes a supporting condition for his virtues and so on, and successively contributes to the attainment of the path of vision.
Người nào muốn vượt qua khổ đau luân hồi, với tâm thanh tịnh quy y Tam Bảo, thì sự quy y đó sẽ trở thành duyên trợ cho các giới học v.v… và dần dần dẫn đến sự chứng đắc đạo kiến.
Vihiṃsādivatthunti yadetaṃ vihiṃsādīnaṃ vatthuṃ vadāma, imasmiṃ vihiṃsādivatthusmiṃ.
"The matter of violence and so on" means in this matter of violence and so on, which we speak of.
“Vihiṃsādivatthuṃ” (đối tượng của sự làm hại v.v…) là trong đối tượng của sự làm hại v.v… mà chúng ta đang nói đến.
Antamicchādiṭṭhiñca micchattānaṃ ādimicchādiṭṭhiñcāti idaṃ desanākkamaṃ sandhāya vuttaṃ.
"And extreme wrong view, and the primary wrong view among wrong views" is stated with reference to the order of teaching.
“Antamicchādiṭṭhiñca micchattānaṃ ādimicchādiṭṭhiñcā” (cả tà kiến cuối cùng và tà kiến đầu tiên trong các tà hạnh) – điều này được nói là ám chỉ đến thứ tự thuyết giảng.
Missetvāti micchādiṭṭhibhāvasāmaññena ekajjhaṃ katvā.
"Mixing" means combining them into one, in terms of their common nature as wrong view.
“Missetvā” (pha trộn) là gộp chung lại do có cùng bản chất tà kiến.
Tathāti iminā yathā kammapathamicchattānaṃ ante ādimhi ca vuttamicchādiṭṭhiṃ missetvā ekajjhaṃ vuttaṃ, tathā tesaṃ ante vuttasammādiṭṭhīti imamatthaṃ upasaṃharati.
"Similarly" refers to the way that wrong view, mentioned at the end and beginning of the wrong ways of action, is mixed and spoken of as one, and thus he summarizes the meaning regarding the right view mentioned at the end of them.
“Tathā” (Cũng vậy) – điều này tổng hợp ý nghĩa rằng giống như tà kiến được nói ở cuối và ở đầu của các tà hạnh được gộp chung lại, thì cũng vậy đối với chánh kiến được nói ở cuối của chúng.
Pāṇanti vohārato sattaṃ, paramatthato jīvitindriyaṃ.
"Life" is a being by convention, and the faculty of life by ultimate reality.
“Pāṇaṃ” (sinh mạng) là chúng sinh theo cách gọi thông thường, và là sinh mạng quyền theo nghĩa tối hậu.
Atipātenti saraseneva patanasabhāvaṃ aticca antarā eva pātenti, atikkamma vā satthādīhi abhibhavitvā pātenti.
"They take away" means they cause to fall midway, transcending the natural state of falling, or they cause to fall by overpowering with weapons and so on.
“Atipātenti” (làm tổn hại) là vượt qua bản chất tự nhiên của sự rơi rụng mà làm cho rơi rụng ở giữa chừng, hoặc vượt qua bằng cách áp đảo bằng vũ khí v.v… mà làm cho rơi rụng.
Adinnanti parasantakaṃ.
Adinna means belonging to others.
Adinna (vật chưa cho) là của cải của người khác.
Ādiyantīti gaṇhanti.
Ādiyanti means they take.
Ādiyanti (lấy) nghĩa là chiếm đoạt.
Sallekhatīti samaṃ lekhati, pajahatīti attho.
Sallekhati means it shaves equally, meaning it abandons.
Sallekhati (gọt giũa, tinh luyện) nghĩa là gọt giũa đồng đều, tức là từ bỏ.
Kammapathakathā esāti ‘‘atthabhañjanaka’’nti vuttaṃ.
This is a discourse on the path of action, hence it is said to be " destructive of welfare."
Đây là lời nói về nghiệp đạo (kammapatha), nên được gọi là “atthabhañjanaka” (phá hoại lợi ích).
Piyasuññakaraṇato pisuṇā, pisati pare satte hiṃsatīti vā pisuṇā.
It is pisuṇā (slanderous speech) because it makes pleasant things empty, or it is pisuṇā because it harms other beings.
Vì làm cho người thân trở nên xa lạ, nên gọi là pisuṇā (lời nói chia rẽ); hoặc vì làm hại chúng sanh khác nên gọi là pisuṇā.
Pharusāti lūkhā, niṭṭhurāti attho.
Pharusā means rough, harsh.
Pharusā (thô ác) nghĩa là thô lỗ, bất nhẫn.
Niratthakanti attharahitaṃ attano paresañca hitavinimuttaṃ.
Niratthaka means devoid of meaning, separated from one's own and others' welfare.
Niratthaka (vô ích) nghĩa là không có lợi ích, không mang lại lợi lạc cho bản thân và người khác.
Micchāti viparītā niccādivasena pavattiyā.
Micchā means contrary to the nature of permanence, etc.
Micchā (tà) nghĩa là trái ngược với sự vận hành theo thường, v.v.
Pāpikāti lāmikā.
Pāpikā means vile.
Pāpikā (ác) nghĩa là thấp kém.
Ekantākusalatāya viññūhi buddhādīhi garahitā.
It is reprehended by the wise such as the Buddhas, due to its inherent unwholesomeness.
Vì hoàn toàn bất thiện, nên bị những bậc trí như chư Phật chê bai.
Natthi dinnanti ādivatthukāyāti dasavatthukamicchādiṭṭhimāha.
By "there is no giving," etc., it refers to the wrong view (micchādiṭṭhi) consisting of ten items.
“Không có sự bố thí” và những điều tương tự, là nói về tà kiến mười điều.
Natthikabhāvābhinivesanavasena kammapathappattiyevassā kammapathapariyāpannatā.
Its inclusion in the path of action is due to its attainment of the path of action through adherence to non-existence.
Kammapathapariyāpannatā (thuộc về nghiệp đạo) của nó là do sự chấp thủ vào trạng thái không hiện hữu, thuộc về nghiệp đạo.
‘‘Rūpaṃ attā’’’tiādinayappavattā attadiṭṭhi maggantarāyakarattā aniyyānikadiṭṭhi.
The view of self (attadiṭṭhi) that arises in the manner of "form is self," etc., is an unleading view because it obstructs the path.
Tự kiến (attadiṭṭhi) vận hành theo cách “sắc là ngã” và những điều tương tự, vì cản trở con đường, nên là aniyyānikadiṭṭhi (tà kiến không đưa đến giải thoát).
Aniyyānikattā eva hissā micchattapariyāpannatā.
Its inclusion in wrongness (micchatta) is precisely because it is unleading.
Chính vì không đưa đến giải thoát nên nó thuộc về tà kiến.
Sammāti aviparītā, tato eva sobhanā sundarā, buddhādīhi pasatthattā viññuppasatthā.
Sammā means not contrary, and for that very reason it is auspicious, beautiful, and praised by the wise due to being extolled by Buddhas and others.
Sammā (chánh) nghĩa là không trái ngược, và do đó là tốt đẹp (sobhanā), được chư Phật tán thán nên được những bậc trí tán thán (viññuppasatthā).
Sesamettha micchādiṭṭhiyaṃ vuttanayena veditabbaṃ.
The rest here should be understood in the manner stated for wrong view (micchādiṭṭhi).
Những phần còn lại ở đây nên được hiểu theo cách đã nói về tà kiến.
Asubhādīsu subhādiākāraggahaṇato ayāthāvaaniyyānikā ayoniso uppattiyā.
It is not truly leading because of the inappropriate arising of the perception of beauty and other aspects in unbeautiful things, etc.
Do chấp thủ các tướng tốt đẹp, v.v. trong các tướng bất tịnh, v.v., nên là ayāthāvaaniyyānikā (không đúng như thật, không đưa đến giải thoát) do sinh khởi phi như lý.
Akusalāti ayāthāvāaniyyānikā akusalā saṅkappā.
Unwholesome refers to not truly leading, unwholesome thoughts.
Akusalā (bất thiện) là các tư duy (saṅkappa) không đúng như thật, không đưa đến giải thoát, bất thiện.
Esa nayoti iminā ‘‘ayāthāvā aniyyānikā akusalā vācā’’tiādinā tattha tattha ayāthāvādiatthaṃ atidisati.
This is the method means that in this way, it extends the meaning of "not truly leading," etc., to "not truly leading, unwholesome speech," etc., in various places.
Esa nayo (cũng vậy) là chỉ ra ý nghĩa “không đúng như thật, không đưa đến giải thoát, bất thiện” ở mỗi chỗ, như “lời nói không đúng như thật, không đưa đến giải thoát, bất thiện”, v.v.
Vācāti cetanā adhippetā, tathā kammantājīvāsati ca.
Speech refers to volition, and similarly for action, livelihood, and mindfulness.
Vācā (lời nói) được hiểu là ý chí (cetanā), cũng như kammantājīvāsati (hành động, sinh kế, niệm).
Yebhuyyena atītānussaraṇavasena pavattito ‘‘atītaṃ cintayato’’ti vuttaṃ.
It is said "one who contemplates the past" because it generally arises through remembering the past.
Vì phần lớn vận hành theo sự hồi tưởng quá khứ, nên được nói là “atītaṃ cintayato” (khi suy nghĩ về quá khứ).
Tathā hi loke evaṃ vadanti ‘‘yaṃ me pahūtaṃ dhanaṃ ahosi, taṃ pamādavasena pana bahuṃ khīṇa’’nti.
Just as people say in the world, "The abundant wealth I had was much diminished through negligence."
Như vậy, người đời thường nói: “Số tài sản lớn mà ta có đã bị hao mòn nhiều do sự phóng dật.”
Satipatirūpakenāti ‘‘cirakatampi cirabhāsitampi saritā’’ti evaṃ vuttasatuppattipatirūpakena.
By a semblance of mindfulness refers to a semblance of the arising of mindfulness as stated, "one remembers what was done long ago and said long ago."
Satipatirūpakena (tương tự niệm) nghĩa là tương tự với sự sinh khởi niệm đã nói như “nhớ được điều đã làm lâu, đã nói lâu”.
Uppattinti cittuppattiṃ.
Arising refers to the arising of consciousness.
Uppatti (sự sinh khởi) là sự sinh khởi của tâm.
Tathāpavattacittuppādo hi micchāsati.
Indeed, such an arising of consciousness is wrong mindfulness (micchāsati).
Sự sinh khởi tâm vận hành như vậy chính là tà niệm (micchāsati).
Sā pana kodhavasena vā ‘‘akkocchi maṃ avadhi ma’’ntiādinā (dha. pa. 3) upanayhantassa, rāgavasena vā ‘‘yānissa tāni pubbe mātugāmena saddhiṃ hasitalapitakīḷitāni anussaratī’’ti (a. ni. 7.50) vuttanayena subhato anussarantassa, diṭṭhivasena vā ‘‘so kho pana me atto nicco dhuvo’’tiādinā micchāabhinivisantassāti evamādinā nayena pavattatīti veditabbā.
That* should be understood to arise either through anger, for instance, in one who harbors resentment with thoughts like "He abused me, he struck me," or through lust, as described in the phrase "remembering the smiles, talks, and play he formerly had with women," seeing them as beautiful, or through wrong view, for instance, in one who wrongly clings to the idea that "this self of mine is permanent, stable," and so on.
Nên biết rằng tà niệm ấy vận hành theo cách này: do sân hận, như người ôm lòng thù hận “nó mắng ta, nó đánh ta” (Dhp. 3); hoặc do tham ái, như người hồi tưởng một cách tốt đẹp những điều đã nói, đã cười, đã vui chơi với phụ nữ trước đây (A.N. 7.50); hoặc do tà kiến, như người chấp thủ sai lầm “ngã của ta là thường còn, bất biến”, v.v.
Upāyacintāvasenāti khippajālakumināduhalādiupakaraṇasaṃvidhānādīsu yutticintanādivasena pāpaṃ katvā vippaṭisāranimittaṃ, ‘‘sukataṃ mayā’’ti pāmojjanimittaṃ katvā paccavekkhaṇākārena moho aññāṇaṃ.
Through contemplation of expedients means by contemplating expedients for arranging equipment like quick fishing nets and traps, and so on; after doing evil resulting in remorse, the delusion of ignorance arises in the manner of reflection that "it was well done by me," resulting in joy.
Upāyacintāvasena (do suy nghĩ về phương tiện), tức là do suy nghĩ về sự sắp xếp các phương tiện như lưới, bẫy, v.v. để làm điều ác (pāpaṃ katvā) với mục đích hối hận, hoặc “sukataṃ mayā” (ta đã làm tốt) với mục đích hoan hỷ, thì vô minh (moha) là sự không biết dưới dạng sự quán xét (paccavekkhaṇā).
Tattha pana ‘‘asive sivā’’ti vohāro viya ñāṇavohāro.
There, however, it is a designation of knowledge, similar to the designation of "auspicious" for inauspicious things.
Ở đây, đó là cách gọi của trí tuệ, giống như cách gọi “tốt lành trong điều không tốt lành”.
Micchāsabhāvattā pana micchāñāṇaṃtveva vuccati.
But because of its wrong nature, it is called wrong knowledge.
Tuy nhiên, vì bản chất là tà, nên nó được gọi là micchāñāṇaṃ (tà trí) mà thôi.
Ekūnavīsatibhedaṃ paccavekkhaṇañāṇaṃ sammā pekkhitattā sammāñāṇaṃ vuccati, itaraṃ pana jhānādipaccavekkhaṇañāṇaṃ sammādiṭṭhiyāva saṅgayhati.
Reflection-knowledge (paccavekkhaṇañāṇa) of nineteen kinds is called right knowledge because it is reflected upon correctly; other jhāna-reflection-knowledge, however, is included in right view itself.
Trí quán xét mười chín loại được gọi là sammāñāṇaṃ (chánh trí) vì đã quán xét đúng đắn; còn trí quán xét thiền định, v.v. thì thuộc về chánh kiến (sammādiṭṭhi) mà thôi.
Rūpārūpasamāpattilābhitāmattena vaṭṭato avimuttāyeva samānā ‘‘vimuttā maya’’nti evaṃsaññino.
Though they are not liberated, they imagine themselves to be liberated merely by having attained form and formless attainments, being still bound by the round of existence.
Chỉ với việc đạt được các định sắc giới và vô sắc giới, họ vẫn còn trong luân hồi, “avimuttāyeva samānā ‘vimuttā maya’nti evaṃsaññino” (dù chưa giải thoát nhưng vẫn có nhận thức rằng “chúng ta đã giải thoát”).
Pakatipurisantarañāṇasaṅkhātāyaṃ, guṇaviyuttassa attano sakattani avaṭṭhānasaṅkhātāyaṃ, attano mahābrahmunā salokatā tassa samīpatāsaṃyujjanasaṅkhātāyaṃ vā avimuttiyaṃ vimuttisaññino.
They perceive liberation in non-liberation, which is reckoned as knowledge different from that of ordinary people, or as the non-abiding of oneself, devoid of qualities, in one's own nature, or as being in the same realm as Mahābrahmā, or as closeness to him.
Vimuttisaññino (nhận thức về sự giải thoát) trong sự chưa giải thoát này là: sự hiểu biết về những người khác, sự không an trú của bản thân không có đức hạnh, hoặc sự kết nối của bản thân với Đại Phạm Thiên, sự gần gũi với Ngài.
Ekantākusalatāya hīnattā pāpikā.
It is vile because of its inferiority due to being inherently unwholesome.
Vì hoàn toàn bất thiện nên là thấp kém, pāpikā (ác).
Ayāthāvatāya viparītā.
It is contrary because it is not as it truly is.
Vì không đúng như thật nên là viparītā (trái ngược).
Yathāvuttenāti ‘‘avimuttāyeva samānā’’ti vuttappakārena.
In the manner stated refers to the way expressed as "though they are not liberated."
Yathāvuttena (theo cách đã nói) là theo cách đã nói “dù chưa giải thoát”.
‘‘Mayamettha sammādiṭṭhi bhavissāmā’’tiādīsu phalasammādiṭṭhiādīnipi maggasammādiṭṭhiādipakkhikānevāti adhippāyena ‘‘phalasampayuttāni…pe… veditabbā’’ti vuttaṃ.
In phrases such as "Here we shall be of right view," it is stated that " associated with fruit...etc....should be understood" with the intention that even fruit-right view, etc., are on the side of path-right view, etc.
Trong các câu “chúng ta sẽ có chánh kiến ở đây” và những câu tương tự, các loại chánh kiến quả (phalasammādiṭṭhi), v.v. cũng thuộc về các loại chánh kiến đạo (maggasammādiṭṭhi), v.v. với ý nghĩa đó, nên được nói là “phalasampayuttāni…pe… veditabbā” (liên hệ đến quả…v.v… nên được hiểu).
Sabbepi pana phaladhamme vimuttikkhandhasaṅgahato ‘‘vimuttī’’ti vuccamāne na koci virodho.
And there is no contradiction if all fruit-dharmas are called "liberation" as they are included in the aggregate of liberation.
Tuy nhiên, nếu tất cả các pháp quả được gọi là “giải thoát” (vimutti) vì chúng thuộc về uẩn giải thoát (vimuttikkhandha), thì không có gì mâu thuẫn.
Ettha sammāvimuttisaṅkhāte sallekhavatthumhi.
Here, in the matter of purification, which is called right liberation.
Ở đây, trong đối tượng gọt giũa (sallekhavatthu) được gọi là chánh giải thoát (sammāvimutti).
Yadi nīvaraṇavasena vuttāni, tasmā tīṇeva vuttānīti āha ‘‘abhijjhālū’’tiādi.
If they are stated in terms of hindrances, therefore only three are stated, as in " covetous," etc.
Nếu nīvaraṇavasena vuttāni (được nói theo cách của các triền cái), do đó chỉ có ba điều được nói, nên nói “abhijjhālū” (tham lam), v.v.
Pariyuṭṭhānappattā thinamiddhapariyuṭṭhitā.
They are overcome by sloth and torpor because they have reached the stage of being overwhelmed.
Đạt đến trạng thái bị bao vây là thinamiddhapariyuṭṭhitā (bị hôn trầm, thụy miên bao vây).
Yassa dhammassa atthitāya uddhatā nāma honti, so dhammo uddhaccanti āha ‘‘uddaccena samannāgatāti uddhatā’’ti.
That quality by the existence of which one is called agitated (uddhata), that quality is agitation (uddhacca), he says: " agitated are those who are accompanied by agitation."
Pháp mà do sự hiện hữu của nó mà người ta trở nên phóng dật, pháp đó là phóng dật. Nên nói: “uddaccena samannāgatāti uddhatā” (được phóng dật bao gồm là phóng dật).
Vicinantāti dhammoti vā adhammoti vā ādinā yaṃ kiñci sabhāvaṃ vinicchinantā.
Investigating means discerning any nature, whether it is Dhamma or not Dhamma, etc.
Vicinantā (tìm kiếm) nghĩa là phân tích bất cứ bản chất nào, dù là pháp hay phi pháp.
Upanāhanasīlāti parassa attano citte anubandhanasīlā.
Accustomed to tying knots means accustomed to binding others' minds and one's own.
Upanāhanasīlā (có thói quen ôm ấp) nghĩa là có thói quen cột chặt vào tâm của người khác và của chính mình.
Issantīti usūyanti.
Issanti means they are envious.
Issanti (ganh tị) nghĩa là đố kỵ.
Saṭhayantīti saṭhā aññathā attānaṃ aññathā pavedanakā.
Saṭhayanti are saṭhā (deceitful), those who present themselves as other than what they are.
Saṭhayanti (lừa dối) nghĩa là saṭhā (gian xảo), những người tự tuyên bố mình khác với thực tế.
Te pana yasmā na yathābhūtavādino, tasmā āha ‘‘na sammā bhāsantīti vuttaṃ hotī’’ti.
But since they are not speakers of the truth, it is said: " it means they do not speak correctly."
Vì những người ấy không nói đúng sự thật, nên nói “na sammā bhāsantīti vuttaṃ hotī” (nghĩa là không nói đúng đắn).
Vuttapaccanīkanayenāti ‘‘na kodhanā akkodhanā’’tiādinā vuttaatthapaṭipakkhanayena.
By the method of the opposite of what was stated refers to the method of the opposite meaning of what was stated, as in "not irritable, un-irritable," etc.
Vuttapaccanīkanayena (theo cách đối nghịch đã nói) là theo cách đối nghịch với ý nghĩa đã nói như “không sân hận, không giận dữ”, v.v.
Dukkhaṃ vaco etesu vippaṭikūlaggāhitāya vipaccanīkagāhesūti dubbacā.
Difficult speech (dukkha vaco) for those who hold to opposing views, thus dubbacā (hard to admonish).
Lời nói khó nghe trong những điều này, do chấp thủ những điều trái ngược, nên là dubbacā (khó dạy).
Te pana vacanakkhamā na hontīti āha ‘‘vattuṃ dukkhā’’tiādi.
They are not amenable to admonition, so it is said: " difficult to speak to," etc.
Vì những người ấy không dễ nghe lời, nên nói “vattuṃ dukkhā” (khó nói), v.v.
Hīnācāratāya dukkhassa vā sampāpakatāya pāpakā.
Evil (pāpakā) due to their lowly conduct or because they bring about suffering.
Vì hành vi thấp kém hoặc vì mang lại khổ đau, nên là pāpakā (ác).
Asaddhammavasenāti asappurisadhammavasena.
By way of unwholesome qualities means by way of qualities of ignoble persons.
Asaddhammavasena (theo cách của phi pháp) là theo cách của pháp của người không tốt.
Attanā visesitabbavasena kāyaviññattiādīnaṃ kāyakammadvārādibhāvo viya assaddhiyādiasaddhammasamannāgamenaasataṃ asappurisānaṃ dhammānanti tāniyeva assaddhiyādīni asaddhammā nāma, tesaṃ vasenāha ‘‘saddhā etesaṃ natthī’’ti yathā taṃ ‘‘duppaññā’’ti.
Just as the qualities of bodily intimation, etc., are aspects of the door of body-action, etc., as determined by oneself, so too, the unwholesome qualities like lack of faith are the qualities of unnoble, ignoble persons who are endowed with lack of faith, etc.; by way of these, he says, " they have no faith," just like "lacking wisdom."
Giống như sự biểu lộ thân (kāyaviññatti), v.v. trở thành cửa thân nghiệp (kāyakammadvāra), v.v. theo cách mà chúng được phân biệt, thì các pháp của người không tốt (asappurisa) do được bao gồm bởi phi pháp như vô tín (assaddhiyādi), v.v. chính là các phi pháp (asaddhamma) như vô tín, v.v. Theo cách của chúng, nên nói “saddhā etesaṃ natthī” (những người này không có đức tin), giống như “duppaññā” (kém trí tuệ).
Suttageyyādi appaṃ sutaṃ etesanti appassutā, sutena anupapannā.
Appassutā (of little learning) are those who have little learning in suttas, geyyas, etc., unendowed with learning.
Appassutā (ít học) là những người có ít điều được nghe như kinh, kệ, v.v., không có sự học vấn.
Natthīti gahetabbanti iminā abhāvattho ayaṃ appa-saddo ‘‘appaḍaṃsamakasavātātapasarīsapasamphassāna’’ntiādīsu (a. ni. 10.11) viyāti dasseti.
It should be understood as "there is not" by this, it shows that this word appa- has the meaning of absence, as in "from the touch of gnats, mosquitoes, wind, sun, and creeping things," etc.
Natthīti gahetabba (nên hiểu là không có) là chỉ ra rằng từ “appa” (ít) này có nghĩa là không hiện hữu, giống như trong “appaḍaṃsamakasavātātapasarīsapasamphassānaṃ” (không bị muỗi, ruồi, gió, nắng, rắn rết chạm vào), v.v.
Sammāpaṭipattiyā anārambhanato kucchitā gārayhā sīdanti osīdanti saṃkilesapakkheti kusītā da-kārassa ta-kāraṃ katvā.
They are contemptible, reprehensible, they sink, they are submerged into the side of defilements, kusītā (indolent), having changed the da- to ta-.
Vì không bắt đầu chánh hạnh, nên kucchitā (đáng ghê tởm), đáng bị quở trách, sīdanti (chìm đắm), chìm đắm trong phe phiền não, là kusītā (biếng nhác) bằng cách biến âm d thành t.
Akusalānaṃ dhammānaṃ pahānāya kusalānaṃ dhammānaṃ upasampadāya āraddhaṃ paggahitaṃ vīriyaṃ etesanti āraddhavīriyā.
Āraddhavīriyā (of aroused energy) are those whose energy is aroused and sustained for the abandoning of unwholesome states and the attainment of wholesome states.
Āraddhavīriyā (tinh tấn) là những người có vīriyaṃ (tinh tấn) āraddhaṃ (được bắt đầu), được nắm giữ để từ bỏ các pháp bất thiện và thành tựu các pháp thiện.
Anuppādanena muṭṭhā naṭṭhā sati etesanti muṭṭhassatī.
Muṭṭhassatī (of lost mindfulness) are those whose mindfulness is lost, destroyed, by not being produced.
Do không sinh khởi, muṭṭhā (mất), niệm bị mất, etesanti muṭṭhassatī (những người này là thất niệm).
Duṭṭhāti dūsitā.
Duṭṭhā means corrupted.
Duṭṭhā (hư hỏng) nghĩa là bị làm hư hại.
Duppaññā nāma dūsitabhāvo paṭipakkhena vināsitabhāvoti āha ‘‘naṭṭhapaññāti vuttaṃ hotī’’ti.
Lacking wisdom (duppaññā) means having a corrupted state, a state destroyed by its opposite, he says: " it means having lost wisdom."
Duppaññā (kém trí tuệ) nghĩa là trạng thái bị hư hại, trạng thái bị hủy hoại bởi đối nghịch, nên nói “naṭṭhapaññāti vuttaṃ hotī” (nghĩa là trí tuệ bị hủy hoại).
Heṭṭhā sammādiṭṭhiggahaṇena kammassakatāpaññāya maggasammādiṭṭhiyā ca gahitattā subbacakalyāṇamittatāparivārāhi idha saddhādīhi vipassanāsambhārassa uddhaṭattā ca vuttaṃ ‘‘idha vipassanāpaññā veditabbā’’ti.
Since the wisdom of kamma-ownership and path-right view were previously included by the mention of right view, and since the requisites for insight are here brought forth by faith, etc., accompanied by being easy to admonish and having noble friends, it is said: " here, insight-wisdom should be understood."
Vì ở dưới chánh kiến đã bao gồm trí tuệ về nghiệp (kammassakatāpaññā) và chánh kiến đạo (maggasammādiṭṭhi), và ở đây các yếu tố của tuệ quán (vipassanāsambhāra) đã được nêu ra qua đức tin (saddhā), v.v. với sự bạn bè tốt đẹp (kalyāṇamittatā) dễ dạy, nên nói “idha vipassanāpaññā veditabbā” (ở đây nên hiểu là tuệ quán).
Tenāha ‘‘vipassanāsambhāro hī’’tiādi.
Therefore it is said: "For it is the prerequisite for insight," and so on.
Do đó, ngài nói: "Vì các yếu tố của thiền quán," v.v.
Yuttiṃ anapekkhitvāpi ayamattho gahetabboti dassento āha ‘‘porāṇānaṃ āṇā’’ti.
Showing that this meaning should be taken even without expecting logic, it is said: "It is the command of the ancients."
Để chỉ rõ rằng ý nghĩa này nên được chấp nhận ngay cả khi không xem xét lý lẽ, ngài nói: "Đây là lời dạy của các bậc cổ đức."
Lokuttaraguṇānaṃ antarāyakaranti lokuttaraguṇānaṃ adhigamassa antarāyakaraṃ.
"An obstacle to supramundane qualities" means an obstacle to the attainment of supramundane qualities.
Là chướng ngại cho các pháp siêu thế có nghĩa là chướng ngại cho sự chứng đắc các pháp siêu thế.
Sandiṭṭhinti saṃ attano diṭṭhiṃ, yaṃ vā taṃ vā attanā yathāgahitadiṭṭhinti attho.
"One's own view" means one's own view, or whatever view has been grasped by oneself.
Sandiṭṭhi là cái thấy của chính mình, nghĩa là bất kỳ cái thấy nào mà mình đã chấp thủ.
Sabhāvaṃ atikkamitvā parato āmasanato parāmāsī.
Grasping (parāmāsī) means touching it as something other than its true nature.
Vì chạm vào từ bên ngoài, vượt quá bản chất, nên là parāmāsī (chấp thủ).
Daḷhaggāhīti ‘‘idameva sacca’’nti thiraggāhaggāhī.
"Holding firmly" means holding firmly with the thought, "This alone is true."
Daḷhaggāhī là người chấp thủ vững chắc, nói rằng: "Chỉ điều này là sự thật."
Paṭinissaggīti paṭinissajjanako.
"Renouncer" means one who gives up.
Paṭinissaggī là người từ bỏ.
Kummovāti yathā kacchapo attano pādādike aṅge kenaci ghaṭṭito sabbāni aṅgāni attano kapāleyeva samodahati, na bahi nīharati, evamayampi ‘‘na sundaro tava gāho, chaḍḍehi na’’nti vutto taṃ na vissajjeti.
"Like a tortoise" means that just as a tortoise, when struck by something on its feet or other limbs, withdraws all its limbs into its shell and does not put them out, so too, when told "Your view is not good, abandon it," this one does not give it up.
Như con rùa – ví như con rùa khi bị ai đó chạm vào chân hoặc các bộ phận khác của cơ thể, nó thu tất cả các bộ phận vào mai của mình, không đưa ra ngoài; cũng vậy, người này khi được nói: "Sự chấp thủ của ông không tốt, hãy từ bỏ nó," thì không từ bỏ nó.
Antoyeva attano hadaye eva ṭhapetvā taṃ vadati.
"Inside only" means he keeps it in his heart and speaks of it.
Antoyeva (chỉ bên trong) là giữ nó trong lòng mình rồi nói ra.
Kumbhīlaggāhanti saṃsumāraggāhaṃ.
"Crocodile's grasp" means the grasp of a crocodile.
Kumbhīlaggāha là sự chấp thủ của cá sấu.
Gaṇhantīti yathā saṃsumārā gahitaṃ na vissajjenti, evaṃ gaṇhanti.
"They grasp" means that just as crocodiles do not release what they have grasped, so do they grasp.
Gaṇhantī (họ nắm giữ) là như cá sấu không nhả ra những gì đã nắm giữ, họ cũng nắm giữ như vậy.
84. Evaṃ catucattālīsāya ākārehīti avihiṃsanādīhi catuadhikacattālīsappakārehi.
84. "In these forty-four ways" means in the forty-four ways beginning with non-harming.
84. Như vậy, với bốn mươi bốn phương cách là với bốn mươi bốn cách thức như không làm hại, v.v.
Kasmā panettha avihiṃsā ādito vuttā?
Why is non-harming mentioned first here?
Vì sao ở đây không làm hại được nói trước tiên?
Sabbaguṇānaṃ mūlabhāvato.
Because it is the root of all good qualities.
Vì đó là cội rễ của tất cả các thiện pháp.
Avihiṃsāti hi karuṇāyetaṃ adhivacanaṃ, sā ca visesato sīlassa mūlakāraṇaṃ parūpaghātalakkhaṇā dussīlyā oramāpanato.
For non-harming is a term for compassion, and it is a special root cause of morality, as it prevents immorality characterized by harming others.
Thật vậy, không làm hại là tên gọi khác của lòng bi mẫn, và nó đặc biệt là nguyên nhân gốc rễ của giới, vì nó ngăn chặn sự ác giới có đặc tính làm hại người khác.
Yathā hi pāṇātipāto parūpaghātalakkhaṇo, tathā paresaṃ sāpateyyāvaharaṇaṃ, sattippahāratopi dhanassāvahāro garutaroti.
For just as the destruction of life is characterized by harming others, so is the taking of others' property; indeed, the taking of wealth is even more serious than striking a blow.
Ví như sát sinh có đặc tính làm hại người khác, thì việc cướp tài sản của người khác cũng vậy; và việc cướp tài sản còn nặng hơn cả việc đâm chém bằng vũ khí.
Tathā abrahmacariyaṃ gabbhadhāraṇādidukkhāvahanato, paradārātikkame pana vattabbameva natthi.
Similarly, unchastity brings the suffering of pregnancy and so on; as for adultery, there is no need to speak further.
Cũng vậy, tà hạnh có đặc tính mang lại đau khổ như mang thai, v.v.; còn đối với việc tà dâm với vợ người khác thì không cần phải nói nữa.
Paresaṃ visaṃvādanabhedanamammaghaṭṭanānaṃ parūpaghātabhāvo pākaṭo eva, samphappalāpo atthaggāhāpanato anatthuppādanato, abhijjhā adinnādānādihetuto, byāpādo pāṇātipātādihetuto, micchādiṭṭhi sabbānatthahetuto parūpaghātalakkhaṇā, micchādiṭṭhi dhammikapaṭiññopi pāṇātipātādīni karoti, pare ca tattha niyojeti, kimaṅgaṃ pana itare.
The harming of others through deceit, division, and cutting remarks is evident; frivolous talk leads to the loss of benefit and the arising of disadvantage; covetousness is the cause of taking what is not given and so on; ill-will is the cause of the destruction of life and so on; wrong view, being the cause of all disadvantages, is characterized by harming others. Even with a righteous claim, wrong view leads to the destruction of life and so on, and compels others to do likewise; what then of the others?
Việc nói dối, chia rẽ, đâm chọc vào chỗ yếu của người khác có đặc tính làm hại người khác là điều hiển nhiên; nói lời vô ích là vì làm mất ý nghĩa và gây ra điều bất lợi; tham lam là nguyên nhân của trộm cắp, v.v.; ác ý là nguyên nhân của sát sinh, v.v.; tà kiến là nguyên nhân của tất cả điều bất lợi, có đặc tính làm hại người khác; tà kiến, ngay cả khi tự xưng là chánh pháp, vẫn gây ra sát sinh, v.v., và còn xúi giục người khác làm điều đó, huống chi những điều khác.
Vihiṃsalakkhaṇā dussīlyā oramā avihiṃsalakkhaṇā visesato sīlassa balavakāraṇaṃ.
Abstaining from immorality characterized by harming is a particularly strong cause for morality, characterized by non-harming.
Việc từ bỏ ác giới có đặc tính làm hại là nguyên nhân mạnh mẽ đặc biệt của giới có đặc tính không làm hại.
Sīlapadaṭṭhāno ca samādhi, samādhipadaṭṭhānā ca paññāti sabbaguṇānaṃ mūlabhūtā avihiṃsā.
And concentration is founded upon morality, and wisdom is founded upon concentration; thus non-harming is the root of all good qualities.
Và định có nền tảng là giới, tuệ có nền tảng là định; như vậy, không làm hại là cội rễ của tất cả các thiện pháp.
Apica uḷārajjhāsayānaṃ nisammakārīnaṃ dhīrānaṃ uttamapurisānaṃ sīlaṃ viya samādhipaññāpi paresaṃ hitasukhāvahāva sampajjantīti evampi karuṇā sabbaguṇānaṃ mūlanti sā ādito vuttā.
Moreover, just as the morality, concentration, and wisdom of noble persons—those with excellent intentions, who act discerningly, the wise—conduce to the welfare and happiness of others, so too is compassion the root of all good qualities; therefore, it is mentioned first.
Hơn nữa, cũng như giới, định và tuệ của những người có ý chí cao thượng, hành động thận trọng, những bậc trí tuệ, những bậc thượng nhân, đều mang lại lợi ích và hạnh phúc cho người khác; như vậy, bi mẫn là cội rễ của tất cả các thiện pháp, nên nó được nói trước tiên.
Tato paraṃ visesato ‘‘avihiṃsāsamuṭṭhānā ime dhammā’’ti dassanatthaṃ kusalakammapathadhammā gahitā.
After that, the wholesome courses of action (kusalakammapatha) are taken to specifically show that "these mental states arise from non-harming."
Sau đó, các pháp thiện nghiệp đạo được nêu ra để đặc biệt chỉ rõ: "Những pháp này phát sinh từ sự không làm hại."
Tato idaṃ guṇānaṃ mūlabhūtaṃ sīlaṃ, ettha patiṭṭhitena ime dhammā uppādetabbāti dassanatthaṃ aṭṭha sammattā gahitā.
Then, to show that morality is the root of these qualities, and that these qualities should be generated by one established therein, the eight right qualities are taken.
Sau đó, tám chánh được nêu ra để chỉ rõ rằng giới này là cội rễ của các thiện pháp, và các pháp này phải được phát sinh bởi người đã an trú trong giới này.
Tesaṃ visodhanāya paṭipannassa ādito evaṃ hotīti dassanatthaṃ nīvaraṇaviveko gahito, ādito nīvaraṇadvayassa aggahaṇe gahitāgahitakāraṇaṃ aṭṭhakathāya vuttameva.
To show that such is the case for one who initially practices for their purification, the removal of hindrances (nīvaraṇa-viveka) is taken. The reason for taking or not taking the two hindrances initially is already stated in the Commentary.
Để chỉ rõ rằng đối với người thực hành để thanh lọc chúng, ban đầu sẽ như thế này, sự tách rời khỏi các triền cái được nêu ra; lý do không nêu ra hai triền cái ban đầu đã được nói trong Aṭṭhakathā về việc cái nào được nêu ra và cái nào không.
Kodhassa pana byāpādato bhedo vatthasuttavaṇṇanāyaṃ (ma. ni. aṭṭha. 1.71) vuttanayeneva veditabbo.
The distinction of anger from ill-will should be understood in the manner stated in the commentary on the Vatthasutta.
Sự khác biệt giữa sân và ác ý cần được hiểu theo cách đã nói trong Vatthasuttavaṇṇanā (Ma. Ni. Aṭṭha. 1.71).
Kodhādippahānena cettha sallekhasiddhīti dassanatthaṃ tato upakkilesavisuddhi gahitā.
Here, to show that purification is achieved by abandoning anger and so on, the purification from defilements (upakkilesavisuddhi) is taken thereafter.
Sau đó, sự thanh tịnh các cấu uế được nêu ra để chỉ rõ rằng sự thành tựu của sự tự thanh lọc (sallekha) ở đây là do sự đoạn trừ sân hận, v.v.
Sā ca subbacakalyāṇamittaappamattatāhi sijjhatīti dassanatthaṃ pakiṇṇakā gahitā.
And to show that this is achieved through tractability, good friendship, and diligence, miscellaneous qualities are taken.
Và để chỉ rõ rằng điều đó thành tựu nhờ sự dễ dạy, bạn lành và không phóng dật, các pháp tạp được nêu ra.
Sampannasovacassatādiguṇassa ime dhammā pāripūriṃ gacchanti, vipassanaṃ paribrūhetvā ariyamaggādhigamāya saṃvattantīti dassanatthaṃ saddhammā gahitā.
To show that these mental states bring to perfection the qualities of excellent tractability and so on, and conduce to the attainment of the noble path by developing insight, the good qualities (saddhammā) are taken.
Để chỉ rõ rằng những pháp này đạt đến sự viên mãn cho người có các đức tính như dễ dạy đầy đủ, và chúng dẫn đến sự chứng đắc Thánh đạo bằng cách phát triển thiền quán, các chánh pháp (saddhamma) được nêu ra.
Evaṃbhūtassa ayaṃ micchāgāho lokuttaraguṇādhigamassa antarāyakaro, tasmā so dūrato vajjetabbo, evaṃ yathāvuttāya sammāpaṭipattiyā ariyamaggaṃ adhigacchanto sallekhaṃ matthakaṃ pāpetīti dassanatthaṃ ‘‘sandiṭṭhiparāmāsī’’tiādi vuttanti evametesaṃ catucattālīsāya sallekhākārānaṃ gahaṇapayojanaṃ anupubbī ca veditabbā.
Such a wrong grasping as this is an obstacle to the attainment of supramundane qualities; therefore, it should be avoided from afar. To show that one who attains the noble path through the right practice as described brings purification to its culmination, it is said "one who grasps with one's own view," and so on. Thus, the purpose and sequence of taking these forty-four aspects of purification should be understood.
Đối với người như vậy, sự chấp thủ sai lầm này là chướng ngại cho sự chứng đắc các pháp siêu thế, do đó nó phải được tránh xa; và để chỉ rõ rằng người chứng đắc Thánh đạo bằng cách thực hành chánh hạnh như đã nói sẽ đưa sự tự thanh lọc lên đến đỉnh cao, nên "sandiṭṭhiparāmāsī" (chấp thủ kiến chấp) v.v., đã được nói; như vậy, mục đích và trình tự của việc nêu ra bốn mươi bốn phương cách tự thanh lọc này cần được hiểu rõ.
Payogato sallekhapaṭipadaṃ paṭipajjituṃ asakkontānaṃ cittuppādopi bahūpakāroti āha ‘‘cittuppādassapi bahūpakārataṃ dassetu’’nti.
He says, "to show the great benefit of even a thought," because those unable to undertake the path of purification by practice can still gain great benefit from even a thought (cittuppāda).
Để chỉ rõ rằng ngay cả sự phát khởi tâm cũng có nhiều lợi ích đối với những người không thể thực hành con đường tự thanh lọc bằng hành động, ngài nói: "Để chỉ rõ sự phát khởi tâm cũng có nhiều lợi ích."
Kusalesu dhammesūti avihiṃsādīsu yathāvuttaanavajjadhammesu.
"In wholesome mental states" means in the blameless mental states as described, beginning with non-harming.
Trong các pháp thiện là trong các pháp vô tội như không làm hại, v.v., đã nói ở trên.
Anuvidhiyanāti cittuppādassa kāyavācāhi anuvidhānā.
"Following" means the following of the thought by body and speech.
Anuvidhiyanā là sự tùy thuận của phát khởi tâm bằng thân và khẩu.
Tesaṃ dhammānanti avihiṃsādidhammānaṃ, tesaṃ vā cittuppādavasena pavattadhammānaṃ.
"Of those mental states" means of the mental states beginning with non-harming, or of the mental states that occur by way of the thought.
Của các pháp ấy là của các pháp như không làm hại, v.v., hoặc của các pháp diễn tiến theo sự phát khởi tâm.
Idāni yathāvuttadhammaṃ vitthārato dassetuṃ ‘‘kasmā panā’’tiādi āraddhaṃ.
Now, to explain the aforementioned mental states in detail, "Why then..." and so on, is begun.
Bây giờ, để trình bày chi tiết các pháp đã nói, ngài bắt đầu với "Vì sao lại..."
Saraṇagamanaṃ vācāya viññāpetuṃ asakkontassa vasena vuttaṃ ‘‘kāyena vā’’ti.
"Or by body" is said concerning one who is unable to declare the taking of refuge by speech.
"Bằng thân" được nói trong trường hợp người không thể biểu lộ sự quy y bằng lời nói.
‘‘Sīlaṃ kāyena samādiyatī’’ti etthāpi eseva nayo.
The same method applies to "takes up morality by body."
Ở đây cũng vậy, trong câu "thọ giới bằng thân," nguyên tắc cũng tương tự.
Ettha ca tathā tathā pavattasallahukakāmāvacarakusalacittuppattiṃ upādāya tathārūpakusalakāyavacīkammānaṃ bahūpakāratā vuttāti na sabhāvato cittuppādassa bahūpakārataṃ ñāyatīti daṭṭhabbaṃ.
And here it should be understood that the great benefit of wholesome bodily and verbal actions of that kind is stated based on the arising of light-hearted sense-sphere wholesome thoughts of that kind, not that the thought itself is inherently greatly beneficial.
Và ở đây, cần hiểu rằng sự lợi ích lớn của các nghiệp thân và khẩu thiện như vậy được nói dựa trên sự phát sinh của các tâm thiện dục giới nhẹ nhàng diễn tiến theo cách đó, chứ không phải bản chất của sự phát khởi tâm có lợi ích lớn.
85. Hitādhigamāyāti diṭṭhadhammikādihitasampattiyā, ariyamaggādhigamāya eva vā.
85. "For the attainment of welfare" means for the attainment of welfare in this life and so on, or indeed for the attainment of the noble path.
85. Để chứng đắc lợi ích là để đạt được các thành tựu lợi ích như hiện tại, hoặc chỉ để chứng đắc Thánh đạo.
Ariyamaggo hi ekantahitattā hito nāma.
For the noble path is called welfare because it is exclusively beneficial.
Thật vậy, Thánh đạo được gọi là lợi ích vì nó là lợi ích tuyệt đối.
Parivajjanavasena kamanaṃ pavatti parikkamananti āha ‘‘parikkamanāya parivajjanatthāyā’’ti.
"Avoidance, for avoiding" means proceeding by way of avoiding, circumvention.
Sự đi lại theo cách tránh né, sự diễn tiến (pavatti), sự tránh né (parikkamana) có nghĩa là "để tránh né, để từ bỏ."
Sammādassanupāyasaṃvidhānena avihiṃsā paṭiyattā sammāsambuddhena.
"Non-harming has been prepared" by the Perfectly Self-Enlightened One by means of the arrangement of methods for right vision.
Không làm hại được sắp đặt bởi Đức Chánh Đẳng Giác với phương tiện và sự sắp xếp của chánh kiến.
Sukhenevāti akiccheneva.
"Easily" means without difficulty.
Dễ dàng là không khó khăn.
Eteneva upāyenāti eteneva avihiṃsāpade vuttena vidhinā.
"By this method" means by this very method stated in the non-harming section.
Với phương tiện này là với phương pháp đã nói trong mục không làm hại này.
Sabbapadānīti sesāni tecattālīsa padāni.
"All sections" means the remaining forty-three sections.
Tất cả các mục là ba mươi ba mục còn lại.
86. Akusalā paṭisandhiajanakā nāma uddhaccasahagatacittuppādadhammā aññepi pavattivipākamattadāyino, dinnāya paṭisandhiyā vipākajanakā, paccayavekallena vipaccituṃ aladdhokāsā ahosikammādayo vā ajanakā.
86. Unwholesome mental states are those which do not produce rebirth, such as thoughts accompanied by restlessness, and other mental states that only yield results in the course of existence; or those that do not produce rebirth, such as deeds that have lost their opportunity to ripen due to a lack of conditions.
86. Các pháp bất thiện là các pháp phát sinh tâm hợp với trạo cử không tạo tái sinh, và các pháp khác chỉ mang lại quả trong quá trình diễn tiến; các pháp tạo quả cho tái sinh đã được cho, hoặc các pháp như vô hiệu nghiệp (ahosikamma) không có cơ hội chín muồi do thiếu duyên, là các pháp không tạo tái sinh.
Jātivasenāti akusalajātivasena.
"By class" means by the class of unwholesome deeds.
Theo loại là theo loại bất thiện.
Adhobhāgaṅgamanīyāti apāyagamanīyā.
"Leading downwards" means leading to the lower realms.
Dẫn đến các cõi thấp là dẫn đến các cõi khổ.
Evaṃnāmāti nāmaggahaṇena sabhāvaṃ upalakkheti sati paccayasamavāye taṃsabhāvānativattanato.
"Of such a name" means that by taking the name, one discerns its nature, as its nature does not change when the conditions are present.
Có tên như vậy là chỉ ra bản chất bằng cách nêu tên, vì bản chất đó không thay đổi khi có đầy đủ các duyên.
Tenāha ‘‘vipākakāle aniṭṭhākantavipākattā’’ti.
Therefore it is said: "Because its result is undesirable and unpleasant at the time of fruition."
Do đó, ngài nói: "Vì có quả không mong muốn, không thích ý vào thời gian chín muồi."
Vuttanayeneva kusalapakkho veditabbo.
The wholesome side should be understood in the same way as described.
Phía thiện cần được hiểu theo cách đã nói.
Ayaṃ pana viseso, idha paṭisandhiajanakā abhiññāsahagatadhammā, sesaṃ vuttasadisameva.
But this is the distinction: here, the mental states accompanied by supernormal knowledge (abhiññā) do not produce rebirth; the rest is similar to what has been said.
Nhưng có sự khác biệt này: ở đây, các pháp hợp với thắng trí là những pháp không tạo tái sinh; phần còn lại tương tự như đã nói.
Sabbe akusalāti ettha vihiṃsamekaṃ ṭhapetvā itare sabbe akusalā upamābhūtā.
In "all unwholesome," all other unwholesome states, except for harming, are used as comparisons.
Tất cả các pháp bất thiện – ở đây, ngoại trừ sự làm hại, tất cả các pháp bất thiện khác đều là ví dụ.
Vihiṃsā hi upameyyaṃ.
For harming is the object of comparison.
Thật vậy, sự làm hại là đối tượng được ví.
Sabbe kusalāti etthāpi eseva nayo.
The same method applies to "all wholesome."
Tất cả các pháp thiện – ở đây cũng vậy, nguyên tắc tương tự.
Eteneva upāyenāti yathā vihiṃsānaṃ upameyyatā, tadavasesānaṃ kusalākusalānaṃ upamābhāvo vutto, iminā nayena akusalaṃ pāṇātipātādiakusalena itarena, kusalañca pāṇātipātāpaṭiviratiādikusalena itarena upametabbaṃ.
“Eteneva upāyenā” means that just as the comparability of harmful acts and the metaphorical nature of the remaining wholesome and unwholesome acts have been stated, in this way, unwholesome acts such as taking life should be compared with other unwholesome acts, and wholesome acts such as abstaining from taking life should be compared with other wholesome acts.
Eteneva upāyenā (theo cách này) là, như đã nói về sự so sánh của sự làm hại, thì trạng thái ví dụ của những điều thiện và bất thiện còn lại cũng vậy. Theo cách này, điều bất thiện nên được so sánh với điều bất thiện khác như sát sanh, v.v., và điều thiện nên được so sánh với điều thiện khác như sự kiêng cữ sát sanh, v.v.
87. Parinibbāpaneti kilesapariḷāhavūpasamane.
87. “Parinibbāpane” means in the appeasement of the defilement-fever.
87. Parinibbāpane (trong sự Niết-bàn hoàn toàn) là trong sự làm lắng dịu sự thiêu đốt của phiền não.
Parito limpanaṭṭhena palipaṃ vuccati mahākaddamaṃ, taṃ pana ekantato gambhīrampi hotīti ‘‘gambhīrakaddame nimuggo’’ti vuttaṃ.
A great swamp is called palipa because it smears all around; and since it is always deep, it is said: “sunk in a deep swamp.”
Với ý nghĩa là làm dơ bẩn khắp nơi, palipaṃ được gọi là bùn lầy lớn. Vì nó cũng cực kỳ sâu, nên đã nói “chìm trong bùn lầy sâu”.
Palipaṃ viya palipanti pañca kāmaguṇā vuccanti, tasmā evaṃ idāni vuccamānena upamopameyyasaṃsandananayena ettha imasmiṃ ṭhāne atthayojanā veditabbā.
The five sense-pleasures are called palipa, like a swamp. Therefore, here, in this context, the meaning should be understood by the method of comparing the simile and the object of comparison, which is now being stated.
Giống như bùn lầy, năm dục lạc được gọi là palipanti. Do đó, ở đây, trong chỗ này, sự giải thích ý nghĩa nên được hiểu theo cách tương quan giữa ví dụ và điều được ví dụ như đang được nói đến.
Na hi taṃ kāraṇanti ettha kāraṇaṃ nāma hatthassa vā pādassa vā apalipannabhāvo, so pana natthi.
“Na hi taṃ kāraṇaṃ” here, the reason is the state of the hand or foot not being smeared, but that does not exist.
Na hi taṃ kāraṇa (điều đó không phải là nguyên nhân) là, ở đây, nguyên nhân là trạng thái không bị lấm bùn của tay hay chân, nhưng điều đó không có.
Esa nayo upameyyepi.
This method applies to the object of comparison as well.
Cách này cũng tương tự với điều được ví dụ.
Tattha siyā kassaci parivitakko ‘‘bhagavato desanānubhāvena bhikkhuādayo kathentī’’ti.
“Tattha siyā” refers to someone’s thought: “Monks and others speak by the power of the Blessed One’s teaching.”
Tattha siyā (ở đây có thể có) là sự suy tư của một số người rằng “nhờ năng lực thuyết pháp của Đức Thế Tôn mà các tỳ-kheo, v.v. thuyết giảng”.
‘‘Bhagavāyeva hi tattha uddharatī’’ti vatvā upamāya tadatthaṃ vibhāvetuṃ ‘‘rañño’’tiādi vuttaṃ.
Having stated “Bhagavāyeva hi tattha uddharatī” (for indeed, the Blessed One alone lifts up there), “rañño” and so on was said to illustrate that meaning with a simile.
Sau khi nói “chính Đức Thế Tôn đã nâng lên ở đó”, để làm sáng tỏ ý nghĩa đó bằng ví dụ, thì đã nói “rañño” (của vua), v.v.
Puthujjanā tāvatiṭṭhantu, sāvakasikhāppattavisesānampi ariyānaṃ desanā satthuyeva desanāti dassetuṃ ‘‘kiñcāpī’’tiādimāha.
Let ordinary people stand aside; to show that the teaching of even those Noble Ones who have attained special accomplishments as disciples is the teaching of the Teacher himself, he says “kiñcāpi” and so on.
Hãy tạm gác lại những phàm nhân, để chỉ ra rằng lời dạy của các bậc Thánh đã đạt đến đỉnh cao của hàng Thanh văn cũng chính là lời dạy của Bậc Đạo Sư, nên đã nói “kiñcāpī” (mặc dù), v.v.
Tathā hi tehi desitasuttāni buddhavacanameva, tesaṃ desanāya laddhavisesāpi ariyā buddhaputtāyevāti.
For indeed, the suttas taught by them are the words of the Buddha, and the Noble Ones, who are the Buddha’s sons, are those who have attained special accomplishments through their teaching.
Thật vậy, những bài kinh được các vị ấy thuyết giảng chính là Phật ngôn, và những bậc Thánh đã đạt được sự đặc biệt nhờ lời dạy của các vị ấy cũng chính là Phật tử.
Anibbisatāyāti anibbisevanatāya.
“Anibbisatāyā” means by not engaging.
Anibbisatāyā (do không phục vụ) là do không phục vụ.
Asikkhitavinayatāyāti pañcannaṃ vinayānaṃ sādaraṃ asikkhitabhāvena.
“Asikkhitavinayatāyā” means by not carefully training in the five Vinayas.
Asikkhitavinayatāyā (do không học giới luật) là do không học năm giới luật một cách cung kính.
Te pana vinayā tissannaṃ sikkhānaṃ sikkhāpanena hotīti āha ‘‘tisso sikkhā sikkhāpessatī’’ti.
But those disciplines are for the teaching of the three trainings, thus he said, "He will teach the three trainings."
Vì những giới luật đó được thực hiện bằng cách học ba học pháp, nên đã nói “tisso sikkhā sikkhāpessatī” (sẽ dạy ba học pháp).
Kiṃ pana tanti?
"What then is that?"
Kiṃ pana taṃ (vậy điều đó là gì)?
‘‘Ṭhānametaṃ vijjatī’’ti ettha vuttaṃ kiṃ pana ṭhānanti āha ‘‘apalipapalipannatta’’ntiādi.
"This state exists" – what is that state mentioned here? He said, "unsoiled, unsoiled, established," and so on.
Điều được nói ở đây là “điều này có thể xảy ra”, vậy điều đó là gì? Đã nói “apalipapalipannatta” (do không bị lấm bùn và bị lấm bùn), v.v.
Yasmā pāḷiyaṃ ‘‘so vata cundā’’tiādinā sāmaññatthaṃ upamābhāvena gahetvā visesattho upameyyabhāvena vutto, tasmā tamatthaṃ ‘‘evamattho veditabbo’’tiādinā sādhāraṇato vatvā puna asādhāraṇato vivaranto ‘‘kiṃ vuttaṃ hotī’’tiādimāha.
Since in the Pali text, starting with "So vata Cunda," the general meaning is taken as a simile and the specific meaning is stated as the thing to be compared, therefore, explaining that meaning generally with "Thus the meaning should be understood," and then again elaborating it specifically, he said, "What is meant by this?" and so on.
Vì trong kinh điển đã nói “này Cunda” v.v. để lấy ý nghĩa chung làm ví dụ và ý nghĩa đặc biệt làm điều được ví dụ, nên sau khi nói ý nghĩa đó một cách tổng quát bằng “evamattho veditabbo” (ý nghĩa nên được hiểu như vậy), v.v., rồi lại giải thích một cách đặc biệt bằng “kiṃ vuttaṃ hotī” (điều gì đã được nói), v.v.
Parassa vihiṃsācetanaṃ nibbāpessatīti idaṃ yo avihiṃsāsaṅkhātaṃ sammāpaṭipattiṃ disvā diṭṭhānugatiṃ āpajjanto dhammadesanāya paro avihiṃsako hoti, tādisaṃ sandhāya vuttaṃ.
"He will extinguish the intention to harm others" – this is said with reference to one who, seeing the right practice called non-violence, follows that example and becomes non-violent through the teaching of the Dhamma.
Parassa vihiṃsācetanaṃ nibbāpessatī (sẽ làm lắng dịu ý muốn làm hại của người khác) là điều này được nói đến để ám chỉ người nào đó, khi thấy sự thực hành chánh đáng gọi là không làm hại, rồi đi theo sự thấy biết đó, nhờ lời thuyết pháp mà trở thành người không làm hại.
Ādesanañhi tassa vacananti.
For it is his word of instruction.
Vì sự chỉ dẫn đó chính là lời nói của người ấy.
Tenāha ‘‘ayaṃ yā esā vihiṃsakassā’’ti.
Therefore, he said, "This, which is for the violent one."
Do đó đã nói “ayaṃ yā esā vihiṃsakassā” (điều này là của người làm hại).
Pubbe vihiṃsakassa micchāpaṭipajjantassa.
Previously, "for the violent one" means for one practicing wrongly.
Trước đây, vihiṃsakassa (của người làm hại) là của người thực hành sai lầm.
Vihiṃsāpahānāya maggaṃ bhāvayatotiādinā attano eva avihiṃsāya vihiṃsāparinibbānāya saṃvattanamāha.
By "developing the path for the abandonment of violence," and so on, he speaks of one's own non-violence leading to the complete extinguishing of violence.
Vihiṃsāpahānāya maggaṃ bhāvayato (khi tu tập con đường để đoạn trừ sự làm hại), v.v. là nói về sự chuyển hóa của chính mình thành không làm hại để đạt đến sự Niết-bàn của sự làm hại.
Tenāha ‘‘parinibbuto viyā’’tiādi.
Therefore, he said, "as if completely extinguished," and so on.
Do đó đã nói “parinibbuto viyā” (như đã Niết-bàn hoàn toàn), v.v.
Sabbapadesūti ‘‘pāṇātipātissā’’tiādinā āgatesu tecattālīsāya padesu.
"In all aspects" refers to the forty-three aspects mentioned starting with "of taking life."
Sabbapadesū (trong tất cả các phần) là trong bốn mươi ba phần được đề cập bằng “pāṇātipātissā” (của sự sát sanh), v.v.
88. Evanti desitākāraparāmasanaṃ.
88. "Thus" refers to the manner of teaching.
88. Evaṃ (như vậy) là sự nhắc lại cách đã được thuyết giảng.
Tassāti sallekhassa.
"Of that" refers to the purification.
Tassā (của điều đó) là của sự thiểu dục.
‘‘Atthi khvesa brāhmaṇa, pariyāyo’’tiādīsu (a. ni. 8.11; pārā. 3-10) viya pariyāya-saddo kāraṇatthoti āha ‘‘sallekhakāraṇa’’nti.
Like in "There is, O brahmin, a way," and so on, the word "way" means cause, thus he said, "the cause of purification."
Giống như trong “Atthi khvesa brāhmaṇa, pariyāyo” (Này Bà-la-môn, có một phương tiện), v.v., từ pariyāya có nghĩa là nguyên nhân, nên đã nói “sallekhakāraṇa” (nguyên nhân của sự thiểu dục).
Tesaṃ vasenāti sallekhānaṃ vasena.
"By means of these" refers to by means of the purifications.
Tesaṃ vasenā (do năng lực của những điều đó) là do năng lực của những sự thiểu dục.
Mettāya upasaṃharaṇavasena hitaṃ esantena.
"Seeking welfare" by bringing it into connection with loving-kindness.
Với ý nghĩa là sự liên hệ với tâm từ, hitaṃ esantena (bằng cách tìm kiếm lợi ích).
Karuṇāya vasena anukampamānena.
"Having compassion" by means of compassion.
Với ý nghĩa là sự liên hệ với tâm bi, anukampamānena (bằng cách thương xót).
Pariggahetvāti parito gahetvā, paritvāti attho.
"Having encompassed" means having taken completely, that is, having protected.
Pariggahetvā (sau khi nắm giữ) là sau khi nắm giữ khắp nơi, tức là sau khi bảo vệ.
Pariccāti parito itvā, samantato pharitvā icceva attho.
"Having pervaded" means having gone completely, that is, having spread everywhere.
Pariccā (sau khi lan tỏa) là sau khi đi khắp nơi, tức là sau khi lan tỏa khắp mọi phía.
Mā pamajjitthāti ‘‘jhāyathā’’ti vuttasamathavipassanānaṃ aññāṇena, aññena vā kenaci pamādakāraṇena mā pamādaṃ āpajjittha.
"Do not be heedless" means do not fall into heedlessness through ignorance of samatha and vipassanā, which were spoken of as "meditate," or through any other cause of heedlessness.
Mā pamajjitthā (chớ phóng dật) là chớ rơi vào sự phóng dật do không biết về pháp chỉ và pháp quán đã được nói là “hãy thiền định”, hoặc do bất kỳ nguyên nhân phóng dật nào khác.
Niyyānikasāsane hi akattabbakaraṇampi pamādoti.
For in the liberating Dispensation, even doing what should not be done is heedlessness.
Thật vậy, trong giáo pháp dẫn đến sự giải thoát, việc làm điều không nên làm cũng là sự phóng dật.
Vipattikāleti sattaasappāyādivipattiyuttakāle.
"In a time of misfortune" refers to a time accompanied by misfortunes such as the seven unsuitable conditions.
Vipattikāle (trong thời gian thất bại) là trong thời gian gặp phải những thất bại như bảy điều không thích hợp, v.v.
Yathāvuttā pañca pariyāyā aññepi sabbe sāsanaguṇā idheva saṅgahaṃ gacchantīti āha ‘‘jhāyatha, mā pamādatthāti tumhākaṃ anusāsanī’’ti.
The five ways mentioned, and all other qualities of the Dispensation, are included here, thus he said, "Meditate, do not be heedless – this is your instruction."
Năm phương tiện đã nói trên và tất cả các phẩm chất khác của giáo pháp đều được bao gồm ở đây, nên đã nói “jhāyatha, mā pamādatthāti tumhākaṃ anusāsanī” (hãy thiền định, chớ phóng dật, đó là lời giáo huấn của các ông).
89. Kathetukamyatāpucchā evāti avadhāraṇena itarā catasso pucchā nivatteti itarāsaṃ asambhavato, tattha yathāpucchitassa atthassa vissajjanato ca ‘‘ayaṃ sammādiṭṭhī’’ti yāthāvato ajānantāpi puthujjanā bāhirakatāpasādayo attano samānasīle ṭhitaṃ sammādiṭṭhīti vadanti.
89. "The question of wishing to explain" – by the emphatic particle "eva," the other four questions are excluded due to their impossibility, and because the meaning as questioned is expounded therein. Even ordinary people and external ascetics who do not truly know "this is right view" speak of "right view" as being established in their own similar conduct.
89. Kathetukamyatāpucchā evā (chỉ là câu hỏi về ý muốn nói) là bằng cách khẳng định, điều này bác bỏ bốn câu hỏi khác vì chúng không thể xảy ra, và vì ý nghĩa đã được hỏi đã được giải đáp ở đó. Ngay cả những phàm nhân và các ẩn sĩ ngoại đạo, những người không biết chân tướng của “Chánh kiến này”, cũng gọi điều họ giữ là chánh kiến.
Anussavādivasenāpīti anussavākāraparivitakkadiṭṭhinijjhānakkhantivasenapi.
"Also by way of tradition," and so on, means also by way of tradition, inference, speculation, conviction, and patience.
Anussavādivasenāpī (cũng do năng lực của sự nghe truyền lại, v.v.) là cũng do năng lực của sự nghe truyền lại, sự suy tư về hình tướng, sự quán xét và sự nhẫn nại.
Yathāsamaṅgitākārassa atthassa evametanti nijjhānakkhamāpanato ekantato yāthāvaggāho hotīti āha ‘‘attapaccakkhenapī’’ti, yāthāvato lakkhaṇassa paṭividdhattā attano paccakkhabhāvenāti attho.
Since the meaning of the state of being endowed with qualities is such that it allows for conviction, there is an absolute grasp of reality, thus he said, "also by direct experience," meaning by one's own direct experience, due to having penetrated the true characteristic.
Vì ý nghĩa của trạng thái tương ứng được quán xét là “điều này là như vậy” nên sự nắm bắt chân tướng là tuyệt đối, do đó đã nói “attapaccakkhenapī” (cũng bằng sự tự chứng). Tức là, do đã thấu hiểu chân tướng của đặc tính, nên bằng sự tự chứng của chính mình.
Bahunnaṃ vacanaṃ upādāyāti iminā sāsane loke ca niruḷhatāya ayaṃ āmeḍitapayogoti sāsanassa niruḷhatāya ca sampasādaṃ upādāyapi tadubhayiko āmeḍitapayogo daṭṭhabbo.
"By taking many words" – by this, it should be understood that this is a repeated usage due to its common acceptance in the Dispensation and in the world, and also due to taking confidence in the common acceptance of the Dispensation, this dual repeated usage should be seen.
Bahunnaṃ vacanaṃ upādāyā (do nắm giữ lời nói của nhiều người) là điều này cho thấy đây là cách dùng lặp lại trong giáo pháp và trong thế gian. Và do sự tin tưởng vào giáo pháp, cách dùng lặp lại cả hai nên được thấy.
Atthanti vacanatthaṃ.
"Meaning" refers to the meaning of the word.
Attha (ý nghĩa) là ý nghĩa của lời nói.
Lakkhaṇanti sabhāvaṃ.
"Characteristic" refers to its nature.
Lakkhaṇa (đặc tính) là bản chất.
Upādāyāti gahetvā.
"Having taken" means having grasped.
Upādāyā (do nắm giữ) là sau khi nắm giữ.
Sobhanāyāti sundarāya.
"Beautiful" means lovely.
Sobhanāyā (đẹp đẽ) là xinh đẹp.
Pasatthāyāti pasaṃsāya.
"Praiseworthy" means worthy of praise.
Pasatthāyā (đáng khen) là đáng ca ngợi.
Tesu purimena dhammānaṃ yathāsabhāvāvabodhasaṅkhātaṃ sammādiṭṭhisabhāvaṃ dasseti.
By the former, he shows the nature of right view, which is the understanding of the true nature of phenomena.
Với điều đầu tiên, nó chỉ ra bản chất của chánh kiến, tức là sự thấu hiểu bản chất của các pháp.
Tena hi sā sabbadhamme abhibhavitvā sobhati.
For by that, it surpasses all phenomena and shines forth.
Vì vậy, nó vượt trội hơn tất cả các pháp và trở nên đẹp đẽ.
Dutiyena sampayuttadhammesu pariṇāyikabhāvaṃ.
By the latter, its leading role among associated phenomena.
Với điều thứ hai, nó chỉ ra trạng thái dẫn dắt trong các pháp tương ưng.
Tena hi sā sampayuttadhamme ñāṇamaye viya taṃsamaṅginañca puggalaṃ ñāṇapiṇḍaṃ viya karoti, tassa ‘‘paṇḍito nipuṇo cheko viññū vibhāvī’’tiādinā disāsu pasaṃsā pattharati.
Therefore, it makes the associated phenomena as if full of knowledge, and the person endowed with it as if a mass of knowledge. Due to this, praise such as "wise, skillful, clever, discerning, insightful" spreads in all directions for that person.
Vì vậy, nó làm cho các pháp tương ưng giống như có trí tuệ và làm cho người có nó giống như một khối trí tuệ, và lời khen ngợi người ấy lan tỏa khắp các phương là “bậc trí tuệ, tinh xảo, khéo léo, có trí tuệ, có khả năng phân biệt”, v.v.
Kammassakatāñāṇanti kammaṃ sako etassāti kammassako, tassa bhāvo kammassakatā, tattha ñāṇaṃ ‘‘idaṃ kammaṃ sattānaṃ sakaṃ, idaṃ no saka’’nti evaṃ jānanañāṇaṃ.
Knowledge of the ownership of kamma (kammassakatāñāṇa) means that kamma is one's own (saka); the state of having kamma as one's own is kammassakatā. The knowledge therein is the knowing knowledge, "This kamma is one's own for beings, this is not one's own."
Kammassakatāñāṇa (trí tuệ về nghiệp là của riêng) là nghiệp là của riêng của người này, đó là kammassako, trạng thái của điều đó là kammassakatā. Trí tuệ ở đó là trí tuệ biết rằng “nghiệp này là của riêng của chúng sanh, nghiệp này không phải là của riêng”, v.v.
Saccānulomikañāṇanti ariyasaccānaṃ paṭivedhassa anulomato saccānulomikaṃ ñāṇaṃ, vipassanāñāṇaṃ.
Knowledge in conformity with the Truths (saccānulomikañāṇa) is knowledge in conformity with the penetration of the Noble Truths, which is vipassanā-ñāṇa.
Saccānulomikañāṇa (trí tuệ tương ưng với các Chân lý) là trí tuệ tương ưng với sự thấu hiểu các Thánh đế, đó là trí tuệ quán.
No saccānulomikāyāti bāhirako saccānulomikāya sammādiṭṭhiyā no sammādiṭṭhi sabbena sabbaṃ tassa abhāvato.
Not in conformity with the Truths means that the outsider's right view is not right view in conformity with the Truths, because it is entirely absent for him.
No saccānulomikāyā (không phải là tương ưng với các Chân lý) là chánh kiến của người ngoại đạo không phải là chánh kiến tương ưng với các Chân lý, vì nó hoàn toàn không có.
Tattha kāraṇamāha ‘‘attadiṭṭhiparāmāsakattā’’ti.
The reason for that is stated as "due to clinging to a view of self".
Ở đây, nguyên nhân được nói là “attadiṭṭhiparāmāsakattā” (do nắm giữ tà kiến về tự ngã).
Kammassa katādiṭṭhi pana bāhirakassa attadiṭṭhiṃ anurujjhantī pavattati ‘‘atthi dinna’’ntiādinayappavattito.
However, the outsider's view of the ownership of kamma proceeds in conformity with the view of self, because it proceeds in the manner of "there is what is given," and so on.
Tuy nhiên, kiến chấp về nghiệp là của riêng, v.v. của người ngoại đạo vẫn tồn tại do nó ủng hộ kiến chấp về tự ngã, như trong cách nói “có sự bố thí”, v.v.
Sāsaniko dvīhipīti sāsaniko puthujjano kammassakatāñāṇādīhi dvīhipi sammādiṭṭhi.
One within the Dispensation by both means that the ordinary person (puthujjana) within the Dispensation possesses right view by both the knowledge of the ownership of kamma and so on.
Sāsaniko dvīhipī (người trong giáo pháp cũng bằng cả hai) là phàm nhân trong giáo pháp là chánh kiến bằng cả hai điều là trí tuệ về nghiệp là của riêng, v.v.
Okkantasammattaniyāmattā ‘‘sekkho niyatāyā’’ti vuttaṃ.
It is said "the Sekkha by the certain" because they have entered the fixed course of rightness.
“Sekkho niyatāyā” (bậc hữu học là chắc chắn) đã được nói do đã đi vào sự chắc chắn của chánh kiến.
Asekkhāya sammādiṭṭhiyā sammādiṭṭhīti ānetvā sambandhitabbaṃ.
It should be connected by understanding that they possess right view through the asekkhā sammādiṭṭhi.
Nên liên hệ bằng cách nói rằng đó là chánh kiến bằng chánh kiến của bậc vô học.
Tīsupi puggalesu sekkho idha sammādiṭṭhīti adhippetoti dassento ‘‘niyatāya niyyānikāyā’’tiādimāha.
"In all three types of individuals, the Sekkha is here understood as one with right view," intending to show this, he said, "by means of a fixed and leading to liberation," and so on.
Để cho thấy rằng trong ba hạng người, bậc Hữu học ở đây được coi là có chánh kiến, (Đức Phật) đã nói "kiên định, đưa đến giải thoát" và vân vân.
Idāni yathāvuttamatthaṃ pāḷiyā vibhāvetuṃ ‘‘tenevāhā’’tiādi vuttaṃ.
Now, to explain the aforementioned meaning using the Pali text, "Therefore it was said," and so on, was stated.
Bây giờ, để làm rõ nghĩa đã nói như trên bằng lời kinh (Pāḷi), (đoạn) "Chính vì thế (Đức Phật) đã nói" và vân vân đã được nói.
Antadvayanti ‘‘sassataṃ, ucchedaṃ, kāmasukhaṃ, attakilamatha’’nti etaṃ antadvayaṃ.
Two extremes means these two extremes: "eternalism, annihilationism, sensual pleasure, and self-mortification."
Về hai cực đoan: "Thường kiến, đoạn kiến, dục lạc, khổ hạnh" là hai cực đoan này.
Līnuddhaccapatiṭṭhānāyūhanantadvayassa anupagamanaṃ atthasiddhameva.
The non-adherence to the two extremes of laxity/agitation and establishment/striving is indeed the accomplishment of the meaning.
Việc không rơi vào hai cực đoan của sự chấp thủ dựa trên sự luyến ái và phóng dật là điều đã được xác lập về mặt ý nghĩa.
Ujubhāvenāti ujusabhāvena maggena, majjhimāya paṭipattiyāti attho.
By straightforwardness means by a straightforward nature, by the path, by the middle practice—this is the meaning.
Bằng sự ngay thẳng: có nghĩa là bằng con đường ngay thẳng, bằng Trung đạo.
Dhamme pasādaggahaṇena satthari saṅghe ca pasādopi gahitoyeva hotīti ‘‘dhamme’’icceva vutto tadavinābhāvato.
By the acceptance of faith in the Dhamma, faith in the Teacher and the Saṅgha is also understood; thus, it is stated as "in the Dhamma" because of its inseparability.
Bằng việc chấp nhận tịnh tín nơi Pháp, tịnh tín nơi Bậc Đạo Sư và Tăng đoàn cũng đã được bao hàm, vì thế chỉ nói "nơi Pháp" vì điều đó không thể tách rời.
Yasmā esa niyatāya sammādiṭṭhiyā samannāgato sammādiṭṭhīti adhippeto, tañca vaṭṭato niyyānaṃ vivaṭṭādhigamena hotīti āha ‘‘āgato imaṃ saddhamma’’nti.
Since he is understood as having right view, endowed with fixed right view, and that liberation from saṃsāra comes through the attainment of Nibbāna, it is said: "He has come to this Saddhamma."
Vì người này được coi là có chánh kiến do được trang bị chánh kiến kiên định, và điều đó xảy ra bằng cách thoát khỏi luân hồi, bằng cách đạt đến sự giải thoát khỏi luân hồi, nên (Đức Phật) đã nói "đã đến với Chánh Pháp này".
Nibbānañhi santo sadā vijjamāno dhammoti katvā saddhammoti imaṃ phalehi asādhāraṇena pariyāyena vattabbataṃ labhati.
For Nibbāna, being the existing Dhamma, always present, is called Saddhamma (True Dhamma), and thus obtains this designation, which is unique from the fruits.
Niết Bàn, vì là Pháp cao quý luôn tồn tại, nên được gọi là Chánh Pháp, và nhờ đó nó đạt được cách gọi đặc biệt này, không giống như các quả (pháp hữu vi).
Tayidamassa āgamaṃ sacchikiriyābhisamayo, so ca pahānābhisamayādīhi saheva idha ijjhatīti dassento ‘‘sabbadiṭṭhigahanānī’’tiādimāha.
This approach for him is the realization-abhisamaya; and since that is accomplished here together with the abandonment-abhisamaya and others, intending to show this, he said, "all thickets of views," and so on.
Sự đến của người này là sự chứng ngộ bằng cách thực chứng, và điều đó ở đây được thành tựu đồng thời với sự chứng ngộ bằng sự đoạn trừ và vân vân, để cho thấy điều đó (Đức Phật) đã nói "gỡ bỏ mọi rừng tà kiến" và vân vân.
Tattha sabbadiṭṭhigahanāni vinibbeṭhento sabbakilese pajahantoti padadvayena pana pahānābhisamayamāha, jātisaṃsārā nikkhamantoti iminā pariññābhisamayaṃ.
There, by the two phrases "unraveling all thickets of views, abandoning all defilements," he speaks of the abandonment-abhisamaya; by "departing from the cycle of birth and saṃsāra," he speaks of the full comprehension-abhisamaya.
Trong đó, bằng hai cụm từ "gỡ bỏ mọi rừng tà kiến, đoạn trừ mọi phiền não" là nói về sự chứng ngộ bằng sự đoạn trừ, còn bằng cụm từ "thoát khỏi sinh tử luân hồi" là nói về sự chứng ngộ bằng sự liễu tri.
Samatikkamattho hi pariññattho.
For the meaning of full comprehension is the meaning of transcending.
Vì ý nghĩa của sự vượt qua chính là ý nghĩa của sự liễu tri.
Paṭipattiṃ pariniṭṭhapentoti iminā bhāvanābhisamayanti daṭṭhabbaṃ.
By "completing the practice," it should be understood as the development-abhisamaya.
Cần phải hiểu rằng "hoàn thành con đường thực hành" là nói về sự chứng ngộ bằng sự tu tập.
Kālaparicchedavacananti paricchijjatīti paricchedo, kālo eva paricchedo kālaparicchedo, yo so akusalapajānanādinā paricchinno maggavuṭṭhānakālo maggakkhaṇo, tassa vacananti attho.
Term for a period of time means pariccheda is that which is delimited, and kāla (time) itself is the pariccheda, kālapariccheda, which is the moment of emergence from the path, the maggakkhaṇa, delimited by knowing the unwholesome and so on—this is the meaning of its expression.
Lời chỉ định thời gian: là sự chỉ định, thời gian chính là sự chỉ định, đó là thời gian của sự xuất khởi đạo, khoảnh khắc của đạo, được chỉ định bằng sự nhận biết bất thiện và vân vân, đó là ý nghĩa của lời nói đó.
Tenāha ‘‘yasmiṃ kāle’’ti.
Therefore, it is said, "at which time."
Vì thế (Đức Phật) đã nói "vào thời điểm nào".
Akusalañcāti ca-saddo samuccayattho.
And unwholesome—the word ca (and) is used in a conjunctive sense.
Và bất thiện: từ "ca" (và) có nghĩa là tập hợp.
Tena vakkhamānaṃ akusalamūlādiṃ samuccinoti.
Thereby it conjoins the unwholesome roots and so on that will be mentioned.
Nhờ đó, nó tập hợp các căn bản bất thiện và vân vân sẽ được nói đến.
Dasākusalakammapathanti kutoyaṃ viseso, yāvatā aniddhāritavisesaṃ akusalaṃ gahitanti?
The ten unwholesome courses of action—from where is this distinction made, given that the unwholesome, without specified distinctions, is taken?
Mười nghiệp đạo bất thiện: sự đặc biệt này từ đâu mà có, vì đã chấp nhận bất thiện mà không xác định sự đặc biệt?
Na sāmaññajotanāya visese avaṭṭhānato.
It is not so, because there is no particular distinction indicated by the general term.
Không, vì nó không dừng lại ở sự đặc biệt mà chỉ là sự biểu thị chung.
Kiṃ vā imāya yutticintāya, yasmā paṭhamavārena uddesavasena desitassa atthassa vitthāradesanā dutiyavāro.
Or what is the purpose of this logical inquiry, since the second recitation is an elaborate teaching of the meaning presented by way of outline in the first recitation?
Hoặc có gì trong sự suy luận này, vì lần thứ hai là sự trình bày chi tiết về ý nghĩa đã được trình bày tóm tắt trong lần đầu.
Tenevāha ‘‘katamaṃ panāvuso’’tiādi.
Therefore it is said, "What then, friends?" and so on.
Chính vì thế (Đức Phật) đã nói "Này chư Hiền, thế nào là..." và vân vân.
Yasmā lokuttarā sammādiṭṭhi idha adhippetā, tasmā nirodhārammaṇāya pajānanāya maggapaññāya kiccavasena sammohato ‘‘idaṃ dukkha’’nti dasaakusalakammapathaṃ paṭivijjhanto ‘‘akusalaṃ pajānātī’’ti vuccatīti attho.
Since supramundane right view is intended here, it means that he is called "one who knows the unwholesome" because he discerns the ten unwholesome courses of action, such as "this is suffering," by way of the function of path-wisdom, which knows the cessation and penetrates delusion.
Vì chánh kiến siêu thế được hàm ý ở đây, nên có nghĩa là người nhận biết mười nghiệp đạo bất thiện là "khổ" bằng sự nhận biết đối tượng là Niết Bàn, bằng chức năng của tuệ đạo, do sự thoát khỏi si mê, được gọi là "nhận biết bất thiện".
Tassāti akusalakammapathasaṅkhātassa dukkhassa.
Of that refers to suffering, consisting of the unwholesome courses of action.
Của nó: của khổ được gọi là nghiệp đạo bất thiện.
Teneva pakārenāti ‘‘nirodhārammaṇāya pajānanāya kiccavasenā’’ti vuttappakārena.
In that same way means "by way of the function of knowing the cessation"—the way that was stated.
Cũng theo cách đó: theo cách đã nói "bằng chức năng của sự nhận biết đối tượng là Niết Bàn".
Kusalanti etthāyaṃ vacanattho – kucchite pāpadhamme salayati calayati kampetīti kusalaṃ, kucchitena vā ākārena sayantīti kusā, pāpakā dhammā.
Wholesome (kusala)—here is its etymological explanation: that which shakes, stirs, or makes tremble the vile, evil dhammas is kusala; or, evil dhammas are called kusā because they lie in a vile manner.
Thiện: ở đây có ý nghĩa như sau – làm rung chuyển, làm dao động, làm lay động những pháp ác xấu xa nên gọi là kusala (thiện), hoặc những pháp ác xấu xa nằm yên theo một cách xấu xa nên gọi là kusā (cỏ sắc).
Te kuse lunāti chindatīti kusalaṃ.
That which cuts or severs those kusā is kusala.
Cắt đứt, chặt bỏ những kusā đó nên gọi là kusala (thiện).
Kucchitānaṃ vā sānato tanukaraṇato ñāṇaṃ kusaṃ nāma, tena lātabbaṃ gahetabbaṃ pavattetabbanti kusalaṃ.
Or, knowledge that attenuates or makes subtle the vile is called kusa, and that which should be taken, attained, or put into action by it is kusala.
Hoặc sự hiểu biết làm giảm bớt những điều xấu xa được gọi là kusa (sắc bén), điều cần được nắm bắt, được thực hành bằng sự hiểu biết đó nên gọi là kusala (thiện).
Yathā vā kuso ubhayabhāgagataṃ hatthapadesaṃ lunāti, evamidaṃ uppannānuppannavasena ubhayabhāgagataṃ saṃkilesapakkhaṃ lunāti chindati, tasmā kuso viya lunātīti kusalaṃ.
Or, just as a kusa grass cuts the part of the hand that touches both ends, so too this cuts or severs the defilement-side, which is present in both aspects as arisen and not yet arisen; therefore, like a kusa it cuts, hence kusala.
Hoặc giống như cỏ kusa cắt đứt phần tay nằm ở cả hai bên, tương tự, điều này cắt đứt, chặt bỏ phần ô nhiễm nằm ở cả hai bên theo cách đã sinh và chưa sinh, vì thế nó cắt đứt như cỏ kusa nên gọi là kusala (thiện).
Kucchitānaṃ vā sāvajjadhammānaṃ salanato saṃvaraṇato kusalaṃ.
Or, kusala is that which restrains or controls the vile blameworthy dhammas.
Hoặc kusala (thiện) do sự kiềm chế, sự phòng hộ những pháp xấu xa, đáng chê trách.
Kusaladhammavasena hi akusalā manacchaṭṭhesu dvāresu appavattiyā saṃvutā honti.
For, by means of wholesome dhammas, unwholesome dhammas are restrained by not arising in the six sense-doors of the mind.
Vì các pháp bất thiện được kiềm chế không phát sinh ở sáu cửa ý nhờ các pháp thiện.
Kucchite vā pāpadhamme salayati gameti apanetīti kusalaṃ.
Or, kusala is that which causes the vile, evil dhammas to move away or remove them.
Hoặc kusala (thiện) do làm cho các pháp ác xấu xa di chuyển, biến mất.
Kucchitānaṃ vā pāṇātipātādīnaṃ sānato nisānato tejanato kusā, dosalobhādayo.
Or, kusā are greed, hatred, and so on, which arise from sharpening, honing, or kindling the vile acts of killing and so on.
Hoặc do sự mài giũa, sự làm sắc bén, sự làm nhọn các pháp xấu xa như sát sinh và vân vân, nên gọi là kusā (sự sắc bén), đó là các tham, sân và vân vân.
Sādīnavavasena cetanāya tikkhabhāvappattiyā pāṇātipātādīnaṃ mahāsāvajjatā.
By the sharpness of volition, due to their inherent drawback, acts of killing and so on attain great blameworthiness.
Do sự nguy hiểm, do sự đạt đến trạng thái sắc bén của ý chí, nên sát sinh và vân vân có sự nguy hiểm lớn.
Te kuse lunāti chindatīti kusalaṃ.
That which cuts or severs those kusā is kusala.
Cắt đứt, chặt bỏ những kusā đó nên gọi là kusala (thiện).
Kucchitānaṃ vā sānato antakaraṇato vināsanato kusāni, puññakiriyavasena pavattāni saddhādīni indriyāni.
Or, kusāni are faculties such as faith that are activated by meritorious actions, which bring about the end or destruction of vile things.
Hoặc do sự làm cho chấm dứt, sự hủy diệt những điều xấu xa, nên gọi là kusāni (sự hủy diệt), đó là các căn như tín và vân vân, phát sinh do các hành động tạo phước.
Tehi lātabbaṃ pavattetabbanti kusalaṃ.
That which should be taken or put into action by them is kusala.
Điều cần được nắm bắt, được thực hành bằng những điều đó nên gọi là kusala (thiện).
‘‘Ku’’iti vā bhūmi vuccati, adhiṭṭhānabhāvena taṃsadisassa attano nissayabhūtassa rūpārūpapabandhassa sampati āyatiñca anudahena vināsanato kuṃ sasantīti kusā, rāgādayo.
Or, "ku" is said to mean "earth" or "ground"; kusā are passions like lust, which, by not burning or destroying the continuity of mind-and-matter, their own support, which resembles that ground, in the present and in the future, are like those that burn their own support.
Hoặc "ku" được gọi là đất, do sự hủy diệt không ngừng, không đốt cháy các tập hợp sắc và vô sắc là nơi nương tựa của tự ngã tương tự như nó, ở hiện tại và tương lai, nên gọi là kusā (sự hủy diệt), đó là tham và vân vân.
Te viya attano nissayassa lavanato chindanato kusalaṃ.
That which is like cutting or severing its own support is kusala.
Giống như những điều đó, do sự cắt đứt, sự chặt bỏ nơi nương tựa của tự ngã nên gọi là kusala (thiện).
Payogasampāditā hi kusaladhammā accantameva rūpārūpadhamme appavattikaraṇena samucchindanti.
For, wholesome dhammas, perfected by effort, utterly eradicate mind-and-matter dhammas by causing them to cease arising.
Vì các pháp thiện được thành tựu bằng sự thực hành hoàn toàn tiêu diệt các pháp sắc và vô sắc bằng cách làm cho chúng không phát sinh.
Kusalassa mūlanti kusalamūlaṃ, suppatiṭṭhitabhāvasādhanena kusalassa patiṭṭhā nidānanti attho.
The root of the wholesome is kusalamūla, meaning the foundation or cause of the wholesome by establishing it firmly.
Căn bản của thiện là kusalamūla (căn bản thiện), có nghĩa là nền tảng, nguyên nhân của thiện bằng cách xác lập trạng thái vững chắc.
Akusalamūlanti etthāpi eseva nayo.
The same applies to akusalamūla (unwholesome root).
Akusalamūla (căn bản bất thiện): ở đây cũng theo cách tương tự.
Akusalanti pana na kusalaṃ akusalaṃ, kusaladhammānaṃ paṭipakkhavasena akusalanti padassa attho veditabbo.
However, akusala (unwholesome) should be understood not as "not wholesome," but as having the meaning of a term that is opposed to wholesome dhammas.
Tuy nhiên, akusala (bất thiện) không phải là không thiện, ý nghĩa của từ bất thiện cần được hiểu theo nghĩa đối lập với các pháp thiện.
Evañhi ārogyānavajjasukhavipākakosallasambhūtaṭṭhena kusalaṃ vuccatīti.
Thus, it is said that "kusala" refers to that which is wholesome, blameless, has pleasant results, and is born of skill.
Như vậy, điều được gọi là thiện là do nó có được sức khỏe, không đáng chê trách, có quả báo an lạc và được sinh ra từ sự khéo léo.
Yathā yaṃ dhammajātaṃ na arogaṃ na avajjaṃ na sukhavipākaṃ na ca kosallasambhūtaṃ, taṃ akusalanti ayamattho dassito hoti.
In this way, the meaning is shown to be that any phenomenon which is not wholesome, not blameless, does not have pleasant results, and is not born of skill, is unwholesome.
Như vậy, điều được chỉ ra là bất thiện là những loại pháp không có sức khỏe, không đáng chê trách, không có quả báo an lạc và không được sinh ra từ sự khéo léo.
Evaṃ yaṃ na kucchitānaṃ salanasabhāvaṃ, na kusena, kusehi vā pavattetabbaṃ, na ca kuso viya lavanakaṃ, taṃ akusalaṃ nāmāti ayampi attho dassitoti veditabbo.
Similarly, it should be understood that the meaning shown is: that which does not have the nature of restraining the vile, is not to be put into action by kusa or kusā, and is not like kusa in cutting, is called akusala.
Cũng cần phải hiểu rằng ý nghĩa này cũng được chỉ ra: điều không có bản chất làm dao động những điều xấu xa, không được thực hành bằng kusa, hoặc bằng kusā, và không cắt đứt như kusa, thì đó là bất thiện.
Vatthupajānanāti dukkhādivatthuno pajānanā paṭivedho.
Understanding the basis refers to the understanding or penetration of the basis of suffering and so on.
Sự nhận biết đối tượng: là sự nhận biết, sự thấu hiểu đối tượng khổ và vân vân.
Tathā bujjhanakapuggalānaṃ ajjhāsayavasena desanā pavattāti āha ‘‘akusalādipajānanenāpī’’ti.
And so, the teaching proceeds according to the disposition of the individuals who awaken, thus it is said, "even by knowing the unwholesome and so on."
Và sự giảng dạy được thực hiện theo khuynh hướng của những người có khả năng giác ngộ, nên (Đức Phật) đã nói "cũng bằng sự nhận biết bất thiện và vân vân".
Teneva ca saṃkhittena desanā pavattā.
And for this reason, the teaching is concise.
Và chính vì thế, sự giảng dạy được thực hiện một cách tóm tắt.
Bhāvanāmanasikāro pana ‘‘sabbaṃ bhikkhave abhiññeyya’’nti (saṃ. ni. 4.46; paṭi. ma. 1.3) vacanato anavasesato rūpārūpadhammānaṃ pariggahavaseneva pavattati.
However, development-attention (bhāvanāmanasikāra), in accordance with the statement "All, monks, is to be fully known," proceeds by completely comprehending mind-and-matter dhammas.
Tuy nhiên, sự tác ý tu tập được thực hiện bằng cách bao gồm tất cả các pháp sắc và vô sắc một cách không sót lại, theo lời dạy "Này chư Tỳ-kheo, tất cả đều cần phải được thắng tri" (Saṃ. Ni. 4.46; Paṭi. Ma. 1.3).
Tenāha ‘‘desanāyevā’’tiādi.
Therefore, it is said, "only the teaching," and so on.
Vì thế (Đức Phật) đã nói "chỉ là sự giảng dạy" và vân vân.
Tattha manasikārapaṭivedhoti pubbabhāge pavattavipassanāmanasikāro ariyamaggapaṭivedho ca.
There, penetration by attention refers to the Vipassanā attention occurring in the preliminary stage, and the penetration of the noble path.
Trong đó, sự thấu hiểu bằng tác ý: là sự tác ý tuệ quán phát sinh ở giai đoạn đầu và sự thấu hiểu Thánh đạo.
Kassaci akopanato vitthāravaseneva vuttaṃ vipassanaṃ anuyuñjantā maggaṃ paṭivijjhantāpi vitthāranayeneva paṭivijjhantīti attho visuddhikkamassa abhāvato.
Because it does not cause harm to anyone, it is stated in detail; those who practice Vipassanā and penetrate the path also penetrate it in a detailed manner, due to the absence of a purification sequence—this is the meaning.
Ý nghĩa là, những người thực hành tuệ quán và thấu hiểu đạo cũng thấu hiểu theo cách chi tiết, vì không có sự làm cho bất cứ ai bị dao động, vì không có sự thiếu sót trong trình tự thanh tịnh.
Bhikkhūti mahāvihāre dhammasaṅgītivasena pañcanikāyamaṇḍale nisinnabhikkhū.
Monks refers to the monks seated in the five-nikāya assembly for the Dhamma recitation in the Mahāvihāra.
Chư Tỳ-kheo: là các Tỳ-kheo ngồi trong hội đồng năm bộ kinh tại Đại Tự Viện theo cách tụng đọc Pháp.
Theroti tattha saṅghattheroti vadanti.
Elder—there, they say he was the Saṅghatthera (Elder of the Saṅgha).
Trưởng lão: ở đó họ gọi là Trưởng lão Tăng chúng.
Vatthasuttavaṇṇanāyaṃ vuttanayena pana mahāsaṅgharakkhitattherassa antevāsikabhikkhū sandhāya ‘‘āhaṃsū’’ti vuttaṃ.
However, by the method stated in the Vatthasutta commentary, the phrase "they said" refers to the disciples of the Elder Mahāsaṅgharakkhita.
Tuy nhiên, theo cách đã nói trong phần chú giải kinh Vatthasutta, "họ đã nói" là để chỉ các Tỳ-kheo đệ tử của Trưởng lão Mahāsaṅgharakkhita.
Theroti pana mahāsaṅgharakkhitatthero.
And Elder refers to the Elder Mahāsaṅgharakkhita.
Còn Trưởng lão: là Trưởng lão Mahāsaṅgharakkhita.
So hi imasmiṃ majjhimanikāye taṃ taṃ vinicchayaṃ kathesi.
For he delivered those various decisions in this Majjhima Nikāya.
Vì Ngài đã giảng giải các quyết định khác nhau trong Trung Bộ kinh này.
Rāsitoti piṇḍato, ekajjhanti attho.
From a heap means from a mass, the sense is "together."
Rāsito có nghĩa là piṇḍato, tức là ekajjhaṃ (tổng hợp, gom lại).
Akosallappavattiyāti kosallapaṭipakkhato akosallaṃ vuccati aññāṇaṃ, tato pavattanato, akosallasambhūtattāti attho.
Due to the occurrence of unskillfulness means that unskillfulness (akosalla) is called ignorance (aññāṇa) as it is the opposite of skillfulness (kosalla); the sense is "due to its arising from that, due to being born of unskillfulness."
Akosallappavattiyā có nghĩa là akosalla (không thiện xảo) được gọi là aññāṇa (vô minh), vì nó là đối nghịch của kosalla (thiện xảo). Nó có nghĩa là phát sinh từ sự không thiện xảo, hoặc do sự không thiện xảo mà sinh ra.
Ñāṇapaṭipakkho aññāṇaṃ mittapaṭipakkho amitto viya kusalapaṭipakkho akusalaṃ kusalena pahātabbattā, na pana kusalānaṃ pahāyatattā.
Ignorance is the opposite of knowledge, just as an enemy is the opposite of a friend; unwholesome (akusala) is the opposite of wholesome (kusala) because it must be abandoned by the wholesome, not because it abandons the wholesome.
Vô minh là đối nghịch của trí tuệ, giống như kẻ thù là đối nghịch của bạn bè. Bất thiện là đối nghịch của thiện vì nó phải được thiện đoạn trừ, chứ không phải vì nó đoạn trừ thiện.
Kusalameva hi payogasampāditaṃ akusalaṃ pajahati.
For it is wholesome kamma, accomplished by effort, that abandons the unwholesome.
Chính thiện khi được thực hành mới đoạn trừ bất thiện.
Saha avajjehi lobhādīhi vattatīti sāvajjaṃ.
It occurs together with faults (avajja) such as greed, hence sāvajjaṃ (faulty).
Nó tồn tại cùng với các lỗi lầm như tham lam, v.v., nên được gọi là sāvajjaṃ (có lỗi).
Dukkho aniṭṭho catukkhandha-saṅkhāto vipāko etassāti dukkhavipākaṃ.
Its vipāka, consisting of the four aggregates, is painful and undesirable, hence dukkhavipākaṃ (having painful results).
Quả báo của nó là khổ, không mong muốn, bao gồm bốn uẩn, nên được gọi là dukkhavipākaṃ (quả khổ).
Tattha sāvajjavacanena akusalānaṃ pavattidukkhataṃ dasseti, dukkhavipākavacanena vipākadukkhataṃ.
Here, by the word sāvajja, the suffering of the occurrence of unwholesome kamma is shown; by the word dukkhavipāka, the suffering of the result is shown.
Ở đây, lời nói sāvajjaṃ (có lỗi) chỉ ra sự khổ đau trong sự phát sinh của các bất thiện; lời nói dukkhavipākaṃ (quả khổ) chỉ ra sự khổ đau của quả báo.
Purimañhi pavattisambhavavasena akusalassa lakkhaṇavacanaṃ, pacchimaṃ tālantare vipākuppādanasamatthatāvasena.
For the former is a statement of the characteristic of the unwholesome in terms of the possibility of its occurrence, while the latter is in terms of its ability to produce results in a future time.
Thật vậy, điều trước là lời nói về đặc tính của bất thiện theo cách phát sinh và tồn tại; điều sau là theo cách có khả năng tạo ra quả báo trong thời gian sau này.
Tathā purimena akusalassa avisuddhasabhāvataṃ dasseti, pacchimena avisuddhavipākataṃ.
Similarly, by the former, the impure nature of the unwholesome is shown; by the latter, its impure result.
Tương tự, điều trước chỉ ra bản chất không thanh tịnh của bất thiện; điều sau chỉ ra quả báo không thanh tịnh.
Purimena akusalaṃ kusalasabhāvato nivatteti, pacchimena abyākatasabhāvato savipākattadīpakattā pacchimassa.
By the former, the unwholesome is distinguished from the nature of the wholesome; by the latter, it is distinguished from the nature of the indeterminate (abyākata), because the latter indicates its having a result.
Điều trước phân biệt bất thiện với bản chất thiện; điều sau phân biệt nó với bản chất vô ký, vì điều sau chỉ ra sự có quả báo.
Purimena vā avajjavantatādassanato kiccaṭṭhena rasena anatthajananarasataṃ dasseti, pacchimena sampattiatthena aniṭṭhavipākarasataṃ.
Or, by the former, which shows its faultiness, its function (kiccaṭṭha) is shown as the nature of producing harm; by the latter, its manifestation (sampattiṭṭha) is shown as the nature of an undesirable result.
Hoặc, điều trước chỉ ra đặc tính của việc tạo ra điều bất lợi theo nghĩa chức năng (kiccaṭṭha), do nó có lỗi lầm; điều sau chỉ ra đặc tính của quả báo không mong muốn theo nghĩa thành tựu (sampattiṭṭha).
Purimena ca upaṭṭhānākāraṭṭhena paccupaṭṭhānena saṃkilesapaccupaṭṭhānataṃ, pacchimena phalaṭṭhena dukkhavipākapaccupaṭṭhānataṃ.
And by the former, its proximate cause (paccupaṭṭhāna) in terms of its mode of appearance (upaṭṭhānākāraṭṭha) is shown as defilement; by the latter, its proximate cause in terms of its fruit (phalaṭṭha) is shown as a painful result.
Và điều trước chỉ ra sự hiện hữu của ô nhiễm theo nghĩa cách thức hiện hữu (upaṭṭhānākāraṭṭha), và điều sau chỉ ra sự hiện hữu của quả khổ theo nghĩa kết quả (phalaṭṭha).
Purimena ca ayonisomanasikāraṃ akusalassa padaṭṭhānaṃ pakāseti.
And by the former, improper attention (ayoniso manasikāra) is declared to be the immediate cause (padaṭṭhāna) of the unwholesome.
Và điều trước công bố sự tác ý không như lý (ayoniso manasikāra) là nguyên nhân gần (padaṭṭhāna) của bất thiện.
Tato hi taṃ sāvajjaṃ jātaṃ, pacchimena akusalassa aññesaṃ padaṭṭhānabhāvaṃ vibhāveti.
For it is from that that it becomes faulty; by the latter, the unwholesome's state of being the immediate cause of other things is clarified.
Vì từ đó mà nó trở nên có lỗi; điều sau làm rõ rằng bất thiện là nguyên nhân gần của những điều khác.
Tañhi dukkhavipākassa kāraṇanti.
For it is the cause of painful results.
Vì nó là nguyên nhân của quả khổ.
Saṃkiliṭṭhanti saṃkilesehi samannāgataṃ, dasahi kilesavatthūhi vibādhitaṃ, upatāpitaṃ vā tehi vidūsitaṃ malīnakatañcāti attho.
Defiled (saṃkiliṭṭha) means endowed with defilements, afflicted by the ten bases of defilement, or tormented by them, or corrupted and sullied by them.
Saṃkiliṭṭhaṃ có nghĩa là bị ô nhiễm, bị quấy phá bởi mười thứ phiền não, hoặc bị chúng làm cho đau khổ, bị làm cho dơ bẩn, bị làm cho uế tạp.
Idañcassa dukkhavipākatañcāti atthe idañca dukkhavipākataṃ apaccakkhatāya asaddahantānaṃ paccakkhato ādīnavadassanena saṃvejanatthaṃ vuttaṃ.
This, and its painful result, is stated for the purpose of stirring emotion by showing the danger directly to those who do not believe due to not directly perceiving it.
Điều này và sự quả khổ của nó được nói ra để gây xúc động cho những ai không tin tưởng vào sự quả khổ này bằng cách chỉ ra những hiểm nguy một cách trực tiếp.
Sādhāraṇā sabbassapi akusalassa.
Common to all unwholesome kamma.
Sādhāraṇā (chung) cho tất cả các bất thiện.
Saraseneva (dha. sa. mūlaṭī. 1) patanasabhāvassa antarā eva atīva pātanaṃ atipāto, saṇikaṃ patituṃ adatvā sīghaṃ pātananti attho.
Excessive killing (atipāto) is an extreme causing to fall, an excessive falling, of that which by its very nature (sarasena) tends to fall; the sense is "causing to fall quickly without allowing it to fall slowly."
Sự làm cho rơi xuống một cách quá mức, tức là làm cho rơi xuống một cách cực kỳ nhanh chóng, ngay cả khi bản chất của nó là tự rơi xuống, được gọi là atipāto. Có nghĩa là không cho phép nó rơi từ từ mà làm cho nó rơi nhanh chóng.
Atikkammavā satthādīhi abhibhavitvā pātanaṃ atipāto.
Or, atipāto is causing to fall by overpowering with weapons and so on.
Hoặc, làm cho rơi xuống bằng cách vượt qua, tức là bằng cách áp đảo bằng vũ khí, v.v., được gọi là atipāto.
Payogavatthumahantatādīhi mahāsāvajjatā tehi paccayehi uppajjamānāya cetanāya balavabhāvato.
Great faultiness (mahāsāvajjatā) is due to the greatness of the basis of application and so on, and due to the strong nature of the volition arising from these factors.
Mahāsāvajjatā (lỗi lầm lớn) là do sự mạnh mẽ của tác ý phát sinh bởi các yếu tố như sự lớn lao của đối tượng hành động, v.v.
Ekassa hi payogassa sahasā nipphādanavasena sakiccasādhikāya bahukkhattuṃ pavattajavanehi laddhāsevanāya ca sanniṭṭhāpakacetanāya vasena payogassa mahantabhāvo.
The greatness of the application is due to the volition that accomplishes its task by instantly bringing about a single application, and by the volition that establishes it, which has gained repeated practice through frequently occurring impulsion-moments.
Sự lớn lao của hành động là do tác ý quyết định, hoạt động nhiều lần thông qua các sát na tốc hành được tích lũy, theo cách hoàn thành một hành động ngay lập tức.
Satipi kadāci khuddake ceva mahante ca pāṇe payogassa samabhāve mahantaṃ hanantassa cetanā tibbākārā uppajjatīti vatthussa mahantabhāvo.
Even if sometimes the effort is equal in killing small and large beings, the volition of one killing a large being arises with an intense aspect; this is the greatness of the object.
Mặc dù đôi khi hành động có thể giống nhau đối với cả chúng sinh nhỏ và lớn, nhưng khi giết một chúng sinh lớn, tác ý phát sinh với cường độ mạnh mẽ, đó là sự lớn lao của đối tượng.
Iti ubhayampetaṃ cetanāya balavabhāveneva hotīti.
Thus, both of these occur due to the strength of volition.
Vì vậy, cả hai điều này đều xảy ra do sự mạnh mẽ của tác ý.
Yathāvuttapaccayapariyāyepi taṃtaṃpaccayehi cetanāya balavatāya eva mahāsāvajjabhāvo veditabbo.
Even in the categories of factors mentioned, the great blameworthiness should be understood as arising from the strength of volition due to those respective factors.
Ngay cả trong những cách khác nhau của các yếu tố đã nói, sự lỗi lầm lớn cũng phải được hiểu là do sự mạnh mẽ của tác ý bởi các yếu tố tương ứng.
Payogavatthuādipaccayānañhi amahattepi hantabbassa guṇavantatāya mahāsāvajjatā, tabbipariyāyena appasāvajjatā ca vatthussa mahattāmahattesu viya daṭṭhabbā.
Indeed, even if the factors like effort and object are not great, great blameworthiness arises due to the virtuousness of the one to be killed, and conversely, slight blameworthiness arises, just as in the case of the object's greatness or lack thereof.
Mặc dù các yếu tố như hành động và đối tượng không lớn, nhưng do phẩm chất của đối tượng bị giết mà có sự lỗi lầm lớn; và ngược lại, có sự lỗi lầm nhỏ, như đã thấy trong trường hợp đối tượng lớn hay nhỏ.
Kilesānaṃ upakkamānaṃ dvinnañca mudutāya tibbatāya ca appasāvajjatā mahāsāvajjatāpi yojetabbā.
The slight blameworthiness and great blameworthiness should also be applied based on the mildness and intensity of the defilements and the efforts.
Sự lỗi lầm nhỏ và lỗi lầm lớn cũng nên được áp dụng theo sự mềm yếu và mạnh mẽ của hai yếu tố: phiền não và phương tiện.
Pāṇo pāṇasaññitā vadhakacittañca pubbabhāgiyāpi honti, upakkamo vadhakacetanāsamuṭṭhāpito.
The being, the perception of a being, and the intention to kill are also preliminary factors; the effort is initiated by the volition to kill.
Chúng sinh, nhận thức về chúng sinh, và tâm giết hại cũng là những yếu tố chuẩn bị; phương tiện là do tác ý giết hại khởi lên.
Pañca sambhārā hi pāṇātipātacetanāti sā pañcasambhāravinimuttā daṭṭhabbā.
Indeed, the volition for the destruction of life is the five constituents, so it should be understood as distinct from the five constituents.
Năm thành phần (sambhāra) chính là tác ý sát sinh (pāṇātipāta-cetanā), vì vậy nó phải được xem là không tách rời khỏi năm thành phần.
Ayañca vicāro adinnādānādīsupi yathārahaṃ vattabbo.
And this consideration should be stated appropriately in cases like taking what is not given, and so on.
Và sự phân tích này cũng nên được nói một cách thích hợp trong các trường hợp trộm cắp, v.v.
Vijjhanapaharaṇādivasena sahatthenanibbatto sāhatthiko, āṇāpanavasena pavatto āṇattiko, ususattiyantapāsāṇādinissajjanavasena pavatto nissaggiyo, aduhalasajjanādivasena pavatto thāvaro, āthabbaṇikādīnaṃ viya mantaparijappanavasena pavatto vijjāmayo, kammavipākajiddhimayo iddhimayo dāṭhākoṭanādīni viya.
Sāhatthika (personal act) is performed by oneself through piercing, striking, etc.; āṇattika (by command) occurs by way of command; nissaggiya (by projectile) occurs by releasing arrows, spears, machines, stones, etc.; thāvara (fixed) occurs by setting traps, snares, etc.; vijjāmaya (by magic) occurs by reciting spells, like those of sorcerers; iddhimaya (by psychic power) is born of kamma-resultant psychic power, like breaking tusks.
Sāhatthiko (tự tay) là do tự tay thực hiện bằng cách đâm, đánh, v.v.; āṇattiko (sai khiến) là do ra lệnh; nissaggiyo (phóng ra) là do phóng ra tên, giáo, máy móc, đá, v.v.; thāvaro (cố định) là do đặt bẫy, v.v.; vijjāmayo (do thần chú) là do niệm thần chú như của các pháp sư, v.v.; iddhimayo (do thần thông) là do thần thông phát sinh từ nghiệp quả, như việc cắn nanh, v.v.
Yadi ‘‘mama ida’’nti parena pariggahitaṃ adinnaṃ, uttānaseyyakadārakasantake kathaṃ tassa pariggahasaññāya eva abhāvatoti āha ‘‘yattha paro’’tiādi.
If "this is mine" is something taken by another, how can it be considered as such in the case of a baby lying on its back, since there is no perception of possession in it? In response, it is said: "where another" and so on.
Nếu một vật bị người khác chiếm hữu là adinna (không được cho), thì làm sao đối với tài sản của một đứa trẻ sơ sinh đang nằm ngửa, khi mà nó không có nhận thức về sự chiếm hữu đó? Vì vậy, câu nói “yattha paro” (nơi người khác) v.v. được nói ra.
Paro nāma viññū vā aviññū vā atthi tassa vatthussa sāmiko.
"Another" means a sentient or non-sentient being who is the owner of that object.
Paro (người khác) có nghĩa là người có trí hay không có trí, là chủ sở hữu của vật đó.
Aviññūpi hi viññukāle yathākāmaṃ karonto adaṇḍārahoti.
For even a non-sentient being, when it becomes sentient and acts as it wishes, it is not liable to punishment.
Ngay cả người không có trí, khi đến tuổi có trí, hành động theo ý muốn, thì không đáng bị trừng phạt.
Mantaparijappanena parasantakaharaṇaṃ vijjāmayo, vinā mantena parasantakassa kāyavacīpayogehi parikaḍḍhanaṃ tādiseniddhivasena iddhimayo payogoti adinnādāne cha payogā sāhatthikādayo vuttā.
Taking another's property by reciting spells is vijjāmaya; seizing another's property without spells through bodily and verbal effort, or by means of such psychic power, is iddhimaya effort. Thus, six types of efforts like sāhatthika are stated in taking what is not given.
Việc lấy tài sản của người khác bằng cách niệm thần chú là vijjāmayo (do thần chú); việc lấy tài sản của người khác bằng cách kéo đi bằng hành động thân hoặc lời nói mà không dùng thần chú, hoặc bằng thần thông tương tự, là iddhimayo (do thần thông). Như vậy, trong tội trộm cắp (adinnādāna), sáu phương tiện như sāhatthika v.v. đã được nói đến.
Yathānurūpanti ettha sāhatthiko tāva pañcannampi avahārānaṃ vasena pavattati, tathā āṇattiyo nissaggiyo ca.
In "as appropriate", sāhatthika, for instance, operates in terms of all five types of theft, and similarly āṇattika and nissaggiya.
Trong câu yathānurūpaṃ (tùy theo), sāhatthiko (tự tay) xảy ra theo năm loại trộm cắp; tương tự, āṇattiyo (sai khiến) và nissaggiyo (phóng ra) cũng vậy.
Thāvaro theyyāvahārapasayhāvahārapaṭicchannāvahāravasena.
Thāvara operates in terms of theft, robbery, and concealed theft.
Thāvaro (cố định) theo cách trộm cắp lén lút, trộm cắp bằng vũ lực, trộm cắp che giấu.
Tathā sesāpīti daṭṭhabbaṃ.
The same should be understood for the remaining types.
Và những loại còn lại cũng vậy, nên được hiểu.
Methunasamācāresūti sadārāsantosa-paradāragamanavasena duvidhesu methunasamācāresu.
In sexual misconduct refers to the two kinds of sexual misconduct: dissatisfaction with one's own spouse and going with another's spouse.
Methunasamācāresu (trong các hành vi tà dâm) có hai loại: không thỏa mãn với vợ mình và đi đến vợ người khác.
Ayamevahi bhedo idhādhippeto.
Indeed, this distinction is intended here.
Chính sự phân biệt này được đề cập ở đây.
Gottarakkhitā sagottehi rakkhitā.
Gottarakkhitā means protected by her kinsmen.
Gottarakkhitā (được bảo vệ bởi dòng họ) là người được dòng họ bảo vệ.
Dhammarakkhitā sahadhammikehi rakkhitā.
Dhammarakkhitā means protected by her co-religionists.
Dhammarakkhitā (được bảo vệ bởi pháp) là người được các đồng phạm hạnh bảo vệ.
Sārakkhā sasāmikā.
Sārakkhā means having a protector/owner.
Sārakkhā (có chủ) là người có chồng.
Yassā gamane raññā daṇḍo ṭhapito, sā saparidaṇḍā.
She for whose going the king has set a penalty is saparidaṇḍā.
Người mà vua đã ra lệnh trừng phạt nếu ai đó quan hệ với cô ấy, đó là saparidaṇḍā (bị phạt).
Bhariyabhāvatthaṃ dhanena kītā dhanakkītā.
One bought with money for the purpose of being a wife is dhanakkītā.
Người được mua bằng tiền để làm vợ là dhanakkītā (được mua bằng tiền).
Chandena vasantī chandavāsinī.
One who lives by choice is chandavāsinī.
Người sống theo ý muốn là chandavāsinī (sống theo ý muốn).
Bhogatthaṃ vasantī bhogavāsinī.
One who lives for enjoyment is bhogavāsinī.
Người sống để hưởng thụ là bhogavāsinī.
Paṭatthaṃ vasantī paṭavāsinī.
One who lives for a garment is paṭavāsinī.
Người sống để làm việc là paṭavāsinī.
Udakapattaṃ āmasitvā gahitā odapattakinī.
One taken after touching a water pot is odapattakinī.
Người được lấy sau khi chạm vào lá sen nước là odapattakinī.
Cumbaṭakaṃ apanetvā gahitā obhaṭacumbaṭā.
One taken after removing the hair-coil is obhaṭacumbaṭā.
Người được lấy sau khi tháo bỏ khăn đội đầu là obhaṭacumbaṭā.
Karamarānītā dhajāhatā.
One brought by force from war is dhajāhatā.
Người bị bắt về từ chiến tranh là dhajāhatā.
Taṅkhaṇikā muhuttikā.
One for a moment is muhuttikā.
Người chỉ trong chốc lát là muhuttikā.
Abhibhavitvā vītikkame micchācāro mahāsāvajjo, na tathā dvinnaṃ samānachandatāya.
Sexual misconduct by overpowering is greatly blameworthy, not so when both have equal consent.
Tà dâm bằng cách cưỡng bức là lỗi lầm lớn, không giống như khi cả hai đều có ý muốn tương đồng.
Abhibhavitvā vītikkamane satipi maggenamaggapaṭipattiadhivāsane purimuppannasevanābhisandhipayogābhāvato micchācāro na hoti abhibhuyyamānassāti vadanti.
Some say that even if there is an act of misconduct by overpowering, there is no sexual misconduct for the one being overpowered, due to the absence of prior intention for sexual activity and the absence of effort in enduring an improper act.
Một số người nói rằng, ngay cả khi có sự cưỡng bức, nếu không có sự thực hành theo con đường và không có sự tích lũy hành vi trước đó, thì đối với người bị cưỡng bức, đó không phải là tà dâm.
Sevanācitte sati payogābhāvo appamāṇaṃ yebhuyyena itthiyā sevanāpayogassa abhāvato.
If there is an intention for sexual activity, the absence of effort is immeasurable, mostly due to the absence of the woman's effort in sexual activity.
Nếu có ý muốn quan hệ tình dục nhưng không có hành động, thì điều đó không quan trọng, vì phần lớn phụ nữ không có hành động quan hệ tình dục.
Tathā sati puretaraṃ sevanācittassa upaṭṭhānepi tassā micchācāro na siyā, tathā purisassapi sevanāpayogābhāveti, tasmā attano ruciyā pavattitassa vasena tayo, balakkārena pavattitassa vasena tayoti sabbepi aggahitaggahaṇena cattāro sambhārāti vuttanti veditabbaṃ.
In such a case, even if the intention for sexual activity arose earlier, there would be no sexual misconduct for her, nor for the man if there was no effort in sexual activity. Therefore, it should be understood that all are called four constituents by including what was not previously included: three based on one's own desire, and three based on force.
Nếu vậy, ngay cả khi ý muốn quan hệ tình dục xuất hiện trước đó, thì đối với cô ấy cũng không phải là tà dâm, và đối với người đàn ông cũng vậy nếu không có hành động quan hệ tình dục. Do đó, nên hiểu rằng có ba loại theo ý muốn của bản thân, và ba loại theo sự cưỡng bức, tổng cộng là bốn thành phần được nói đến bằng cách bao gồm cả những điều chưa được đề cập.
Atthabhañjakoti kammapathavasena vuttaṃ.
Atthabhañjako (destroyer of benefit) is stated in terms of the path of action.
Atthabhañjako (phá hoại mục đích) được nói đến theo nghĩa nghiệp đạo.
Kammapathakathā hesāti.
This is a discourse on the paths of action.
Đây là câu chuyện về các nghiệp đạo (kammapatha).
Assāti visaṃvādakassa.
Assā means to the deceiver.
Của người ấy (assa) có nghĩa là của người nói dối, người không nói đúng sự thật.
Musā vadati etenāti cetanā musāvādo, imasmiṃ pakkhe atathākārena vatthuno viññāpanapayogo musā, taṃsamuṭṭhāpikā cetanāmusāvādoti vuttattā tato aññathā vattuṃ ‘‘aparo nayo’’tiādi vuttaṃ.
Since it is said that one speaks falsely by this, it is false speech based on intention (cetanā musāvādo). In this context, the act of making a thing known in an untrue manner is false speech, and the intention that gives rise to it is called 'false speech based on intention.' Therefore, in order to speak differently from that, phrases like 'another method' are used.
Nói dối bằng ý định này, đó là cetanā musāvādo (ý định nói dối). Trong trường hợp này, việc sử dụng lời nói để thông báo sự việc không đúng sự thật là lời nói dối (musā). Vì đã nói rằng ý định phát sinh điều đó là cetanā musāvādo, nên để nói khác đi, đã có câu “một phương pháp khác” (aparo nayo) và vân vân.
Attano santakaṃ adātukāmatāyātiādi musāvādasāmaññena vuttaṃ.
The phrase 'due to the wish not to give what belongs to oneself' and so on is stated in the general sense of false speech.
Do không muốn cho cái của mình (attano santakaṃ adātukāmatāyā) và vân vân, được nói theo nghĩa chung của lời nói dối.
Hasādhippāyenapi visaṃvādanapurakkhārassa musāvādo.
Even with the intention of jest, false speech (musāvādo) is for one whose aim is deceit.
Ngay cả với ý định đùa giỡn, lời nói dối vẫn là lời nói dối đối với người có ý định lừa dối.
Parassāti visaṃvādanavasena viññāpetabbassa.
Parassa means to the one to be informed by way of deceit.
Của người khác (parassa) có nghĩa là của người cần được thông báo theo cách lừa dối.
Soti musāvādapayogo.
So refers to the act of false speech.
Đó (so) là việc sử dụng lời nói dối.
Ekantapharusā cetanāti etena duṭṭhacittataṃyeva vibhāveti, duṭṭhacittatā cassa amaraṇādhippāyavasena daṭṭhabbā.
By 'an exclusively harsh intention,' it elucidates the evil-mindedness itself. And its evil-mindedness should be seen in terms of not having the intention to kill.
Ý định cực kỳ thô ác (ekantapharusā cetanā) điều này thể hiện rõ trạng thái tâm ác độc, và trạng thái tâm ác độc này phải được hiểu theo ý định không muốn giết hại.
Sati hi maraṇādhippāye atthasiddhi, tadabhāve pāṇātipātabyāpādā siyunti.
For if there were an intention to kill, the goal would be achieved; in its absence, there would be killing of living beings and ill-will.
Nếu có ý định giết hại, thì có sự thành tựu của nghiệp, nếu không có ý định đó thì sẽ có nghiệp sát sinh và hãm hại.
Yaṃ paṭicca pharusavācā payujjati, tassa sammukhāva sīsaṃ eti.
That for which harsh speech is employed comes to a head directly.
Lời nói thô ác được sử dụng để nhắm vào ai, thì trực tiếp nhắm vào người đó.
Parammukhāpi sīsaṃ eti evāti apare.
Others say it comes to a head even indirectly.
Người khác nói rằng, ngay cả khi nói sau lưng, nó cũng nhắm vào người đó.
Tatthāyaṃ adhippāyo yutto siyā – sammukhā payoge agāravādīnaṃ balavabhāvato siyā cetanā balavatī, parassa ca tadatthaviññāpanaṃ, na tathā asammukhāti.
Here, this intention might be appropriate: in direct application, due to the strength of disrespectful speech, the intention might be strong, and the communication of that meaning to the other person, but not so when indirect.
Trong đó, ý nghĩa này có thể là hợp lý – khi sử dụng trực tiếp, do sự mạnh mẽ của những lời nói thiếu tôn kính, ý định có thể mạnh mẽ, và sự thông báo ý nghĩa đó đến người khác, không giống như khi nói sau lưng.
Yathā ca akkosite mate āḷahane katā khamāpanā upavādantarāyaṃ nivatteti, evaṃ parammukhā payuttā pharusavācā hotiyevāti sakkā viññātuṃ.
Just as an apology made at a funeral after someone has been reviled removes the subsequent offense, so too, it can be understood that harsh speech employed indirectly still occurs.
Và giống như việc xin lỗi được thực hiện tại đám tang của người bị mắng chửi đã loại bỏ chướng ngại của sự phỉ báng, thì lời nói thô ác được sử dụng sau lưng cũng có thể được hiểu là như vậy.
Tassāti ekantapharusacetanāya eva pharusavācābhāvassa āvibhāvatthaṃ.
Tassā is for the purpose of clarifying the absence of harsh speech even in an exclusively harsh intention.
Của điều đó (tassā) là để làm rõ rằng chỉ có ý định cực kỳ thô ác mới là lời nói thô ác.
Mammacchedako savanapharusatāyāti adhippāyo.
Mammacchedako means painful to hear, that is the intention.
Cắt đứt chỗ hiểm yếu (mammacchedako) có nghĩa là khó nghe.
Cittasaṇhātāya pharusavācā na hoti kammapathā’ppattattā, kammabhāvaṃ pana na sakkā vāretuṃ.
Due to its mildness of mind, it is not harsh speech because it has not reached the path of action (kammapatha). However, its karmic nature cannot be denied.
Do tâm dịu dàng, không phải là lời nói thô ác (cittasaṇhātāya pharusavācā na hoti) vì chưa đạt đến nghiệp đạo (kammapatha), nhưng không thể phủ nhận đó là nghiệp.
Evaṃ anvayavasena cetanāpharusatāya pharusavācaṃ sādhetvā idāni tameva byatirekavasena sādhetuṃ ‘‘vacanasaṇhatāyā’’tiādi vuttaṃ.
Having thus established harsh speech through the direct method based on the harshness of intention, now to establish the same through the inverse method, 'vacanasaṇhatāya' and so on is stated.
Như vậy, sau khi chứng minh lời nói thô ác bằng sự thô ác của ý định theo phương pháp thuận, bây giờ để chứng minh điều đó bằng phương pháp nghịch, đã nói “do lời nói dịu dàng” (vacanasaṇhatāyā) và vân vân.
Esāti pharusavācā.
Esā refers to harsh speech.
Điều này (esā) là lời nói thô ác.
Kammapathabhāvaṃ appattā appasāvajjā, itarā mahāsāvajjā.
That which has not attained the state of a path of action is of minor offense, the other is of major offense.
Chưa đạt đến trạng thái nghiệp đạo nên ít tội lỗi (appasāvajjā), còn điều khác thì tội lỗi lớn (mahāsāvajjā).
Tathā kilesānaṃ mudutibbatābhedehi sabbaṃ purimasadisaṃ.
Similarly, everything is like the preceding due to the distinction of the mildness and intensity of defilements.
Tương tự, tất cả đều giống như trước về sự khác biệt giữa phiền não mềm yếu và phiền não mạnh mẽ.
Attano pariṇāmanaṃ cittenevāti veditabbaṃ.
Attano pariṇāmanaṃ should be understood as by the mind itself.
Sự hướng tâm của mình (attano pariṇāmanaṃ) nên được hiểu là chỉ bằng tâm.
Hitasukhaṃ byāpādayatīti yo taṃ uppādeti, tassa hitasukhaṃ vināseti.
Hitasukhaṃ byāpādayatīti means it destroys the welfare and happiness of the one who produces it.
Làm hại lợi ích và hạnh phúc (hitasukhaṃ byāpādayatī) có nghĩa là hủy hoại lợi ích và hạnh phúc của người tạo ra điều đó.
Aho vatāti iminā accantavināsacintanaṃ dīpeti.
By 'Aho vatā,' it indicates the thought of complete destruction.
Ôi chao! (aho vatā) điều này biểu thị ý nghĩ muốn hủy hoại hoàn toàn.
Evaṃ hissa dāruṇapavattiyā kammapathappatti.
Indeed, it is through such cruel action that it attains the path of action.
Như vậy, do hành động tàn ác của người đó mà đạt đến nghiệp đạo.
Yathābhuccagahaṇābhāvenāti yāthāvaggāhassa abhāvena aniccādisabhāvassa niccādito gahaṇena.
Yathābhuccagahaṇābhāvena means by the absence of grasping reality, by grasping impermanent qualities as permanent, and so on.
Do không nắm bắt đúng sự thật (yathābhuccagahaṇābhāvenā) có nghĩa là do không nắm bắt đúng bản chất thực sự, do nắm bắt bản chất vô thường và vân vân như thường còn và vân vân.
Micchā passatīti vitathaṃ passati.
Micchā passati means sees wrongly.
Thấy sai lầm (micchā passatī) có nghĩa là thấy không đúng sự thật.
Samphappalāpo viyāti iminā āsevanassa mandatāya appasāvajjataṃ, mahantatāya mahāsāvajjataṃ dasseti.
By 'like frivolous talk,' it indicates minor offensiveness due to weak practice and major offensiveness due to intense practice.
Giống như lời nói vô ích (samphappalāpo viyā) điều này cho thấy rằng do sự thực hành yếu kém nên ít tội lỗi, do sự thực hành mạnh mẽ nên tội lỗi lớn.
Gahitākāraviparītatāti micchādiṭṭhiyā gahitākārassa viparītabhāvo.
Gahitākāraviparītatā means the opposite state of the grasped mode of wrong view.
Sự trái ngược với cách nắm bắt (gahitākāraviparītatā) có nghĩa là sự trái ngược với cách nắm bắt của tà kiến.
Vatthunoti tassā ayathābhūtasabhāvamāha.
Vatthuno refers to the unreality of its nature.
Của sự vật (vatthuno) điều này nói về bản chất không đúng sự thật của nó.
Tathābhāvenāti gahitākāreneva tassa diṭṭhigatikassa, tassa vā vatthuno upaṭṭhānaṃ evametaṃ, na ito aññathāti.
Tathābhāvena means by that very state, tassa (of that person holding the view), or tassa (of that object), upaṭṭhānaṃ (presentation) as "this is so, and not otherwise."
Với bản chất như vậy (tathābhāvenā) có nghĩa là với cách nắm bắt như vậy, sự hiện hữu (upaṭṭhānaṃ) của người có tà kiến đó (tassa) hoặc của sự vật đó (tassa) là như thế này, không phải khác.
Paṭipāṭiyā sattāti ettha nanu cetanā abhidhamme kammapathesu na vuttāti paṭipāṭiyā sattannaṃ kammapathabhāvo na yuttoti?
Paṭipāṭiyā sattā – here, it is asked, is it not true that intention is not mentioned among the paths of action in the Abhidhamma, so the seven paths of action in sequence are not appropriate?
Bảy theo thứ tự (paṭipāṭiyā sattā) ở đây, chẳng phải ý định (cetanā) không được nói đến trong Abhidhamma về các nghiệp đạo sao? Vậy thì việc bảy điều có trạng thái nghiệp đạo theo thứ tự là không hợp lý sao?
Na, avacanassa aññahetukattā.
No, because its not being mentioned is due to another reason.
Không, vì việc không nói đến có nguyên nhân khác.
Na hi tattha cetanāya akammapathattā kammapatharāsimhi avacanaṃ, kadāci pana kammapatho hoti, na sabbadāti kammapathabhāvassa aniyatattā avacanaṃ.
For it is not that intention is not mentioned in the category of paths of action because it is not a path of action. Rather, it is not mentioned because its state as a path of action is not fixed, as it sometimes is a path of action and not always.
Không phải vì ý định không phải là nghiệp đạo mà nó không được nói đến trong nhóm nghiệp đạo, mà có khi nó là nghiệp đạo, không phải lúc nào cũng vậy, do trạng thái nghiệp đạo của nó không cố định nên không được nói đến.
Yadā pana kammapatho hoti, tadā kammapatharāsisaṅgaho na nivārito.
However, when it is a path of action, its inclusion in the category of paths of action is not prevented.
Nhưng khi nó là nghiệp đạo, thì việc bao gồm nó vào nhóm nghiệp đạo không bị ngăn cản.
Etthāha – yadi cetanāya sabbadā kammapathabhāvābhāvato aniyato kammapathabhāvoti kammapatharāsimhi avacanaṃ, nanu abhijjhādīnaṃ kammapathabhāvaṃ appattānaṃ atthitāya aniyato kammapathabhāvoti tesampi kammapatharāsimhi avacanaṃ āpajjatīti?
Here it is said: If, due to the absence of the state of intention always being a path of action, its path-of-action state is unfixed, and thus it is not mentioned in the category of paths of action, then would not a similar non-mention apply to covetousness (abhijjhā) and others, whose path-of-action state is also unfixed due to their existing without attaining path-of-action status?
Ở đây có người nói: Nếu vì ý định không phải lúc nào cũng là nghiệp đạo nên trạng thái nghiệp đạo của nó không cố định, và do đó không được nói đến trong nhóm nghiệp đạo, thì chẳng phải tham lam (abhijjhā) và vân vân, vì có những thứ chưa đạt đến trạng thái nghiệp đạo nên trạng thái nghiệp đạo của chúng không cố định, vậy thì chúng cũng không được nói đến trong nhóm nghiệp đạo sao?
Nāpajjati kammapathatātaṃsabhāgatāhi tesaṃ tattha vuttattā.
No, it does not apply, because they are mentioned there due to their affinity with the path of action.
Không phải vậy, vì chúng đã được nói đến ở đó do có sự tham gia vào trạng thái nghiệp đạo.
Yadi evaṃ cetanāpi tattha vattabbā siyā?
If so, should not intention also be mentioned there?
Nếu vậy, ý định cũng nên được nói đến ở đó?
Saccametaṃ, sā pana pāṇātipātādikāti pākaṭo, tassā kammapathabhāvoti na vuttā siyā.
This is true, but it is well-known as killing and so on, so its state as a path of action might not have been mentioned.
Đúng vậy, nhưng nó đã rõ ràng là sát sinh (pāṇātipāta) và vân vân, nên trạng thái nghiệp đạo của nó có thể không được nói đến.
Cetanāya hi – ‘‘cetanāhaṃ, bhikkhave, kammaṃ vadāmi (a. ni. 6.63; kathā. 539), tividhā, bhikkhave, kāyasañcetanā akusalaṃ kāyakamma’’ntiādivacanato (kathā. 539) kammabhāvo pākaṭo, kammaṃyeva ca sugatiduggatīnaṃ tattha uppajjanakasukhadukkhānañca pathabhāvena pavattaṃ kammapathoti vuccatīti pākaṭo tassā kammapathabhāvo, abhijjhādīnaṃ pana cetanāsamīhanabhāvena sucaritaduccaritabhāvo cetanājanitapiṭṭhivaṭṭakabhāvena sugatiduggatitaduppajjanakasukhadukkhānaṃ pathabhāvo cāti na tathā pākaṭo kammapathabhāvoti teyeva tena sabhāvena dassetuṃ abhidhamme cetanā kammapatharāsibhāvena na vuttā, atathājātiyakattā vā cetanā tehi saddhiṃ na vuttāti daṭṭhabbaṃ.
Indeed, the karmic nature of intention is evident from statements like "Bhikkhus, I declare intention to be kamma" (A. III, 63; Kathā. 539) and "Bhikkhus, threefold is bodily volition, unwholesome bodily action" (Kathā. 539). And since kamma itself, operating as the path to good and bad destinations and to the pleasant and painful experiences arising therein, is called a path of action (kammapatha), its path-of-action nature is evident. However, the path-of-action nature of covetousness (abhijjhā) and others—namely, their character as good or bad conduct through the nature of intentional seeking, and their nature as paths to good and bad destinations and to the pleasant and painful experiences arising from the kamma-generated continuation—is not so evident. Therefore, only they were presented with that nature. Or it should be understood that intention was not mentioned with them because it is not of the same class.
Vì ý định, từ những lời dạy như: “Này các tỳ-khưu, Ta nói ý định là nghiệp (A.N. 6.63; Kathā. 539), này các tỳ-khưu, có ba loại ý định thân là bất thiện nghiệp thân” (Kathā. 539), trạng thái nghiệp của nó đã rõ ràng. Và chính nghiệp đó, khi tồn tại như con đường dẫn đến thiện thú và ác thú, và đến những khổ đau và hạnh phúc phát sinh ở đó, được gọi là nghiệp đạo (kammapatha). Do đó, trạng thái nghiệp đạo của nó đã rõ ràng. Nhưng đối với tham lam và vân vân, trạng thái thiện hành và ác hành của chúng do ý định mong muốn, và trạng thái con đường dẫn đến thiện thú, ác thú, và những khổ đau và hạnh phúc phát sinh ở đó do là hậu quả của ý định, thì trạng thái nghiệp đạo không rõ ràng như vậy. Do đó, để chỉ ra chúng với bản chất đó, trong Abhidhamma, ý định không được nói đến như một phần của nhóm nghiệp đạo, hoặc nên hiểu rằng ý định không được nói đến cùng với chúng vì chúng không cùng loại.
Mūlaṃ patvāti mūladesanaṃ patvā, mūlasabhāvesu dhammesu vuccamānesūti attho.
Mūlaṃ patvā means reaching the root teaching, meaning when discussing the basic inherent qualities.
Đến gốc (mūlaṃ patvā) có nghĩa là đến giáo lý gốc, nghĩa là khi các pháp có bản chất gốc được nói đến.
Adinnādānaṃ sattārammaṇanti idaṃ ‘‘pañca sikkhāpadā parittārammaṇā eva vā’’ti imāya pañhapucchakapāḷiyā virujjhati.
Adinnādānaṃ sattārammaṇaṃ (taking what is not given has living beings as its object) contradicts the question in the text "Are the five training rules (sikkhāpadā) exclusively with limited objects or not?"
Trộm cắp có đối tượng là chúng sinh (adinnādānaṃ sattārammaṇaṃ) điều này mâu thuẫn với câu hỏi trong kinh Pāli: “Năm giới có đối tượng nhỏ (parittārammaṇā) hay sao?”
Yañhi pāṇātipātādidussīlyassa ārammaṇaṃ, tadeva taṃ veramaṇiyā ārammaṇaṃ.
For indeed, that which is the object of misconduct such as killing is also the object of abstinence from it.
Vì đối tượng của ác hạnh như sát sinh và vân vân, chính là đối tượng của sự kiêng cữ đó.
Vītikkamitabbavatthuto eva hi viratīti.
For abstinence is from that very thing that should be avoided.
Vì sự kiêng cữ là từ vật cần phải vượt qua.
Sattārammaṇanti vā sattasaṅkhātaṃ saṅkhārārammaṇameva upādāya vuttanti nāyaṃ virodho.
Or sattārammaṇaṃ is stated by referring only to the conceptual object counted as a living being, so there is no contradiction.
Hoặc có đối tượng là chúng sinh (sattārammaṇaṃ) được nói đến chỉ dựa trên đối tượng là các hành (saṅkhāra) được gọi là chúng sinh, vậy thì không có mâu thuẫn này.
Tathā hi vuttaṃ sammohavinodaniyaṃ (vibha. aṭṭha. 714) ‘‘yāni sikkhāpadāni ettha sattārammaṇānīti vuttāni, tāni yasmā sattoti saṅkhyaṃ gataṃ saṅkhārameva ārammaṇaṃ karontī’’ti.
Thus it is said in the Sammohavinodanī (VibhA. 714): "Those training rules that are here called 'having living beings as their object' are so called because they take as their object only the conceptualized living being."
Như đã nói trong Sammohavinodanī (VibhA. 714): “Những giới được nói là có đối tượng là chúng sinh ở đây, là vì chúng lấy các hành được gọi là chúng sinh làm đối tượng.”
Visabhāgavatthuno ‘‘itthī, puriso’’ti gahetabbato sattārammaṇoti eke.
Some say that it has living beings as its object because diverse things are grasped as "woman, man."
Vì sự vật không đồng loại được nắm bắt là “phụ nữ, đàn ông”, nên một số người nói là có đối tượng là chúng sinh (sattārammaṇoti eke).
‘‘Eko diṭṭho, dve sutā’’tiādinā samphappalapane diṭṭhasutamutaviññātavasena.
Diṭṭhasutamutaviññātavasena means by way of what is seen, heard, sensed, and known, in frivolous talk such as "one was seen, two were heard."
Trong việc nói vô ích như “một cái đã thấy, hai cái đã nghe”, thì theo cái đã thấy, đã nghe, đã cảm nhận, đã biết (diṭṭhasutamutaviññātavasena).
Tathā abhijjhāti ettha tathā-saddo ‘‘diṭṭhasutamutaviññātavasenā’’ti idampi upasaṃharati, na sattasaṅkhārārammaṇataṃ eva dassanādivasena abhijjhāyanato.
In "Similarly, covetousness," the word "similarly" here also includes "in terms of what is seen, heard, sensed, and cognized," and not merely the state of having sentient beings and formations as objects, because one covets in terms of seeing, etc.
Cũng vậy, tham lam (abhijjhā): Ở đây, từ cũng vậy bao hàm cả* “theo cách thấy, nghe, nhận thức và hiểu biết”, chứ không chỉ là đối tượng là chúng sinh và các hành, vì sự tham lam phát sinh theo cách thấy, v.v.
‘‘Natthi sattā opapātikā’’ti pavattamānāpi micchādiṭṭhi tebhūmakadhammavisayāvāti adhippāyenassā saṅkhārārammaṇatā vuttā.
Even though wrong view, operating as "There are no spontaneously arisen beings," has as its object the phenomena of the three planes, its nature as having formations as its object is stated with this intention.
Ngay cả khi tà kiến phát sinh với* “không có chúng sinh hóa sinh”, nó vẫn có đối tượng là các pháp thuộc ba cõi. Với ý nghĩa này, sự có đối tượng là các hành của nó đã được nói đến.
Kathaṃ pana micchādiṭṭhiyā sabbe tebhūmakadhammā ārammaṇaṃ hontīti?
How then do all phenomena of the three planes become the object of wrong view?
Nhưng làm thế nào mà tất cả các pháp thuộc ba cõi lại là đối tượng của tà kiến?
Sādhāraṇato.
Through generality.
Một cách chung chung.
‘‘Natthi sukatadukkaṭānaṃ kammānaṃ phalaṃ vipāko’’ti hi pavattamānāya atthato rūpārupāvacaradhammāpi gahitā eva hontīti.
For, when it operates as "There is no fruit or result of good and bad deeds," the rūpa and arūpa-avacara phenomena are implicitly included.
Vì khi* phát sinh với* “không có quả dị thục của các nghiệp thiện ác”, thì về mặt ý nghĩa, các pháp thuộc sắc giới và vô sắc giới cũng đã được bao gồm.
Kesañcīti sahajātānaṃ adinnādānādīnaṃ.
Of some refers to co-arisen acts such as taking what is not given.
Đối với một số*: là các pháp đồng sinh như trộm cắp, v.v.
Sampayuttapabhāvakaṭṭhenāti sampayutto hutvā uppādakaṭṭhena.
By way of being a co-associated producer means by way of being co-associated and generating.
Theo cách làm cho chúng tương ưng (sampayuttapabhāvakaṭṭhena): là theo cách làm cho chúng phát sinh khi tương ưng.
Kesañcīti asahajātānaṃ.
Of some refers to non-co-arisen acts.
Đối với một số*: là các pháp không đồng sinh.
Upanissayapaccayaṭṭhenāti etena mūlaṭṭhena lobhassa upakārataṃ nivatteti.
By way of upanissaya condition with this, he refutes the nature of greed as a root condition for its assistance.
Theo cách là duyên y chỉ mạnh (upanissayapaccayaṭṭhena): Điều này loại bỏ sự hỗ trợ của tham lam theo nghĩa gốc.
Suppatiṭṭhitabhāvasādhanaṭṭho hi mūlaṭṭho, so ca hetupaccayatāavinābhāvī, tena cettha mūlamiva mūlanti gahetabbaṃ, nippariyāyato pana pubbe ‘‘kesañcī’’ti vuttānaṃ sahajātānaṃ mūlabhāvo veditabbo.
For the meaning of root is the establishment of a firm foundation, and that is inseparable from the nature of a root condition; therefore, here, it should be understood as "like a root." But in the ultimate sense, the root nature of the co-arisen things mentioned earlier as "of some" should be understood.
Vì nghĩa gốc là cách làm cho* vững chắc, và điều đó không thể tách rời với duyên nhân. Do đó, ở đây cần hiểu là gốc như gốc. Tuy nhiên, theo nghĩa không ẩn dụ, thì các pháp đồng sinh đã được nói đến trước đó là “đối với một số*” cần được hiểu là gốc.
Ratto khotiādinā suttapadenapi pāṇātipātādīnaṃ akusalānaṃ lobhassa mūlakāraṇataṃ vibhāveti, na mūlaṭṭhenupakāratthaṃ avisesato tesaṃ hetupaccayattābhāvato.
By the Sutta passage beginning "Indeed, one who is attached," he also elucidates greed as the root cause of unwholesome deeds like the taking of life, not as providing assistance in the sense of a root condition, because it is not their root condition indiscriminately.
Với câu kinh “Ratto kho” (người tham lam) v.v.,* cũng làm rõ rằng tham lam là nguyên nhân gốc của các bất thiện như sát sinh, v.v., chứ không phải là sự hỗ trợ theo nghĩa gốc, vì chúng không phải là duyên nhân một cách đặc biệt.
Veranti pāṇātipātādipāpadhammaṃ.
Vera refers to evil deeds like the taking of life.
Vera (sự thù hằn): là pháp ác như sát sinh, v.v.
So hi verahetutāya ‘‘vera’’nti vuccati, taṃ maṇati ‘‘mayi idha ṭhitāya kathamāgacchasī’’ti tajjentī viya nivāretīti veramaṇī.
Because it is the cause of enmity, it is called vera (enmity); that which maṇati (prevents) it, as if intimidating with "How can you come to me while I stand here?", is veramaṇī (abstinence).
Vì nó là nguyên nhân của sự thù hằn nên được gọi là “vera”. Nó maṇati (ngăn chặn) như thể đe dọa “làm sao ngươi có thể đến khi ta ở đây?” nên gọi là veramaṇī (sự kiêng cữ).
Tenāha ‘‘pajahatī’’ti.
Thus, he said, "abandons."
Vì vậy,* nói “pajahatī” (từ bỏ).
‘‘Viramaṇī’’ti vattabbe niruttinayena eva-kāraṃ katvā evaṃ vuttaṃ.
Instead of saying "viramaṇī," it is stated this way by emphasizing the word according to etymology.
Đáng lẽ phải nói “viramaṇī”, nhưng đã được nói như vậy bằng cách thêm từ “eva” theo quy tắc ngữ pháp.
Vibhaṅge (vibha. 703, 704) eva niddisanavasena evaṃ vuttā.
It is stated thus descriptively in the Vibhaṅga.
Trong Phân Tích (Vibhaṅga 703, 704), nó được giải thích như vậy theo cách trình bày.
Asamādinnasīlassa sampattato yathāupaṭṭhitavītikkamitabbavatthuto virati sampattavirati, samādānavasena uppannā virati samādānavirati, samādānavasena uppannā virati samādānavirati, kilesānaṃ samucchindanavasena pavattāvirati samucchedavirati.
Abstinence that arises through opportune circumstances from an unaccepted precept, from the transgressible object that presents itself, is sampattavirati (opportunistic abstinence); abstinence that arises through acceptance is samādānavirati (abstinence by undertaking); abstinence that arises through the uprooting of defilements is samucchedavirati (eliminative abstinence).
Sự kiêng cữ phát sinh khi một người chưa thọ giới gặp phải các đối tượng cần phải vượt qua, đó là kiêng cữ tùy duyên (sampattavirati); sự kiêng cữ phát sinh do thọ giới, đó là kiêng cữ do thọ giới (samādānavirati); sự kiêng cữ phát sinh do tận diệt các phiền não, đó là kiêng cữ đoạn diệt (samucchedavirati).
Appanāvāranti nigamanavāraṃ.
Appanāvāra refers to the concluding section.
Phần kết luận (appanāvāraṃ): là phần tổng kết.
Ekena nayenāti vedanādivasena arūpamukheneva anekavidhesu vipassanākammaṭṭhānesu ekena kammaṭṭhānanayena.
By one method means by one meditation method among the many types of insight meditation topics, through the aspect of formlessness, such as by way of feeling.
Theo một phương pháp (ekena nayenā): là theo một phương pháp thiền quán trong nhiều loại thiền quán vipassanā, theo cách của các pháp vô sắc như cảm thọ, v.v.
‘‘Ṭhapetvā abhijjhaṃ nava akusalakammapathā’’ti vattabbaṃ.
It should be said, "nine unwholesome courses of action, excluding covetousness."
Đáng lẽ phải nói “trừ tham lam, có chín nghiệp đạo bất thiện” (ṭhapetvā abhijjhaṃ nava akusalakammapathā).
Dasāti vā idaṃ ‘‘kusalakammapathā’’ti iminā sambandhitabbaṃ ‘‘akusalakammapathā ca dasa kusalakammapathā cā’’ti.
Or this "ten" should be connected with "wholesome courses of action," as in "ten unwholesome courses of action and ten wholesome courses of action."
Hoặc từ “mười” (dasā) này cần được liên kết với “các nghiệp đạo thiện” (kusalakammapathā), tức là “mười nghiệp đạo bất thiện và mười nghiệp đạo thiện”.
‘‘Ṭhapetvā abhijjha’’nti hi imināva akusalakammapathānaṃ navabhāvo vutto hoti.
For the fact that there are nine unwholesome courses of action is stated by "excluding covetousness."
Vì chỉ với* “trừ tham lam” thì số lượng nghiệp đạo bất thiện đã được nói là chín.
Atha vā dasāti idaṃ ubhayathāpi sambandhitabbaṃ.
Alternatively, this "ten" should be connected in both ways.
Hoặc từ “mười” này cần được liên kết theo cả hai cách.
Abhijjhā hi pahātabbāpi sati pariññeyyataṃ nātivattatīti.
For even if covetousness is to be abandoned, it does not transcend the state of being comprehensible.
Vì tham lam, mặc dù cần được từ bỏ, nhưng không vượt ra ngoài phạm vi của sự hiểu biết.
Tathā hi vuttaṃ ‘‘rūpataṇhā piyarūpaṃ sātarūpa’’ntiādi, tasmā sā tāya pariññeyyatāya dukkhasaccepi saṅgahaṃ labhateva, pahātabbaṃ pana upādāya ‘‘ṭhapetvā abhijjha’’nti vuttaṃ.
Thus it is said, "delight in form, agreeable form" and so on; therefore, it also attains inclusion in the truth of suffering through that comprehensibility, but with reference to what is to be abandoned, it is said, "excluding covetousness."
Chẳng hạn, đã nói “ái sắc là pháp đáng yêu, pháp đáng thích”, v.v. Do đó, nó vẫn được bao gồm trong khổ đế thông qua sự hiểu biết đó. Tuy nhiên, khi đề cập đến điều cần từ bỏ,* đã nói “trừ tham lam”.
Tenevāha ‘‘pariyāyena pana sabbepi kammapathā dukkhasacca’’nti.
Thus, he said, "However, by way of inference, all courses of action are the truth of suffering."
Vì vậy,* nói “tuy nhiên, theo cách gián tiếp, tất cả các nghiệp đạo đều là khổ đế” (pariyāyena pana sabbepi kammapathā dukkhasacca).
Abhijjhālobhānaṃ pavattiākārasiddhabhedaṃ upādāya ‘‘ime dve dhammā’’ti vuttaṃ.
"These two phenomena" is said with reference to the established distinction in the mode of occurrence of covetousness and greed.
Dựa trên sự khác biệt về cách phát sinh của tham lam và ái dục,* đã nói “hai pháp này” (ime dve dhammā).
Suttantanayena taṇhā ‘‘samudayasacca’’nti vuttāti āha ‘‘nippariyāyena samudayasacca’’nti.
Since craving is called "the truth of origination" in the Sutta method, he says, "ultimately, the truth of origination."
Theo kinh tạng, ái được gọi là “tập đế”, vì vậy* nói “tập đế không ẩn dụ” (nippariyāyena samudayasacca).
Appavattīti appavattinimittamāha yathā ‘‘rāgakkhayo dosakkhayo’’ti (saṃ. ni. 4.314).
Non-occurrence states the cause of non-occurrence, as in "the destruction of lust, the destruction of hatred."
Sự không phát sinh (appavattī):* nói về nguyên nhân của sự không phát sinh, như “sự diệt trừ tham, sự diệt trừ sân” (Saṃyutta Nikāya 4.314).
Sappaccayatāya saṅkhatasabhāve dukkhasacce gahite appaccayatāya asaṅkhataṃ nirodhasaccaṃ paṭipakkhato āvattati, ekantasāvajje ācayagāmilakkhaṇe samudayasacce gahite sāvajjā vigamanaṃ apacayagāmilakkhaṇaṃ maggasaccaṃpaṭipakkhato āvattatīti dve āvattahāravasena veditabbānīti vuttaṃ.
It is stated that if the truth of suffering, which is conditioned, with cause, is taken, then the unconditioned truth of cessation, without cause, is inferred as the opposite; if the truth of origination, which is entirely blameworthy and accumulates, is taken, then the truth of the path, which is blameless and diminishes, is inferred as the opposite; these two should be understood by way of two inferences.
Khi khổ đế, là pháp hữu vi có duyên, được nắm giữ, thì diệt đế, là pháp vô vi không duyên, sẽ được suy ra từ phía đối lập. Khi tập đế, có đặc tính tích lũy và hoàn toàn có lỗi, được nắm giữ, thì đạo đế, có đặc tính tiêu giảm và thoát khỏi lỗi, sẽ được suy ra từ phía đối lập. Vì vậy, đã nói rằng hai điều này cần được hiểu theo cách suy luận ngược lại.
Tenevāha nettiyaṃ (netti. 4.niddesavāra) –
Thus it is said in the Netti:
Vì vậy, trong Nettiya (Netti. 4.niddesavāra) đã nói:
Sabbākārenāti kāmarāgarūparāgādisabbappakārehi, sabbato vā apāyagamanīyādiākārato, tattha kiñcipi anavasesetvā vā.
In all aspects means in all types such as sensual lust, form-lust, etc., or from all aspects such as leading to lower realms, or without leaving anything behind there.
Bằng mọi phương diện (sabbākārenā): là bằng mọi loại như dục ái, sắc ái, v.v., hoặc từ mọi phương diện như đi đến các cõi khổ, v.v., hoặc không để lại bất cứ điều gì ở đó.
Sabbākārenevāti sabbākārato.
In all aspects means from all aspects.
Hoàn toàn bằng mọi phương diện (sabbākārenevā): là từ mọi phương diện.
Nīharitvāti apanetvā, samucchinditvāicceva attho.
Having removed means having eliminated, or rather, having uprooted.
Loại bỏ (nīharitvā): là gạt bỏ, ý nghĩa là đoạn diệt.
Kañci dhammaṃ anavakārīkaritvāti rūpavedanādīsu kañci ekadhammampi avinibbhogaṃ katvā, ekekato aggahetvā samūhatova gahetvāti attho.
Without rendering any phenomenon inseparable means without making any single phenomenon among form, feeling, etc., inseparable, meaning by taking them as a whole, not individually.
Không làm cho bất kỳ pháp nào không thể phân chia (kañci dhammaṃ anavakārīkaritvā): là không làm cho bất kỳ một pháp nào trong sắc, thọ, v.v., không thể phân chia, có nghĩa là không nắm giữ từng cái một mà nắm giữ toàn bộ.
Asmīti ahamasmīti mānaggāhavasena.
Asmī means "I am" in the sense of the grip of conceit.
Ta là (asmī): là theo cách chấp thủ ngã “ta là”.
So pana yasmā pañcakkhandhe niravasesato gaṇhāti, tasmā vuttaṃ ‘‘samūhaggahaṇākārenā’’ti.
Since it embraces the five aggregates without remainder, it is said: "by way of grasping as a whole."
Vì điều đó nắm giữ năm uẩn một cách không sót lại, nên đã nói “theo cách nắm giữ toàn bộ” (samūhaggahaṇākārenā).
Yasmā cettha aggamaggacittaṃ vuccati, tasmā āha ‘‘diṭṭhisadisaṃ mānānusaya’’nti.
And since the supreme path-consciousness is referred to here, he says: "the conceit-underlying tendency similar to wrong view."
Vì ở đây đề cập đến tâm đạo tối thượng, nên* nói “tùy miên mạn tương tự tà kiến” (diṭṭhisadisaṃ mānānusaya).
‘‘Yaṃ rūpaṃ taṃ aha’’ntiādinā yathā diṭṭhi rūpādiṃ ‘‘ahamasmī’’ti gaṇhantī pavattati, evaṃ mānopi ‘‘seyyohamasmī’’tiādināti āha ‘‘mānānusayo asmīti pavattattā diṭṭhisadiso’’ti.
"Just as wrong view (diṭṭhi) operates by grasping form (rūpa) and so on, saying ‘This form is I’ (yaṃ rūpaṃ taṃ ahaṃ) and so forth, so too conceit (māna) operates by saying ‘I am superior’ (seyyohamasmī) and so forth. Therefore, it is said: ‘The latent tendency of conceit is similar to wrong view because it operates with the thought “I am”’."
Với câu ‘Cái gì là sắc, cái đó là ta’ v.v… như tà kiến chấp thủ sắc v.v… là ‘ta là’, thì ngã mạn cũng vậy, với câu ‘ta là hơn’ v.v… Do đó,* nói: ‘Tùy miên ngã mạn giống như tà kiến vì nó vận hành với ý niệm “ta là”’.
Paricchedakaroti osānaparicchedakaro ito paraṃ dukkhassābhāvakaraṇato.
'Paricchedakaro' (one who makes a boundary/limit) means one who makes the final boundary, because it makes suffering non-existent from that point onwards.
Người tạo ranh giới là người tạo ranh giới cuối cùng, vì từ đây về sau không còn sự hiện hữu của khổ nữa.
Kammapathadesanāyāti kammapathamukhena pavattacatusaccadesanāya.
'Kammapathadesanāyā' (by the teaching of the paths of action) means by the teaching of the Four Noble Truths that proceeds through the paths of action.
Trong sự thuyết giảng về con đường nghiệp là trong sự thuyết giảng Tứ Diệu Đế được trình bày qua con đường nghiệp.
Manasikārappaṭivedhavasenāti vipassanāmanasikāramaggappaṭivedhavasena.
'Manasikārappaṭivedhavasenā' (by way of penetration through attention) means by way of penetration through insight-attention and the path.
Theo cách xuyên thấu bằng sự tác ý là theo cách xuyên thấu bằng sự tác ý thiền quán, con đường.
90. Āharatīti (saṃ. ni. ṭī. 2.2.11) āneti, uppādeti upatthambheti cāti attho.
90. 'Āharati' (brings) means it brings forth, produces, and sustains.
Mang đến (Saṃ. Ni. ṭī. 2.2.11) có nghĩa là đem đến, sinh ra và duy trì.
Nibbattāti pasutā.
'Nibbattā' (born/produced) means brought forth.
Được sinh ra là được tạo ra.
Tato paṭṭhāya hi loke jātavohāro.
Indeed, from that point onwards, the worldly convention of 'born' applies.
Thật vậy, từ đó mà có khái niệm sinh ra trong thế gian.
Paṭisandhiggahaṇato pana paṭṭhāya yāva mātukucchito nikkhamanaṃ, tāva sambhavesino.
However, from the moment of conception (paṭisandhi) until emergence from the mother's womb, beings are 'sambhavesino' (those who are coming into being).
Còn từ khi thọ sanh cho đến khi ra khỏi bụng mẹ, thì là hữu tình đang tìm kiếm sự sống (sambhavesino).
Esa tāva gabbhaseyyakesu bhūtasambhavesivibhāgo, itaresu pana paṭhamacittādivasena vutto.
This is the distinction between 'bhūta' (existent) and 'sambhavesī' (coming into being) for those born from the womb; for others, it is stated based on the first moment of consciousness and so forth.
Đó là sự phân chia giữa hữu tình đã sinh và đang tìm kiếm sự sống đối với loài thai sinh; còn đối với các loài khác thì được nói theo tâm đầu tiên v.v…
Sambhava-saddo cettha gabbhaseyyakānaṃ vasena pasūtipariyāyo, itaresaṃ vasena uppattipariyāyo.
Here, the word 'sambhava' (coming into being) is synonymous with 'birth' in the case of those born from the womb, and synonymous with 'origination' in the case of others.
Ở đây, từ sambhava (sự tìm kiếm sự sống) đối với loài thai sinh là đồng nghĩa với sự sinh sản; đối với các loài khác là đồng nghĩa với sự phát sinh.
Paṭhamacittapaṭhamairiyāpathakkhaṇesu hi te sambhavaṃ uppattiṃ esanti upagacchanti nāma, na tāva bhūtā uppattiyā na suppatiṭṭhitattā.
For at the moment of the first consciousness or the first posture, they are said to be 'seeking origination' (sambhavaṃ esanti), not yet 'existent' (bhūtā) because they are not yet well-established in their origination.
Thật vậy, vào khoảnh khắc tâm đầu tiên, khoảnh khắc oai nghi đầu tiên, chúng được gọi là tìm kiếm sự sống (sambhavaṃ esanti), tức là phát sinh (uppattiṃ upagacchanti), chứ chưa phải là đã sinh (bhūtā) vì chưa được thiết lập vững chắc về sự phát sinh.
Bhūtāyeva sabbaso bhavesanāya samucchinnattā.
'Bhūtāyeva' (they are already existent) means because the seeking of existence is entirely eradicated.
Đã hoàn toàn sinh ra vì đã đoạn diệt hoàn toàn sự tìm kiếm sự sống.
Na puna bhavissantīti avadhāraṇena nivattitamatthaṃ dasseti, ‘‘yo ca kālaghaso bhūto’’tiādīsu (jā. 1.2.190) bhūta-saddassa khīṇāsavavācitā daṭṭhabbā.
'Na puna bhavissantīti' (they will not come into being again) indicates the meaning that is negated by the emphatic assertion, as seen in phrases like "yo ca kālaghaso bhūto" (Jā. 1.2.190), where the word 'bhūta' refers to an Arahant (khīṇāsava).
Sẽ không tái sinh nữa là chỉ ra ý nghĩa được loại bỏ bằng sự xác định, trong các câu như ‘Và ai là kẻ nuốt thời gian đã sinh’ v.v… (Jā. 1.2.190), từ bhūta (đã sinh) cần được hiểu là chỉ cho bậc A-la-hán.
Vā-saddo cettha sampiṇḍanattho ‘‘agginā vā udakena vā’’tiādīsu (udā. 76) viya.
Here, the word 'vā' (or) has the meaning of 'combining', as in "agginā vā udakena vā" (Udā. 76).
Ở đây, từ vā (hoặc) có nghĩa là tổng hợp, như trong các câu ‘bằng lửa hoặc bằng nước’ v.v… (Udā. 76).
Yathāsakaṃ paccayabhāvena attabhāvassa paṭṭhapanamevetthaāhārehi kātabbaanuggahoti adhippāyenāha ‘‘vacanabhedo…pe… ekoyevā’’ti.
With the intention that the sustenance to be provided by nutriments here is solely the establishment of existence through their respective causal roles, it is said: "vacanabhedo...pe...ekoyevā" (the difference in expression...is but one and the same).
Với ý định rằng sự hỗ trợ cần được thực hiện bằng các vật thực ở đây chỉ là sự thiết lập thân thể theo cách làm duyên cho chính nó,* nói: ‘Sự khác biệt về từ ngữ…pe… chỉ là một’.
Sattassa uppannadhammānanti sattassasantāne uppannadhammānaṃ.
'Sattassa uppannadhammānaṃ' (of the arisen phenomena of a being) means of the phenomena arisen in the continuum of a being.
Các pháp đã sinh của hữu tình là các pháp đã sinh trong dòng tâm thức của hữu tình.
Yathā ‘‘vassasataṃ tiṭṭhatī’’ti vutte anuppabandhavasena pavattatīti vuttaṃ hoti, evaṃ ṭhitiyāti anuppabandhavasena pavattiyāti attho, sā pana avicchedoti āha ‘‘avicchedāyā’’ti.
Just as when it is said "vassasataṃ tiṭṭhati" (it remains for a hundred years), it means it continues without interruption, so too 'ṭhitiyā' (for continuance) means for continuance without interruption. And this is non-cessation, so it is said: 'avicchedāyā' (for non-cessation).
Như khi nói ‘tồn tại một trăm năm’ có nghĩa là tiếp tục vận hành không gián đoạn, thì để tồn tại cũng có nghĩa là để tiếp tục vận hành không gián đoạn; và sự không gián đoạn đó là sự không đoạn tuyệt, do đó* nói: ‘để không đoạn tuyệt’.
Anuppabandhadhammuppattiyā sattasantāno anuggahito nāma hotīti āha ‘‘anuppannānaṃ uppādāyā’’ti.
The continuum of a being is said to be sustained by the arising of phenomena that have not yet arisen, so it is said: 'anuppannānaṃ uppādāyā' (for the arising of what has not yet arisen).
Dòng tâm thức của hữu tình được hỗ trợ bởi sự phát sinh của các pháp không gián đoạn, do đó* nói: ‘để phát sinh những pháp chưa sinh’.
Etānīti ṭhitianuggahapadāni.
'Etānī' (these) refers to the terms 'continuance' and 'sustenance'.
Những điều này là các từ hỗ trợ sự tồn tại.
Ubhayattha daṭṭhabbāni, na yathāsaṅkhyaṃ.
They are to be understood 'ubhayattha' (in both cases), not in a one-to-one correspondence.
Cần được hiểu ở cả hai nghĩa, không theo thứ tự.
Vatthugatā ojā vatthu viya tena saddhiṃ āharitabbataṃ gacchatīti vuttaṃ ‘‘ajjhoharitabbato āhāro’’ti.
The essence (ojā) inherent in the substance (vatthu) is to be consumed along with the substance, hence it is said: "ajjhoharitabbato āhāro" (nutriment is that which is to be consumed).
Chất dinh dưỡng (ojā) có trong vật chất cũng như vật chất, đi đến chỗ phải được ăn vào cùng với nó, do đó được nói là ‘vật thực vì nó được ăn vào’.
Nibbattitaojaṃ pana sandhāya ‘‘kabaḷīkārāhāro ojaṭṭhamakarūpāni āharatī’’ti vakkhati.
However, referring to the essence that has been produced, it will be said: "kabaḷīkārāhāro ojaṭṭhamakarūpāni āharati" (physical food brings forth the eight components of matter with essence as the eighth).
Còn đối với chất dinh dưỡng đã được tạo ra,* sẽ nói: ‘Vật thực đoàn thực mang đến các sắc có tám yếu tố là chất dinh dưỡng’.
Oḷārikatā appojatāya, na vatthuno thūlatāya, kathinatāya vā, tasmā yasmiṃ vatthusmiṃ parittā ojā hoti, taṃ oḷārikaṃ.
'Oḷārikatā' (grossness) is due to its slight essence (appojatā), not due to the substance's coarseness or hardness. Therefore, a substance in which there is little essence is gross.
Thô thiển là do ít chất dinh dưỡng, chứ không phải do vật chất thô hoặc cứng; do đó, vật chất nào có ít chất dinh dưỡng thì vật chất đó là thô thiển.
Sappādayo dukkhuppādakatāya oḷārikāveditabbā.
Snakes and the like are to be understood as gross because they cause suffering.
Rắn v.v… cần được biết là thô thiển vì chúng gây ra đau khổ.
Visāṇādīnaṃ tivassachaḍḍitānaṃ pūtibhūttatā mudukatāti vadanti, taracchakheḷatemikatāya pana tathābhūtānaṃ tesaṃ mudukatā.
They say that horns and the like, discarded for three years, become putrid and soft; but their softness is due to the saliva and moisture of hyenas.
Người ta nói rằng sừng v.v… đã bị vứt bỏ ba năm thì bị thối rữa và mềm mại; nhưng sự mềm mại của chúng là do bị thấm nước bọt của chó sói.
Dhammasabhāvo hesa.
This is indeed the nature of phenomena.
Đây là bản chất của pháp.
Sasānaṃ āhāro sukhumo taruṇatiṇasassakhādanato.
The nutriment of rabbits is subtle because they eat tender grass and plants.
Vật thực của thỏ là vi tế vì chúng ăn cỏ non.
Sakuṇānaṃ āhāro sukhumo tiṇabījādikhādanato.
The nutriment of birds is subtle because they eat grass seeds and so forth.
Vật thực của chim là vi tế vì chúng ăn hạt cỏ v.v…
Paccantavāsīnaṃ sukhumo, tesañhi sākapaṇṇasukkhakurapadumapattampi āhāroti.
The nutriment of border-dwellers is subtle, for even leaves, dried grains, and lotus petals are their food.
Vật thực của những người sống ở biên địa là vi tế, vì đối với họ, ngay cả rau lá khô và lá sen cũng là vật thực.
Tesaṃ paranimmitavasavattīnaṃ.
'Tesaṃ' (of them) refers to the devas of the realm of those who delight in others' creations (Paranimmitavasavattī).
Của họ là của chư thiên Paranimmitavasavattī.
Sukhumotvevāti na kiñci upādāya, atha kho sukhumo icceva niṭṭhaṃ patto tato paraṃ sukhumassa abhāvato.
'Sukhumotvevā' (it is indeed subtle) means not by depending on anything, but simply "it is subtle," 'niṭṭhaṃ patto' (having reached its conclusion), because there is no subtlety beyond that.
Chỉ là vi tế không dựa vào bất cứ điều gì khác, mà chỉ là vi tế đạt đến tột cùng vì không có gì vi tế hơn thế nữa.
Vatthuvasena panettha āhārassa oḷārikasukhumatā vuttā, sā cassa appojamahojatāhi veditabbāti dassetuṃ ‘‘ettha cā’’tiādi vuttaṃ.
To show that the grossness and subtlety of nutriment here are stated in terms of the substance, and that this is to be understood by its abundance or scarcity of essence, "ettha cā" (and here) and so forth is stated.
Ở đây, sự thô thiển và vi tế của vật thực được nói theo vật chất, và để chỉ ra rằng điều đó cần được biết qua việc có ít chất dinh dưỡng hay nhiều chất dinh dưỡng,* đã nói ‘Ở đây và’ v.v…
Parissamanti khudāvasena uppannaṃ sarīrakhedaṃ.
'Parissamaṃ' (weariness) means the bodily fatigue arisen due to hunger.
Sự mệt mỏi là sự mệt mỏi của thân thể phát sinh do đói.
Vinodetīti vatthu tassa vinodanamattaṃ karoti.
'Vinodetī' (dispels) means the substance merely causes its dispelling.
Loại bỏ là vật chất chỉ làm được việc loại bỏ sự mệt mỏi đó.
Na pana sakkoti pāletunti sarīraṃ yāpetuṃ nappahoti nissārattā.
'Na pana sakkoti pāletuṃ' (but it cannot sustain) means it is unable to maintain the body because it is devoid of essence.
Nhưng không thể duy trì là không đủ sức để duy trì thân thể vì nó không có cốt lõi.
Na sakkoti parissamaṃ vinodetuṃ āmāsayassa apūraṇato.
Is unable to dispel fatigue due to the stomach not being full.
Không thể loại bỏ sự mệt mỏi vì không làm đầy dạ dày.
Chabbidhopīti iminā kassacipi phassassa anavasesitabbatamāha.
By "even sixfold" he states that no contact whatsoever should be left out.
Sáu loại này chỉ ra rằng không có xúc nào bị bỏ sót.
Āhārassadesanākkamenevettha phassādīnaṃ dutiyāditā, na aññena kāraṇenāti āha ‘‘desanānayo evā’’tiādi.
Here, the reason for contact and so on being second is just the sequence of teaching the nutriment itself, not for any other reason, thus he says, "it is just the method of teaching" and so on.
Ở đây, thứ tự thứ hai v.v… của xúc v.v… là theo thứ tự thuyết giảng về vật thực, chứ không phải do nguyên nhân nào khác, do đó* nói: ‘Chỉ là phương pháp thuyết giảng’ v.v…
Manaso sañcetanā, na sattassāti dassanatthaṃ manogahaṇaṃ yathā ‘‘cittassa ṭhiti (dha. sa. 11), cetovimutti cā’’ti (ma. ni. 1.69) āha ‘‘manosañcetanāti cetanā evā’’ti.
To show that it is mental volition, not a being's, the term 'mano' (mind) is included, just as in "steadiness of mind (Dhs. 11), and liberation of mind" (MN 1.69), thus he says, "mental volition is just cetanā."
Để chỉ ra rằng sự tác ý là của tâm, chứ không phải của hữu tình, như trong các câu ‘sự an trú của tâm (Dhs. 11), và sự giải thoát tâm’ (Mā. Ni. 1.69),* nói: ‘Ý tác ý chỉ là tư tâm sở’.
Cittanti yaṃ kiñci cittaṃ, na vipākaviññāṇameva.
Mind means any mind whatsoever, not just resultant consciousness.
Tâm là bất kỳ tâm nào, không chỉ là tâm thức quả dị thục.
Pubbe ‘‘āhāranti paccaya’’nti vuttattā ‘‘yadi paccayaṭṭho āhāraṭṭho’’tiādinā codeti.
Since it was previously stated, "nutriment means condition," he raises an objection with "If the meaning of nutriment is the meaning of condition," and so on.
Trước đây đã nói ‘Vật thực là duyên’, do đó* đặt câu hỏi: ‘Nếu vật thực có nghĩa là duyên’ v.v…
Atha kasmā imeyeva cattāro vuttāti atha kasmā cattārova vuttā, ime eva ca vuttāti yojanā.
"Then why are only these four stated?" The construction is: "Then why are only four stated, and why only these?"
Vậy tại sao chỉ có bốn loại này được nói đến có nghĩa là tại sao chỉ có bốn loại được nói đến, và chỉ những loại này được nói đến.
Visesapaccayattāti etena yathā aññe paccayadhammā attano paccayuppannassa paccayāva honti, ime pana tathā ca honti aññathā cāti samānepi paccayatte atirekapaccayā honti, tasmā āhārāti vuttāti imamatthaṃ dasseti.
By "due to being special conditions," he shows this meaning: just as other conditioned phenomena are conditions only for their conditioned results, these, however, are both that way and otherwise. Thus, even though they are similar in being conditions, they are additional conditions; therefore, they are called nutriments.
Vì là duyên đặc biệt điều này chỉ ra rằng, trong khi các pháp duyên khác chỉ là duyên cho pháp được duyên của chúng, thì những pháp này vừa là duyên như vậy vừa theo cách khác, do đó, mặc dù là duyên như nhau, chúng vẫn là những duyên đặc biệt, vì vậy chúng được gọi là vật thực.
Idāni taṃ atirekapaccayataṃ dassetuṃ ‘‘visesapaccayo hī’’tiādi āraddhaṃ.
Now, to show that additional conditionality, "For a special condition," and so on, is commenced.
Bây giờ, để chỉ ra sự đặc biệt của duyên đó,* bắt đầu nói ‘Thật vậy, duyên đặc biệt’ v.v…
Visesapaccayo rūpakāyassa kabaḷīkāro āhāro upatthambhakabhāvato.
Material food is a special condition for the material body due to its role as a supporter.
Vật thực đoàn thực là duyên đặc biệt cho sắc thân vì nó có tính chất hỗ trợ.
Tenāha aṭṭhakathāyaṃ (visuddhi. 2.708; paṭṭhā. aṭṭha. paccayuddesavaṇṇanā) ‘‘rūpārūpānaṃ upatthambhakattena upakārakā cattāro āhārā āhārapaccayo’’ti.
Therefore, it is said in the Commentary (Vism. 2.708; Paṭṭhāna Commentary, Paccayuddesa Vaṇṇanā): "The four nutriments, being supporters of both material and immaterial phenomena, are nutriment conditions."
Do đó, trong Aṭṭhakathā (Visuddhi. 2.708; Paṭṭhā. Aṭṭha. Paccayuddesavaṇṇanā) có nói: ‘Bốn loại vật thực hỗ trợ sắc và vô sắc là duyên vật thực’.
Upatthambhakattañhi satipi janakatte arūpīnaṃ āhārānaṃ āhārajarūpasamuṭṭhāpakarūpāhārassa ca hoti, asati pana upatthambhakatte āhārānaṃ janakattaṃ natthīti upatthambhakattaṃ padhānaṃ.
For even if there is generation, the supporting role belongs to the immaterial nutriments and to the nutriment of material phenomena that arise from nutriment; but if there is no supporting role, there is no generative role for the nutriments. Thus, the supporting role is primary.
Tính chất hỗ trợ, ngay cả khi có tính chất tạo ra, cũng có ở các vật thực vô sắc và vật thực sắc tạo ra các sắc do vật thực sinh; nhưng nếu không có tính chất hỗ trợ, thì các vật thực không có tính chất tạo ra, do đó tính chất hỗ trợ là chính yếu.
Janayamānopi hi āhāro avicchedavasena upatthambhayamāno eva janetīti upattambhakabhāvo eva āhārabhāvo.
For even when generating, nutriment generates only by continuously supporting; thus, the state of being a supporter is precisely the state of being a nutriment.
Thật vậy, ngay cả khi tạo ra, vật thực cũng tạo ra bằng cách hỗ trợ không gián đoạn, do đó tính chất hỗ trợ chính là tính chất vật thực.
Vedanāya phasso visesapaccayo.
Contact is a special condition for feeling.
Xúc là duyên đặc biệt cho thọ.
‘‘Phassapaccayā vedanā’’ti hi vuttaṃ.
For it is said, "Feeling is conditioned by contact."
Thật vậy, đã nói: ‘Do duyên xúc mà có thọ’.
‘‘Saṅkhārapaccayā viññāṇa’’nti (udā. 1; ma. ni. 3.126) vacanato viññāṇassamanosañcetanā.
Mental volition is a special condition for consciousness by the saying, "Consciousness is conditioned by volitional formations" (Ud. 1; MN 3.126).
Theo lời dạy ‘Do duyên hành mà có thức’ (Udā. 1; Mā. Ni. 3.126), ý tác ý là duyên đặc biệt cho thức.
‘‘Cetanā tividhaṃ bhavaṃ janetī’’ti hi vuttaṃ.
For it is said, "Cetanā generates three kinds of existence."
Thật vậy, đã nói: ‘Tư tâm sở sinh ra ba loại hữu’.
‘‘Viññāṇapaccayā nāmarūpa’’nti pana vacanato nāmarūpassa viññāṇaṃ visesapaccayā.
However, by the saying, "Name-and-form is conditioned by consciousness," consciousness is a special condition for name-and-form.
Còn theo lời dạy ‘Do duyên thức mà có danh sắc’, thức là duyên đặc biệt cho danh sắc.
Na hi okkantiviññāṇābhāve nāmarūpassa attasambhavo.
For without the consciousness of conception, name-and-form has no self-existence.
Thật vậy, nếu không có thức tái tục, danh sắc không thể tự hiện hữu.
Yathāha ‘‘viññāṇañca hi, ānanda, mātukucchismiṃ na okkamissatha, api nu kho nāmarūpaṃ mātukucchismiṃ samuccissathā’’tiādi (dī. ni. 2.115).
As it is said, "If, Ānanda, consciousness were not to descend into the mother's womb, would name-and-form consolidate in the mother's womb?" and so on (DN 2.115).
Như đã nói: ‘Này Ānanda, nếu thức không nhập vào bụng mẹ, liệu danh sắc có thể phát sinh trong bụng mẹ không?’ v.v… (Dī. Ni. 2.115).
Vuttamevatthaṃ suttena sādhetuṃ ‘‘yathāhā’’tiādi vuttaṃ.
To prove the stated meaning with a Sutta, "As it is said," and so on, is stated.
Để chứng minh ý nghĩa đã nói bằng kinh điển,* đã nói ‘Như đã nói’ v.v…
Evaṃ yadipi paccayaṭṭho āhāraṭṭho, visesapaccayatāya pana ime eva āhārāti vuttāti taṃ nesaṃ visesapaccayataṃ avibhāgato dassetvā idāni vibhāgato dassetuṃ ‘‘ko panetthā’’tiādi āraddhaṃ.
Although the meaning of condition and sustenance is thus the same, these are called 'nutriments' due to their specific conditionality. Having shown their specific conditionality without differentiation, the section starting with "Now, which among these..." has been commenced to show it with differentiation.
Mặc dù theo nghĩa duyên, chúng là vật thực, nhưng vì chúng là những duyên đặc biệt nên được gọi là vật thực. Sau khi trình bày tính chất duyên đặc biệt của chúng một cách không phân biệt, bây giờ, để trình bày một cách phân biệt, đoạn "Thế thì, trong số này..." đã được bắt đầu.
Mukhe ṭhapitamattoyeva asaṅkhādito, tattakenapi abbhantarassa āhārassa paccayo hoti eva.
Merely placed in the mouth, without being chewed, it still becomes a condition for internal nutriment.
Chỉ cần đặt vào miệng, chưa nhai nuốt, chỉ chừng đó thôi cũng đã là duyên cho vật thực bên trong.
Tenāha ‘‘aṭṭha rūpāni samuṭṭhāpetī’’ti.
Therefore, it is said, "It generates eight rūpas."
Do đó, đã nói "nó sinh khởi tám sắc".
Sukhavedanāya hito sukhavedaniyo.
Beneficial for pleasant feeling is conducive to pleasant feeling.
Lợi ích cho thọ lạc là lạc thọ.
Sabbathāpīti cakkhusamphassādivasena.
In every way means in terms of eye-contact and so on.
Bằng mọi cách nghĩa là theo cách xúc giác nhãn v.v.
Yattakā phassassa pakārabhedā, tesaṃ vasena sabbappakāropi phassāhāro.
As many varieties of contact there are, in terms of those, contact-nutriment is of all kinds.
Có bao nhiêu loại xúc khác nhau, theo những loại đó, tất cả các loại đều là xúc thực.
Yathārahaṃ tisso vedanā āharati, anāhārako natthi.
Appropriately, it brings forth the three feelings; there is no non-sustainer.
Nó mang đến ba thọ một cách thích hợp, không có cái gì không mang đến.
Sabbathāpīti idhāpi phassāhāre vuttanayānusārena attho veditabbo.
In every way here too, the meaning should be understood according to the method stated for contact-nutriment.
Bằng mọi cách ở đây cũng vậy, ý nghĩa nên được hiểu theo cách đã nói về xúc thực.
Tisantativasenāti kāyadasakaṃ bhāvadasakaṃ vatthudasakanti tividhasantativasena.
By means of the three continua refers to the three kinds of continua: the body decads, the sex decads, and the base decads.
Theo cách ba mươi mốt loại nghĩa là theo ba loại thân liên tục: thân thập sắc, hữu thập sắc, vật thập sắc.
Sahajātādipaccayanayenāti sahajātādipaccayavidhinā.
By the method of co-nascent and other conditions refers to the method of co-nascent and other conditions.
Theo cách duyên đồng sinh v.v. nghĩa là theo phương pháp duyên đồng sinh v.v.
Paṭisandhiviññāṇañhi attanā sahajātanāmassa sahajātaaññamaññanissayavipākindriyasampayuttaatthiavigatapaccayehi paccayo hontoyeva āhārapaccayatāya taṃ āhāretī vuttaṃ, sahajātarūpesu pana vatthuno sampayuttapaccayaṃ ṭhapetvā vippayuttapaccayena, sesarūpassa aññamaññapaccayañca ṭhapetvā vuttanayenevayojanā kātabbā.
Indeed, rebirth-consciousness, being a condition through its co-nascent nāma, through the co-nascent, mutual, support, resultant, faculty, associated, presence, and non-disappearance conditions, sustains it by way of nutriment-condition. In the case of co-nascent rūpas, however, the interpretation should be made in the stated manner, excluding the associated condition for the base and excluding the mutual condition for the remaining rūpas.
Thật vậy, thức tái sinh được nói là nuôi dưỡng (āhāreti) do các duyên đồng sinh, tương hỗ, nương tựa, quả dị thục, quyền, tương ưng, hiện hữu, bất ly đã là duyên cho danh đồng sinh với nó; nhưng đối với các sắc đồng sinh, ngoại trừ duyên tương ưng của vật, đối với các sắc còn lại, ngoại trừ duyên tương hỗ, thì nên kết nối theo cách đã nói.
Tānīti napuṃsakaniddeso anapuṃsakānampi napuṃsakehi saha vacanato.
These is a neuter gender designation because non-neuter elements are mentioned together with neuter ones.
Chúng là một từ chỉ giống trung tính vì nó được nói cùng với những từ không phải giống trung tính.
Sāsavā kusalākusalacetanāva vuttā.
Defiled wholesome and unwholesome volitions are spoken of.
Hữu lậu là chỉ cho thiện và bất thiện tư.
Visesapaccayabhāvadassanaṃ hetanti.
This shows the state of being a specific condition.
Việc trình bày tính chất duyên đặc biệt là nguyên nhân của điều này.
Tenāha ‘‘avisesena panā’’tiādi.
Therefore, it is said, "And without distinction..." and so on.
Do đó, đã nói "Tuy nhiên, một cách không đặc biệt..." v.v.
Paṭisandhiviññāṇameva vuttanti etthāpi eseva nayo.
Rebirth-consciousness itself is spoken of; here too, the same method applies.
Chỉ cho thức tái sinh ở đây cũng vậy, nguyên tắc này cũng được áp dụng.
Yathā tassa tassa phalassa visesato paccayatāya etesaṃ āhāraṭṭho, evaṃ avisesatopīti dassantena ‘‘avisesena panā’’tiādi vuttaṃ.
Just as the nutriment-meaning of these is due to their being specific conditions for their respective results, so too is it without distinction, as is said by "And without distinction..." and so on.
Như tính chất vật thực của chúng là do là duyên đặc biệt cho quả này quả nọ, thì cũng là duyên không đặc biệt, để trình bày điều đó, đã nói "Tuy nhiên, một cách không đặc biệt..." v.v.
Tattha taṃsampayuttataṃsamuṭṭhānadhammānanti tehi phassādīhi sampayuttadhammānañceva taṃsamuṭṭhānarūpadhammānañca.
Here, for those co-associated and co-arisen phenomena means for the phenomena co-associated with those contacts and so on, and for the rūpa-phenomena co-arisen from them.
Ở đó, "của các pháp tương ưng và đồng khởi với chúng" nghĩa là của các pháp tương ưng với các xúc v.v. đó và của các pháp sắc đồng khởi với chúng.
Tattha sampayuttaggahaṇaṃ yathārahato daṭṭhabbaṃ, samuṭṭhānaggahaṇaṃ pana avisesato.
Here, the mention of co-associated should be understood as appropriate, but the mention of co-arisen is without distinction.
Ở đó, sự nắm giữ tương ưng nên được xem xét một cách thích hợp, còn sự nắm giữ đồng khởi thì không phân biệt.
Upatthambhento āhārakiccaṃ sādhetīti upatthambhentoyeva rūpaṃ samuṭṭhāpeti, ojaṭṭhamakarūpasamuṭṭhāpaneneva panassa upatthambhanakiccasiddhi.
Supporting, it accomplishes the function of nutriment means it generates rūpa precisely by supporting it. However, the accomplishment of its supporting function is through the generation of the eight essential rūpas.
Nương tựa, nó hoàn thành chức năng vật thực nghĩa là chỉ khi nương tựa, nó mới sinh khởi sắc; nhưng chức năng nương tựa của nó được hoàn thành chỉ bằng cách sinh khởi tám sắc có chất dinh dưỡng.
Phusantoyevāti phusanakiccaṃ karonto eva.
Merely contacting means merely performing the function of contact.
Chỉ khi xúc chạm nghĩa là chỉ khi thực hiện chức năng xúc chạm.
Āyūhamānāvāti cetayamānā eva abhisandahantī eva.
Merely intending means merely volitionally intending, merely contriving.
Chỉ khi tích lũy nghĩa là chỉ khi tác ý, chỉ khi hướng đến.
Vijānantamevāti upapattiparikappanavasena vijānantameva āhārakiccaṃ sādhetīti yojanā.
Merely knowing means, interpreting, it accomplishes the function of nutriment precisely by knowing in terms of conceiving rebirth.
Chỉ khi nhận biết nghĩa là chỉ khi nhận biết theo cách tưởng tượng về sự tái sinh, nó hoàn thành chức năng vật thực.
Sesapadadvayepi eseva nayo.
The same method applies to the other two terms.
Hai từ còn lại cũng theo nguyên tắc này.
Āhārakiccasādhanañca tesaṃ vedanādiuppattihetutāya attabhāvassa pavattanameva.
And the accomplishment of the nutriment-function for them is simply the continuation of existence by being the cause of the arising of feeling and so on.
Và việc hoàn thành chức năng vật thực của chúng chính là sự duy trì sự hiện hữu do là nguyên nhân sinh khởi của thọ v.v.
Kāyaṭṭhapanenāti kasmā vuttaṃ?
By maintaining the body – why is this said?
Bằng cách duy trì thân – tại sao lại nói như vậy?
Nanu kammajādirūpaṃ kammādināva pavattatīti codanaṃ sandhāyāha ‘‘kammajanitopī’’tiādi.
Anticipating the objection "Surely kamma-born rūpas and so on continue by kamma and so on alone," it is said, "Even that which is generated by kamma..." and so on.
Để giải đáp câu hỏi rằng sắc do nghiệp v.v. chỉ tồn tại do nghiệp v.v., đã nói "Mặc dù do nghiệp sinh..." v.v.
Upādinnarūpasantatiyā upatthambhaneneva utucittajarūpasantatīnampi upatthambhanasiddhi hotīti ‘‘dvinnaṃ rūpasantatīna’’nti vuttaṃ.
The success of supporting the continua of temperature-born and mind-born rūpas is achieved precisely by supporting the continuum of grasped-rūpas, which is why "of the two continua of rūpas" is said.
Do sự nương tựa của dòng sắc đã được chấp thủ, sự nương tựa của các dòng sắc do thời tiết và tâm sinh cũng được hoàn thành, do đó đã nói "của hai dòng sắc".
Upatthambhanameva sandhāya ‘‘anupālako hutvā’’ti ca vuttaṃ.
"Having become a maintainer" is also said, referring precisely to supporting.
Và "trở thành người bảo vệ" cũng được nói để chỉ sự nương tựa.
Rūpakāyassa ṭhitihetutā hi yāpanā anupālanā.
Indeed, the cause for the persistence of the material body is sustenance, maintenance.
Thật vậy, nguyên nhân duy trì thân sắc là sự duy trì, sự bảo vệ.
Sukhādivatthubhūtanti sukhādīnaṃ pavattiṭṭhānabhūtaṃ.
Being the basis for pleasure and so on means being the place of occurrence for pleasure and so on.
Là đối tượng của lạc v.v. nghĩa là là nơi sinh khởi của lạc v.v.
Ārammaṇampi hi vasati ettha ārammaṇakaraṇavasena tadārammaṇā dhammāti vatthūti vuccati.
Even an object is called a 'basis' because those phenomena that have it as their object dwell in it by making it an object.
Đối tượng cũng được gọi là vật (vatthu) vì các pháp có đối tượng đó trú ngụ ở đây theo cách tạo thành đối tượng.
Phusantoyevāti idaṃ phassassa phusanasabhāvattā vuttaṃ.
Merely contacting is said because contact inherently possesses the nature of contacting.
Chỉ khi xúc chạm – điều này được nói vì xúc có bản chất xúc chạm.
Na hi dhammānaṃ sabhāvena vinā pavatti atthi.
For there is no occurrence of phenomena apart from their inherent nature.
Thật vậy, không có sự tồn tại của các pháp mà không có bản chất của chúng.
Vedanāpavattiyā vinā sattānaṃ sandhāvanatā natthīti āha ‘‘sukhādi…pe… hotī’’ti, na cettha saññībhavakathāyaṃ asaññībhavo dassetabbo, tassāpi vā kāraṇabhūtavedanāpavattivaseneva ṭhitiyā hetuno abyāpitā.
It is said that without the occurrence of feeling, the wandering of beings does not exist, so he says, "pleasure and so on... (etc.) ...becomes"; and here, in the discourse on the state of perception, the state of non-perception should not be shown, nor is the causal nature of the occurrence of feeling for it (non-perception) spread out.
Không có sự lang thang của chúng sinh nếu không có sự tồn tại của thọ, do đó đã nói "lạc v.v. ... trở thành"; và ở đây, không nên trình bày sự không có tưởng trong lời nói về sự có tưởng, hoặc do sự không lan rộng của nguyên nhân duy trì do sự tồn tại của thọ là nguyên nhân của nó.
Tathā hi ‘‘manosañcetanā…pe… bhavamūlanipphādanato sattānaṃ ṭhitiyā hotī’’ti vuttā, tato eva ‘‘viññāṇaṃ vijānantamevāti upapattiparikappanavasena vijānantamevā’’ti vuttovāyamatthoti.
Thus, it is said, "Mental volition... (etc.) ...becomes for the persistence of beings by generating the root of existence," and from that very statement, the meaning "consciousness, merely knowing, means merely knowing in terms of conceiving rebirth" is said.
Thật vậy, đã nói "ý tư... trở thành nguyên nhân duy trì chúng sinh do tạo ra gốc rễ của hữu", do đó ý nghĩa này đã được nói là "thức chỉ khi nhận biết, nghĩa là chỉ khi nhận biết theo cách tưởng tượng về sự tái sinh".
Cattāri bhayāni daṭṭhabbāni ādīnavavibhāvanato.
Four fears should be seen by explaining their disadvantages.
Bốn nỗi sợ hãi nên được thấy do sự trình bày về hiểm họa.
Nikantīti nikāmanā.
Craving means longing.
Tham muốn nghĩa là sự khao khát.
Rasataṇhaṃ sandhāya vadati.
It refers to craving for taste.
Nó đề cập đến ái vị.
Sā hi kabaḷīkāre āhāre balavatī.
For this is strong in edible food.
Thật vậy, nó rất mạnh mẽ đối với đoàn thực.
Teneva tattha avadhāraṇaṃ kataṃ.
Therefore, an emphasis is placed on it there.
Chính vì thế mà có sự nhấn mạnh ở đó.
Bhāyati etasmāti bhayaṃ, nikantiyevabhayaṃ mahānatthahetuto.
From which one fears, that is fear; craving itself is fear because it is the cause of great disaster.
Sợ hãi từ đó là sợ hãi (bhaya); tham muốn chính là sợ hãi vì nó là nguyên nhân của những tai họa lớn.
Upagamanaṃ visayindriyaviññāṇesu visayaviññāṇesu eva ca saṅgativasena pavatti, taṃ vedanādiuppattihetutāya ‘‘bhaya’’nti vuttaṃ.
Approaching means occurring in the sense of attachment to objects and faculties, or merely to objects and consciousness; this is called "fear" because it is the cause of the arising of feeling and so on.
Sự tiếp cận là sự tồn tại theo cách kết hợp trong các thức cảnh giới và căn cảnh giới, và trong các thức cảnh giới, nó được gọi là "sợ hãi" do là nguyên nhân sinh khởi của thọ v.v.
Avadhāraṇe payojanaṃ vuttanayameva.
The purpose of the emphasis is the same as stated.
Mục đích của sự nhấn mạnh là như đã nói.
Sesadvayepi esevanayo.
The same method applies to the other two.
Hai điều còn lại cũng theo nguyên tắc này.
Āyūhanaṃ abhisandahanaṃ, saṃvidhānantipi vadanti.
Exertion means contriving; some also call it planning.
Sự tích lũy là sự hướng đến, cũng được gọi là sự sắp đặt.
Taṃ bhavūpapattihetutāya ‘‘bhaya’’nti vuttaṃ.
That is called "fear" because it is the cause of rebirth in existence.
Nó được gọi là "sợ hãi" do là nguyên nhân của sự tái sinh.
Abhinipāto tattha tattha bhave paṭisandhiggahaṇavasena nibbatti.
Falling into means arising by taking rebirth in various existences.
Sự rơi vào là sự sinh khởi ở các cõi khác nhau theo cách chấp thủ tái sinh.
So bhavūpapattihetukānaṃ sabbesaṃ anatthānaṃ mūlakāraṇattā ‘‘bhaya’’nti vutto.
That is called "fear" because it is the fundamental cause of all disadvantages that lead to rebirth in existence.
Nó được gọi là "sợ hãi" vì là nguyên nhân gốc rễ của tất cả những tai họa do sự tái sinh.
Idāni nikantiādīnaṃ sappaṭibhayataṃ vitthārato dassetuṃ ‘‘kiṃkāraṇā’’tiādi āraddhaṃ.
Now, to extensively show the fearful nature of craving and so on, the section starting with "For what reason?" has been commenced.
Bây giờ, để trình bày chi tiết sự đáng sợ của tham muốn v.v., đoạn "Tại sao?" v.v. đã được bắt đầu.
Tattha nikantiṃ katvāti ālayaṃ janetvā, taṇhaṃ uppādetvāti attho.
Here, having craved means having generated attachment, having aroused craving.
Ở đó, "sau khi tạo ra tham muốn" nghĩa là sau khi tạo ra sự bám chấp, sau khi sinh khởi ái.
Phassa upagacchantāti cakkhusamphassādibhedaṃ phassaṃ pavattentā.
Approaching contact means generating contact differentiated as eye-contact and so on.
Tiếp cận xúc nghĩa là làm cho xúc tồn tại, xúc có sự khác biệt như nhãn xúc v.v.
Phassassādinoti kāyasamphassavasena phoṭṭabbasaṅkhātassa phassassa assādanasīlā.
Tasters of contact means those whose habit is to taste contact, referring to tangible objects by way of bodily contact.
Thích thú xúc nghĩa là có thói quen thưởng thức xúc, tức là xúc chạm.
Kāyasamphassavasena hi sattānaṃ phoṭṭhabbataṇhā pavattatīti dassetuṃ phassāhārādīnavadassane phoṭṭhabbārammaṇaṃ uddhaṭaṃ ‘‘paresaṃ rakkhitagopitesū’’tiādinā.
For it is to show that the craving for tangibles arises in beings by way of bodily contact, that in showing the disadvantage of contact-nutriment, the object of tangibles is introduced by "in what is guarded and protected by others..." and so on.
Để trình bày rằng ái đối với xúc chạm của chúng sinh tồn tại theo cách thân xúc, đối tượng xúc chạm đã được nêu ra trong việc trình bày hiểm họa của xúc thực, bằng cách "trong những thứ được người khác bảo vệ và giữ gìn" v.v.
Phassassādinoti vā phassāhārassādinoti attho.
Or tasters of contact means tasters of contact-nutriment.
Hoặc thích thú xúc nghĩa là thích thú xúc thực.
Sati hi phassāhāre sattānaṃ phassārammaṇe assādo, nāsatīti.
For when there is contact-nutriment, there is tasting of the object of contact in beings, not otherwise.
Thật vậy, khi có xúc thực, chúng sinh có sự thích thú đối với đối tượng xúc, không có thì không.
Tenāha ‘‘phassassādamūlaka’’ntiādi.
Therefore, it is said, "rooted in the taste of contact..." and so on.
Do đó, đã nói "có gốc rễ từ sự thích thú xúc" v.v.
Tatrāti tāsu upamāsu.
There refers to those similes.
Ở đó nghĩa là trong những ví dụ đó.
Bhūtamatthaṃ katvāti na parikappitamatthaṃ, atha kho bhūtaṃ bhūtapubbaṃ atthaṃ katvā.
Making a real fact means not an imagined fact, but making a real, historically existing fact.
Sau khi làm cho ý nghĩa trở thành sự thật nghĩa là không phải ý nghĩa được giả định, mà là sau khi làm cho ý nghĩa đã xảy ra, đã từng xảy ra trở thành sự thật.
Pātheyyahatthesu gacchantesu pātheyyaṃ, gacchantaṃ viya hotīti vuttaṃ ‘‘gantvā pātheyyaṃ niṭṭhāsī’’ti.
It is said, "having gone, the provisions ceased," because when provisions are in the hands of those going, it is like the provisions going.
Khi những người cầm lương thực đi, lương thực giống như đang đi, do đó đã nói "sau khi đi, lương thực đã cạn".
Gantvāti vāgamanahetūti attho.
Or having gone means due to the going.
Hoặc sau khi đi nghĩa là nguyên nhân của việc đi.
Khuppipāsāturatāya ghanacchāyaṃ rukkhaṃ upagantuṃ asamatthā viraḷhacchāyāyaṃ nisīdiṃsu.
Being tormented by hunger and thirst and unable to approach a thickly shaded tree, they sat in a sparsely shaded place.
Vì bị đói khát hành hạ, họ không thể đến một cái cây có bóng râm dày đặc, nên họ ngồi dưới bóng râm thưa thớt.
Na dāni sakkā taṃ mayā kātuṃ atidubbalabhāvato.
It is no longer possible for me to do that due to extreme weakness.
Bây giờ tôi không thể làm điều đó vì quá yếu ớt.
Parikkhalitagatitaruṇadārako khuppipāsābhibhūto ca, tasmā gacchantoyeva mato.
The young child, stumbling as he walked, was overcome by hunger and thirst; therefore, he died while walking.
Đứa trẻ non nớt bước đi lảo đảo, bị đói và khát hành hạ, do đó đã chết ngay khi đang đi.
Sajātimaṃsatāyāti (saṃ. ni. ṭī. 2.2.63) samānajātimaṃsatāya, manussamaṃsatāyāti attho.
Sajātimaṃsatāya means 'meat of the same species,' which is to say, human flesh.
Sajātimaṃsatāyā (Saṃ. Ni. Ṭī. 2.2.63) là thịt đồng loại, có nghĩa là thịt người.
Yaṃ manussamaṃsaṃ, tañhi loke jigucchanīyattā paṭikulaṃ.
For human flesh, being detestable in the world, is repugnant.
Thịt người, ở đời, vì đáng ghê tởm nên là đáng ghê tởm.
Tathā hi taṃ viññūhi vajjitaṃ, manussamaṃsesupi ñātimaṃsaṃ ayuttaparibhogatāya paṭikūlaṃ, tatthāpi puttamaṃsaṃ, tatthāpi piyaputtamaṃsaṃ, tatthāpi taruṇamaṃsaṃ, tatthāpi āmakamaṃsaṃ, tatthāpi agorasābhisaṅkhataṃ, tatthāpi aloṇaṃ, tatthāpi adhūpitanti evaṃ heṭṭhimato uttaruttarassa paṭikūlatarabhāvakāraṇatā daṭṭhabbā.
Indeed, it is avoided by the wise. Even among human flesh, the flesh of a relative is repugnant due to improper consumption; even more so, the flesh of one's child; even more so, the flesh of a beloved child; even more so, the flesh of a young one; even more so, raw flesh; even more so, that which is not prepared for the market; even more so, that which is unsalted; even more so, that which is unsmoked. In this way, the reasons for increasing repugnance, from the lower to the higher, should be understood.
Như vậy, nó bị người trí tránh xa. Trong các loại thịt người, thịt người thân vì không nên thọ dụng nên đáng ghê tởm; trong đó, thịt con trai; trong đó, thịt con trai yêu quý; trong đó, thịt non; trong đó, thịt sống; trong đó, thịt không được chế biến từ chợ; trong đó, thịt không muối; trong đó, thịt không hun khói. Như vậy, phải thấy rằng từ dưới lên trên, mỗi loại càng đáng ghê tởm hơn.
Puttamaṃsasadisanti paṭikūlatāupaṭṭhāpanena puttamaṃsasadisaṃ katvā passati.
Puttamaṃsasadisaṃ means one perceives it as similar to the flesh of one's child by presenting its repugnance.
Giống như thịt con trai là xem như thịt con trai bằng cách trình bày sự đáng ghê tởm.
Tattha nikantiṃ pariyādiyatīti ariyamaggena āhāre sāpekkhaṃ khepeti.
Tattha nikantiṃ pariyādiyatī means that through the Noble Path, one eliminates attachment to food.
Ở đó, đoạn trừ sự ham muốn là đoạn trừ sự phụ thuộc vào thức ăn bằng Thánh đạo.
Sattisatena hatā eva upamā sattisatahatūpamā, tassaṃ sattisatahatūpamāyaṃ.
Killed by a hundred spears is eva (indeed) an analogy, the sattisatahatūpamā (analogy of being struck by a hundred spears); in that sattisatahatūpamāyaṃ.
Sự ví dụ về một trăm mũi tên đâm trúng như vậy là ví dụ về một trăm mũi tên đâm trúng, trong ví dụ về một trăm mũi tên đâm trúng đó.
Taṃ sattisataṃ.
Taṃ refers to that hundred spears.
Một trăm mũi tên đó.
Assa purisassa.
Assa refers to that man.
Của người đó.
Patitokāseti purimasattīhi patitappadese.
Patitokāse means in the place where the previous spears fell.
Ở nơi bị đâm là ở chỗ bị các mũi tên trước đâm trúng.
Dukkhassa pamāṇaṃ natthi anekassa aparāparaṃ uppajjanato.
Dukkhassa pamāṇaṃ natthi because countless sufferings arise one after another.
Khổ không có giới hạn vì vô số khổ liên tục phát sinh.
Khandhajanananti khandhānaṃ aparāparuppādo, paṭhamābhinibbatti pana paṭisandhi eva.
Khandhajananaṃ is the continuous arising of the aggregates; the first arising, however, is rebirth-linking consciousness (paṭisandhi).
Sự sinh khởi của các uẩn là sự phát sinh liên tục của các uẩn, còn sự khởi sinh đầu tiên chính là tái tục.
Āgucārī puriso viya paṭisandhiviññāṇaṃ nānappakāradukkhuppādasannissayato, tehi ca dukkhehi upagantabbato.
Āgucārī puriso viya paṭisandhiviññāṇaṃ (rebirth-linking consciousness is like a man committing an offense) because it is the basis for the arising of various kinds of suffering and must be approached by these sufferings.
Thức tái tục giống như người phạm tội vì là nơi nương tựa cho sự phát sinh của nhiều loại khổ khác nhau, và vì phải chịu đựng những khổ đó.
Sampayuttadhammānaṃ pamukhabhāvena pavattiyā ‘‘viññāṇassa dukkhuppādoti vuttā.
Due to the principal functioning of associated phenomena, it is stated: viññāṇassa dukkhuppādo (the arising of suffering for consciousness).
Vì sự vận hành của các pháp tương ưng ở vị trí chủ yếu, nên nói “sự phát sinh khổ của thức”.
Tathā hi vuttaṃ ‘‘manopubbaṅgamā dhammā’’ti (dha. pa. 1, 2) yathā viññāṇaṃ āyatiṃ paṭisandhivasena na pavattati, evaṃ karaṇaṃ tattha nikantipariyādānaṃ daṭṭhabbaṃ.
As it is stated: "Mind is the forerunner of all mental states," it should be understood that the action of eliminating attachment there is what causes consciousness not to arise again in the future by way of rebirth-linking.
Như đã nói “các pháp do ý dẫn đầu” (Dhp. 1, 2), phải hiểu rằng sự đoạn trừ ham muốn ở đó là việc làm để thức không vận hành trong tương lai theo nghĩa tái tục.
Pariññātaṃ vatthūti dukkhasaccamāha.
Pariññātaṃ vatthu refers to the truth of suffering.
Đối tượng đã được liễu tri là nói về Khổ đế.
Pañcakāmaguṇiko rāgoti pañcakāmaguṇārammaṇo rāgo.
Pañcakāmaguṇiko rāgo means lust that has the five strands of sensuality as its object.
Tham ái có năm dục công đức là tham ái có đối tượng là năm dục công đức.
Pariññāto hotīti paricchijja jānanena samatikkanto hoti.
Pariññāto hotī means it is overcome by knowing it thoroughly.
Đã được liễu tri là đã được vượt qua bằng cách hiểu rõ.
Rasataṇhāya hi sammadeva vigatāya rūpataṇhādayopi vigatāyeva honti.
Indeed, when craving for taste is completely eradicated, craving for forms and so on are also eradicated.
Thật vậy, khi ái vị đã hoàn toàn biến mất, thì ái sắc, v.v. cũng biến mất.
Tathā ca sati kāmarāgasaṃyojanaṃ samucchinnameva hoti, evaṃ karaṇaṃ tattha nikantipariyādānaṃ daṭṭhabbaṃ.
And when that is the case, the fetter of sensual lust is completely cut off. It should be understood that this action is the elimination of attachment there.
Khi đó, dục ái kiết sử đã bị đoạn trừ hoàn toàn. Việc làm như vậy phải được hiểu là sự đoạn trừ ham muốn ở đó.
Pariññābhisamaye hi siddhe pahānābhisamayo siddho evāti.
For when the comprehension (pariññā) is perfected, the abandonment (pahāna) is also perfected.
Thật vậy, khi sự liễu tri đã thành tựu, thì sự đoạn trừ cũng thành tựu.
Pahīne ca kāmarāgasaṃyojane orambhāgiyasaṃyojanānaṃ lesopi nāvasissatīti dassento āha ‘‘natthi taṃ saṃyojana’’ntiādi.
And by showing that when the fetter of sensual lust is abandoned, not even a trace of the lower fetters remains, it is stated: natthi taṃ saṃyojana and so on.
Và khi dục ái kiết sử đã được đoạn trừ, không còn một chút tàn dư nào của hạ phần kiết sử, nên nói “không có kiết sử đó”, v.v.
Tena kabaḷīkārāhārapariññā anāgāmitaṃ pāpetīti dasseti.
This shows that the full comprehension of physical food leads to non-returning (anāgāmitā).
Điều đó cho thấy rằng sự liễu tri về đoàn thực đưa đến quả vị Bất Hoàn.
Sesāhārapariññā pana arahattaniṭṭhā evāti dassento ‘‘phasse bhikkhave’’tiādimāha.
And by showing that the full comprehension of the remaining foods culminates in arahantship, it states: phasse bhikkhave (monks, in contact) and so on.
Và để cho thấy rằng sự liễu tri về các loại thực còn lại đưa đến quả vị A-la-hán, nên nói “Này các Tỳ-kheo, về xúc”, v.v.
Tattha tisso taṇhāti kāmataṇhā rūpataṇhā arūpataṇhāti imā tisso taṇhā.
There, tisso taṇhā (the three cravings) are sensual craving, craving for existence in the form realm, and craving for existence in the formless realm.
Ở đó, ba ái là ba ái này: dục ái, sắc ái, vô sắc ái.
‘‘Purimataṇhāsamudayā’’ti saṅkhepato vuttamatthaṃ vitthārato dassetuṃ ‘‘katha’’ntiādi āraddhaṃ.
To extensively explain the meaning concisely stated as purimataṇhāsamudayā (from the arising of former craving), the phrase kathaṃ (how) and so on is begun.
Để trình bày chi tiết ý nghĩa đã được nói tóm tắt trong “do sự tập khởi của ái trước”, nên bắt đầu bằng “như thế nào”, v.v.
Tattha taṇhāpaccayanibbattāti taṇhāpaccayā nibbattā.
There, taṇhāpaccayanibbattā means arisen conditioned by craving.
Ở đó, do duyên ái mà sinh khởi là do duyên ái mà sinh khởi.
Paṭisandhikkhaṇe purimataṇhāsamudayā āhārānaṃ samudayadassaneneva pavattikkhaṇepi upādinnakaāhārasamudayo dassito hotīti taṃ anāmasitvā anupādinnakānaṃ taṇhāsamudayaṃ dassetuṃ ‘‘yasmā panā’’tiādi vuttaṃ.
By merely showing the arising of foods from former craving at the moment of rebirth-linking, the arising of supported foods at the moment of continuity is also shown. Therefore, without referring to that, to show the arising of unsupported foods from craving, it is stated: yasmā panā (but since) and so on.
Vì sự tập khởi của các món ăn đã được chỉ rõ qua sự tập khởi của ái trước vào khoảnh khắc tái tục, nên sự tập khởi của món ăn hữu thủ cũng được chỉ rõ vào khoảnh khắc vận hành. Do đó, để chỉ rõ sự tập khởi của các món ăn vô thủ mà không đề cập đến điều đó, nên nói “vì vậy”, v.v.
Idhāti imasmiṃ sutte missitvā kathitā avisesitattā.
Idha (here), in this sutta, they are missitvā kathitā (spoken mixed together) because they are not differentiated.
Ở đây, trong kinh này, được nói lẫn lộn vì không được phân biệt.
Sahajātataṇhāpaccayanibbattoti ettha sahajātaggahaṇaṃ asahajātataṇhāpaccayanibbattopi anupādinnakaāhāro labbhatīti dassanatthaṃ.
The inclusion of sahajāta (co-arisen) in sahajātataṇhāpaccayanibbatto (arisen conditioned by co-arisen craving) is to show that unsupported food can also be obtained conditioned by non-co-arisen craving.
Trong câu “do duyên ái đồng sinh mà sinh khởi”, việc dùng từ “đồng sinh” là để cho thấy rằng món ăn vô thủ cũng có thể được tìm thấy do duyên ái không đồng sinh mà sinh khởi.
So pana asahajātataṇhāpaccayanibbattatāsāmaññenapi yathāvuttaupādinnakāhārena saṃsayaṃ janeyyāti na uddhaṭo, na ca etaṃ kāraṇaṃ ‘‘rāgaṃ upanissāya domanassaṃ uppajjatī’’ti vacanato, taṇhopanissayapaṭighacittasamuṭṭhānāya ca ojāya vasena anupādinnakaāhārassa labbhanato.
However, that (non-co-arisen) is not brought forth because it might cause doubt with the aforementioned supported food due to the commonality of being conditioned by non-co-arisen craving, and this is not a reason, because unsupported food is obtained in terms of craving as a proximate cause for aversion, and in terms of oja (nutriment) arising from a mind rooted in aversion, according to the statement, "Aversion arises dependent on lust."
Nhưng điều đó không được nêu ra vì có thể gây nghi ngờ với món ăn hữu thủ đã nói, do sự tương đồng về việc sinh khởi do duyên ái không đồng sinh. Và điều này không phải là lý do vì món ăn vô thủ có thể được tìm thấy theo cách “dựa vào tham ái mà ưu phiền phát sinh” và theo nghĩa tinh chất (ojā) sinh khởi từ tâm sân hận được duyên bởi ái.
Kathaṃ pana taṇhā ojāya upanissayapaccayo; na hi paṭṭhāne katthaci rūpassa upanissayapaccayo vutto atthīti.
But how is craving a proximate cause for oja? For nowhere in the Paṭṭhāna is craving stated to be a proximate cause for material form.
Nhưng làm thế nào ái lại là duyên nương tựa cho tinh chất? Vì trong Paṭṭhāna, không có chỗ nào nói về duyên nương tựa của sắc.
Nāyaṃ virodho ‘‘yasmiṃ sati yaṃ hoti, so tassa upanissayo’’ti suttantanayassa adhippetattā yathāvuttatthasambhavato.
This is not a contradiction, because the Suttanta method, which states "that which exists when something else exists, is its proximate cause," is intended, and thus the aforementioned meaning is possible.
Đây không phải là sự mâu thuẫn vì ý nghĩa đã nói có thể xảy ra do ý nghĩa của phương pháp kinh điển là “cái gì có mặt thì cái đó là duyên nương tựa của nó”.
Tenevāha ‘‘imissā…pe… taṇhāya nirodhenā’’ti.
Therefore, it is stated: imissā...pe... taṇhāya nirodhenā (with the cessation of this... craving...)
Chính vì thế mà nói “do sự diệt trừ của ái này… v.v.”.
Kāraṇe sabbaso niruddhe phalampi sabbaso nirujjhatīti āha ‘‘āhāranirodho paññāyatī’’ti.
When the cause is completely ceased, the result also completely ceases, thus it is stated: āhāranirodho paññāyatī (the cessation of food is discerned).
Khi nhân đã hoàn toàn diệt trừ, thì quả cũng hoàn toàn diệt trừ, nên nói “sự diệt trừ của các món ăn được chỉ rõ”.
Āhārānaṃ dukkhasaccekadesattā āhāraggahaṇaṃ dukkhasaccaggahaṇameva hotīti āha ‘‘idha cattāripi saccāni sarūpeneva vuttānī’’ti.
Since foods are a part of the truth of suffering, the apprehension of foods is indeed the apprehension of the truth of suffering, thus it is stated: idha cattāripi saccāni sarūpeneva vuttānī (here, all four truths are stated in their own nature).
Vì các món ăn là một phần của Khổ đế, nên việc nắm lấy các món ăn cũng chính là nắm lấy Khổ đế, nên nói “ở đây, cả bốn Thánh đế đều được nói theo bản chất của chúng”.
Saccadesanā dukkhādīnaṃ yāvadeva pariññeyyādibhāvasandassanatthā, tasmā jarāmaraṇādīsu pariññeyyādibhāvo asammohato sallakkhetabboti dassento ‘‘sabbattha asammuyhantena saccāni uddharitabbānī’’ti āha.
The teaching of the truths is for the very purpose of demonstrating the nature of suffering and so on as that which is to be comprehended and so on. Therefore, the nature of old age and death and so on as that which is to be comprehended and so on should be clearly understood without confusion, thus it is stated: sabbattha asammuyhantena saccāni uddharitabbānī (the truths should be extracted everywhere by one who is not confused).
Sự thuyết giảng về các Thánh đế là để chỉ rõ tính chất liễu tri, v.v. của khổ, v.v. Do đó, phải nhận thức rõ ràng tính chất liễu tri, v.v. trong già, chết, v.v. mà không bị lầm lẫn, nên nói “phải nhận thức các Thánh đế ở khắp mọi nơi mà không bị lầm lẫn”.
Gatijātivasenāti (saṃ. ni. ṭī. 2.1.2) pañcagativasena, tatthāpi ekekāya gatiyā khattiyādibhummadevādihatthiādijātivasena ca.
Gatijātivasena (by way of destination and birth) means by way of the five destinations; and within each destination, by way of births such as khattiya (warrior class), terrestrial devas, elephants, and so on.
Theo nghĩa cảnh giới và loại sinh (Saṃ. Ni. Ṭī. 2.1.2) là theo nghĩa năm cảnh giới, và trong đó, theo nghĩa loại sinh của Sát-đế-lợi, chư thiên trên cõi người, loài voi, v.v. trong mỗi cảnh giới.
Nikiyyanti sattā ettha, etena vāti nikāyo, gottacaraṇādivibhāgo.
Beings are gathered here, or by this (they are gathered), thus nikāya (a collection, group), a division based on lineage, conduct, and so on.
Chúng sinh tụ tập ở đây, hoặc bởi điều này, nên gọi là nikāya (bộ/tập hợp), là sự phân chia theo dòng dõi, hạnh kiểm, v.v.
Jarāya sabhāvo nāma vayohāni, tasmā jarāti vayohānisaṅkhātassa sabhāvassa niddeso, pākaṭajarāvasena niddeso khaṇḍiccādivasena gahaṇato.
The nature of old age is the deterioration of vitality; therefore, jarā (old age) is a description of the nature characterized as the deterioration of vitality. The description is in terms of manifest old age, due to its comprehension through tooth decay and so on.
Bản chất của sự già là sự suy giảm tuổi tác, do đó, jarā (già) là sự mô tả bản chất được tính là sự suy giảm tuổi tác; sự mô tả theo cách già rõ rệt, vì nó được nắm bắt qua các trạng thái như răng sứt, v.v.
Jīraṇameva jīraṇatā, jīrantassa vā ākāro tā-saddena vutto.
The very aging is jīraṇatā (agedness), or the aspect of aging is expressed by the suffix ‘-tā’.
Jīraṇatā chính là sự già đi, hoặc trạng thái của sự già đi được diễn tả bằng hậu tố -tā.
Tenāha ‘‘ayaṃ ākāraniddeso’’ti.
Therefore, it is said, "this is a description of an aspect."
Do đó, nói rằng: “Đây là sự mô tả trạng thái.”
Dantādīnaṃ vasena khaṇḍaṃ jātaṃ etassāti khaṇḍito, puggalo.
Fragmented due to teeth and so on, thus khaṇḍita, (the) person.
Người mà răng, v.v., đã bị sứt mẻ thì gọi là khaṇḍito (sứt mẻ), tức là người.
Tassa bhāvo khaṇḍiccaṃ.
His state is khaṇḍiccaṃ (brokenness).
Trạng thái của người ấy là khaṇḍiccaṃ (sứt mẻ).
Palitaṃ etassa atthīti palito, tassa bhāvo pāliccaṃ.
One who has gray hair, thus palita (gray-haired); his state is pāliccaṃ (grayness).
Người có tóc bạc thì gọi là palito (tóc bạc). Trạng thái của người ấy là pāliccaṃ (tóc bạc).
Vali taco etassāti valittaco, tassa bhāvo valittacatā.
One who has wrinkled skin, thus valittaca (wrinkled-skinned); his state is valittacatā (wrinkledness).
Người có da nhăn nheo thì gọi là valittaco (da nhăn nheo). Trạng thái của người ấy là valittacatā (da nhăn nheo).
Ime khaṇḍiccādayo jarā.
These khaṇḍicca and so on are old age.
Những điều này như sứt mẻ, v.v., là sự già.
Vikārānaṃ dassanavasenāti vipattidassanavasena.
By showing the changes means by showing the corruptions.
Theo cách thể hiện các biến đổi là theo cách thể hiện sự hư hoại.
Vātassāti mahato vātakkhandhassa.
Of the wind means of the great wind element.
Của gió là của khối gió lớn.
Khaṇḍiccādivasena gatamaggo pākaṭo, tasmā khaṇḍiccādiggahaṇaṃ jarāya kiccaniddesoti vuttanti dasseti.
It shows that "the path taken by tooth decay and so on is manifest," therefore the comprehension of tooth decay and so on is described as the function of old age.
Con đường đạt đến sự già rõ rệt là con đường đi qua các trạng thái như sứt mẻ, v.v., do đó việc nắm bắt các trạng thái sứt mẻ, v.v., được nói là sự mô tả chức năng của sự già.
Na ca khaṇḍiccādīneva jarāti kalalakālato pabhuti purimarūpānaṃ jarāpattakkhaṇe uppajjamānāni pacchimarūpāni paripakkarūpānurūpāni pariṇatapariṇatāni uppajjantīti anukkamena supariṇatarūpānaṃ paripākakāle uppajjamānāni khaṇḍiccādisabhāvāni uppajjanti, tāni udakādimaggesu tiṇarukkhasaṃbhaggatādayo viya paripākagatamaggasaṅkhātesu paripakkarūpesu uppannāni ‘‘jarāya gato maggo’’icceva vuttāni, na jarāti.
And tooth decay and so on are not old age themselves. From the kalala stage onwards, at the moment when previous forms attain old age, subsequent forms arise corresponding to mature forms, increasingly ripened; thus, gradually, at the time of the full maturation of forms, conditions like tooth decay arise. These, like grass and trees being broken in watery paths, arise in the mature forms, which are described as the path taken by maturation, and are referred to as "the path taken by old age," not old age itself.
Và không phải chỉ riêng các trạng thái sứt mẻ, v.v., là sự già, mà từ thời kỳ kalala (hợp chất) trở đi, khi các sắc pháp trước đạt đến trạng thái già, các sắc pháp sau sinh khởi tương ứng với các sắc pháp đã chín muồi, chúng sinh khởi dần dần trở nên chín muồi hơn. Khi các sắc pháp đã chín muồi hoàn toàn, các trạng thái như sứt mẻ, v.v., sinh khởi. Những trạng thái này, giống như cỏ cây bị gãy đổ trên đường nước chảy, v.v., sinh khởi trên các sắc pháp đã chín muồi trên con đường đã đạt đến sự chín muồi, được gọi là “con đường mà sự già đã đi qua”, chứ không phải là sự già.
Pakatiyāti phalavipaccanapakatiyā, jarāya vā pāpuṇitabbaṃ phalamevapakati, tāya jarā dīpitā.
By nature means by the nature of ripening fruit, or the fruit to be attained by old age is itself the nature, by which old age is revealed.
Theo bản chất là theo bản chất của sự chín muồi quả báo, hoặc bản chất chính là quả báo cần phải đạt đến của sự già, và sự già được làm sáng tỏ bởi bản chất đó.
Suppasannānīti suṭṭhu pasannāni.
Suppasannāni means very clear.
Suppasannānī (hoàn toàn trong sạch) là rất trong sạch.
Tameva suppasannataṃ kiccato dassetuṃ ‘‘sukhumampī’’tiādi vuttaṃ.
To show that very clarity through its function, "even subtle" and so on is stated.
Để thể hiện sự hoàn toàn trong sạch đó qua chức năng, đã nói “sukhumampī” (dù là vi tế) v.v.
Tikkhavisadatā hi tesaṃ indriyānaṃ suppasannatā.
For sharpness and clarity are the clarity of those faculties.
Thật vậy, sự sắc bén và trong sáng là sự hoàn toàn trong sạch của các căn đó.
Āluḷitānīti ākulāni.
Āluḷitāni means disturbed.
Āluḷitānī (bị xáo trộn) là bị rối loạn.
Avisadānīti abyattāni.
Avisadāni means unclear.
Avisadānī (không trong sáng) là không rõ ràng.
Kāmaṃ rūpadhammesupi khaṇikajarā durupalakkhitā paṭicchannāva, sā pana yasmā santānavasena pavattiyā paribyattāva hotīti ‘‘pākaṭajarā’’icceva vuttā.
Indeed, even in material phenomena, momentary old age is imperceptible, concealed. But since it becomes manifest through its continuity in a stream, it is simply referred to as "manifest old age."
Kāmaṃ (mong muốn), ngay cả trong các sắc pháp, sự già sát na cũng khó nhận biết, bị che giấu. Nhưng vì nó được thể hiện rõ ràng qua sự tiếp nối của dòng chảy, nên được gọi là “pākaṭajarā” (sự già rõ rệt).
Avīci nirantarā jarā avīcijarā sati santāne sattānaṃ anuppabandhato.
Continuous old age, without interruption, is avīcijarā (uninterrupted old age), because beings are not severed in the stream of existence.
Sự già không gián đoạn, sự già không khoảng cách ( avīcijarā), là sự không gián đoạn của chúng sinh trong dòng chảy liên tục.
Tato aññesūti mandadasakādīsu pubbadasakādiparicchedato aññesu yathāvuttesu.
Among others means among others as described, such as the mandadasaka group, distinct from the pubbadasaka group.
Tato aññesū (trong những cái khác ngoài cái đó) là trong những cái khác đã được nói đến, như mandadasaka (mười yếu) v.v., khác với sự phân chia pubbadasaka (mười trước) v.v.
Antarantarāti tesu eva vuttappakāresu purimadasakādito pacchimadasakādīnaṃ antarantarā.
Intermittently means intermittently among those very groups described, from the former dasaka groups to the latter dasaka groups.
Antarantarā (giữa các khoảng) là giữa các pacchimadasaka (mười sau) v.v., so với purimadasaka (mười trước) v.v., trong các loại đã nói đó.
Vaṇṇavisesādīnanti vaṇṇavisesasaṇṭhānavisesasamphassavisesādīnaṃ.
Of specific colors and so on means of specific colors, specific shapes, specific touches, and so on.
Vaṇṇavisesādīnaṃ (của các đặc điểm màu sắc, v.v.) là của các đặc điểm màu sắc, đặc điểm hình dáng, đặc điểm xúc chạm, v.v.
Vacanakavasenāti ka-kārena hi padaṃ vaḍḍhetvā vuttaṃ, tasmā cavanaṃ cutīti vuttaṃ hoti.
In the sense of a word means that the word is formed by adding the suffix 'ka'; therefore, it is said that "cavanaṃ cutī" (falling away is passing away).
Theo cách nói (vacana) là đã nói thêm chữ ka vào từ, do đó cavanā (sự rời bỏ) được nói là cuti (sự chết).
Taṃ pana ekacatupañcavokārabhavesu cutiyā avisesato gahaṇanti āha ‘‘ekacatupañcakkhandhānaṃ sāmaññavacana’’nti.
Since there is no distinction in passing away in the one-, four-, and five-constituent existences, it is taken as such, and thus he says, "a common term for the one, four, and five aggregates."
Điều đó là sự nắm bắt sự chết mà không có sự khác biệt trong các cõi ekacatupañcavokāra (một, bốn, năm uẩn), nên nói “là từ chung cho một, bốn, năm uẩn”.
Cavanakavasenāti vā cavanakassa puggalassa vasenāti attho.
In the sense of falling away, or in the sense of the person falling away; this is the meaning.
Hoặc theo cách rời bỏ là theo cách của người rời bỏ, là ý nghĩa.
Cavanameva cavanatāti āha ‘‘bhāvavacanenā’’ti.
Falling away itself is cavanatā (the state of falling away), thus he says, "by a noun of state."
Sự rời bỏ chính là cavanatā (sự rời bỏ), nên nói “bằng từ chỉ trạng thái”.
Lakkhaṇanidassananti vayasaṅkhātassa lakkhaṇassa nidassanaṃ.
Description of the characteristic means a description of the characteristic known as decay.
Sự chỉ rõ đặc tính là sự chỉ rõ đặc tính được gọi là sự suy giảm.
Cavantassa vā ākāro tā-saddena vutto ‘‘cavanatā’’ti.
Or the aspect of one falling away is expressed by the suffix ‘-tā’ in "cavanatā."
Hoặc trạng thái của người rời bỏ được diễn tả bằng hậu tố -tā là “cavanatā”.
Bhijjanaṃ bhedoti vuttaṃ ‘‘cutikkhandhānaṃ bhaṅguppattiparidīpana’’nti.
Breaking is bhedo (disintegration), thus it is said, "the exposition of the arising of disintegration of the aggregates of passing away."
Sự tan vỡ là bhedo (sự tan rã), được nói là “sự làm sáng tỏ sự sinh khởi của sự tan rã của các uẩn chết”.
Yathā bhinnassa ghaṭassa kenaci pariyāyena ghanaghaṭabhāvena ṭhānaṃ natthi, evaṃ bhinnānaṃ khandhānanti cavanaṃ antarahitaṃ nāmāti āha ‘‘antaradhānanti…pe… paridīpana’’nti.
Just as a broken pot has no way to remain in a solid pot-like state, so too for broken aggregates, falling away means disappearance; thus he says, "disappearance...pe...exposition."
Giống như một cái bình đã vỡ không thể tồn tại dưới dạng một cái bình nguyên vẹn bằng bất kỳ cách nào, tương tự, các uẩn đã tan vỡ, tức là sự rời bỏ, là sự biến mất, nên nói “sự biến mất… v.v… sự làm sáng tỏ”.
Yo maccūti vuccati bhedo, yañca maraṇaṃ pāṇacāgo, tadubhayaṃ ekajjhaṃ katvā vuttaṃ ‘‘maccu maraṇa’’nti evaṃ vā ettha attho daṭṭhabbo.
That which is called death (maccu), and that which is the abandonment of life (maraṇaṃ), both combined are called "maccu maraṇaṃ" (death and passing away); or this meaning should be understood here.
Cái được gọi là maccu (cái chết) là sự tan rã, và cái chết là sự từ bỏ sự sống, cả hai điều đó được gộp lại và nói là “maccu maraṇa” (cái chết và sự chết). Hoặc ý nghĩa ở đây nên được hiểu như vậy.
Kālassa antakassa kiriyāti yā loke vuccati, sā cuti, maraṇanti attho.
The action of the end of time, which is spoken of in the world, is passing away, which means death.
Hành động của kẻ hủy diệt thời gian, cái mà người đời gọi, chính là sự chết, sự tử vong, là ý nghĩa.
Cavanakālo eva vā anatikkamanīyattā visesena kāloti vuttoti tassa kiriyā atthato cutikkhandhānaṃ bhedappattiyeva.
Or the time of passing away itself is called 'time' especially because it cannot be transcended; thus, its action is, in essence, the attainment of the disintegration of the aggregates of passing away.
Hoặc thời điểm rời bỏ được gọi là thời gian một cách đặc biệt vì không thể vượt qua được, nên hành động của nó về bản chất chính là sự đạt đến sự tan rã của các uẩn chết.
‘‘Cuti cavanatā’’tiādinā pubbe vohāramissakena niddiṭṭhaṃ.
"Passing away, the state of passing away" and so on was previously described in terms of conventional usage.
“Cuti cavanatā” (sự chết, sự rời bỏ) v.v., đã được trình bày trước đây với sự pha trộn của cách dùng thông thường.
Idāni nibbattitaparamatthanayeneva niddesoti dassetuṃ ‘‘paramatthena dīpetu’’nti vuttaṃ.
Now, to show that the description is made according to the method of absolute reality, "to explain in terms of ultimate reality" is stated.
Để chỉ ra rằng bây giờ là sự trình bày theo phương pháp chân đế đã được thành tựu, nên nói “để làm sáng tỏ theo chân đế”.
‘‘Cavanakavasenā’’tiādinā hi puggalavasena ca vohārādhiṭṭhānā saṃvaṇṇanā katā.
For "in the sense of falling away" and so on, a commentary was made based on the individual and conventional designation.
Thật vậy, “Cavanakavasenā” (theo cách rời bỏ) v.v., đã được giải thích theo cách của cá nhân và dựa trên cách dùng thông thường.
Na kiñci kaḷevaraṃ nikkhipaki opapātikānaṃ cutikkhandhānaṃ antaradhānamevahoti, tato paraṃ utusamuṭṭhānarūpasantati na pavattati.
Nothing of the body is deposited; the disappearance of the aggregates of passing away for spontaneous birth beings is just that; after that, the continuity of form arising from climate does not continue.
Không có gì là thân thể được để lại; sự biến mất của các uẩn chết của chúng sinh hóa sinh là như vậy, sau đó dòng chảy của các sắc pháp do thời tiết sinh ra không tiếp tục.
‘‘Jātisamudayā’’tiādīsu yaṃ vattabbaṃ, taṃ ‘‘taṇhāsamudayā’’tiādīsu vuttanayaneva sakkā viññātunti na vuttaṃ.
What should be said regarding "the arising of birth" and so on is not stated because it can be understood in the same way as described for "the arising of craving" and so on.
Những gì cần nói trong “Jātisamudayā” (sự tập khởi của sinh) v.v., có thể hiểu được theo cách đã nói trong “Taṇhāsamudayā” (sự tập khởi của ái) v.v., nên không nói.
93. Jāyanaṭṭhenātiādi āyatanavasena yonivasena ca dvīhi dvīhi padehi sabbasatte pariyādiyitvā jātiṃ dassetuṃ vuttaṃ.
In the sense of arising and so on is stated to describe birth by encompassing all beings with two terms each, in terms of sense bases and in terms of wombs.
93. Jāyanaṭṭhenā (theo nghĩa sinh khởi) v.v., được nói để thể hiện sự sinh khởi bằng hai từ, bao gồm tất cả chúng sinh theo nghĩa xứ và theo nghĩa thai.
Sammohavinodaniyaṃ (vibha. aṭṭha. 191) pana ‘‘jāyamānakavasena jāti, sañjāyanavasena sañjātī’’ti vuttattā tattha ekekeneva padena sabbasatte pariyādiyitvā jātiṃ dassetīti daṭṭhabbaṃ.
In Sammohavinodanī (VibhA. 191), however, it is stated, "in the sense of being born is jāti (birth); in the sense of coming into being is sañjāti (coming-to-be)," so it should be understood that there, birth is described by encompassing all beings with each single term.
Tuy nhiên, trong Sammohavinodanī (vibha. aṭṭha. 191) đã nói “theo cách đang sinh khởi là jāti (sinh), theo cách sinh khởi hoàn toàn là sañjāti (toàn sinh)”, do đó, ở đây cần hiểu rằng mỗi từ đều bao gồm tất cả chúng sinh để thể hiện sự sinh khởi.
Sampuṇṇā jāti sañjātīti katvā ‘‘sā paripuṇṇāyatanavasena yuttā’’ti vuttaṃ.
Since full birth is sañjāti (coming-to-be), it is said, "that is suitable in terms of complete sense bases."
Sự sinh khởi đầy đủ là sañjāti (toàn sinh), do đó nói “nó phù hợp với ý nghĩa xứ đầy đủ”.
Eteneva kevalaṃ jātisaddena vuttāya jātiyā aparipuṇṇāyatanatā daṭṭhabbā.
By this very statement, the incompleteness of sense bases for birth expressed merely by the word 'jāti' should be understood.
Chính vì điều này mà sự không đầy đủ của xứ cần được hiểu đối với sự sinh khởi được nói chỉ bằng từ jāti.
Abhibyattā nibbatti abhinibbatti, pākaṭā nibbattīti attho.
Manifest arising is abhinibbatti (full arising); the meaning is manifest arising.
Sự sinh khởi được biểu lộ là abhinibbatti (tái sinh rõ rệt), nghĩa là sự sinh khởi rõ ràng.
‘‘Tesaṃ tesaṃ sattānaṃ…pe… abhinibbattī’’ti sattavasena pavattattā vohāradesanā.
"The full arising of those particular beings...pe..." is a conventional discourse because it occurs in terms of beings.
“Của các chúng sinh đó… v.v… sự tái sinh rõ rệt” là sự thuyết giảng theo cách dùng thông thường vì nó diễn ra theo chúng sinh.
Tatra tatrāti ettha catuvokārabhave dvinnaṃ, ekavokārabhave dvinnaṃ, sesarūpadhātuyaṃ paṭisandhikkhaṇe uppajjamānānaṃ pañcannaṃ, kāmadhātuyaṃ vikalāvikalindriyavasena sattannaṃ navannaṃ dasannaṃ, puna dasannaṃ, ekādasannañca āyatanānaṃ vasena saṅgaho veditabbo.
There, in each case, for the four-constituent existence, the inclusion of two; for the one-constituent existence, the inclusion of two; for the remaining rūpa-sphere, the inclusion of five (sense bases) arising at the moment of rebirth; for the kāma-sphere, the inclusion of seven, nine, or ten depending on whether faculties are complete or incomplete, and again ten, and eleven (sense bases) should be understood.
Tatra tatrā (ở đó, ở đó), ở đây cần hiểu sự tập hợp theo xứ: hai xứ trong cõi bốn uẩn, hai xứ trong cõi một uẩn, năm xứ sinh khởi vào sát na tái tục trong các cõi sắc giới còn lại, và bảy, chín, mười, rồi mười, và mười một xứ trong cõi dục giới tùy theo căn bị khuyết hay không khuyết.
Yadipi cutikkhandhā anantarānaṃ paṭisandhikadhammānaṃ anantarādinā paccayā honti, ye pana samudayā ajanakā, te ettha upapattibhavoti adhippetā.
Although the aggregates of passing away are conditions for the immediate rebirth phenomena in terms of immediate contiguity and so on, those origins that are non-productive are here intended as existences of rebirth.
Mặc dù các uẩn chết là duyên cho các pháp tái tục ngay sau đó bằng cách là ngay sau đó, v.v., nhưng ở đây, những sự tập khởi không sinh ra thì được xem là upapattibhava (hữu tái sinh).
Janako eva bhavoti adhippetoti dassento ‘‘jātiyā paccayabhūto kammabhavo veditabbo’’ti āha.
To show that only the generator is intended as existence, he says, "the kamma-bhava, which is the condition for birth, should be understood."
Để chỉ ra rằng chỉ janaka (cái sinh ra) mới được xem là bhava (hữu), nên nói “cần hiểu kammabhava (nghiệp hữu) là duyên cho jāti (sinh)”.
94. Bhāvanabhavanaṭṭhena bhavo duvidho.
Existence (bhava) is twofold in the sense of bringing into existence (bhāvana) and being (bhavana).
94. Hữu có hai loại theo nghĩa bhāvana (sự tạo ra) và bhavana (sự tồn tại).
Tattha kammabhavo ‘‘bhavati etasmā upapattibhavo’’ti bhāvanaṭṭhena bhavo.
Among these, kamma-bhava is bhava in the sense of bringing into existence, as "from this, rebirth-existence comes into being."
Trong đó, nghiệp hữu là hữu theo nghĩa bhāvana (sự tạo ra) vì “từ đó mà hữu tái sinh sinh khởi”.
Aṭṭhakathāyaṃ pana upapattibhavaṃ ‘‘bhavatīti bhavo’’ti vatvā tassa kāraṇattā kammaṃ phalūpacārena bhavoti ayamattho vutto, ubhayatthāpi upapattibhavahetubhāvanettha kammassa kammabhavapariyāyoti dassitaṃ hoti.
In the Commentary, however, having said that rebirth-existence is "that which comes into being (bhavati) is existence (bhava)," it is stated that kamma, being its cause, is existence by way of fruit-metonymy; in both cases, it is shown that kamma's being the cause of rebirth-existence is a synonym for kamma-bhava.
Tuy nhiên, trong Aṭṭhakathā (Chú giải), sau khi nói hữu tái sinh là “cái tồn tại là hữu”, thì ý nghĩa này đã được nói rằng nghiệp là hữu theo nghĩa ẩn dụ về quả báo vì nó là nguyên nhân của hữu tái sinh. Trong cả hai trường hợp, điều này cho thấy rằng nghiệp là đồng nghĩa với nghiệp hữu theo nghĩa là nguyên nhân của hữu tái sinh.
Sabbathāpīti bhāvanabhavanakusalākusalaupapattisampattibhavahīnapaṇītādinā sabbappakārenapi.
In every way means in all aspects, such as by way of development, becoming, wholesome, unwholesome, rebirth-attainment, existence, inferior, and superior.
"Sabbathāpī" (bằng mọi cách) có nghĩa là bằng mọi phương diện như tu tập, hữu, thiện, bất thiện, tái sinh, thành tựu, hữu thấp kém, cao thượng v.v...
Kāmabhavoti vuttaṃ kāmataṇhāhetukato kāmataṇhāya ārammaṇabhāvato ca.
Called sense-sphere existence because it is conditioned by craving for sense pleasures and is an object of craving for sense pleasures.
"Kāmabhavo" (cõi dục) được nói như vậy vì nó là do tham ái dục, và vì nó là đối tượng của tham ái dục.
Rūpabhavūpagakammaṃ rūpabhavo, tathā arūpabhavūpagakammaṃ arūpabhavo, taṃtaṃnibbattakkhandhā rūpārūpupattibhavā, rūpārūpabhavabhāvo pana tesaṃ ‘‘kāmabhavo’’ti ettha vuttanayeneva veditabbo.
Karma leading to fine-material existence is fine-material existence; similarly, karma leading to immaterial existence is immaterial existence. The aggregates produced by these are fine-material and immaterial rebirth-existences. The state of fine-material and immaterial existence, however, should be understood in the same way as stated here for "sense-sphere existence."
Nghiệp dẫn đến sắc hữu là sắc hữu, tương tự, nghiệp dẫn đến vô sắc hữu là vô sắc hữu. Các uẩn được tạo ra bởi nghiệp đó là sắc hữu và vô sắc hữu. Trạng thái sắc hữu và vô sắc hữu của chúng nên được hiểu theo cách đã nói ở đây là “dục hữu”.
95. Upādānanti catubbidhampi upādānaṃ.
95. Clinging means all four kinds of clinging.
95. Thủ (Upādāna) là tất cả bốn loại thủ.
Yathā hi kāmassādavasena, bhavassādavasena vā taṃtaṃsugatibhavūpagaṃ kammaṃ karontassa kāmupādānaṃ, evaṃ ucchedādimicchābhinivesavasenāti cattāripi upādānāni yathārahaṃ tassa tassa kusalakammabhavassa upanissayavaseneva paccayā honti, akusalakammabhavassa asahajātassa anantarassa upanissayavasenapi ārammaṇavasenapi.
Just as sense-pleasure clinging arises for one who performs karma leading to a fortunate rebirth in this or that existence due to the enjoyment of sense pleasures or the enjoyment of existence, so too all four clingings, in their respective ways, become conditions for that wholesome karma-existence primarily through proximate cause. For unwholesome karma-existence, which is not co-arisen, they are conditions through contiguity, proximate cause, and also through object.
Giống như đối với người thực hiện nghiệp dẫn đến các cõi thiện tương ứng do hưởng thụ dục lạc hoặc hưởng thụ hữu, thì có dục thủ (kāmupādāna). Tương tự, do chấp thủ tà kiến về đoạn diệt, v.v., cả bốn loại thủ đều là duyên theo cách y chỉ mạnh mẽ (upanissaya) cho hữu nghiệp thiện tương ứng, và là duyên theo cách y chỉ mạnh mẽ (upanissaya) hoặc duyên cảnh (ārammaṇa) cho hữu nghiệp bất thiện không đồng sinh và vô gián.
Sahajātassa kāmupādānaṃ sahajāta-aññamañña-nissaya-sampayutta-atthi-avigata-hetu-vasena sattadhā, sesaupādānāni tattha hetupaccayabhāvaṃ pahāya maggapaccayaṃ pakkhipitvā sattadhāva paccayā honti.
For co-arisen sense-pleasure clinging, there are seven ways: co-arisen, mutual, support, association, presence, non-disappearance, and root. For the remaining clingings, by abandoning the condition of root and including the condition of path, there are also seven ways in which they are conditions.
Dục thủ (kāmupādāna) đồng sinh là duyên theo bảy cách: đồng sinh (sahajāta), hỗ tương (aññamañña), y chỉ (nissaya), tương ưng (sampayutta), hiện hữu (atthi), bất ly (avigata), và nhân (hetu). Các loại thủ còn lại là duyên theo bảy cách, bỏ đi duyên nhân và thêm vào duyên đạo (magga).
Anantarassa pana anantarasamanantaraanantarūpanissayanatthivigatāsevanavasena paccayā honti.
But for the immediate, they are conditions by way of immediate, contiguous, non-immediate, strong-support, absence, disappearance, and repetition.
Đối với các loại vô gián, chúng là duyên theo các cách vô gián (anantara), đẳng vô gián (samanantara), vô gián y chỉ mạnh mẽ (anantarūpanissaya), bất hiện hữu (natthi), ly (vigata), và thường cận hành (āsevana).
Tassidampi sahajātādīti ādi-saddena saṅgahitanti daṭṭhabbaṃ.
It should be understood that this also is included by the word "etc." in "co-arisen, etc."
Điều này cũng nên được hiểu là đã bao gồm trong từ v.v. (ādi) của đồng sinh v.v. (sahajātādi).
Vatthukāmaṃ upādiyati cittaṃ, puggalo vā etenāti attho.
The meaning is that the mind or the person "clings to the object of sensual desire" by this.
Có nghĩa là tâm, hoặc người, bám víu (upādiyati) bằng cái này (etena) vào các dục cảnh.
Tanti vatthukāmaṃ.
"That" refers to the object of sensual desire.
Cái đó (taṃ) là dục cảnh.
Kāmetīti kāmo ca so upādiyatīti upādānañcāti yojanā.
The explanation is that it desires, so it is kāma; and it is clung to, so it is upādāna.
Cách phối hợp từ là: cái gì được ham muốn (kāmeti) là dục (kāma), và cái đó được bám víu (upādiyati) là thủ (upādāna).
Vuttanayenāti abhidhamme vuttanayena.
"In the manner stated" means in the manner stated in the Abhidhamma.
Theo cách đã nói (vuttanayena) là theo cách đã nói trong Vi Diệu Pháp (abhidhamme).
Sassato attāti idaṃ purimadiṭṭhiṃ upādiyamānaṃ uttaradiṭṭhiṃ nidassetuṃ vuttaṃ.
"The self is eternal"—this was stated to indicate the later view, which clings to the former view.
Tự ngã thường còn (sassato attā) được nói để chỉ ra tà kiến sau dựa trên chấp thủ tà kiến trước.
Yathā esā diṭṭhi daḷhīkaraṇavasena purimaṃ purimaṃ uttarā uttarā upādiyati, evaṃ ‘‘natthi dinna’’ntiādikāpīti.
Just as this view, by way of strengthening, clings to the preceding view more and more, so too is the case for "there is no giving," and so on.
Giống như tà kiến này chấp thủ tà kiến trước để củng cố tà kiến sau, thì tà kiến “không có bố thí” v.v. cũng vậy.
Attaggahaṇaṃ pana attavādupādānanti nayidaṃ diṭṭhupādānadassananti daṭṭhabbaṃ.
However, the grasping of "self" is attavādupādāna, and it should be understood that this is not diṭṭhupādāna.
Tuy nhiên, cần hiểu rằng sự chấp thủ tự ngã (attaggahaṇa) là ngã kiến thủ (attavādupādāna), không phải là kiến thủ (diṭṭhupādāna).
Loko cāti attaggahaṇavinimuttagahaṇaṃ diṭṭhupādānabhūtaṃ idha purimadiṭṭhiuttaradiṭṭhivacanehi vuttanti veditabbaṃ.
And "the world"—it should be understood that the grasping distinct from the grasping of self, which is diṭṭhupādāna, is stated here by the words referring to the former view and the later view.
Và thế gian (loko ca) là sự chấp thủ không liên quan đến tự ngã, là kiến thủ (diṭṭhupādāna), được nói ở đây bằng các từ tà kiến trước và tà kiến sau.
Sabbadiṭṭhigatassa ‘‘diṭṭhupādāna’’nti etaṃ adhivacanaṃ ‘‘sabbāpi diṭṭhi diṭṭhupādāna’’nti vacanato.
"This is a designation for all wrong views" (sabbadiṭṭhigatassa etaṃ adhivacanaṃ) because "all views are diṭṭhupādāna."
Cái này (etaṃ) là tên gọi (adhivacanaṃ) của tất cả các loại tà kiến (sabbadiṭṭhigatassa) là “kiến thủ (diṭṭhupādāna)” theo nguyên tắc “tất cả mọi tà kiến đều là kiến thủ”.
Sīlabbataṃ upādiyantīti sīlabbataṃ ‘‘suddhimaggo’’ti upādiyanti.
"They cling to precepts and observances" means they cling to precepts and observances as "the path to purity."
Chấp thủ giới cấm (sīlabbataṃ upādiyanti) có nghĩa là chấp thủ giới cấm (sīlabbata) như là “con đường thanh tịnh”.
Etena micchābhinivesena.
"By this" wrong adherence.
Bằng cái này (etena) là bằng sự chấp thủ tà kiến này.
Sayaṃ vā taṃ micchābhinivesasahagataṃ.
"That itself" is accompanied by wrong adherence.
Cái đó (taṃ) là đồng hành với sự chấp thủ tà kiến.
Sīlabbatasahacaraṇato sīlabbatañca taṃ daḷhaggāhabhāvato upādānañcāti sīlabbatupādānaṃ.
Because it accompanies precepts and observances, it is "precepts and observances"; and because it is a firm grasping, it is "clinging"—thus sīlabbatupādāna.
Vì đồng hành với giới cấm, cái đó là giới cấm (sīlabbatañca taṃ); vì là sự chấp thủ mạnh mẽ, nó là thủ (upādānañcāti), nên là giới cấm thủ (sīlabbatupādānaṃ).
Evaṃ suddhīti abhinivesatoti evaṃ gosīlagovatādicaraṇena saṃsārasuddhīti abhinivesabhāvato.
"From the adherence that purity is thus" means from the adherence that purity in saṃsāra is achieved by practicing the observances of a cow, a dog, and so on.
Do chấp thủ “thanh tịnh như vậy” (evaṃ suddhīti abhinivesato) có nghĩa là do chấp thủ rằng sự thanh tịnh trong luân hồi là do thực hành các giới như giữ giới bò, giới chó, v.v.
Etena taṃ sahacaraṇato abhinivesassa taṃsaddārahataṃ dasseti.
By this, it shows that due to its accompaniment, the adherence is worthy of that word.
Bằng cách này, nó cho thấy rằng sự chấp thủ đó xứng đáng với từ đó vì nó đồng hành với giới cấm.
Taṇhā kāmupādānassāti ettha ‘‘tattha katamaṃ kāmupādānaṃ?
Regarding "craving for sensual clinging" (taṇhā kāmupādānassa), here, as stated by "What is kāma-upādāna? The sensual desire, sensual lust, sensual delight, sensual craving, sensual affection, sensual torment, sensual infatuation, sensual attachment in sensual pleasures. This is called kāma-upādāna," kāma-upādāna is the strengthened craving.
Tham ái (taṇhā) là dục thủ (kāmupādānassa). Ở đây, theo câu “Thế nào là dục thủ? Đó là dục tham, dục ái, dục hỷ, dục ái, dục luyến, dục nhiệt, dục mê, dục chấp đối với các dục. Đây gọi là dục thủ”, thì sự kiên cố của tham ái là dục thủ.
Yo kāmesu kāmacchando kāmarāgo kāmanandī kāmataṇhā kāmasneho kāmapariḷāho kāmamucchā kāmajjhosānaṃ.
.
Tham ái là dục tham, dục ái, dục hỷ, dục ái, dục luyến, dục nhiệt, dục mê, dục chấp đối với các dục. Đây gọi là dục thủ.
Idaṃ vuccati kāmupādāna’’nti vacanato taṇhādaḷhattaṃ kāmupādānaṃ.
.
Sự kiên cố của tham ái là dục thủ.
Taṇhādaḷhattanti ca purimataṇhāupanissayapaccayato daḷhabhūtā uttarataṇhā eva.
And "strengthened craving" is indeed the later craving that has become strong due to the condition of the preceding craving as strong-support.
Và sự kiên cố của tham ái (taṇhādaḷhatta) chính là tham ái sau trở nên kiên cố do duyên y chỉ mạnh mẽ của tham ái trước.
Keci panāhu –
However, some say:
Một số người nói:
‘‘Appattavisayapatthanā taṇhā andhakāre corassahatthappasāraṇaṃ viya, sampattavisayaggahaṇaṃ upādānaṃ tasseva bhaṇḍaggahaṇaṃ viyā’’ti.
"Craving is the aspiration for an unobtained object, like a thief stretching out his hand in the dark; clinging is the grasping of an obtained object, like his taking hold of the goods."
“Tham ái là sự khao khát đối với đối tượng chưa đạt được, giống như một tên trộm đưa tay ra trong bóng tối. Thủ là sự nắm giữ đối tượng đã đạt được, giống như tên trộm đó nắm lấy đồ vật.”
Appicchasantuṭṭhipaṭipakkhā ete dhammā pariyesanārakkhadukkhamūlāni, tasmā vuttalakkhaṇā taṇhā vuttalakkhaṇasseva upādānassa anānantarassa upanissayavasena paccayo, ārammaṇādivasenapi paccayo hotiyeva, anantarādīnaṃ pana anantarādivasena paccayo.
These phenomena are opposed to contentment and satisfaction, and are the roots of the suffering of seeking and guarding. Therefore, craving, with its stated characteristic, is a condition for clinging, with its stated characteristic, by way of strong-support, not immediately contiguous. It is also a condition by way of object, and so on. But for the immediate, etc., it is a condition by way of immediate, etc.
Những pháp này là đối nghịch với thiểu dục và tri túc, là cội rễ của khổ do tìm cầu và bảo vệ. Do đó, tham ái với đặc tính đã nói là duyên theo cách y chỉ mạnh mẽ (upanissaya) cho thủ với đặc tính đã nói, không phải vô gián. Nó cũng là duyên theo cách cảnh (ārammaṇa) v.v. Đối với các loại vô gián v.v., nó là duyên theo cách vô gián v.v.
Sabbassapi hi lobhassa taṇhāpariyāyopi kāmupādānapariyāyopi labbhatevāti.
Indeed, for all greed, the designation of craving and the designation of sensual clinging are always found.
Thật vậy, đối với tất cả lòng tham, cả danh từ tham ái (taṇhāpariyāya) và danh từ dục thủ (kāmupādānapariyāya) đều có thể được sử dụng.
Avasesānanti diṭṭhupādānādīnaṃ.
"For the remaining" refers to diṭṭhupādāna, and so on.
Đối với các loại còn lại (avasesānaṃ) là đối với kiến thủ (diṭṭhupādāna) v.v.
Sahajātādivasenāti sahajātānaṃ sahajātādivasena, asahajātānaṃ anantaraupanissayādivasenāti sabbaṃ heṭṭhā vuttanayeneva veditabbaṃ.
"By way of co-arisen, etc." means by way of co-arisen, etc., for co-arisen phenomena, and by way of immediate, strong-support, etc., for non-co-arisen phenomena. Everything should be understood in the manner stated below.
Theo cách đồng sinh v.v. (sahajātādivasena) có nghĩa là đối với các pháp đồng sinh thì theo cách đồng sinh v.v., đối với các pháp không đồng sinh thì theo cách vô gián y chỉ mạnh mẽ v.v. Tất cả nên được hiểu theo cách đã nói ở trên.
96. ‘‘Cakkhusamphasso’’tiādi phassassa mātito nāmaṃ viya puttassa vatthuto tassa nissayabhāvena uppattihetuttā, ārammaṇaṃ pana kevalaṃ uppattihetūti vuttaṃ ‘‘seṭṭhi…pe… nāma’’nti.
96. "Eye-contact," and so on, is like the name of a son from his mother, because contact is the cause of its arising by way of being its basis. But the object is merely the cause of arising—this is stated in "the rich man... etc. ...name."
96. “Xúc nhãn (Cakkhusamphasso)” v.v. được nói là tên của xúc theo mẹ, vì nó là nguyên nhân phát sinh theo cách y chỉ của nó đối với vật chất, còn cảnh chỉ là nguyên nhân phát sinh, như đã nói “Trưởng giả... v.v. ... tên”.
Kāmarāgabhāvenāti vatthukāmassa rajjanavasena.
"By way of sensual lust" means by way of being enamored with the object of sensual desire.
Theo trạng thái dục tham (kāmarāgabhāvenā) là do sự dính mắc vào dục cảnh.
Rūpaṃ assādentīti rupārammaṇaṃ taṇhābhinandanāvasena abhiramamānā eva assādentī.
"They enjoy form" means they enjoy the object of form by delighting in it with craving.
Thưởng thức sắc (rūpaṃ assādenti) có nghĩa là thưởng thức cảnh sắc bằng cách vui thích với nó do tham ái.
Niccantiādinā diṭṭhābhinandanāmukhena rūpaṃ abhiramantī.
"Permanent," and so on, means delighting in form through the door of delighting in views.
Thường còn (niccaṃ) v.v. là vui thích với sắc thông qua sự vui thích với tà kiến.
Pecca na bhavissatīti bhijjitvā na hoti puna anuppajjanato.
"After death, it will not be" means it breaks up and does not exist again, because it does not re-arise.
Sau khi chết sẽ không còn (pecca na bhavissati) có nghĩa là sau khi tan rã sẽ không còn tồn tại nữa do không tái sinh.
Tathā saddakaṇhādayopīti yathā rūpataṇhā kāmarāgabhāvena sassatarāgavasena ucchedarāgavasenāti ca pavattiyā tisso taṇhā, tathā saddataṇhā gandharasaphoṭṭhabbadhammataṇhāpi.
And similarly, sound-craving, etc. Just as craving for forms, by way of sensual desire, by way of eternalist craving, and by way of annihilationist craving, these three cravings arise, so too do craving for sounds, craving for smells, tastes, tangible objects, and mental objects.
Tương tự, ái về tiếng, mùi, vị, xúc, pháp (tathā saddakaṇhādayopī) có nghĩa là giống như ái sắc có ba loại ái theo sự vận hành: theo trạng thái dục tham, theo trạng thái chấp thường, theo trạng thái chấp đoạn diệt, thì ái tiếng, ái mùi, ái vị, ái xúc, ái pháp cũng vậy.
Taṇhāvicaritānīti taṇhāsamudācārā, samudācāravasena pavattataṇhāti attho.
"Craving's wanderings" means the modes of craving's activity; it is craving that proceeds by way of its modes of activity.
Sự vận hành của ái (taṇhāvicaritānī) là sự phát sinh của ái, có nghĩa là ái vận hành theo cách phát sinh.
Ajjhattikassupādāyāti (vibha. aṭṭha. 973; saṃ. ni. ṭī. 2.2.2) ajjhattikaṃ khandhapañcakaṃ upādāya.
"By clinging to the internal" means by clinging to the five internal aggregates.
Do chấp thủ nội tại (ajjhattikassupādāyā) (Vibha. Aṭṭha. 973; Saṃ. Ni. Ṭī. 2.2.2) là do chấp thủ năm uẩn nội tại.
Upayogatthe hi idaṃ sāmivacanaṃ.
Indeed, this is a genitive case used in the sense of 'with reference to'.
Ở đây, đây là sở hữu cách với nghĩa sử dụng.
Asmīti hotīti yadetaṃ ajjhattaṃ khandhapañcakaṃ upādāya taṇhāmānadiṭṭhivasena samūhagāhato asmīti evaṃ hoti, tasmiṃ satīti attho.
"It comes to be, 'I am'" means that when one clings to these internal five aggregates, by way of craving, conceit, and wrong view, and grasps them as a collection, it comes to be "I am" in this way; that is the meaning when that exists.
Có ta (asmīti hotī) có nghĩa là do chấp thủ năm uẩn nội tại này, do chấp thủ tập hợp theo tham ái, ngã mạn và tà kiến, nên có “ta”. Có nghĩa là khi có cái đó.
Itthasmīti hotīti khattiyādīsu ‘‘idaṃpakāro aha’’nti evaṃ taṇhāmānadiṭṭhivasena hotīti idamettha anupanidhāya gahaṇaṃ.
"It comes to be, 'I am thus'" means that among Khattiyas and others, it comes to be "I am of this kind" by way of craving, conceit, and wrong view; here, this is a grasping without comparison.
Có như thế này (itthasmīti hotī) có nghĩa là có theo tham ái, ngã mạn và tà kiến như “ta là loại này” trong các giai cấp Sát đế lỵ v.v. Đây là sự chấp thủ không so sánh.
Evamādināti ādi-saddena ‘‘evaṃsmīti, aññathāsmīti, bhavissanti, itthaṃ bhavissanti, evaṃ bhavissanti, aññathā bhavissanti, asasmīti, satasmīti, siyanti, itthaṃ siyanti, evaṃ siyanti, aññathā siyanti, apāhaṃ siyanti, apāhaṃ itthaṃ siyanti, apāhaṃ evaṃ siyanti, apāhaṃ aññathā siya’’nti (vibha. 973) imesaṃ taṇhāvicaritānaṃ gahaṇaṃ.
"And so on" means that by the word "etc." are included these wanderings of craving: "I am thus, I am otherwise, I will be, I will be thus, I will be in this way, I will be otherwise, I will not be, I will be, I might be, I might be thus, I might be in this way, I might be otherwise, I might not be, I might not be thus, I might not be in this way, I might not be otherwise."
Bằng cách này v.v. (evamādinā), từ v.v. (ādi) bao gồm các sự vận hành của ái sau: “có ta như vậy, có ta khác, sẽ có, sẽ có như thế này, sẽ có như vậy, sẽ có khác, sẽ không có, sẽ có, sẽ là, sẽ là như thế này, sẽ là như vậy, sẽ là khác, sẽ không là ta, sẽ không là ta như thế này, sẽ không là ta như vậy, sẽ không là ta khác” (Vibha. 973).
Tattha evaṃsmīti idaṃ samato upanidhāya gahaṇaṃ, yathā ayaṃ khattiyo, yathā ayaṃ brāhmaṇo, evaṃ ahampīti attho.
Among these, "I am thus" is a grasping by comparison to equality, meaning "just as this Khattiya is, just as this brahmin is, so too am I."
Trong đó, có ta như vậy (evaṃsmī) là sự chấp thủ so sánh, có nghĩa là “người này là Sát đế lỵ, người này là Bà la môn, ta cũng vậy”.
Aññathāsmīti idaṃ asamaṇo upanidhāya gahaṇaṃ, yathā ayaṃ khattiyo, yathā ayaṃ brāhmaṇo, tato aññathā ahaṃ hīno vā adhiko vāti attho.
"I am otherwise" – this is a taking, referring to one who is not a samaṇa, meaning, "Just as this khattiya is, or this brahmin is, otherwise than that, I am inferior or superior."
Tôi khác – đây là sự chấp thủ dựa trên việc không phải là một Sa-môn, như "vị Sát-đế-lợi này", "vị Bà-la-môn này"; ý nghĩa là "từ đó, tôi khác, tôi kém hơn hoặc tôi hơn".
Iti imāni pubbe vuttāni dveti etāni paccuppannavasena cattāri taṇhāvicaritāni.
Thus, these two mentioned previously are these four wanderings of craving in terms of the present.
Như vậy, hai điều đã nói trước đây và bốn điều này là những tư duy tham ái (taṇhāvicārita) theo cách hiện tại.
Bhavissantiādīni pana cattāri anāgatavasena vuttāni.
Moreover, "I shall be" and so on are the four stated in terms of the future.
Còn bốn điều "Tôi sẽ là" và những điều tương tự thì được nói theo cách vị lai.
Tesaṃ purimacatukke vuttanayeneva attho veditabbo.
Their meaning should be understood by the very method stated in the former fourfold group.
Ý nghĩa của chúng nên được hiểu theo cách đã nói trong nhóm bốn điều trước.
Asasmīti asatīti asaṃ.
"I am not" means asaṃ because it does not exist.
Tôi không là (Asasmī) – không tồn tại (asati), tức là không là (asaṃ).
Niccassetaṃ adhivacanaṃ, tasmā sassato asmīti attho.
This is a designation for the eternal, therefore, the meaning is "I am eternal."
Đây là từ đồng nghĩa với thường hằng; do đó, ý nghĩa là "tôi là thường hằng".
Satasmīti sīdatīti sataṃ.
"I am" means sataṃ because it perishes.
Tôi là (Satasmī) – suy yếu (sīdati), tức là là (sataṃ).
Aniccassetaṃ adhivacanaṃ, tasmā asassato asmīti attho.
This is a designation for the impermanent, therefore, the meaning is "I am impermanent."
Đây là từ đồng nghĩa với vô thường; do đó, ý nghĩa là "tôi là vô thường".
Iti imāni dve sassatucchedavasena vuttāni.
Thus, these two are stated in terms of eternalism and annihilationism.
Như vậy, hai điều này được nói theo cách thường kiến và đoạn kiến.
Ito parāni siyantiādīni cattāri saṃsayaparivitakkavasena vuttāni, tāni purimacatukke vuttanayena atthato veditabbāni.
From here on, "I might be" and so on are the four stated in terms of doubt and vacillation, and their meaning should be understood in terms of the method stated in the former fourfold group.
Bốn điều tiếp theo, "có thể là" (siyanti) và những điều tương tự, được nói theo cách nghi ngờ và suy đoán; chúng nên được hiểu về ý nghĩa theo cách đã nói trong nhóm bốn điều trước.
Apāhaṃ siyantiādīni cattāri ‘‘api nāmāhaṃ bhaveyya’’nti evaṃ patthanākappanavasena vuttāni, tāni purimacatukke vuttanayeneva veditabbāni.
"I might become" and so on are the four stated in terms of aspiration and presumption, as in "Oh, that I might be!" These should be understood in terms of the very method stated in the former fourfold group.
Bốn điều "có thể tôi là" (apāhaṃ siyanti) và những điều tương tự, được nói theo cách ước nguyện và suy tưởng "ước gì tôi sẽ là"; chúng nên được hiểu theo cách đã nói trong nhóm bốn điều trước.
Ettha ca sassatucchedavasena vuttā dve diṭṭhisīsā nāma, asmi, bhavissaṃ, siyaṃ, apāhaṃ siyanti ete pana cattāro suddhasīsā eva, ‘‘itthasmī’’tiādayo tayo tayoti dvādasa sīsamūlakā nāma.
Here, the two views stated in terms of eternalism and annihilationism are called "diṭṭhisīsā" (view-heads); "I am," "I shall be," "I might be," and "I might become" are pure heads; and "I am thus" and so on, three by three, are called "sīsamūlakā" (root-of-heads), making twelve.
Ở đây, hai kiến chấp được nói theo cách thường kiến và đoạn kiến được gọi là các đầu kiến (diṭṭhisīsā); còn "tôi là" (asmi), "tôi sẽ là" (bhavissaṃ), "có thể tôi là" (siyaṃ), "có thể tôi sẽ là" (apāhaṃ siyaṃ) là bốn đầu thuần túy (suddhasīsā); "tôi là thế này" (itthasmī) và ba điều tương tự, mỗi loại có ba, được gọi là mười hai gốc đầu (sīsamūlakā).
Evametāni dve diṭṭhisīsā, cattāro suddhasīsā, dvādasa sīsamūlakāti ajjhattikassupādāya aṭṭhārassa taṇhāvicaritāni veditabbāni.
Thus, these two diṭṭhisīsā, four pure heads, and twelve sīsamūlakā—eighteen wanderings of craving—should be understood as referring to the internal.
Như vậy, hai đầu kiến, bốn đầu thuần túy, và mười hai gốc đầu này, dựa trên nội tại, nên được hiểu là mười tám tư duy tham ái (taṇhāvicārita).
Bāhirassupādāyāti bāhiraṃ khandhapañcakaṃ upādāya.
"Referring to the external" means referring to the external five aggregates.
Dựa trên ngoại tại (bāhirassupādāyā) – dựa trên năm uẩn ngoại tại.
Idampi hi upayogatthe sāmivacanaṃ.
This is also a possessive case used in the sense of utility.
Điều này cũng là cách nói sở thuộc trong ý nghĩa sử dụng.
Imināti iminā rupena vā…pe… viññāṇena vāti evaṃ rūpādīsu ekameva ‘‘aha’’nti, itaraṃ kiñcanapalibodhabhāvena gahetvā taṇhādivasena ‘‘asmī’’ti abhinivisati, ‘‘iminā’’ti ayamettha viseso.
"By this" – by this form or... by this consciousness, taking one of these, such as form, as "I," and the other as some kind of hindrance, one becomes obsessed with "I am" in terms of craving, and so on; "by this" is the distinction here.
Bởi cái này (iminā) – bởi sắc này hoặc... bởi thức này; như vậy, chấp thủ một trong các sắc uẩn làm "tôi", và chấp thủ những thứ khác như là trở ngại nhỏ nhặt, rồi bám víu "tôi là" theo cách tham ái, v.v., "bởi cái này" là sự khác biệt ở đây.
Asmīti iminā khaggena vā chattena vā abhisekena vā ‘‘khattiyohamasmī’’ti abhinivisati.
"I am" – by this sword or parasol or consecration, one becomes obsessed with "I am a khattiya."
Tôi là (asmī) – bởi thanh kiếm này, hoặc bởi chiếc lọng này, hoặc bởi lễ quán đảnh, người ta bám víu "tôi là một Sát-đế-lợi".
Bāhirarūpādinissitānīti bāhirāni parasantatipariyāpannāni rūpavedanādīni nissitāni.
"Dependent on external forms and so on" means dependent on external forms, feelings, and so on, belonging to the continuum of others.
Dựa vào sắc, v.v., ngoại tại (bāhirarūpādinissitānī) – dựa vào sắc, thọ, v.v., ngoại tại thuộc dòng dõi người khác.
Aṭṭhārasāti iminā ‘‘asmī’’tiādinayappavattāni aṭṭhārasa, tāni pubbe vuttanayeneva veditabbāni.
"Eighteen" means eighteen that arise in the manner of "I am" and so on, and these should be understood by the method stated previously.
Mười tám (aṭṭhārasā) – mười tám điều phát sinh theo cách "tôi là" và những điều tương tự; chúng nên được hiểu theo cách đã nói trước đây.
‘‘Iminā’’ti hi ayamevettha viseso, tasmā ‘‘dve diṭṭhisīsā’’tiādinā vuttanayeneva niddhāretvā veditabbā.
Indeed, "by this" is the distinction here; therefore, they should be defined and understood by the method stated using "two diṭṭhisīsā" and so on.
Thật vậy, "bởi cái này" là sự khác biệt ở đây; do đó, chúng nên được xác định và hiểu theo cách đã nói qua "hai đầu kiến" và những điều tương tự.
Ubhayaṃ pana ekajjhaṃ katvā āha ‘‘chattiṃsā’’ti.
Bringing both together, it is said "thirty-six."
Cộng cả hai lại, Ngài nói "ba mươi sáu".
Vipākavedanā adhippetā visesato attānaṃ assādetabbato.
"Resultant feeling is intended," especially because it is to be savored by oneself.
Thọ quả dị thục được đề cập (vipākavedanā adhippetā) – đặc biệt vì nó đáng được hưởng thụ bởi chính nó.
Tameva hissā assādetabbataṃ pakāsetuṃ ‘‘katha’’ntiādi vuttaṃ.
Indeed, to illustrate its savorability, "how" and so on is stated.
Để làm rõ tính đáng hưởng thụ của nó, Ngài đã nói "làm sao" và những điều tương tự.
Assādanenāti abhiratiyā.
"By savoring" means by delighting.
Bằng sự hưởng thụ (assādanenā) – bằng sự thích thú.
Mamāyantāti dhanāyantā.
"Attaching to as 'mine'" means desiring wealth.
Cho là của mình (mamāyantā) – cho là tài sản của mình.
Cittakārādīnanti ādi-saddena iṭṭhavaṇṇārammaṇadāyakānaṃ saṅgaho.
"Of painters and so on" – the term "and so on" includes those who provide agreeable visual objects.
Của họa sĩ, v.v. (cittakārādīna) – với từ v.v. bao gồm những người cung cấp đối tượng sắc cảnh đáng ưa thích.
Sippasandassanakādīnanti ādi-saddena vejjādīnaṃ saṅgaho.
"Of those who show skills and so on" – the term "and so on" includes doctors and others.
Của những người trình bày kỹ năng, v.v. (sippasandassanakādīna) – với từ v.v. bao gồm các thầy thuốc, v.v..
Vejjā hi rasāyatanojāvasena tadupatthambhitavasena ca dhammārammaṇassa dāyakā.
Indeed, doctors provide mind-objects in terms of elixirs and potent medicines, and in terms of supporting them.
Thật vậy, các thầy thuốc là những người cung cấp đối tượng pháp (dhammārammaṇa) qua việc bào chế thuốc và các chất bổ dưỡng, và qua việc hỗ trợ chúng.
Svāyaṃ ādi-saddo ‘‘vīṇāvādakādī’’tiādinā paccekañca yojetabbo, puttaṃ mamāyantāti puttaṃ sampiyāyantā.
This term "and so on" should also be connected individually, as in "of lute players and so on"; "attaching to a son as 'mine'" means cherishing a son.
Từ v.v. này cũng nên được kết hợp riêng lẻ với "người chơi đàn vĩ cầm, v.v."; cho con là của mình (puttaṃ mamāyantā) – yêu thương con.
Putto viya cettha vedanā daṭṭhabbā, sappāyasappikhīrādīni viya vedanāya paccayabhūtāni iṭṭharūpādiārammaṇāni, dhāti viya rūpādichaḷārammaṇadāyakā cittakārādayo daṭṭhabbā.
Here, feeling should be seen like a son; agreeable forms and so on, which are the objects, like suitable ghee and milk, are causes of feeling; and painters and so on, who provide the six objects of form and so on, should be seen like a nurse.
Ở đây, thọ nên được xem như đứa con; các đối tượng sắc cảnh đáng ưa thích, v.v., là nhân duyên của thọ, nên được xem như bơ, sữa, v.v., thích hợp; các họa sĩ, v.v., là những người cung cấp sáu đối tượng sắc cảnh, v.v., nên được xem như vú nuôi.
97. Cakkhusamphassajā eva vedanā atītādibhedabhinnā rāsivasena ekajjhaṃ gahetvā eko vedanākāyo yathā vedanākkhandho, evaṃ sotasamphassajādikāti pāḷiyaṃ ‘‘chayime āvuso vedanākāyā’’ti vuttanti āha ‘‘vedanākāyāti vedanāsamūhā’’ti.
When the feeling arisen from eye-contact, divided into past and so on, is taken together as a mass, it is one body of feeling, just like the aggregate of feeling; similarly, with feelings arisen from ear-contact and so on—this is what is stated in the Pāḷi text, "Friends, there are these six bodies of feeling," thus he says: "Bodies of feeling means groups of feelings."
97. Thọ do xúc nơi mắt sinh, khác biệt theo quá khứ, v.v., được gom lại thành một khối như một thân thọ, giống như uẩn thọ; và thọ do xúc nơi tai sinh, v.v., cũng vậy. Như vậy, trong kinh nói "Này các Tỳ-khưu, có sáu thân thọ này", nên Ngài nói "thân thọ tức là tập hợp các thọ".
Cakkhusamphassato jātā cakkhusamphassajā vedanā.
"Feeling arisen from eye-contact" is feeling arisen from eye-contact.
Thọ do xúc nơi mắt sinh (cakkhusamphassajā vedanā) – là thọ sinh từ xúc nơi mắt.
Sā pana upādinnāpi anupādinnāpi, tadubhayassapi saṅgaṇhantena atthavaṇṇanāya katattā āha ‘‘ayaṃ tāvettha sabbasaṅgāhikakathā’’ti.
Since that feeling can be both clung to and not clung to, and the explanation of the meaning includes both, he says: "This is the all-inclusive statement here."
Thọ đó có thể là bị chấp thủ (upādinna) hoặc không bị chấp thủ (anupādinna); vì sự giải thích ý nghĩa bao gồm cả hai, nên Ngài nói "đây là lời nói bao gồm tất cả".
Idāni ‘‘vipākavidhi aya’’nti upādinnayeva gaṇhanto ‘‘vipākavasenā’’tiādimāha.
Now, taking only clung-to feeling as "this is the method of result," he says "in terms of result" and so on.
Bây giờ, khi chỉ lấy thọ bị chấp thủ, Ngài nói "theo cách quả dị thục" và những điều tương tự, vì "đây là phương pháp quả dị thục".
Manodvāre manoviññāṇadhātusampayuttāti tadārammaṇamanoviññāṇadhātusampayuttā.
"Conjoined with the mind-consciousness element at the mind-door" means conjoined with the mind-consciousness element having that object.
Tương ưng với ý thức giới tại ý môn (manodvāre manoviññāṇadhātusampayuttā) – tương ưng với ý thức giới đó là đối tượng.
Avasesānanti sampaṭicchanādivedanānaṃ.
"Of the remaining" means of the feelings of reception and so on.
Của các thọ còn lại (avasesāna) – của các thọ như tiếp nhận, v.v..
Upanissayādīti ādi-saddena anantarādīnaṃ saṅgaho daṭṭhabbo.
"Upanissaya and so on" – the term "and so on" should be understood as including anantara and others.
Yểm trợ, v.v. (upanissayādī) – với từ v.v. nên hiểu là bao gồm các nhân vô gián (anantara), v.v..
Anantarānañhi anantarādivasena, itaresaṃ upanissayavasena phasso paccayo hoti, manodvāre pana tadārammaṇavedanānaṃ manosamphasso upanissayavasena paccayo.
Indeed, contact is a condition for anantara feelings in the way of anantara and so on, and for others in the way of upanissaya; but at the mind-door, mind-contact is a condition for feelings of that object in the way of upanissaya.
Thật vậy, xúc là nhân duyên cho các thọ vô gián theo cách vô gián, v.v., và cho các thọ khác theo cách yểm trợ; còn tại ý môn, ý xúc là nhân duyên cho các thọ đó là đối tượng theo cách yểm trợ.
Advārikānanti dvārarahitānaṃ.
"Doorless" means without doors.
Không có môn (advārikāna) – không có cửa.
Na hi paṭisandhiādivedanānaṃ kiñci dvāraṃ atthi.
Indeed, there is no door for feelings of rebirth and so on.
Thật vậy, không có môn nào cho các thọ như tái sinh, v.v..
Sahajātamanosamphassasamudayāti etenassa tāsaṃ sahajātakoṭiyā paccayabhāvamāha.
"Arisen from co-arisen mind-contact" – by this, he states its conditionality in the category of co-arisen for those feelings.
Phát sinh đồng thời với ý xúc (sahajātamanosamphassasamudayā) – bằng điều này, Ngài nói về tính nhân duyên của nó trong khía cạnh đồng thời của chúng.
98. Cakkhuṃ nissāya uppanno samphasso cakkhusamphasso.
Contact arisen depending on the eye is "eye-contact."
98. Xúc sinh ra nương vào mắt là nhãn xúc.
Pañcavatthukāti cakkhādipañcavatthukā cakkhādipañcavatthusannissayā.
"Having five bases" means having the eye and so on as five bases, having the eye and so on as five supports.
Có năm căn bản (pañcavatthukā) – có năm căn bản như mắt, v.v., nương tựa vào năm căn bản như mắt, v.v..
‘‘Upādinnakakathā esā’’ti bāvīsatiggahaṇaṃ, pavattikathābhāvato lokiyaggahaṇaṃ.
The inclusion of "twenty-two" indicates "this is a statement about clung-to phenomena"; the inclusion of "mundane" indicates it is a statement about the process of existence.
Hai mươi hai (bāvīsati) được lấy vì "đây là lời nói về những gì bị chấp thủ"; thế gian (lokiya) được lấy vì đó là lời nói về sự diễn tiến.
Vipākamanasampayuttaphassāti vipākamanoviññāṇasampayuttā phassā.
"Contacts conjoined with resultant mind" means contacts conjoined with resultant mind-consciousness.
Các xúc tương ưng với ý thức quả dị thục (vipākamanasampayuttaphassā) – các xúc tương ưng với ý thức giới quả dị thục.
Paccayuppannena viya paccayenapi upādinnakeneva bhavitabbanti ‘‘channaṃ cakkhādīnaṃ āyatanāna’’nti vuttaṃ.
Just as the conditioned phenomenon, so too the condition must be clung-to; this is what is meant by "of the six bases of eye and so on."
Như quả dị thục, nhân duyên cũng phải là bị chấp thủ, nên nói "của sáu xứ như mắt, v.v.".
99. Nidassanamattañcetaṃ, tasmā yathā ettha arūpalokāpekkhāya chaṭṭhāyatanañca saḷāyatanañca saḷāyatananti ekaseso icchitabbo, evaṃ yesaṃ paccayuppanno upādinno, paccayo pana anupādinnotipi icchitabbo.
This is merely an illustration; therefore, just as here, with reference to the formless realms, the sixth base and the six bases should be understood as an ekasesa (elliptical compound) meaning "the six bases," so too, for those in whose view the conditioned phenomenon is clung to, but the condition may not be clung to, an ekasesa should be understood in terms of the external bases as well: "the sixth base and the six bases and the six bases and the six bases."
99. Điều này chỉ là một ví dụ; do đó, như ở đây, đối với các cõi vô sắc, xứ thứ sáu và sáu xứ nên được hiểu là một từ còn lại (ekasesa) là sáu xứ, thì cũng vậy, đối với những người mà quả dị thục bị chấp thủ, nhưng nhân duyên có thể không bị chấp thủ, cũng nên được chấp nhận.
Tesaṃ matena bāhirāyatanavasenapi ekaseso veditabbo ‘‘chaṭṭhāyatanañca saḷāyatanañca saḷāyatanañca saḷāyatana’’nti.
Theo quan điểm của họ, sự còn lại của một từ cũng nên được hiểu theo cách xứ ngoại tại: "xứ thứ sáu và sáu xứ và sáu xứ và sáu xứ".
Visuddhimaggopi imassa āgamassa atthasaṃvaṇṇanāti āha ‘‘visuddhimagge…pe… vuttanayamevā’’ti.
Since the Visuddhimagga is an explanation of the meaning of this scripture, he says: "in the Visuddhimagga... and so on... the very method stated."
Thanh Tịnh Đạo (Visuddhimagga) cũng là sự giải thích ý nghĩa của truyền thống này, nên Ngài nói "trong Thanh Tịnh Đạo... v.v... chỉ theo cách đã nói".
Esa nayo aññatthāpi visuddhimaggaggahaṇe.
This method applies elsewhere too when the Visuddhimagga is mentioned.
Cách này cũng áp dụng cho việc đề cập đến Thanh Tịnh Đạo ở những nơi khác.
Upādiyitvāti paccaye katvā.
Upādiyitvā means having made into conditions.
Upādiyitvā (nắm giữ) có nghĩa là biến thành nhân.
Paccayakaraṇameva hi paccayuppannassa paccayabhūtadhammānaṃ upādiyanaṃ.
Indeed, the very act of making conditions for that which has arisen from conditions is the taking up of those phenomena that are conditions.
Vì việc biến thành nhân chính là sự nắm giữ các pháp là nhân của những gì được sinh ra bởi nhân.
Samūhasambandhe sāmivacanaṃ etanti ‘‘samūhatthe etaṃ sāmivacana’’nti vuttaṃ tena vinā sambandhassa abhāvato.
This is the possessive case in the sense of a collection, and thus it is said, "This is the possessive case in the sense of a collection," because without it, connection is absent.
Đây là sở hữu cách trong mối quan hệ tập hợp, như đã nói “đây là sở hữu cách trong ý nghĩa tập hợp” (samūhatthe etaṃ sāmivacanaṃ), vì không có mối quan hệ nếu không có nó.
Tenāti tasmā.
Tena means therefore.
Tenā (do đó) có nghĩa là vì vậy.
Taṃ sabbampīti taṃ bhūtupādāyapabhedaṃ sabbampi sattavīsatividhaṃ.
Taṃ sabbampi means all of that, the twenty-seven kinds, which are differentiated as fundamental elements and derived elements.
Taṃ sabbampī (tất cả những điều đó) là tất cả hai mươi bảy loại được phân loại là vật chất sơ đẳng và vật chất thứ cấp (bhūtupādāya).
Yassa nāmassāti catuvokārabhave nāmassa.
Yassa nāmassā (of which name) refers to the name in the four-constituent existence.
Yassa nāmassā (của danh này) là của danh trong hữu bốn uẩn (catuvokārabhava).
Viññāṇampi tappariyāpannameva veditabbaṃ.
Viññāṇa (consciousness) should also be understood as included within it.
Viññāṇa (thức) cũng phải được hiểu là nằm trong đó.
Rūpassāti ekavokārabhave rūpassa.
Rūpassā (of form) refers to form in the one-constituent existence.
Rūpassā (của sắc) là của sắc trong hữu một uẩn (ekavokārabhava).
Viññāṇaṃ pana pañcavokārabhave saṅkhāraviññāṇameva.
But viññāṇa (consciousness) in the five-constituent existence is just saṅkhāra-viññāṇa (volitional consciousness).
Viññāṇaṃ (thức) trong hữu năm uẩn (pañcavokārabhava) chỉ là hành thức (saṅkhāraviññāṇa) mà thôi.
Yassa pañcavokārabhave nāmarūpassa.
Yassa refers to the name-and-form in the five-constituent existence.
Yassa (của cái nào) là của danh sắc (nāmarūpa) trong hữu năm uẩn.
Tassa vasenāti sahajātassa sahajātādivasena, anantarassa anantarādivasena, itarassa upanissayādivasena tassa nāmassa yathārahaṃ tassa tassa viññāṇassa paccayabhāvo veditabbo.
Tassa vasena (by means of that) means that the conditionality of that name, in the manner appropriate for each consciousness (viññāṇa), should be understood as co-arisen, etc., for the co-arisen; as immediately precedent, etc., for the immediately precedent; and as root-cause, etc., for the others.
Tassa vasenā (theo quyền năng của cái đó) có nghĩa là phải hiểu rằng danh đó là nhân của thức đó một cách tương ứng, theo quyền năng của đồng sinh (sahajāta) v.v., đối với đồng sinh; theo quyền năng của vô gián (anantara) v.v., đối với vô gián; và theo quyền năng của tăng thượng duyên (upanissaya) v.v., đối với cái khác.
101. Tebhūmakavipākaggahaṇe kāraṇaṃ heṭṭhā vuttameva.
The reason for the inclusion of tebhūmaka-vipāka (resultant consciousness of the three planes) has already been stated below.
101. Lý do để nắm giữ quả dị thục ba cõi (tebhūmakavipāka) đã được nói ở dưới.
Saṅkhāro yassa viññāṇassāti ettha aṭṭhavidhopi kāmāvacarapuññābhisaṅkhāro soḷasavidhassa kāmāvacaravipākaviññāṇassa, pañcavidhopi rūpāvacarapuññābhisaṅkhāro pañcavidhassa rūpāvacaravipākaviññāṇassa, dvādasavidhopi apuññābhisaṅkhāro sattavidhassa akusalavipākaviññāṇassa, catubbidhopi āneñjābhisaṅkāro catubbidhassa arūpāvacaravipākaviññāṇassa yathārahaṃ paṭisandhipavattīsu kammapaccayena ceva upanissayapaccayena ca paccayo hoti.
Here, in saṅkhāro yassa viññāṇassa (volitional formation of which consciousness), the eight kinds of meritorious volitional formations of the sense-sphere are conditions, as appropriate, for the sixteen kinds of resultant sense-sphere consciousness; the five kinds of meritorious volitional formations of the fine-material sphere are conditions for the five kinds of resultant fine-material sphere consciousness; the twelve kinds of unmeritorious volitional formations are conditions for the seven kinds of unwholesome resultant consciousness; and the four kinds of imperturbable volitional formations are conditions for the four kinds of resultant immaterial-sphere consciousness, both through karma condition and through root-cause condition, during both rebirth-linking and the process of existence.
Ở đây, saṅkhāro yassa viññāṇassā (hành là nhân của thức nào), tất cả tám loại thiện hành dục giới (kāmāvacarapuññābhisaṅkhāro) là nhân của mười sáu loại quả dị thục dục giới (kāmāvacaravipākaviññāṇa); tất cả năm loại thiện hành sắc giới (rūpāvacarapuññābhisaṅkhāro) là nhân của năm loại quả dị thục sắc giới (rūpāvacaravipākaviññāṇa); tất cả mười hai loại bất thiện hành (apuññābhisaṅkhāro) là nhân của bảy loại quả dị thục bất thiện (akusalavipākaviññāṇa); và tất cả bốn loại bất động hành (āneñjābhisaṅkāro) là nhân của bốn loại quả dị thục vô sắc giới (arūpāvacaravipākaviññāṇa) một cách tương ứng, trong tái tục và trong diễn tiến, bằng nghiệp duyên và tăng thượng duyên.
Ayamettha saṅkhepo, vitthāro pana visuddhimagge (visuddhi. 2.620) vuttanayena veditabbo.
This is the summary here; the detailed explanation should be understood according to the method stated in the Visuddhimagga (Visuddhi. 2.620).
Đây là tóm tắt ở đây, phần chi tiết phải được hiểu theo cách đã nói trong Thanh Tịnh Đạo (Visuddhi. 2.620).
102. Abhisaṅkharaṇalakkhaṇoti abhisañcetayitasabhāvo, āyūhanalakkhaṇoti attho.
Abhisaṅkharaṇalakkhaṇo (characterized by forming) means having the nature of intentionally creating, or the characteristic of accumulating.
102. Abhisaṅkharaṇalakkhaṇo (có đặc tính là tạo tác) có nghĩa là có bản chất là tạo tác, tức là có đặc tính là tích lũy.
Copanavasenāti kāyaviññattisaṅkhātacopanavasena.
Copanavasena (by means of impulsion) refers to the impulsion constituted by bodily intimation.
Copanavasenā (theo quyền năng của sự thúc đẩy) có nghĩa là theo quyền năng của sự thúc đẩy được gọi là thân biểu tri (kāyaviññatti).
Tena pañcadvārikacetanā paṭikkhipati.
This excludes volitions connected with the five sense doors.
Điều đó loại trừ các tư (cetanā) thuộc năm cửa.
Vacanabhedavasenāti vācānicchāraṇavasena.
Vacanabhedavasena (by means of utterance) refers to the emission of speech.
Vacanabhedavasenā (theo quyền năng của sự phân biệt lời nói) có nghĩa là theo quyền năng của sự phát ra lời nói.
Vacīviññattisamuṭṭhāpanavasenāti attho.
It means by means of giving rise to verbal intimation.
Tức là theo quyền năng của việc tạo ra ngữ biểu tri (vacīviññatti).
Yathāvuttā vīsati, nava mahaggatakusalacetanā cāti ekūnatiṃsa manosañcetanā.
The twenty types mentioned above, plus the nine kinds of lofty wholesome volitions, make twenty-nine kinds of mental volitions.
Hai mươi loại đã nói, và chín tư thiện đại hành (mahaggatakusalacetanā) nữa, đó là hai mươi chín ý tư (ekūnatiṃsa manosañcetanā).
‘‘Kusalānaṃ upanissayavasenā’’ti vuttaṃ, ekaccānaṃ ārammaṇavasenapīti vattabbaṃ.
It is said, " through root-cause condition for wholesome actions," and it should also be stated, "for some, through object condition."
Đã nói “theo quyền năng của tăng thượng duyên đối với các thiện pháp” (kusalānaṃ upanissayavasenā), cũng phải nói là theo quyền năng của đối tượng đối với một số.
Sahajātādivasenāti sahajāta-aññamañña-nissaya-sampayutta-atthi-avigatahetuvasena, anantarānaṃ anantarasamanantaraanantarūpanissayanatthivigatāsevanasena paccayo.
Sahajātādivasena (by means of co-arisen, etc.) means through co-arisen, mutual, support, associated, presence, and non-disappearance conditions for causes; and for immediately precedent states, it is a condition through immediate, contiguous, immediately precedent root-cause, absence, disappearance, and repetition conditions.
Sahajātādivasenā (theo quyền năng của đồng sinh v.v.) có nghĩa là nhân theo quyền năng của đồng sinh (sahajāta), hỗ tương (aññamañña), y chỉ (nissaya), tương ưng (sampayutta), hiện hữu (atthi), bất ly (avigatahetu); đối với các pháp vô gián (anantara), là nhân theo quyền năng của vô gián (anantara), đẳng vô gián (samanantara), vô gián tăng thượng duyên (anantarūpanissaya), vô hữu (natthi), ly khứ (vigata), và thường hành (āsevana).
Api-saddena upanissayaṃ saṅgaṇhāti.
The word api (also) includes root-cause condition.
Từ api (cũng) bao gồm tăng thượng duyên (upanissaya).
103. ‘‘Dukkhasacceaññāṇa’’nti saṅkhepato vuttamatthaṃ vivarituṃ ‘‘tatthā’’tiādi āraddhaṃ.
The phrase "tatthā" (therein), etc., is introduced to elaborate on the meaning concisely stated as " ignorance regarding the truth of suffering."
103. Để giải thích ý nghĩa đã nói tóm tắt là “vô minh về Khổ đế” (dukkhasacce aññāṇa), câu “tatthā” (ở đó) v.v. đã được bắt đầu.
Tanti aññāṇaṃ.
Taṃ refers to ignorance.
Taṃ (cái đó) là vô minh.
Satipi pahātabbatte pariññeyyattavasena antogadhaṃ.
Though it ought to be abandoned, it is included by way of being something to be fully understood.
Mặc dù có tính chất phải được đoạn trừ, nhưng nó nằm trong (antogadhaṃ) về mặt phải được liễu tri (pariññeyyatta).
Dukkhasaccañcassāti vatthusaṅkhātaṃ sampayuttakhandhasaṅkhātañca dukkhasaccaṃ assa aññāṇassa.
Dukkhasaccañcassa means the truth of suffering, which is the basis (vatthu) and the associated aggregates, for that ignorance.
Dukkhasaccañcassā (và Khổ đế của nó) là Khổ đế được gọi là đối tượng (vatthusaṅkhātaṃ) và Khổ đế được gọi là các uẩn tương ưng (sampayuttakhandhasaṅkhātañca) của vô minh này.
Taṃ hissa nissayapaccayo hoti.
For that (ignorance), this (suffering) is a support condition.
Vì nó là nhân y chỉ (nissayapaccayo) của vô minh.
Tassāti dukkhasaccassa.
Tassā refers to the truth of suffering.
Tassā (của cái đó) là của Khổ đế.
Yāthāvalakkhaṇapaṭivedhanivāraṇenāti saṅkhataaviparītasabhāvapaṭivijjhanassa nivāraṇena.
Yāthāvalakkhaṇapaṭivedhanivāraṇena (by preventing the penetration of its true characteristic) means by preventing the penetration of its unconditioned and undistorted nature.
Yāthāvalakkhaṇapaṭivedhanivāraṇenā (bằng cách ngăn cản sự thâm nhập vào đặc tính chân thật) có nghĩa là bằng cách ngăn cản sự thâm nhập vào bản chất chân thật của pháp hữu vi (saṅkhataaviparītasabhāva).
Etenassa pariññābhisamayasaṅkhātassa ariyamaggapaṭivedhassa vibandhakabhāvamāha.
By this, it states that ignorance is an impediment to the penetration of the noble path, which is called the comprehension of full understanding.
Điều này nói lên tính chất cản trở của nó đối với sự thâm nhập Thánh đạo (ariyamaggapaṭivedha) được gọi là liễu tri (pariññābhisamaya).
Ñāṇappavattiyāti ‘‘idaṃ dukkhaṃ, ettakaṃ dukkha’’nti anubujjhanākārāya pubbabhāgañāṇappavattiyā.
Ñāṇappavattiyā refers to the arising of preliminary knowledge in the form of understanding, "this is suffering, this much is suffering."
Ñāṇappavattiyā (bằng sự diễn tiến của trí tuệ) có nghĩa là bằng sự diễn tiến của trí tuệ sơ khởi (pubbabhāgañāṇa) theo cách nhận biết rằng “đây là khổ, khổ nhiều đến thế này”.
Etthāti dukkhasacce.
Ettha means in this (truth of suffering).
Etthā (ở đây) là trong Khổ đế.
Appadānenāti avissajjanena.
Appadānenā means by not giving, by not releasing.
Appadānenā (bằng sự không cho phép) có nghĩa là bằng sự không giải thoát.
Etenassā anubodhañāṇassapi vibandhakatamāha.
By this, it states that it is an impediment even to intuitive knowledge.
Điều này cũng nói lên tính chất cản trở của nó đối với trí tuệ nhận biết.
Tīhi kāraṇehi veditabbaṃ antogadhābhāvato.
It is to be understood by three reasons due to its non-inclusion.
Tīhi kāraṇehi veditabbaṃ (phải được hiểu bằng ba lý do) vì không nằm trong.
Idha sampayuttakhandhavaseneva vatthuto samudaye aññāṇaṃ daṭṭhabbaṃ.
Here, ignorance regarding the origin should be seen essentially through the associated aggregates.
Ở đây, vô minh về tập đế phải được thấy về mặt đối tượng (vatthuto) chỉ theo các uẩn tương ưng (sampayuttakhandhavaseneva).
Ekenevāti itaraṃ kāraṇattayaṃ paṭikkhipati.
Ekeneva (by one alone) rejects the other three reasons.
Ekenevā (chỉ bằng một) loại bỏ ba lý do còn lại.
Yadipi aññāṇaṃ nirodhamagge ārammaṇaṃ na karoti, kuto tadantogadhatabbatthutā, te pana jānitukāmassa tappaṭicchādanavasena anirodhamaggesu nirodhamaggaggāhahetutāvasena ca pavattamānaṃ ‘‘nirodhe paṭipadāyañca aññāṇa’’nti vuccati.
Although ignorance does not take cessation and the path as its object (kammaṇa), how can it be included within them or be their basis? But since it operates by concealing them for one who wishes to know them, and by causing one to grasp at non-cessation and non-path instead of cessation and the path, it is called "ignorance regarding cessation and the path."
Mặc dù vô minh không tạo đối tượng cho Diệt đế và Đạo đế, làm sao có thể nói rằng nó nằm trong hoặc là đối tượng của chúng? Tuy nhiên, khi nó diễn tiến bằng cách che đậy chúng đối với người muốn biết chúng, và bằng cách là nguyên nhân của việc nắm giữ Diệt đế và Đạo đế như là không phải Diệt đế và Đạo đế, nó được gọi là “vô minh về Diệt đế và Đạo đế” (nirodhe paṭipadāyañca aññāṇa).
Tenāha ‘‘paṭicchādanato’’tiādi.
Therefore, it is said, " through concealment," etc.
Do đó, Ngài nói “paṭicchādanato” (do sự che đậy) v.v.
Tassattho vuttoyeva.
Its meaning has already been stated.
Ý nghĩa của nó đã được nói rồi.
Gambhīrattāti sabhāveneva gambhīrattā.
Gambhīrattā (due to its profundity) means due to its inherent profundity.
Gambhīrattā (do tính sâu xa) có nghĩa là do bản chất sâu xa.
Agādhaapatiṭṭhābhāvena taṃvisayassa ñāṇassa uppādetuṃ asakkuṇeyyattā duddasaṃ.
It is difficult to see (duddasaṃ) because it is unable to give rise to knowledge regarding its object due to its unfathomable and unsupportable nature.
Do không thể tạo ra trí tuệ đối với đối tượng đó vì không có đáy và không có chỗ dựa, nên nó khó thấy (duddasaṃ).
Purimaṃ pana saccadvayaṃ.
Purimaṃ pana refers to the former two truths.
Hai Thánh đế trước (purimaṃ pana).
Vañcanīyaṭṭhenāti vañcakabhāvena ayāthāvabhāvena upaṭṭhānato duddasattā gambhīraṃ, na sabhāvato, tasmā taṃvisayaṃ aññāṇaṃ uppajjati.
Vañcanīyaṭṭhena (in the sense of being deceptive) means it is profound due to being difficult to see because it appears in a deceptive, unreal way, not inherently so; therefore, ignorance regarding its object arises.
Vañcanīyaṭṭhenā (theo nghĩa lừa dối) có nghĩa là do sự hiện hữu theo tính chất lừa dối, không chân thật, nên nó khó thấy và sâu xa, chứ không phải do bản chất, do đó vô minh đối với đối tượng đó phát sinh.
Tatthāti tasmiṃ purimasaccadvaye aniccādisabhāvalakkhaṇassa duddasattā eva niccādivipallāsavasena pavattati aññāṇanti ānetvā sambandhitabbaṃ.
Tatthā (therein) in those former two truths, it should be connected by inferring that ignorance arises through misconceptions of permanence, etc., due to the difficulty of seeing the characteristics of impermanence, etc.
Tatthā (ở đó) có nghĩa là phải hiểu và liên kết rằng trong hai Thánh đế trước đó, do tính chất khó thấy của đặc tính vô thường v.v., vô minh diễn tiến theo sự điên đảo về thường v.v.
Idāni niddesavibhāgenapi avijjāya saccesu pavattivibhāgaṃ dassetuṃ ‘‘apicā’’tiādi vuttaṃ.
Now, to show the distinctions in the operation of ignorance regarding the truths even through the method of enumeration, the phrase "apicā" (furthermore), etc., is stated.
Bây giờ, để chỉ ra sự diễn tiến của vô minh trong các Thánh đế ngay cả bằng cách phân loại theo sự chỉ định, câu “apicā” (hơn nữa) v.v. đã được nói.
Tattha dukkheti ettakena bhummaniddesena.
Here, dukkhe (in suffering) is by means of locative specification.
Ở đó, dukkhe (trong Khổ) là bằng sự chỉ định trạng thái.
Saṅgahatoti pariññeyyatāya dukkhena saṅgahetabbato.
Saṅgahato (by inclusion) means by being included by suffering as something to be fully understood.
Saṅgahato (do sự bao gồm) có nghĩa là do phải được bao gồm bởi Khổ về mặt phải được liễu tri.
Tena niddhāraṇatthaṃ dasseti.
By this, it shows the meaning of determination.
Điều đó chỉ ra ý nghĩa của sự xác định.
Dukkhasmiñhi avijjā niddhārīyati, na aññasmiṃ.
For ignorance is determined in suffering, not in anything else.
Vì vô minh được xác định trong Khổ, chứ không phải trong cái khác.
Vatthutoti ādhāratthaṃ.
Vatthuto (as its basis) means in the sense of a foundation.
Vatthuto (về mặt đối tượng) là ý nghĩa của sự y chỉ.
Dukkhasannissayā hi avijjā.
For ignorance is dependent on suffering.
Vì vô minh y chỉ vào Khổ.
Ārammaṇatoti visayatthaṃ taṃ ārabbha pavattanato.
Ārammaṇato (as its object) means in the sense of an object, as it operates by taking that as its object.
Ārammaṇato (về mặt đối tượng) là ý nghĩa của đối tượng, vì nó diễn tiến dựa vào đối tượng đó.
Kiccatoti byāpanatthaṃ chādanavasena taṃ byāpetvā pavattanato.
Kiccato (as its function) means in the sense of pervading, as it operates by pervading that (suffering) by way of concealing.
Kiccato (về mặt chức năng) là ý nghĩa của sự bao trùm, vì nó diễn tiến bao trùm đối tượng đó bằng cách che đậy.
Iminā nayena sesesupi attho veditabbo.
By this method, the meaning in the remaining (truths) should also be understood.
Theo cách này, ý nghĩa trong các trường hợp còn lại cũng phải được hiểu.
Avisesatoti visesābhāvato, vuttanayena dukkhādīsu pavattiākāravisesaṃ aggahetvāti attho.
Avisesato (without distinction) means due to the absence of distinction, meaning without distinguishing the particular mode of operation in suffering, etc., in the way stated.
Avisesato (không có sự khác biệt) có nghĩa là không có sự khác biệt, tức là không nắm giữ sự khác biệt trong cách diễn tiến trong Khổ v.v. theo cách đã nói.
Sabhāvatoti sarasalakkhaṇato.
Sabhāvato (by nature) means by its essential characteristic.
Sabhāvato (do bản chất) có nghĩa là do đặc tính riêng của nó.
Catunnampi saccānaṃ ajānanasabhāvā hi avijjā.
For ignorance has the nature of not knowing all four truths.
Vì vô minh có bản chất là không biết cả bốn Thánh đế.
Kāmarāgabhavarāgā kāmāsavabhavāsavāti āha ‘‘sahajātādivasenā’’ti.
Referring to sensual lust and lust for existence as sensual influx and influx of existence, it is said, "sahajātādivasena" (by means of co-arisen, etc.).
Dục ái (kāmarāga) và hữu ái (bhavarāga) là dục lậu (kāmāsava) và hữu lậu (bhavāsava), do đó Ngài nói “sahajātādivasenā” (theo quyền năng của đồng sinh v.v.).
Nanu avijjā eva avijjāsavo, so kathaṃ avijjāya paccayoti āha ‘‘pubbuppannā’’tiādi.
Since ignorance itself is the influx of ignorance, how can it be a condition for ignorance? To this, it is said, "pubbuppannā" (previously arisen), etc.
Vô minh chính là vô minh lậu (avijjāsava), làm sao nó có thể là nhân của vô minh? Ngài nói “pubbuppannā” (đã phát sinh trước) v.v.
104. Āsavavāre āsava-saddattho āsavavicāro ca heṭṭhā vuttoyeva.
In the Āsavavāra (section on influxes), the meaning of the word āsava (influx) and the discussion of āsava have already been stated below.
104. Trong Āsavavāra (Chương Lậu), ý nghĩa của từ āsava và sự khảo sát về āsava đã được nói ở dưới.
Kasmā panāyaṃ vāro vutto, nanu avijjādikāva paṭiccasamuppādadesanāti codanaṃ sandhāya ‘‘ayaṃ vāro’’tiādi āraddhaṃ.
Why is this section stated? Is it not the teaching of dependent origination beginning with ignorance? Addressing this question, the phrase "ayaṃ vāro" (this section), etc., is introduced.
Tại sao chương này lại được nói, phải chăng sự thuyết giảng về Duyên khởi (paṭiccasamuppāda) là về vô minh v.v.? Để giải đáp câu hỏi này, câu “ayaṃ vāro” (chương này) v.v. đã được bắt đầu.
Paṭiccasamuppādapadesūti paṭiccasamuppādakoṭṭhāsesu.
Paṭiccasamuppādapadesu means in the parts of dependent origination.
Paṭiccasamuppādapadesū (trong các phần của Duyên khởi) có nghĩa là trong các bộ phận của Duyên khởi.
Dvādasakoṭṭhāsā hi satthu paṭiccasamuppādadesanā.
Indeed, the Teacher's teaching of dependent origination has twelve factors.
Quả thật, lời dạy về Duyên khởi của Bậc Đạo Sư có mười hai phần.
Tassāpi paccayadassanavasenāti nāyaṃ kāpilānaṃ mūlapakati viya appaccayā, atha kho sappaccayāti avijjāyapi paccayadassanavasena.
The phrase 'by way of showing its condition' means that this* is not unconditioned like the primary nature (mūlapakati) of the Sāṃkhyas, but rather it is conditioned, even ignorance, by way of showing its condition.
“Theo cách thấy nhân duyên của nó” nghĩa là điều này không phải không có nhân duyên như bản chất gốc của trường phái Sāṅkhya (Kapila), mà là có nhân duyên, theo cách thấy nhân duyên của ngay cả vô minh.
Āsavasamudayenāti atītabhave āsavānaṃ samudayena etarahi avijjāya samudayo, etarahi avijjāya samudayena anāgate āsavasamudayoti evaṃ āsavāvijjānaṃ paccayapaccayuppannakabhāvena aparāparaṃ pavattamānaṃ ādikoṭiabhāveneva tannimittassa saṃsārassa ādikoṭiabhāvato anamataggatāsiddhi veditabbā.
The phrase 'with the arising of the influxes' signifies that with the arising of the influxes in a past existence, there is the arising of ignorance in the present; and with the arising of ignorance in the present, there is the arising of the influxes in the future. Thus, by means of the causal and resultative relationship of the influxes and ignorance, which continues ceaselessly, the beginningless nature (anamataggatā) of Saṃsāra, whose cause is these, is to be understood as established due to its beginningless nature.
“Do sự tập khởi của các lậu hoặc” nghĩa là do sự tập khởi của các lậu hoặc trong kiếp quá khứ mà có sự tập khởi của vô minh hiện tại; do sự tập khởi của vô minh hiện tại mà có sự tập khởi của các lậu hoặc trong tương lai. Như vậy, do lậu hoặc và vô minh có trạng thái nhân và quả, tiếp tục diễn ra hết lần này đến lần khác, nên phải biết rằng sự không có điểm khởi đầu của chúng dẫn đến sự không có điểm khởi đầu của vòng luân hồi có dấu hiệu đó (lậu hoặc và vô minh), do đó thành tựu sự vô thỉ (anamatagga).