1. Seyyathidanti taṃ katamaṃ, taṃ kathanti vā attho.
1. Seyyathidaṃ means "which is that?" or "how is that?"
1. Tức là (Seyyathidaṃ) có nghĩa là cái nào, hay nói như thế nào.
Aniyamaniddesavacananti natthi etassa niyamoti aniyamo, niddisīyati attho etenāti niddeso, vuccati etenāti vacanaṃ, niddesoyeva vacanaṃ niddesavacanaṃ, aniyamassa niddesavacanaṃ aniyamaniddesavacanaṃ, paṭhamaṃ aniyamitassa samayassa niddesavacananti attho.
Aniyamaniddesavacana means that which has no determination is aniyama; that by which a meaning is indicated is niddesa; that by which it is spoken is vacana; niddesa itself is vacana, niddesavacana; the indicating word of an undetermination is aniyamaniddesavacana, meaning the indicating word of a initially undetermined occasion.
Lời nói chỉ định không xác định (Aniyamaniddesavacana) có nghĩa là không có sự xác định của nó, đó là aniyama. Niddesa là ý nghĩa được chỉ định bởi điều này, vacana là lời nói bởi điều này. Niddesavacana là lời nói chỉ định, aniyamaniddesavacana là lời nói chỉ định của sự không xác định, tức là lời nói chỉ định của thời điểm ban đầu không được xác định.
‘‘Yenāti avatvā tenāti vuttattā aniyamaṃ katvā niddiṭṭhavacanaṃ aniyamaniddesavacana’’ntipi vadanti.
Some also say, "It is aniyamaniddesavacana, a word indicated with indeterminacy, because it states 'then' without stating 'when'."
Cũng có người nói rằng: “Do không nói ‘yena’ mà nói ‘tena’, nên đó là lời nói chỉ định không xác định.”
Yaṃtaṃsaddānaṃ niccasambandhabhāvato āha ‘‘tassa sarūpena avuttenapī’’tiādi.
Because the words yaṃ and taṃ always have a correlation, it states "even without its form" and so on.
Vì các từ yaṃ và taṃ luôn có mối quan hệ với nhau, nên đã nói “ngay cả khi không được nói bằng hình thức của nó” v.v.
Tattha tassāti ‘‘tenā’’ti etassa.
Here, tassa refers to "tena" (by that).
Trong đó, tassā là của “tena”.
Sarūpena avuttenapīti ‘‘yenā’’ti evaṃ sarūpato pāḷiyaṃ avuttenapi.
Sarūpena avuttenapi means "even if not stated in its literal form in the Pāḷi, such as 'yena' (by which)."
Ngay cả khi không được nói bằng hình thức của nó có nghĩa là ngay cả khi không được nói rõ ràng trong Pāḷi dưới hình thức “yena”.
Atthato siddhenāti parabhāge sāriputtattherassa uppajjanakaparivitakkasaṅkhātaatthato siddhena.
Atthato siddhena means by the meaning established, which is the thought that arose later for the Elder Sāriputta.
Được xác định theo ý nghĩa có nghĩa là được xác định theo ý nghĩa của sự suy tư (parivitakka) phát sinh sau này của Trưởng lão Sāriputta.
Parivitakke hi siddhe yena samayena parivitakko udapādīti idaṃ atthato siddhameva hoti.
For when the thought is established, the statement "at which time the thought arose" is also established by its meaning.
Thật vậy, khi sự suy tư đã được xác định, thì việc “vào thời điểm nào sự suy tư ấy phát sinh” là điều đã được xác định theo ý nghĩa.
Tenevāha ‘‘aparabhāge hi vinayapaññattiyācanahetubhūto āyasmato sāriputtassa parivitakko siddho’’tiādi.
Therefore, it says "for later, the thought of Venerable Sāriputta, which was the cause for requesting the promulgation of the Vinaya, is established" and so on.
Chính vì thế mà đã nói “thật vậy, sau này sự suy tư của Tôn giả Sāriputta, vốn là nguyên nhân của lời thỉnh cầu ban hành giới luật, đã được xác định” v.v.
‘‘Tenā’’ti vatvā tato tadatthameva ‘‘yenā’’ti atthato vuccamānattā ‘‘yenā’’ti ayaṃ ‘‘tenā’’ti etassa paṭiniddeso nāma jāto.
By stating "tena" and then referring to it by meaning as "yena" for the same purpose, "yena" becomes a counter-statement (paṭiniddesa) to "tena."
Khi nói “tena” rồi sau đó nói “yena” theo ý nghĩa của nó, thì “yena” trở thành một sự chỉ định lại (paṭiniddesa) của “tena”.
Paṭiniddesoti ca vitthāraniddesoti attho.
Paṭiniddeso means an elaborate explanation.
Và paṭiniddesa có nghĩa là sự chỉ định chi tiết.
Aparabhāge hīti ettha hi-saddo hetumhi, yasmāti attho.
In Aparabhāge hi, the word hi is in the sense of cause, meaning "because."
Trong Aparabhāge hi, từ hi có nghĩa là lý do, tức là “vì”.
Vinayapaññattiyācanahetubhūtoti ‘‘etassa bhagavā kālo, etassa sugata kālo, yaṃ bhagavā sāvakānaṃ sikkhāpadaṃ paññapeyya, uddiseyya pātimokkhaṃ.
Vinayapaññattiyācanahetubhūto means that which was the cause of the request for the promulgation of the Vinaya, which proceeded thus: "Now is the time, Blessed One! Now is the time, Fortunate One, for the Blessed One to lay down a training rule for the disciples, to recite the Pātimokkha. So that this holy life may endure for a long time, may be long-lasting."
Là nguyên nhân của lời thỉnh cầu ban hành giới luật (Vinayapaññattiyācanahetubhūto) có nghĩa là là nguyên nhân của lời thỉnh cầu ban hành giới luật đã diễn ra như sau: “Bạch Thế Tôn, đã đến lúc, bạch Thiện Thệ, đã đến lúc Thế Tôn nên ban hành giới luật cho các đệ tử, nên đọc Tăng giới (Pātimokkha). Để cho Phạm hạnh này được lâu dài, tồn tại lâu bền.”
Yathayidaṃ brahmacariyaṃ addhaniyaṃ assa ciraṭṭhitika’’nti evaṃ pavattassa vinayapaññattiyācanassa kāraṇabhūtoti attho.
The meaning is that it is the reason for the request for the laying down of the Vinaya, which occurred thus: “so that this holy life may be long-lasting, may endure for a long time.”
.
Parivitakkoti ‘‘katamesānaṃ kho buddhānaṃ bhagavantānaṃ brahmacariyaṃ na ciraṭṭhitikaṃ ahosi, katamesānaṃ buddhānaṃ bhagavantānaṃ brahmacariyaṃ ciraṭṭhitikaṃ ahosī’’ti evaṃ pavatto parivitakko.
Parivitakko (thought) refers to the thought that arose thus: "For which Buddhas, Blessed Ones, was the holy life not long-lasting? For which Buddhas, Blessed Ones, was the holy life long-lasting?"
Sự suy tư (Parivitakko) là sự suy tư đã diễn ra như sau: “Phạm hạnh của những vị Phật, Thế Tôn nào đã không tồn tại lâu dài? Phạm hạnh của những vị Phật, Thế Tôn nào đã tồn tại lâu bền?”
Yaṃtaṃsaddānaṃ niccasambandhoti āha ‘‘tasmā yena samayenā’’tiādi.
Because the words yaṃ and taṃ always have a correlation, it states "tasmā yena samayenā" (therefore, at whatever time) and so on.
Vì các từ yaṃ và taṃ luôn có mối quan hệ với nhau, nên đã nói “do đó, vào thời điểm nào” v.v.
Pubbe vā pacchā vā atthato siddhenāti pubbe vā pacchā vā uppannaatthato siddhena.
Pubbe vā pacchā vā atthato siddhena means by the meaning established, whether it arose before or after.
Được xác định theo ý nghĩa dù trước hay sau có nghĩa là được xác định theo ý nghĩa đã phát sinh dù trước hay sau.
Paṭiniddeso kattabboti etassa ‘‘yadida’’nti iminā sambandho.
Paṭiniddeso kattabbo is connected to "yadidaṃ."
Cần phải thực hiện sự chỉ định lại (Paṭiniddeso kattabbo) có liên hệ với “yadidaṃ” này.
‘‘Paṭiniddeso kattabbo’’ti yadidaṃ yaṃ idaṃ vidhānaṃ, ayaṃ sabbasmiṃ vinaye yuttīti attho.
"Paṭiniddeso kattabbo yadidaṃ" means "this regulation, which is to make a counter-statement, is appropriate in the entire Vinaya."
“Cần phải thực hiện sự chỉ định lại” tức là điều này, quy tắc này, là sự hợp lý trong toàn bộ Luật.
Atha vā ‘‘paṭiniddeso kattabbo’’ti yadidaṃ yā ayaṃ yutti, ayaṃ sabbasmiṃ vinaye yuttīti attho.
Alternatively, "Paṭiniddeso kattabbo" (a counter-statement should be made) means "this method is appropriate in the entire Vinaya."
Hoặc là, “cần phải thực hiện sự chỉ định lại” tức là điều này, sự hợp lý này, là sự hợp lý trong toàn bộ Luật.
Tatridaṃ mukhamattanidassananti tassā yathāvuttayuttiyā paridīpane idaṃ mukhamattanidassanaṃ, upāyamattanidassananti attho.
Tatridaṃ mukhamattanidassanaṃ (Herein this is merely an example) means this is merely an example, merely a means of elucidation, for clarifying the method explained.
Ở đây, đây là một ví dụ ban đầu (Tatridaṃ mukhamattanidassanaṃ) có nghĩa là đây là một ví dụ ban đầu, một ví dụ về phương pháp để làm sáng tỏ sự hợp lý đã nói ở trên.
Mukhaṃ dvāraṃ upāyoti hi atthato ekaṃ.
For 'mukha' (mouth), 'dvāra' (door), and 'upāya' (means) are essentially one in meaning.
Thật vậy, mukha (cửa), dvāra (cổng), upāya (phương pháp) có cùng ý nghĩa.
‘‘Tena hi bhikkhave bhikkhūnaṃ sikkhāpadaṃ paññapessāmī’’ti pāḷiṃ dassetvā tattha paṭiniddesamāha ‘‘yena sudinno’’tiādinā.
By showing the Pāḷi text "Tena hi bhikkhave bhikkhūnaṃ sikkhāpadaṃ paññapessāmī" (Therefore, bhikkhus, I will lay down a training rule for the bhikkhus), a counter-statement is given there with "yena sudinno" (by which Sudinna) and so on.
Sau khi chỉ ra đoạn Pāḷi “Thế thì này các Tỳ-khưu, Ta sẽ ban hành giới luật cho các Tỳ-khưu”, đã nói về sự chỉ định lại ở đó bằng “yena Sudinno” v.v.
Tenāti hetuatthe karaṇavacanattā tassa paṭiniddesopi tādisoyevāti āha ‘‘yasmā paṭisevī’’ti.
Since "tena" is in the instrumental case with the meaning of cause, its counter-statement is also of that kind, as it states "yasmā paṭisevī" (because he engaged in).
Vì tena là từ chỉ nguyên nhân trong ý nghĩa nguyên nhân, nên sự chỉ định lại của nó cũng tương tự, do đó đã nói “yasmā paṭisevī” (vì đã thực hành).
Pubbe atthato siddhenāti pubbe uppannamethunadhammapaṭisevanasaṅkhātaatthato siddhena.
Pubbe atthato siddhena means by the meaning established, which is the engagement in sexual intercourse that occurred previously.
Được xác định theo ý nghĩa đã có trước có nghĩa là được xác định theo ý nghĩa đã phát sinh trước đó, tức là sự thực hành pháp dâm dục.
Pacchā atthato siddhenāti raññā adinnaṃ dārūnaṃ ādiyanasaṅkhātapacchāuppannaatthato siddhena.
Pacchā atthato siddhena means by the meaning established, which is the taking of wood not given by the king, that occurred later.
Được xác định theo ý nghĩa đã có sau có nghĩa là được xác định theo ý nghĩa đã phát sinh sau đó, tức là việc lấy gỗ không được vua ban cho.
Samayasaddoti etassa ‘‘dissatī’’ti iminā sambandho.
Samayasaddo (the word 'samaya') is connected with "dissatī" (is seen).
Từ samayasaddo (từ ‘samaya’) có liên hệ với “dissatī” (được thấy) này.
Samavāyeti paccayasāmaggiyaṃ, kāraṇasamavāyeti attho.
Samavāye means in the assemblage of conditions, meaning in the convergence of causes.
Trong sự hội tụ (Samavāye) có nghĩa là trong sự hội tụ của các nhân duyên, tức là trong sự hội tụ của các nguyên nhân.
Khaṇeti okāse.
Khaṇe means in an opportunity.
Vào thời điểm (Khaṇe) có nghĩa là vào cơ hội.
Assāti assa samayasaddassa samavāyo atthoti sambandho.
Assā (of that) means the word 'samaya' has the meaning of 'samavāya'.
Của nó (Assā) có nghĩa là từ samaya ấy có ý nghĩa là sự hội tụ.
Appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyāti ettha kālo nāma upasaṅkamanassa yuttapayuttakālo.
In Appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā (Perhaps tomorrow too we may approach, taking into account the time and the occasion), kāla means the appropriate and inappropriate time for approaching.
Trong câu “ Appeva nāma svepi upasaṅkameyyāma kālañca samayañca upādāyā” (có lẽ ngày mai chúng ta sẽ đến, tùy thuộc vào thời gian và cơ hội), kāla (thời gian) là thời gian thích hợp hay không thích hợp để đến.
Samayo nāma tasseva paccayasāmaggī, atthato tadanurūpaṃ sarīrabalañceva tappaccayaparissayābhāvo ca.
Samaya means the assemblage of conditions for that very purpose, meaning, in effect, the strength of body corresponding to it and the absence of obstacles related to that.
Samaya (cơ hội) là sự hội tụ của các nhân duyên cho việc đó, theo ý nghĩa là sức mạnh cơ thể phù hợp và sự không có chướng ngại do nhân duyên ấy.
Upādānaṃ nāma ñāṇena tesaṃ gahaṇaṃ sallakkhaṇaṃ, tasmā kālañca samayañca paññāya gahetvā upadhāretvāti attho.
Upādāna means the grasping and discerning of them with wisdom, therefore it means having taken and considered the time and the occasion with wisdom.
Upādānaṃ (sự chấp thủ) là sự nắm giữ, sự nhận biết chúng bằng trí tuệ. Do đó, có nghĩa là nắm giữ và quán xét thời gian và cơ hội bằng trí tuệ.
Idaṃ vuttaṃ hoti – sace amhākaṃ sve gamanassa yuttakālo bhavissati, kāye balamattā ceva pharissati, gamanapaccayā ca añño aphāsuvihāro na bhavissati, athetaṃ kālañca gamanakāraṇasamavāyasaṅkhātaṃ samayañca upadhāretvā api eva nāma sve āgaccheyyāmāti.
This is what is said: "If tomorrow will be an appropriate time for our departure, and we will have sufficient bodily strength, and no other discomforts due to the journey will arise, then, having considered that time and the occasion, which is the assemblage of conditions for departure, perhaps we may come tomorrow."
Điều này có nghĩa là: nếu ngày mai là thời gian thích hợp để chúng ta đi, và chúng ta có đủ sức mạnh cơ thể, và không có chướng ngại nào khác do việc đi lại, thì sau khi quán xét thời gian và cơ hội được gọi là sự hội tụ của các nguyên nhân cho việc đi lại, có lẽ ngày mai chúng ta sẽ đến.
Khaṇoti okāso.
Khaṇo means opportunity.
Khaṇo (thời điểm) có nghĩa là cơ hội.
Tathāgatuppādādiko hi maggabrahmacariyassa okāso tappaccayapaṭilābhahetuttā, khaṇo eva ca samayo.
The arising of a Tathāgata and so forth is indeed an opportunity for the path of spiritual practice, as it is the cause for obtaining its requisites, and a moment is indeed a season.
Quả thật, sự xuất hiện của Đức Như Lai, v.v., là cơ hội cho phạm hạnh (con đường), vì đó là nguyên nhân đạt được các duyên ấy; và khaṇa (khoảnh khắc) chính là samaya (thời điểm).
Yo khaṇoti ca samayoti ca vuccati, so ekovāti hi attho.
That which is called a 'moment' and a 'season' is indeed one and the same in meaning.
Quả thật, cái được gọi là khaṇa và samaya chỉ là một nghĩa.
Mahāsamayoti mahāsamūho.
Mahāsamaya means a great assembly.
Mahāsamaya nghĩa là một tập hợp lớn.
Pavuddhaṃ vanaṃ pavanaṃ, tasmiṃ pavanasmiṃ, vanasaṇḍeti attho.
A dense forest is pavana. In that pavana, it means a thicket of trees.
Rừng rậm rạp là pavana, trong pavana ấy, nghĩa là một khu rừng.
Samayopi kho te bhaddāli appaṭividdho ahosīti ettha samayoti sikkhāpadapūraṇassa hetu.
Here, in "O Bhaddālī, the occasion was indeed not penetrated by you," samayo means the cause for fulfilling the training rule.
Trong câu “Này Bhaddāli, thời điểm (samaya) ấy cũng không được ngươi thấu hiểu”, ở đây samaya nghĩa là nguyên nhân để hoàn thành giới luật.
Bhaddālīti tassa bhikkhuno nāmaṃ.
Bhaddālī is the name of that bhikkhu.
Bhaddāli là tên của vị Tỳ khưu ấy.
Idaṃ vuttaṃ hoti – bhaddāli tayā paṭivijjhitabbayuttakaṃ etaṃ kāraṇaṃ atthi, tampi te na paṭividdhaṃ na sallakkhitanti.
This is what is said: "Bhaddālī, there is this matter that should have been penetrated by you, but even that was not penetrated, not noticed by you."
Điều này có nghĩa là – Này Bhaddāli, có một sự việc này đáng lẽ ngươi phải thấu hiểu, nhưng sự việc ấy cũng không được ngươi thấu hiểu, không được ngươi ghi nhận.
Kiṃ taṃ kāraṇanti āha ‘‘bhagavā kho’’tiādi.
What is that matter? He states, "the Blessed One indeed," and so on.
Sự việc ấy là gì? Ngài nói “Đức Thế Tôn quả thật…” v.v.
Uggāhamāno tiādīsu mānoti tassa paribbājakassa pakatināmaṃ, kiñci kiñci pana uggahetuṃ samatthatāya ‘‘uggāhamāno’’ti naṃ sañjānanti, tasmā ‘‘uggāhamāno’’ti vuccati.
In Uggāhamāno and so forth, Māno is the natural name of that wanderer; however, they recognize him as "Uggāhamāno" because of his ability to grasp various things, therefore he is called "Uggāhamāno."
Trong các từ Uggāhamāno v.v., Māno là tên tự nhiên của vị du sĩ ấy, nhưng vì có khả năng nắm bắt được một điều gì đó nên người ta gọi ông là “Uggāhamāno”, do đó ông được gọi là “Uggāhamāno”.
Samaṇamuṇḍikāya putto samaṇamuṇḍikāputto.
The son of a female ascetic is Samaṇamuṇḍikāputto.
Con trai của nữ Sa-môn đầu trọc là Samaṇamuṇḍikāputto.
So kira devadattassa upaṭṭhāko.
He, it is said, was Devadatta's attendant.
Người ấy được biết là người hầu cận của Devadatta.
Samayaṃ diṭṭhiṃ pavadanti etthāti samayappavādako, tasmiṃ samayappavādake, diṭṭhippavādaketi attho.
They proclaim their views here, hence samayappavādako, meaning a proclaimer of views, in that samayappavādaka.
Nơi mà người ta tuyên bố các quan điểm (samaya) thì gọi là samayappavādako, trong samayappavādako ấy, nghĩa là nơi tuyên bố các quan điểm.
Tasmiṃ kira ṭhāne caṅkītārukkhapokkharasātipabhutayo brāhmaṇā nigaṇṭhācelakaparibbājakādayo ca paribbājakā sannipatitvā attano attano samayaṃ diṭṭhiṃ pavadanti kathenti dīpenti, tasmā so ārāmo ‘‘samayappavādako’’ti vuccati, sveva tindukācīrasaṅkhātāya timbarurukkhapantiyā parikkhittattā ‘‘tindukācīra’’nti vuccati.
It is said that in that place, Brahmins like Caṅkī, Tārukkhapokkharasāti, and wanderers like Nigaṇṭhas and Acelakas, would gather and proclaim, express, and elucidate their respective views (samayaṃ diṭṭhiṃ). Therefore, that park is called "samayappavādako." Since it is encircled by a row of Tinduka trees, also known as Timbaruru trees, it is called "Tindukācīra."
Được biết, tại nơi ấy, các Bà-la-môn như Caṅkī, Tārukkhapokkharasāti, v.v., và các du sĩ như Ni-kiền-tử, Acelaka, v.v., tập hợp lại để tuyên bố, trình bày, và giải thích các quan điểm (samaya) của riêng mình; do đó, khu vườn ấy được gọi là “samayappavādako”, và vì nó được bao quanh bởi một hàng cây timbaru gọi là tindukācīra nên nó được gọi là “tindukācīra”.
Ekā sālā etthāti ekasālako.
There is one hall here, hence ekasālako.
Nơi có một hội trường thì gọi là ekasālako.
Yasmā panettha paṭhamaṃ ekā sālā katā ahosi, pacchā mahāpuññaṃ poṭṭhapādaparibbājakaṃ nissāya bahū sālā katā, tasmā tameva ekaṃ sālamupādāya laddhanāmavasena ‘‘ekasālako’’ti vuccati.
Because initially there was only one hall built there, and later, due to the greatly meritorious wanderer Poṭṭhapāda, many halls were built, it is called "Ekasālako" by virtue of retaining the name from that single hall.
Vì ban đầu chỉ có một hội trường được xây dựng ở đó, sau này nhờ có vị du sĩ Poṭṭhapāda đầy phước đức mà nhiều hội trường đã được xây dựng, do đó, chỉ dựa vào hội trường duy nhất ấy mà nó được gọi là “ekasālako” theo tên đã đặt.
Mallikāya pana pasenadirañño deviyā uyyānabhūto so pupphaphalasañchanno ārāmoti katvā ‘‘mallikāya ārāmo’’ti saṅkhyaṃ gato.
However, since it was the pleasure park of Queen Mallikā, King Pasenadi's queen, a park adorned with flowers and fruits, it became known as "Mallikāya Ārāmo."
Còn khu vườn ấy, vì là một khu vườn đầy hoa quả của hoàng hậu Mallikā, vợ của vua Pasenadi, nên đã được biết đến với tên gọi “khu vườn của Mallikā”.
Tasmiṃ samayappavādake tindukācīre ekasālake mallikāya ārāme.
In that Samayappavādaka, Tindukācīra, Ekasālaka, Mallikā's Park.
Trong khu vườn của Mallikā, nơi có một hội trường duy nhất, tại tindukācīra, nơi tuyên bố các quan điểm.
Paṭivasatīti tasmiṃ vāsaphāsutāya vasati.
Resides means he dwells there because of the comfort of dwelling.
Paṭivasatī nghĩa là trú ngụ ở đó vì sự thuận tiện về chỗ ở.
Diṭṭhe dhammeti paccakkhe attabhāve.
In this very life means in the present existence.
Diṭṭhe dhamme nghĩa là trong đời sống hiện tại.
Atthoti vuḍḍhi.
Benefit means prosperity.
Attho nghĩa là sự tăng trưởng, lợi ích.
Samparāyikoti kammakilesavasena samparetabbato sampāpuṇitabbato samparāyo, paraloko.
Pertaining to the next world means samparāya, the next world, because one is to be associated with or attained there by way of kamma and defilements.
Samparāyiko nghĩa là samparāya (đời sau), vì phải được đạt đến, phải được tiếp cận theo nghiệp và phiền não.
Tattha niyutto samparāyiko, paralokattho.
That which is dedicated to it is samparāyika, the benefit of the next world.
Cái liên quan đến đó là samparāyiko, lợi ích đời sau.
Atthābhisamayāti yathāvuttaubhayatthasaṅkhātahitapaṭilābhā.
Through the penetration of benefit means the acquisition of benefit, referring to the aforementioned twofold benefit.
Atthābhisamayā nghĩa là sự đạt được lợi ích, tức là cả hai lợi ích đã nói ở trên.
Samparāyikopi hi attho kāraṇassa nipphannattā paṭiladdho nāma hotīti tamatthadvayaṃ ekato katvā ‘‘atthābhisamayā’’ti vuttaṃ.
Indeed, the benefit pertaining to the next world is also said to be acquired because the cause has been accomplished; thus, combining these two benefits, it is stated as "atthābhisamayā."
Quả thật, lợi ích đời sau cũng được coi là đã đạt được vì nguyên nhân đã hoàn thành, và hai lợi ích ấy được gộp lại thành “atthābhisamayā”.
Dhiyā paññāya rāti gaṇhātīti dhīro.
He grasps with wisdom (dhiyā paññāya rāti), hence dhīro.
Người dùng trí tuệ để nắm bắt thì gọi là dhīro.
Atha vā dhī paññā etassa atthīti dhīro.
Or, he possesses wisdom (dhī paññā etassa atthīti), hence dhīro.
Hoặc, người có trí tuệ thì gọi là dhīro.
Sammā mānābhisamayāti mānassa sammā pahānena.
Through the right penetration of conceit means through the right abandoning of conceit.
Sammā mānābhisamayā nghĩa là sự đoạn trừ kiêu mạn một cách đúng đắn.
Sammāti iminā mānassa aggamaggañāṇena samucchedappahānaṃ vuttaṃ.
By "rightly," the utter eradication of conceit by the knowledge of the highest path is expressed.
Với từ sammā này, sự đoạn trừ tận gốc kiêu mạn bằng trí tuệ đạo tối thượng được nói đến.
Dukkhassa pīḷanaṭṭhotiādīsu dukkhasaccassa pīḷanaṃ taṃsamaṅgino hiṃsanaṃ avipphārikatākaraṇaṃ, pīḷanameva attho pīḷanaṭṭho, tthakārassa ṭṭhakāraṃ katvā vuttaṃ.
In the meaning of oppression of suffering and so forth, "oppression of the truth of suffering" means harming the one endowed with it, making it unexpandable; "oppression" itself is the meaning, "oppression-meaning" (pīḷanaṭṭho), stated by changing 'ttha' to 'ṭṭha'.
Trong các từ Dukkhassa pīḷanaṭṭho v.v., sự áp bức (pīḷana) của Khổ đế là sự tổn hại đối với người có Khổ đế, sự không làm cho nó lan rộng; pīḷana chính là nghĩa pīḷanaṭṭho, được nói bằng cách biến tthakāra thành ṭṭhakāra.
Evaṃ sesesupi.
Thus, in all remaining cases as well.
Cũng vậy đối với các từ còn lại.
Samecca paccayehi katabhāvo saṅkhataṭṭho.
The state of being made up of conditions, having come together, is saṅkhataṭṭho.
Trạng thái được tạo ra bởi sự kết hợp với các duyên là saṅkhataṭṭho.
Santāpo dukkhadukkhatādivasena santāpanaṃ paridahanaṃ.
Torment is burning up, consuming, due to the suffering of suffering and so forth.
Santāpo là sự nung đốt, sự thiêu đốt theo nghĩa khổ khổ, v.v.
Vipariṇāmo jarāya maraṇena cāti dvidhā vipariṇāmetabbatā.
Changeability is the state of being subject to change in two ways: through old age and through death.
Vipariṇāmo là sự biến đổi hai mặt: bởi già và bởi chết.
Abhisametabbo paṭivijjhitabboti abhisamayo, abhisamayova attho abhisamayaṭṭho, pīḷanādīni.
That which is to be penetrated, to be comprehended, is abhisamaya. Abhisamaya itself is the meaning, abhisamayaṭṭho, referring to oppression and so forth.
Cái cần được thấu hiểu, cần được xuyên thấu là abhisamayo, abhisamayo chính là nghĩa abhisamayaṭṭho, tức là sự áp bức (pīḷana), v.v.
Tāni hi abhisametabbabhāvena ekībhāvaṃ upanetvā ‘‘abhisamayaṭṭho’’ti vuttāni, abhisamayassa vā paṭivedhassa visayabhūto attho abhisamayaṭṭhoti tāneva pīḷanādīni abhisamayassa visayabhāvūpagamanasāmaññato ekattena vuttāni.
These indeed, having been brought to a state of unity by their penetrability, are called "abhisamayaṭṭho." Or, the meaning that is the object of abhisamaya (penetration) or paṭivedha (realization) is "abhisamayaṭṭho"; these same oppressions and so forth are stated as one due to their common characteristic of becoming objects of abhisamaya.
Quả thật, những điều ấy được nói là “abhisamayaṭṭho” bằng cách hợp nhất chúng thành một trạng thái cần được thấu hiểu, hoặc nghĩa là đối tượng của sự thấu hiểu (paṭivedha) là abhisamayaṭṭho, tức là những điều áp bức (pīḷana) ấy được nói là một vì có sự chung tính là trở thành đối tượng của sự thấu hiểu.
Ettha ca upasaggānaṃ jotakamattattā tassa tassa atthassa vācako samayasaddo evāti samayasaddassa atthuddhārepi saupasaggo abhisamayasaddo vutto.
Here, since the prefixes merely indicate, the word samaya itself is the expresser of that particular meaning; thus, even in explaining the meaning of the word samaya, the word abhisamaya with its prefix is mentioned.
Ở đây, vì các tiền tố chỉ là để làm rõ, từ samaya là từ nói lên ý nghĩa của từng điều ấy, nên trong phần giải thích nghĩa của từ samaya, từ abhisamaya có tiền tố cũng được nói đến.
Tattha sahakārīkāraṇasannijjhaṃ sameti samavetīti samayo, samavāyo.
There, it comes together, it coalesces, a co-operative cause's coming to fruition, hence samayo, an assemblage.
Ở đó, cái hòa hợp, cái kết hợp với sự hoàn thành của các nguyên nhân hỗ trợ là samayo, sự kết hợp.
Sameti samāgacchati maggabrahmacariyaṃ ettha tadādhārapuggalehīti samayo, khaṇo.
The path of spiritual practice comes together, it assembles here, in the persons who are its basis, hence samayo, a moment.
Cái mà phạm hạnh (con đường) hòa hợp, tụ hội ở đó bởi những người làm nền tảng cho nó là samayo, khoảnh khắc.
Samenti ettha, etena vā saṃgacchanti dhammā sahajātadhammehi uppādādīhi vāti samayo, kālo.
The phenomena meet here, or through this, they come together with co-arisen phenomena like arising and so forth, hence samayo, time.
Cái mà các pháp hòa hợp ở đó, hoặc các pháp hòa hợp với nó bởi các pháp đồng sinh như sự sinh khởi, v.v., là samayo, thời gian.
Dhammappavattimattatāya atthato abhūtopi hi kālo dhammappavattiyā adhikaraṇaṃ kāraṇaṃ viya ca parikappanāmattasiddhena rūpena voharīyati.
Indeed, time, though unreal in essence due to being merely the occurrence of phenomena, is designated by a form established by mere conceptualization as if it were the locus or cause of the occurrence of phenomena.
Quả thật, thời gian, dù không có thật về bản chất vì chỉ là sự vận hành của các pháp, nhưng được gọi bằng hình thức chỉ tồn tại do sự quy ước, như là nền tảng và nguyên nhân của sự vận hành của các pháp.
Samaṃ, saha vā avayavānaṃ ayanaṃ pavatti avaṭṭhānanti samayo, samūho yathā ‘‘samudāyo’’ti.
The equal or simultaneous going, occurrence, or abiding of constituent parts is samayo, an assembly, like "samudāyo."
Sự vận hành, sự tồn tại của các bộ phận một cách bình đẳng, hoặc cùng nhau là samayo, tập hợp, như trong “samudāyo”.
Avayavena sahāvaṭṭhānameva hi samūho.
Indeed, an assembly is precisely the abiding together of constituent parts.
Quả thật, sự tồn tại cùng với các bộ phận chính là tập hợp.
Paccayantarasamāgame eti phalaṃ etasmā uppajjati pavattati cāti samayo, hetu yathā ‘‘samudayo’’ti.
From which, upon the coming together of other conditions, a result comes forth and arises, hence samayo, a cause, like "samudayo."
Cái mà từ đó quả sinh ra và vận hành khi các duyên khác kết hợp là samayo, nguyên nhân, như trong “samudayo”.
Sameti saṃyojanabhāvato sambandho eti attano visaye pavattati, daḷhaggahaṇabhāvato vā taṃsaṃyuttā ayanti pavattanti sattā yathābhinivesaṃ etenāti samayo, diṭṭhi.
It comes together, or by way of its being a fetter, it proceeds within its sphere, or by way of its strong grasp, beings proceed and act according to their inclinations through this, hence samayo, a view.
Cái mà sự kết nối, sự ràng buộc vận hành trong lĩnh vực của chính nó, hoặc cái mà chúng sinh đi đến, vận hành theo sự chấp thủ của mình bởi sự chấp thủ kiên cố là samayo, quan điểm.
Diṭṭhisaṃyojanena hi sattā ativiya bajjhanti.
Indeed, beings are excessively bound by the fetter of views.
Quả thật, chúng sinh bị ràng buộc rất chặt bởi sự trói buộc của các quan điểm.
Samiti saṅgati samodhānanti samayo, paṭilābho.
It is an encounter, a coming together, a combination, hence samayo, an acquisition.
Sự hội tụ, sự kết hợp là samayo, sự đạt được.
Samassa nirodhassa yānaṃ, sammā vā yānaṃ apagamo appavattīti samayo, pahānaṃ.
The going to the cessation of equality, or the right going, the vanishing, the non-arising, hence samayo, abandonment.
Sự đi đến sự đoạn trừ, hoặc sự đi đến một cách đúng đắn, sự tiêu diệt, sự không vận hành là samayo, sự đoạn trừ.
Ñāṇena abhimukhaṃ sammā etabbo adhigantabboti abhisamayo, dhammānaṃ aviparīto sabhāvo.
That which is to be approached rightly, to be attained face-to-face with knowledge, is abhisamayo, the unperverted true nature of phenomena.
Cái cần được đạt đến, cần được thấu hiểu một cách đúng đắn bằng trí tuệ là abhisamayo, bản chất không sai lạc của các pháp.
Abhimukhabhāvena sammā eti gacchati bujjhatīti abhisamayo, dhammānaṃ yathābhūtasabhāvāvabodho.
He rightly approaches, goes, and understands face-to-face, hence abhisamayo, the comprehension of the true nature of phenomena as it is.
Cái đi đến, hiểu biết một cách đúng đắn theo nghĩa đối diện là abhisamayo, sự thấu hiểu bản chất chân thật của các pháp.
Evaṃ tasmiṃ tasmiṃ atthe samayasaddassa pavatti veditabbā.
Thus, the occurrence of the word samaya in these various meanings should be understood.
Như vậy, cần phải biết sự vận hành của từ samaya trong từng nghĩa ấy.
Nanu ca atthamattaṃ paṭicca saddā abhinivisanti, na ekena saddena aneke atthā abhidhīyantīti?
Do not words indeed attach themselves to the meaning alone, and not that many meanings are expressed by one word?
Chẳng phải các từ chỉ gắn liền với một nghĩa, chứ không phải một từ có thể biểu thị nhiều nghĩa sao?
Saccametaṃ saddavisese apekkhite.
This is true when a specific word is expected.
Điều này đúng khi xét đến một từ cụ thể.
Saddavisese hi apekkhiyamāne ekena saddena anekatthābhidhānaṃ na sambhavati.
When a specific word is expected, the expression of many meanings by one word is not possible.
Quả thật, khi xét đến một từ cụ thể, việc một từ biểu thị nhiều nghĩa là không thể.
Na hi yo kālattho samayasaddo, soyeva samūhādiatthaṃ vadati.
For the word samaya that means 'time' is not the same that expresses the meaning of 'assembly' and so forth.
Quả thật, từ samaya có nghĩa là thời gian không phải là từ nói lên nghĩa tập hợp, v.v.
Ettha pana tesaṃ tesaṃ atthānaṃ samayasaddavacanīyatāsāmaññamupādāya anekatthatā samayasaddassa vuttā.
Here, however, the many meanings of the word samaya are stated by taking the commonality of the word samaya being capable of expressing those respective meanings.
Tuy nhiên, ở đây, sự đa nghĩa của từ samaya được nói đến dựa trên sự chung tính của từ samaya trong việc biểu thị các nghĩa khác nhau.
Evaṃ sabbattha atthuddhāre adhippāyo veditabbo.
Thus, the intention in all explanations of meanings should be understood.
Như vậy, cần phải hiểu ý nghĩa trong tất cả các phần giải thích nghĩa.
Idha panassa kālo atthoti assa samayasaddassa idha kālo attho samavāyādīnaṃ atthānaṃ idha asambhavato desadesakādīnaṃ viya nidānabhāvena kālassa apadisitabbato ca.
Here, however, its meaning is time—that is, the meaning of this word samaya here is 'time'—because meanings such as 'assemblage' are not possible here, and because time is to be indicated as a cause, like for particular places and periods.
Tuy nhiên, ở đây, nghĩa của nó là thời gian, vì ở đây, kāla (thời gian) là nghĩa của từ samaya này, do các nghĩa như samavāya (sự kết hợp), v.v., không khả thi ở đây, và do thời gian cần được chỉ ra như là nguyên nhân, giống như các nơi chốn, v.v.
Upayogavacanena bhummavacanena ca niddesamakatvā idha karaṇavacanena niddese payojanaṃ niddhāretukāmo parammukhena codanaṃ samuṭṭhāpeti ‘‘etthāhā’’tiādi.
Wishing to determine the purpose of stating the direction with the instrumental case instead of the locative or accusative cases, he raises an objection from an external perspective, saying, "Here he says," and so on.
Muốn xác định mục đích của việc trình bày bằng cách dùng cách nói công cụ thay vì cách nói thuộc ngữ và cách nói xứ ngữ, ngài đặt ra một câu hỏi theo cách gián tiếp: “Etthāhā” v.v.
Ettha ‘‘tena samayenā’’ti imasmiṃ ṭhāne vitaṇḍavādī āhāti attho.
Here, the meaning is that a sophist says "tena samayena" in this passage.
Ở đây, ý nghĩa là người tranh luận nói rằng: “vào thời điểm đó” tại chỗ này.
Athāti codanāya kattukāmataṃ dīpeti, nanūti iminā samānattho.
Atha indicates the desire to raise an objection; it has the same meaning as "nanu".
Và rồi biểu lộ ý muốn chất vấn, đồng nghĩa với “chẳng phải sao”.
Kasmā karaṇavacanena niddeso katoti sambandho.
The connection is: "Why is the designation made with the instrumental case?"
Mối liên hệ là tại sao đã trình bày bằng cách dùng cách thức ngữ.
Bhummavacanena niddeso katoti yojetabbaṃ.
It should be construed that the designation is made with the locative case.
Nên được kết nối là đã trình bày bằng cách dùng vị trí ngữ.
Etthāpi ‘‘yathā’’ti idaṃ ānetvā sambandhitabbaṃ.
Even here, "yathā" should be brought in and connected.
Ở đây cũng vậy, nên mang từ “như thế nào” (yathā) đến và kết nối.
Tatthāti tesu suttābhidhammesu.
There means in those Suttas and Abhidhamma texts.
Ở đó là trong những kinh và Abhidhamma đó.
Tathāti upayogabhummavacanehi.
Thus means with the instrumental and locative cases.
Như thế là bằng cách dùng nghiệp dụng ngữ và vị trí ngữ.
Idhāti imasmiṃ vinaye.
Here means in this Vinaya.
Ở đây là trong giới luật này.
Aññathāti karaṇavacanena.
Otherwise means with the instrumental case.
Khác là bằng cách dùng cách thức ngữ.
Accantamevāti ārambhato paṭṭhāya yāva desanāniṭṭhānaṃ, tāva accantameva, nirantaramevāti attho.
Accantamevā means from the beginning up to the completion of the teaching, it is entirely, continuously.
Hoàn toàn là từ lúc bắt đầu cho đến khi hoàn tất sự thuyết giảng, là hoàn toàn, là liên tục, là ý nghĩa.
Karuṇāvihārenāti parahitapaṭipattisaṅkhātena karuṇāvihārena.
With an abiding in compassion means with an abiding in compassion, which consists of practice for the welfare of others.
Bằng sự an trú từ bi là bằng sự an trú từ bi được gọi là sự thực hành lợi ích cho người khác.
Tathā hi karuṇānidānattā desanāya idha parahitapaṭipatti ‘‘karuṇāvihāro’’ti vuttā, na pana karuṇāsamaāpattivihāro.
Indeed, because the teaching is rooted in compassion, here the practice for the welfare of others is called "karuṇāvihāra", not an abiding in the attainment of compassion.
Thật vậy, vì sự thuyết giảng có nguồn gốc từ từ bi, nên ở đây sự thực hành lợi ích cho người khác được gọi là “sự an trú từ bi”, chứ không phải là sự an trú nhập từ bi.
Na hi desanākāle desetabbadhammavisayassa desanāñāṇassa sattavisayāya mahākaruṇāya sahuppatti sambhavati bhinnavisayattā, tasmā karuṇāvasena pavatto parahitapaapattisaṅkhāto vihāro idha karuṇāvihāroti veditabbo.
For at the time of teaching, the simultaneous arising of the teaching-knowledge regarding the teaching-dhammas and great compassion regarding beings is not possible due to their having different objects; therefore, an abiding consisting of practice for the welfare of others, which proceeds by way of compassion, should be understood as karuṇāvihāra here.
Vì sự đồng khởi của tuệ thuyết giảng có đối tượng là các pháp cần thuyết giảng với đại từ bi có đối tượng là chúng sanh không thể xảy ra vào thời điểm thuyết giảng do có đối tượng khác nhau, do đó sự an trú được gọi là sự thực hành lợi ích cho người khác, phát sinh do từ bi, ở đây nên được hiểu là sự an trú từ bi.
Tadatthajotanatthanti accantasaṃyogatthadīpanatthaṃ upayoganiddeso kato yathā ‘‘māsaṃ ajjhetī’’ti.
To illuminate that meaning means to clarify the meaning of continuous conjunction, the instrumental case is used, as in "māsaṃ ajjhetī" (he studies for a month).
Để làm sáng tỏ ý nghĩa đó là để làm sáng tỏ ý nghĩa của sự liên hệ hoàn toàn, sự trình bày nghiệp dụng ngữ đã được thực hiện, ví dụ như “học một tháng”.
Adhikaraṇatthoti ādhārattho.
The meaning of 'location' is the meaning of basis.
Ý nghĩa sở y là ý nghĩa của cơ sở.
Bhāvo nāma kiriyā, kiriyāya kiriyantaralakkhaṇaṃ bhāvenabhāvalakkhaṇaṃ, soyevattho bhāvenabhāvalakkhaṇattho.
Bhāva means action; the characteristic of one action by another action is bhāvenabhāvalakkhaṇa (the characteristic of a state by another state); that same meaning is the meaning of bhāvenabhāvalakkhaṇa.
Bhāva có nghĩa là hành động (kiriyā), hành động làm dấu hiệu cho hành động khác (kiriyantaralakkhaṇaṃ) được gọi là bhāvenabhāvalakkhaṇaṃ, chính ý nghĩa đó là ý nghĩa bhāvenabhāvalakkhaṇa.
Kathaṃ pana abhidhamme yathāvuttaatthadvayasambhavoti āha ‘‘adhikaraṇañhī’’tiādi.
But how is the aforementioned twofold meaning possible in the Abhidhamma? He says: "For the location..." and so on.
Nhưng làm thế nào hai ý nghĩa đã nói trên có thể xảy ra trong Abhidhamma? Vị ấy nói: “Vì sở y” v.v...
Tattha kālasaṅkhāto attho kālattho, samūhasaṅkhāto attho samūhattho.
There, the meaning consisting of time is kālattha, the meaning consisting of assemblage is samūhattha.
Trong đó, ý nghĩa được gọi là thời gian là ý nghĩa thời gian, ý nghĩa được gọi là tập hợp là ý nghĩa tập hợp.
Atha vā kālasaddassa attho kālattho, samūhasaddassa attho samūhattho.
Alternatively, the meaning of the word kāla is kālattha, the meaning of the word samūha is samūhattha.
Hoặc là, ý nghĩa của từ kāla là ý nghĩa thời gian, ý nghĩa của từ samūha là ý nghĩa tập hợp.
Ko so?
What is it?
Nó là gì?
Samayo.
Samaya.
Là samaya.
Idaṃ vuttaṃ hoti – kālattho samūhattho ca samayo tattha abhidhamme vuttānaṃ phassādidhammānaṃ adhikaraṇaṃ ādhāroti yasmiṃ kāle dhammapuñje vā kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃyeva kāle puñje ca phassādayopi hontīti ayañhi tattha attho.
This is said: kālattha and samūhattha are samaya, the location, the basis, of the aggregates of phenomena like contact (phassa) mentioned in the Abhidhamma, meaning that when kāmāvacara wholesome consciousness arises at that time or in that assemblage of phenomena, then contact and other phenomena also exist at that same time or in that assemblage. This is indeed the meaning there.
Điều này được nói như sau: samaya, là ý nghĩa thời gian và ý nghĩa tập hợp, là sở y, là cơ sở của các pháp xúc v.v... đã được nói trong Abhidhamma đó. Ý nghĩa ở đó là khi tâm thiện dục giới sinh khởi trong thời điểm hoặc trong nhóm pháp, thì xúc v.v... cũng có mặt trong chính thời điểm và nhóm pháp đó.
Abhidhamme ādhāratthasambhavaṃ dassetvā idāni bhāvenabhāvalakkhaṇatthasambhavaṃ dassento āha ‘‘khaṇasamavāyahetusaṅkhātassā’’tiādi.
Having shown the possibility of the meaning of 'basis' in the Abhidhamma, he now shows the possibility of the meaning of 'bhāvenabhāvalakkhaṇa' by saying: "consisting of khaṇa, samavāya, and hetu..." and so on.
Sau khi trình bày khả năng tồn tại của ý nghĩa sở y trong Abhidhamma, bây giờ trình bày khả năng tồn tại của ý nghĩa bhāvenabhāvalakkhaṇa, vị ấy nói: “Do khoảnh khắc, sự tập hợp và nguyên nhân” v.v...
Tattha khaṇo nāma aṭṭhakkhaṇavinimutto navamo buddhuppādasaṅkhāto khaṇo, yāni vā panetāni ‘‘cattārimāni, bhikkhave, cakkāni yehi samannāgatānaṃ devamanussānaṃ catucakkaṃ pavattatī’’ti (a. ni. 4.31) ettha patirūpadesavāso, sappurisūpanissayo, attasammāpaṇidhi, pubbe ca katapuññatāti cattāri cakkāni vuttāni, tāni ekajjhaṃ katvā okāsaṭṭhena khaṇoti veditabbo.
There, khaṇa means the ninth moment, distinct from the eight moments, which is the arising of a Buddha; or it refers to those four wheels mentioned in "Bhikkhus, these are the four wheels by which the four-wheeled carriage of devas and humans rolls" (A. IV, 31), namely, dwelling in a suitable region, association with noble persons, proper self-guidance, and having made merit in the past. These, gathered together, should be understood as khaṇa in the sense of opportunity.
Trong đó, khoảnh khắc (khaṇa) là khoảnh khắc thứ chín tách rời khỏi tám khoảnh khắc, tức là khoảnh khắc Phật xuất hiện; hoặc là, những gì đã được nói ở đây trong “Này các tỳ khưu, có bốn bánh xe này mà khi chư thiên và loài người có được thì cỗ xe bốn bánh vận hành” (A.N. 4.31) là bốn bánh xe: trú xứ thích hợp, nương tựa bậc thiện trí, tự thân chánh định, và đã làm phước trong quá khứ, những điều này khi được tập hợp lại, nên được hiểu là khoảnh khắc theo nghĩa cơ hội.
Tāni hi kusaluppattiyā okāsabhūtāni.
For these are the opportunities for the arising of wholesome states.
Vì những điều đó là cơ hội cho sự sinh khởi của thiện pháp.
Samavāyo nāma ‘‘cakkhuñca paṭicca rūpe ca uppajjati cakkhuviññāṇa’’nti (ma. ni. 1.204; 3.421; saṃ. ni. 4.60) evamādinā niddiṭṭhā cakkhuviññāṇādisaṅkhātasādhāraṇaphalanipphādakattena saṇṭhitā cakkhurūpādipaccayasāmaggī.
Samavāya means the assemblage of causes such as eye and form, which is established as producing the common result, such as eye-consciousness, as indicated by expressions like "Eye-consciousness arises dependent on the eye and forms" (M. I, 204; III, 421; S. IV, 60).
Sự tập hợp (samavāyo) là sự tập hợp các duyên như mắt và sắc v.v... được thiết lập để tạo ra kết quả chung như nhãn thức v.v... được nói trong các câu như “do duyên mắt và sắc, nhãn thức sinh khởi” (M.N. 1.204; 3.421; S.N. 4.60).
Cakkhurūpādīnañhi cakkhuviññāṇādisādhāraṇaphalaṃ.
For the eye and forms have eye-consciousness as their common result.
Vì kết quả chung của mắt và sắc v.v... là nhãn thức v.v...
Hetūti janakahetu.
Hetu means the generative cause.
Nguyên nhân (hetū) là nguyên nhân sinh khởi.
Yathāvuttakhaṇasaṅkhaātassa samavāyasaṅkhātassa hetusaṅkhātassa ca samayassa bhāvena sattāya tesaṃ phassādidhammānaṃ bhāvo sattā lakkhīyati viññāyatīti attho.
The meaning is that by the existence (bhāva) of samaya, which consists of the aforementioned khaṇa, samavāya, and hetu, the existence of those phenomena like contact is characterized or known.
Ý nghĩa là do sự tồn tại (bhāva) của samaya được gọi là khoảnh khắc, được gọi là sự tập hợp, và được gọi là nguyên nhân như đã nói, sự tồn tại (bhāvo) của các pháp xúc v.v... đó được biết, được hiểu.
Idaṃ vuttaṃ hoti – yathā ‘‘gāvīsu duyhamānāsu gato, duddhāsu āgato’’ti dohanakiriyāya gamanakiriyā lakkhīyati, evamidhāpi ‘‘yasmiṃ samaye, tasmiṃ samaye’’ti ca vutte ‘‘satī’’ti ayamattho viññāyamāno eva hoti aññakiriyāya sambandhābhāve padatthassa sattāvirahābhāvatoti samayassa sattākiriyāya cittassa uppādakiriyā phassādibhavanakiriyā ca lakkhīyatīti.
This is said: just as by the action of milking, the action of going is characterized, as in "He went while the cows were being milked, he returned when they were milked," so too here, when it is said "yasmiṃ samaye, tasmiṃ samaye" (at which time, at that time), the meaning "satī" (being present/existing) is understood, because without a connection to another action, the existence of the meaning of the word would be lacking. Thus, by the action of the existence of samaya, the action of the arising of consciousness and the action of the occurrence of contact and other phenomena are characterized.
Điều này được nói như sau: giống như khi nói “đi khi bò đang được vắt sữa, về khi bò đã được vắt sữa”, hành động đi được biết qua hành động vắt sữa, thì ở đây cũng vậy, khi nói “vào thời điểm nào, vào thời điểm đó” thì ý nghĩa “có mặt” (satī) này được hiểu rõ, vì nếu không có sự liên hệ với hành động khác thì không có sự vắng mặt của sự tồn tại của từ ngữ, do đó hành động sinh khởi của tâm và hành động tồn tại của xúc v.v... được biết qua hành động tồn tại của samaya.
Ayañhi tattha attho yasmiṃ yathāvutte khaṇe paccayasamavāye hetumhi ca sati kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti, tasmiṃyeva khaṇe paccayasamavāye hetumhi ca sati phassādayopi hontīti.
This is indeed the meaning there: when, in the aforementioned khaṇa, samavāya of conditions, and hetu, kāmāvacara wholesome consciousness has arisen, at that same khaṇa, samavāya of conditions, and hetu, contact and other phenomena also arise.
Ý nghĩa ở đó là: khi có khoảnh khắc, sự tập hợp duyên và nguyên nhân như đã nói, tâm thiện dục giới sinh khởi, thì trong chính khoảnh khắc, sự tập hợp duyên và nguyên nhân đó, xúc v.v... cũng có mặt.
Tadatthajotanatthanti adhikaraṇatthassa bhāvenabhāvalakkhaṇatthassa ca dīpanatthaṃ.
To illuminate that meaning means to clarify the meaning of 'basis' and the meaning of 'bhāvenabhāvalakkhaṇa'.
Để làm sáng tỏ ý nghĩa đó là để làm sáng tỏ ý nghĩa sở y và ý nghĩa bhāvenabhāvalakkhaṇa.
Idha panāti imasmiṃ vinaye.
But here means in this Vinaya.
Nhưng ở đây là trong giới luật này.
Hetuattho karaṇattho ca sambhavatīti ‘‘annena vasati, vijjāya vasatī’’tiādīsu viya hetuattho ‘‘pharasunā chindati, kudālena khaṇatī’’tiādīsu viya karaṇattho ca sambhavati.
The meaning of 'cause' and the meaning of 'instrument' are possible, just as the meaning of 'cause' is possible as in "lives by food, lives by knowledge," and the meaning of 'instrument' is possible as in "cuts with an axe, digs with a hoe."
Ý nghĩa nguyên nhân và ý nghĩa cách thức có thể xảy ra giống như trong các câu “trú bằng thức ăn, trú bằng học vấn” v.v... thì ý nghĩa nguyên nhân, và giống như trong các câu “chặt bằng rìu, đào bằng cuốc” v.v... thì ý nghĩa cách thức có thể xảy ra.
Kathaṃ sambhavatīti āha ‘‘yo hi so’’tiādi.
How are they possible? He says: "For that which..." and so on.
Làm thế nào mà nó có thể xảy ra? Vị ấy nói: “Vì cái đó” v.v...
Tena samayena hetubhūtena karaṇabhūtenāti ettha pana taṃtaṃvatthuvītikkamova sikkhāpadapaññattiyā hetu ceva karaṇañca.
Here, by that time as cause, as instrument, it is the transgression of the respective matter itself that is both the cause and the instrument for the promulgation of the training rule.
Trong câu “bằng samaya đó, là nguyên nhân, là cách thức”, thì chính sự vi phạm đối tượng đó là nguyên nhân và cũng là cách thức cho sự chế định giới học.
Tathā hi yadā bhagavā sikkhāpadapaññattiyā paṭhamameva tesaṃ tesaṃ tattha tattha taṃtaṃsikkhāpadapaññattihetubhūtaṃ vītikkamaṃ apekkhamāno viharati, tadā taṃ taṃ vītikkamaṃ apekkhitvā tadatthaṃ vasatīti siddho vatthuvītikkamassa hetubhāvo ‘‘annena vasati, annaṃ apekkhitvā tadatthāya vasatī’’tiādīsu viya.
Indeed, when the Blessed One abides, primarily awaiting the transgressions that serve as the cause for the promulgation of various training rules in various places, then by awaiting that transgression, he abides for its sake. Thus, the transgressions' causal nature is established, as in "lives by food," meaning "lives awaiting food, for its sake."
Thật vậy, khi Đức Thế Tôn an trú quán sát sự vi phạm, là nguyên nhân chế định giới học đó, ở chỗ đó, của những người đó, lần đầu tiên cho sự chế định giới học, thì khi quán sát sự vi phạm đó, Ngài an trú vì mục đích đó, do đó tính chất nguyên nhân của sự vi phạm đối tượng được thành tựu, giống như trong các câu “trú bằng thức ăn, trú bằng cách quán sát thức ăn vì mục đích đó” v.v...
Sikkhāpadapaññattikāle pana teneva pubbasiddhena vītikkamena sikkhāpadaṃ paññapetīti sikkhāpadapaññattiyā sādhakatamattā karaṇabhāvopi vītikkamasseva siddho ‘‘asinā chindatī’’tiādīsu viya.
However, at the time of promulgating a training rule, he promulgates the training rule by means of that already established transgression. Thus, the instrumental nature of the transgression, as the most effective means for the promulgation of the training rule, is established, as in "cuts with a sword."
Nhưng vào thời điểm chế định giới học, Ngài chế định giới học bằng chính sự vi phạm đã thành tựu trước đó, do đó tính chất cách thức của chính sự vi phạm được thành tựu do là phương tiện tốt nhất cho sự chế định giới học, giống như trong các câu “chặt bằng kiếm” v.v...
Vītikkamaṃ pana apekkhamāno teneva saddhiṃ tannissayakālampi apekkhitvā viharatīti kālassapi idha hetubhāvo vutto, sikkhāpadaṃ paññapento ca taṃ taṃ vītikkamakālaṃ anatikkamitvā teneva kālena sikkhāpadaṃ paññapetīti vītikkamanissayassa kālassapi karaṇabhāvo vutto, tasmā iminā pariyāyena kālassapi hetubhāvo karaṇabhāvo ca labbhatīti vuttaṃ ‘‘tena samayena hetubhūtena karaṇabhūtenā’’ti.
But by awaiting the transgression, he also abides awaiting the time dependent on it. Thus, the causal nature of time is also stated here. And when promulgating a training rule, he does not go beyond the time of that transgression, but promulgates the training rule at that very time. Thus, the instrumental nature of time, which is dependent on the transgression, is also stated. Therefore, by this method, both the causal and instrumental nature of time are obtained, and it is said, "by that time as cause, as instrument."
Nhưng khi quán sát sự vi phạm, Ngài cũng quán sát thời điểm liên quan đến sự vi phạm đó và an trú, do đó tính chất nguyên nhân của thời gian cũng được nói ở đây; và khi chế định giới học, Ngài chế định giới học không vượt quá thời điểm vi phạm đó, mà chế định bằng chính thời điểm đó, do đó tính chất cách thức của thời gian liên quan đến sự vi phạm cũng được nói. Do đó, bằng cách này, tính chất nguyên nhân và tính chất cách thức của thời gian cũng đạt được, nên đã nói “bằng samaya đó, là nguyên nhân, là cách thức”.
Nippariyāyato pana vītikkamoyeva hetubhūto karaṇabhūto ca.
Directly, however, the transgression itself is the cause and the instrument.
Nhưng một cách trực tiếp, chính sự vi phạm là nguyên nhân và là phương tiện.
So hi vītikkamakkhaṇe hetu hutvā pacchā sikkhāpadapaññāpane karaṇampi hotīti.
For at the moment of transgression it is the cause, and afterwards, in the laying down of a training rule, it also becomes the instrument.
Vì chính điều đó, vào khoảnh khắc vi phạm, là nguyên nhân, và sau đó, trong việc chế định học giới, cũng là phương tiện.
Sikkhāpadāni paññāpayantoti vītikkamaṃ pucchitvā bhikkhusaṅghaṃ sannipātāpetvā otiṇṇavatthukaṃ puggalaṃ paṭipucchitvā vigarahitvā ca taṃ taṃ vatthuṃ otiṇṇakālaṃ anatikkamitvā teneva kālena karaṇabhūtena sikkhāpadāni paññāpayanto.
Laying down the training rules means: having inquired about the transgression, having assembled the Saṅgha of monks, having questioned the person on whom the matter had descended, and having rebuked them, laying down the training rules for that particular matter, not going beyond the time it occurred, with that very time as the instrument.
Chế định các học giới có nghĩa là: sau khi hỏi về sự vi phạm, triệu tập Tăng đoàn, hỏi lại vị tỳ-khưu đã phạm tội, khiển trách rồi chế định các học giới bằng phương tiện đó vào thời điểm phạm tội, không vượt quá thời điểm xảy ra sự việc đó.
Sikkhāpadapaññattihetuñca apekkhamānoti tatiyapārājikādīsu viya sikkhāpadapaññattiyā hetubhūtaṃ taṃ taṃ vatthuṃ vītikkamasamayaṃ apekkhamāno tena samayena hetubhūtena bhagavā tattha tattha vihāsīti attho.
And expecting the cause for laying down a training rule means: as in the case of the third pārājika and so on, expecting that particular matter, the time of the transgression, which is the cause for laying down a training rule; the meaning is that the Blessed One dwelt there at that time which was the cause.
Và chờ đợi nguyên nhân chế định học giới có nghĩa là: như trong các tội Ba-la-di thứ ba và những tội khác, Đức Phật đã an trú ở nơi đó, chờ đợi nguyên nhân chế định học giới, tức là thời điểm vi phạm sự việc đó; đó là ý nghĩa.
‘‘Sikkhāpadāni paññāpayanto sikkhāpadapaññattihetuñca apekkhamāno’’ti vacanato ‘‘tena samayena karaṇabhūtena hetubhūtenā’’ti evaṃ vattabbepi paṭhamaṃ ‘‘hetubhūtenā’’ti vacanaṃ idha hetuatthassa adhippetattā vuttaṃ.
Although, according to the statement “laying down the training rules and expecting the cause for laying down a training rule,” it should be said, “at that time, which was the instrument, which was the cause,” the initial phrase “which was the cause” is stated here because the meaning of ‘cause’ is intended.
Theo lời dạy “Chế định các học giới và chờ đợi nguyên nhân chế định học giới”, mặc dù nên nói là “bằng phương tiện đó, bằng nguyên nhân đó”, nhưng việc nói “bằng nguyên nhân đó” trước ở đây là vì ý nghĩa nguyên nhân được đề cập.
Bhagavā hi verañjāyaṃ viharanto therassa sikkhāpadapaññattiyācanahetubhūtaṃ parivitakkasamayaṃ apekkhamāno tena samayena hetubhūtena vihāsīti tīsupi gaṇṭhipadesu vuttaṃ.
For the Blessed One, while dwelling in Verañjā, was expecting the time of the Elder’s reflection, which was the cause for the request to lay down the training rules; with that time as the cause, he dwelt. This is stated in all three Gaṇṭhipada texts.
Vì Đức Thế Tôn khi an trú tại Ve-rañjā đã chờ đợi thời điểm suy tư là nguyên nhân cho lời thỉnh cầu chế định học giới của vị Trưởng lão, nên Ngài đã an trú bằng nguyên nhân đó vào thời điểm đó, điều này đã được nói trong cả ba chú giải.
Kiṃ panettha yutticintāya, ācariyassa idha kamavacanicchā natthīti evametaṃ gahetabbaṃ.
What is the use of logical reflection here? This should be understood thus: the teacher here has no wish for the accusative case.
Có gì ở đây để suy luận hợp lý? Không có ý định về thứ tự lời nói của vị thầy ở đây, nên điều này nên được hiểu như vậy.
Teneva dīghanikāyaṭṭhakathāyampi (dī. ni. aṭṭha. 1.paribbājakakathāvaṇṇanā) ‘‘tena samayena hetubhūtena karaṇabhūtenā’’tiādinā ayameva anukkamo vutto.
For this very reason, in the Commentary to the Dīgha Nikāya, this same sequence is stated, beginning with “at that time, which was the cause, which was the instrument.”
Vì thế, trong Chú giải Trường bộ kinh (Dī. Ni. Aṭṭha. 1. Paribbājakakathāvaṇṇanā) cũng đã nói về trình tự này bằng cách nói “bằng nguyên nhân đó, bằng phương tiện đó” và những điều tương tự.
Na hi tattha paṭhamaṃ ‘‘hetubhūtenā’’ti vacanaṃ idha ‘‘tena samayena verañjāyaṃ viharatī’’ti ettha hetuatthassa adhippetabhāvadīpanatthaṃ vuttaṃ.
For the initial phrase “which was the cause” is not stated there to indicate that the meaning of ‘cause’ is intended here in “at that time he dwells in Verañjā.”
Không phải việc nói “bằng nguyên nhân đó” trước ở đây là để chỉ ra rằng ý nghĩa nguyên nhân được đề cập trong câu “vào thời điểm đó, an trú tại Ve-rañjā”.
‘‘Sikkhāpadāni paññāpayanto hetubhūtena karaṇabhūtena samayena vihāsi, sikkhāpadapaññattihetuñca apekkhamāno hetubhūtena samayena vihāsīti evamettha sambandho kātabbo’’tipi vadanti.
Some also say: “The connection here should be made thus: ‘Laying down the training rules, he dwelt at that time which was the cause and the instrument; and expecting the cause for laying down a training rule, he dwelt at that time which was the cause.’”
Cũng có người nói rằng: “Nên liên kết ở đây như sau: Đức Thế Tôn đã an trú vào thời điểm là nguyên nhân và là phương tiện để chế định các học giới, và Ngài đã an trú vào thời điểm là nguyên nhân để chờ đợi nguyên nhân chế định học giới.”
Tadatthajotanatthanti hetuatthassa karaṇatthassa vā dīpanatthaṃ.
To illuminate that meaning means to clarify the meaning of ‘cause’ or the meaning of ‘instrument’.
Để làm sáng tỏ ý nghĩa đó có nghĩa là: để làm sáng tỏ ý nghĩa nguyên nhân hoặc ý nghĩa phương tiện.
Idhāti imasmiṃ vinaye.
Here means in this Vinaya.
Ở đây có nghĩa là: trong giới luật này.
Hoti cetthāti ettha imasmiṃ padese yathāvuttatthasaṅgahavasena ayaṃ gāthā hoti.
And here there is means: here, in this passage, this verse occurs by way of summarizing the meaning as stated.
Ở đây có bài kệ có nghĩa là: ở đây, tại phần này, có bài kệ này để tóm tắt ý nghĩa đã nói.
Aññatrāti suttābhidhammesu.
Elsewhere means in the Suttas and the Abhidhamma.
Ở các nơi khác có nghĩa là: trong các kinh Sutta và Abhidhamma.
Porāṇāti aṭṭhakathācariyā.
The ancients means the commentary teachers.
Các vị cổ đức có nghĩa là: các vị thầy của các bản Chú giải.
Abhilāpamattabhedoti vacanamattena viseso.
A mere difference in wording means a distinction only in the words used.
Chỉ khác biệt về cách diễn đạt có nghĩa là: sự khác biệt chỉ ở lời nói.
Tena suttavinayesu vibhattivipariṇāmo katoti dasseti.
By this, he shows that in the Suttas and the Vinaya, a change of grammatical case was made.
Điều đó cho thấy rằng trong các kinh Sutta và Vinaya đã có sự thay đổi về biến cách.
Parato atthaṃ vaṇṇayissāmāti parato ‘‘itipi so bhagavā’’tiādinā āgataṭṭhāne vaṇṇayissāma.
We will explain the meaning later means we will explain it later at the place where it appears with “Thus, he is the Blessed One,” and so on.
Chúng tôi sẽ giải thích ý nghĩa sau có nghĩa là: chúng tôi sẽ giải thích ở phần sau, tại chỗ có câu “Đức Thế Tôn ấy là như vậy” và những điều tương tự.
Verañjāyanti ettha ‘‘balikaraggahaṇena janassa pīḷābhāvato niddosattā vigato rajo assāti verañjā, serivāṇijajātake devadattassa veruppannapadese katattā veraṃ ettha jātanti verañjā, paviṭṭhapaviṭṭhe naṭasamajjādīhi khādanīyabhojanīyālaṅkārādīhi ca vividhehi upakaraṇehi rañjanato vividhehi rañjayatīti verañjā, paṭipakkhe abhibhavitvā katabhāvato veraṃ abhibhavitvā jātāti verañjā, verañjassa nāma isino assamaṭṭhāne katattā verañjā’’ti evamādinā keci vaṇṇayanti.
Regarding in Verañjā, some explain it in various ways, such as: “Because of the absence of affliction to the people from the collection of taxes, it is free from fault (raja); thus, it is Verañjā. Because in the Serivāṇija Jātaka, it was done in a country hostile to Devadatta, hostility (veraṃ) arose (jātaṃ) here; thus, Verañjā. Because it delights with various requisites such as eatables, food, and ornaments through theatrical performances and so on that have been entered, it delights in various ways; thus, Verañjā. Because it was created after conquering the opposition, hostility (veraṃ) was conquered (abhibhavitvā) and it arose (jātaṃ); thus, Verañjā. Because it was founded on the site of the hermitage of the seer named Verañja; thus, Verañjā.”
Về Ve-rañjā, một số người giải thích như sau: “ Ve-rañjā là nơi không có bụi bẩn vì không có sự áp bức dân chúng do thu thuế, nghĩa là không có lỗi; Ve-rañjā là nơi mà sự thù hận đã phát sinh, vì nó được xây dựng tại nơi Devadatta đã nảy sinh sự thù hận trong truyện Serivāṇija Jātaka; Ve-rañjā là nơi làm vui lòng bằng nhiều phương tiện khác nhau như đồ ăn, thức uống, trang sức, v.v., từ các buổi biểu diễn kịch nghệ cho những người đến thăm; Ve-rañjā là nơi đã được tạo ra bằng cách đánh bại kẻ thù, nghĩa là đã đánh bại sự thù hận; Ve-rañjā là nơi được xây dựng tại đạo tràng của vị ẩn sĩ tên Ve-rañja.”
Kiṃ iminā, nāmamattametaṃ tassa nagarassāti dassento āha ‘‘verañjāti aññatarassa nagarassetaṃ adhivacana’’nti.
What is the use of this? Showing that this is merely the name of that city, he said: “Verañjā is the designation for a certain city.”
Để chỉ ra rằng “cần gì những điều này, đây chỉ là tên của thành phố đó”, nên đã nói “Ve-rañjā là một tên gọi khác của một thành phố nào đó”.
Samīpatthe bhummavacananti ‘‘gaṅgāyaṃ gāvo caranti, kūpe gaggakula’’ntiādīsu viya.
The locative case is used in the sense of proximity, as in examples like “cows graze on the Ganges” and “the Gagga family is at the well.”
Biến cách định sở chỉ ý nghĩa gần có nghĩa là: giống như trong các câu “bò ăn cỏ trên sông Gaṅgā”, “gia đình Gaggaka ở trong giếng” và những câu tương tự.
Avisesenāti ‘‘pātimokkhasaṃvarasaṃvuto viharati.
Without specification means without reference to a specific type established by the proximity of another word, as in: “he dwells restrained by the restraint of the Pātimokkha,”
Một cách không đặc biệt có nghĩa là: không có sự tham chiếu đặc biệt nào được thiết lập bởi sự hiện diện của một từ khác, như trong các câu “an trú với sự phòng hộ bằng giới bổn Pātimokkha.
Paṭhamaṃ jhānaṃ upasampajja viharati.
“he dwells having attained the first jhāna,”
Chứng đạt và an trú thiền thứ nhất.
Mettāsahagatena cetasā ekaṃ disaṃ pharitvā viharati.
“he dwells suffusing one direction with a mind accompanied by loving-kindness,”
An trú bằng cách trải tâm từ bi đến một phương.
Sabbanimittānaṃ amanasikārā animittaṃ cetosamādhiṃ samāpajjitvā viharatī’’tiādīsu viya saddantarasannidhānasiddhena visesaparāmasanena vinā.
“and he dwells having attained the signless concentration of mind through non-attention to all signs.”
Chứng đạt và an trú thiền định vô tướng bằng cách không tác ý đến tất cả các tướng” và những câu tương tự.
Atha vā avisesenāti na visesena, vihārabhāvasāmaññenāti attho.
Or else, without specification means not with a specific type; the meaning is, with the general state of abiding.
Hoặc một cách không đặc biệt có nghĩa là: không phải một cách đặc biệt, mà là theo ý nghĩa chung của sự an trú.
Iriyāpatha…pe… vihāresūti iriyāpathavihāro dibbavihāro brahmavihāro ariyavihāroti etesu catūsu vihāresu.
In the postures… and other… abidings means in these four abidings: the abiding of posture, the divine abiding, the sublime abiding, and the noble abiding.
Trong các tư thế…v.v…an trú có nghĩa là: trong bốn loại an trú này: tư thế an trú (iriyāpathavihāra), an trú chư thiên (dibbavihāra), an trú phạm thiên (brahmavihāra), an trú thánh (ariyavihāra).
Tattha iriyanaṃ pavattanaṃ iriyā, kāyappayogo kāyikakiriyā.
Therein, moving, the act of moving is iriyā; bodily application, bodily action.
Trong đó, sự cử động, sự vận hành là tư thế (iriyā); sự vận dụng thân là hành động thân (kāyappayogo kāyikakiriyā).
Tassā pavattanupāyabhāvato iriyāya pathoti iriyāpatho, ṭhānanisajjādi.
Because it is the means for carrying out that movement, the path of movement is iriyāpatha: standing, sitting, and so on.
Vì là phương tiện cho sự vận hành đó, con đường của tư thế là tư thế an trú (iriyāpatho), như đứng, ngồi, v.v.
Na hi ṭhānanisajjādīhi avatthāhi vinā kañci kāyikakiriyaṃ pavattetuṃ sakkā.
For it is not possible to perform any bodily action without the states of standing, sitting, and so on.
Vì không thể thực hiện bất kỳ hành động thân nào mà không có các trạng thái như đứng, ngồi, v.v.
Ṭhānasamaṅgī vā hi kāyena kiñci kareyya gamanādīsu aññatarasamaṅgī vāti.
One might do something with the body while endowed with the state of standing, or while endowed with one of the other states, such as walking.
Vì một người có thể làm điều gì đó bằng thân khi đang đứng hoặc khi đang đi, v.v.
Viharaṇaṃ, viharati etenāti vā vihāro, iriyāpathova vihāro iriyāpathavihāro, so ca atthato ṭhānanisajjādiākārappavatto catusantatirūpappabandhova.
Abiding, or that by which one abides, is a vihāra; the posture itself is the abiding, the abiding of posture. And this, in terms of substance, is just the continuum of the four types of continuity that proceeds in the modes of standing, sitting, and so on.
Sự an trú, hoặc sự an trú bằng điều này là an trú (vihāro); tư thế an trú là an trú tư thế (iriyāpathavihāro), và về ý nghĩa, đó chính là sự liên tục của bốn trạng thái thân được biểu hiện qua các tư thế như đứng, ngồi, v.v.
Divi bhavo dibbo, tattha bahulappavattiyā brahmapārisajjādidevalokabhavoti attho.
What is in the divine realm is dibba; the meaning is, what exists in the divine world of Brahma’s assembly and so on, due to its frequent occurrence there.
Có mặt ở cõi trời là thuộc về chư thiên (dibbo), ý nghĩa là sự hiện hữu ở cõi trời của các vị Phạm thiên tùy tùng, v.v., do sự vận hành thường xuyên ở đó.
Tattha yo dibbānubhāvo tadatthāya saṃvattatīti vā dibbo, abhiññābhinīhāravasena mahāgatikattā vā dibbo, dibbo ca so vihāro cāti dibbavihāro, dibbabhāvāvaho vā vihāro dibbavihāro, mahaggatajjhānāni.
Or, because it conduces to the attainment of that divine state, it is dibba; or because it has a great sphere through the basis of higher knowledges, it is dibba. That which is divine and is an abiding is a divine abiding; or, the abiding that brings about a divine state is a divine abiding; these are the meditations of the fine-material sphere.
Hoặc điều gì đó dẫn đến sự thần thông của chư thiên là thuộc về chư thiên (dibbo); hoặc thuộc về chư thiên do có sự vận hành lớn nhờ vào các thắng trí và sự quyết tâm; và đó là an trú chư thiên (dibbavihāro), hoặc an trú dẫn đến trạng thái chư thiên là an trú chư thiên, tức là các thiền hữu sắc.
Āruppasamāpattiyopi hi ettheva saṅgahaṃ gacchanti.
The formless attainments are also included right here.
Các thiền vô sắc cũng được bao gồm ở đây.
Nettiyaṃ pana ‘‘catasso āruppasamāpattiyo āneñjavihāro’’ti vuttaṃ, taṃ mettājhānādīnaṃ brahmavihāratā viya tāsaṃ bhāvanāvisesabhāvaṃ sandhāya vuttaṃ.
In the Netti, however, it is said, “The four formless attainments are the imperturbable abiding.” This is stated with reference to their being a special kind of meditative development, just as the meditations on loving-kindness and so on are sublime abidings.
Tuy nhiên, trong Netti có nói rằng “bốn thiền vô sắc là an trú bất động”, điều đó được nói để chỉ ra tính chất đặc biệt của sự tu tập của chúng, giống như các thiền từ bi, v.v., là an trú phạm thiên.
Aṭṭhakathāsu pana dibbabhāvāvahasāmaññato tāpi ‘‘dibbavihārā’’tveva vuttā.
But in the commentaries, because of their general nature of bringing about a divine state, they too are simply called “divine abidings.”
Nhưng trong các bản Chú giải, chúng cũng được gọi là “an trú chư thiên” vì tính chất chung là dẫn đến trạng thái chư thiên.
Brahmānaṃ vihārā brahmavihārā, brahmāno vā vihārā brahmavihārā, hitūpasaṃharādivasena pavattiyā brahmabhūtā seṭṭhabhūtā vihārāti attho, mettājhānādikā catasso appamaññāyo.
The abidings of the Brahmās are the sublime abidings; or, the abidings that are sublime are sublime abidings. The meaning is, abidings that are sublime, that are excellent, due to their proceeding by way of bringing benefit, and so on; these are the four immeasurables, namely the meditations on loving-kindness and so on.
Các an trú của Phạm thiên là an trú phạm thiên (brahmavihārā), hoặc các an trú là Phạm thiên là an trú phạm thiên, ý nghĩa là các an trú cao quý, tối thượng, do sự vận hành mang lại lợi ích, v.v., đó là bốn vô lượng tâm như thiền từ bi, v.v.
Ariyā uttamā vihārāti ariyavihārā, anaññasādhāraṇattā ariyānaṃ vā vihārā ariyavihārā, catasso phalasamāpattiyo.
Abidings that are noble, supreme, are noble abidings; or, because they are not shared by others, they are the abidings of the nobles, noble abidings; these are the four fruitional attainments.
Các an trú tối thượng là an trú thánh (ariyavihārā), hoặc các an trú của các bậc thánh vì chúng không thuộc về người khác, đó là bốn quả thiền.
Visesato pana rūpāvacaracatutthajjhānaṃ catasso appamaññāyo catutthajjhānikaphalasamāpatti ca bhagavato dibbabrahmaariyavihārā.
Specifically, however, the fourth jhāna of the fine-material sphere, the four immeasurables, and the fruitional attainment based on the fourth jhāna are the Blessed One’s divine, sublime, and noble abidings.
Đặc biệt hơn, thiền thứ tư thuộc sắc giới, bốn vô lượng tâm và quả thiền thứ tư là các an trú chư thiên, phạm thiên và thánh của Đức Thế Tôn.
Aññataravihārasamaṅgīparidīpananti yathāvuttavihāresu aññataravihārasamaṅgībhāvaparidīpanaṃ.
The indication of being endowed with a certain abiding means the indication of the state of being endowed with one of the aforementioned abidings.
Chỉ ra sự thành tựu một trong các an trú có nghĩa là: chỉ ra sự thành tựu một trong các an trú đã nói.
Bhagavā hi lobhadosamohussannakāle loke tassa sakāya paṭipattiyā vinayanatthaṃ dibbabrahmaaayavihāre upasampajja viharati.
For the Blessed One, at a time when the world is overrun with greed, hatred, and delusion, dwells having attained the divine, sublime, and noble abidings in order to tame it through his own practice.
Quả vậy, vào thời kỳ tham, sân, si hưng thịnh trong thế gian, Đức Thế Tôn, vì mục đích điều phục chúng, đã an trú, thành tựu các trú xứ của chư thiên và phạm thiên bằng sự thực hành của chính Ngài.
Tathā hi yadā sattā kāmesu vippaṭipajjanti, tadā kira bhagavā dibbena vihārena viharati tesaṃ alobhakusalamūluppādanatthaṃ ‘‘appeva nāma imaṃ paṭipattiṃ disvā ettha ruciṃ uppādentā kāmesu virajjeyyu’’nti.
Indeed, when beings are behaving wrongly in regard to sensual pleasures, it is said that the Blessed One dwells with a divine abiding for the purpose of generating wholesome roots of non-greed in them, with the thought: “Perhaps, having seen this practice, they will generate a liking for it and become dispassionate towards sensual pleasures.”
Thật vậy, khi chúng sinh hành xử sai trái trong các dục, nghe nói khi ấy Đức Thế Tôn an trú bằng thiên trú, vì mục đích làm phát sinh cội rễ thiện vô tham cho họ, (với ý nghĩ rằng) “mong rằng sau khi thấy sự thực hành này, họ sẽ làm phát sinh sự ưa thích nơi đây và sẽ ly tham trong các dục”.
Yadā pana issariyatthaṃ sattesu vippaṭipajjanti, tadā pana brahmavihārena viharati tesaṃ adosakusalamūluppādanatthaṃ ‘‘appeva nāma imaṃ paṭipattiṃ disvā ettha ruciṃ uppādetvā adosena dosaṃ vūpasameyyu’’nti.
But when beings act wrongly for the sake of power, then he dwells with a Brahmavihāra to generate the wholesome root of non-hatred in them, thinking, "Perhaps, seeing this practice, they might generate liking for it and overcome hatred with non-hatred."
Nhưng khi họ hành xử sai trái đối với chúng sinh vì quyền lực, thì Ngài an trú trong các trú xứ Phạm thiên để phát sinh căn lành không sân hận nơi họ, (với ý nghĩ) “Mong rằng, khi thấy hạnh này, họ sẽ phát khởi sự ưa thích ở đây và nhờ không sân hận mà diệt trừ sân hận.”
Yadā pana pabbajitā dhammādhikaraṇaṃ vivadanti, tadā ariyavihārena viharati tesaṃ amohakusalamūluppādanatthaṃ ‘‘appeva nāma imaṃ paṭipattiṃ disvā tattha ruciṃ uppādetvā amohena mohaṃ vūpasameyyu’’nti.
But when renunciants dispute over a Dhamma issue, then he dwells with an Ariyavihāra to generate the wholesome root of non-delusion in them, thinking, "Perhaps, seeing this practice, they might generate liking for it and overcome delusion with non-delusion."
Nhưng khi các vị xuất gia tranh cãi về một vấn đề pháp, thì Ngài an trú trong các trú xứ Thánh để phát sinh căn lành không si mê nơi họ, (với ý nghĩ) “Mong rằng, khi thấy hạnh này, họ sẽ phát khởi sự ưa thích ở đó và nhờ không si mê mà diệt trừ si mê.”
Evañca katvā imehi dibbabrahmaariyavihārehi sattānaṃ vividhaṃ hitasukhaṃ harati upaharati upaneti janeti uppādetīti ‘‘viharatī’’ti vuccati.
Having acted thus, it is said "he dwells" (viharati) because with these divine, Brahmā, and Noble (ariya) abodes, he brings forth, offers, conveys, generates, and produces various benefits and happiness for beings.
Và khi làm như vậy, với những trú xứ Phạm thiên, trú xứ Thánh, trú xứ thiên này, Ngài mang lại, dâng hiến, đem đến, tạo ra, phát sinh nhiều lợi ích và an lạc cho chúng sinh, nên được gọi là “an trú” (viharati).
Iriyāpathavihārena pana na kadāci na viharati taṃ vinā attabhāvapariharaṇābhāvato, tatoyeva ca dibbavihārādīnampi sādhāraṇo iriyāpathavihāroti āha ‘‘idha panā’’tiādi.
However, he never does not dwell in the posture of living (iriyāpathavihāra), as without it, there is no maintenance of the body. For this very reason, the posture of living is common even to the divine abodes, etc., thus he says "But here..." and so on.
Còn với sự an trú trong oai nghi, Ngài không bao giờ không an trú, vì không có sự duy trì thân thể nếu thiếu nó; và chính vì lý do đó, sự an trú trong oai nghi là phổ biến cho cả các trú xứ thiên, v.v., nên đã nói “ở đây” v.v.
Iriyāpathasamāyogaparidīpananti itaravihārasamāyogaparidīpanassa visesavacanassa abhāvato iriyāpathasamāyogaparidīpanassa ca atthasiddhattā vuttaṃ.
"Iriyāpathasamāyogaparidīpana" (Elucidation of the conjunction with postures) is stated because there is no specific word for the elucidation of the conjunction with other abodes, and the purpose of elucidating the conjunction with postures is achieved.
“Sự chỉ rõ sự kết hợp với oai nghi” là điều đã nói vì không có lời nói đặc biệt chỉ rõ sự kết hợp với các trú xứ khác, và vì ý nghĩa của sự chỉ rõ sự kết hợp với oai nghi đã thành tựu.
Asmiṃ pana pakkhe viharatīti ettha vi-saddo vicchedatthajotano, haratīti neti pavattetīti attho, vicchinditvā haratīti vuttaṃ hoti.
In this context, regarding "viharati," the prefix "vi-" indicates cutting off, and "harati" means to lead or to continue. Thus, it is said to lead by cutting off.
Tuy nhiên, trong trường hợp này, ở từ viharatī (an trú), tiền tố vi chỉ ý nghĩa gián đoạn, còn haratī có nghĩa là dẫn dắt, vận hành; vậy có nghĩa là dẫn dắt một cách gián đoạn.
Tattha kassa kena vicchindanaṃ, kathaṃ kassa pavattananti antolīnacodanaṃ sandhāyāha ‘‘so hī’’tiādi.
In this regard, to whom is the cutting off by what, and how is the continuation to whom? He addresses this underlying question by saying "For he..." and so on.
Do đó, để giải đáp câu hỏi tiềm ẩn “Cái gì bị gián đoạn bởi cái gì, và cái gì được vận hành như thế nào?”, Ngài nói “Vị ấy” v.v.
Soti bhagavā.
"He" refers to the Blessed One.
“Vị ấy” là Đức Thế Tôn.
Yadipi bhagavā ekenapi iriyāpathena cirataraṃ kālaṃ attabhāvaṃ pavattetuṃ sakkoti, tathāpi upādinnakasarīrassa nāma ayaṃ sabhāvoti dassetuṃ ‘‘ekaṃ iriyāpathabādhana’’ntiādi vuttaṃ.
Although the Blessed One is capable of maintaining his body for a long time in even a single posture, the phrase "hindering one posture" and so on, is stated to show that this is the nature of an appropriated body.
Mặc dù Đức Thế Tôn có thể duy trì thân thể trong một thời gian dài chỉ với một oai nghi, nhưng để chỉ ra rằng đây là bản chất của một thân thể được chấp thủ, nên đã nói “sự cản trở của một oai nghi” v.v.
Aparipatantanti apatantaṃ.
"Aparipatantaṃ" means not falling.
“Không rơi rụng” có nghĩa là không ngã.
Yasmā pana bhagavā yattha katthaci vasanto vineyyānaṃ dhammaṃ desento nānāsamāpattīhi ca kālaṃ vītināmento vasatīti sattānaṃ attano ca vividhaṃ hitasukhaṃ harati upaneti, tasmā vividhaṃ haratīti viharatīti evampettha attho veditabbo.
Moreover, since the Blessed One, dwelling wherever, teaching the Dhamma to those who are to be disciplined, and spending time in various attainments, resides and thereby brings forth and conveys various benefits and happiness for beings and for himself, therefore, the meaning here should be understood as "viharati" because he brings forth various things.
Vì Đức Thế Tôn, khi an trú ở bất cứ đâu, thuyết pháp cho các đệ tử và trải qua thời gian với nhiều tầng thiền định, Ngài mang lại và đem đến nhiều lợi ích và an lạc cho chúng sinh và cho chính mình; do đó, ở đây cũng nên hiểu nghĩa là “mang lại nhiều điều” (vividhaṃ harati) nên là “an trú” (viharati).
Naḷerupucimandamūleti ettha vaṇṇayanti – naḷerūti tasmiṃ rukkhe adhivatthayakkhassetaṃ adhivacanaṃ, tasmā tena adhivattho pucimando ‘‘naḷerussa pucimando naḷerupucimando’’ti vuccati.
Regarding "Naḷerupucimandamūle," they explain: "Naḷeru" is a designation for the yakkha dwelling in that tree; hence, the pucimanda tree, being dwelt in by him, is called "Naḷeru's pucimanda," or Naḷerupucimanda.
Về Naḷerupucimandamūle (dưới gốc cây Pucimanda của Naḷeru), họ giải thích rằng: Naḷeru là tên gọi của vị Dạ-xoa trú ngụ trên cây đó, vì vậy cây Pucimanda được vị ấy trú ngụ được gọi là “Pucimanda của Naḷeru”, tức là Naḷerupucimanda.
Atha vā naḷe ruhattā jātattā naḷeru.
Alternatively, Naḷeru, because it grew or was born in reeds (naḷe ruhattaṃ).
Hoặc, nó được gọi là Naḷeru vì nó “ruha” (mọc) hoặc “jāta” (sinh ra) trong “naḷa” (ống tre).
Susiramettha naḷasaddena vuccati, tasmā rukkhasusire jātattā naḷeru ca so pucimando cāti naḷerupucimandoti vuccati.
Here, the word naḷa refers to a hollow space; therefore, because it was born in a hollow of a tree, it is called naḷeru, and since it is a pucimanda, it is called Naḷerupucimanda.
Ở đây, từ “naḷa” được dùng để chỉ một cái lỗ rỗng, vì vậy nó được gọi là Naḷerupucimanda vì nó là Naḷeru (mọc trong lỗ rỗng của cây) và là cây Pucimanda.
Naḷavane ruhattā jātattā vā naḷeru.
Or Naḷeru, because it grew or was born in a reed forest (naḷavane ruhattaṃ).
Hoặc, nó được gọi là Naḷeru vì nó “ruha” (mọc) hoặc “jāta” (sinh ra) trong một rừng tre (naḷavana).
Naḷavane kira so pucimandarukkho jāto.
Indeed, that pucimanda tree is said to have grown in a reed forest.
Nghe nói cây Pucimanda đó đã mọc trong một rừng tre.
Urunaḷo pucimando naḷerupucimando.
A great hollow (uru naḷo) pucimanda is Naḷerupucimanda.
Pucimanda có lỗ rỗng lớn (uru-naḷa) là Naḷerupucimanda.
Urusaddo cettha mahantapariyāyo, naḷasaddo susirapariyāyo, tasmā mahantena susirena samannāgato pucimando naḷerupucimandoti vuccatīti.
Here, the word uru means "great," and the word naḷa means "hollow"; therefore, a pucimanda endowed with a great hollow is called Naḷerupucimanda.
Ở đây, từ “uru” có nghĩa là lớn, và từ “naḷa” có nghĩa là lỗ rỗng; vì vậy, cây Pucimanda có lỗ rỗng lớn được gọi là Naḷerupucimanda.
Ācariyo pana kimettha bahubhāsitenāti ekamevatthaṃ dassento ‘‘naḷeru nāma yakkho’’tiādimāha.
But the teacher, indicating just one meaning, says, "What is the point of much talk here?" and then "Naḷeru is a yakkha" and so on.
Tuy nhiên, bậc thầy (Ācariya) đã nói “Naḷeru là một Dạ-xoa” v.v., chỉ ra một ý nghĩa duy nhất, (như thể nói) “Tại sao phải nói nhiều ở đây?”
Mūla-saddo ettha samīpavacano adhippeto, na mūlamūlādīsu vattamānoti dassento āha ‘‘mūlanti samīpa’’ntiādi.
The word mūla here is intended to mean "proximity," not "root of a root" and so on, thus he says, "mūla means proximity" and so on.
Ở đây, từ “mūla” được hiểu là có nghĩa “gần gũi” (samīpa), chứ không phải là “gốc rễ” (mūlamūla) v.v., nên Ngài nói “mūla có nghĩa là gần gũi” v.v.
Nippariyāyena sākhādimato saṅghātassa suppatiṭṭhitabhāvasādhane avayavavisese pavattamāno mūlasaddo yasmā taṃsadisesu tannissaye padese ca ruḷhīvasena pariyāyato pavattati, tasmā ‘‘mūlāni uddhareyyā’’ti ettha nippariyāyato mūlaṃ adhippetanti ekena mūlasaddena visesetvā āha ‘‘mūlamūle dissatī’’ti yathā ‘‘dukkhadukkhaṃ, rūparūpa’’nti ca.
Since the word mūla, which primarily refers to the specific component that serves as the foundation for the stable existence of an aggregate endowed with branches, etc., secondarily operates by convention in analogous things and in dependent places, he specifies by one word mūla that the primary mūla is intended when it says "may uproot the roots," thus he says "it is seen at the root of the root," just as in "suffering of suffering" and "form of form."
Vì từ “mūla” (gốc rễ), vốn được dùng một cách trực tiếp để chỉ một phần đặc biệt của một tập hợp có cành, v.v., là phương tiện để thiết lập sự vững chắc, được dùng một cách gián tiếp theo thói quen để chỉ những thứ tương tự và những nơi dựa vào đó, nên để làm rõ rằng “gốc rễ” ở đây là gốc rễ theo nghĩa trực tiếp, Ngài đã đặc biệt nói bằng một từ “mūla” là “nó xuất hiện ở gốc rễ của gốc rễ” (mūlamūle dissatī), giống như “khổ của khổ” (dukkhadukkhaṃ) và “sắc của sắc” (rūparūpaṃ).
Asādhāraṇahetumhīti asādhāraṇakāraṇe.
"Asādhāraṇahetumhi" means in an uncommon cause.
“Asādhāraṇahetumhi” có nghĩa là nguyên nhân không phổ biến.
Lobho hi lobhasahagataakusalacittuppādasseva hetuttā asādhāraṇo, tasmā lobhasahagatacittuppādānameva āveṇike nesaṃ suppatiṭṭhitabhāvasādhanato mūlaṭṭhena upakārake paccayadhammaviseseti attho.
Greed is indeed uncommon because it is a cause only for unwholesome states of consciousness accompanied by greed. Therefore, it refers to specific causal phenomena that are helpful in the sense of a root, being the unique foundation for states of consciousness accompanied by greed.
Tham (lobha) là không phổ biến vì nó chỉ là nhân của các tâm bất thiện đồng sanh với tham; do đó, nó có nghĩa là một yếu tố điều kiện đặc biệt, hỗ trợ theo nghĩa gốc rễ, chỉ đặc biệt cho sự phát sinh của các tâm đồng sanh với tham.
Atha vā yathā alobhādayo kusalābyākatasādhāraṇā, lobhādayo pana tathā na honti akusalasseva sādhāraṇattāti asādhāraṇakāraṇaṃ.
Alternatively, just as non-greed, etc., are common to wholesome and indeterminate states, greed, etc., are not so, being common only to unwholesome states, hence an uncommon cause.
Hoặc, giống như không tham (alobha) v.v. là phổ biến cho thiện và vô ký, nhưng tham v.v. thì không như vậy vì nó chỉ phổ biến cho bất thiện, nên nó là nguyên nhân không phổ biến.
Atha vā ādīsūti ettha ādi-saddena alobhādīnampi kusalābyākatamūlānaṃ saṅgaho daṭṭhabbo.
Alternatively, in "ādīsu" (and so on), the word "ādi" (and so on) should be understood to include the wholesome and indeterminate roots such as non-greed, etc.
Hoặc, ở từ ādīsu (v.v.), từ ādi (v.v.) nên được hiểu là bao gồm cả các căn lành và vô ký như không tham v.v.
Tesupi hi alobhādikusalamūlaṃ akusalābyākatehi asādhāraṇattā asādhāraṇakāraṇaṃ, tathā alobhādiabyākatamūlampi itaradvayehi asādhāraṇattāti.
For even among these, the wholesome root of non-greed, etc., is an uncommon cause because it is uncommon with unwholesome and indeterminate states, and similarly, the indeterminate root of non-greed, etc., is also uncommon with the other two.
Vì ngay cả trong những điều đó, căn lành như không tham v.v. là nguyên nhân không phổ biến vì nó không phổ biến với bất thiện và vô ký; tương tự, căn vô ký như không tham v.v. cũng không phổ biến với hai loại kia.
Nivāteti vātarahite padese, vātassa abhāve vā.
"Nivāte" means in a place free from wind, or in the absence of wind.
“Nivāte” có nghĩa là ở nơi không có gió, hoặc trong trường hợp không có gió.
Patantīti nipatanti, ayameva vā pāṭho.
"Patanti" means they fall; this is indeed the reading.
“Patantī” có nghĩa là rơi xuống; hoặc đây là cách đọc (pāṭha) đúng.
Ramaṇīyoti manuñño.
"Ramaṇīyo" means pleasing.
“Ramaṇīyo” có nghĩa là dễ chịu.
Pāsādikoti pasādāvaho, pasādajanakoti attho.
"Pāsādiko" means inspiring confidence, that is, generating clarity.
“Pāsādiko” có nghĩa là mang lại sự thanh tịnh, tức là tạo ra sự thanh tịnh.
Ādhipaccaṃ kurumāno viyāti sambandho.
The connection is as if he were exercising sovereignty.
Có mối liên hệ như “đang thực hiện quyền thống trị.”
Tatthāti ‘‘tena samayena buddho bhagavā verañjāyaṃ viharati naḷerupucimandamūle’’ti yaṃ vuttaṃ, tattha.
"Tatthā" refers to what was said: "At that time, the Buddha, the Blessed One, was dwelling in Verañjā, at the root of the Naḷeru Pucimanda tree."
“Tatthā” (ở đó) là ở chỗ đã nói: “Vào thời điểm đó, Đức Phật, Thế Tôn, đang an trú tại Verañjā, dưới gốc cây Pucimanda của Naḷeru.”
Siyāti kassaci evaṃ parivitakko siyā, vakkhamānākārena kadāci codeyya vāti attho.
"Siyā" means that such a thought might occur to someone, or he might at some time question in the manner that will be stated.
“Siyā” có nghĩa là có thể có một suy nghĩ như vậy ở một người nào đó, tức là có thể có lúc người ta sẽ chất vấn theo cách sắp được nói.
Yadi tāva bhagavātiādīsu codakassāyamadhippāyo – ‘‘pāṭaliputte pāsāde vasatī’’tiādīsu viya adhikaraṇādhikaraṇaṃ yadi bhaveyya, tadā ‘‘verañjāyaṃ viharati naḷerupucimandamūle’’ti adhikaraṇadvayaniddeso yutto siyā, imesaṃ pana bhinnadesattā na yutto ubhayaniddesoti.
In "Yadi tāva Bhagavā" (If indeed the Blessed One) and so on, the questioner's intention is: "If it were a locative governing another locative, as in 'he dwells in a mansion in Pāṭaliputta,' then the designation of two locatives, 'he dwells in Verañjā, at the root of the Naḷeru Pucimanda tree,' would be appropriate. But since these are in different places, the designation of both is not appropriate."
Trong “Yadi tāva bhagavā” v.v., ý của người chất vấn là: “Nếu đó là một địa điểm sở thuộc (adhikaraṇa) như trong ‘Ngài an trú trong cung điện ở Pāṭaliputta’ v.v., thì việc chỉ ra hai địa điểm sở thuộc ‘Ngài an trú tại Verañjā, dưới gốc cây Pucimanda của Naḷeru’ là hợp lý. Nhưng vì những nơi này khác nhau về địa điểm, nên việc chỉ ra cả hai là không hợp lý.”
Atha tattha viharatīti yadi naḷerupucimandamūle viharati.
"Atha tattha viharati" means if he dwells at the root of the Naḷeru Pucimanda tree.
“Atha tattha viharatī” có nghĩa là nếu Ngài an trú dưới gốc cây Pucimanda của Naḷeru.
Na vattabbanti nānāṭhānabhūtattā verañjānaḷerupucimandamūlānaṃ ‘‘tena samayenā’’ti ca vuttattāti adhippāyo.
"Na vattabbaṃ" (should not be said) implies that since Verañjā and the root of the Naḷeru Pucimanda tree are distinct places, and "at that time" is stated, it means they are not to be simultaneously stated.
“Na vattabbaṃ” (không nên nói) có nghĩa là vì Verañjā và gốc cây Pucimanda của Naḷeru là những nơi khác nhau, và cũng vì đã nói “vào thời điểm đó.”
Idāni codako tameva attano adhippāyaṃ ‘‘na hi sakkā’’tiādinā vivarati.
Now the questioner clarifies his own intention with "Na hi sakkā" (For it is not possible) and so on.
Bây giờ, người chất vấn giải thích ý của mình bằng “Na hi sakkā” (không thể) v.v.
Verañjānaḷerupucimandamūlānaṃ bhūmibhāgavasena bhinnattāyeva hi na sakkā ubhayattha teneva samayena viharituṃ, ‘‘ubhayattha teneva samayenā’’ti ca vuttattā nānāsamaye vihāro avāritoti veditabbo.
For it is indeed not possible to dwell in both places at the same time, because the regions of Verañjā and the root of the Naḷeru Pucimanda tree are distinct. And since it says "in both places at the same time," it should be understood that dwelling at different times is not prohibited.
Vì Verañjā và gốc cây Pucimanda của Naḷeru khác nhau về mặt địa lý, nên không thể an trú ở cả hai nơi cùng một lúc. Và vì đã nói “ở cả hai nơi cùng một lúc,” nên cần hiểu rằng việc an trú vào những thời điểm khác nhau thì không bị ngăn cấm.
Itaro sabbametaṃ aviparītamatthaṃ ajānantena tayā vuttanti dassento ‘‘na kho panetaṃ evaṃ daṭṭhabba’’ntiādimāha.
The other (speaker), indicating that all this was stated by you who did not understand the correct meaning, says "Na kho panetaṃ evaṃ daṭṭhabbaṃ" (But this should not be understood thus) and so on.
Người kia, để chỉ ra rằng tất cả những điều này đã được nói bởi người chất vấn mà không hiểu ý nghĩa đúng đắn, đã nói “Na kho panetaṃ evaṃ daṭṭhabba” v.v.
Tattha etanti ‘‘verañjāyaṃ viharati naḷerupucimandamūle’’ti etaṃ vacanaṃ.
Here, "etaṃ" refers to the statement "he dwells in Verañjā, at the root of the Naḷeru Pucimanda tree."
Ở đây, “etaṃ” (điều này) là lời nói “Ngài an trú tại Verañjā, dưới gốc cây Pucimanda của Naḷeru.”
Evanti ‘‘yadi tāva bhagavā’’tiādinā yaṃ taṃ bhavatā coditaṃ, taṃ atthato evaṃ na kho pana daṭṭhabbaṃ, na ubhayattha apubbaṃ acarimaṃ vihāradassanatthanti attho.
"Evaṃ" means that what was questioned by you in "Yadi tāva Bhagavā" and so on, should not be understood in that way as to its meaning, nor as indicating a dwelling in both places simultaneously without precedence or subsequence.
“Evaṃ” (như vậy) có nghĩa là điều mà quý vị đã chất vấn bằng “Yadi tāva bhagavā” v.v., thì về mặt ý nghĩa, điều đó không nên được hiểu như vậy; tức là không phải để chỉ ra sự an trú ở cả hai nơi mà không có trước sau.
Idāni attanā yathādhippetaṃ aviparītamatthaṃ tassa ca paṭikacceva vuttabhāvaṃ tena ca appaṭividdhataṃ pakāsento ‘‘nanu avocumha samīpatthe bhummavacana’’ntiādimāha.
Now, revealing his own intended and correct meaning, and also that it was stated beforehand and not grasped by the other, he says "Did we not say that the locative case is for the meaning of proximity?" and so on.
Bây giờ, để làm rõ ý nghĩa đúng đắn mà mình muốn nói, và rằng nó đã được nói trước đó nhưng người kia không hiểu, Ngài nói “Nanu avocumha samīpatthe bhummavacana” (Chẳng phải chúng ta đã nói rằng cách thức chỉ địa điểm được dùng với nghĩa gần gũi) v.v.
Goyūthānīti gomaṇḍalāni.
"Goyūthāni" means herds of cattle.
“Goyūthānī” có nghĩa là đàn bò.
Evampi naḷerupucimandamūle viharaticceva vattabbaṃ, na verañjāyanti, tasmā samīpādhikaraṇatthavasena ubhayathā nidānakittane kiṃ payojananti codanaṃ manasi nidhāyāha ‘‘gocaragāmanidassanattha’’ntiādi.
Even so, it should be said only that he was dwelling at the root of the Naleru-pucimanda tree, not “at Verañjā.” Therefore, bearing in mind the objection, “What is the purpose of stating the basis in both ways, through the meaning of proximity as the principal cause?” he said, “to show the alms-resort village,” and so on.
Như vậy, cũng cần phải nói là trú tại gốc cây naḷeru-pucimanda, chứ không phải ở Verañjā. Do đó, khi ghi chép nguyên nhân theo cả hai cách với ý nghĩa của địa điểm gần, thì lợi ích gì, câu hỏi này được giữ trong tâm trí,* nói "để chỉ ra làng khất thực" và vân vân.
Assāti bhagavato.
Of him means of the Blessed One.
Assā là của Thế Tôn.
Avassañcettha gocaragāmakittanaṃ kattabbaṃ.
And the mention of the alms-resort village must certainly be made here.
Ở đây, việc đề cập đến làng khất thực là điều tất yếu phải làm.
Yathā hi naḷerupucimandamūlakittanaṃ pabbajitānuggahakaraṇādianekappayojanaṃ, evaṃ gocaragāmakittanampi gahaṭṭhānuggahakaraṇādivividhappayojananti dassento ‘‘verañjākittanenā’’tiādimāha.
Just as the mention of the root of the Naleru-pucimanda tree has many purposes, such as rendering assistance to the ordained, so too the mention of the alms-resort village has various purposes, such as rendering assistance to householders. Showing this, he said, “By the mention of Verañjā,” and so on.
Thật vậy, cũng như việc đề cập đến gốc cây naḷeru-pucimanda có nhiều lợi ích như giúp đỡ các bậc xuất gia, thì việc đề cập đến làng khất thực cũng có nhiều lợi ích khác nhau như giúp đỡ các gia chủ, khi chỉ ra điều đó,* nói "bằng cách đề cập đến Verañjā" và vân vân.
Tattha gahaṭṭhānuggahakaraṇanti tesaṃ tattha paccayaggahaṇena upasaṅkamanapayirupāsanādīnaṃ okāsadānena dhammadesanāya saraṇesu sīlesu ca patiṭṭhāpanena yathūpanissayaṃ uparivisesādhigamāvahanena ca gahaṭṭhānaṃ anuggahakaraṇaṃ.
Therein, rendering assistance to householders means rendering assistance to householders by accepting requisites from them, by giving them the opportunity for approaching and attending, by teaching the Dhamma, by establishing them in the refuges and moral precepts, and by leading them to the attainment of higher distinctions according to their supporting conditions.
Trong đó, giúp đỡ các gia chủ là việc giúp đỡ các gia chủ bằng cách nhận các vật dụng cúng dường ở đó, bằng cách tạo cơ hội cho họ đến gần, phục vụ, vân vân, bằng cách thuyết pháp, bằng cách thiết lập họ vào quy y và giới luật, và bằng cách dẫn dắt họ đạt được những thành tựu đặc biệt cao hơn tùy theo căn cơ.
Pabbajitānuggahakaraṇanti uggahaparipucchānaṃ kammaṭṭhānānuyogassa ca anurūpavasanaṭṭhānapariggahenettha pabbajitānaṃ anuggahakaraṇaṃ.
Rendering assistance to the ordained means rendering assistance to the ordained here by providing a suitable dwelling place for study, inquiry, and the practice of meditation subjects.
Giúp đỡ các bậc xuất gia là việc giúp đỡ các bậc xuất gia ở đây bằng cách chọn một nơi ở phù hợp cho việc học hỏi, hỏi đáp và thực hành thiền định.
Paccayaggahaṇeneva paccayaparibhogasiddhito āha ‘‘tathā purimena…pe… vivajjananti.
Since the enjoyment of requisites is accomplished simply by the acceptance of requisites, he said, “Thus, by the former… and so on… the avoidance.”
Vì sự thọ dụng các vật dụng cúng dường được thành tựu ngay khi nhận các vật dụng cúng dường, nên* nói "cũng như với điều trước…pe… từ bỏ".
Tattha purimenāti verañjāvacanena.
Therein, by the former means by the word “Verañjā.”
Trong đó, với điều trước là với từ Verañjā.
Āhito ahaṃmāno etthāti attā, attabhāvo.
The self, the personality-group, is that wherein the conceit ‘I am’ is deposited.
Cái mà sự kiêu mạn về "ta" được đặt vào, đó là tự ngã, là thân phận.
Tassa kilamatho kilantabhāvo attakilamatho, attapīḷā attadukkhanti vuttaṃ hoti, tassa anuyogo karaṇaṃ attakilamathānuyogo, upavāsakaṇṭakāpassayaseyyādinā attano dukkhuppādananti vuttaṃ hoti.
The fatigue of that is attakilamatho, fatigue of self; it means self-affliction, self-suffering. The practice of that, the undertaking of it, is attakilamathānuyogo; it means producing suffering for oneself through fasting, lying on a bed of thorns, and so on.
Sự mệt mỏi của nó, trạng thái mệt mỏi là sự hành hạ tự ngã, sự làm khổ tự ngã, sự đau khổ tự ngã, tức là sự tự gây ra đau khổ cho bản thân bằng cách nhịn ăn, nằm trên giường gai, vân vân.
Tassa vivajjanaṃ attakilamathānuyogavivajjanaṃ.
The avoidance of that is the avoidance of the practice of self-mortification.
Sự từ bỏ điều đó là sự từ bỏ việc hành hạ tự ngã.
Antogāme vasantānaṃ anicchantānampi visabhāgarūpādiārammaṇadassanādisambhavato bahigāme patirūpaṭṭhāne vasantānaṃ tadabhāvato āha ‘‘pacchimena vatthukāmappahānato’’tiādi.
Since for those dwelling inside a village, the seeing of disagreeable objects such as forms, etc., is possible even if they do not wish it, whereas for those dwelling in a suitable place outside a village this does not occur, he said, “by the latter, through the abandoning of the objects of sensuality,” and so on.
Vì những người sống trong làng, ngay cả khi không muốn, cũng có thể nhìn thấy những đối tượng như sắc tướng không phù hợp, vân vân, còn những người sống ở nơi thích hợp bên ngoài làng thì không có điều đó, nên* nói "với điều sau là từ bỏ dục cảnh" và vân vân.
Tattha pacchimenāti naḷerupucimandamūlavacanena.
Therein, by the latter means by the words “the root of the Naleru-pucimanda tree.”
Trong đó, với điều sau là với từ gốc cây naḷeru-pucimanda.
Kilesakāmassa vatthubhūtattā rūpādayo pañca kāmaguṇā vatthukāmo, tassa pahānaṃ vatthukāmappahānaṃ.
Because they are the basis of sensual defilement, the five strands of sensual pleasure, such as forms, are the objects of sensuality. The abandoning of this is the abandoning of the objects of sensuality.
Vì các sắc, thinh, hương, vị, xúc là đối tượng của phiền não dục, nên năm đối tượng dục này là dục cảnh, sự từ bỏ nó là sự từ bỏ dục cảnh.
Kāmasukhallikānuyogavivajjanupāyadassananti vatthukāmesu kilesakāmasaṃyuttassa sukhassa yogo anuyogo anubhavo, tassa parivajjane upāyadassanaṃ.
Showing the method for avoiding the practice of indulgence in sensual pleasure means showing the method for avoiding the practice, the indulgence, the experience of pleasure connected with sensual defilement in the objects of sensuality.
Chỉ ra phương tiện để từ bỏ việc buông thả theo dục lạc là việc chỉ ra phương tiện để từ bỏ sự buông thả, sự hưởng thụ lạc thú liên quan đến phiền não dục trong dục cảnh.
Dhammadesanābhiyogavivekādhimuttīnaṃ hetubhūtā eva karuṇāpaññā dhammadesanāya upagamanassa tato apagamanassa kāraṇabhūtā hontīti āha ‘‘purimena karuṇāya upagamana’’ntiādi.
Because compassion and wisdom, which are the very causes of the application to teaching the Dhamma and the inclination toward seclusion, are the reasons for going to and departing from there, he said, “by the former, the approach through compassion,” and so on.
Chính lòng bi và tuệ là nguyên nhân của sự nỗ lực thuyết pháp và sự thiên về độc cư, chúng là nguyên nhân của sự đến để thuyết pháp và sự rời đi khỏi đó, nên* nói "với điều trước là sự đến bằng lòng bi" và vân vân.
Karuṇāpaññāyeva hi anantaradukassa hetū honti.
For it is compassion and wisdom that are the causes of the immediately following pair.
Chính lòng bi và tuệ là nguyên nhân của khổ đau ngay lập tức.
Etena ca karuṇāya upagamanaṃ na lābhādinimittaṃ, paññāya apagamanaṃ na virodhādinimittanti upagamanāpagamanānaṃ nirupakkilesataṃ vibhāvibhanti daṭṭhabbaṃ.
And by this, it should be seen that he clarifies the undefiled nature of the approaching and departing, in that the approach through compassion is not for the sake of gains and so on, and the departure through wisdom is not for the sake of opposition and so on.
Qua điều này, cần phải hiểu rằng sự đến bằng lòng bi không phải vì lợi lộc, vân vân, và sự rời đi bằng tuệ không phải vì sự đối kháng, vân vân, điều này làm sáng tỏ sự thanh tịnh của việc đến và đi.
Adhimuttatanti tanninnabhāvaṃ.
Inclination means the leaning towards that.
Adhimuttata là trạng thái hướng về điều đó.
Nirupalepananti anupalepanaṃ anallīyanaṃ.
Being unsullied means not being sullied, not clinging.
Nirupalepana là không bị nhiễm ô, không bị dính mắc.
Dhammikasukhāpariccāganimittanti ettha dhammikasukhaṃ nāma anavajjasukhaṃ.
Here, for the sake of not abandoning righteous happiness, righteous happiness means blameless happiness.
Trong dhammikasukhāpariccāganimitta (nguyên nhân không từ bỏ lạc hợp pháp), lạc hợp pháp là lạc không đáng trách.
Tañhi dhammikaṃ lābhaṃ paṭicca uppannattā ‘‘dhammikasukha’’nti vuccati.
Because it arises in dependence on a righteous gain, it is called “righteous happiness.”
Thật vậy, lạc đó được gọi là "lạc hợp pháp" vì nó phát sinh từ lợi lộc hợp pháp.
Uttarimanussadhammābhiyoganimittaṃ phāsuvihāranti sambandho.
The connection is: for the sake of applying oneself to the higher states of humans, a comfortable abiding.
Có mối liên hệ là sự an trú thoải mái là nguyên nhân của sự nỗ lực vào các pháp siêu nhân.
Manussānaṃ upakārabahulatanti paccayapaṭiggahaṇadhammadesanādivasena upakārabahulataṃ.
The great benefit to human beings means the great benefit through the acceptance of requisites, the teaching of the Dhamma, and so on.
Sự giúp đỡ nhiều cho loài người là sự giúp đỡ nhiều bằng cách nhận vật dụng cúng dường, thuyết pháp, vân vân.
Devatānaṃ upakārabahulataṃ janavivittatāya.
The great benefit to deities is due to the seclusion from people.
Sự giúp đỡ nhiều cho chư thiên là do nơi vắng vẻ không có người.
Pacurajanavivittañhi ṭhānaṃ devā upasaṅkamitabbaṃ maññanti.
For deities consider a place that is secluded from many people as worthy of being approached.
Thật vậy, chư thiên cho rằng một nơi vắng vẻ nhiều người là nơi đáng đến.
Loke saṃvaḍḍhabhāvanti āmisopabhogena saṃvaḍḍhitabhāvaṃ.
The state of being nourished in the world means the state of having been nourished through the enjoyment of material things.
Sự tăng trưởng trong thế gian là trạng thái được tăng trưởng bằng cách thọ dụng các vật chất.
Ekapuggaloti ettha (a. ni. aṭṭha. 1.1.170) ekoti dutiyādipaṭikkhepattho gaṇanaparicchedo.
Here, in one person, one is a numerical specification, meaning the rejection of a second, etc.
Trong ekapuggalo (một người) ở đây (A.N.A. 1.1.170), eko có nghĩa là loại trừ thứ hai, vân vân, là sự phân định số lượng.
Puggaloti sammutikathā, na paramatthakathā.
Person is a conventional expression, not an ultimate expression.
Puggalo là cách nói quy ước, không phải cách nói tối hậu.
Buddhassa hi bhagavato duvidhā desanā sammutidesanā paramatthadesanā cāti.
For the Blessed One, the Buddha, has two kinds of teaching: conventional teaching and ultimate teaching.
Thật vậy, Thế Tôn có hai loại giáo pháp: giáo pháp quy ước và giáo pháp tối hậu.
Ayamattho pana heṭṭhā vitthāritovāti idha na vuccati.
But since this matter was explained in detail before, it is not stated here.
Tuy nhiên, ý nghĩa này đã được giải thích chi tiết ở dưới nên không được nói ở đây.
Eko ca so puggalo cāti ekapuggalo.
He is one and he is a person, thus ‘one person’.
Chỉ có một người, đó là ekapuggalo (một người).
Kenaṭṭhena ekapuggalo?
In what sense is he ‘one person’?
Vì ý nghĩa nào mà là một người?
Asadisaṭṭhena guṇavisiṭṭhaṭṭhena asamasamaṭṭhena.
In the sense of being unequalled, in the sense of being distinguished by qualities, in the sense of being equal to the unequal.
Vì ý nghĩa không ai sánh bằng, vì ý nghĩa có phẩm chất đặc biệt, vì ý nghĩa không ai bằng.
So hi dasannaṃ pāramīnaṃ paṭipāṭiyā āvajjanaṃ ādiṃ katvā bodhisambhāraguṇehi ceva buddhaguṇehi ca sesamahājanena asadisoti asadisaṭṭhenapi ekapuggalo.
For he, beginning with the reflection on the ten perfections in order, is unequalled by the rest of the great populace with respect to the qualities that are requisites for Awakening and with respect to the qualities of a Buddha; thus he is one person in the sense of being unequalled.
Thật vậy, Ngài, bắt đầu từ sự quán xét theo thứ tự mười ba-la-mật sau khi nhận được lời thọ ký dưới chân Phật Dīpaṅkara, và tìm kiếm các pháp tạo thành Phật, thấy mười ba-la-mật và quyết định "ta phải viên mãn các pháp này", ngay cả khi đang viên mãn ba-la-mật bố thí, cũng được gọi là uppajjamāno (người đang sinh khởi).
Ye cassa te guṇā, tepi aññasattānaṃ guṇehi visiṭṭhāti guṇavisiṭṭhaṭṭhenapi ekapuggalo.
And those qualities of his are also distinguished from the qualities of other beings; thus he is one person in the sense of being distinguished by qualities.
Ngay cả khi đang viên mãn ba-la-mật giới…pe… ba-la-mật xả, mười ba-la-mật này, ngay cả khi đang viên mãn mười upapāramī (tiểu ba-la-mật), cũng được gọi là uppajjamāno.
Purimakā sammāsambuddhā sabbasattehi asamā, tehi saddhiṃ ayameva eko rūpakāyaguṇehi ceva nāmakāyaguṇehi ca samoti asamasamaṭṭhenapi ekapuggalo.
The Perfectly Enlightened Ones of the past were unequal to all beings; with them, he alone is equal with respect to the qualities of the physical body and the qualities of the mental body; thus he is one person in the sense of being equal to the unequal.
Ngay cả khi đang viên mãn mười paramatthapāramī (tối thượng ba-la-mật), cũng được gọi là uppajjamāno.
Loketi sattaloke.
In the world means in the world of beings.
Ngay cả khi đang từ bỏ năm đại thí xả, cũng được gọi là uppajjamāno.
Uppajjamāno uppajjatīti idaṃ pana ubhayampi vippakatavacanameva.
As for arising, he arises, both of these are just expressions of an ongoing action.
Uppajjamāno uppajjatī (người đang sinh khởi sinh khởi) – cả hai điều này đều là lời nói chưa hoàn chỉnh.
Uppajjanto bahujanahitatthāya uppajjati, na aññena kāraṇenāti evaṃ panettha attho veditabbo.
The meaning here should be understood thus: while arising, he arises for the welfare of the manyfolk, not for any other reason.
Ở đây, cần phải hiểu ý nghĩa là: người đang sinh khởi sinh khởi vì lợi ích của nhiều người, không phải vì lý do nào khác.
Evarūpañcettha lakkhaṇaṃ na sakkā etaṃ aññena saddalakkhaṇena paṭibāhituṃ.
And such a grammatical feature here cannot be refuted by any other grammatical rule.
Một đặc điểm như vậy ở đây không thể bị bác bỏ bởi bất kỳ đặc điểm từ ngữ nào khác.
Apica uppajjamāno nāma, uppajjati nāma, uppanno nāmāti ayamettha bhedo veditabbo.
Moreover, the distinction here should be understood as: he is ‘arising,’ he ‘arises,’ he ‘has arisen.’
Hơn nữa, ở đây cần phải hiểu sự khác biệt là uppajjamāno nāma (người đang sinh khởi), uppajjati nāma (người sinh khởi), uppanno nāma (người đã sinh khởi).
Esa hi dīpaṅkarapādamūlato laddhabyākaraṇo buddhakārakadhamme pariyesanto dasa pāramiyo disvā ‘‘ime dhammā mayā pūretabbā’’ti katasanniṭṭhāno dānapāramiṃ pūrentopi uppajjamāno nāma.
For he, having received the prediction at the feet of Dīpaṅkara, while searching for the qualities that make a Buddha, having seen the ten perfections and made the resolution, “These qualities must be fulfilled by me,” is called ‘arising’ even while fulfilling the perfection of giving.
Thật vậy, vị ấy, sau khi nhận được lời thọ ký dưới chân Phật Dīpaṅkara, tìm kiếm các pháp tạo thành Phật, thấy mười ba-la-mật và quyết định "ta phải viên mãn các pháp này", ngay cả khi đang viên mãn ba-la-mật bố thí, cũng được gọi là uppajjamāno.
Sīlapāramiṃ…pe… upekkhāpāraminti imā dasa pāramiyo pūrentopi, dasa upapāramiyo pūrentopi uppajjamāno nāma.
While fulfilling the perfection of virtue… and so on… the perfection of equanimity—while fulfilling these ten perfections, he is called ‘arising.’ While fulfilling the ten sub-perfections, he is called ‘arising.’
Ngay cả khi đang viên mãn ba-la-mật giới…pe… ba-la-mật xả, mười ba-la-mật này, ngay cả khi đang viên mãn mười upapāramī, cũng được gọi là uppajjamāno.
Dasa paramatthapāramiyo pūrentopi uppajjamāno nāma.
While fulfilling the ten ultimate perfections, he is called ‘arising.’
Ngay cả khi đang viên mãn mười paramatthapāramī, cũng được gọi là uppajjamāno.
Pañca mahāpariccāge pariccajantopi uppajjamāno nāma.
While making the five great relinquishments, he is called ‘arising.’
Ngay cả khi đang từ bỏ năm đại thí xả, cũng được gọi là uppajjamāno.
Ñātatthacariyaṃ lokatthacariyaṃ buddhatthacariyaṃ pūrayamānopi uppajjamāno nāma.
While fulfilling the conduct for the welfare of his relatives, the conduct for the welfare of the world, and the conduct for the welfare of Buddhahood, he is called ‘arising.’
Ngay cả khi đang viên mãn hạnh lợi ích thân quyến, hạnh lợi ích thế gian, hạnh lợi ích Phật quả, cũng được gọi là uppajjamāno.
Kappasatasahassādhikāni cattāri asaṅkhyeyyāni buddhakārake dhamme matthakaṃ pāpentopi uppajjamāno nāma.
While bringing to perfection the qualities that make a Buddha over four incalculables and one hundred thousand eons, he is called ‘arising.’
Ngay cả khi đang hoàn thành các pháp tạo thành Phật trong bốn a-tăng-kỳ và một trăm ngàn đại kiếp, cũng được gọi là uppajjamāno.
Vessantarattabhāvaṃ pahāya tusitapure paṭisandhiṃ gahetvā saṭṭhivassasatasahassādhikā sattapaṇṇāsa vassakoṭiyo tiṭṭhantopi uppajjamāno nāma.
Even after abandoning the state of being Vessantara, taking relinking in the Tusita realm, and remaining there for fifty-seven crores and six million years, he is called ‘one who is arising’.
Ngay cả khi đã từ bỏ thân phận Vessantara, tái sinh vào cõi trời Tusita và an trú ở đó trong năm mươi bảy vạn sáu mươi ngàn năm, cũng được gọi là uppajjamāno.
Devatāhi yācito pañca mahāvilokanāni viloketvā māyādeviyā kucchismiṃ paṭisandhiṃ gaṇhantopi, anūnādhike dasa māse gabbhavāsaṃ vasantopi uppajjamāno nāma.
Even when, requested by the devas, he made the five great investigations and took relinking in the womb of Queen Māyā, and even while dwelling in the womb for ten months, no more, no less, he is called ‘one who is arising’.
Ngài được chư thiên thỉnh cầu, quán xét năm điều đại quán, rồi thọ sinh vào thai của Hoàng hậu Māyā, và an trú trong thai mười tháng không thiếu không thừa, đó gọi là 'sinh ra' (uppajjamāno).
Ekūnatiṃsa vassāni agāramajjhe tiṭṭhantopi uppajjamāno nāma.
Even while remaining in the household life for twenty-nine years, he is called ‘one who is arising’.
Ngài an trú trong gia đình hai mươi chín năm, đó cũng gọi là 'sinh ra'.
Kāmesu ādīnavaṃ nekkhamme ca ānisaṃsaṃ disvā rāhulabhaddassa jātadivase channasahāyo kaṇḍakaṃ assavaramāruyha nikkhamantopi uppajjamāno nāma.
Even when, having seen the danger in sensual pleasures and the benefit in renunciation, on the day of the noble Rāhula’s birth, he departed, accompanied by Channa and mounted on the excellent horse Kaṇṭhaka, he is called ‘one who is arising’.
Ngài thấy sự nguy hiểm trong các dục lạc và lợi ích trong sự xuất ly, vào ngày Thái tử Rāhula ra đời, cùng với người bạn Channa cưỡi ngựa Kanthaka xuất gia, đó cũng gọi là 'sinh ra'.
Tīṇi rajjāni atikkamanto anomanaditīre pabbajantopi uppajjamāno nāma.
Even while crossing three kingdoms and going forth on the bank of the river Anomā, he is called ‘one who is arising’.
Ngài vượt qua ba vương quốc, xuất gia bên bờ sông Anomā, đó cũng gọi là 'sinh ra'.
Chabbassāni mahāpadhānaṃ karontopi uppajjamāno nāma.
Even while undertaking the great striving for six years, he is called ‘one who is arising’.
Ngài thực hành đại khổ hạnh sáu năm, đó cũng gọi là 'sinh ra'.
Paripākagate ñāṇe oḷārikaṃ āhāraṃ āharantopi uppajjamāno nāma.
Even when, his knowledge having ripened, he partook of physical food, he is called ‘one who is arising’.
Khi trí tuệ đã chín muồi, Ngài thọ nhận thực phẩm thô, đó cũng gọi là 'sinh ra'.
Sāyanhasamaye visākhapuṇṇamāyaṃ mahābodhimaṇḍaṃ āruyha mārabalaṃ vidhametvā paṭhamayāme pubbenivāsaṃ anussaritvā majjhimayāme dibbacakkhuṃ parisodhetvā pacchimayāmasamanantare dvādasaṅgaṃ paṭiccasamuppādaṃ anulomapaṭilomato sammasitvā sotāpattimaggaṃ paṭivijjhantopi uppajjamāno nāma.
Even when, on the evening of the full moon of Visākha, he ascended to the seat of great awakening, vanquished the forces of Māra, recollected his past lives in the first watch, purified the divine eye in the middle watch, and immediately after the last watch, contemplated the twelve-linked dependent origination in forward and reverse order and penetrated the path of stream-entry, he is called ‘one who is arising’.
Vào buổi chiều ngày trăng tròn tháng Visākha, Ngài lên đại Bồ-đề đạo tràng, đánh bại quân ma, trong canh đầu nhớ lại các đời quá khứ, trong canh giữa thanh lọc thiên nhãn, ngay sau canh cuối, Ngài quán xét Thập nhị nhân duyên theo chiều thuận và nghịch, và chứng ngộ đạo Tu-đà-hoàn, đó cũng gọi là 'sinh ra'.
Sotāpattiphalakkhaṇepi sakadāgāmiphalakkhaṇepi anāgāmiphalakkhaṇepi uppajjamāno nāma.
Even at the moment of the fruit of stream-entry, at the moment of the fruit of once-returning, and at the moment of the fruit of non-returning, he is called ‘one who is arising’.
Vào khoảnh khắc quả Tu-đà-hoàn, vào khoảnh khắc quả Tư-đà-hàm, vào khoảnh khắc quả A-na-hàm, đó cũng gọi là 'sinh ra'.
Arahattamaggakkhaṇe pana uppajjati nāma.
But at the moment of the path of Arahatship, he is called ‘arises’.
Nhưng vào khoảnh khắc đạo A-la-hán, thì gọi là sinh ra (uppajjati).
Arahattaphalakkhaṇe uppanno nāma.
At the moment of the fruit of Arahatship, he is called ‘arisen’.
Vào khoảnh khắc quả A-la-hán, thì gọi là đã sinh ra (uppanno).
Buddhānañhi sāvakānaṃ viya na paṭipāṭiyā iddhividhañāṇādīni uppajjanti, saheva pana arahattamaggena sakalopi sabbaññutaññāṇādi guṇarāsi āgatova nāma hoti, tasmā nibbattasabbakiccattā arahattaphalakkhaṇe uppanno nāma hoti.
For Buddhas, the knowledge of psychic powers and so forth do not arise in sequence as they do for disciples; rather, the entire multitude of qualities, such as the knowledge of omniscience, is said to have arrived together with the path of Arahatship. Therefore, because all duties have been accomplished, at the moment of the fruit of Arahatship, he is called ‘arisen’.
Quả thật, đối với các vị Phật, các trí như thần thông không sinh ra theo thứ tự như các vị Thanh văn; mà toàn bộ các phẩm chất như Nhất thiết trí đã đến cùng với đạo A-la-hán. Do đó, vì tất cả công việc đã hoàn thành, vào khoảnh khắc quả A-la-hán, Ngài được gọi là 'đã sinh ra'.
Imasmimpi sutte arahattaphalakkhaṇaṃyeva sandhāya ‘‘uppajjatī’’ti vuttaṃ.
In this sutta as well, “arises” is said with reference to the moment of the fruit of Arahatship.
Trong kinh này, từ ‘‘uppajjati’’ (sinh ra) cũng được nói đến để chỉ khoảnh khắc quả A-la-hán.
Uppanno hotīti ayañhettha attho.
“He has arisen” is the meaning here.
Ở đây, ý nghĩa là 'đã sinh ra' (uppanno hoti).
Bahujanahitāyāti mahājanassa hitatthāya uppajjati.
For the welfare of many beings means he arises for the welfare of the great multitude.
Vì lợi ích của nhiều người (Bahujanahitāya): Ngài sinh ra vì lợi ích của đại chúng.
Bahujanasukhāyāti mahājanassa sukhatthāya uppajjati.
For the happiness of many beings means he arises for the happiness of the great multitude.
Vì hạnh phúc của nhiều người (Bahujanasukhāya): Ngài sinh ra vì hạnh phúc của đại chúng.
Lokānukampāyāti sattalokassa anukampaṃ paṭicca uppajjati.
Out of compassion for the world means he arises on account of compassion for the world of beings.
Vì lòng bi mẫn đối với thế gian (Lokānukampāya): Ngài sinh ra vì lòng bi mẫn đối với chúng sinh.
Katarasattalokassāti?
For which world of beings?
Đối với chúng sinh nào?
Yo tathāgatassa dhammadesanaṃ sutvā amatapānaṃ pivi, dhammaṃ paṭivijjhi, tassa.
For that one which, having heard the Tathāgata's teaching of the Dhamma, drank the deathless nectar and penetrated the Dhamma.
Đối với những ai đã nghe giáo pháp của Đức Như Lai, đã uống nước cam lồ, đã chứng ngộ giáo pháp.
Bhagavatā hi mahābodhimaṇḍe sattasattāhaṃ vītināmetvā bodhimaṇḍā isipatanaṃ āgamma ‘‘dveme, bhikkhave, antā pabbajitena na sevitabbā’’ti dhammacakkappavattanasuttante (saṃ. ni. 3.5; mahāva. 13) desite āyasmatā aññāsikoṇḍaññattherena saddhiṃ aṭṭhārasakoṭisaṅkhā brahmāno amatapānaṃ piviṃsu, etassa sattalokassa anukampāya uppanno.
Indeed, when the Blessed One, after spending seven weeks at the seat of great awakening, came from the seat of awakening to Isipatana and taught the Discourse on the Turning of the Wheel of the Dhamma, beginning, “Monks, these two extremes should not be cultivated by one who has gone forth,” eighteen crores of brahmās, together with the venerable Elder Aññāsi Koṇḍañña, drank the deathless nectar. He has arisen out of compassion for this world of beings.
Quả thật, sau khi Đức Thế Tôn trải qua bảy tuần tại Bồ-đề đạo tràng, rồi đến Isipatana từ Bồ-đề đạo tràng, khi kinh Chuyển Pháp Luân (Saṃ. Ni. 3.5; Mahāva. 13) được thuyết giảng: “Này các Tỳ-kheo, có hai cực đoan mà người xuất gia không nên thực hành”, mười tám ức chư Phạm thiên cùng với Tôn giả Aññāsikoṇḍañña đã uống nước cam lồ. Ngài sinh ra vì lòng bi mẫn đối với chúng sinh đó.
Pañcamadivase anattalakkhaṇasuttantapariyosāne pañcavaggiyattherā arahatte patiṭṭhahiṃsu, etassapi sattalokassa anukampāya uppanno.
On the fifth day, at the conclusion of the Discourse on the Characteristic of Not-Self, the elders of the group of five were established in Arahatship. He has also arisen out of compassion for this world of beings.
Vào ngày thứ năm, khi kinh Vô Ngã Tướng kết thúc, năm vị Tỳ-kheo nhóm Kiều Trần Như đã chứng quả A-la-hán. Ngài sinh ra vì lòng bi mẫn đối với chúng sinh đó.
Tato yasadārakappamukhe pañcapaṇṇāsa purise arahatte patiṭṭhāpesi, tato kappāsikavanasaṇḍe tiṃsa bhaddavaggiye tayo magge ca phalāni ca sampāpesi, etassapi sattalokassa anukampāya uppanno.
Thereafter, he established fifty-five men, led by Yasa the householder’s son, in Arahatship. Then, in the cotton-tree grove, he brought the thirty Bhaddavaggiya to attain the three paths and fruits. He has also arisen out of compassion for this world of beings.
Sau đó, Ngài giúp năm mươi lăm người, đứng đầu là thanh niên Yasa, chứng quả A-la-hán; sau đó, Ngài giúp ba mươi vị Bhaddavaggī tại rừng Kapaṭṭika đạt được ba đạo và quả. Ngài sinh ra vì lòng bi mẫn đối với chúng sinh đó.
Gayāsīse ādittapariyāyapariyosāne (saṃ. ni. 4.28; mahāva. 54) jaṭilasahassaṃ arahatte patiṭṭhāpesi, tato laṭṭhivane bimbisārappamukhā ekādasa nahutā brāhmaṇagahapatikā satthu dhammadesanaṃ sutvā sotāpattiphale patiṭṭhahiṃsu, ekaṃ nahutaṃ saraṇesu patiṭṭhitaṃ.
At Gayāsīsa, at the conclusion of the Fire Sermon, he established a thousand matted-hair ascetics in Arahatship. Then, in the Laṭṭhivana, eleven nahutas of brahmins and householders, led by Bimbisāra, having heard the Master's teaching of the Dhamma, were established in the fruit of stream-entry; one nahuta was established in the refuges.
Tại Gayāsīsa, khi kinh Lửa Cháy (Saṃ. Ni. 4.28; Mahāva. 54) kết thúc, Ngài giúp một ngàn vị ẩn sĩ tóc bện chứng quả A-la-hán; sau đó, tại Laṭṭhivana, mười một vạn Bà-la-môn và gia chủ, đứng đầu là vua Bimbisāra, đã nghe giáo pháp của Đức Đạo Sư và chứng quả Tu-đà-hoàn; một vạn người đã quy y Tam Bảo.
Tirokuṭṭaanumodanāvasāne (khu. pā. 7. 1 ādayo) caturāsītiyā pāṇasahassehi amatapānaṃ pītaṃ.
At the end of the Tirokuṭṭa sermon, the deathless nectar was drunk by eighty-four thousand living beings.
Khi kinh Hồi Hướng Cho Người Đã Khuất (Khu. Pā. 7. 1 trở đi) kết thúc, tám mươi bốn ngàn chúng sinh đã uống nước cam lồ.
Sumanamālākārasamāgame caturāsītiyā, dhanapālasamāgame dasahi pāṇasahassehi, khadiraṅgārajātakasamāgame caturāsītiyā pāṇasahassehi, jambukaājīvakasamāgame caturāsītiyāva, ānandaseṭṭhisamāgame caturāsītiyāva pāṇasahassehi amatapānaṃ pītaṃ.
At the gathering for Sumana the garland-maker, by eighty-four thousand; at the gathering for Dhanapāla, by ten thousand living beings; at the gathering for the Khadiraṅgāra Jātaka, by eighty-four thousand living beings; at the gathering for Jambuka the Ājīvaka, by eighty-four thousand as well; at the gathering for Ānanda the wealthy merchant, the deathless nectar was drunk by eighty-four thousand living beings as well.
Trong buổi hội kiến với người làm vòng hoa Sumana, tám mươi bốn ngàn; trong buổi hội kiến với Dhanapāla, mười ngàn chúng sinh; trong buổi hội kiến với câu chuyện tiền thân Khadiraṅgāra, tám mươi bốn ngàn chúng sinh; trong buổi hội kiến với tu sĩ khổ hạnh Jambuka, tám mươi bốn ngàn; trong buổi hội kiến với trưởng giả Ānanda, tám mươi bốn ngàn chúng sinh đã uống nước cam lồ.
Pāsāṇakacetiye pārāyanasuttakathādivase (su. ni. 982 ādayo) cuddasa koṭiyo amatapānaṃ piviṃsu.
At the Pāsāṇaka Cetiya, on the day of the discourse on the Pārāyana Sutta, fourteen crores drank the deathless nectar.
Tại Pāsāṇakacetiya, vào ngày thuyết kinh Pārāyana (Su. Ni. 982 trở đi), mười bốn ức chúng sinh đã uống nước cam lồ.
Yamakapāṭihāriyadivase vīsati pāṇakoṭiyo, tāvatiṃsabhavane paṇḍukambalasilāyaṃ nisīditvā mātaraṃ kāyasakkhiṃ katvā sattappakaraṇaṃ abhidhammaṃ desentassa asīti pāṇakoṭiyo, devorohaṇe tiṃsa pāṇakoṭiyo, sakkapañhasuttante (dī. ni. 2.344 ādayo) asīti devasahassāni amatapānaṃ piviṃsu.
On the day of the Twin Miracle, twenty crores of living beings; in the Tāvatiṃsa realm, as he sat on the Paṇḍukambala stone and taught the Abhidhamma of seven treatises with his mother as a direct witness, eighty crores of living beings; at the descent from the deva world, thirty crores of living beings; in the Sakkapañha Sutta, eighty thousand devas drank the deathless nectar.
Vào ngày song thần biến, hai mươi ức chúng sinh; khi Ngài ngồi trên tảng đá Paṇḍukambala tại cõi trời Tāvatiṃsa, lấy mẹ làm nhân chứng và thuyết giảng Vi Diệu Pháp gồm bảy bộ, tám mươi ức chúng sinh; khi Ngài giáng trần, ba mươi ức chúng sinh; trong kinh Sakkapañha (Dī. Ni. 2.344 trở đi), tám mươi ngàn chư thiên đã uống nước cam lồ.
Mahāsamayasuttante (dī. ni. 2.331 ādayo) maṅgalasutte (khu. pā. 5.1 ādayo; su. ni. maṅgalasutta) cūḷarāhulovāde (ma. ni. 3.416 ādayo) samacittapaṭipadāyāti (a. ni. 2.33) imesu catūsu ṭhānesu abhisamayappattasattānaṃ paricchedo natthi, etassapi sattalokassa anukampāya uppannoti.
In the Mahāsamaya Sutta, the Maṅgala Sutta, the Cūḷarāhulovāda, and on the path of an equanimous mind, on these four occasions there is no reckoning of the beings who attained realization. He has also arisen out of compassion for this world of beings.
Trong kinh Mahāsamaya (Dī. Ni. 2.331 trở đi), kinh Mangala (Khu. Pā. 5.1 trở đi; Su. Ni. Mangalasutta), lời khuyên cho tiểu Rāhula (Ma. Ni. 3.416 trở đi), và trong bốn trường hợp này về sự thực hành tâm bình đẳng (A. Ni. 2.33), số lượng chúng sinh chứng ngộ là vô hạn. Ngài sinh ra vì lòng bi mẫn đối với chúng sinh đó.
Yāvajjadivasā ito parampi anāgate imaṃ sāsanaṃ nissāya saggamokkhamagge patiṭṭhahantānaṃ vasenapi ayamattho veditabbo.
This meaning should be understood also by way of those who, relying on this Dispensation, will establish themselves in the path to heaven and liberation in the future, from this day forward.
Ý nghĩa này cũng nên được hiểu theo cách là nhờ vào giáo pháp này, cho đến ngày nay và cả trong tương lai, những ai nương tựa vào giáo pháp này sẽ an trú trên con đường đến thiên giới và giải thoát.
Katamo ekapuggaloti kathetukamyatāpucchā.
Who is that one person? is a question prompted by the desire to speak.
Một người nào (Katamo ekapuggalo): Là câu hỏi muốn biết danh tính.
Idāni tāya pucchāya puṭṭhaṃ ekapuggalaṃ vibhāvento ‘‘tathāgato arahaṃ sammāsambuddho’’ti āha.
Now, in analyzing the one person asked about in that question, he said, “The Tathāgata, the Arahaṃ, the Sammāsambuddha.”
Bây giờ, để giải thích về một người đã được hỏi bằng câu hỏi đó, Ngài nói: “Đức Như Lai, bậc A-la-hán, bậc Chánh Đẳng Giác”.
Tadatthaparinipphādananti lokatthanipphādanaṃ, buddhakiccasampādananti attho.
The accomplishment of that purpose means the accomplishment of the world’s purpose; the meaning is the fulfillment of the Buddha’s duties.
Hoàn thành mục đích đó (Tadatthaparinipphādanaṃ): Là hoàn thành lợi ích cho thế gian, có nghĩa là hoàn thành các công việc của một vị Phật.
Paṭhamaṃ lumbinīvane dutiyaṃ bodhimaṇḍeti lumbinīvane rūpakāyena jāto, bodhimaṇḍe dhammakāyena.
First in Lumbinīvana, second at the seat of awakening means in Lumbinīvana he was born with the physical body, at the seat of awakening with the Dhamma body.
Lần thứ nhất tại vườn Lumbinī, lần thứ hai tại Bồ-đề đạo tràng (Paṭhamaṃ lumbinīvane dutiyaṃ bodhimaṇḍe): Tại vườn Lumbinī, Ngài sinh ra với thân sắc (rūpakāya); tại Bồ-đề đạo tràng, Ngài sinh ra với thân pháp (dhammakāya).
Evamādināti ādi-saddena verañjākittanato rūpakāyassa anuggaṇhanaṃ dasseti, naḷerupucimandamūlakittanato dhammakāyassa.
By ‘and so on’, by the word ādi, the mention of Verañjā indicates the preservation of the physical body; the mention of the foot of the Naḷeru-pucimanda tree indicates the preservation of the Dhamma body.
Và tương tự như vậy (Evamādinā): Với từ tương tự (ādi), điều này chỉ ra sự ủng hộ thân sắc thông qua việc ca ngợi Verañjā, và thân pháp thông qua việc ca ngợi gốc cây Naḷeru và Pucimanda.
Tathā purimena parādhīnakiriyākaraṇaṃ, dutiyena attādhīnakiriyākaraṇaṃ.
Likewise, by the former, it indicates the performance of an action dependent on others; by the latter, the performance of an action dependent on oneself.
Tương tự, điều đầu tiên là hành động phụ thuộc vào người khác, điều thứ hai là hành động tự chủ.
Purimena vā karuṇākiccaṃ, itarena paññākiccaṃ, purimena cassa paramāya anukampāya samannāgamaṃ, pacchimena paramāya upekkhāya samannāgamanti evamādiṃ saṅgaṇhāti.
Or, by the former, the duty of compassion; by the latter, the duty of wisdom. By the former, his possession of supreme compassion; by the latter, his possession of supreme equanimity; he includes and so on in this way.
Hoặc điều đầu tiên là công việc của lòng từ bi, điều còn lại là công việc của trí tuệ; điều đầu tiên bao gồm sự đầy đủ của lòng bi mẫn tối thượng, điều cuối cùng bao gồm sự đầy đủ của tâm xả tối thượng, và tương tự như vậy.
Pacchimakoti guṇena pacchimako.
The last one means the last one in terms of quality.
Người cuối cùng (Pacchimako): Là người cuối cùng về phẩm chất.
Ānandattheraṃ sandhāyetaṃ vuttaṃ.
This was said with reference to the Elder Ānanda.
Điều này được nói đến để chỉ Tôn giả Ānanda.
Saṅkhyāyapīti gaṇanatopi.
By enumeration too means also by counting.
Về số lượng (Saṅkhyāyapī): Cũng là về mặt đếm.
Diṭṭhisīlasāmaññena saṃhatattā saṅghoti imamatthaṃ vibhāvento āha ‘‘diṭṭhisīlasāmaññasaṅkhātasaṅghātena samaṇagaṇenā’’ti.
Analyzing this meaning, that it is a Saṅgha because of being united by commonality of view and virtue, he said “by a group of ascetics united through the union termed commonality of view and virtue.”
Để giải thích ý nghĩa này rằng Tăng đoàn là sự tập hợp do sự tương đồng về quan điểm và giới hạnh, Ngài nói: “do nhóm Sa-môn được gọi là sự tập hợp về quan điểm và giới hạnh”.
Ettha pana ‘‘yāyaṃ diṭṭhi ariyā niyyānikā niyyāti takkarassa sammā dukkhakkhayāya, tathārūpāya diṭṭhiyā diṭṭhisāmaññagato viharatī’’ti (dī. ni. 3.324, 356, ma. ni. 1.492; 3.54) evaṃ vuttāya diṭṭhiyā, ‘‘yāni tāni sīlāni akhaṇḍāni acchiddāni asabalāni akammāsāni bhujissāni viññuppasatthāni aparāmaṭṭhāni samādhisaṃvattanikāni, tathārūpesu sīlesu sīlasāmaññagato viharatī’’ti (dī. ni. 3.324; 356; ma. ni. 1.492; 3.54) evaṃ vuttānañca sīlānaṃ sāmaññasaṅkhātena saṅghato saṅghaṭito sametoti diṭṭhisīlasāmaññasaṅkhātasaṅghāto, samaṇagaṇo.
Here, however, an ascetic community is said to be a union characterized by commonality of view and virtue because it is brought together and assembled through commonality in "a noble view that is emancipating, leading one who acts according to it to the complete destruction of suffering, one dwells having attained commonality in such a view," and in "those virtues which are unbroken, unblemished, untarnished, unblotted, liberating, praised by the wise, untainted, conducive to concentration, one dwells having attained commonality in such virtues"—by such a view and such virtues thus stated.
Ở đây, tăng đoàn được gọi là diṭṭhisīlasāmaññasaṅkhātasaṅghāto (tăng đoàn được gọi là có sự đồng nhất về kiến giải và giới hạnh) là một nhóm sa môn (samaṇagaṇo) đã tụ hội, kết hợp, đạt được sự đồng nhất về kiến giải, tức là kiến giải đã được nói đến như sau: ‘‘kiến giải này là cao thượng, đưa đến giải thoát, dẫn dắt người hành trì đến sự diệt khổ một cách chân chánh, vị ấy an trú với sự đồng nhất về kiến giải như vậy’’ và về giới hạnh, tức là các giới hạnh đã được nói đến như sau: ‘‘các giới hạnh ấy không sứt mẻ, không lỗ hổng, không tì vết, không ô nhiễm, tự do, được người trí khen ngợi, không bị chấp thủ, đưa đến định, vị ấy an trú với sự đồng nhất về giới hạnh như vậy.’’
Diṭṭhisīlasāmaññena saṃhatoti vuttaṃ hoti.
It means they are united by commonality of view and virtue.
Có nghĩa là đã kết hợp với nhau bằng sự đồng nhất về kiến giải và giới hạnh.
Tathā hi ‘‘aṭṭhānametaṃ, bhikkhave, anavakāso, yaṃ diṭṭhisampanno puggalo sañcicca pāṇaṃ jīvitā voropeyya, netaṃ ṭhānaṃ vijjatī’’ti ādivacanato diṭṭhisīlānaṃ niyatasabhāvattā sotāpannāpi aññamaññaṃ diṭṭhisīlasāmaññena saṃhatā, pageva sakadāgāmiādayo.
Thus, since views and virtues are of a fixed nature, as stated in the discourse beginning with "It is impossible, monks, it is not feasible that a person perfect in view would intentionally deprive a living being of life; such a thing does not exist," even Sotāpannas are united by commonality of view and virtue, not to mention Sakadāgāmis and others.
Quả thật, theo các lời dạy như ‘‘Này các Tỳ-khưu, điều này là phi lý, không thể có, một người có kiến giải chân chánh lại cố ý đoạn mạng một sinh vật, điều này không thể có,’’ do tính chất nhất định của kiến giải và giới hạnh, ngay cả các bậc Dự Lưu cũng đã kết hợp với nhau bằng sự đồng nhất về kiến giải và giới hạnh, huống hồ là các bậc Nhất Lai trở lên.
Ariyapuggalā hi yattha katthaci dūre ṭhitāpi attano guṇasāmaggiyā saṃhatāyeva.
For noble individuals, even if they are situated far apart, are united by the completeness of their virtues.
Thật vậy, các bậc Thánh nhân dù ở bất cứ nơi đâu, dù ở xa, cũng đã kết hợp với nhau bằng sự toàn vẹn của các đức tính của mình.
‘‘Tathārūpāya diṭṭhiyā diṭṭhisāmaññagato viharati (dī. ni. 3.324, 356; ma. ni. 1.492; 3.54), tathārūpesu sīlesu sīlasāmaññagato viharatī’’ti (dī. ni. 3.324, 356; ma. ni. 1.492; 3.54) vacanato puthujjanānampi diṭṭhisīlasāmaññena saṃhatabhāvo labbhatiyeva, idha pana ariyasaṅghoyeva adhippeto ‘‘yo tattha pacchimako, so sotāpanno’’ti vacanato.
By the statement "one dwells having attained commonality in such a view, one dwells having attained commonality in such virtues," the unity of ordinary people by commonality of view and virtue is also obtained; but here, only the noble Sangha is intended, by the statement "whoever is the last among them, he is a Sotāpanna."
Theo lời dạy ‘‘vị ấy an trú với sự đồng nhất về kiến giải như vậy, vị ấy an trú với sự đồng nhất về giới hạnh như vậy,’’ thì cũng có thể tìm thấy sự kết hợp của những phàm phu bằng sự đồng nhất về kiến giải và giới hạnh, nhưng ở đây, chỉ có Thánh Tăng được đề cập đến, theo lời dạy ‘‘người cuối cùng trong số đó là bậc Dự Lưu.’’
Etenāti ‘‘pañcamattehi bhikkhusatehī’’ti etena vacanena.
By this means by the phrase "with some five hundred monks."
Etena (bởi điều này) có nghĩa là bởi lời nói ‘‘với khoảng năm trăm vị Tỳ-khưu.’’
Assāti pañcamattassa bhikkhusatassa.
Its refers to the five hundred monks.
Assā (của vị ấy) có nghĩa là của năm trăm vị Tỳ-khưu.
Nirabbudotiādīnaṃ vacanattho parato eva āvi bhavissati.
The meaning of terms like Nirabbudo will become clear later.
Ý nghĩa của các từ như Nirabbudo (không có khối u) sẽ được làm rõ sau.
Assosīti ettha savanamupalabbhoti āha ‘‘assosīti suṇi upalabhī’’ti, aññāsīti attho.
Regarding Assosī, referring to savanampa upalabbho, it says "Assosī means heard, comprehended," meaning understood.
Đối với từ Assosī (nghe), để chỉ sự hiểu biết, ngài nói ‘‘assosīti suṇi upalabhī’’ (Assosī nghĩa là nghe, nhận biết), tức là biết.
So cāyamupalabbho savanavasenevāti imamatthaṃ dassento āha ‘‘sotadvārasampattavacananigghosānusārena aññāsī’’ti.
And showing that this comprehension is by way of hearing, it says "he understood through the sound of words that reached the ear-door."
Để chỉ rõ rằng sự nhận biết này là thông qua việc nghe, ngài nói ‘‘sotadvārasampattavacananigghosānusārena aññāsī’’ (người ấy đã biết theo tiếng nói đến cửa tai).
Avadhāraṇaphalattā saddappayogassa sabbampi vākyaṃ antogadhāvadhāraṇanti āha ‘‘khoti padapūraṇamatte nipāto’’ti.
Since emphasis is the effect of using the word, the entire sentence contains implied emphasis, so it says "khoo is a particle merely for filling out the phrase."
Do kết quả của sự nhấn mạnh trong việc sử dụng từ, toàn bộ câu đều chứa đựng sự nhấn mạnh, nên ngài nói ‘‘kho là một tiểu từ chỉ để làm đầy câu’’.
Avadhāraṇattheti pana iminā antogadhāvadhāraṇepi sabbasmiṃ vākye iṭṭhatovadhāraṇatthaṃ khosaddaggahaṇanti dasseti.
However, by "in the sense of emphasis," it shows that even though the entire sentence contains implied emphasis, the word kho is used for the sake of desired emphasis.
Tuy nhiên, với từ avadhāraṇatthe (với ý nghĩa nhấn mạnh) này, ngài chỉ ra rằng việc sử dụng từ kho là để nhấn mạnh ý nghĩa mong muốn trong toàn bộ câu, ngay cả khi câu đó đã ngụ ý sự nhấn mạnh.
Tameva iṭṭhatovadhāraṇaṃ dassento āha ‘‘tattha avadhāraṇatthenā’’tiādi.
Showing that very desired emphasis, it says "there, in the sense of emphasis," and so on.
Để chỉ ra sự nhấn mạnh mong muốn đó, ngài nói ‘‘tattha avadhāraṇatthenā’’ (ở đó, với ý nghĩa nhấn mạnh) và tiếp theo.
Atha padapūraṇatthena khosaddena kiṃpayojananti āha ‘‘padapūraṇena pana byañjanasiliṭṭhatāmattamevā’’ti.
Then, what is the purpose of the word kho in the sense of filling out the phrase? It says "by filling out the phrase, it merely provides for the euphony of the consonants."
Vậy thì, từ kho với ý nghĩa làm đầy câu có lợi ích gì? Ngài nói ‘‘padapūraṇena pana byañjanasiliṭṭhatāmattamevā’’ (nhưng với việc làm đầy câu, chỉ có sự gắn kết về mặt ngữ âm mà thôi).
‘‘Assosī’’ti hi padaṃ khosadde gahite tena phullitamaṇḍitavibhūsitaṃ viya hontaṃ pūritaṃ nāma hoti, tena ca purimapacchimapadāni siliṭṭhāni honti, na tasmiṃ aggahite, tasmā padapūraṇena byañjanasiliṭṭhatāmattameva payojanaṃ.
For when the word kho is taken, the word "Assosī" becomes, as it were, blossoming, adorned, and embellished, thereby becoming "filled out," and by that, the preceding and succeeding words become euphonious, which they are not when it is not taken; therefore, the purpose of filling out the phrase is merely the euphony of the consonants.
Thật vậy, khi từ kho được thêm vào từ ‘‘Assosī’’, nó giống như được trang điểm, làm đẹp, làm cho câu được đầy đủ, và nhờ đó, các từ phía trước và phía sau trở nên gắn kết, điều mà không có từ kho thì không có được. Do đó, mục đích của việc làm đầy câu chỉ là sự gắn kết về mặt ngữ âm mà thôi.
Matta-saddo cettha visesanivattiattho, tenassa anatthantaradīpanataṃ dasseti, eva-saddena pana byañjanasiliṭṭhatāya ekantikataṃ.
The word matta here has the meaning of 'exclusion of otherness', thereby showing its non-differentiation from the meaning; and the word eva shows the exclusivity of the euphony of the consonants.
Từ matta (chỉ) ở đây có nghĩa là loại trừ sự đặc biệt, do đó nó chỉ ra rằng không có sự khác biệt về ý nghĩa; còn từ eva (chắc chắn) chỉ ra sự tuyệt đối của sự gắn kết về mặt ngữ âm.
Verañjoti ettha saddalakkhaṇānusārena atthaṃ dassento āha ‘‘verañjāyaṃ jāto’’tiādi.
Regarding Verañjo, showing its meaning according to the rules of grammar, it says "born in Verañja," and so on.
Đối với từ Verañjo (người Ve-ran-ja), ngài giải thích ý nghĩa theo ngữ pháp bằng cách nói ‘‘verañjāyaṃ jāto’’ (sinh ra ở Ve-ran-ja) và tiếp theo.
Brahmaṃ aṇatīti ettha brahmanti vedo vuccati, so pana mantabrahmakappavasena tividho.
Here, in brahmaṃ aṇatī, brahma refers to the Vedas, which are threefold by way of mantra-brahma and kappa.
Đối với Brahmaṃ aṇatī (người nói về Phạm), brahmaṃ được gọi là Veda, có ba loại theo cách thức của thần chú và nghi lễ Phạm.
Tattha mantā padhānamūlabhāvatoyeva aṭṭhakādīhi pavuttā, itare pana tannissayena jātā, tena padhānasseva gahaṇaṃ.
Among these, the mantras are principal and fundamental, as stated by the Commentators, while the others arise in dependence on them; therefore, only the principal is taken.
Trong đó, các thần chú (mantā) được nói đến bởi các Chú giải sư (aṭṭhakādīhi) vì chúng là gốc rễ chính yếu, còn những cái khác thì phát sinh dựa vào chúng, do đó chỉ lấy cái chính yếu.
Mante sajjhāyatīti iruvedādike mantasatthe sajjhāyatīti attho.
He recites the mantras means he recites the mantra-scriptures such as the Iruveda.
Mante sajjhāyatī (tụng đọc thần chú) có nghĩa là tụng đọc các bộ kinh thần chú như Iruveda (Ṛgveda) và các bộ khác.
Iruvedādayo hi guttabhāsitabbatāya ‘‘mantā’’ti vuccanti.
For the Iruveda and others are called "mantras" because they are to be guarded and recited.
Thật vậy, Iruveda và các bộ khác được gọi là ‘‘mantā’’ (thần chú) vì chúng phải được giữ kín và nói ra.
Idameva hīti avadhāraṇena brahmato jātotiādikaṃ niruttiṃ paṭikkhipati.
Indeed, this is by emphasis, rejecting the etymology such as "born from Brahma" and so on.
Idameva hī (chính điều này) với sự nhấn mạnh, bác bỏ các cách giải thích từ nguyên như ‘‘sinh ra từ Phạm’’ và tiếp theo.
Jātibrāhmaṇānanti iminā aññepi brāhmaṇā atthīti dasseti.
By of brahmin by birth, it shows that there are other brahmins too.
Với từ Jātibrāhmaṇānaṃ (của các Bà-la-môn do dòng dõi), ngài chỉ ra rằng cũng có những Bà-la-môn khác.
Duvidhā hi brāhmaṇā jātibrāhmaṇā visuddhibrāhmaṇā cāti.
For brahmins are of two kinds: brahmins by birth and brahmins by purity.
Thật vậy, có hai loại Bà-la-môn: Bà-la-môn do dòng dõi và Bà-la-môn do sự thanh tịnh.
Idāni tattha visuddhibrāhmaṇānaṃ niruttiṃ dassento āha ‘‘ariyā panā’’tiādi.
Now, showing the etymology of brahmins by purity among them, it says "but the noble ones," and so on.
Bây giờ, để chỉ ra từ nguyên của các Bà-la-môn do sự thanh tịnh, ngài nói ‘‘ariyā panā’’ (nhưng các bậc Thánh) và tiếp theo.
Samitapāpattāti accantaṃ anavasesato savāsanaṃ samitapāpattā.
Because sins are appeased means because sins are absolutely, completely, and without remainder, along with their latent tendencies, appeased.
Samitapāpattā (vì đã dẹp bỏ tội lỗi) có nghĩa là đã dẹp bỏ tội lỗi một cách triệt để, không còn sót lại, cùng với các khuynh hướng tiềm ẩn (savāsanaṃ).
Evañhi bāhirakaavītarāgasekkhāsekkhapāpasamaṇato bhagavato pāpasamaṇaṃ visesitaṃ hoti.
Thus, the appeasement of sins of the Blessed One is distinguished from that of external individuals who have not abandoned passion, as well as from those on the training path and those perfected.
Như vậy, sự dẹp bỏ tội lỗi của Đức Thế Tôn được phân biệt với sự dẹp bỏ tội lỗi của những người phàm tục bên ngoài, những người chưa ly tham, những bậc Hữu Học và Vô Học.
Vuttamevatthaṃ udāharaṇena vibhāvento āha ‘‘vuttañheta’’ntiādi.
Illustrating the very meaning that has been stated with an example, it says "for it has been said," and so on.
Để làm rõ ý nghĩa đã nói bằng một ví dụ, ngài nói ‘‘vuttañheta’’ (điều này đã được nói) và tiếp theo.
Ettha pana ‘‘bāhitapāpoti brāhmaṇo, samitapāpattā samaṇoti vuccatīti idaṃ bhinnagāthāsannissitapadadvayaṃ ekato gahetvā vutta’’nti vadanti.
Here, however, they say that "a brahmin is one whose sins have been banished, an ascetic is called one whose sins have been appeased" is stated by taking these two words, which belong to different stanzas, together.
Ở đây, họ nói rằng ‘‘ bāhitapāpoti brāhmaṇo, samitapāpattā samaṇoti vuccatī (vì đã loại bỏ tội lỗi nên được gọi là Bà-la-môn, vì đã dẹp bỏ tội lỗi nên được gọi là Sa-môn) là lời nói được kết hợp từ hai từ trong các bài kệ khác nhau.’’
Vuttañhetaṃ tīsupi gaṇṭhipadesu ‘‘samitattā hi pāpānaṃ, samaṇoti pavuccatīti idaṃ vacanaṃ gahetvā ‘samitattā samaṇoti vuccatī’ti vuttaṃ.
For this has been stated in all three Gaṇṭhipadas: "Taking the statement 'because of the appeasement of sins, he is called an ascetic,' it is said, 'because of appeasement, he is called an ascetic'."
Điều này đã được nói trong cả ba bộ Gaṇṭhipada rằng ‘‘Lời nói ‘vì đã dẹp bỏ tội lỗi nên được gọi là Sa-môn’ là lấy từ câu ‘samitattā hi pāpānaṃ, samaṇoti pavuccatī’ (vì đã dẹp bỏ tội lỗi, nên được gọi là Sa-môn).’’
Bāhitapāpoti brāhmaṇoti idaṃ pana aññasmiṃ gāthābandhe vuttavacana’’nti.
But "a brahmin is one whose sins have been banished" is a statement made in another stanza.
Còn câu ‘Bāhitapāpoti brāhmaṇo’ (vì đã loại bỏ tội lỗi nên được gọi là Bà-la-môn) là lời nói trong một bài kệ khác.’’
Anekatthattā nipātānaṃ idha anussavanatthe adhippetoti āha ‘‘khalūti anussavanatthe nipāto’’ti.
Because particles have multiple meanings, here the meaning of anussavana (recollection) is intended, so it says "khalu is a particle in the sense of recollection."
Do các tiểu từ có nhiều nghĩa, ở đây nó được hiểu theo nghĩa ghi nhớ, nên ngài nói ‘‘khalūti anussavanatthe nipāto’’ (khalu là một tiểu từ với ý nghĩa ghi nhớ).
Jātisamudāgatanti jātiyā āgataṃ, jātisiddhanti vuttaṃ hoti.
Jātisamudāgataṃ means arisen by birth, which is to say, established by birth.
Jātisamudāgataṃ (đến từ dòng dõi) có nghĩa là đến từ dòng dõi, tức là có được do dòng dõi.
Ālapanamattanti piyālāpavacanamattaṃ.
Mere address means merely words of affectionate address.
Ālapanamattaṃ (chỉ là lời chào hỏi) có nghĩa là chỉ là lời nói chào hỏi thân mật.
Piyasamudāhārā hete bhoti vā āvusoti vā devānampiyāti vā.
For these are affectionate greetings: "bho," "āvuso," or "devānampiya."
Những lời như ‘‘bho’’ hoặc ‘‘āvuso’’ hoặc ‘‘devānampiya’’ là những lời chào hỏi thân mật.
Bhovādī nāma so hotīti yo āmantanādīsu ‘‘bho bho’’ti vadanto vicarati, so bhovādī nāma hotīti attho.
One who uses "bho" is called so means one who goes about saying "bho, bho" in addressing others is called one who uses "bho."
Bhovādī nāma so hotī (người ấy được gọi là Bhovādī) có nghĩa là người nào thường nói ‘‘bho bho’’ khi chào hỏi, thì người ấy được gọi là Bhovādī.
Sakiñcanoti rāgādīhi kiñcanehi sakiñcano.
Sakiñcano means one possessing defilements such as passion.
Sakiñcano (có kiñcana) có nghĩa là có những phiền não (kiñcana) như tham ái.
Rāgādayo hi satte kiñcenti maddanti palibundhantīti ‘‘kiñcanānī’’ti vuccanti.
For passions and the like are called "defilements" because they afflict, crush, and bind beings.
Tham ái và các phiền não khác được gọi là ‘‘kiñcana’’ vì chúng làm ô nhiễm, đè nén, trói buộc chúng sinh.
Manussā kira goṇehi khalaṃ maddāpentā ‘‘kiñcehi kapila, kiñcehi kāḷakā’’ti vadanti, tasmā maddanaṭṭho kiñcanaṭṭhoti veditabbo.
It is said that people, when making oxen thresh grain, say, "Kiñcehi Kapila, Kiñcehi Kāḷakā" (thresh, Kapila; thresh, Kāḷaka); therefore, the meaning of 'crushing' should be understood as the meaning of 'defilement'.
Người ta nói rằng, khi con người dùng bò để giẫm đạp lúa, họ nói ‘‘kiñcehi Kapila, kiñcehi Kāḷakā’’ (hỡi bò Kapila, hãy giẫm đạp đi; hỡi bò Kāḷaka, hãy giẫm đạp đi), do đó, nên hiểu kiñcana có nghĩa là giẫm đạp, làm ô nhiễm.
Gottavasenāti ettha gaṃ tāyatīti gottaṃ.
Regarding Gottavasena, gotta means that which protects go.
Đối với Gottavasena (theo dòng họ), ‘‘gottaṃ’’ (dòng họ) có nghĩa là bảo vệ cái ‘‘go’’.
Gosaddena cettha abhidhānaṃ buddhi ca vuccati, tasmā evamettha attho daṭṭhabbo.
Here, by the word go, 'designation' and 'intellect' are meant; therefore, the meaning here should be understood thus.
Ở đây, từ ‘‘go’’ được dùng để chỉ tên gọi (abhidhāna) và trí tuệ (buddhi), do đó, ý nghĩa ở đây nên được hiểu như sau.
Gotamoti pavattamānaṃ abhidhānaṃ buddhiñca ekaṃsikavisayatāya tāyati rakkhatīti gottaṃ.
Gotama (Gotama) is gotta because it protects the currently used designation and intellect by being of a certain definite domain.
Gotama là dòng họ bảo vệ (tāyati rakkhatīti) tên gọi đang được sử dụng và trí tuệ trong một lĩnh vực nhất định.
Yathā hi buddhi ārammaṇabhūtena atthena vinā na vattati, evaṃ abhidhānaṃ abhidheyyabhūtena, tasmā so gottasaṅkhāto attho tāni buddhiabhidhānāni tāyati rakkhatīti vuccati.
Just as intellect cannot function without its object, so too designation cannot function without its designated object; therefore, that meaning called gotta is said to protect those intellects and designations.
Cũng như trí tuệ không thể hoạt động nếu không có đối tượng, thì tên gọi cũng không thể hoạt động nếu không có đối tượng được gọi. Do đó, ý nghĩa được gọi là dòng họ (gotta) đó bảo vệ tên gọi và trí tuệ đó.
So pana aññakulaparamparāya asādhāraṇaṃ tassa kulassa ādipurisasamudāgataṃ taṃkulapariyāpannasādhāraṇaṃ sāmaññarūpanti daṭṭhabbaṃ.
And that should be understood as a common form, specific to that family, having originated from the ancestral founder of that family, and not common to other family lineages.
Nên hiểu rằng đó là một hình thức chung, đặc trưng của dòng họ đó, không phổ biến với các dòng họ khác, và phát sinh từ tổ tiên của dòng họ đó.
Ettha ca samaṇoti iminā sarikkhakajanehi bhagavato bahumatabhāvo dassito samitapāpatākittanato, gotamoti iminā lokiyajanehi uḷārakulasambhūtatādīpanato.
Here, by samaṇo, the Blessed One's high regard among those of similar ascetic practice is shown through the mention of the appeasement of sins; by gotamo, his noble birth is indicated to worldly people.
Ở đây, với từ samaṇo (Sa-môn), ngài chỉ ra rằng Đức Thế Tôn được người cùng đẳng cấp tôn kính, vì đã nói về sự dẹp bỏ tội lỗi; với từ gotamo (Gotama), ngài chỉ ra rằng Đức Thế Tôn được người đời tôn kính, vì đã nói về việc sinh ra trong một gia đình cao quý.
Sakyassa suddhodanamahārājassa putto sakyaputto.
Sakyaputto is the son of King Suddhodana of the Sakyas.
Sakyaputto (con của dòng Sakya) là con trai của Đại vương Suddhodana của dòng Sakya.
Iminā ca uditoditavipulakhattiyakulavibhāvanato vuttaṃ ‘‘idaṃ pana bhagavato uccākulapaadīpana’’nti.
And because it makes known the arisen, illustrious, and extensive Khattiya family, it is said: ‘This indeed illuminates the exalted family of the Bhagavā.’
Và vì sự hiển bày dòng dõi Sát-đế-lợi cao quý, phát triển và rộng lớn này, nên đã nói rằng: “Điều này lại làm sáng tỏ dòng dõi cao quý của Đức Thế Tôn.”
Sabbakhattiyānañhi ādibhūtamahāsammatamahārājato paṭṭhāya asambhinnaṃ uḷāratamaṃ sakyarājakulaṃ.
For the Sakya royal family is the most excellent, unbroken lineage, from the first great elected monarch who was the origin of all Khattiyas.
Thật vậy, dòng dõi vương tộc Sakya là dòng dõi cao quý nhất, không bị pha tạp, bắt đầu từ Đại Vương Mahāsammata, vị vua đầu tiên của tất cả các Sát-đế-lợi.
Kenaci pārijuññena anabhibhūtoti ñātipārijuññabhogapārijuññādinā kenaci pārijuññena parihāniyā anabhibhūto anajjhotthaṭo.
‘Unoverwhelmed by any deterioration’ means not overwhelmed, not overcome by any deterioration, such as deterioration of relatives or deterioration of possessions.
“Không bị bất kỳ sự suy yếu nào lấn át” nghĩa là không bị lấn át, không bị chế ngự bởi bất kỳ sự suy yếu nào như sự suy yếu về bà con hay sự suy yếu về tài sản.
Tathā hi lokanāthassa abhijātiyaṃ tassa kulassa na kiñci pārijuññaṃ, atha kho vaḍḍhiyeva.
Indeed, at the birth of the Lord of the World, there was no deterioration of that family, but rather prosperity.
Thật vậy, khi Đức Thế Tôn (Lokānātha) đản sinh, dòng dõi ấy không có bất kỳ sự suy yếu nào, mà chỉ có sự tăng trưởng.
Abhinikkhamane ca tato samiddhatamabhāvo loke pākaṭo paññāto.
And at the going forth, its utmost prosperity became manifest and known in the world.
Và khi Ngài xuất gia, sự thịnh vượng tột bậc của dòng dõi ấy đã được công bố, được biết đến rộng rãi trên thế gian.
Tena ‘‘sakyakulā pabbajito’’ti idaṃ vacanaṃ bhagavato saddhāpabbajitabhāvaparidīpanatthaṃ vuttaṃ mahantaṃ ñātiparivaṭṭaṃ mahantañca bhogakkhandhaṃ pahāya pabbajitabhāvasiddhito.
Therefore, the statement ‘gone forth from the Sakya family’ is said to reveal the Bhagavā's state of having gone forth out of faith, as he went forth having abandoned a great circle of relatives and a great mass of possessions.
Vì vậy, câu nói “xuất gia từ dòng tộc Sakya” này được nói ra để làm sáng tỏ việc Đức Thế Tôn đã xuất gia do lòng tin, bởi vì Ngài đã từ bỏ một đoàn thể bà con lớn và một khối tài sản lớn để xuất gia.
Tato paranti ‘‘verañjāyaṃ viharatī’’tiādi.
‘Beyond that’ refers to ‘resides in Verañjā,’ and so on.
“Từ đó trở đi” nghĩa là “Ngài đang trú tại Veranja” v.v.
Itthambhūtākhyānatthe upayogavacananti itthaṃ imaṃ pakāraṃ bhūto āpannoti ittambhūto, tassa ākhyānaṃ itthambhūtākhyānaṃ, soyeva attho itthambhūtākhyānattho.
‘The use of a term for stating suchness’ means itthaṃbhūta (suchness) is to be in this manner, to have attained this manner; its declaration is itthaṃbhūtākhyāna, and that same meaning is itthaṃbhūtākhyānattha.
“Upayogavacana (ngữ dụng) trong ý nghĩa itthambhūtākhyāna (diễn tả trạng thái đã thành tựu)” nghĩa là “itthambhūta” là “đã đạt đến trạng thái này”, “itthambhūtākhyāna” là sự diễn tả trạng thái đó, và “itthambhūtākhyānattha” là ý nghĩa của điều đó.
Atha vā itthaṃ evaṃ pakāro bhūto jātoti evaṃ kathanattho itthambhūtākhyānattho, tasmiṃ upayogavacananti attho.
Or, it means the meaning of stating ‘thus, of such a kind, has come to be,’ which is itthaṃbhūtākhyānattha; and within that, the use of the term.
Hoặc, “itthambhūtākhyānattha” là ý nghĩa của việc nói rằng “đã thành tựu theo cách này”, và “upayogavacana” là ngữ dụng trong ý nghĩa đó.
Ettha ca abbhuggatoti ettha abhi-saddo itthambhūtākhyānatthajotako abhibhavitvā uggamanappakārassa dīpanato.
And here, in ‘abbhuggato’ (arisen), the prefix ‘abhi-’ indicates the meaning of stating suchness, by revealing the manner of rising by overcoming.
Ở đây, trong từ “abbhuggato”, tiền tố “abhi” làm sáng tỏ ý nghĩa itthambhūtākhyāna, vì nó diễn tả cách thức vượt lên trên và phát triển.
Tena yogato ‘‘taṃ kho pana bhavantaṃ gotama’’nti idaṃ upayogavacanaṃ sāmiatthepi samānaṃ itthambhūtākhyānadīpanato ‘‘itthambhūtākhyānatthe’’ti vuttaṃ.
Therefore, due to its connection, the phrase ‘taṃ kho pana bhavantaṃ gotama’ (to that Venerable Gotama), even while having the meaning of possession, is said to be ‘for stating suchness’ because it indicates suchness.
Vì vậy, do sự kết hợp của tiền tố đó, dù câu “taṃ kho pana bhavantaṃ gotamaṃ” này cũng có thể mang ý nghĩa sở hữu (sāmiattha), nhưng vì nó làm sáng tỏ itthambhūtākhyāna, nên đã nói “trong ý nghĩa itthambhūtākhyāna”.
Tenevāha ‘‘tassa kho pana bhoto gotamassāti attho’’ti.
For this reason, it is said: ‘The meaning is, to that Venerable Gotama.’
Chính vì thế mà nói: “Nghĩa là của Đức Gotama ấy.”
Idaṃ vuttaṃ hoti – yathā ‘‘sādhu devadatto mātaramabhī’’ti ettha abhisaddayogato itthambhūtākhyāne upayogavacanaṃ kataṃ, evamidhāpi taṃ kho pana bhavantaṃ gotamaṃ abhi evaṃ kalyāṇo kittisaddo uggatoti abhisaddayogato itthambhūtākhyāne upayogavacananti.
This means: just as in ‘sādhu devadatto mātaramabhī’ (Devadatta is good towards his mother), the phrase indicating suchness is formed through the conjunction with the word ‘abhi,’ so too here, ‘a good sound of fame has arisen with regard to that Venerable Gotama,’ this phrase indicating suchness is formed through the conjunction with the word ‘abhi.’
Điều này có nghĩa là: Cũng như trong câu “Sādhu devadatto mātaramabhī” (Devadatta tốt với mẹ), do sự kết hợp với tiền tố “abhi”, ngữ dụng được dùng trong ý nghĩa itthambhūtākhyāna, thì ở đây cũng vậy, do sự kết hợp với tiền tố “abhi” trong “taṃ kho pana bhavantaṃ gotamaṃ abhi evaṃ kalyāṇo kittisaddo uggato” (Tiếng tốt lành như vậy đã lan truyền về Đức Gotama ấy), ngữ dụng được dùng trong ý nghĩa itthambhūtākhyāna.
‘‘Sādhu devadatto mātaramabhī’’ti ettha hi ‘‘devadatto mātaramabhi mātari visaye mātuyā vā sādhū’’ti evaṃ adhikaraṇatthe sāmiatthe vā bhummavacanassa vā sāmivacanassa vā pasaṅge itthambhūtākhyānatthajotakena abhisaddena yoge upayogavacanaṃ kataṃ.
For here in ‘sādhu devadatto mātaramabhī,’ in the context of the locative case for ‘concerning the mother’ or the possessive case for ‘of the mother,’ or the possibility of using the locative or possessive case, the instrumental case is used in conjunction with the word ‘abhi’ which expresses the meaning of stating suchness.
Thật vậy, trong câu “Sādhu devadatto mātaramabhī”, khi có thể dùng cách nói vị trí (bhummavacana) hoặc cách nói sở hữu (sāmivacana) trong ý nghĩa vị trí “Devadatta tốt lành đối với mẹ” hoặc trong ý nghĩa sở hữu “của mẹ”, thì ngữ dụng đã được dùng do sự kết hợp với tiền tố “abhi” làm sáng tỏ ý nghĩa itthambhūtākhyāna.
Yathā cettha ‘‘devadatto mātu visaye mātusambandhī vā sādhuttappakārappatto’’ti ayamattho viññāyati, evamidhāpi ‘‘bhoto gotamassa sambandhī kittisaddo abbhuggato abhibhavitvā uggamanappakārappatto’’ti ayamattho viññāyati.
Just as here the meaning understood is ‘Devadatta has attained the state of goodness concerning his mother or related to his mother,’ so too here the meaning understood is ‘a sound of fame related to the Bhagavā Gotama has arisen, having attained the manner of overcoming and arising.’
Cũng như ở đây, ý nghĩa được hiểu là “Devadatta đạt đến trạng thái tốt lành đối với mẹ hoặc liên quan đến mẹ”, thì ở đây cũng vậy, ý nghĩa được hiểu là “tiếng tốt lành liên quan đến Đức Gotama đã lan truyền, đã đạt đến trạng thái vượt lên trên và phát triển”.
Tattha hi devadattaggahaṇaṃ viya idha kittisaddaggahaṇaṃ, tathā tattha ‘‘mātara’’nti vacanaṃ viya idha ‘‘taṃ kho pana bhavantaṃ gotama’’nti vacanaṃ, tattha sādhusaddaggahaṇaṃ viya idha uggatasaddaggahaṇaṃ veditabbaṃ.
Here, the mention of Devadatta is like the mention of the sound of fame here; similarly, the phrase ‘concerning the mother’ there is like the phrase ‘to that Venerable Gotama’ here; and the mention of the word ‘good’ there is to be understood as the mention of the word ‘arisen’ here.
Ở đó, việc dùng từ “Devadatta” cũng như ở đây là việc dùng từ “kittisadda” (tiếng tốt lành); cũng vậy, ở đó câu “mātaraṃ” cũng như ở đây là câu “taṃ kho pana bhavantaṃ gotamaṃ”; ở đó việc dùng từ “sādhu” cũng như ở đây là việc dùng từ “uggata” (lan truyền) cần được hiểu.
Kalyāṇoti bhaddako.
‘Kalyāṇo’ means excellent.
“Kalyāṇo” nghĩa là tốt đẹp.
Kalyāṇabhāvo cassa kalyāṇaguṇavisayatāyāti āha ‘‘kalyāṇaguṇasamannāgato’’ti, kalyāṇehi guṇehi samannāgato taṃvisayatāya yuttoti attho.
Its excellent nature lies in its being concerned with excellent qualities, and so it says: ‘endowed with excellent qualities,’ meaning suitable due to its concern with excellent qualities.
Và sự tốt đẹp của nó là do nó liên quan đến những phẩm chất tốt đẹp, nên nói “kalyāṇaguṇasamannāgato” nghĩa là phù hợp với những phẩm chất tốt đẹp, có nghĩa là liên quan đến chúng.
Taṃvisayatā hettha samannāgamo kalyāṇaguṇavisayatāya tannissitoti adhippāyo.
Here, being endowed means being concerned with excellent qualities, implying that it depends on them.
Ở đây, “samannāgamo” (sự phù hợp) là sự liên quan đến những phẩm chất tốt đẹp, có nghĩa là dựa vào chúng.
Seṭṭhoti etthāpi eseva nayo.
The same method applies to ‘seṭṭho’ (supreme).
“Seṭṭho” (tối thượng) cũng theo nguyên tắc này.
Seṭṭhaguṇavisayatāya eva hi kittisaddassa seṭṭhatā ‘‘bhagavāti vacanaṃ seṭṭha’’ntiādīsu viya.
For the supremacy of the sound of fame is indeed due to its concern with supreme qualities, as in statements like ‘the word Bhagavā is supreme.’
Thật vậy, sự tối thượng của tiếng tốt lành là do nó liên quan đến những phẩm chất tối thượng, như trong các trường hợp “câu ‘Bhagavā’ là tối thượng” v.v.
‘‘Bhagavā araha’’ntiādinā guṇānaṃ saṃkittanato saddanīyato ca kittisaddo vaṇṇoti āha ‘‘kittisaddoti kitti evā’’ti.
Since qualities are praised and sounded forth by phrases like ‘Bhagavā arahaṃ’ (the Bhagavā is an Arahant), the sound of fame is praise; therefore, it says: ‘the sound of fame is indeed fame.’
Vì các phẩm chất được tóm tắt bằng “Bhagavā Arahā” v.v. và được xưng tán, nên tiếng tốt lành là lời tán thán, nên nói “kittisaddo nghĩa là kitti (lời tán thán) vậy”.
Vaṇṇoyeva hi kittetabbato kittisaddanīyato saddoti ca vuccati.
For praise itself is called a sound because it is to be praised and sounded forth.
Thật vậy, lời tán thán (vaṇṇa) được gọi là “kitti” (tiếng tốt lành) vì nó đáng được tán thán, và là “sadda” (tiếng) vì nó đáng được xưng tán.
Kittipariyāyo hi saddasaddo yathā ‘‘uḷārasaddā isayo, guṇavanto tapassino’’ti.
The word sadda is a synonym for kitti, as in ‘illustrious are the sages, endowed with virtue and austerity.’
Thật vậy, từ “sadda” là từ đồng nghĩa với “kitti”, như trong “Các vị ẩn sĩ có tiếng tốt lành, có phẩm hạnh, có hạnh khổ hạnh.”
Abhitthavanavasena pavatto saddo thutighoso, abhitthavudāhāro.
A sound that arises in the manner of eulogy is a shout of praise, an utterance of eulogy.
Tiếng vang lên dưới dạng tán thán là tiếng ca ngợi, là lời tán thán.
‘‘Abbhuggato’’ti pana etassa attho aṭṭhakathāyaṃ na dassito, tasmā tassattho evaṃ veditabbo – abbhuggatoti abhibhavitvā uggato, anaññasādhāraṇaguṇe ārabbha pavattattā sadevakaṃ lokaṃ ajjhottharitvā pavattoti vuttaṃ hoti.
The meaning of ‘abbhuggato’ (arisen), however, is not shown in the Aṭṭhakathā; therefore, its meaning should be understood thus: ‘abbhuggato’ means having arisen by overcoming, implying that it has arisen having surpassed the world with its deities, because it has arisen concerning unsurpassed qualities.
Tuy nhiên, ý nghĩa của từ “Abbhuggato” không được giải thích trong Chú giải (Aṭṭhakathā), do đó ý nghĩa của nó cần được hiểu như sau: “Abbhuggato” nghĩa là đã vượt lên trên và phát triển, có nghĩa là đã lan truyền bao trùm khắp thế gian cùng với chư thiên, vì nó được phát sinh dựa trên những phẩm chất không thể sánh bằng của người khác.
Kinti saddo abbhuggatoti āha ‘‘itipi so bhagavā’’tiādi.
What kind of sound is ‘abbhuggato’? It says: ‘itipi so bhagavā’ (thus is that Bhagavā), and so on.
Tiếng tốt lành là gì mà lại lan truyền? Nên nói “itipi so Bhagavā” v.v.
Ito paraṃ pana īdisesu ṭhānesu yattha yattha pāḷipāṭhassa attho vattabbo siyā, tattha tattha ‘‘pāḷiyaṃ panā’’ti vatvā atthaṃ dassayissāma, idāni tattha padayojanāpubbakaṃ atthaṃ dassento āha ‘‘itipi so bhagavātiādīsu pana ayaṃ tāva yojanā’’tiādi.
From now on, wherever the meaning of a Pāli text needs to be explained in such places, we will explain it by saying ‘pāḷiyaṃ pana’ (but in the Pāli); now, intending to explain the meaning preceded by a word-by-word analysis, it says: ‘itipi so bhagavā’ and so on, ‘this is the exposition here.’
Từ đây trở đi, ở những chỗ mà ý nghĩa của đoạn kinh (pāḷipāṭha) cần được giải thích, chúng tôi sẽ nói “Pāḷi panā” (Còn trong Pāḷi) rồi giải thích ý nghĩa. Bây giờ, khi giải thích ý nghĩa trước khi phân tích từ ngữ, nên nói “idāni itipi so Bhagavātiādīsu pana ayaṃ tāva yojanā” (Bây giờ, trong các câu “itipi so Bhagavā” v.v., đây là cách sắp xếp từ ngữ trước hết) v.v.
So bhagavāti yo so samatiṃsa pāramiyo pūretvā sabbakilese bhañjitvā anuttaraṃ sammāsambodhiṃ abhisambuddho devānaṃ atidevo sakkānaṃ atisakko brahmānaṃ atibrahmā lokanātho bhāgyavantatādīhi kāraṇehi bhagavāti laddhanāmo, so bhagavā.
‘So bhagavā’ (that Bhagavā) means: that one who, having fulfilled thirty perfections, having shattered all defilements, having attained unsurpassed Perfect Self-Enlightenment, is a god among gods, a Sakka among Sakkas, a Brahmā among Brahmās, the Lord of the World, and who has received the name Bhagavā for reasons such as being fortunate – that Bhagavā.
“So Bhagavā” (Đức Thế Tôn ấy) nghĩa là Đức Thế Tôn ấy, người đã hoàn thành ba mươi pāramī, đã phá tan tất cả phiền não, đã chứng đắc Vô Thượng Chánh Đẳng Chánh Giác, là vị Thầy của chư thiên, là vị Thầy của các Sakka, là vị Thầy của các Brahmā, là vị Chủ của thế gian, người đã được gọi là Bhagavā (Thế Tôn) vì những lý do như có phước báu v.v.
Bhagavāti hi idaṃ satthu nāmakittanaṃ.
For this ‘Bhagavā’ is the proclaiming of the Teacher's name.
Thật vậy, “Bhagavā” đây là tên gọi của Đức Đạo Sư.
Tenāha āyasmā dhammasenāpati ‘‘bhagavāti netaṃ nāmaṃ mātarā kata’’ntiādi (mahāni. 84).
Therefore, the Venerable Dhammasenāpati said: ‘Bhagavā is not a name given by his mother,’ and so on (Mahāniddesa 84).
Vì vậy, Tôn giả Dhammasenāpati đã nói: “Bhagavā không phải là tên do mẹ đặt” v.v. (Mahāni. 84).
Parato pana bhagavāti guṇakittanameva.
Further on, ‘Bhagavā’ is solely the proclaiming of qualities.
Còn sau này, “Bhagavā” chỉ là sự tán thán phẩm chất.
Yathā kammaṭṭhānikena ‘‘araha’’ntiādīsu navasu ṭhānesu paccekaṃ itipisaddaṃ yojetvā buddhaguṇā anussarīyanti, evaṃ buddhaguṇasaṃkittakenapīti dassento ‘‘itipi arahaṃ itipi sammāsambuddho…pe… itipi bhagavā’’ti āha.
To show that just as a meditator recollects the qualities of the Buddha by connecting the word itipi (thus) to each of the nine terms like ‘arahaṃ’ (Arahant), so too does one who proclaims the Buddha's qualities, it says: ‘itipi arahaṃ, itipi sammāsambuddho…pe… itipi bhagavā.’
Để chỉ ra rằng, cũng như một người hành thiền (kammaṭṭhānika) quán tưởng các phẩm chất của Đức Phật bằng cách kết hợp từ “itipi” với từng trong chín chỗ như “Arahā” v.v., thì một người tán thán phẩm chất của Đức Phật cũng vậy, nên nói “itipi Arahā itipi Sammāsambuddho…pe… itipi Bhagavā”.
Evañhi sati ‘‘araha’’ntiādīhi navahi padehi ye sadevake loke ativiya pākaṭā paññātā buddhaguṇā, te nānappakārato vibhāvitā honti.
For when this is the case, the Buddha's qualities, which are exceedingly manifest and known in the world with its deities, are thus illuminated in various ways by these nine terms, such as ‘Arahant.’
Khi đó, những phẩm chất của Đức Phật, vốn rất nổi bật và được biết đến trong thế gian cùng với chư thiên, được làm sáng tỏ theo nhiều cách khác nhau bằng chín từ như “Arahā” v.v.
‘‘Itipetaṃ bhūtaṃ, itipetaṃ taccha’’ntiādīsu (dī. ni. 1.6) viya hi idha iti-saddo āsannapaccakkhakāraṇattho, pi-saddo sampiṇḍanattho, tena ca tesaṃ guṇānaṃ bahubhāvo dīpito, tāni ca guṇasallakkhaṇakāraṇāni saddhāsampannānaṃ viññujātikānaṃ paccakkhāni hontīti tāni saṃkittentena viññunā cittassa sammukhībhūtāneva katvā saṃkittetabbānīti dassento ‘‘iminā ca iminā ca kāraṇenāti vuttaṃ hotī’’ti āha.
For in phrases like ‘itipetaṃ bhūtaṃ, itipetaṃ tacchaṃ’ (thus is this real, thus is this true), the word ‘iti-’ here indicates a reason that is immediately perceptible, and the word ‘pi-’ indicates summation; and thereby, the abundance of those qualities is revealed, and those reasons for discerning qualities are directly perceptible to those endowed with faith and discerning; thus, to show that a discerning person, when proclaiming them, should do so by making them present to mind, it says: ‘this means by this and that reason.’
Thật vậy, ở đây, từ “iti” có nghĩa là lý do trực tiếp (āsannapaccakkhakāraṇa), như trong “Itipetaṃ bhūtaṃ, itipetaṃ tacchaṃ” (Điều này là sự thật, điều này là chân lý) v.v. (Dī. Ni. 1.6); từ “pi” có nghĩa là tổng hợp, và qua đó, sự đa dạng của những phẩm chất đó được làm sáng tỏ. Và để chỉ ra rằng những lý do nhận biết phẩm chất đó là trực tiếp đối với những người có đức tin và những người có trí tuệ, và rằng khi tán thán chúng, một người có trí tuệ nên quán tưởng chúng như thể chúng đang hiện diện trước tâm mình, nên nói “iminā ca iminā ca kāraṇenāti vuttaṃ hoti” (Điều này có nghĩa là do lý do này và lý do này).
‘‘Suttantikānaṃ vacanānamatthaṃ, suttānurūpaṃ paridīpayantī’’ti heṭṭhā vuttattā visuddhimagge (visuddhi. 1.125-128) sabbākārato saṃvaṇṇitampi atthaṃ idhāpi vitthāretvā dassetukāmo tattha payojanamāha ‘‘idāni vinayadharāna’’ntiādi.
Since it was stated earlier, ‘explaining the meanings of the Suttanta statements in conformity with the Suttas,’ intending to expand and explain the meaning, even though it is fully expounded in the Visuddhimagga (Visuddhi. 1.125-128), here too he states its purpose, saying: ‘Now, for the Vinaya-holders,’ and so on.
Vì đã nói ở phần dưới rằng “giải thích ý nghĩa của các lời kinh (suttanta) một cách phù hợp với các kinh (sutta)”, nên để giải thích chi tiết ý nghĩa đã được trình bày đầy đủ trong Visuddhimagga (Visuddhi. 1.125-128) ở đây, Ngài đã nêu mục đích: “idāni vinayadharānaṃ” (Bây giờ, đối với những người giữ giới luật) v.v.
Tattha cittasampahaṃsanatthanti cittasantosanatthaṃ, cittappasādajananatthanti vuttaṃ hoti.
There, ‘cittasampahaṃsanatthaṃ’ means for the delight of the mind, it is said to be for generating mental clarity.
Ở đó, “cittasampahaṃsanatthaṃ” nghĩa là để làm hài lòng tâm, để tạo ra sự thanh tịnh trong tâm.
‘‘Ārakattā’’tiādīsu ārakattāti suvidūrattā.
In ‘ārakattā’ and so on, ‘ārakattā’ means due to being far removed.
Trong các từ “Ārakattā” v.v., “ārakattā” nghĩa là do ở rất xa.
Arīnanti kilesārīnaṃ.
Ariya means defilement-enemies.
Arīnanti (A-rì-na) là những phiền não là kẻ thù.
Arānanti saṃsāracakkassa arānaṃ.
Ara means the spokes of the wheel of saṃsāra.
Arānanti (A-rà-na) là những nan hoa của bánh xe luân hồi.
Hatattāti viddhaṃsitattā.
Hatattā means because of being vanquished.
Hatattāti (Hát-tát-tà) là đã bị hủy diệt hoàn toàn.
Paccayādīnanti cīvarādipaccayānañceva pūjāvisesānañca.
Paccayādīnaṃ means requisites such as robes, etc., and also special offerings.
Paccayādīnanti (Pác-cay-á-đì-na) là các vật dụng như y phục, v.v. và các loại cúng dường đặc biệt.
Idāni yathāvuttamevatthaṃ vibhāvento āha ‘‘ārakā hi so’’tiādi.
Now, elucidating the meaning just stated, he said: “for he is far removed,” and so on.
Bây giờ, để giải thích ý nghĩa đã nói như trên,* nói: ‘‘quả thật Ngài ở xa’’, v.v.
Dūratā nāma āsannatā viya upādāyupādāya vuccatīti paramukkaṃsagataṃ dūrabhāvaṃ dassento ‘‘suvidūravidūre ṭhito’’ti āha, suṭṭhu vidūrabhāveneva vidūre ṭhitoti attho.
Since farness, like nearness, is spoken of conditionally, showing a state of farness that has reached the highest excellence, he said: “standing extremely far away.” The meaning is, he stands far away indeed by the very nature of being far removed.
Vì khoảng cách xa cũng được nói tùy theo sự gần gũi như sự gần gũi, nên để chỉ ra trạng thái xa xôi đã đạt đến mức tối thượng,* nói: ‘‘ở rất xa’’, nghĩa là ở rất xa xôi.
So panassa kilesehi dūre ṭhitabhāvo, na padesavasena, atha kho tesaṃ sabbaso pahīnattāti dassento āha ‘‘maggena kilesānaṃ viddhaṃsitattā’’ti.
And this state of his standing far removed from the defilements is not in terms of locality, but rather because they are entirely abandoned, as he said: “because the defilements are vanquished by the path.”
Để chỉ ra rằng trạng thái Ngài ở xa các phiền não không phải là do khoảng cách địa lý mà là do chúng đã bị diệt trừ hoàn toàn,* nói: ‘‘do con đường đã hủy diệt các phiền não’’.
Nanu aññesampi khīṇāsavānaṃ te pahīnā evāti anuyogaṃ manasi katvā vuttaṃ ‘‘savāsanāna’’nti.
Having considered the objection, “But for other Arahants too, they are indeed abandoned,” it was stated: “together with their latent tendencies (vāsanā).”
Chẳng phải các phiền não đó cũng đã bị diệt trừ đối với các vị A-la-hán khác sao? Nghĩ đến câu hỏi đó,* nói: ‘‘cùng với tập khí (vāsanā)’’.
Na hi ṭhapetvā bhagavantaṃ aññe saha vāsanāya kilese pahātuṃ sakkonti.
For, apart from the Blessed One, no others can abandon defilements together with their latent tendencies.
Thật vậy, ngoài Đức Thế Tôn, không ai có thể diệt trừ các phiền não cùng với tập khí của chúng.
Etena aññehi asādhāraṇaṃ bhagavato arahattanti dassitaṃ hoti.
By this it is shown that the Lord’s Arahantship is unique from others.
Điều này cho thấy quả A-la-hán của Đức Thế Tôn là phi thường, không giống với các vị khác.
Kā panāyaṃ vāsanā nāma?
What, then, is this latent tendency called vāsanā?
Vậy tập khí này là gì?
Pahīnakilesassapi appahīnakilesassa payogasadisapayogahetubhūto kilesanissito sāmatthiyaviseso āyasmato pilindavacchassa vasalasamudācāranimittaṃ viya.
It is a specific inherent capacity residing in the defilements, which, even in one whose defilements are abandoned, serves as a cause for actions similar to those of one whose defilements are not abandoned, like the reason for Venerable Pilindavaccha’s use of rude address.
Đó là một năng lực đặc biệt dựa trên phiền não, là nguyên nhân của những hành vi giống như hành vi của người chưa diệt trừ phiền não, ngay cả khi phiền não đã bị diệt trừ, giống như trường hợp của Đại đức Pilindavaccha có thói quen gọi người khác là ‘‘vasala’’ (hạ tiện).
Kathaṃ pana ‘‘ārakā’’ti vutte ‘‘kilesehī’’ti ayamattho labbhatīti sāmaññacodanāya visese avaṭṭhānato visesatthinā ca visesassa anupayujjitabbato ‘‘ārakāssa honti pāpakā akusalā dhammā’’tiādīni (ma. ni. 1.434) suttapadānettha udāharitabbāni.
How, it might be asked, when “ārakā” is said, is the meaning “from defilements” obtained? Because a specific meaning is derived from a general instruction, and because the specific meaning should not be applied by one who seeks a specific meaning, suttas such as “Evil, unwholesome states are far removed from him” should be cited here.
Vậy làm thế nào khi nói ‘‘ārakā’’ (ở xa) lại có được ý nghĩa ‘‘khỏi các phiền não’’? Vì sự chỉ định chung được xác định bởi một trường hợp cụ thể, và vì người muốn có ý nghĩa cụ thể không nên sử dụng ý nghĩa chung, nên các đoạn kinh như ‘‘các pháp ác bất thiện ở xa Ngài’’ (Ma. Ni. 1.434) nên được dẫn ra ở đây.
Ārakāti cettha ā-kārassa rassattaṃ, ka-kārassa ca hakāraṃ sānusāraṃ katvā niruttinayena ‘‘araha’’nti padasiddhi veditabbā.
Here, through the method of etymology, by shortening the vowel “ā” and making the consonant “ka” sibilant, the derivation of the word “arahaṃ” should be understood.
Ở đây, cần biết rằng theo quy tắc ngữ pháp, chữ ā trong Ārakā được rút ngắn, và chữ ka được biến thành ha có âm mũi để tạo thành từ ‘‘Arahaṃ’’.
Yathāvuttassevatthassa sukhaggahaṇatthaṃ idamettha vuccati –
For the easy comprehension of the meaning just stated, this is said here:
Để dễ hiểu ý nghĩa đã nói như trên, điều này được nói ở đây:
Yañcetaṃ saṃsāracakkanti sambandho.
And this refers to the wheel of saṃsāra.
Và đó là bánh xe luân hồi, có sự liên hệ.
Rathacakkassa nābhi viya mūlāvayavabhūtaṃ anto bahi ca samavaṭṭhitaṃ avijjābhavataṇhādvayanti vuttaṃ ‘‘avijjābhavataṇhāmayanābhī’’ti.
Like the nave of a chariot wheel, the root components, existing both internally and externally, are said to be the duality of ignorance and craving for existence, hence “with the nave consisting of ignorance and craving for existence.”
Cái được gọi là ‘‘trục bánh xe làm bằng vô minh, hữu ái’’ là hai thứ vô minh và hữu ái, là thành phần gốc rễ, giống như trục bánh xe ngựa, nằm bên trong và bên ngoài.
Nābhiyā nemiyā ca sambaddhaarasadisā paccayaphalabhūtehi avijjātaṇhājarāmaraṇehi sambaddhā puññābhisaṅkhāraapuññābhisaṅkhāraāneñjābhisaṅkhārāti vuttaṃ ‘‘puññādiabhisaṅkhārāra’’nti.
Like the spokes connected to the nave and rim, connected by the cause-and-effect results of ignorance, craving, aging, and death, are meritorious volitional formations, demeritorious volitional formations, and imperturbable volitional formations, hence “with spokes of meritorious and other volitional formations.”
Cái được gọi là ‘‘nan hoa làm bằng các hành thiện, v.v.’’ là các hành thiện (puññābhisaṅkhāra), các hành bất thiện (apuññābhisaṅkhāra) và các hành bất động (āneñjābhisaṅkhāra), liên kết với vô minh, ái, già chết, là các nhân quả, giống như các nan hoa nối trục và vành bánh xe.
Tattha tattha bhave pariyantabhāvena pākaṭaṃ jarāmaraṇanti taṃ nemiṭṭhāniyaṃ katvā āha ‘‘jarāmaraṇanemī’’ti.
Aging and death, which are manifest as the concluding aspect in each existence, are treated as the rim, thus he said: “with the rim of aging and death.”
Già chết (jarāmaraṇa) là cái rõ ràng ở cuối mỗi kiếp sống, nên lấy nó làm vị trí của vành bánh xe và nói ‘‘vành bánh xe là già chết’’.
Yathā rathacakkappavattiyā padhānakāraṇaṃ akkho, evaṃ saṃsāracakkappavattiyā āsavasamudayoti āha ‘‘āsavasamudayamayena akkhena vijjhitvā’’ti.
Just as the axle is the primary cause for the movement of a chariot wheel, so too the origin of the āsavas is for the movement of the wheel of saṃsāra, thus he said: “having pierced with the axle made of the origin of the āsavas.”
Cũng như trục là nguyên nhân chính cho sự vận hành của bánh xe ngựa, thì sự tập khởi của các lậu hoặc là nguyên nhân cho sự vận hành của bánh xe luân hồi, nên* nói: ‘‘đã xuyên thủng bằng trục làm bằng sự tập khởi của các lậu hoặc’’.
Āsavā eva avijjādīnaṃ kāraṇattā āsavasamudayo.
The āsavas themselves are the origin of the āsavas because they are the cause of ignorance and so forth.
Các lậu hoặc chính là sự tập khởi của các lậu hoặc vì chúng là nguyên nhân của vô minh, v.v.
Yathāha ‘‘āsavasamudayā avijjāsamudayo’’ti (ma. ni. 1.103).
As it is said: “From the origin of the āsavas comes the origin of ignorance.”
Như đã nói: ‘‘Do sự tập khởi của các lậu hoặc mà có sự tập khởi của vô minh’’ (Ma. Ni. 1.103).
Vipākakaṭattārūpappabhedo kāmabhavādiko tibhavo eva ratho, tasmiṃ tibhavarathe.
The three planes of existence, beginning with the sense-sphere, consisting of result, kamma-born, and formless states, are the chariot; in that chariot of the three planes of existence.
Ba cõi (tibhawo) là dục giới, sắc giới và vô sắc giới, là sự phân loại của quả dị thục và nghiệp đã tạo, chính là cỗ xe, trong cỗ xe ba cõi đó.
Attano paccayehi samaṃ, sabbaso vā ādito paṭṭhāya yojitanti samāyojitaṃ.
Yoked together with its causes, or entirely from the very beginning, thus samāyojitaṃ (yoked together).
Samāyojitaṃ (đã được kết nối) là được kết nối cùng với các nhân của nó, hoặc được kết nối hoàn toàn từ đầu.
Ādirahitaṃ kālaṃ pavattatīti katvā anādikālappavattaṃ.
Because it proceeds for a time without a beginning, thus anādikālappavattaṃ (proceeding for beginningless time).
Vì nó vận hành trong thời gian không có khởi đầu, nên gọi là anādikālappavattaṃ (vận hành từ thời vô thủy).
Evaṃ vuttasaṃsārova saṃsāracakkaṃ.
Thus the wheel of saṃsāra is saṃsāra as described.
Sự vận hành không gián đoạn, được gọi là luân hồi’’ (Thanh Tịnh Đạo 2.619, v.v.) – Luân hồi được nói như vậy chính là bánh xe luân hồi.
Anenāti bhagavatā.
Anena means by the Blessed One.
Anenāti (A-nê-ná) là bởi Đức Thế Tôn.
Bodhimaṇḍeti bodhisaṅkhātassa ñāṇassa maṇḍabhāvappatte ṭhāne kāle vā.
Bodhimaṇḍe means at the place or time where wisdom, called Bodhi, attained the state of clarity (maṇḍa).
Bodhimaṇḍeti (Bô-đhí-man-đê) là tại nơi hoặc thời điểm trí tuệ giác ngộ (bodhi) đạt đến trạng thái viên mãn (maṇḍa).
Bodhīti paññā, sā ettha maṇḍā pasannā jātāti bodhimaṇḍo.
Bodhi means wisdom; since it became clear (maṇḍa) here, it is Bodhimaṇḍa.
Bodhī (Bô-đhí) là trí tuệ, ở đây trí tuệ đã trở nên viên mãn (maṇḍā), trong sáng, nên gọi là Bodhimaṇḍo (Bô-đhí-man-đô).
Vīriyapādehīti saṃkilesavodānapakkhiyesu sannirumbhanasannikkhipanakiccatāya dvidhā pavatteti attano vīriyasaṅkhātehi pādehi.
Vīriyapādehī means by his own feet, which are his effort, functioning in two ways: for the suppression of defilements and for the accumulation of wholesome states.
Vīriyapādehīti (Vì-rì-ya-pá-đê-hì) là bằng đôi chân tinh tấn của chính mình, vận hành theo hai cách: kiềm chế (sannirumbhana) và tích lũy (sannikkhipana) trong các pháp thuộc về phiền não và thanh tịnh.
Sīlapathaviyanti patiṭṭhānaṭṭhena sīlameva pathavī, tassaṃ.
Sīlapathaviyaṃ means on the earth that is virtue, in the sense of a foundation.
Sīlapathaviyanti (Sì-la-pá-thá-vì-yan) là giới luật chính là mặt đất (pathavī) theo nghĩa là nền tảng, trên mặt đất đó.
Patiṭṭhāyāti sampādanavasena patiṭṭhahitvā.
Patiṭṭhāyā means having established oneself in the sense of accomplishment.
Patiṭṭhāyāti (Pá-tít-thá-yá) là đã an trú theo nghĩa thành tựu.
Saddhāhatthenāti anavajjadhammādānasādhanato saddhāva hattho, tena.
Saddhāhatthena means by the hand that is faith, because it serves as a means for taking hold of blameless states.
Saddhāhatthenāti (Sát-đhá-hát-thê-ná) là niềm tin (saddhā) chính là bàn tay (hattha) vì nó có khả năng nắm giữ các pháp không lỗi lầm, bằng bàn tay đó.
Kammakkhayakaranti kāyakammādibhedassa sabbassapi kammassa khayakaraṇato kammakkhayakaraṃ.
Kammakkhayakaraṃ means that which causes the destruction of all kamma, including bodily kamma, etc., therefore it is that which causes the destruction of kamma.
Kammakkhayakaranti (Kám-mác-kháy-ya-ká-raṃ) là làm cho nghiệp (kamma) chấm dứt, vì nó làm chấm dứt tất cả các loại nghiệp như thân nghiệp, v.v.
Ñāṇapharasunti samādhisilāyaṃ sunisitaṃ maggañāṇapharasuṃ gahetvā.
Ñāṇapharasuṃ means having taken the axe of path-knowledge, sharpened on the whetstone of concentration.
Ñāṇapharasunti (Nhá-ná-phá-rá-sun) là cầm chiếc rìu trí tuệ đạo (maggañāṇa) đã được mài sắc trên phiến đá định (samādhisilā).
Evaṃ ‘‘arānaṃ hatattā’’ti ettha vuttaṃ arasaṅkhātaṃ saṃsāraṃ cakkaṃ viya cakkanti gahetvā atthayojanaṃ katvā idāni paṭiccasamuppādadesanākkamenapi taṃ dassetuṃ ‘‘atha vā’’tiādi vuttaṃ.
Thus, in the phrase “because of the destruction of the spokes,” having taken saṃsāra, which is called a spoke, as a wheel, and having constructed the meaning, now, to show it also by the method of teaching dependent origination, “or else,” etc., was said.
Như vậy, sau khi đã giải thích ý nghĩa của từ ‘‘arānaṃ hatattā’’ (đã diệt trừ các nan hoa) bằng cách coi luân hồi là nan hoa giống như bánh xe, bây giờ để chỉ ra điều đó theo cách thuyết giảng duyên khởi,* nói ‘‘atha vā’’ (hoặc là), v.v.
Tattha anamataggasaṃsāravaṭṭanti anu anu amataggaṃ aviññātapubbakoṭikaṃ saṃsāramaṇḍalaṃ.
There, anamataggasaṃsāravaṭṭaṃ means the cycle of saṃsāra whose beginning-point (agga) is unknown (anamata).
Trong đó, anamataggasaṃsāravaṭṭanti (a-ná-mát-tác-gác-sàng-sá-rá-vát-táṃ) là vòng luân hồi có khởi đầu không thể biết (aviññātapubbakoṭikaṃ), tức là không có điểm khởi đầu được nhận biết.
Sesā dasa dhammāti saṅkhārādayo jātipariyosānā dasa dhammā.
Sesā dasa dhammā means the other ten states, from volitional formations (saṅkhārā) up to birth (jāti).
Sesā dasa dhammāti (sê-sá đa-sá đhám-má) là mười pháp còn lại, từ các hành (saṅkhāra) cho đến già chết (jāti).
Kathaṃ tesaṃ saṅkhārādīnaṃ arabhāvoti āha ‘‘avijjāmūlakattā jarāmaraṇapariyantattā cā’’ti.
How are these volitional formations, etc., spokes? He said: “because they have ignorance as their root and end in aging and death.”
Làm thế nào mà các hành, v.v. đó lại là nan hoa?* nói: ‘‘do có gốc rễ là vô minh và kết thúc bằng già chết’’.
Tattha avijjā mūlaṃ padhānakāraṇaṃ yesaṃ saṅkhārādīnaṃ te avijjāmūlakā, tesaṃ bhāvo avijjāmūlakattaṃ.
There, avijjāmūlakattaṃ means the state of having ignorance as their root, which is the principal cause of these volitional formations and so forth.
Trong đó, vô minh là gốc rễ, là nguyên nhân chính của các hành, v.v. thì chúng là avijjāmūlakā (có gốc rễ là vô minh), trạng thái của chúng là avijjāmūlakattaṃ (trạng thái có gốc rễ là vô minh).
Jarāmaraṇaṃ pariyantaṃ pariyosānabhūtaṃ etesanti jarāmaraṇapariyantā, saṅkhārādayo dasa dhammā.
Aging and death are the ending, the concluding state, for these ten states, from volitional formations up to birth; thus they are jarāmaraṇapariyantā (ending in aging and death).
Già chết là điểm cuối cùng, là sự kết thúc của chúng, nên chúng là jarāmaraṇapariyantā (kết thúc bằng già chết), tức là mười pháp từ các hành, v.v.
Tesaṃ bhāvo jarāmaraṇapariyantattaṃ.
Their state is jarāmaraṇapariyantattaṃ.
Trạng thái của chúng là jarāmaraṇapariyantattaṃ (trạng thái kết thúc bằng già chết).
Saṅkhārādijātipariyosānānaṃ dasadhammānaṃ avijjāmūlakattā jarāmaraṇapariyosānattā cāti attho, nābhibhūtāya avijjāya mūlato nemibhūtena jarāmaraṇena antato saṅkhārādīnaṃ sambandhattāti adhippāyo.
The meaning is: because the ten states, from volitional formations up to birth, have ignorance as their root and end in aging and death; the intention is that the volitional formations and so forth are fundamentally connected to ignorance, which is like the nave, and ultimately connected to aging and death, which are like the rim.
Nghĩa là, mười pháp từ các hành cho đến già chết có gốc rễ là vô minh và kết thúc bằng già chết, tức là các hành, v.v. liên hệ từ gốc rễ là vô minh như trục bánh xe, cho đến cuối cùng là già chết như vành bánh xe.
Dukkhādīsūti dukkhasamudayanirodhamaggesu.
Dukkhādīsu means in suffering, its origin, its cessation, and the path.
Dukkhādīsūti (Đúc-khá-đì-su) là trong khổ, tập, diệt, đạo.
Aññāṇanti ñāṇappaṭipakkhattā moho aññāṇaṃ, na pana ñāṇato aññaṃ, napi ñāṇassa abhāvamattaṃ.
Aññāṇaṃ means delusion (moha) is unknowing (aññāṇaṃ) because it is the opposite of knowledge (ñāṇa), not something different from knowledge, nor merely the absence of knowledge.
Aññāṇanti (A-nhá-náṃ) là si mê (moha) là vô minh (aññāṇa) vì nó đối lập với trí tuệ (ñāṇa), chứ không phải là một cái gì khác ngoài trí tuệ, cũng không phải chỉ là sự thiếu vắng trí tuệ.
Tattha dukkhādīsu aññāṇaṃ yathāsabhāvappaṭivedhāppadānato tappaṭicchādanavaseneva.
There, unknowing regarding suffering and so forth is through the function of obscuring, as it does not provide insight into their true nature.
Trong đó, vô minh về khổ, v.v. chỉ là che giấu (paṭicchādana) chứ không phải là sự thấu hiểu bản chất đúng đắn.
Ettha hi kiñcāpi ṭhapetvā lokuttarasaccadvayaṃ sesaṭṭhānesu ārammaṇavasenapi avijjā uppajjati, evaṃ santepi paṭicchādanavaseneva idha adhippetā.
Here, although ignorance can also arise as an object in other places apart from the two supramundane truths, even so, it is primarily intended here in the sense of obscuring.
Ở đây, mặc dù vô minh có thể phát sinh như một đối tượng trong các trường hợp khác ngoài hai chân lý siêu thế, nhưng ở đây nó được hiểu theo nghĩa che giấu.
Sā hi uppannā dukkhasaccaṃ paṭicchādetvā tiṭṭhati, yāthāvasarasalakkhaṇaṃ paṭivijjhituṃ na deti, tathā samudayaṃ nirodhaṃ magganti.
For when it arises, it obscures the truth of suffering, not allowing one to penetrate its actual characteristic, and likewise with the origin, cessation, and path.
Khi vô minh phát sinh, nó che giấu khổ đế, không cho phép thấu hiểu đặc tính và bản chất của nó, cũng như che giấu tập đế, diệt đế và đạo đế.
Dukkhanti cettha dukkhaṃ ariyasaccaṃ adhippetanti taṃ kāmabhavādivasena tidhā bhinditvā tathā tappaṭicchādikañca avijjaṃ tidhā katvā avijjādipaccaye tīsu bhavesu saṅkhārādike paṭipāṭiyā dassento ‘‘kāmabhave ca avijjā’’tiādimāha.
Here, dukkha is intended as the noble truth of suffering. Having divided it threefold based on the sense-sphere existence and so on, and likewise having made ignorance, which covers it, threefold, he states, beginning with " and ignorance in the sense-sphere existence," thereby showing the conditionality of ignorance and so on, for the volitional formations and so on, in the three planes of existence, in sequence.
Ở đây, khổ (dukkha) được hiểu là Khổ Thánh đế. Chia khổ ấy thành ba theo dục hữu (kāmabhava) và các loại tương tự, đồng thời chia vô minh (avijjā) che đậy khổ ấy thành ba, rồi tuần tự trình bày các duyên như vô minh là nhân cho các hành (saṅkhārā) và các pháp khác trong ba cõi hữu, đoạn kinh nói “vô minh trong dục hữu” và vân vân.
Tattha kāmabhave ca avijjāti kāmabhave ādīnavapaṭicchādikā avijjā.
In that regard, "and ignorance in the sense-sphere existence" means the ignorance that conceals the danger in the sense-sphere existence.
Trong đó, “vô minh trong dục hữu” (kāmabhave ca avijjā) có nghĩa là vô minh che giấu sự nguy hiểm trong dục hữu.
Rūpabhave avijjā arūpabhave avijjāti etthāpi eseva nayo.
The same principle applies to "ignorance in the form-sphere existence, ignorance in the formless-sphere existence" as well.
“Vô minh trong sắc hữu (rūpabhave avijjā), vô minh trong vô sắc hữu (arūpabhave avijjā)” ở đây cũng theo cách giải thích tương tự.
Kāmabhave saṅkhārānanti kāmabhūmipariyāpannānaṃ puññāpuññasaṅkhārānaṃ, kāmabhave vā nipphādetabbā ye puññāpuññasaṅkhārā, tesaṃ kāmabhavūpapattinibbattakasaṅkhārānanti attho.
"For the volitional formations in the sense-sphere existence" means for the wholesome and unwholesome volitional formations pertaining to the sense-sphere realm, or alternatively, those wholesome and unwholesome volitional formations that are to be produced in the sense-sphere existence, meaning the volitional formations that bring about rebirth in the sense-sphere existence.
“Các hành trong dục hữu” (kāmabhave saṅkhārānaṃ) có nghĩa là các hành phước và bất phước thuộc về cõi dục (kāmabhūmi), hoặc các hành phước và bất phước sẽ được tạo ra trong dục hữu, tức là các hành tạo ra sự tái sinh trong dục hữu.
Saṅkhārāti cettha lokiyakusalākusalacetanā veditabbā.
Here, volitional formations should be understood as mundane wholesome and unwholesome volitions.
Các hành (saṅkhārā) ở đây nên hiểu là các tư (cetanā) thiện và bất thiện thuộc thế gian.
Paccayo hotīti puññābhisaṅkhārānaṃ tāva ārammaṇapaccayena ceva upanissayapaccayena cāti dvidhā paccayo hoti, apuññābhisaṅkhāresu sahajātassa sahajātādivasena, asahajātassa anantarasamanantarādivasena, anānantarassa pana ārammaṇavasena ceva upanissayavasena ca paccayo hoti.
"Is a condition": For wholesome volitional formations (puññābhisaṅkhārānaṃ) it is a condition in two ways: as object condition and as decisive support condition. For unwholesome volitional formations (apuññābhisaṅkhāresu), for those that are co-arisen, it is a condition in the way of co-arisen and so on; for those that are not co-arisen, in the way of immediate, contiguous, and so on; and for those that are not immediate, it is a condition by way of object and decisive support.
Là duyên (paccayo hoti) có nghĩa là, đối với các hành phước (puññābhisaṅkhārā), vô minh là duyên theo hai cách: duyên đối tượng (ārammaṇapaccaya) và duyên y chỉ mạnh (upanissayapaccaya); đối với các hành bất phước (apuññābhisaṅkhāra) đồng sinh, là duyên đồng sinh (sahajātapaccaya) và các loại tương tự; đối với các hành không đồng sinh, là duyên vô gián (anantarapaccaya), duyên đẳng vô gián (samanantarapaccaya) và các loại tương tự; còn đối với các hành không vô gián, là duyên đối tượng và duyên y chỉ mạnh.
Arūpabhave saṅkhārānanti āneñjābhisaṅkhārānaṃ.
"For the volitional formations in the formless-sphere existence" refers to the imperturbable volitional formations (āneñjābhisaṅkhārānaṃ).
“Các hành trong vô sắc hữu” (arūpabhave saṅkhārānaṃ) có nghĩa là các hành bất động (āneñjābhisaṅkhāra).
Paccayo hotīti upanissayapaccayavaseneva.
"Is a condition" means solely by way of decisive support condition.
Là duyên (paccayo hoti) chỉ theo cách duyên y chỉ mạnh.
Imasmiñca panatthe ettha vitthāriyamāne atippapañco hoti, tasmā taṃ nayidha vitthārayissāma.
If this matter were to be elaborated upon here, it would become overly diffuse; therefore, we will not elaborate on it here.
Nếu giải thích rộng về ý nghĩa này ở đây thì sẽ quá dài dòng, vì vậy chúng tôi sẽ không giải thích rộng ở đây.
Itaresūti rūpārūpabhavesu.
"In the others" means in the form-sphere and formless-sphere existences.
“Trong các cõi khác” (itaresu) có nghĩa là trong sắc hữu và vô sắc hữu.
Tiṇṇaṃ āyatanānanti cakkhusotamanāyatanānaṃ ghānādittayassa tattha asambhavato.
"Of the three bases" refers to the eye, ear, and mind bases, because the three beginning with nose cannot exist there.
“Ba xứ” (tiṇṇaṃ āyatanānaṃ) là nhãn xứ (cakkhāyatana), nhĩ xứ (sotāyatana) và ý xứ (manāyatana), vì ba xứ còn lại (khứu, thiệt, thân) không thể có ở đó.
Ekassāti manāyatanassa itaresaṃ tattha asambhavato.
"Of one" refers to the mind base, because the others cannot exist there.
“Một xứ” (ekassā) là ý xứ, vì các xứ còn lại không thể có ở đó.
Iminā nayena tiṇṇaṃ phassānantiādīsupi attho veditabbo.
In this same way, the meaning should be understood in phrases such as "of the three contacts" and so on.
Theo cách này, ý nghĩa của “ba xúc” (tiṇṇaṃ phassānaṃ) và các loại tương tự cũng nên được hiểu.
Chabbidhassa phassassāti cakkhusamphassasotasamphassaghānasamphassajivhāsamphassakāyasamphassamanosamphassānaṃ vasena chabbidhassa phassassa.
"Of the six types of contact" refers to the six types of contact: eye-contact, ear-contact, nose-contact, tongue-contact, body-contact, and mind-contact.
“Sáu loại xúc” (chabbidhassa phassassa) là xúc nhãn (cakkhusamphassa), xúc nhĩ (sotasamphassa), xúc tỷ (ghānasamphassa), xúc thiệt (jivhāsamphassa), xúc thân (kāyasamphassa) và xúc ý (manosamphassa).
Channaṃ vedanānanti cakkhusamphassajā vedanā, tathā sotasamphassajā ghānasamphassajā jivhāsamphassajā kāyasamphassajā manosamphassajā vedanāti imāsaṃ channaṃ vedanānaṃ.
"Of the six feelings" refers to these six feelings: feeling born of eye-contact, and likewise, feeling born of ear-contact, nose-contact, tongue-contact, body-contact, and mind-contact.
“Sáu loại thọ” (channaṃ vedanānaṃ) là thọ do xúc nhãn sinh, thọ do xúc nhĩ sinh, thọ do xúc tỷ sinh, thọ do xúc thiệt sinh, thọ do xúc thân sinh và thọ do xúc ý sinh.
Channaṃ taṇhākāyānanti rūpataṇhā saddataṇhā gandhataṇhā rasataṇhā phoṭṭhabbataṇhā dhammataṇhāti imesaṃ channaṃ taṇhākāyānaṃ.
"Of the six bodies of craving" refers to these six bodies of craving: craving for forms, craving for sounds, craving for odors, craving for tastes, craving for tangibles, and craving for mental objects.
“Sáu loại ái” (channaṃ taṇhākāyānaṃ) là sắc ái (rūpataṇhā), thanh ái (saddataṇhā), hương ái (gandhataṇhā), vị ái (rasataṇhā), xúc ái (phoṭṭhabbataṇhā) và pháp ái (dhammataṇhā).
Tattha tattha sā sā taṇhāti rūpataṇhādibhedā tattha tattha kāmabhavādīsu uppajjanakataṇhā.
"That particular craving there" means the craving that arises in each respective place, such as in the sense-sphere existence, being of the nature of craving for forms and so on.
“Ái ấy ở nơi đó” (tattha tattha sā sā taṇhā) có nghĩa là ái sinh khởi ở nơi đó, trong dục hữu và các cõi khác, được phân loại thành sắc ái và các loại tương tự.
Sā taṇhādimūlikā kathā atisaṃkhittāti taṃ upādānabhave ca vibhajitvā vitthāretvā dassetuṃ ‘‘katha’’ntiādi vuttaṃ.
Since that discourse, rooted in craving, is too concise, in order to explain it further by also analyzing it in the existence of clinging, the phrase "how" and so on was stated.
Vì lời dạy về ái làm gốc quá vắn tắt, nên để phân tích và trình bày rộng hơn về ái ấy trong hữu (bhava) do chấp thủ (upādāna), đoạn kinh nói “như thế nào” (kathaṃ) và vân vân.
Tattha kāme paribhuñjissāmīti iminā kāmataṇhāpavattimāha, tathā saggasampattiṃ anubhavissāmītiādīhi.
Therein, with "I will enjoy sense pleasures," he speaks of the arising of sense-craving, and likewise with "I will experience heavenly bliss," and so on.
Trong đó, “tôi sẽ thọ hưởng các dục” (kāme paribhuñjissāmīti) nói lên sự phát sinh của dục ái (kāmataṇhā), cũng như “tôi sẽ kinh nghiệm sự thành tựu của cõi trời” (saggasampattiṃ anubhavissāmīti) và các loại tương tự.
Sā pana taṇhā yasmā bhusamādānavasena pavattamānā kāmupādānaṃ nāma hoti, tasmā vuttaṃ ‘‘kāmupādānapaccayā’’ti.
Since that craving, when it occurs with intense grasping, is called clinging to sense pleasures, it is said, "conditioned by clinging to sense pleasures."
Ái ấy, vì khi phát sinh mạnh mẽ như một sự chấp thủ, được gọi là dục chấp thủ (kāmupādāna), nên kinh nói “do duyên dục chấp thủ” (kāmupādānapaccayā).
Tathevāti kāmupādānapaccayā eva.
"Likewise" means conditioned by clinging to sense pleasures.
“Cũng vậy” (tathevā) có nghĩa là cũng do duyên dục chấp thủ.
Brahmalokasampattinti rūpībrahmaloke sampattiṃ.
"Bliss of the Brahma world" means bliss in the Brahma world with form.
“Sự thành tựu của cõi Phạm thiên” (brahmalokasampattiṃ) là sự thành tựu trong cõi Phạm thiên sắc giới.
‘‘Sabbepi tebhūmakā dhammā kāmanīyaṭṭhena kāmā’’ti vacanato bhavarāgopi kāmupādānamevāti katvā ‘‘kāmupādānapaccayā eva mettaṃ bhāvetī’’tiādi vuttaṃ.
According to the saying, "All phenomena of the three planes of existence are sense pleasures in the sense of being desirable," clinging to existence is also clinging to sense pleasures; therefore, it is said, "conditioned by clinging to sense pleasures, one cultivates loving-kindness," and so on.
Theo nguyên tắc ‘‘tất cả các pháp thuộc ba cõi đều là dục vì chúng đáng được ham muốn’’, nên tham hữu (bhavarāga) cũng là dục chấp thủ, do đó kinh nói “do duyên dục chấp thủ, hành thiền từ” (kāmupādānapaccayā eva mettaṃ bhāvetīti) và vân vân.
Tattha mettaṃ bhāvetīti mijjati siniyhatīti mettā, taṃ bhāveti vaḍḍhetīti attho.
Therein, "cultivates loving-kindness": mijjati siniyhati means loving-kindness; to cultivate it means to develop it.
Trong đó, “hành thiền từ” (mettaṃ bhāvetīti) có nghĩa là từ (mettā) là cái làm cho người ta yêu mến, thân thiện; hành thiền từ là làm cho nó phát triển.
Atha vā mettā etassa atthīti mettaṃ, cittaṃ, taṃsampayuttaṃ jhānaṃ vā, taṃ bhāveti vaḍḍheti uppādeti vāti attho.
Alternatively, that which has loving-kindness is called mettaṃ, meaning the mind, or the jhāna associated with it; to cultivate it means to develop it or produce it.
Hoặc, từ (mettā) là cái có lòng từ, tức là tâm (citta) hoặc thiền (jhāna) tương ưng với nó; hành thiền từ là làm cho nó phát triển hoặc sinh khởi.
Karuṇaṃ bhāvetītiādīsupi imināva nayena attho veditabbo.
The meaning in "cultivates compassion" and so on should be understood in the same way.
Trong “hành thiền bi” (karuṇaṃ bhāvetīti) và các loại tương tự, ý nghĩa cũng nên được hiểu theo cách này.
Sesupādānamūlikāsupīti diṭṭhupādānasīlabbatupādānaattavādupādānamūlikāsupi yojanāsu eseva nayoti attho.
"And in other applications of clinging": This means that the same principle applies to applications rooted in clinging to views, clinging to rites and rituals, and clinging to a doctrine of self.
“Trong các loại chấp thủ làm gốc còn lại” (sesupādānamūlikāsupi) có nghĩa là, trong các cách kết hợp dựa trên tà kiến chấp thủ (diṭṭhupādāna), giới cấm thủ (sīlabbatupādāna) và ngã kiến chấp thủ (attavādupādāna) làm gốc, cũng theo cách tương tự.
Tatthāyaṃ yojanā – idhekacco ‘‘natthi paraloko’’ti natthikadiṭṭhiṃ gaṇhāti, so diṭṭhupādānapaccayā kāyena duccaritaṃ caratītiādi vuttanayena yojetabbaṃ.
Here is the application: Someone here holds a nihilistic view, saying, "There is no other world." This should be applied according to the method stated, "conditioned by clinging to views, he commits misconduct by body," and so on.
Cách kết hợp như sau: Ở đây, một số người chấp giữ tà kiến đoạn diệt (natthikadiṭṭhi) rằng “không có đời sau”; người ấy, do duyên tà kiến chấp thủ, thực hành ác hạnh bằng thân và các loại tương tự, nên cần kết hợp theo cách đã nói.
Aparo ‘‘asukasmiṃ sampattibhave attā ucchijjatī’’ti ucchedadiṭṭhiṃ gaṇhāti, so tatrūpapattiyā kāyena sucaritaṃ caratītiādi vuttanayeneva yojetabbaṃ.
Another person holds the annihilationist view, saying, "The self is annihilated in such and such a blissful existence." This should be applied according to the method stated, "for the sake of rebirth there, he performs good conduct by body," and so on.
Một người khác chấp giữ tà kiến đoạn diệt rằng “tự ngã sẽ bị đoạn diệt trong một cõi hữu thành tựu nào đó”; người ấy, để tái sinh vào cõi đó, thực hành thiện hạnh bằng thân và các loại tương tự, nên cần kết hợp theo cách đã nói.
Aparo ‘‘rūpī manomayo hutvā attā ucchijjatī’’ti rūpūpapattiyā maggaṃ bhāveti bhāvanāpāripūriyāti sabbaṃ vuttanayeneva veditabbaṃ.
Another person, saying, "The self, having become form-based and mind-made, is annihilated," cultivates the path for rebirth in the form realm, to the full perfection of his development; all this should be understood according to the stated method.
Một người khác chấp giữ tà kiến rằng “tự ngã sẽ bị đoạn diệt khi trở thành thân ý tạo (manomaya) có sắc”; người ấy tu tập đạo (magga) để tái sinh vào sắc hữu, do sự viên mãn của tu tập; tất cả đều nên hiểu theo cách đã nói.
Aparopi ‘‘arūpabhave uppajjitvā attā ucchijjatī’’ti arūpūpapattiyā maggaṃ bhāveti bhāvanāpāripūriyāti sabbaṃ vuttanayeneva veditabbaṃ.
Yet another, saying, "The self, having arisen in the formless realm, is annihilated," cultivates the path for rebirth in the formless realm, to the full perfection of his development; all this should be understood according to the stated method.
Một người khác nữa chấp giữ tà kiến rằng “tự ngã sẽ bị đoạn diệt khi sinh vào vô sắc hữu”; người ấy tu tập đạo để tái sinh vào vô sắc hữu, do sự viên mãn của tu tập; tất cả đều nên hiểu theo cách đã nói.
Etāhiyeva attavādupādānamūlikāpi yojanā saṃvaṇṇitāti daṭṭhabbaṃ.
It should be seen that applications rooted in clinging to a doctrine of self are also explained by these same points.
Cũng cần thấy rằng các cách kết hợp dựa trên ngã kiến chấp thủ cũng được giải thích theo những cách này.
Evaṃ diṭṭhadhammanibbānavādavasenapi yojanā veditabbā.
Likewise, the application based on the doctrine of Nibbāna in this very life should be understood.
Cũng vậy, cách kết hợp dựa trên thuyết Niết bàn hiện tại (diṭṭhadhammanibbānavāda) cũng nên được hiểu.
Aparo ‘‘sīlena suddhi, vatena suddhī’’ti asuddhimaggaṃ ‘‘suddhimaggo’’ti parāmasanto sīlabbatupādānapaccayā kāyena duccaritaṃ caratītiādi sabbaṃ vuttanayeneva yojetabbaṃ.
Another person, mistakenly regarding an impure path as "the path to purity," saying, "purity through virtue, purity through ritual," commits misconduct by body conditioned by clinging to rites and rituals; all this should be applied according to the stated method.
Một người khác, khi xem xét con đường bất tịnh là “con đường thanh tịnh” với ý nghĩ “thanh tịnh do giới, thanh tịnh do cấm giới”, người ấy, do duyên giới cấm thủ, thực hành ác hạnh bằng thân và các loại tương tự; tất cả đều nên kết hợp theo cách đã nói.
Idāni yvāyaṃ saṃsāracakkaṃ dassentena ‘‘kāmabhave avijjā kāmabhave saṅkhārānaṃ paccayo hotī’’tiādinā avijjādīnaṃ paccayabhāvo saṅkhārādīnaṃ paccayuppannabhāvo ca dassito, tameva paṭisambhidāmaggapāḷiṃ ānetvā nigamanavasena dassento ‘‘evamaya’’ntiādimāha.
Now, to conclude and show the conditionality of ignorance and so on, and the conditioned arising of volitional formations and so on, as demonstrated by the phrase "ignorance in the sense-sphere existence is a condition for volitional formations in the sense-sphere existence" and so on, which depicts the cycle of saṃsāra, he states, beginning with "thus this," by citing the Paṭisambhidāmagga Pāli.
Bây giờ, để kết luận, trình bày lại vòng luân hồi (saṃsāracakka) đã được chỉ ra bằng cách nói “vô minh trong dục hữu là duyên cho các hành trong dục hữu” và các loại tương tự, trong đó sự duyên khởi của vô minh và các pháp khác, cùng với sự sinh khởi của các hành và các pháp khác do duyên, kinh nói “như thế này” và vân vân, dẫn từ kinh Paṭisambhidāmagga.
Tattha yathā saṅkhārā hetunibbattā, evaṃ avijjāpi kāmāsavādinā sahetukā evāti āha ‘‘ubhopete hetusamuppannā’’ti.
Therein, just as volitional formations are produced by causes, so too ignorance is indeed caused by defilements such as craving for sensual pleasures; thus, it states, "both of these are causally arisen."
Trong đó, giống như các hành được sinh ra do nhân, vô minh cũng có nhân do dục lậu (kāmāsava) và các loại tương tự, nên kinh nói “cả hai điều này đều do nhân sinh” (ubhopete hetusamuppannā).
Paccayapariggaheti nāmarūpassa paccayānaṃ avijjādīnaṃ paricchijja gahaṇe.
"In the comprehension of conditions" refers to the discerning apprehension of the conditions of mind-and-matter, such as ignorance and so on.
“Trong việc phân biệt duyên” (paccayapariggahe) có nghĩa là trong việc phân biệt các duyên của danh sắc, tức là vô minh và các pháp khác.
Nipphādetabbe bhummaṃ.
The locative case implies "to be produced."
Từ “nipphādetabbe” (cần được tạo ra) là thuộc cách chỉ định vị trí.
Paññāti kaṅkhāvitaraṇavisuddhisaṅkhātā pakārato jānanā.
"Wisdom" refers to knowledge in a distinct manner, known as purification from doubt.
“Tuệ” (paññā) là sự hiểu biết đặc biệt, được gọi là sự thanh tịnh vượt qua nghi ngờ (kaṅkhāvitaraṇavisuddhi).
Dhammaṭṭhitiñāṇanti tiṭṭhanti ettha phaladhammā tadāyattavuttitāyāti ṭhiti, kāraṇaṃ, dhammānaṃ ṭhiti dhammaṭṭhiti, dhammaṭṭhitiyā ñāṇaṃ dhammaṭṭhitiñāṇaṃ, paccayañāṇanti attho, paṭiccasamuppādāvabodhoti vuttaṃ hoti.
"Knowledge of the stability of phenomena": Ṭhiti means that wherein resultant phenomena stand, because they are dependent on it; it means cause. Dhammaṭṭhiti is the stability of phenomena. Dhammaṭṭhitiñāṇa is the knowledge of the stability of phenomena, meaning knowledge of conditions; it is said to be the comprehension of dependent origination.
“Pháp trụ trí” (dhammaṭṭhitiñāṇaṃ) là “trụ” (ṭhiti) nơi các pháp quả tồn tại, vì chúng có sự tồn tại phụ thuộc vào đó, tức là nhân (kāraṇa); “pháp trụ” (dhammaṭṭhiti) là sự trụ của các pháp; “pháp trụ trí” (dhammaṭṭhitiñāṇaṃ) là trí về pháp trụ, tức là trí về duyên (paccayañāṇaṃ), có nghĩa là sự giác ngộ về Duyên khởi (paṭiccasamuppāda).
Kāmañcettha paccayapariggahe paññāyeva dhammaṭṭhitiñāṇaṃ, saṅkhāresu pana adiṭṭhesu avijjāya saṅkhārānaṃ paccayabhāvo na sakkā daṭṭhunti ‘‘saṅkhārā hetusamuppannā’’ti paccayuppannadhammānampi gahaṇaṃ katanti veditabbaṃ.
Although here, wisdom in the comprehension of conditions is itself the knowledge of the stability of phenomena, it should be understood that since the conditionality of ignorance for volitional formations cannot be seen if the volitional formations are not perceived, the apprehension of conditioned phenomena with "volitional formations are causally arisen" is also made.
Mặc dù ở đây, tuệ trong việc phân biệt duyên chính là pháp trụ trí, nhưng vì không thể thấy sự duyên khởi của vô minh đối với các hành khi các hành chưa được thấy, nên cần hiểu rằng kinh cũng đề cập đến các pháp do duyên sinh bằng cách nói “các hành do nhân sinh” (saṅkhārā hetusamuppannā).
Ubhopete hetusamuppannāti idaṃ pana ubhinnampi paccayuppannabhāvaṃ dassetukāmatāya vuttaṃ.
However, "both of these are causally arisen" is stated with the intention of showing the causally arisen nature of both.
Còn câu “cả hai điều này đều do nhân sinh” (ubhopete hetusamuppannā) được nói ra để chỉ rõ rằng cả hai đều do duyên sinh.
Idañca dhammaṭṭhitiñāṇaṃ yasmā addhattaye kaṅkhāmalavitaraṇavasena pavattati, tasmā ‘‘atītampi addhāna’’ntiādi vuttaṃ.
And since this knowledge of the stability of phenomena operates by removing the stain of doubt in the three times, "even the past time" and so on is stated.
Và vì pháp trụ trí này hoạt động bằng cách loại bỏ vết nhơ của nghi ngờ trong ba thời, nên kinh nói “cả thời quá khứ” (atītampi addhānaṃ) và vân vân.
Etena nayena sabbapadāni vitthāretabbānīti etena nayena ‘‘avijjā hetū’’tiādinā avijjāyaṃ vuttanayena ‘‘saṅkhārā hetu, viññāṇaṃ hetusamuppanna’’ntiādinā sabbapadāni vitthāretabbāni.
By this method all terms are to be expounded: By this method, beginning with "ignorance is the cause," in the manner stated for ignorance, all terms are to be expounded, beginning with "formations are the cause, consciousness is conditionally arisen."
Theo cách này, tất cả các từ ngữ cần được giải thích rộng rãi—theo cách này, bắt đầu với "vô minh là nhân" và theo cách đã được nói về vô minh, tất cả các từ ngữ cần được giải thích rộng rãi, bắt đầu với "các hành là nhân, thức là do nhân sinh khởi," v.v.
Saṃkhippanti ettha avijjādayo viññāṇādayo cāti saṅkhepo, hetu vipāko ca.
Here, ignorance and so on, and consciousness and so on, are summarized, thus it is a summary, referring to cause and result.
Ở đây, vô minh và các pháp khác, thức và các pháp khác được tóm tắt lại, gọi là sự tóm tắt (saṅkhepa), tức là nhân và quả.
Atha vā hetuvipākoti saṃkhippatīti saṅkhepo, avijjādayo viññāṇādayo ca.
Or, it is a summary because cause and result are summarized, referring to ignorance and so on, and consciousness and so on.
Hoặc, nhân và quả được tóm tắt lại, gọi là sự tóm tắt, tức là vô minh và các pháp khác, thức và các pháp khác.
Saṅkhepabhāvasāmaññena pana ekavacanaṃ katanti daṭṭhabbaṃ.
But it should be understood that the singular number is used due to the common characteristic of being a summary.
Tuy nhiên, cần hiểu rằng số ít được sử dụng do tính chất chung của sự tóm tắt.
Te pana saṅkhepā atīte hetu, etarahi vipāko, etarahi hetu, āyatiṃ vipākoti evaṃ kālavibhāgena cattāro jātā, tenāha ‘‘purimasaṅkhepo cettha atīto addhā’’tiādi.
These summaries, however, become four by division according to time in this way: cause in the past, result in the present; cause in the present, result in the future. Therefore, it is said: "Here, the first summary is the past period," and so on.
Những sự tóm tắt này, theo sự phân chia thời gian, trở thành bốn loại: nhân trong quá khứ, quả trong hiện tại; nhân trong hiện tại, quả trong tương lai. Do đó, kinh nói: "Ở đây, sự tóm tắt đầu tiên là thời quá khứ" v.v.
Paccuppanno addhāti sambandho.
The connection is "the present period."
"Thời hiện tại" là một sự liên kết.
Taṇhupādānabhavā gahitāva hontīti ettha avijjāgahaṇena kilesabhāvasāmaññato taṇhupādānā gahitā, saṅkhāraggahaṇena kammabhāvasāmaññato bhavo gahito, avijjāsaṅkhārānaṃ tehi vinā sakiccākaraṇato ca taṇhupādānabhavā gahitāva honti.
Craving, clinging, and becoming are indeed included: Here, by the inclusion of ignorance, craving and clinging are included due to their common characteristic as defilements. By the inclusion of formations, becoming is included due to its common characteristic as kamma. And also because ignorance and formations do not perform their functions without these, craving, clinging, and becoming are indeed included.
Tham ái, chấp thủ, hữu đã được bao gồm—ở đây, do tính chất chung là phiền não, tham ái và chấp thủ đã được bao gồm bởi sự nắm giữ vô minh; do tính chất chung là nghiệp, hữu đã được bao gồm bởi sự nắm giữ các hành; và do vô minh và các hành không thể thực hiện chức năng của chúng nếu không có những yếu tố đó, tham ái, chấp thủ và hữu đã được bao gồm.
Atha vā avidvā paritassati, paritasito upādiyati, tassupādānapaccayā bhavo, tasmā taṇhupādānabhavāpi gahitā honti.
Or, an ignorant person craves, one who craves clings, and becoming arises dependent on that clinging. Therefore, craving, clinging, and becoming are also included.
Hoặc, người vô minh khao khát, người khao khát thì chấp thủ, do duyên chấp thủ mà có hữu. Do đó, tham ái, chấp thủ và hữu cũng đã được bao gồm.
Tathā ca vuttaṃ –
And so it is said:
Và điều đó đã được nói như sau:
Tattha (vibha. aṭṭha. 242; paṭi. ma. aṭṭha. 1.1.47) purimakammabhavasminti purime kammabhave, atītajātiyaṃ kammabhave kariyamāneti attho.
There, in the previous kamma-becoming means in the previous kamma-existence, that is to say, when kamma is being performed in the past life.
Ở đó (Vibha. Aṭṭha. 242; Paṭi. Ma. Aṭṭha. 1.1.47), trong hữu nghiệp quá khứ có nghĩa là trong hữu nghiệp quá khứ, tức là trong kiếp quá khứ khi nghiệp được thực hiện.
Moho avijjāti yo tadā dukkhādīsu moho yena mūḷho kammaṃ karoti, sā avijjā.
Delusion is ignorance means that delusion concerning suffering and so on, by which one, being deluded, performs kamma at that time—that is ignorance.
Si mê là vô minh—si mê về khổ và các pháp khác vào thời điểm đó, do đó người ngu si thực hiện nghiệp, đó là vô minh.
Āyūhanā saṅkhārāti taṃ kammaṃ karoto yā purimacetanāyo, yathā ‘‘dānaṃ dassāmī’’ti cittaṃ uppādetvā māsampi saṃvaccharampi dānūpakaraṇāni sajjentassa uppannā purimacetanāyo, paṭiggāhakānaṃ pana hatthe dakkhiṇaṃ patiṭṭhāpayato cetanā bhavoti vuccati.
Accumulation is formations means the prior volitions of one performing that kamma, for example, the prior volitions that arose in one who, having conceived the thought "I will give a gift," prepares materials for a gift for even a month or a year. But the volition of one who places the offering into the hands of the recipients is called becoming.
Tích lũy là các hành—những ý chí trước đó của người thực hiện nghiệp đó, ví dụ, những ý chí trước đó phát sinh ở người đã phát khởi tâm "tôi sẽ bố thí" và chuẩn bị các vật dụng bố thí trong một tháng hoặc một năm; còn ý chí của người đặt vật cúng dường vào tay người nhận thì được gọi là hữu.
Ekāvajjanesu vā chasu javanesu cetanā āyūhanasaṅkhārā nāma, sattamā bhavo.
Or, in the six javanas of a single āvajjana, volition is called accumulation-formations; the seventh is becoming.
Hoặc, trong sáu sát na tốc hành của một quá trình tâm, ý chí được gọi là hành tích lũy, còn sát na thứ bảy là hữu.
Yā kāci vā pana cetanā bhavo, sampayuttā āyūhanasaṅkhārā nāma.
Or, any volition whatsoever is becoming, while co-arisen ones are called accumulation-formations.
Hoặc, bất kỳ ý chí nào là hữu, thì các hành tương ưng được gọi là hành tích lũy.
Nikanti taṇhāti yā kammaṃ karontassa tassa phale upapattibhave nikāmanā patthanā, sā taṇhā nāma.
Delight is craving means that longing, that aspiration for the fruit of kamma in the realm of rebirth, of one performing kamma—that is called craving.
Sự khao khát là tham ái—sự khao khát, mong cầu về quả của nghiệp đó, về hữu tái sinh của người đang thực hiện nghiệp, đó được gọi là tham ái.
Upagamanaṃ upādānanti yaṃ kammabhavassa paccayabhūtaṃ ‘‘idaṃ katvā asukasmiṃ nāma ṭhāne kāme sevissāmi ucchijjissāmī’’tiādinā nayena pavattaṃ upagamanaṃ gahaṇaṃ parāmasanaṃ, idaṃ upādānaṃ nāma.
Undertaking is clinging means that undertaking, grasping, or preoccupation, which, being a condition for kamma-becoming, proceeds in such a way as: "Having done this, I will enjoy sense pleasures in such and such a place, I will come to an end"—this is called clinging.
Sự tiếp cận là chấp thủ—sự tiếp cận, sự nắm giữ, sự bám víu phát sinh theo cách "sau khi làm điều này, tôi sẽ hưởng dục lạc hoặc sẽ bị diệt vong ở nơi nào đó," là nhân cho hữu nghiệp, điều này được gọi là chấp thủ.
Cetanā bhavoti ‘‘taṃ kammaṃ karoto yā purimā cetanāyo’’tiādinā heṭṭhā vuttesu tīsu atthavikappesu yā cetanā bhavoti vuttā, sā cetanā bhavoti evamattho veditabbo.
Volition is becoming: Thus, it should be understood that the meaning is "that volition is becoming" in whichever of the three alternatives mentioned earlier, such as "the prior volitions of one performing that kamma," the volition is stated to be becoming.
Ý chí là hữu—theo ba cách giải thích đã nói ở trên, "những ý chí trước đó của người thực hiện nghiệp đó," ý chí nào được gọi là hữu, thì ý chí đó là hữu; đây là ý nghĩa cần được hiểu.
Idāni sabbepete avijjādayo dhamme dvīhi vaṭṭehi saṅgahetvā dassetukāmo āha ‘‘ime pañca dhammā atīte kammavaṭṭa’’nti.
Now, desiring to demonstrate all these phenomena, beginning with ignorance, encompassed by two rounds, it is said: "These five phenomena are the kamma-round in the past."
Bây giờ, muốn trình bày tất cả các pháp này, bắt đầu từ vô minh, được bao gồm trong hai vòng luân hồi, kinh nói: "Năm pháp này là vòng nghiệp trong quá khứ."
Ettha ca nippariyāyato saṅkhārā bhavo ca kammaṃ, avijjādayo pana kammasahāyatāya kammasarikkhakā tadupakārakā cāti kammanti vuttā.
Here, formations and becoming are kamma in the strict sense. Ignorance and the others, however, are called kamma because they are companions to kamma, similar to kamma, and supportive of it.
Ở đây, một cách trực tiếp, các hành và hữu là nghiệp; còn vô minh và các pháp khác được gọi là nghiệp do chúng là bạn đồng hành của nghiệp, tương tự nghiệp và là những yếu tố hỗ trợ nghiệp.
Avijjādayo hi vipākadhammadhammatāya kammasarikkhakā sahajātakoṭiyā upanissayakoṭiyā ca kammassa ca upakārakā.
For ignorance and the others are similar to kamma by their nature as phenomena leading to results, and they are supportive of kamma in the sense of being co-arisen and as a strong support.
Vô minh và các pháp khác, do bản chất là pháp quả, tương tự nghiệp và là những yếu tố hỗ trợ nghiệp theo phương diện đồng sinh và phương diện tăng thượng duyên.
Kammameva ca aññamaññasambandhaṃ hutvā punappunaṃ parivattanaṭṭhena kammavaṭṭaṃ.
And kamma itself, being mutually connected, revolving again and again, is the kamma-round.
Và chính nghiệp, do liên kết với nhau và lặp đi lặp lại, là vòng nghiệp.
Viññāṇādayo pañcāti viññāṇādayo vedanāpariyantā pañca etarahi idāni imasmiṃ attabhāveti vuttaṃ hoti.
The five, beginning with consciousness: This means the five, beginning with consciousness and ending with feeling, in this present existence, now.
Năm pháp bắt đầu từ thức—có nghĩa là năm pháp bắt đầu từ thức cho đến thọ, tức là hiện tại, trong kiếp sống này.
Avijjāsaṅkhārā gahitāva hontīti etthāpi pubbe viya kilesakammabhāvasāmaññato taṇhupādānaggahaṇena avijjā gahitā, bhavaggahaṇena saṅkhārā gahitāti daṭṭhabbaṃ.
Ignorance and formations are indeed included: Here too, it should be understood that, as before, by the inclusion of craving and clinging, ignorance is included due to the common characteristic of defilements; and by the inclusion of becoming, formations are included due to the common characteristic of kamma.
Vô minh và các hành đã được bao gồm—ở đây cũng vậy, như đã nói trước đây, do tính chất chung là phiền não và nghiệp, vô minh đã được bao gồm bởi sự nắm giữ tham ái và chấp thủ; các hành đã được bao gồm bởi sự nắm giữ hữu; điều này cần được hiểu.
Atha vā bhave gahite tassa pubbabhāgā taṃsampayuttā vā saṅkhārā gahitāva honti, taṇhupādānaggahaṇena ca taṃsampayuttā yāya vā mūḷho kammaṃ karoti, sā avijjāva hotīti taṇhupādānabhavaggahaṇena avijjāsaṅkhārā gahitāva honti.
Or, when becoming is included, its prior parts or its co-arisen formations are indeed included. And by the inclusion of craving and clinging, that ignorance by which one, being deluded, performs kamma is indeed ignorance. Thus, by the inclusion of craving, clinging, and becoming, ignorance and formations are indeed included.
Hoặc, khi hữu đã được bao gồm, thì các hành là phần trước của nó hoặc tương ưng với nó cũng đã được bao gồm; và bởi sự nắm giữ tham ái và chấp thủ, vô minh mà người ngu si thực hiện nghiệp cũng đã được bao gồm. Do đó, vô minh và các hành đã được bao gồm bởi sự nắm giữ tham ái, chấp thủ và hữu.
Teneva vuttaṃ –
Therefore, it is said:
Và điều đó đã được nói như sau:
Viññāṇanāmarūpasaḷāyatanaphassavedanānaṃ jātijarābhaṅgāvatthā jātijarāmaraṇanti vuttāti avatthānaṃ gahaṇena avatthāvantā gahitāva honti tadavinābhāvatoti āha ‘‘jātijarāmaraṇāpadesena viññāṇādīnaṃ niddiṭṭhattā’’ti.
The states of arising, aging, and dissolution of consciousness, name-and-form, six sense bases, contact, and feeling are called birth, aging, and death. And by the inclusion of the states, those possessing the states are indeed included, because they are inseparable. Thus it is said: "Because consciousness and the others are indicated by way of birth, aging, and death."
Các trạng thái sinh, già, hoại của thức, danh sắc, sáu xứ, xúc, thọ được gọi là sinh, già, chết. Do sự nắm giữ các trạng thái, những gì có trạng thái đã được bao gồm do không thể tách rời khỏi chúng. Do đó, kinh nói: "Do sự chỉ định thức và các pháp khác bằng cách sinh, già, chết."
Apadesenāti jātijarāmaraṇānaṃ kathanena.
By way of indication means by the mention of birth, aging, and death.
Bằng cách chỉ định—bằng cách nói về sinh, già, chết.
Imeti viññāṇādayo.
These refers to consciousness and the others.
Những điều này—là thức và các pháp khác.
Āyatiṃ vipākavaṭṭanti paccuppannahetuto bhāvīnaṃ anāgatānaṃ gahitattā.
The future result-round means because the future, which is dependent on the present cause, is included.
Vòng quả trong tương lai—do đã bao gồm những gì sẽ xảy ra trong tương lai từ nhân hiện tại.
Teti avijjādayo.
They refers to ignorance and the others.
Chúng—là vô minh và các pháp khác.
Ākāratoti sarūpato avuttāpi tasmiṃ tasmiṃ saṅgahe ākirīyanti avijjāsaṅkhārādiggahaṇehi pakāsīyantīti ākārā, atītahetuādīnaṃ vā pakārā ākārā.
In terms of aspects: Even if not explicitly stated in their own form, they are introduced (ākīriyanti) into each compilation, or clarified by the inclusion of ignorance, formations, and so on. Or, the aspects (pakārā) of the past cause and so on are the aspects (ākārā).
Theo phương diện—mặc dù không được nói rõ về bản chất, chúng được bao gồm trong mỗi sự tóm tắt, được làm sáng tỏ bởi sự nắm giữ vô minh, các hành, v.v. Hoặc, các phương diện của nhân quá khứ và các pháp khác là các phương diện.
Tato ākārato.
From that, in terms of aspects.
Do đó, theo phương diện.
Vīsatividhā hontīti atīte hetupañcakādibhedato vīsatividhā honti.
Become twentyfold means they become twentyfold, distinguished by the five causes in the past and so on.
Trở thành hai mươi loại—trở thành hai mươi loại do sự phân chia thành năm nhân trong quá khứ và các pháp khác.
Itīti vuttappakāraparāmasanaṃ.
Thus refers to the manner described.
Như vậy—chỉ sự lặp lại của cách đã nói.
Tenāha ‘‘catusaṅkhepa’’ntiādi.
Therefore, it is said: "the four summaries," and so on.
Do đó, kinh nói: "bốn sự tóm tắt" v.v.
Sabbākāratoti idha vuttehi ca avuttehi ca paṭiccasamuppādavibhaṅge anantanayasamantapaṭṭhānādīsu ca āgatehi sabbehi ākārehi.
In all aspects means in all aspects, both those mentioned here and those unmentioned, and those found in the analysis of dependent origination, in the limitless methods, the great expositions, and so on.
Theo mọi phương diện—bằng tất cả các phương diện đã nói ở đây và chưa nói, và những phương diện được tìm thấy trong phân tích Duyên khởi, trong Vô tận pháp môn, v.v.
Jānātīti avabujjhati.
Knows means understands.
Biết—là hiểu rõ.
Passatīti dassanabhūtena ñāṇacakkhunā paccakkhato passati.
Sees means directly sees with the eye of wisdom, which is vision.
Thấy—là thấy trực tiếp bằng nhãn tuệ, là thấy.
Aññāti paṭivijjhatīti tesaṃyeva vevacanaṃ.
Penetrates with direct knowledge are synonyms for the same thing.
Hiểu biết, xuyên thấu—là những từ đồng nghĩa của chúng.
Tanti taṃ jānanaṃ.
That refers to that knowing.
Điều đó—là sự hiểu biết đó.
Ñātaṭṭhenāti yathāsabhāvato jānanaṭṭhena.
By knowing means by knowing things as they truly are.
Theo phương diện hiểu biết—theo phương diện hiểu biết đúng bản chất.
Pajānanaṭṭhenāti aniccādīhi pakārehi paṭivijjhanaṭṭhena.
By understanding means by penetrating in ways such as impermanence and so on.
Theo phương diện hiểu biết rõ ràng—theo phương diện xuyên thấu bằng các cách như vô thường, v.v.
Idāni yadatthamidaṃ bhavacakkaṃ idhānītaṃ, taṃ dassetuṃ ‘‘iminā’’tiādi vuttaṃ.
Now, to show the purpose for which this wheel of existence is presented here, "by this" and so on is stated.
Bây giờ, để chỉ ra mục đích của việc mang bánh xe hữu này đến đây, kinh nói: "Bằng điều này" v.v.
Tattha te dhammeti te avijjādike dhamme.
There, those phenomena refers to those phenomena beginning with ignorance.
Ở đó, những pháp đó—là những pháp bắt đầu từ vô minh.
Yathābhūtaṃ ñatvāti mahāvajirañāṇena yāthāvato jānitvā.
Having known as it really is means having known in accordance with reality with the great diamond knowledge.
Biết như thật nghĩa là biết đúng như thật bằng đại kim cương tuệ.
Nibbindantoti balavavipassanāya nibbindanto.
Nibbindanto means becoming dispassionate through powerful vipassanā.
Nhàm chán nghĩa là nhàm chán bằng tuệ quán mạnh mẽ.
Virajjanto vimuccantoti ariyamaggehi virajjanto vimuccanto.
Virajjanto vimuccanto means becoming dispassionate, becoming liberated through the noble paths.
Ly tham, giải thoát nghĩa là ly tham, giải thoát bằng các đạo lộ Thánh.
Are hanīti sambandho.
The connection is with "he destroyed the spokes."
Liên quan đến từ “đã diệt các nan” (Are hanī).
Tattha yadā bhagavā virajjati vimuccati, tadā are hanati nāma.
In that context, when the Blessed One becomes dispassionate and liberated, then it is said that he destroys the spokes.
Trong đó, khi Đức Thế Tôn ly tham và giải thoát, thì được gọi là diệt các nan.
Tato paraṃ pana abhisambuddhakkhaṇaṃ gahetvā vuttaṃ ‘‘hani vihani viddhaṃsesī’’ti.
But after that, taking the moment of full enlightenment, it was said, "he has struck, struck down, shattered."
Tuy nhiên, sau đó, lấy khoảnh khắc giác ngộ tối thượng, đã nói rằng “đã diệt, đã phá hủy, đã hủy diệt”.
Evampi arānaṃ hatattā arahanti evaṃ imināpi pakārena yathāvuttasaṃsāracakkassa saṅkhārādiarānaṃ hatattā arahaṃ.
Thus also, because of having destroyed the spokes, he is an arahant means: Thus, in this way too, because of having destroyed the spokes, such as formations and so on, of the aforesaid wheel of saṃsāra, he is an arahant.
Cũng vậy, vì đã diệt trừ các nan nên là A-la-hán nghĩa là cũng theo cách này, vì đã diệt trừ các nan như các hành (saṅkhāra) v.v… của vòng luân hồi như đã nói, nên là A-la-hán.
Etthedaṃ vuccati –
Here this is said:
Ở đây, điều này được nói:
Aggadakkhiṇeyyattāti uttamadakkhiṇeyyabhāvato.
Because of being the most worthy of offerings means because of being the supreme recipient of offerings.
Vì là bậc đáng thọ nhận cúng dường tối thượng nghĩa là vì là bậc đáng thọ nhận cúng dường cao tột.
Cakkavattino acetane cakkaratane uppanne tattheva loko pūjaṃ karoti, aññattha pūjāvisesā pacchijjanti, kimaṅgaṃ pana sammāsambuddhe uppanneti dassento ‘‘uppanne tathāgate’’tiādimāha.
Just as when an inanimate wheel-treasure appears for a wheel-turning monarch, the world makes offerings right there, and special offerings elsewhere cease, how much more so when a Perfectly Enlightened One has appeared—showing this, he said, “when a Tathāgata has appeared,” and so on.
Khi bánh xe báu vô tri của vị Chuyển Luân Vương xuất hiện, thế gian chỉ cúng dường ở đó, các sự cúng dường đặc biệt khác bị loại bỏ; huống chi khi một vị Chánh Đẳng Giác xuất hiện, để chỉ ra điều đó, Ngài nói: “Khi Như Lai xuất hiện” v.v…
‘‘Ekekaṃ dhammakkhandhaṃ ekekavihārena pūjessāmī’’ti vuttepi satthāraṃyeva uddissa katattā ‘‘bhagavantaṃ uddissā’’tiādi vuttaṃ.
Even if it were said, “We will honor each aggregate of the Dhamma with a separate monastery,” because it is done directed towards the Teacher, it is stated “directed towards the Blessed One,” and so on.
Dù đã nói “chúng ta sẽ cúng dường mỗi uẩn pháp bằng mỗi cách thức”, nhưng vì đã thực hiện nhắm đến Đức Bổn Sư, nên đã nói “nhắm đến Đức Thế Tôn” v.v…
Ko pana vādo aññesaṃ pūjāvisesānanti yathāvuttato aññesaṃ amahesakkhehi devamanussehi kariyamānānaṃ nātiuḷārānaṃ pūjāvisesānaṃ arahabhāve kā nāma kathā.
What, then, is to be said of other special offerings? means: What is there to say about the worthiness of special offerings other than the aforesaid, which are not so magnificent, being made by less powerful devas and humans?
Huống chi là các sự cúng dường đặc biệt khác? Nghĩa là nói gì đến việc là bậc A-la-hán đối với các sự cúng dường đặc biệt không quá cao quý, được thực hiện bởi các chư thiên và loài người không có đại oai lực, khác với những gì đã nói.
Paccayādīnaṃ arahattāpi arahanti yathāvuttacīvarādipaccayānaṃ pūjāvisesassa ca aggadakkhiṇeyyabhāvena anucchavikattāpi arahaṃ.
Also because of being worthy of requisites and so on, he is an arahant means: also because of being worthy of the aforesaid requisites such as robes and of special offerings due to being the supreme recipient of offerings, he is an arahant.
Cũng là A-la-hán vì đáng thọ nhận các vật dụng cúng dường v.v… nghĩa là cũng là A-la-hán vì xứng đáng với các vật dụng cúng dường như y phục v.v… đã nói và sự cúng dường đặc biệt, do là bậc đáng thọ nhận cúng dường tối thượng.
Imassapi atthassa sukhaggahaṇatthaṃ idaṃ vuccati –
For the easy comprehension of this meaning too, this is said:
Để dễ hiểu ý nghĩa này, điều này được nói:
‘‘Saṅghāṭikaṇṇe cepi me, bhikkhave, bhikkhu gahetvā piṭṭhito piṭṭhito anubandho assa pāde pādaṃ nikkhipanto, so ca hoti abhijjhālu kāmesu tibbasārāgo byāpannacitto paduṭṭhamanasaṅkappo muṭṭhassati asampajāno asamāhito vibbhantacitto pākatindriyo, atha kho so ārakāva mayhaṃ, ahañca tassa.
“Bhikkhus, even if a bhikkhu were to follow me step by step, holding on to the corner of my outer robe, but he is covetous, with intense passion for sensual pleasures, with a malevolent mind, with corrupt mental resolves, with confused mindfulness, not clearly comprehending, unconcentrated, with a distracted mind, and with unrestrained faculties, then he is far away from me, and I from him.
“Này các Tỳ-kheo, dù một Tỳ-kheo có nắm lấy mép y của Ta, theo sát Ta từ phía sau, bước chân theo từng bước chân, nhưng nếu người ấy tham lam, có dục vọng mãnh liệt đối với các dục, tâm sân hận, ý nghĩ ác độc, thất niệm, không tỉnh giác, không định tĩnh, tâm tán loạn, các căn buông lung, thì người ấy ở xa Ta, và Ta cũng ở xa người ấy.
Taṃ kissa hetu?
For what reason?
Vì sao vậy?
Dhammañhi so, bhikkhave, bhikkhu na passati, dhammaṃ apassanto na maṃ passatī’’ti (itivu. 92).
Because, bhikkhus, that bhikkhu does not see the Dhamma. Not seeing the Dhamma, he does not see me.”
Vì Tỳ-kheo ấy, này các Tỳ-kheo, không thấy Pháp, không thấy Pháp thì không thấy Ta”. (Itivu. 92).
Pāsaṃsattā vā bhagavā arahaṃ.
Or, the Blessed One is Arahant because he is praiseworthy.
Hoặc Đức Thế Tôn là A-la-hán vì Ngài đáng được tán dương.
Akkharacintakā hi pasaṃsāyaṃ arahasaddaṃ vaṇṇenti.
For grammarians (akkharacintaka) explain the word araha in the sense of praise.
Các nhà ngữ pháp học giải thích từ araha trong nghĩa tán dương.
Pāsaṃsabhāvo ca bhagavato anaññasādhāraṇato yathābhuccaguṇādhigato sadevake loke suppatiṭṭhito.
And the praiseworthiness of the Blessed One, being unique, established by truly existing qualities, is well-established in the world with its devas.
Và phẩm chất đáng tán dương của Đức Thế Tôn được thiết lập vững chắc trong thế gian cùng với chư thiên, do Ngài đạt được những phẩm chất chân thật không ai sánh bằng.
Tathā hesa anuttarena sīlena anuttarena samādhinā anuttarāya paññāya anuttarāya vimuttiyā asamo asamasamo appaṭimo appaṭibhāgo appaṭipuggaloti evaṃ tasmiṃ tasmiṃ guṇe vibhajitvā vuccamāne paṇḍitapurisehi devehi brahmehi bhagavatā vā pana pariyosāpetuṃ asakkuṇeyyarūpo.
For he is incomparable, unequalled, peerless, matchless, without counterpart, with unsurpassed morality, unsurpassed concentration, unsurpassed wisdom, unsurpassed liberation, such that when expounded in regard to each of these qualities, he cannot be fully described by wise individuals, devas, Brahmās, or even by the Blessed One himself.
Thật vậy, Ngài là bậc vô song, vô đẳng, vô tỷ, vô đối, vô thượng về giới, vô thượng về định, vô thượng về tuệ, vô thượng về giải thoát; khi được các bậc hiền trí, chư thiên, Phạm thiên phân tích từng phẩm chất như vậy, thì không thể kết thúc được.
Iti pāsaṃsattāpi bhagavā arahaṃ.
Thus, the Blessed One is Arahant also because he is praiseworthy.
Như vậy, Đức Thế Tôn cũng là A-la-hán vì Ngài đáng được tán dương.
Tenedaṃ vuccati –
Hence it is said:
Vì thế, điều này được nói:
Idāni sammāsambuddhoti imassa atthaṃ vibhajitvā dassento āha ‘‘sammā sāmañcā’’tiādi.
Now, to explain and show the meaning of Sammāsambuddho, it says “sammā sāmañcā” and so on.
Bây giờ, để giải thích ý nghĩa của từ Sammāsambuddho (Chánh Đẳng Giác), Ngài nói “sammā sāmañcā” (một cách đúng đắn và tự mình), v.v.
Tattha sammāti aviparītaṃ.
Therein, sammā means ‘correctly’, ‘unerroneously’.
Trong đó, sammā có nghĩa là không sai lệch.
Sāmanti sayameva, aparaneyyo hutvāti attho.
Sāmaṃ means ‘by oneself’, which is to say, ‘without being led by another’.
Sāmaṃ có nghĩa là tự mình, tức là không cần người khác dẫn dắt.
Sambuddhoti hi ettha saṃ-saddo sayanti etassa atthassa bodhakoti daṭṭhabbo.
In Sambuddho, the prefix saṃ is to be understood as signifying this meaning of ‘by oneself’.
Ở đây, từ saṃ trong Sambuddho cần được hiểu là chỉ ra ý nghĩa “tự mình”.
Sabbadhammānanti anavasesānaṃ neyyadhammānaṃ.
Sabbadhammānaṃ means ‘all knowable phenomena’, without remainder.
Sabbadhammānaṃ có nghĩa là tất cả các pháp cần được biết, không sót một điều gì.
Kathaṃ panettha sabbadhammānanti ayaṃ viseso labbhatīti?
How is this distinction of ‘all phenomena’ obtained here?
Làm thế nào mà ở đây có được sự đặc biệt “của tất cả các pháp” này?
Ekadesassa aggahaṇato.
From the non-grasping of a part.
Do không nắm giữ một phần nào.
Padesaggahaṇe hi asati gahetabbassa nippadesatāva viññāyati yathā ‘‘dikkhito na dadātī’’ti.
For when there is no grasping of a part, the entireness of what is to be grasped is understood, just as in “one who is consecrated does not give.”
Thật vậy, khi không nắm giữ một phần, thì sự không có phần của điều cần nắm giữ được hiểu rõ, giống như câu “người đã thọ giới không bố thí”.
Evañca katvā atthavisesanapekkhā kattari eva buddhasaddasiddhi veditabbā kammavacanicchāya abhāvato.
And thus, the establishment of the word buddha in the sense of an agent (kattari) without expecting a specific object of action (atthavisesanapekkhā) should be understood, due to the absence of the desire for a passive voice (kammavacanicchāya).
Và khi đã làm như vậy, sự thành tựu của từ buddha (giác ngộ) trong chủ cách cần được hiểu là không phụ thuộc vào sự đặc biệt của ý nghĩa, vì không có ý muốn nói trong bị động.
‘‘Sammā sāmañca buddhattā sammāsambuddho’’ti ettakameva hi idha saddato labbhati, ‘‘sabbadhammāna’’nti idaṃ pana atthato labbhamānaṃ gahetvā vuttaṃ.
For from the word itself, only “sammā sāmañca buddhattā sammāsambuddho” (one who has awakened correctly and by oneself is a Sammāsambuddha) is obtained here; the phrase “sabbadhammānaṃ” (of all phenomena) is stated, taking what is obtained from the meaning.
Thật vậy, ở đây, từ ngữ chỉ có nghĩa là “do tự mình giác ngộ một cách đúng đắn, nên là Chánh Đẳng Giác”, còn “của tất cả các pháp” được nói ra khi nắm lấy ý nghĩa được hiểu từ ngữ cảnh.
Na hi bujjhanakiriyā avisayā yujjati.
For the act of awakening is not possible without an object.
Thật vậy, hành động giác ngộ không thể không có đối tượng.
Idāni tassā visayaṃ ‘‘sabbadhamme’’ti sāmaññato vuttaṃ vibhajitvā dassetuṃ ‘‘abhiññeyye dhamme’’tiādi vuttaṃ.
Now, to explain and show its object, which was generally stated as “all phenomena,” it says “abhiññeyye dhamme” and so on.
Bây giờ, để giải thích đối tượng đó, đã được nói chung là “tất cả các pháp”, Ngài đã nói “abhiññeyye dhamme” (các pháp cần được thắng tri), v.v.
Tattha abhiññeyyeti aniccādito lakkhaṇarasādito ca abhivisiṭṭhena ñāṇena jānitabbe catusaccadhamme.
Therein, abhiññeyye refers to the four Noble Truths, which are to be known with particularly distinguished knowledge (abhivisiṭṭhena ñāṇena) from the perspective of impermanence, etc., and characteristics, essences, etc.
Trong đó, abhiññeyye có nghĩa là Tứ Thánh đế cần được biết bằng trí tuệ đặc biệt cao cấp hơn, từ vô thường, v.v., và từ đặc tính, bản chất, v.v.
Abhiññeyyato buddhoti abhiññeyyabhāvato bujjhi, pubbabhāge vipassanāpaññādīhi adhigamakkhaṇe maggapaññāya aparabhāge sabbaññutaññāṇādīhi aññāsīti attho.
Abhiññeyyato buddho means ‘he awakened because they are knowable’, meaning he realized them in the prior stage through insight wisdom, etc., at the moment of attainment through path wisdom, and in the latter stage knew them through omniscience, etc.
Abhiññeyyato buddho có nghĩa là Ngài đã giác ngộ do bản chất cần được thắng tri; tức là, ở giai đoạn đầu, Ngài đã đạt được bằng tuệ quán, v.v., vào thời điểm chứng đắc bằng tuệ đạo, và ở giai đoạn sau, Ngài đã biết bằng Nhất thiết trí, v.v.
Ito paresupi eseva nayo.
The same method applies to the subsequent terms.
Đối với các phần tiếp theo cũng theo cách này.
Pariññeyye dhammeti aniccādivasena parijānitabbaṃ dukkhaṃ ariyasaccamāha.
Pariññeyye dhamme refers to the Noble Truth of Suffering, which is to be fully understood in terms of impermanence, etc.
Pariññeyye dhamme (các pháp cần được biến tri) chỉ Khổ Thánh đế cần được biến tri theo cách vô thường, v.v.
Pahātabbeti samudayapakkhiye.
Pahātabbe refers to the phenomena belonging to the origin (samudaya) of suffering.
Pahātabbe (các pháp cần được đoạn trừ) chỉ những pháp thuộc về tập đế.
Sacchikātabbeti nibbānaṃ sandhāyāha.
Sacchikātabbe refers to Nibbāna.
Sacchikātabbe (các pháp cần được chứng ngộ) chỉ Niết Bàn.
Bahuvacananiddeso panettha sopādisesādikaṃ pariyāyasiddhaṃ bhedamapekkhitvā kato, uddeso vā ayaṃ catusaccadhammānampi.
The use of the plural here is made with reference to the distinctions like sopādisesa (Nibbāna with remainder) etc., which arise by implication, or this is an enumeration for the four Noble Truths themselves.
Việc sử dụng số nhiều ở đây được thực hiện để chỉ các phân loại gián tiếp như hữu dư y và vô dư y, hoặc đây cũng là sự liệt kê của Tứ Thánh đế.
Tathā hi vakkhati ‘‘cakkhu dukkhasacca’’ntiādi.
For it will indeed be said, “the eye is the Truth of Suffering,” and so on.
Thật vậy, Ngài sẽ nói “mắt là Khổ Thánh đế”, v.v.
Uddeso ca avinicchitatthaparicchedassa dhammassa vasena karīyati.
And an enumeration is made concerning a phenomenon whose specific meaning is not yet determined.
Và sự liệt kê được thực hiện dựa trên các pháp có ý nghĩa chưa được xác định rõ ràng.
Uddesena hi uddisiyamānānaṃ atthitāmattaṃ vuccati, na paricchedoti aparicchedena bahuvacanena vuttaṃ yathā ‘‘appaccayā dhammā, asaṅkhatā dhammā’’ti.
For by an enumeration, only the mere existence of what is enumerated is stated, not its specific nature; hence it is stated in the plural without specificity, as in “phenomena with no conditions, unconditioned phenomena.”
Thật vậy, bằng sự liệt kê, chỉ nói lên sự tồn tại của những điều được liệt kê, chứ không phải sự xác định rõ ràng; vì thế, nó được nói bằng số nhiều không xác định, giống như “các pháp không duyên, các pháp vô vi”.
Sacchikātabbeti vā phalavimuttīnampi gahaṇaṃ, na nibbānassevāti bahuvacananiddeso kato.
Or, in Sacchikātabbe, the comprehension of fruit-liberations is also included, not just Nibbāna, hence the use of the plural.
Hoặc Sacchikātabbe cũng bao gồm các giải thoát quả, chứ không chỉ Niết Bàn; vì thế, nó được nói bằng số nhiều.
Evañca bhāvetabbeti ettha jhānānampi gahaṇaṃ daṭṭhabbaṃ.
Thus, in bhāvetabbe (to be developed), the jhāna attainments should also be understood as included.
Và như vậy, trong bhāvetabbe (các pháp cần được tu tập) cũng cần hiểu là bao gồm các thiền định.
Teneva cāhāti selabrāhmaṇassa attano buddhabhāvaṃ sādhento evamāha.
Teneva cāha means that he said this to the brahmin Sela, proving his own state of a Buddha.
Teneva cāha (và vì thế Ngài đã nói) có nghĩa là Ngài đã nói như vậy khi chứng minh phẩm chất Phật của mình cho Bà-la-môn Sela.
Kiṃ pana bhagavā sayameva attano sammāsambuddhabhāvaṃ sādhetīti?
Does the Blessed One himself prove his state of being a Sammāsambuddha?
Nhưng Đức Thế Tôn có tự mình chứng minh phẩm chất Chánh Đẳng Giác của mình không?
Sādheti mahākaruṇāya aññesaṃ avisayato.
He proves it out of great compassion, because it is beyond the scope of others.
Ngài có chứng minh, vì đại bi và vì điều đó không thuộc phạm vi của người khác.
Tattha ‘‘ekomhi sammāsambuddho, sabbābhibhū sabbavidūhamasmī’’tiādīni (ma. ni. 2.341; mahāva. 11) suttapadāni, idameva ca ‘‘abhiññeyya’’ntiādi suttapadaṃ etassa atthassa sādhakaṃ.
In this regard, the phrases from the suttas such as “I am a Sammāsambuddha, I am the all-overcoming, the all-knowing,” and this very phrase “abhiññeyya” and so on, are proofs of this meaning.
Trong đó, các câu kinh như “Ta là bậc Chánh Đẳng Giác độc nhất, ta là bậc vượt trên tất cả, bậc biết tất cả” và câu kinh “abhiññeyya” (cần thắng tri) này là bằng chứng cho ý nghĩa đó.
Tattha abhiññeyyanti iminā dukkhasaccamāha, bhāvetabbanti maggasaccaṃ.
Therein, abhiññeyya refers to the Truth of Suffering, and bhāvetabba to the Truth of the Path.
Trong đó, abhiññeyya (cần thắng tri) chỉ Khổ Thánh đế, bhāvetabba (cần tu tập) chỉ Đạo Thánh đế.
Ca-saddo panettha avuttasamuccayattho, tena sacchikātabbassa gahaṇaṃ veditabbaṃ.
The particle ca here has the meaning of including what is unstated; by this, the comprehension of what is to be realized (sacchikātabba) should be understood.
Ở đây, từ ca có nghĩa là tập hợp những điều không được nói rõ, vì thế cần hiểu là bao gồm cả điều cần chứng ngộ.
Atha vā abhiññeyyanti imināva pārisesañāyena pariññeyyadhamme sacchikātabbadhamme ca dasseti.
Or, by this very term 'abhiññeyya' (to be thoroughly understood), it shows the dhammas to be fully understood and the dhammas to be realized, by means of the pārisesañāya.
Hoặc, với từ cần thắng tri (abhiññeyya) này, theo lý suy luận còn lại, Ngài chỉ rõ các pháp cần phải thắng tri và các pháp cần phải chứng ngộ.
Tasmā buddhosmīti yasmā cattāri saccāni mayā buddhāni, saccavinimuttañca kiñci ñeyyaṃ natthi, tasmā sabbampi ñeyyaṃ buddhosmi, abbhaññāsinti attho.
"Therefore, I am the Buddha" means: since the four noble truths have been understood by me, and there is nothing to be known apart from the truths, therefore I have understood everything that is to be known, I have thoroughly known it.
Do đó, Ta là Phật (tasmā buddhosmī) – vì bốn sự thật đã được Ta giác ngộ, và không có bất cứ điều gì cần biết nằm ngoài các sự thật. Do đó, Ta đã giác ngộ tất cả những gì cần biết, nghĩa là Ta đã hiểu rõ.
Selasuttaṭṭhakathāyaṃ pana idaṃ vuttaṃ –
But in the Selasutta commentary this was said: –
Tuy nhiên, trong Chú giải kinh Sela (Selasuttaṭṭhakathā), điều này đã được nói:
Tattha vijjāti maggavijjā vuttā ukkaṭṭhaniddesena.
There, 'vijjā' (knowledge) refers to path-knowledge, indicated by an exalted designation.
Ở đây, minh (vijjā) được nói đến là đạo minh, bằng cách chỉ định điều cao cả nhất.
Vimuttīti phalavimutti.
'Vimutti' (liberation) refers to fruit-liberation.
Giải thoát (vimutti) là quả giải thoát.
Kāmañcettha maggavijjāpi bhāvetabbabhāvena gahitā, sabbepi pana sabhāvadhammā abhiññeyyāti vijjāya abhiññeyyabhāvo vutto.
Although path-knowledge is also included here as something to be developed, since all dhammas that are inherent nature are to be thoroughly understood, the state of knowledge as being to be thoroughly understood is stated.
Mặc dù ở đây, đạo minh cũng được nắm giữ với ý nghĩa là điều cần tu tập, nhưng vì tất cả các pháp tự tính đều là cần thắng tri, nên trạng thái cần thắng tri của minh đã được nói đến.
Imināva nayena sabbesampi abhiññeyyabhāvo vutto evāti daṭṭhabbaṃ.
It should be understood that in this very way, the state of all things as being to be thoroughly understood is stated.
Theo cách này, trạng thái cần thắng tri của tất cả cũng đã được nói đến, điều này cần được hiểu.
Phalena vinā hetubhāvasseva abhāvato hetuvacanena phalasiddhi vuttāti veditabbaṃ.
It should be understood that the accomplishment of the result is stated by the word for cause, because the state of being a cause does not exist without a result.
Cần phải biết rằng sự thành tựu của quả đã được nói đến bằng cách nói về nhân, vì không có trạng thái nhân mà không có quả.
Nirodhassa hi sampāpanena maggassa hetubhāvo, dukkhassa nibbattanena taṇhāya samudayabhāvoti.
For the path, its state of being a cause exists by the attainment of cessation; for craving, its state of being an origin exists by the arising of suffering.
Thật vậy, trạng thái nhân của đạo là do sự đạt đến diệt, và trạng thái tập của tham ái là do sự sinh khởi của khổ.
Evaṃ saccavasena sāmaññato vuttamatthaṃ dvārārammaṇehi saddhiṃ dvārappavattadhammehi ceva khandhādīhi ca saccavaseneva vibhajitvā dassetuṃ ‘‘apicā’’tiādi āraddhaṃ.
Thus, in order to show the meaning generally stated in terms of the truths, by dividing it in terms of doors and objects, and also in terms of dhammas occurring through the doors, and the aggregates, etc., with the truths, the passage beginning "apicā" (furthermore) is commenced.
Như vậy, để phân tích và chỉ rõ ý nghĩa đã được nói một cách tổng quát theo các sự thật, cùng với các căn và đối tượng, cùng với các pháp hoạt động qua các căn và các uẩn, v.v., theo cách của các sự thật, đoạn “hơn nữa” (apicā) v.v. đã được bắt đầu.
Mūlakāraṇabhāvenāti santesupi avijjādīsu aññesu kāraṇesu tesampi mūlabhūtakāraṇabhāvena.
"Mūlakāraṇabhāvenā" (as a root cause) means: even though there are other causes such as ignorance, it acts as their fundamental root cause.
Do trạng thái nhân gốc (mūlakāraṇabhāvena) – mặc dù có những nguyên nhân khác như vô minh, v.v., nhưng do trạng thái là nguyên nhân gốc của chúng.
Taṇhā hi kammassa vicittabhāvahetuto sahāyabhāvūpagamanato ca dukkhavicittatāya padhānakāraṇaṃ.
For craving is the principal cause of the variety of suffering, because it is the cause of the varied nature of kamma and because it acts as an associate.
Thật vậy, tham ái là nguyên nhân chính của sự đa dạng của khổ, do là nguyên nhân của sự đa dạng của nghiệp và do trở thành người bạn đồng hành.
Samuṭṭhāpikāti uppādikā.
"Samuṭṭhāpikā" (originator) means: producer.
Samuṭṭhāpikā là người tạo ra, sinh ra.
Purimataṇhāti purimabhavasiddhā taṇhā.
"Purimataṇhā" (previous craving) means: craving that was established in a previous existence.
Tham ái trước (purimataṇhā) là tham ái đã thành tựu trong kiếp trước.
Ubhinnanti cakkhussa taṃsamudayassa ca.
"Ubhinnaṃ" (of both) means: of the eye and its origin.
Của cả hai (ubhinnam) là của nhãn căn và sự sinh khởi của nó.
Appavattīti appavattinimittaṃ.
"Appavattī" (non-occurrence) means: the sign of non-occurrence.
Không hoạt động (appavattī) là nguyên nhân của sự không hoạt động.
Nirodhappajānanāti sacchikiriyābhisamayavasena nirodhassa paṭivijjhanā.
"Nirodhappajānanā" (understanding of cessation) means: the penetration of cessation by way of realization and comprehension.
Sự hiểu biết về diệt (nirodhappajānanā) là sự thâm nhập vào diệt theo cách chứng ngộ và thể nhập.
Ekekapaduddhārenāti ‘‘cakkhuṃ cakkhusamudayo cakkhunirodho’’tiādinā ekekakoṭṭhāsaniddhāraṇena.
"Ekekapaduddhārenā" (by extracting each term) means: by the determination of each component, such as "the eye, the origin of the eye, the cessation of the eye."
Bằng cách trích dẫn từng từ (ekekapaduddhārena) là bằng cách xác định từng phần, như “nhãn, sự sinh khởi của nhãn, sự diệt của nhãn”, v.v.
Taṇhāyapi pariññeyyabhāvasabbhāvato upādānakkhandhogadhattā saṅkhāradukkhabhāvato ca dukkhasaccasaṅgahaṃ dassetuṃ ‘‘rūpataṇhādayo cha taṇhākāyā’’ti vuttaṃ, tasmā vattamānabhave taṇhā khandhapariyāpannattā saṅkhāradukkhabhāvato ca dukkhasaccaṃ.
To show the inclusion of craving in the suffering-truth, due to its being a phenomenon to be fully understood, its falling within the clinging-aggregates, and its being the suffering of formations, it is said: "the six classes of craving, such as craving for forms." Therefore, craving in the present existence, being included in the aggregates and being the suffering of formations, is the suffering-truth.
Để chỉ rõ rằng sáu loại tham ái như tham ái sắc, v.v. được bao gồm trong khổ thánh đế, vì tham ái cũng có trạng thái cần thắng tri, nằm trong các uẩn chấp thủ và do là khổ của hành, nên đã nói “sáu loại tham ái như tham ái sắc, v.v.” (rūpataṇhādayo cha taṇhākāyā). Do đó, tham ái trong hiện tại, vì nằm trong các uẩn và do là khổ của hành, nên là khổ thánh đế.
Yasmiṃ pana attabhāve sā uppajjati, tassa attabhāvassa mūlakāraṇabhāvena samuṭṭhāpikā purimabhavasiddhā taṇhā samudayasaccanti gahetabbā.
But the craving established in a previous existence, which gives rise to that existence in which it arises, as its root cause, should be understood as the origin-truth.
Tuy nhiên, tham ái đã thành tựu trong kiếp trước, là nguyên nhân gốc của kiếp sống mà nó sinh khởi, cần được hiểu là tập thánh đế.
Kasiṇānīti kasiṇārammaṇikajjhānāni.
"Kasiṇāni" (kasiṇas) means: jhānas that have kasiṇas as their object.
Các kasiṇa (kasiṇāni) là các thiền định có đối tượng là kasiṇa.
Dvattiṃsākārāti dvattiṃsa koṭṭhāsā tadārammaṇajjhānāni ca.
"Dvattiṃsākārā" (32 parts) means: the thirty-two bodily parts and the jhānas that have them as objects.
Ba mươi hai thể loại (dvattiṃsākārā) là ba mươi hai phần và các thiền định có đối tượng đó.
Nava bhavāti kāmabhavo rūpabhavo arūpabhavo saññībhavo asaññībhavo nevasaññīnāsaññībhavo ekavokārabhavo catuvokārabhavo pañcavokārabhavoti nava bhavā.
"Nava bhavā" (nine existences) means: the nine existences are: sense-sphere existence, form-sphere existence, formless-sphere existence, percipient existence, non-percipient existence, neither-percipient-nor-non-percipient existence, one-aggregate existence, four-aggregate existence, five-aggregate existence.
Chín cõi sống (nava bhavā) là: cõi dục, cõi sắc, cõi vô sắc, cõi hữu tưởng, cõi vô tưởng, cõi phi tưởng phi phi tưởng, cõi nhất uẩn, cõi tứ uẩn, cõi ngũ uẩn.
Tattha bhavatīti bhavo, kāmarāgasaṅkhātena kāmena yutto bhavo, kāmasaṅkhāto vā bhavo kāmabhavo, ekādasa kāmāvacarabhūmiyo.
There, that which exists is bhava (existence); existence accompanied by sensual craving, referred to as sensuality, or existence called sensuality, is sense-sphere existence (kāmabhava), comprising the eleven sense-sphere planes.
Ở đây, cái gì tồn tại là cõi sống (bhava). Cõi sống gắn liền với dục, tức là dục ái, hoặc cõi sống được gọi là dục là cõi dục (kāmabhava), đó là mười một cõi dục giới.
Kāme pahāya rūparāgasaṅkhātena rūpena yutto bhavo, rūpasaṅkhāto vā bhavo rūpabhavo, soḷasa rūpāvacarabhūmiyo.
Having abandoned sensuality, existence accompanied by form-craving, referred to as form, or existence called form, is form-sphere existence (rūpabhava), comprising the sixteen form-sphere planes.
Sau khi từ bỏ dục, cõi sống gắn liền với sắc, tức là sắc ái, hoặc cõi sống được gọi là sắc là cõi sắc (rūpabhava), đó là mười sáu cõi sắc giới.
Kāmañca rūpañca pahāya arūparāgasaṅkhātena arūpena yutto bhavo, arūpasaṅkhāto vā bhavo arūpabhavo, catasso āruppabhūmiyo.
Having abandoned sensuality and form, existence accompanied by formless-craving, referred to as formless, or existence called formless, is formless-sphere existence (arūpabhava), comprising the four formless planes.
Sau khi từ bỏ dục và sắc, cõi sống gắn liền với vô sắc, tức là vô sắc ái, hoặc cõi sống được gọi là vô sắc là cõi vô sắc (arūpabhava), đó là bốn cõi vô sắc giới.
Saññāvataṃ bhavo saññībhavo, saññā vā ettha bhave atthīti saññībhavo, so kāmabhavo ca asaññībhavamutto rūpabhavo ca nevasaññīnāsaññībhavamutto arūpabhavo ca hoti.
Existence of those with perception is percipient existence (saññībhava), or existence where perception is present is percipient existence; this includes sense-sphere existence, form-sphere existence (excluding the non-percipient existence), and formless-sphere existence (excluding the neither-percipient-nor-non-percipient existence).
Cõi sống của những hữu tình có tưởng là cõi hữu tưởng (saññībhava), hoặc tưởng có trong cõi sống này nên là cõi hữu tưởng. Đó là cõi dục, cõi sắc không phải cõi vô tưởng, và cõi vô sắc không phải cõi phi tưởng phi phi tưởng.
Na saññībhavo asaññībhavo, so rūpabhavekadeso.
Non-percipient existence is non-percipient existence (asaññībhava); it is a part of form-sphere existence.
Cái không phải cõi hữu tưởng là cõi vô tưởng (asaññībhava), đó là một phần của cõi sắc.
Oḷārikattābhāvato nevasaññā, sukhumattassa sabbhāvato nāsaññāti nevasaññānāsaññā, tāya yutto bhavo nevasaññānāsaññābhavo.
Because there is no gross perception, it is neither-perception; because there is subtle perception, it is not-no-perception. Thus, neither-perception-nor-no-perception is neither-percipient-nor-non-percipient existence (nevasaññīnāsaññībhava).
Vì không có tưởng thô, nên là phi tưởng; vì có tưởng vi tế, nên là phi phi tưởng. Cõi sống gắn liền với điều đó là cõi phi tưởng phi phi tưởng (nevasaññānāsaññābhava).
Atha vā oḷārikāya saññāya abhāvā sukhumāya ca bhāvā nevasaññā nāsaññā asmiṃ bhaveti nevasaññānāsaññābhavo, so arūpabhavekadeso.
Alternatively, because there is no gross perception and there is subtle perception, neither-perception-nor-no-perception is in this existence, hence neither-percipient-nor-non-percipient existence; it is a part of formless-sphere existence.
Hoặc, vì không có tưởng thô và có tưởng vi tế, nên là phi tưởng phi phi tưởng trong cõi sống này, đó là cõi phi tưởng phi phi tưởng. Đó là một phần của cõi vô sắc.
Ekena rūpakkhandhena vokiṇṇo bhavo, ekena vā vokāro assa bhavassāti ekavokārabhavo, so asaññībhavo.
Existence characterized by one aggregate, or existence which has one aggregate, is one-aggregate existence (ekavokārabhava); that is non-percipient existence.
Cõi sống chỉ có một sắc uẩn, hoặc cõi sống này chỉ có một uẩn là cõi nhất uẩn (ekavokārabhavo), đó là cõi vô tưởng.
Catūhi arūpakkhandhehi vokiṇṇo bhavo, catūhi vā vokāro assa bhavassāti catuvokārabhavo, so arūpabhavo eva.
Existence characterized by four formless aggregates, or existence which has four aggregates, is four-aggregate existence (catuvokārabhava); that is precisely formless-sphere existence.
Cõi sống chỉ có bốn vô sắc uẩn, hoặc cõi sống này chỉ có bốn uẩn là cõi tứ uẩn (catuvokārabhavo), đó chính là cõi vô sắc.
Pañcahi khandhehi vokiṇṇo bhavo, pañcahi vā vokāro assa bhavassāti pañcavokārabhavo, so kāmabhavo ca rūpabhavekadeso ca hoti.
Existence characterized by five aggregates, or existence which has five aggregates, is five-aggregate existence (pañcavokārabhava); that is sense-sphere existence and a part of form-sphere existence.
Cõi sống chỉ có năm uẩn, hoặc cõi sống này chỉ có năm uẩn là cõi ngũ uẩn (pañcavokārabhavo), đó là cõi dục và một phần của cõi sắc.
Vokāroti vā khandhānametamadhivacanaṃ, tasmā eko vokāro assa bhavassāti ekavokārabhavoti evamādināpettha attho veditabbo.
Or, 'vokāra' is a designation for aggregates; therefore, the meaning here should be understood in this way: existence which has one aggregate is one-aggregate existence, and so on.
Hoặc vokāra là tên gọi khác của các uẩn. Do đó, ý nghĩa ở đây cần được hiểu theo cách này, rằng cõi sống này có một uẩn là cõi nhất uẩn, v.v.
Cattāri jhānānīti aggahitārammaṇavisesāni cattāri rūpāvacarajjhānāni.
"Cattāri jhānāni" (four jhānas) means: the four form-sphere jhānas without specific captured objects.
Bốn thiền định (cattāri jhānāni) là bốn thiền sắc giới không có đối tượng đặc biệt được nắm giữ.
Vipākajjhānānaṃ vā etaṃ gahaṇaṃ.
Or, this is the inclusion of resultant jhānas.
Hoặc đây là sự nắm giữ các thiền định quả.
Ettha ca kusaladhammānaṃ upanissayabhūtā taṇhāsamuṭṭhāpikā purimataṇhāti veditabbā.
And here, craving which gives rise to kusaladhammas (wholesome states) and acts as their proximate cause, should be understood as the previous craving.
Và ở đây, tham ái đã thành tựu trong kiếp trước, là nhân sinh khởi của tham ái, là điều kiện hỗ trợ cho các pháp thiện, cần được hiểu.
Kiriyadhammānaṃ pana yattha te kiriyadhammā uppajjanti, tassa attabhāvassa kāraṇabhūtā taṇhā.
As for kiriyadhammas (functional states), craving is the cause of the existence in which those kiriyadhammas arise.
Tuy nhiên, đối với các pháp hành động, tham ái là nguyên nhân của kiếp sống mà các pháp hành động đó sinh khởi.
Anulomatoti ettha ‘‘saṅkhārā dukkhasaccaṃ, avijjā samudayasacca’’nti iminā anukkamena yojetabbaṃ.
"Anulomato" (in direct order) here means it should be arranged in the sequence: "formations are the suffering-truth, ignorance is the origin-truth."
Ở đây, theo thứ tự thuận (anulomato) cần được kết hợp theo trình tự này: “các hành là khổ thánh đế, vô minh là tập thánh đế”.
Nanu ca sabbaññutaññāṇato aññaṃ anāvaraṇañāṇaṃ, aññathā ‘‘cha asādhāraṇañāṇāni buddhañāṇānī’’ti vacanaṃ virujjheyyāti?
Is not unobstructed knowledge different from omniscient knowledge? Otherwise, the statement "six uncommon knowledges are Buddha-knowledges" would be contradictory, would it not?
Há chẳng phải vô ngại trí là khác với tuệ toàn tri sao? Nếu không, lời nói “sáu trí không chung với ai là Phật trí” sẽ mâu thuẫn sao?
Na virujjhati visayappavattibhedavasena aññehi asādhāraṇabhāvadassanatthaṃ ekasseva ñāṇassa dvidhā vuttattā.
It is not contradictory, as the same knowledge is stated in two ways to show its uncommon nature by way of different modes of application to its objects.
Không mâu thuẫn, vì cùng một trí đã được nói đến hai cách để chỉ rõ trạng thái không chung với ai khác, do sự khác biệt trong phạm vi hoạt động của đối tượng.
Ekameva hi taṃ ñāṇaṃ anavasesasaṅkhatāsaṅkhatasammutidhammavisayatāya sabbaññutaññāṇaṃ, tattha ca āvaraṇābhāvato nissaṅgacāramupādāya anāvaraṇañāṇanti vuttaṃ.
For that one knowledge is omniscient knowledge due to its encompassing all conditioned, unconditioned, and conventional dhammas as its objects; and it is called unobstructed knowledge because there is no obstruction therein, by virtue of its unimpeded operation.
Thật vậy, cùng một trí đó là tuệ toàn tri vì đối tượng của nó là tất cả các pháp hữu vi, vô vi và tục đế không sót một thứ nào. Và do không có chướng ngại trong đó, nên nó được gọi là vô ngại trí, vì nó hoạt động không vướng mắc.
Yathāha paṭisambhidāyaṃ (paṭi. ma. 1.119) ‘‘sabbaṃ saṅkhatamasaṅkhataṃ anavasesaṃ jānātīti sabbaññutaññāṇaṃ, tattha āvaraṇaṃ natthīti anāvaraṇañāṇa’’ntiādi.
As it is said in the Paṭisambhidāmagga: “Knowing all conditioned and unconditioned things without remainder is omniscience (sabbaññutaññāṇa); therein there is no obstruction, hence it is unobstructed knowledge (anāvaraṇañāṇa),” and so on.
Như đã nói trong Paṭisambhidāmagga: “Trí tuệ biết tất cả pháp hữu vi và vô vi không còn sót lại gọi là sabbaññutaññāṇa (toàn giác trí), nơi đó không có chướng ngại gọi là anāvaraṇañāṇa (vô ngại trí)” v.v...
Tasmā natthi nesaṃ atthato bhedo, ekantena cetaṃ evamicchitabbaṃ.
Therefore, there is no difference between them in meaning, and this must be understood as such absolutely.
Do đó, không có sự khác biệt về mặt ý nghĩa giữa chúng, và điều này chắc chắn phải được chấp nhận như vậy.
Aññathā sabbaññutānāvaraṇañāṇānaṃ sādhāraṇatā asabbadhammārammaṇatā ca āpajjeyya.
Otherwise, omniscience and unobstructed knowledge would become common (to others) and not have all phenomena as their object.
Nếu không, sabbaññutaññāṇa (toàn giác trí) và anāvaraṇañāṇa (vô ngại trí) sẽ trở thành có tính chất chung và không lấy tất cả các pháp làm đối tượng.
Na hi bhagavato ñāṇassa aṇumattampi āvaraṇaṃ atthi, anāvaraṇañāṇassa asabbadhammārammaṇabhāve yattha taṃ na pavattati, tatthāvaraṇasabbhāvato anāvaraṇabhāvoyeva na siyā.
For there is not even a jot of obstruction in the knowledge of the Blessed One. If unobstructed knowledge did not have all phenomena as its object, then wherever it did not extend, obstruction would exist, and thus it would not truly be unobstructed.
Quả vậy, đối với trí tuệ của Đức Thế Tôn, không có một chướng ngại nào dù là nhỏ nhất; nếu vô ngại trí không lấy tất cả các pháp làm đối tượng, thì ở nơi mà nó không diễn tiến, do có sự tồn tại của chướng ngại, bản chất vô ngại sẽ không tồn tại.
Atha vā pana hotu aññameva anāvaraṇañāṇaṃ sabbaññutaññāṇato, idha pana sabbattha appaṭihatavuttitāya anāvaraṇañāṇanti sabbaññutaññāṇameva adhippetaṃ, tassa cādhigamanena bhagavā sabbaññū sabbavidū sammāsambuddhoti ca vuccati na sakiṃyeva sabbadhammāvabodhanato.
Or, let unobstructed knowledge be something different from omniscience; but here, by “unobstructed knowledge” is meant omniscience itself, due to its unimpeded operation everywhere. And through its attainment, the Blessed One is called all-knowing, all-seeing, and Perfectly Self-Enlightened, not merely by knowing all phenomena at once.
Hoặc giả, cứ cho rằng anāvaraṇañāṇa (vô ngại trí) là một trí khác với sabbaññutaññāṇa (toàn giác trí), nhưng ở đây, chính sabbaññutaññāṇa (toàn giác trí) được coi là anāvaraṇañāṇa (vô ngại trí) do khả năng diễn tiến không bị ngăn ngại ở khắp mọi nơi, và chính nhờ sự chứng đắc trí tuệ ấy mà Đức Thế Tôn được gọi là bậc Toàn Giác (sabbaññū), bậc Toàn Tri (sabbavidū), bậc Chánh Đẳng Giác (sammāsambuddha), chứ không phải chỉ do sự thấu hiểu tất cả các pháp trong một lần.
Tathā ca vuttaṃ paṭisambhidāyaṃ (paṭi. ma. 1.162) ‘‘vimokkhantikametaṃ buddhānaṃ bhagavantānaṃ bodhiyā mūle saha sabbaññutaññāṇassa paṭilābhā sacchikā paññatti yadidaṃ buddho’’ti.
And thus it is said in the Paṭisambhidāmagga: “This is a true designation, leading to liberation, for the Buddhas, the Blessed Ones, at the foot of the Bodhi tree upon the attainment of omniscience (sabbaññutaññāṇa): that is, ‘Buddha’.”
Và điều này đã được nói trong Paṭisambhidāmagga: “Đây là sự quy định thực tại, là điểm cuối cùng của sự giải thoát của các vị Phật, các Đức Thế Tôn, tại cội Bồ-đề, cùng với sự chứng đắc sabbaññutaññāṇa (toàn giác trí), đó là ‘Phật’”.
Sabbadhammāvabodhanasamatthañāṇasamadhigamena hi bhagavato santāne anavasesadhamme paṭivijjhituṃ samatthatā ahosīti.
For by the attainment of knowledge capable of understanding all phenomena, the Blessed One possessed the ability to fully comprehend all phenomena.
Quả vậy, nhờ sự chứng đắc trí tuệ có khả năng thấu hiểu tất cả các pháp mà trong dòng tâm thức của Đức Thế Tôn đã có khả năng liễu ngộ các pháp không còn sót lại.
Etthāha – kiṃ panidaṃ ñāṇaṃ pavattamānaṃ sakiṃyeva sabbasmiṃ visaye pavattati, udāhu kamenāti.
Here it is asked: “Does this knowledge, when it functions, extend to all objects simultaneously, or gradually?”
Ở đây có người hỏi – Trí tuệ này khi diễn tiến, nó diễn tiến trên toàn bộ đối tượng trong một lần, hay là tuần tự?
Kiñcettha – yadi tāva sakiṃyeva sabbasmiṃ visaye pavattati, atītānāgatapaccuppannaajjhattabahiddhādibhedabhinnānaṃ saṅkhatadhammānaṃ asaṅkhatasammutidhammānañca ekajjhaṃ upaṭṭhāne dūrato cittapaṭaṃ pekkhantassa viya paṭivibhāgenāvabodho na siyā, tathā sati ‘‘sabbe dhammā anattā’’ti vipassantānaṃ anattākārena viya sabbadhammā anirūpitarūpena bhagavato ñāṇassa visayā hontīti āpajjati.
And what then? If it operates on all objects simultaneously, then with conditioned phenomena—divided into past, future, present, internal, external, and so forth—and unconditioned and conventional phenomena, when they are presented together, there would be no comprehension with distinction, like someone looking at a distant canvas. In that case, it would follow that all phenomena become objects of the Blessed One’s knowledge in an undifferentiated form, just as when those contemplating “all phenomena are not self” see them in the aspect of not-self.
Và ở đây có vấn đề gì – Nếu nó diễn tiến trên toàn bộ đối tượng trong một lần, thì khi các pháp hữu vi được phân chia theo các loại như quá khứ, vị lai, hiện tại, bên trong, bên ngoài, v.v... cùng với các pháp vô vi và pháp chế định cùng hiện khởi một lúc, sẽ không có sự thấu hiểu một cách phân minh, giống như người nhìn một bức tranh từ xa; nếu vậy, sẽ dẫn đến kết luận rằng tất cả các pháp trở thành đối tượng của trí tuệ Đức Thế Tôn một cách không xác định, giống như đối với những người đang tu tập minh sát “tất cả các pháp là vô ngã” theo khía cạnh vô ngã.
Yepi ‘‘sabbañeyyadhammānaṃ ṭhitalakkhaṇavisayaṃ vikapparahitaṃ sabbakālaṃ buddhānaṃ ñāṇaṃ pavattati, tena te sabbavidūti vuccanti, evañca katvā ‘caraṃ samāhito nāgo, tiṭṭhantopi samāhito’ti idampi vacanaṃ suvuttaṃ hotī’’ti vadanti, tesampi vuttadosā nātivatti, ṭhitalakkhaṇārammaṇatāya ca atītānāgatasammutidhammānaṃ tadabhāvato ekadesavisayameva bhagavato ñāṇaṃ siyā, tasmā sakiṃyeva ñāṇaṃ pavattatīti na yujjati.
Even for those who say, “The knowledge of the Buddhas constantly operates on the established characteristic object of all knowable phenomena, without mental fabrications; therefore, they are called all-knowing. And having established this, the saying ‘The awakened one, concentrated when walking, concentrated even when standing’ is well-spoken,” the aforementioned fault does not cease. And because past, future, and conventional phenomena do not possess an established characteristic as their object, the Blessed One’s knowledge would be limited to a partial domain. Therefore, it is not appropriate to say that knowledge operates simultaneously.
Ngay cả những người nói rằng “trí tuệ của các vị Phật luôn luôn diễn tiến, không có sự phân biệt, lấy đặc tính thường hằng của tất cả các pháp cần biết làm đối tượng, do đó các Ngài được gọi là bậc Toàn Tri, và khi làm như vậy, câu ‘bậc Nāga đi trong định, đứng cũng trong định’ này cũng trở thành lời nói khéo”, thì đối với họ, cũng không thoát khỏi lỗi đã nêu, và vì lấy đặc tính thường hằng làm đối tượng, nên đối với các pháp quá khứ, vị lai và pháp chế định, do không có đặc tính đó, trí tuệ của Đức Thế Tôn sẽ chỉ có đối tượng là một phần; do đó, việc trí tuệ diễn tiến trong một lần là không hợp lý.
Atha kamena sabbasmiṃ visaye ñāṇaṃ pavattatīti.
“Then, does knowledge operate on all objects gradually?”
Nếu nói rằng trí tuệ diễn tiến tuần tự trên toàn bộ đối tượng.
Evampi na yujjati.
This too is not appropriate.
Như vậy cũng không hợp lý.
Na hi jātibhūmisabhāvādivasena disādesakālādivasena ca anekabhedabhinne ñeyye kamena gayhamāne tassa anavasesappaṭivedho sambhavati apariyantabhāvato ñeyyassa.
For when the knowable is taken gradually, it being multifariously differentiated by birth, plane of existence, nature, and by direction, place, time, and so forth, its complete penetration is not possible due to the infinitude of the knowable.
Quả vậy, khi đối tượng nhận thức được phân chia thành vô số loại theo chủng loại, cảnh giới, bản chất, v.v... và theo phương hướng, nơi chốn, thời gian, v.v... được nắm bắt tuần tự, thì sự liễu ngộ không còn sót lại đối với nó là không thể xảy ra, vì đối tượng nhận thức là vô hạn.
Ye pana ‘‘atthassa avisaṃvādanato ñeyyassa ekadesaṃ paccakkhaṃ katvā sesepi evanti adhimuccitvā vavatthāpanena sabbaññū bhagavā, tañca ñāṇaṃ na anumānañāṇaṃ saṃsayābhāvato.
But those who say, “The Blessed One is omniscient because, by observing a part of the knowable directly, due to the non-deceptiveness of the matter, he then determines the rest as being likewise by resolve; and that knowledge is not inferential knowledge because there is no doubt.
Còn những người nói rằng “Đức Thế Tôn là bậc Toàn Giác nhờ sự xác lập bằng cách nhận thức trực tiếp một phần của đối tượng nhận thức và tin chắc rằng phần còn lại cũng như vậy, do sự không sai lệch của thực tại, và trí tuệ đó không phải là trí suy luận vì không có sự nghi ngờ.
Saṃsayānubaddhañhi loke anumānañāṇa’’nti vadanti, tesampi taṃ na yuttaṃ.
For in the world, inferential knowledge is bound by doubt,” their assertion is also not valid.
Quả vậy, trong thế gian, trí suy luận luôn đi kèm với sự nghi ngờ”, quan điểm của họ cũng không hợp lý.
Sabbassa hi appaccakkhabhāve atthāvisaṃvādanena ñeyyassa ekadesaṃ paccakkhaṃ katvā sesepi evanti adhimuccitvā vavatthāpanassa asambhavato.
For if the whole is not directly perceived, it is impossible to determine the rest as being likewise by resolve, after directly perceiving a part of the knowable due to the non-deceptiveness of the matter.
Vì khi toàn bộ không được nhận thức trực tiếp, thì việc xác lập bằng cách nhận thức trực tiếp một phần của đối tượng nhận thức và tin chắc rằng phần còn lại cũng như vậy do sự không sai lệch của thực tại là không thể xảy ra.
Yañhi taṃ sesaṃ, taṃ appaccakkhanti.
For that which is the rest is not directly perceived.
Vì phần còn lại đó không được nhận thức trực tiếp.
Atha tampi paccakkhaṃ tassa sesabhāvo eva na siyāti?
Then, if that too is directly perceived, would it not cease to be the rest?
Nếu phần đó cũng được nhận thức trực tiếp, thì nó sẽ không còn là phần còn lại nữa?
Sabbametaṃ akāraṇaṃ.
All this is groundless.
Tất cả những điều này đều không có lý do.
Avisayavicāraṇabhāvato.
Because it is an investigation into an inappropriate domain.
Vì đó là sự xem xét điều không phải là đối tượng (của tư duy).
Vuttañhetaṃ bhagavatā – ‘‘buddhavisayo, bhikkhave, acinteyyo na cintetabbo, yo cinteyya, ummādassa vighātassa bhāgī assā’’ti (a. ni. 4.77).
For it was said by the Blessed One: “The domain of a Buddha, monks, is inconceivable and not to be conceived; whoever conceives it would be subject to madness and vexation.”
Điều này đã được Đức Thế Tôn nói – “Này các Tỳ-khưu, cảnh giới của chư Phật là điều không thể nghĩ bàn, không nên nghĩ bàn đến; người nào nghĩ bàn đến, sẽ trở thành người điên cuồng, khổ não”.
Idaṃ panettha sanniṭṭhānaṃ – yaṃ kiñci bhagavatā ñātuṃ icchitaṃ sakalaṃ ekadeso vā, tattha tattha appaṭihatavuttitāya paccakkhato ñāṇaṃ pavattati niccasamādhānañca vikkhepābhāvato.
This is the conclusion here: whatever the Blessed One desires to know, whether in its entirety or in part, his knowledge operates with direct perception in each case, unimpededly, and with constant collectedness due to the absence of distraction.
Đây là kết luận ở đây – Bất cứ điều gì Đức Thế Tôn muốn biết, dù là toàn bộ hay một phần, trí tuệ của Ngài diễn tiến một cách trực tiếp ở nơi đó, nơi đó với khả năng không bị ngăn ngại, và luôn luôn định tĩnh do không có sự phóng dật.
Ñātuṃ icchitassa ca sakalassa avisayabhāve tassa ākaṅkhappaṭibaddhavuttitā na siyā, ekantenevassā icchitabbā ‘‘sabbe dhammā buddhassa bhagavato āvajjanappaṭibaddhā ākaṅkhappaṭibaddhā manasikārappaṭibaddhā cittuppādappaṭibaddhā’’ti (mahāni. 69; paṭi. ma. 3.5) vacanato.
And if the entirety of what he desires to know were not within his domain, his knowledge would not be contingent on his aspiration; it must absolutely be so, as stated: “All phenomena for the Buddha, the Blessed One, are dependent on attention, dependent on aspiration, dependent on mental advertence, dependent on a thought arising.”
Và nếu toàn bộ những gì muốn biết không phải là đối tượng, thì khả năng diễn tiến của trí tuệ đó sẽ không phụ thuộc vào ý muốn; chắc chắn nó phải được mong muốn, theo như câu nói: “Tất cả các pháp đều phụ thuộc vào sự hướng tâm của Đức Phật, Đức Thế Tôn, phụ thuộc vào ý muốn, phụ thuộc vào sự tác ý, phụ thuộc vào sự khởi tâm”.
Atītānāgatavisayampi bhagavato ñāṇaṃ anumānāgamatakkagahaṇavirahitattā paccakkhameva.
Even the Blessed One’s knowledge regarding past and future domains is direct perception, being free from inference, tradition, and speculative reasoning.
Trí tuệ của Đức Thế Tôn, ngay cả đối với đối tượng quá khứ và vị lai, cũng là trực tiếp vì không có sự nắm bắt bằng suy luận, kinh điển, hay lý luận.
Nanu ca etasmimpi pakkhe yadā sakalaṃ ñātuṃ icchitaṃ, tadā sakiṃyeva sakalavisayatāya anirūpitarūpena bhagavato ñāṇaṃ pavatteyyāti vuttadosā nātivattiyevāti?
But in this view also, when the entirety is desired to be known, would not the aforementioned faults persist, since the Blessed One’s knowledge would operate simultaneously on the entire domain in an undifferentiated manner?
Nhưng chẳng phải trong trường hợp này, khi Ngài muốn biết toàn bộ, thì trí tuệ của Đức Thế Tôn sẽ diễn tiến một cách không xác định do có đối tượng là toàn bộ trong một lần, và như vậy không thoát khỏi lỗi đã nêu sao?
Na, tassa visodhitattā.
No, because that has been clarified.
Không, vì điều đó đã được làm cho trong sạch.
Visodhito hi so buddhavisayo acinteyyoti.
For that domain of the Buddha has been clarified as inconceivable.
Quả vậy, cảnh giới của chư Phật đó đã được làm cho trong sạch là điều không thể nghĩ bàn.
Aññathā pacurajanañāṇasamānavuttitāya buddhānaṃ bhagavantānaṃ ñāṇassa acinteyyatā na siyā, tasmā sakaladhammārammaṇampi taṃ ekadhammārammaṇaṃ viya suvavatthāpiteyeva te dhamme katvā pavattatīti idamettha acinteyyaṃ, ‘‘yāvatakaṃ ñeyyaṃ, tāvatakaṃ ñāṇaṃ.
Otherwise, the knowledge of the Buddhas, the Blessed Ones, would not be inconceivable, as it would be similar in operation to the knowledge of ordinary people. Therefore, that knowledge, even when it has all phenomena as its object, operates by making those phenomena well-defined, just as when it has a single phenomenon as its object—this is the inconceivable aspect here: “As much as there is to be known, so much is knowledge.
Nếu không, trí tuệ của các vị Phật, các Đức Thế Tôn, sẽ không phải là điều không thể nghĩ bàn do có cách diễn tiến giống như trí tuệ của nhiều người; do đó, ngay cả khi lấy tất cả các pháp làm đối tượng, nó vẫn diễn tiến sau khi đã xác lập rõ ràng các pháp ấy như thể lấy một pháp làm đối tượng, đây chính là điều không thể nghĩ bàn ở đây, (như đã nói) “Đối tượng nhận thức có bao nhiêu, trí tuệ có bấy nhiêu.
Yāvatakaṃ ñāṇaṃ, tāvatakaṃ ñeyyaṃ.
As much as there is knowledge, so much is there to be known.
Trí tuệ có bao nhiêu, đối tượng nhận thức có bấy nhiêu.
Ñeyyapariyantikaṃ ñāṇaṃ, ñāṇapariyantikaṃ ñeyya’’nti (paṭi. ma. 3.5) evamekajjhaṃ visuṃ sakiṃ kamena vā icchānurūpaṃ sammā sāmaṃ sabbadhammānaṃ buddhattā sammāsambuddho.
Knowledge has the knowable as its boundary; the knowable has knowledge as its boundary.” By being the Buddha of all phenomena himself, rightly, as he desires, whether simultaneously, distinctly, gradually, or all at once, he is the Perfectly Self-Enlightened One.
Trí tuệ có giới hạn là đối tượng nhận thức, đối tượng nhận thức có giới hạn là trí tuệ”, như vậy, do đã tự mình giác ngộ một cách chân chánh tất cả các pháp, dù là cùng một lúc, riêng lẻ, trong một lần hay tuần tự, theo như ý muốn, nên Ngài là bậc Chánh Đẳng Giác.
Vijjāhīti ettha vindiyaṃ vindatīti vijjā, yāthāvato upalabbhatīti attho.
Here, by wisdom (vijjā) means “that which finds what is to be found,” which is to say, it is accurately apprehended.
Trong từ Vijjāhi, vijjā là cái tìm thấy điều cần tìm thấy, có nghĩa là được lĩnh hội đúng như thật.
Attano vā paṭipakkhassa vijjhanaṭṭhena vijjā, tamokkhandhādikassa padālanaṭṭhenāti attho.
Or, vijjā means wisdom by virtue of piercing its opposite, meaning by virtue of splitting asunder masses of darkness and so forth.
Hoặc vijjā có nghĩa là xuyên thủng đối nghịch của nó, tức là có nghĩa là phá tan khối u minh, v.v...
Tato eva attano visayassa viditakaraṇaṭṭhenapi vijjā.
For that very reason, vijjā is also that which makes its object known.
Cũng chính vì vậy, vijjā còn có nghĩa là làm cho đối tượng của nó được biết đến.
Sampannattāti samannāgatattā paripuṇṇattā vā, avikalattāti attho.
Endowed with (sampannattā) means being possessed of, or being perfect, that is, being complete.
Sampannattā có nghĩa là do đã được trang bị, hay do đã được viên mãn, tức là có nghĩa là không thiếu sót.
Tatrāti ambaṭṭhasutte.
Therein (tatrā) refers to the Ambaṭṭha Sutta.
Tatrā có nghĩa là trong kinh Ambaṭṭha.
Manomayiddhiyāti ettha ‘‘idha bhikkhu imamhā kāyā aññaṃ kāyaṃ abhinimmināti rūpiṃ manomayaṃ sabbaṅgapaccaṅgaṃ ahīnindriya’’nti (dī. ni. 1.236) iminā nayena āgatā iddhi sarīrabbhantare aññasseva jhānamanena nibbattattā manomayassa sarīrassa nibbattivasena pavattā manomayiddhi nāma.
Here, mind-made power (manomayiddhi) is the power that arises by creating a mind-made body within one’s own body through jhānic mind, as presented in the passage: “Here, a bhikkhu creates from this body another body, material, mind-made, complete in all its limbs and parts, with unimpaired faculties.”
Trong từ Manomayiddhiyā, thần thông được đề cập theo cách này: “Ở đây, vị Tỳ-khưu từ thân này hóa hiện ra một thân khác, có sắc, do tâm tạo, có đủ tất cả các bộ phận lớn nhỏ, không thiếu căn”, thần thông này được gọi là manomayiddhi (thân do tâm tạo thần thông) vì nó diễn tiến bằng cách tạo ra một thân do tâm tạo, được tạo ra bởi tâm thiền của một người khác bên trong thân thể.
Cha abhiññāti āsavakkhayañāṇena saddhiṃ iddhividhādikā pañcābhiññāyo.
Six higher knowledges (cha abhiññā) are the five higher knowledges such as supernormal powers, along with the knowledge of the destruction of cankers (āsavakkhayañāṇa).
Sáu thắng trí là năm thắng trí bắt đầu bằng thần túc thông cùng với Lậu Tận Trí.
Tissannaṃ aṭṭhannañca vijjānaṃ tattha tattha sutte gahaṇaṃ veneyyajjhāsayavasenāti daṭṭhabbaṃ.
The inclusion of three or eight knowledges in various suttas should be understood as being in accordance with the disposition of the trainees.
Cần được hiểu rằng việc đề cập đến ba minh và tám minh trong các kinh ở chỗ này chỗ kia là tùy theo căn tánh của chúng sanh cần được tế độ.
Satta saddhammā nāma saddhā hirī ottappaṃ bāhusaccaṃ vīriyaṃ sati paññā ca.
The seven good qualities (satta saddhammā) are faith (saddhā), sense of shame (hirī), dread of wrongdoing (ottappa), extensive learning (bāhusacca), energy (vīriya), mindfulness (sati), and wisdom (paññā).
Bảy diệu pháp là tín, tàm, quý, đa văn, tinh tấn, niệm, và tuệ.
Ye sandhāya vuttaṃ ‘‘idha bhikkhu saddho hoti, hirimā, ottappī, bahussuto, āraddhavīriyo, upaṭṭhitassati, paññavā hotī’’ti (dī. ni. 3.330).
Referring to what was said: "Here a bhikkhu is endowed with faith, shame, fear of wrongdoing, much learning, aroused energy, established mindfulness, and wisdom."
Điều này được nói đến khi đề cập rằng: “Ở đây, một tỳ-khưu có đức tin, biết hổ thẹn, biết ghê sợ, đa văn, tinh tấn, niệm tỉnh, và có trí tuệ”.
Cattāri jhānānīti yāni kānici cattāri rūpāvacarajjhānāni.
The four jhāna means any of the four rūpāvacara jhānas.
Bốn thiền (cattāri jhānāni) là bất cứ bốn thiền sắc giới nào.
Kasmā panettha sīlādayoyeva pannarasa ‘‘caraṇa’’nti vuttāti codanaṃ sandhāyāha ‘‘imeyeva hī’’tiādi.
Referring to the question, "Why are these fifteen, beginning with sīla, called 'caraṇa' here?" it says, "Because these very things..." and so on.
Để giải đáp câu hỏi: “Tại sao chỉ có mười lăm pháp giới đức hạnh (sīla) v.v... ở đây được gọi là ‘hạnh’ (caraṇa)?”, nên mới nói “chính những điều này” v.v...
Tena tesaṃ sikkhattayasaṅgahato nibbānupagamane ekaṃsato sādhanabhāvamāha.
Thereby it states their being the sole means for attaining Nibbāna, as they are included in the three trainings.
Bởi vì chúng được bao gồm trong ba học pháp, nên điều này nói lên sự chứng đắc Niết Bàn một cách tuyệt đối.
Idāni tadatthasādhanāya āgamaṃ dassento ‘‘yathāhā’’tiādimāha.
Now, displaying the canonical text for the accomplishment of that meaning, it says, "As it was said..." and so on.
Bây giờ, để chứng minh ý nghĩa đó, Ngài đưa ra kinh điển và nói “như đã nói” v.v...
Bhagavātiādi vuttassevatthassa nigamanavasena vuttaṃ.
The Blessed One and so on, is stated by way of concluding the meaning already spoken.
Thế Tôn (Bhagavā) v.v... được nói ra theo cách kết luận ý nghĩa đã được trình bày.
Nanu cāyaṃ vijjācaraṇasampadā sāvakesupi labbhatīti?
But is not this accomplishment of knowledge and conduct found also in disciples?
Chẳng phải sự thành tựu minh hạnh này cũng có thể tìm thấy nơi các đệ tử sao?
Kiñcāpi labbhati, na pana tathā, yathā bhagavatoti dassetuṃ ‘‘tattha vijjāsampadā’’tiādi vuttaṃ.
Although it is found, it is not like that of the Blessed One; to show this, "There, the accomplishment of knowledge" and so on, is stated.
Mặc dù có thể tìm thấy, nhưng không phải như ở Thế Tôn, để chỉ ra điều đó nên mới nói “trong đó sự thành tựu minh” v.v...
Āsavakkhayavijjāya sabbaññubhāvasiddhito āha ‘‘vijjāsampadā bhagavato sabbaññutaṃ pūretvā ṭhitā’’ti.
Since the omniscience of the Blessed One is established by the knowledge of the destruction of the āśavas, it says, "The accomplishment of knowledge, for the Blessed One, stands fulfilling omniscience."
Vì sự chứng đắc toàn tri được hoàn thành bởi minh lậu tận, nên nói “sự thành tựu minh của Thế Tôn đứng vững sau khi hoàn thành toàn tri”.
Catūsu jhānesu antogadhabhāvena caraṇadhammapariyāpannattā karuṇābrahmavihārassa yathārahaṃ tassa ca mahākaruṇāsamāpattivasena asādhāraṇasabhāvassa bhagavati upalabbhanato āha ‘‘caraṇasampadā mahākāruṇikataṃ pūretvā ṭhitā’’ti.
Since the brahmavihāra of compassion is included in the four jhāna and thus comprised within the caraṇa qualities as appropriate, and since its unique nature through the attainment of great compassion is found in the Blessed One, it says, "The accomplishment of conduct stands fulfilling great compassion."
Vì phạm trú bi được bao gồm trong bốn thiền và thuộc về các pháp hạnh, và vì bản chất phi thường của nó như là sự nhập Đại Bi được tìm thấy nơi Thế Tôn một cách thích đáng, nên nói “sự thành tựu hạnh đứng vững sau khi hoàn thành Đại Bi”.
Yathā sattānaṃ anatthaṃ parivajjetvā atthe niyojanaṃ paññāya vinā na hoti, evaṃ nesaṃ atthānatthajānanaṃ satthu karuṇāya vinā na hotīti ubhayampi ubhayattha sakiccakameva siyā.
Just as the dedication of beings to welfare, avoiding harm, is not possible without wisdom, so too their knowledge of welfare and harm is not possible without the Teacher's compassion; thus, both would be functional in both respects.
Cũng như việc hướng dẫn chúng sinh đến lợi ích mà không tránh khỏi sự bất lợi sẽ không có được nếu không có trí tuệ, thì việc biết lợi ích và bất lợi của họ cũng không có được nếu không có lòng bi của Bậc Đạo Sư; như vậy, cả hai đều có vai trò thiết yếu ở cả hai khía cạnh.
Yattha pana yassā padhānabhāvo, taṃ dassetuṃ ‘‘so sabbaññutāyā’’tiādi vuttaṃ.
To show where which is primary, "He through omniscience" and so on, is stated.
Tuy nhiên, để chỉ ra cái nào là chủ yếu ở đâu, nên nói “Ngài do toàn tri” v.v...
Yathā taṃ vijjācaraṇasampannoti ettha tanti nipātamattaṃ, yathā aññopi vijjācaraṇasampanno niyojeti, tathā ayanti attho.
In "Just as he is accomplished in knowledge and conduct," the word "taṃ" is merely a particle; the meaning is, just as another who is accomplished in knowledge and conduct instructs, so too does this one.
Trong câu “như vị ấy thành tựu minh hạnh” (yathā taṃ vijjācaraṇasampanno), chữ taṃ chỉ là một giới từ; ý nghĩa là: cũng như một vị khác thành tựu minh hạnh hướng dẫn, thì vị này cũng vậy.
Tena vijjācaraṇasampannassevāyaṃ āveṇikā paṭipattīti dasseti.
Thereby it shows that this is an exclusive practice of one accomplished in knowledge and conduct.
Điều này cho thấy rằng đây là một thực hành độc đáo chỉ dành cho người thành tựu minh hạnh.
Sā panāyaṃ satthu vijjācaraṇasampadā sāsanassa niyyānikatāya sāvakānaṃ sammāpaṭipattiyā ekantakāraṇanti dassetuṃ ‘‘tenassā’’tiādi vuttaṃ.
To show that this accomplishment of the Teacher's knowledge and conduct is the sole cause for the disciples' right practice, by leading to liberation from the dispensation, "Therefore, for him..." and so on, is stated.
Để chỉ ra rằng sự thành tựu minh hạnh này của Bậc Đạo Sư là nguyên nhân tuyệt đối cho sự thực hành đúng đắn của các đệ tử, dẫn đến sự giải thoát của giáo pháp, nên nói “do đó của Ngài” v.v...
Tattha attantapādayoti ādi-saddena parantapaubhayantapā gahitā.
There, attantapa and others—by the word "ādi" (and others), parantapa and ubhayantapa are included.
Trong đó, những người hành khổ mình (attantapādayo) – với chữ v.v... (ādi) – bao gồm những người hành khổ người khác (parantapa) và những người hành khổ cả hai (ubhayantapā).
Sesaṃ suviññeyyameva.
The rest is easily understood.
Phần còn lại rất dễ hiểu.
Ettha ca vijjāsampadāya satthu paññāmahattaṃ pakāsitaṃ hoti, caraṇasampadāya karuṇāmahattaṃ.
Here, the great wisdom of the Teacher is revealed by the accomplishment of knowledge, and his great compassion by the accomplishment of conduct.
Ở đây, sự vĩ đại của trí tuệ của Bậc Đạo Sư được công bố qua sự thành tựu minh, và sự vĩ đại của lòng bi được công bố qua sự thành tựu hạnh.
Tesu paññāya bhagavato dhammarajjappatti, karuṇāya dhammasaṃvibhāgo.
Through wisdom, the Blessed One attained the Dhamma-kingship; through compassion, he shared the Dhamma.
Trong đó, Thế Tôn đạt được vương quốc Chánh Pháp bằng trí tuệ, và phân chia Chánh Pháp bằng lòng bi.
Paññāya saṃsāradukkhanibbidā, karuṇāya saṃsāradukkhasahanaṃ.
Through wisdom, revulsion from the suffering of saṃsāra; through compassion, endurance of the suffering of saṃsāra.
Trí tuệ dẫn đến sự nhàm chán khổ đau sinh tử, lòng bi dẫn đến sự chịu đựng khổ đau sinh tử.
Paññāya paradukkhaparijānanaṃ, karuṇāya paradukkhapatikārārambho.
Through wisdom, knowing the suffering of others; through compassion, undertaking to remedy the suffering of others.
Trí tuệ nhận biết khổ đau của người khác, lòng bi khởi sự giúp đỡ khổ đau của người khác.
Paññāya parinibbānābhimukhabhāvo, karuṇāya tadadhigamo.
Through wisdom, being inclined towards final Nibbāna; through compassion, its attainment.
Trí tuệ hướng đến sự Niết Bàn, lòng bi đạt được điều đó.
Paññāya sayaṃ taraṇaṃ, karuṇāya paresaṃ tāraṇaṃ.
Through wisdom, crossing over oneself; through compassion, helping others to cross over.
Trí tuệ tự mình vượt qua, lòng bi giúp người khác vượt qua.
Paññāya buddhabhāvasiddhi, karuṇāya buddhakiccasiddhi.
Through wisdom, the accomplishment of Buddhahood; through compassion, the accomplishment of the Buddha's tasks.
Trí tuệ thành tựu Phật quả, lòng bi thành tựu Phật sự.
Karuṇāya vā bodhisattabhūmiyaṃ saṃsārābhimukhabhāvo, paññāya tattha anabhirati, tathā karuṇāya paresaṃ abhiṃsāpanaṃ, paññāya sayaṃ parehi abhāyanaṃ.
Or, through compassion, inclination towards saṃsāra in the bodhisatta stage; through wisdom, non-delight therein. Similarly, through compassion, not harming others; through wisdom, not being harmed by others oneself.
Hoặc, lòng bi hướng về sinh tử trong địa vị Bồ Tát, trí tuệ không hoan hỷ ở đó; cũng vậy, lòng bi làm cho người khác không bị tổn hại, trí tuệ tự mình không bị người khác tổn hại.
Karuṇāya paraṃ rakkhanto attānaṃ rakkhati, paññāya attānaṃ rakkhanto paraṃ rakkhati.
Through compassion, one protects oneself by protecting others; through wisdom, one protects others by protecting oneself.
Do lòng bi, bảo vệ người khác là bảo vệ chính mình; do trí tuệ, bảo vệ chính mình là bảo vệ người khác.
Tathā karuṇāya aparantapo, paññāya anattantapo, tena attahitāya paṭipannādīsu catūsu puggalesu catutthapuggalabhāvo siddho hoti.
Thus, through compassion, he is not one who harms others (aparantapa); through wisdom, he is not one who harms himself (anattantapa). Therefore, his being the fourth type of person among the four individuals, such as those devoted to their own welfare, is established.
Cũng vậy, do lòng bi, Ngài không hành khổ người khác; do trí tuệ, Ngài không hành khổ chính mình; do đó, trong bốn hạng người như người thực hành vì lợi ích của mình v.v..., Ngài được chứng minh là hạng người thứ tư.
Tathā karuṇāya lokanāthatā, paññāya attanāthatā.
Similarly, through compassion, he is the Lord of the world; through wisdom, he is his own Lord.
Cũng vậy, do lòng bi, Ngài là bậc che chở thế gian; do trí tuệ, Ngài là bậc che chở cho chính mình.
Karuṇāya cassa ninnatābhāvo, paññāya unnamābhāvo.
And through compassion, he is humble; through wisdom, he is exalted.
Cũng vậy, do lòng bi, Ngài có sự khiêm tốn; do trí tuệ, Ngài có sự cao thượng.
Tathā karuṇāya sabbasattesu janitānuggaho, paññānugatattā na ca na sabbattha virattacitto, paññāya sabbadhammesu virattacitto, karuṇānugatattā na ca na sabbasattānuggahāya pavatto.
Similarly, through compassion, he generated favor towards all beings, and being accompanied by wisdom, his mind was not dispassionate everywhere; through wisdom, his mind was dispassionate towards all phenomena, and being accompanied by compassion, he did not fail to strive for the welfare of all beings.
Cũng vậy, do lòng bi, Ngài tạo ra sự giúp đỡ cho tất cả chúng sinh, và vì được trí tuệ hướng dẫn, tâm Ngài không phải là không ly tham đối với mọi thứ; do trí tuệ, tâm Ngài ly tham đối với tất cả các pháp, và vì được lòng bi hướng dẫn, Ngài không phải là không hoạt động để giúp đỡ tất cả chúng sinh.
Yathā hi karuṇā bhagavato sinehasokavirahitā, evaṃ paññā ahaṃkāramamaṃkāravinimuttāti aññamaññavisodhitā paramavisuddhā guṇavisesā vijjācaraṇasampadāhi pakāsitāti daṭṭhabbaṃ.
Just as the Blessed One's compassion is free from affection and sorrow, so too his wisdom is free from egoism and possessiveness. Thus, these mutually purified, supremely pure distinguished qualities are revealed by the accomplishment of knowledge and conduct.
Như lòng bi của Thế Tôn không có sự luyến ái và sầu muộn, thì trí tuệ cũng không có ngã mạn và ngã sở; như vậy, những phẩm chất đặc biệt siêu việt được thanh lọc lẫn nhau và cực kỳ thanh tịnh này được công bố qua sự thành tựu minh hạnh.
Idāni sugatoti imassa atthaṃ dassento āha ‘‘sobhanagamanattā’’tiādi.
Now, displaying the meaning of sugata, it says, "Because of his good going" and so on.
Bây giờ, để chỉ ra ý nghĩa của từ Sugato (Thiện Thệ), Ngài nói “do có sự đi tốt đẹp” v.v...
‘‘Gate ṭhite’’tiādīsu gamanampi gatanti vuccatīti āha ‘‘gamanampi hi gatanti vuccatī’’ti.
In phrases like "having gone, having stood," going is also called gata; thus, it says, "Going is indeed also called gata."
Trong các câu như “đã đi, đã đứng” v.v..., sự đi cũng được gọi là đã đi, nên Ngài nói “sự đi cũng được gọi là đã đi”.
Sobhananti subhaṃ, subhabhāvo visuddhatāya, visuddhatā dosavigamenāti āha ‘‘parisuddhamanavajja’’nti.
Sobhana means pure (subha). Purity is due to blamelessness, and blamelessness is due to the absence of defilements; thus, it says, "Pure, blameless."
Tốt đẹp (sobhaṇa) là thanh tịnh; sự thanh tịnh là do sự trong sạch, sự trong sạch là do sự loại bỏ các ô nhiễm, nên Ngài nói “trong sạch, không có lỗi lầm”.
Gamanañca nāma bahuvidhanti idhādhippetaṃ gamanaṃ dassento ‘‘ariyamaggo’’ti āha.
Going is of many kinds; showing the going intended here, it says, "The Noble Path."
Sự đi có nhiều loại, để chỉ ra sự đi được đề cập ở đây, Ngài nói “Bát Chánh Đạo” (ariyamagga).
So hi nibbānassa gati adhigamoti ca katvā gataṃ gamananti ca vuccati.
For it is the going to Nibbāna, the attainment, and thus it is called a "gone going."
Vì đó là con đường dẫn đến Niết Bàn, là sự chứng đắc, nên cũng được gọi là sự đi đã đi.
Idāni tasseva gamane kāraṇaṃ dassetuṃ ‘‘tena hesā’’tiādi vuttaṃ.
Now, to show the reason for that very going, "Therefore, that..." and so on, is stated.
Bây giờ, để chỉ ra nguyên nhân của sự đi đó, nên nói “do đó, điều này” v.v...
Khemaṃ disanti nibbānaṃ.
The secure direction is Nibbāna.
Phương an ổn (khemaṃ disa) là Niết Bàn.
Asajjamānoti paripanthābhāvena sugatigamanepi asajjanto saṅgaṃ akaronto, pageva itarattha.
Without clinging means not clinging to good destinations due to the absence of obstacles, much less to other destinations.
Không vướng mắc (asajjamāno) nghĩa là không bị cản trở khi đi trên con đường tốt đẹp do không có chướng ngại, huống chi là ở những nơi khác.
Atha vā ekāsane nisīditvā khippābhiññāvaseneva catunnampi maggānaṃ paṭiladdhabhāvato asajjamāno abajjhanto gato.
Alternatively, having sat on one seat, he went without clinging, without impediment, having attained all four paths through swift super-knowledge.
Hoặc, do đã đạt được cả bốn đạo một cách nhanh chóng chỉ trong một chỗ ngồi, nên Ngài đã đi mà không bị vướng mắc, không bị ràng buộc.
Yaṃ gamanaṃ gacchanto sabbagamanatthaṃ āvahati, sabbañca anuttaraṃ sampattiṃ āvahati, tadeva sobhanaṃ nāma, tena ca bhagavā gatoti āha ‘‘iti sobhanagamanattā sugato’’ti sobhanattho susaddoti katvā.
That going, by which one goes, brings about the essence of all going, and brings about all unsurpassed prosperity, that alone is called "good." And by that, the Blessed One went; thus, it says, "Thus, because of his good going, he is Sugata," taking the meaning of "good" as "su."
Sự đi nào khi đi đến mang lại tất cả các lợi ích của sự đi, và mang lại tất cả các thành tựu vô thượng, thì đó mới là sự đi tốt đẹp; và Thế Tôn đã đi bằng sự đi đó, nên nói “như vậy, do có sự đi tốt đẹp, Ngài là Sugato”, coi ý nghĩa tốt đẹp là Sugato.
Asundarānaṃ dukkhānaṃ saṅkhārappavattīnaṃ abhāvato accantasukhattā ekantato sundaraṃ nāma asaṅkhatā dhātūti āha ‘‘sundarañcesa ṭhānaṃ gato amataṃ nibbāna’’nti.
Since there is no existence of unbeautiful sufferings and formations, and it is entirely blissful, the unconditioned element (Nibbāna) is indeed supremely beautiful; thus, it says, "He has gone to a beautiful state, the deathless Nibbāna."
Vì không có những khổ đau bất thiện và sự vận hành của các hành, nên yếu tố vô vi là một trạng thái hoàn toàn hạnh phúc và tuyệt đối tốt đẹp, nên Ngài nói “Ngài đã đi đến trạng thái tốt đẹp, Niết Bàn bất tử”.
Tenāha bhagavā ‘‘nibbānaṃ paramaṃ sukha’’nti (ma. ni. 2.215; dha. pa. 203-204).
Therefore, the Blessed One said, "Nibbāna is the supreme bliss."
Do đó, Thế Tôn đã nói: “Niết Bàn là hạnh phúc tối thượng”.
Sammāti suṭṭhu.
Sammā means thoroughly.
Chánh (sammā) là tốt đẹp.
Suṭṭhu gamanañca nāma paṭipakkhena anabhibhūtassa gamananti āha ‘‘pahīne kilese puna apaccāgacchanto’’ti, pahīnānaṃ puna asamudācāravasena apaccāgacchanto.
And thorough going means the going of one who is not overcome by the opponent; thus, it says, "Having abandoned defilements, not returning to them again," meaning not returning by way of their non-resurgence after being abandoned.
Sự đi tốt đẹp là sự đi không bị đối nghịch chế ngự, nên Ngài nói “không trở lại với các phiền não đã đoạn trừ”, nghĩa là không trở lại theo cách các phiền não đã đoạn trừ không còn khởi lên nữa.
Vuttamevatthaṃ āgamaṃ dassetvā vibhāvento āha ‘‘vuttañceta’’ntiādi.
Displaying the very meaning stated, by means of canonical text, and elaborating, it says, "And it was said..." and so on.
Để minh họa ý nghĩa đã nói bằng cách đưa ra kinh điển, Ngài nói “và điều này đã được nói” v.v...
Etanti tena tena maggena pahīnakilesānaṃ puna apaccāgamanaṃ, idañca sikhāppattaṃ sammāgamanaṃ, yāya āgamanīyapaṭipadāya siddhaṃ, sāpi sammāgamanamevāti evampi bhagavā sugatoti dassetuṃ ‘‘sammā vā āgato’’tiādi vuttaṃ.
This refers to the non-return of defilements that have been abandoned by each path; and this is a perfected right going. The practice by which it is accomplished is also a right going. To show that the Blessed One is Sugata in this way too, "Or having rightly come" and so on, is stated.
Điều này (etaṃ) là việc các phiền não đã đoạn trừ bằng con đường đó không trở lại nữa, và đây là sự đi chánh đạt đến đỉnh cao; con đường thực hành dẫn đến sự thành tựu điều đó cũng là sự đi chánh; như vậy, để chỉ ra rằng Thế Tôn cũng là Sugato, nên nói “hoặc đã đến một cách chánh” v.v...
Sammāpaṭipattiyāti sammāsambodhiyā sampāpane aviparītapaṭipattiyā.
By right practice means by the unperverted practice that leads to the attainment of perfect enlightenment.
Bằng sự thực hành chánh (sammāpaṭipattiyā) là bằng sự thực hành không sai lệch để đạt được Chánh Đẳng Giác.
Sabbalokassa hitasukhameva karontāti etena mahābodhiyā paṭipadā avibhāgena sabbasattānaṃ sabbadā hitasukhāvahabhāveneva pavattatīti dasseti.
Doing only what is beneficial and conducive to happiness for all the world—by this, it shows that the practice leading to great enlightenment (mahābodhi) proceeds without distinction, always bringing benefit and happiness to all beings.
Luôn làm lợi ích và hạnh phúc cho tất cả thế gian (sabbalokassa hitasukhameva karontā) – điều này cho thấy rằng sự thực hành của Đại Bồ Đề luôn diễn ra để mang lại lợi ích và hạnh phúc cho tất cả chúng sinh một cách không phân biệt.
Sassataṃ ucchedanti ime ante anupagacchanto gatoti etena paṭiccasamuppādagatiṃ dasseti.
Having gone without resorting to these extremes: eternalism and annihilationism—by this, it shows the path of dependent origination.
Đã đi mà không rơi vào các cực đoan này là thường kiến và đoạn kiến (sassataṃ ucchedanti ime ante anupagacchanto gato) – điều này chỉ ra sự đi theo duyên khởi.
Kāmasukhaṃ attakilamathanti ime anupagacchanto gatoti etena ariyamaggagatiṃ dasseti.
Having gone without resorting to these: sensual pleasure and self-mortification—by this, it shows the path of the Noble Eightfold Path.
Đã đi mà không rơi vào các cực đoan này là dục lạc và tự hành khổ (kāmasukhaṃ attakilamathanti ime anupagacchanto gato) – điều này chỉ ra sự đi theo Bát Chánh Đạo.
Tatrāti yuttaṭṭhāne yuttasseva bhāsane.
"Therein" refers to speaking only what is appropriate in an appropriate context.
Tatra (ở đó) có nghĩa là nói điều phù hợp ở nơi phù hợp.
Nipphādetabbe sādhetabbe cetaṃ bhummaṃ.
This locative case (bhumma) refers to that which should be accomplished and established.
Đây là một trường hợp của cách định sở (bhumma) cần được thực hiện và hoàn thành.
Abhūtanti abhūtatthaṃ.
"Not real" (abhūtaṃ) means a false matter.
Abhūta (không có thật) có nghĩa là điều không có thật.
Atthamukhena hi vācāya abhūtatā bhūtatā vā.
For it is by way of meaning that speech is false or true.
Bởi vì sự không có thật hay có thật của lời nói là do ý nghĩa của nó.
Atacchanti tasseva vevacanaṃ.
"Not true" (atacchaṃ) is a synonym for the same.
Ataccha (không đúng sự thật) là từ đồng nghĩa của điều đó.
Anatthasaṃhitanti diṭṭhadhammikena samparāyikena vā anatthena saṃhitaṃ anatthasaṃhitaṃ, anatthāvahaṃ.
"Not conducive to welfare" (anatthasaṃhitaṃ) means conducive to non-welfare, whether in this present life or in future lives; it means bringing about non-welfare.
Anatthasaṃhita (không lợi ích) có nghĩa là liên quan đến điều không lợi ích trong hiện tại hay vị lai, tức là mang lại điều không lợi ích.
Na atthoti anattho, atthassa paṭipakkho abhāvo ca, tena saṃhitaṃ, pisuṇavācaṃ samphappalāpañcāti attho.
That which is not welfare (attha) is non-welfare (anattha), the opposite of welfare, and its absence; that which is associated with it—this means slanderous speech and frivolous talk.
Không lợi ích là anattha, là đối nghịch và không có lợi ích; liên quan đến điều đó, có nghĩa là lời nói đâm thọc và lời nói vô ích.
Evamettha catubbidhassapi vacīduccaritassa saṅgaho daṭṭhabbo.
Thus, the inclusion of all four kinds of verbal misconduct should be understood here.
Ở đây, cần hiểu rằng tất cả bốn loại ác hạnh của lời nói đều được bao gồm.
Ettha ca paṭhamā vācā sīlavantaṃ ‘‘dussīlo’’ti, acaṇḍālādiṃ ‘‘caṇḍālo’’tiādinā bhāsamānassa daṭṭhabbā.
Here, the first type of speech should be understood as that of one who speaks to a virtuous person, saying "You are immoral," or to one who is not an outcast, saying "You are an outcast," and so forth.
Và ở đây, lời nói thứ nhất là khi nói về một người giữ giới là "người phá giới", hoặc nói về một người không phải caṇḍāla (tiện dân) là "caṇḍāla" v.v.
Dutiyā dussīlaṃ ‘‘dussīlo’’ti, caṇḍālādimeva ‘‘caṇḍālo’’tiādinā avinayena bhāsamānassa.
The second type is of one who speaks unskillfully to an immoral person, saying "You are immoral," or to an outcast, saying "You are an outcast," and so forth.
Lời nói thứ hai là khi nói về một người phá giới là "người phá giới", hoặc nói về một caṇḍāla là "caṇḍāla" v.v. một cách thiếu tôn trọng.
Tatiyā nerayikādikassa nerayikādibhāvavibhāvanīkathā yathā ‘‘āpāyiko devadatto nerayiko’’tiādikā.
The third type is speech that declares the state of beings in hell, and so forth, such as "Devadatta is bound for the lower realms, he is an inhabitant of hell."
Lời nói thứ ba là câu chuyện làm rõ trạng thái của một chúng sinh trong địa ngục, v.v. ví dụ như: "Devadatta sẽ tái sinh vào địa ngục, là chúng sinh địa ngục" v.v.
Catutthī ‘‘vedavihitena yaññavidhinā pāṇātipātādikataṃ sugatiṃ āvahatī’’ti lokassa byāmohanakathā.
The fourth type is speech that deludes people, such as "Killing and other actions performed according to the sacrificial rites prescribed in the Vedas lead to a happy destination."
Lời nói thứ tư là câu chuyện mê hoặc thế gian rằng: "Việc sát sinh v.v. được thực hiện theo nghi lễ hiến tế được quy định trong kinh Veda sẽ đưa đến thiện thú."
Pañcamī bhūtena pesuññupasaṃhārā kathā.
The fifth type is speech involving slander, based on truth.
Lời nói thứ năm là câu chuyện mang tính đâm thọc có thật.
Chaṭṭhā yuttapattaṭṭhāne pavattitā dānasīlādikathā veditabbā.
The sixth type is speech about generosity, morality, and so forth, spoken in an appropriate and timely manner.
Lời nói thứ sáu là câu chuyện về bố thí, trì giới v.v. được nói ra ở nơi thích hợp.
Evaṃ sammā gadattāti yathāvuttaṃ abhūtādiṃ vajjetvā bhūtaṃ tacchaṃ atthasaṃhitaṃ piyaṃ manāpaṃ tato eva sammā suṭṭhu gadanato sugato.
"Thus having spoken well" (evaṃ sammā gadattā): Having avoided what is false and so forth, as stated, and having spoken well and truly what is real, factual, conducive to welfare, pleasing, and agreeable—because of this, he is Sugata.
Evaṃ sammā gadattā (vì đã nói đúng như vậy) có nghĩa là Thiện Thệ (Sugata) vì đã nói đúng đắn, tốt đẹp, tránh những điều không có thật v.v. như đã nói, mà nói những điều có thật, đúng sự thật, lợi ích, đáng yêu và dễ chịu.
Āpāthagamanamattena kassaci appiyampi hi bhagavato vacanaṃ piyaṃ manāpameva atthasiddhiyā lokassa hitasukhāvahattā.
Even if some of the Fortunate One's words may not be pleasing to someone at first hearing, they are indeed pleasing and agreeable because they lead to the accomplishment of welfare and bring benefit and happiness to the world.
Mặc dù có những lời của Đức Thế Tôn có thể không đáng yêu đối với một số người chỉ vì chúng được nói ra, nhưng chúng vẫn đáng yêu và dễ chịu vì chúng mang lại lợi ích và hạnh phúc cho thế gian để đạt được mục tiêu.
Ettha pana da-kārassa ta-kāraṃ katvā ‘‘sugato’’ti vuttanti daṭṭhabbaṃ.
It should be understood that here the letter 'da' has been changed to 'ta' to form Sugata.
Ở đây, cần hiểu rằng chữ da đã được đổi thành ta để tạo thành từ "Sugata".
Aparo nayo – sobhanaṃ gataṃ gamanaṃ etassāti sugato.
Another explanation: he is Sugata because his going (gata) is good (sobhana).
Một cách giải thích khác – Sugata (Thiện Thệ) là người có sự đi, sự đến tốt đẹp.
Bhagavato hi veneyyajanupasaṅkamanaṃ ekantena tesaṃ hitasukhanipphādanato sobhanaṃ bhaddakaṃ.
For the Fortunate One's approach to those who are amenable to instruction is excellent and auspicious, as it invariably brings about their benefit and happiness.
Việc Đức Thế Tôn đến với những người có thể giáo hóa là tốt đẹp và đáng kính vì nó hoàn toàn mang lại lợi ích và hạnh phúc cho họ.
Tathā lakkhaṇānubyañjanappaṭimaṇḍitarūpakāyatāya dutavilambitakhalitānukaḍḍhananippīḷanukkuṭikakuṭilākulatādidosavirahitaṃ vilāsitarājahaṃsavasabhavāraṇamigarājagamanaṃ kāyagamanaṃ ñāṇagamanañca vipulanimmalakaruṇāsativīriyādiguṇavisesahitamabhinīhārato yāva mahābodhi anavajjatāya sattānaṃ hitasukhāvahatāya ca sobhanameva.
Likewise, his physical going, adorned with the major and minor characteristics, free from defects such as hesitation, slowness, stumbling, dragging, pressing, cramping, crookedness, and agitation, like the majestic gait of a royal swan or elephant, and his going by way of knowledge, endowed with special qualities such as vast, pure compassion, mindfulness, and effort, from the time of his solemn resolve up to the great Bodhi-tree, is excellent due to its blamelessness and because it brings benefit and happiness to beings.
Tương tự, sự đi của thân (kāyagamana) được trang hoàng bằng các tướng tốt và tùy tướng, không có các lỗi như vội vàng, chậm chạp, vấp ngã, kéo lê, ép buộc, co rút, cong vẹo, rối loạn, mà là sự đi duyên dáng như chim hạc chúa, voi chúa, sư tử chúa; và sự đi của trí tuệ (ñāṇagamana) là tốt đẹp vì nó được thúc đẩy bởi các phẩm chất đặc biệt như lòng bi mẫn, chánh niệm, tinh tấn v.v. rộng lớn và trong sạch, từ khi phát nguyện cho đến Đại Bồ Đề, và vì nó vô tội, mang lại lợi ích và hạnh phúc cho chúng sinh.
Atha vā sayambhūñāṇena sakalampi lokaṃ pariññābhisamayavasena parijānanto sammā gato avagatoti sugato.
Alternatively, having fully understood the entire world through the comprehension of his self-existent knowledge, he is Sugata because he has gone (gato) to perfect understanding (sammā).
Hoặc, Sugata là người đã đi (gato) đúng đắn (sammā), đã hiểu rõ (avagato) toàn bộ thế gian bằng trí tuệ tự sinh (sayambhūñāṇa) thông qua sự thấu hiểu (pariññābhisamaya).
Tathā lokasamudayaṃ pahānābhisamayavasena pajahanto anuppattidhammataṃ āpādento sammā gato atītoti sugato.
Similarly, having abandoned the origin of the world through the comprehension of relinquishment, bringing it to a state of non-arising, he is Sugata because he has gone (gato) to perfect transcendence (sammā atīto).
Tương tự, Sugata là người đã đi (gato) đúng đắn (sammā), đã vượt qua (atīto) sự tập khởi của thế gian (lokasamudaya) bằng sự thấu hiểu sự đoạn trừ (pahānābhisamayavasena), đưa nó đến trạng thái không sinh khởi trở lại.
Lokanirodhaṃ nibbānaṃ sacchikiriyābhisamayavasena sammā gato adhigatoti sugato.
Having realized Nibbāna, the cessation of the world, through the comprehension of actualization, he is Sugata because he has gone (gato) to perfect attainment (sammā adhigato).
Sugata là người đã đi (gato) đúng đắn (sammā), đã đạt được (adhigato) sự diệt tận của thế gian (lokanirodha) tức Niết Bàn, bằng sự thấu hiểu sự chứng ngộ (sacchikiriyābhisamayavasena).
Lokanirodhagāminiṃ paṭipadaṃ bhāvanābhisamayavasena sammā gato paṭipannoti sugato.
Having practiced the path leading to the cessation of the world through the comprehension of development, he is Sugata because he has gone (gato) to perfect practice (sammā paṭipanno).
Sugata là người đã đi (gato) đúng đắn (sammā), đã thực hành (paṭipanno) con đường dẫn đến sự diệt tận của thế gian (lokanirodhagāminiṃ paṭipadaṃ) bằng sự thấu hiểu sự tu tập (bhāvanābhisamayavasena).
Tathā yaṃ imassa sadevakassa lokassa diṭṭhaṃ sutaṃ mutaṃ viññātaṃ pattaṃ pariyesitaṃ ñātaṃ anuvicaritaṃ manasā, sabbaṃ taṃ hatthatale āmalakaṃ viya sammā paccakkhato gato abbhaññāsīti sugato.
Similarly, all that is seen, heard, sensed, cognized, attained, sought, known, and thoroughly investigated by the mind in this world with its deities—all that he has perfectly realized as if it were an amalaka fruit in the palm of his hand; thus, he is Sugata.
Tương tự, Sugata là người đã đi (gato) đúng đắn (sammā), đã hiểu rõ (abbhaññāsī) tất cả những gì thế gian này cùng với chư thiên đã thấy, nghe, cảm nhận, nhận thức, đạt được, tìm kiếm, biết và suy xét bằng ý, như quả āmalaka trong lòng bàn tay.
Idāni lokavidūti imassa atthaṃ pakāsento āha ‘‘sabbathā viditalokattā’’tiādi.
Now, explaining the meaning of "knower of the world" (lokavidū), he says "because he has known the world in every way" and so forth.
Bây giờ, để làm sáng tỏ ý nghĩa của từ lokavidū (bậc hiểu biết thế gian), Ngài nói: "sabbathā viditalokattā" (vì đã biết thế gian bằng mọi cách) v.v.
Tattha sabbathāti sabbappakārena, yo yo loko yena yena pakārena veditabbo, tena tena pakārenāti attho.
Here, "in every way" (sabbathā) means in all aspects, that is, in whatever way each world is to be known, in that very way.
Trong đó, sabbathā (bằng mọi cách) có nghĩa là bằng mọi phương cách, tức là bằng mọi phương cách mà thế gian cần được biết.
Te pana pakāre dassetuṃ ‘‘sabhāvato’’tiādi vuttaṃ.
To show those aspects, "by way of its nature" (sabhāvato) and so forth were stated.
Để chỉ ra những phương cách đó, Ngài đã nói "sabhāvato" (từ bản chất) v.v.
Tattha sabhāvatoti dukkhasabhāvato.
Here, "by way of its nature" (sabhāvato) means by way of the nature of suffering.
Trong đó, sabhāvato (từ bản chất) có nghĩa là từ bản chất khổ.
Sabbo hi loko dukkhasabhāvo.
For the entire world is of the nature of suffering.
Toàn bộ thế gian đều có bản chất khổ.
Yathāha ‘‘saṃkhittena pañcupādānakkhandhā dukkhā’’ti.
As it is said: "In brief, the five aggregates of clinging are suffering."
Như đã nói: "Tóm lại, năm uẩn chấp thủ là khổ."
Samudayatoti yato samudeti, tato taṇhādito.
"By way of its origin" (samudayato) means from where it originates, that is, from craving and so forth.
Samudayato (từ sự tập khởi) có nghĩa là từ nơi nó tập khởi, tức là từ ái v.v.
Nirodhatoti yattha so nirujjhati, tato visaṅkhārato.
"By way of its cessation" (nirodhato) means where it ceases, that is, from the unconditioned (visaṅkhāra).
Nirodhato (từ sự diệt tận) có nghĩa là nơi nó diệt tận, tức là từ sự ly dục (visaṅkhāra).
Nirodhūpāyatoti yena vidhinā so nirodho pattabbo, tato ariyamaggato ito aññassa pakārassa abhāvā.
"By way of the means to its cessation" (nirodhūpāyato) means by which method that cessation is to be attained, that is, from the Noble Eightfold Path, as there is no other aspect.
Nirodhūpāyato (từ phương tiện diệt tận) có nghĩa là bằng phương pháp mà sự diệt tận đó được đạt đến, tức là từ Bát Chánh Đạo, vì không có phương cách nào khác.
Iti ‘‘sabbathā lokaṃ avedī’’ti vatvā tadatthasādhakaṃ suttaṃ dassento ‘‘yattha kho, āvuso’’tiādimāha.
Thus, having said, "He has known the world in every way," he then cites a Sutta to confirm this meaning, saying "where, friend" and so forth.
Như vậy, sau khi nói "Ngài đã biết thế gian bằng mọi cách", để chỉ ra kinh điển xác nhận ý nghĩa đó, Ngài nói: "yattha kho, āvuso" (này chư hiền) v.v.
Idañca suttaṃ ‘‘yattha kho, bhante, na jāyati…pe… na upapajjati, sakkā nu kho so, bhante, gamanena lokassa anto ñātuṃ vā daṭṭhuṃ vā pāpuṇituṃ vā’’ti (saṃ. ni. 1.107; a. ni. 4.45) okāsalokassa gatiṃ sandhāya rohitadevaputtena puṭṭho bhagavā abhāsi.
This Sutta was spoken by the Fortunate One when questioned by the devaputta Rohita concerning the destination of the world of space: "Where, Venerable Sir, one is not born... nor passes away, nor reappears—is it possible, Venerable Sir, by going to know or see or reach the end of the world?"
Kinh này được Đức Thế Tôn thuyết giảng khi được thiên tử Rohitassa hỏi về sự đi của thế gian không gian: "Bạch Thế Tôn, nơi nào không sinh… v.v. … không tái sinh, bạch Thế Tôn, có thể nào bằng sự đi mà biết, thấy hay đạt đến tận cùng của thế gian đó không?"
Tattha na jāyatītiādinā ujukaṃ jātiādīni paṭikkhipitvā na cavati na upapajjatīti padadvayena aparāparaṃ cavanupapatanāni paṭikkhipati.
Here, by directly denying birth and so forth with "is not born" and so forth, he denies successive passing away and reappearing with the two phrases "does not pass away, does not reappear".
Trong đó, na jāyati (không sinh) v.v. trực tiếp phủ nhận sự sinh v.v., và bằng hai từ na cavati na upapajjati (không chết không tái sinh) phủ nhận sự chết và tái sinh liên tục.
Keci pana ‘‘na jāyatītiādi gabbhaseyyakādivasena vuttaṃ, itaraṃ opapātikavasenā’’ti vadanti.
Some say that "is not born" and so forth refers to birth in a womb and so forth, while the other refers to spontaneous birth.
Một số người nói rằng "na jāyati v.v. được nói theo nghĩa sinh trong thai v.v., còn cái kia là theo nghĩa hóa sinh."
Tanti jātiādirahitaṃ.
"That" (taṃ) refers to that which is devoid of birth and so forth.
Taṃ (điều đó) là điều không có sinh v.v.
Gamanenāti padasā gamanena.
"By going" (gamanena) means by walking on foot.
Gamanena (bằng sự đi) là bằng sự đi bộ.
Lokassantanti saṅkhāralokassa antabhūtaṃ nibbānaṃ.
"The end of the world" (lokassantaṃ) refers to Nibbāna, which is the end of the world of formations.
Lokassanta (tận cùng của thế gian) là Niết Bàn, là phần cuối của thế gian hành.
Ñāteyyanti jānitabbaṃ.
"To be known" (ñāteyyaṃ) means to be understood.
Ñāteyya (nên biết) là điều cần phải biết.
Daṭṭheyyanti daṭṭhabbaṃ.
"To be seen" (daṭṭheyyaṃ) means to be observed.
Daṭṭheyya (nên thấy) là điều cần phải thấy.
Patteyyanti pattabbaṃ.
"To be attained" (patteyyaṃ) means to be reached.
Patteyya (nên đạt) là điều cần phải đạt.
‘‘Ñātāyaṃ diṭṭhāyaṃ pattāya’’nti vā pāṭho, tattha gamanena lokassantaṃ ñātā ayaṃ diṭṭhā ayaṃ pattā ayanti na vadāmīti attho.
Alternatively, the reading might be "This is known, this is seen, this is attained." In that case, the meaning is: "I do not say that this end of the world is known, seen, or attained by going."
Hoặc là bài đọc "Ñātāyaṃ diṭṭhāyaṃ pattāyaṃ", trong đó có nghĩa là "Tôi không nói rằng tận cùng của thế gian này đã được biết, đã được thấy, đã được đạt đến bằng sự đi."
Ayanti nibbānatthiko.
"This" (ayaṃ) refers to one who seeks Nibbāna.
Ayaṃ (người này) là người tìm cầu Niết Bàn.
Kāmaṃ padasā gamanena gantvā lokassantaṃ ñātuṃ daṭṭhuṃ pattuṃ vā na sakkā, api ca parimitaparicchinnaṭṭhāne taṃ paññāpetvā dassemīti dassento ‘‘api cā’’tiādimāha.
Though it is not possible to know, see, or attain the end of the world by walking on foot, he shows that he can point it out and present it within a limited, confined space, saying "Nevertheless" (api cā) and so forth.
Mặc dù không thể bằng sự đi bộ mà đi đến, biết, thấy hay đạt đến tận cùng của thế gian, nhưng để chỉ ra rằng Ngài có thể tuyên bố và chỉ cho thấy điều đó ở một nơi có giới hạn và được xác định, Ngài nói: "api cā" (tuy nhiên) v.v.
Tattha byāmamatte kaḷevareti byāmappamāṇe attabhāve.
Here, "in this fathom-long body" (byāmamatte kaḷevare) means in one's own body of a fathom's length.
Trong đó, byāmamatte kaḷevare (trong thân thể một sải tay) là trong thân thể có kích thước một sải tay.
Iminā rūpakkhandhaṃ dasseti.
By this, he indicates the aggregate of form.
Bằng điều này, Ngài chỉ ra sắc uẩn.
Sasaññimhīti saññāya sahite.
"With perception" (sasaññimhī) means endowed with perception.
Sasaññimhī (cùng với tưởng) có nghĩa là cùng với tưởng.
Iminā saññāsīsena vedanādayo tayo khandhe dasseti saññāsahitattā eva.
By this, he indicates the three aggregates—feeling, and so forth—because they are associated with perception.
Bằng điều này, Ngài chỉ ra ba uẩn còn lại là thọ, hành và thức, vì chúng đều đi kèm với tưởng.
Samanaketi saviññāṇaketi attho.
"With mind" (samanake) means with consciousness.
Samanake (cùng với ý) có nghĩa là cùng với thức.
Iminā viññāṇakkhandhaṃ dasseti, aviññāṇake pana utusamuṭṭhānarūpasamudāyamatte paññāpetuṃ na sakkāti adhippāyo.
By this, he indicates the aggregate of consciousness, the intention being that it is not possible to point it out in a mere collection of inanimate form arising from physical conditions.
Bằng điều này, Ngài chỉ ra thức uẩn, và ý nghĩa là không thể tuyên bố điều đó chỉ trong một tập hợp sắc pháp do thời tiết sinh ra mà không có thức.
Lokanti khandhādilokaṃ.
"The world" (lokaṃ) refers to the world of aggregates and so forth.
Loka (thế gian) là thế gian uẩn v.v.
Lokanirodhanti tassa lokassa nirujjhanaṃ nibbānameva vā.
"The cessation of the world" (lokanirodhaṃ) refers to the cessation of that world, or simply Nibbāna itself.
Lokanirodha (sự diệt tận của thế gian) là sự diệt tận của thế gian đó, hoặc chính là Niết Bàn.
Nibbānampi hi khandhe paṭicca paññāpanato sarīrasmiṃyeva paññāpeti.
For Nibbāna too, being pointed out in dependence on the aggregates, is pointed out within the body itself.
Ngay cả Niết Bàn cũng được tuyên bố dựa trên các uẩn, vì vậy Ngài tuyên bố nó ngay trong thân thể.
Adesampi hi taṃ yesaṃ nirodho, tesaṃ vasena desatopi upacāravasena niddisīyati yathā ‘‘cakkhuṃ loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā pahīyamānā pahīyati, ettha nirujjhamānā nirujjhatī’’ti (dī. ni. 2.401; ma. ni. 1.134; vibha. 204).
Even though it is placeless, it is referred to by way of location metaphorically, through the cessation of those to whom it pertains, as in "The eye is lovely and agreeable in the world; there this craving, being abandoned, is abandoned; there, being ceased, it ceases."
Mặc dù Niết Bàn không có nơi chốn, nhưng nó được chỉ định một cách ẩn dụ như có nơi chốn dựa trên những người mà sự diệt tận của họ xảy ra, ví dụ như: "Mắt là một hình ảnh đáng yêu, dễ chịu trong thế gian. Ở đây, ái đó được đoạn trừ, ở đây nó diệt tận."
Gamanenāti pākatikagamanena.
"By going" (gamanena) means by ordinary going.
Gamanena (bằng sự đi) là bằng sự đi thông thường.
Lokassantoti saṅkhāralokassa anto antakiriyāya hetubhūtaṃ nibbānaṃ.
"The end of the world" (lokassanto) refers to Nibbāna, which is the end of the world of formations and the cause of its cessation.
Lokassanto (tận cùng của thế gian) là Niết Bàn, là sự chấm dứt của thế gian hành, là nguyên nhân của sự chấm dứt.
Kudācananti kadācipi.
"Never" (kudācanaṃ) means at any time.
Kudācana (bất cứ lúc nào) là bất cứ khi nào.
Appatvāti aggamaggena anadhigantvā.
"Without having reached" (appatvā) means without having attained by the supreme path.
Appatvā (chưa đạt được) là chưa đạt được bằng đạo tối thượng.
Pamocananti pamutti nissaraṇaṃ.
"Liberation" (pamocanaṃ) means release, escape.
Pamocana (sự giải thoát) là sự giải thoát, sự thoát ly.
Tasmāti yasmā lokantaṃ appatvā vaṭṭadukkhato mutti natthi, tasmā.
"Therefore" (tasmā) means because there is no liberation from the suffering of saṃsāra without reaching the end of the world.
Tasmā (do đó) là vì chưa đạt đến tận cùng của thế gian thì không có sự giải thoát khỏi khổ luân hồi, do đó.
Haveti nipātamattaṃ.
"Indeed" (have) is merely a particle.
Have là một giới từ.
Lokavidūti sabhāvādito sabbaṃ lokaṃ vijānanto.
Knower of the world means knowing the entire world from its intrinsic nature and so on.
Bậc Tri Thế là người biết tất cả thế gian theo bản chất của nó.
Sumedhoti sundarapañño.
Of good wisdom means of excellent wisdom.
Bậc Thiện Tuệ là người có trí tuệ tốt đẹp.
Lokantagūti pariññābhisamayena lokaṃ viditvā pahānābhisamayena lokantagū.
Gone to the end of the world means, having known the world through the full understanding of comprehension, he has gone to the end of the world through the full understanding of abandonment.
Bậc Đến Cùng Khổ là người sau khi đã biết thế gian bằng sự thấu hiểu toàn diện, đã đến tận cùng thế gian bằng sự thấu hiểu đoạn trừ.
Maggabrahmacariyassa pariniṭṭhitattā vusitabrahmacariyo.
Because the noble life of the path is fully accomplished, he has lived the noble life.
Vì Phạm hạnh đạo đã hoàn thành nên Phạm hạnh đã thành.
Sabbesaṃ kilesānaṃ samitattā catusaccadhammānaṃ vā abhisamitattā samitāvī.
Due to the calming of all defilements or due to the full understanding of the dhammas of the Four Truths, he is samitāvī.
Vì tất cả các phiền não đã lắng dịu, hoặc vì các pháp Tứ Thánh Đế đã được thấu hiểu nên Bậc An Tịnh.
Nāsīsatīti na pattheti, yathā imaṃ lokaṃ, evaṃ parañca lokaṃ nāsīsati appaṭisandhikattā.
‘Nāsīsati’ means he does not long for. Just as he does not long for this world, so too he does not long for the next world, due to having no relinking.
Không mong cầu nghĩa là không khao khát; như thế nào đối với thế gian này, cũng như đối với thế gian khác, vị ấy không mong cầu vì không còn tái sanh.
Evaṃ yadipi lokavidutā anavasesato dassitā sabhāvādito dassitattā, loko pana ekadeseneva vuttoti taṃ anavasesato dassetuṃ ‘‘api ca tayo lokā’’tiādi vuttaṃ.
In this way, although the quality of being a knower of the world was shown without remainder by showing it from the perspective of its intrinsic nature, because the world was spoken of only in part, in order to show it without remainder, “Furthermore, there are three worlds,” etc., was said.
Như vậy, mặc dù sự tri thế đã được trình bày không sót lại gì theo phương thức bản chất, nhưng thế gian chỉ được nói đến một phần, nên để trình bày không sót lại gì điều đó, câu “hơn nữa, ba thế gian” v.v. đã được nói đến.
Tattha indriyabaddhānaṃ khandhānaṃ samūho santāno ca sattaloko.
Therein, the collection and continuum of the aggregates connected with the faculties is the world of beings.
Trong đó, sự tập hợp của các uẩn và dòng tương tục của các căn là thế gian chúng sanh.
Rūpādīsu sattavisattatāya satto, lokīyati ettha kusalākusalaṃ tabbipāko cāti loko.
A being is attached or clings to form and so on; in it, wholesome and unwholesome karma and their results are experienced, thus it is a world.
Chúng sanh là vì bị chấp thủ vào sắc v.v., thế gian là vì thiện, bất thiện và quả báo của chúng được biết đến ở đây.
Anindriyabaddhānaṃ rūpādīnaṃ samūho santāno ca okāsaloko lokīyanti ettha jaṅgamā thāvarā ca tesañca okāsabhūtoti katvā.
The collection and continuum of form and so on not connected with the faculties is the spatial world, because in it moving and stationary things are experienced and because it is the location for them.
Sự tập hợp của sắc v.v. và dòng tương tục của những thứ không bị chấp thủ vào các căn là thế gian không gian vì các loài động vật và thực vật được biết đến ở đây, và vì nó là cơ sở cho chúng.
Tadādhāratāya hesa ‘‘bhājanaloko’’tipi vuccati.
Because it is their container, it is also called the "receptacle world."
Vì là cơ sở cho điều đó, nó cũng được gọi là “thế gian bình chứa”.
Ubhayepi khandhā saṅkhāraloko paccayehi saṅkharīyanti lujjanti palujjanti cāti.
Both sets of aggregates are the world of formations, because they are formed by conditions and they crumble and perish.
Cả hai uẩn đều là thế gian hành vì chúng được tạo tác bởi các duyên, và chúng tan rã, hoại diệt.
Āhāraṭṭhitikāti paccayaṭṭhitikā, paccayāyattavuttikāti attho.
Sustained by nutriment means sustained by conditions; the meaning is that their existence depends on conditions.
Duy trì bằng thức ăn nghĩa là duy trì bằng các duyên, nghĩa là có sự tồn tại phụ thuộc vào các duyên.
Paccayattho hettha āhārasaddo ‘‘ayamāhāro anuppannassa vā kāmacchandassa uppādāyā’’tiādīsu (saṃ. ni. 5.232) viya.
Here, the word 'nutriment' has the meaning of 'condition', as in such passages as "this nutriment is for the arising of unarisen sensual desire."
Ở đây, từ “thức ăn” có nghĩa là duyên, như trong “thức ăn này là để làm phát sinh dục tham chưa sanh” v.v. (Tương Ưng Bộ, tập 5, trang 232).
Evañhi ‘‘sabbe sattā’’ti iminā asaññasattāpi pariggahitā honti.
For in this way, by the phrase "all beings," even non-percipient beings are included.
Như thế, với câu “tất cả chúng sanh”, ngay cả các chúng sanh vô tưởng cũng được bao gồm.
Sā panāyaṃ āhāraṭṭhitikatā nippariyāyato saṅkhāradhammo, na sattadhammoti āha ‘‘āhāraṭṭhitikāti āgataṭṭhāne saṅkhāraloko veditabbo’’ti.
However, this quality of being sustained by nutriment is, in the ultimate sense, a property of formations, not a property of a being; thus he said, “Where it says ‘sustained by nutriment,’ the world of formations should be understood.”
Tuy nhiên, sự duy trì bằng thức ăn này, một cách trực tiếp, là pháp hành, không phải pháp chúng sanh, nên đã nói “ở chỗ có câu ‘duy trì bằng thức ăn’, cần phải hiểu là thế gian hành”.
Yadi evaṃ ‘‘sabbe sattā’’ti idaṃ kathanti?
If so, how is the phrase "all beings" to be understood?
Nếu vậy, câu “tất cả chúng sanh” này thì sao?
Puggalādhiṭṭhānadesanāti nāyaṃ doso.
This is not a fault, as it is a teaching based on the individual.
Đây không phải là lỗi vì đây là sự thuyết giảng dựa trên giả định về cá nhân.
Kasmā pana bhagavā katthaci puggalādhiṭṭhānaṃ katvā dhammaṃ deseti, katthaci dhammādhiṭṭhānaṃ katvā dhammaṃ desetīti?
But why does the Blessed One sometimes teach the Dhamma based on the individual, and sometimes teach the Dhamma based on its phenomena?
Tại sao Thế Tôn đôi khi thuyết giảng giáo pháp dựa trên giả định về cá nhân, đôi khi lại thuyết giảng giáo pháp dựa trên giả định về các pháp?
Desanāvilāsato veneyyajjhāsayato ca.
Due to the beauty of the teaching and the disposition of those to be trained.
Do sự đa dạng trong cách thuyết giảng và do khuynh hướng của người được giáo hóa.
Desanāvilāsappattā hi buddhā bhagavanto, te yathāruci katthaci puggalādhiṭṭhānaṃ katvā katthaci dhammādhiṭṭhānaṃ katvā dhammaṃ desenti.
For the Buddhas, the Blessed Ones, have attained beauty in their teaching; they teach the Dhamma as they wish, sometimes based on the individual, sometimes based on its phenomena.
Vì các vị Phật, Thế Tôn đạt đến sự đa dạng trong cách thuyết giảng, các Ngài tùy thích thuyết giảng giáo pháp đôi khi dựa trên giả định về cá nhân, đôi khi dựa trên giả định về các pháp.
Ye vā pana veneyyā sāsanakkamaṃ anotiṇṇā, tesaṃ puggalādhiṭṭhānaṃ desanaṃ desenti.
Or, for those to be trained who have not yet entered the way of the Teaching, he gives a teaching based on the individual.
Và đối với những người được giáo hóa chưa thâm nhập vào giáo pháp, Ngài thuyết giảng giáo pháp dựa trên giả định về cá nhân.
Ye ca otiṇṇā, tesaṃ dhammādhiṭṭhānaṃ.
And for those who have entered, he gives one based on its phenomena.
Đối với những người đã thâm nhập, Ngài thuyết giảng dựa trên giả định về các pháp.
Sammutisaccavisayā puggalādhiṭṭhānā desanā, itarā paramatthasaccavisayā.
A teaching based on the individual is in the domain of conventional truth; the other is in the domain of ultimate truth.
Sự thuyết giảng dựa trên giả định về cá nhân thuộc về chân lý tương đối; sự thuyết giảng kia thuộc về chân lý tối hậu.
Purimā karuṇānukūlā, itarā paññānukūlā.
The former is conducive to compassion; the other is conducive to wisdom.
Sự thuyết giảng trước phù hợp với lòng từ bi; sự thuyết giảng kia phù hợp với trí tuệ.
Saddhānusārīgottānaṃ vā purimā.
Or, the former is for those of the lineage of faith-followers.
Hoặc sự thuyết giảng trước dành cho những người có chủng tánh theo tín.
Te hi puggalappamāṇikā, pacchimā dhammānusārīgottānaṃ.
For they take the individual as their measure; the latter is for those of the lineage of Dhamma-followers.
Vì họ lấy cá nhân làm thước đo; sự thuyết giảng sau dành cho những người có chủng tánh theo pháp.
Saddhācaritatāya vā lokādhipatīnaṃ vasena puggalādhiṭṭhānā, paññācaritatāya dhammādhipatīnaṃ vasena dhammādhiṭṭhānā.
Or, for those of a faithful temperament with the world as their sovereign, the teaching is based on the individual; for those of a wise temperament with the Dhamma as their sovereign, it is based on its phenomena.
Hoặc sự thuyết giảng dựa trên giả định về cá nhân là do những người có lòng tin làm chủ; sự thuyết giảng dựa trên giả định về các pháp là do những người có trí tuệ làm chủ.
Purimā ca neyyatthā, pacchimā nītatthā.
And the former requires interpretation; the latter is of explicit meaning.
Và sự thuyết giảng trước là cần giải thích, sự thuyết giảng sau là đã được giải thích.
Iti bhagavā taṃ taṃ visesaṃ apekkhitvā tattha tattha duvidhaṃ desanaṃ desetīti veditabbaṃ.
Thus it should be understood that the Blessed One, with regard to each particular distinction, gives a twofold teaching in each case.
Như vậy, cần phải hiểu rằng Thế Tôn, tùy theo từng đặc điểm, đã thuyết giảng hai loại giáo pháp ở những nơi khác nhau.
Diṭṭhigatikānaṃ sassatādivasena ‘‘attā loko’’ti parikappanā yebhuyyena sattavisayā, na saṅkhāravisayāti āha ‘‘sassato lokoti vā asassato lokoti vāti āgataṭṭhāne sattaloko veditabbo’’ti.
For those holding speculative views, the assumption "the self is the world," etc., in terms of eternalism and so on, is mostly concerned with beings, not with formations; thus he said, “Where it says ‘the world is eternal,’ or ‘the world is not eternal,’ the world of beings should be understood.”
Sự suy đoán của những người theo tà kiến, như “thế gian là thường còn” hay “thế gian là vô thường” v.v., chủ yếu liên quan đến chúng sanh, không phải đến các hành, nên đã nói “ở chỗ có câu ‘thế gian là thường còn hay thế gian là vô thường’ v.v., cần phải hiểu là thế gian chúng sanh”.
Yāvatā candimasūriyā pariharantīti yattake ṭhāne candimasūriyā parivattanti paribbhamanti.
As far as the sun and moon revolve means in whatever space the sun and moon revolve and wander.
Chừng nào mặt trăng và mặt trời còn chuyển động nghĩa là trong phạm vi mà mặt trăng và mặt trời còn xoay vần, còn chuyển động.
Disā bhanti virocamānāti tesaṃ paribbhamaneneva tā tā disā pabhassarā hutvā virocanti.
Shining, they illuminate the directions means that by their very revolving, those various directions become radiant and shine.
Các phương hướng tỏa sáng rực rỡ nghĩa là do sự chuyển động của chúng mà các phương hướng đó trở nên rực rỡ và tỏa sáng.
Atha vā disāti upayogabahuvacanaṃ, tasmā sayaṃ virocamānā candimasūriyā yattakā disā bhanti sobhenti obhāsayantīti attho.
Alternatively, directions is a plural of application; therefore, the meaning is that the sun and moon, shining themselves, make radiant, illuminate, as many directions as there are.
Hoặc các phương hướng là số nhiều của dụng cách, do đó, mặt trăng và mặt trời tự mình tỏa sáng, chừng nào các phương hướng tỏa sáng, rực rỡ, chiếu rọi.
Tāva sahassadhā lokoti tattakena pamāṇena sahassappakāro okāsaloko, sahassalokadhātuyoti attho.
So far is the thousandfold world means that the spatial world is of a thousand kinds by that measure; the meaning is a thousand-world-system.
Thế gian có ngàn phần như vậy nghĩa là thế gian không gian có ngàn loại với kích thước như vậy, nghĩa là ngàn thế giới.
‘‘Tāvasahassavā’’ti vā pāṭho, tāva tattakaṃ sahassaṃ assa atthīti tāvasahassavā.
Or the reading may be “tāvasahassavā”; it has that many thousands, thus “tāvasahassavā.”
Hoặc là đọc “có ngàn phần như vậy”, nghĩa là có ngàn phần như vậy.
Etthāti sahassalokadhātusaṅkhāte loke.
Therein means in the world described as a thousand-world-system.
Ở đây nghĩa là trong thế gian được gọi là ngàn thế giới.
Tampīti tividhampi lokaṃ.
That too means all three kinds of world.
Điều đó nghĩa là cả ba loại thế gian.
Sabbathā avedīti sabbappakārato paṭivijjhi.
He knew it in every way means he penetrated it in all its aspects.
Đã biết rõ mọi phương diện nghĩa là đã thấu hiểu mọi phương diện.
Kathaṃ paṭivijjhīti āha ‘‘tathā hī’’tiādi.
To show how he penetrated it, he said, “For so it is,” etc.
Làm sao đã thấu hiểu? Đã nói “thật vậy” v.v.
Tathā hissāti imassa ‘‘sabbathā vidito’’ti etena sambandho.
“For so to him” is connected with "was known in every way."
Thật vậy, của Ngài liên hệ với câu “đã biết rõ mọi phương diện”.
Assāti anena bhagavatā.
To him means by this Blessed One.
Của Ngài là bởi Đức Thế Tôn.
Eko loko sabbe sattā āhāraṭṭhitikāti yāya puggalādhiṭṭhānāya kathāya sabbesaṃ saṅkhārānaṃ paccayāyattavuttitā vuttā, tāya sabbo saṅkhāraloko ekavidho pakārantarassa abhāvato.
One world: all beings are sustained by nutriment means that by this teaching based on the individual, wherein the dependence of all formations on conditions was stated, the entire world of formations is of one kind, because there is no other kind.
Một thế gian là tất cả chúng sanh duy trì bằng thức ăn nghĩa là bằng lời thuyết giảng dựa trên giả định về cá nhân mà sự tồn tại phụ thuộc vào duyên của tất cả các hành đã được nói đến, do đó, tất cả thế gian hành là một loại vì không có loại khác.
Dve lokātiādīsupi imināva nayena attho veditabbo.
Two worlds, etc., is also to be understood in this same way.
Trong các câu “hai thế gian” v.v. cũng cần phải hiểu ý nghĩa theo cách này.
Nāmaggahaṇena cettha nibbānassa aggahaṇaṃ tassa alokasabhāvattā.
And here, Nibbāna is not included in the mention of name, because it does not have the nature of a world.
Ở đây, Niết Bàn không được bao gồm trong tên gọi vì nó không có bản chất của thế gian.
Nanu ca ‘‘āhāraṭṭhitikā’’ti ettha paccayāyattavuttitāya maggaphaladhammānampi lokatā āpajjatīti?
But is it not the case that in the phrase "sustained by nutriment," due to their dependence on conditions, even the dhammas of the path and fruit would fall into the category of 'world'?
Há chẳng phải ở chỗ “duy trì bằng thức ăn” thì các pháp đạo và quả cũng trở thành thế gian do sự tồn tại phụ thuộc vào duyên sao?
Nāpajjati pariññeyyānaṃ dukkhasaccadhammānaṃ idha lokoti adhippetattā.
They do not, because what is meant here by 'world' are the dhammas of the truth of suffering, which are to be fully understood.
Không phải vậy, vì ở đây, thế gian được hiểu là các pháp khổ đế cần phải được thấu hiểu.
Atha vā na lujjati na palujjatīti yo gahito tathā na hoti, so lokoti taṃgahaṇarahitānaṃ lokuttarānaṃ natthi lokatā.
Alternatively, that which is grasped as 'does not crumble, does not perish' is not so; that is the world. For the supramundane states, which are free from that grasping, there is no 'world-ness'.
Hoặc là, cái được chấp thủ là “không tan rã, không hoại diệt” nhưng lại không phải như vậy, thì đó là thế gian; do đó, các pháp siêu thế không có tính thế gian vì chúng không bị chấp thủ như vậy.
Tisso vedanāti sukhadukkhaupekkhāvasena.
Three feelings means in terms of pleasure, pain, and neutral feeling.
Ba thọ là thọ lạc, thọ khổ và thọ xả.
Cattāro āhārāti kabaḷīkārāhāro phassāhāro manosañcetanāhāro viññāṇāhāroti cattāro āhārā.
Four nutriments means the four nutriments: physical food, contact, mental volition, and consciousness.
Bốn thức ăn là bốn thức ăn: đoàn thực, xúc thực, tư niệm thực, thức thực.
Tattha kabaḷīkārāhāro ojaṭṭhamakaṃ rūpaṃ āharatīti āhāro.
Therein, physical food is a nutriment because it brings forth the eightfold material group with nutritive essence.
Trong đó, đoàn thực là thức ăn vì nó mang lại sắc có tám yếu tố là chất bổ dưỡng.
Phasso tisso vedanā āharatīti āhāro.
Contact is a nutriment because it brings forth the three feelings.
Xúc là thức ăn vì nó mang lại ba thọ.
Manosañcetanā tīsu bhavesu paṭisandhiṃ āharatīti āhāro.
Mental volition is a nutriment because it brings forth rebirth in the three realms of existence.
Tư niệm là thức ăn vì nó mang lại sự tái sanh trong ba cõi.
Viññāṇaṃ paṭisandhikkhaṇe nāmarūpaṃ āharatīti āhāro.
Consciousness is a nutriment because it brings forth name-and-form at the moment of relinking.
Thức là thức ăn vì nó mang lại danh sắc vào khoảnh khắc tái sanh.
Upādānānaṃ ārammaṇabhūtā khandhā upādānakkhandhā.
The aggregates that are the objects of clinging are the clinging-aggregates.
Các uẩn là đối tượng của sự chấp thủ là các thủ uẩn.
Cha ajjhattikāni āyatanānīti cakkhāyatanādimanāyatanapariyantāni.
Six internal sense-bases means from the eye-base up to the mind-base.
Sáu nội xứ là từ nhãn xứ cho đến ý xứ.
Satta viññāṇaṭṭhitiyoti nānattakāyā nānattasaññino, nānattakāyā ekattasaññino, ekattakāyā nānattasaññino, ekattakāyā ekattasaññino, heṭṭhimā ca tayo āruppāti imā satta ‘‘viññāṇaṃ tiṭṭhati etthāti viññāṇaṭṭhitiyo’’ti vuccanti.
Seven stations of consciousness refers to: those with diverse bodies and diverse perceptions, those with diverse bodies and uniform perception, those with uniform bodies and diverse perceptions, those with uniform bodies and uniform perception, and the lower three formless states. These seven are called "stations of consciousness" because consciousness is stationed in them.
Bảy thức trú là những chúng sanh có thân khác nhau và tưởng khác nhau, có thân khác nhau và tưởng đồng nhất, có thân đồng nhất và tưởng khác nhau, có thân đồng nhất và tưởng đồng nhất, và ba cõi vô sắc giới dưới; bảy điều này được gọi là “thức trú” vì thức tồn tại ở đó.
Tattha nānattaṃ kāyo etesaṃ, nānatto vā kāyo etesanti nānattakāyā, nānattasaññā etesaṃ atthīti nānattasaññino.
Therein, 'diverse bodies' means those whose body is diverse, or they have diverse bodies; 'diverse perceptions' means they have diverse perceptions.
Trong đó, thân của những chúng sanh này khác nhau, hoặc thân của những chúng sanh này khác nhau là nānattakāyā (thân khác nhau), tưởng của những chúng sanh này có là nānattasaññino (tưởng khác nhau).
Iminā nayena sesapadesupi attho veditabbo.
The meaning in the remaining phrases should be understood in this way.
Theo cách này, ý nghĩa cũng cần được hiểu trong các phần còn lại.
Sabbe manussā (dī. ni. aṭṭha. 2.127; a. ni. aṭṭha. 3.7.44-45) chakāmāvacarā ca devā ekacce ca vinipātikā ‘‘nānattakāyā nānattasaññino’’ti vuccanti.
All human beings, the six classes of devas in the sense-sphere, and some of the beings in a state of loss are called "those with diverse bodies and diverse perceptions."
Tất cả loài người và chư thiên sáu cõi dục giới, và một số loài đọa xứ được gọi là “thân khác nhau, tưởng khác nhau”.
Aparimāṇesu hi cakkavāḷesu aparimāṇānaṃ manussānaṃ vaṇṇasaṇṭhānādivasena dvepi ekasadisā natthi.
For among the countless human beings in the countless world-systems, there are not even two who are identical in terms of complexion, form, and so on.
Trong vô số cõi luân hồi, không có hai người nào giống nhau về màu sắc, hình dáng v.v. của vô số người.
Yepi katthaci yamakabhātaro vaṇṇena vā saṇṭhānena vā ekasadisā honti, tesampi ālokitavilokitakathitahasitagamanaṭhānādīhi viseso hotiyeva, paṭisandhisaññā ca nesaṃ tihetukāpi duhetukāpi ahetukāpi hoti, tasmā sabbepi manussā nānattakāyā nānattasaññino.
Even those who are twin brothers, similar in color or form, still have differences in their looking, gazing, speaking, laughing, walking, standing, and so forth. Their rebirth-consciousness (paṭisandhi-saññā) can be with three roots (tihetuka), two roots (duhetuka), or rootless (ahetuka). Therefore, all human beings are diverse in body and diverse in perception.
Ngay cả những anh em sinh đôi ở một nơi nào đó, dù có màu da hay hình dáng giống hệt nhau, vẫn có sự khác biệt qua cách nhìn, cách ngó, cách nói, cách cười, cách đi, cách đứng. Và thức tái sanh của họ có thể là tam nhân, nhị nhân, hoặc vô nhân. Do đó, tất cả loài người đều có thân dị biệt, tưởng dị biệt.
Chakāmāvacaradevesu ca kesañci kāyo nīlo hoti, kesañci pītādivaṇṇo, paṭisandhisaññā ca nesaṃ duhetukāpi tihetukāpi hoti, tasmā tepi nānattakāyā nānattasaññino.
Among the devas of the six sense-sphere heavens, some have blue bodies, while others have yellow or other colors. Their rebirth-consciousness can be with two roots or three roots. Therefore, they too are diverse in body and diverse in perception.
Trong sáu cõi trời Dục giới, thân của một số vị có màu xanh, một số vị có màu vàng,... và thức tái sanh của họ có thể là nhị nhân hoặc tam nhân. Do đó, họ cũng có thân dị biệt, tưởng dị biệt.
Ekacce vinipātikā pana catuapāyavinimuttakā uttaramātā yakkhinī, piyaṅkaramātā, dhammaguttāti evamādayo daṭṭhabbā.
However, some of those who have fallen (vinipātika), though released from the four lower realms, should be understood as Uttaramātā the Yakkhiṇī, Piyaṅkaramātā, Dhammagutta, and others of their kind.
Một số chúng sanh đoạ lạc (vinipātika) đã thoát khỏi bốn đường ác, cần được hiểu là các vị như dạ-xoa-nữ Uttaramātā, Piyaṅkaramātā, Dhammaguttā.
Etesañhi odātakaāḷamaṅguracchavisāmavaṇṇādivasena ceva kisathūlarassadīghādivasena ca kāyo nānā hoti, manussānaṃ viya tihetukaduhetukāhetukavasena paṭisandhisaññāpi, te pana devā viya na mahesakkhā, kapaṇamanussā viya appesakkhā dullabhaghāsacchādanā dukkhapīḷitā viharanti, ekacce kāḷapakkhe dukkhitā juṇhapakkhe sukhitā honti, tasmā sukhasamussayato vinipatitattā sukhasamussayato vinipāto etesaṃ atthīti vinipātikāti vuttā satipi devabhāve dibbasampattiyā abhāvato.
Indeed, their bodies are diverse in terms of pale, dark, reddish-brown, dusky complexions, and also in being lean, stout, short, or tall, just like human beings. Their rebirth-consciousness (paṭisandhi-saññā) is also diverse, being with three roots, two roots, or rootless. But unlike devas, they are not greatly powerful; like impoverished humans, they are of little power, find food and clothing difficult to obtain, and live afflicted by suffering. Some are miserable during the dark half of the month and happy during the bright half. Therefore, because they have fallen from a collection of happiness, they are called vinipātika, meaning that they possess a fall from a collection of happiness, despite being devas and lacking divine attainment.
Thật vậy, thân của họ khác nhau do màu da trắng, đen, màu cá trê, màu sẫm,... và do hình dáng gầy, mập, thấp, cao,... Thức tái sanh của họ cũng khác nhau, có thể là tam nhân, nhị nhân, vô nhân như loài người. Tuy nhiên, họ không có đại oai lực như chư thiên, mà có ít oai lực như những người nghèo khổ, sống trong khổ đau, khó kiếm được thức ăn và y phục. Một số bị khổ vào hắc nguyệt và được an lạc vào bạch nguyệt. Do đó, vì đã rơi khỏi sự tích tập của an lạc, và vì có sự rơi khỏi sự tích tập của an lạc, nên họ được gọi là chúng sanh đoạ lạc (vinipātika), mặc dù đã có được thân chư thiên nhưng lại không có thiên sản.
Ye panettha tihetukā, tesaṃ dhammābhisamayopi hoti.
Among these, those who are tihetuka can also realize the Dhamma.
Trong số này, những vị nào là tam nhân thì cũng có thể chứng ngộ Chánh pháp.
Piyaṅkaramātā hi yakkhinī paccūsasamaye anuruddhattherassa dhammaṃ sajjhāyato sutvā –
For Piyaṅkaramātā the Yakkhiṇī, having heard the Elder Anuruddha reciting the Dhamma at dawn, said:
Dạ-xoa-nữ Piyaṅkaramātā, vào lúc rạng đông, khi nghe Trưởng lão Anuruddha tụng đọc Chánh pháp, đã –
Brahmapārisajjabrahmapurohitamahābrahmasaṅkhātā pana hīnamajjhimapaṇītabhedabhinnena paṭhamajjhānena nibbattā brahmakāyikā ceva catūsu apāyesu sattā ca ‘‘nānattakāyā ekattasaññino’’ti vuccanti.
However, the Brahmakāyika devas, namely the Brahmāparishādya, Brahmāpurohita, and Mahābrahmā, who are born from the first jhāna, differentiated into inferior, middling, and superior, as well as beings in the four lower realms, are called “diverse in body and unified in perception.”
Còn các chúng sanh thuộc cõi Phạm thiên được sanh ra bởi sơ thiền, phân chia theo các cấp độ hạ, trung, thượng, được gọi là Phạm Chúng thiên, Phạm Phụ thiên, và Đại Phạm, cùng với các chúng sanh trong bốn đường ác, được gọi là “thân dị biệt, tưởng đồng nhất.”
Etesu hi brahmakāyikesu brahmapurohitānaṃ kāyo brahmapārisajjehi pamāṇato vipulataro hoti, mahābrahmānaṃ kāyo pana brahmapurohitehipi pamāṇato vipulataro hoti.
Among these Brahmakāyika devas, the bodies of the Brahmāpurohitas are proportionally larger than those of the Brahmāparishādyas, and the bodies of the Mahābrahmās are proportionally larger than even those of the Brahmāpurohitas.
Trong số các Phạm thiên này, thân của các vị Phạm Phụ thiên về kích thước thì lớn hơn các vị Phạm Chúng thiên, còn thân của các vị Đại Phạm về kích thước thì lớn hơn cả các vị Phạm Phụ thiên.
Kāmañca nesaṃ pabhāvasenapi kāyo heṭṭhimaheṭṭhimehi uḷārataro hoti, taṃ pana idha appamāṇaṃ.
Although their bodies are also nobler than those below them in terms of splendor, that is not of primary importance here.
Mặc dù thân của họ cũng cao quý hơn các cõi thấp hơn về phương diện quang minh, nhưng điều đó ở đây không được kể đến.
Tathā hi parittābhādīnaṃ parittasubhādīnañca kāye satipi pabhāvematte ekattavaseneva vavatthapīyatīti ‘‘ekattakāyā’’tveva te vuccanti.
Indeed, even though the Parittābha and Parittasubhā devas, and so on, have bodies, they are categorized as “unified in body” merely on account of their splendor.
Thật vậy, mặc dù thân của các vị trời Quang Thiểu và Quang Âm có sự khác biệt về quang minh, nhưng vẫn được xác định là đồng nhất, nên họ được gọi là “thân đồng nhất”.
Evamime brahmakāyikā kāyassa nānattā paṭhamajjhānavipākavasena pana paṭisandhisaññāya ca ekattā nānattakāyā ekattasaññino.
Thus, these Brahmakāyika devas are diverse in body, but unified in rebirth-consciousness (paṭisandhi-saññā) due to the result of the first jhāna, hence “diverse in body and unified in perception.”
Như vậy, các Phạm thiên này, do thân có sự khác biệt và do thức tái sanh đồng nhất vì là quả của sơ thiền, nên là thân dị biệt, tưởng đồng nhất.
Yathā ca te, evaṃ catūsu apāyesu sattā.
And just as they are, so are the beings in the four lower realms.
Giống như họ, các chúng sanh trong bốn đường ác cũng vậy.
Nirayesu hi kesañci gāvutaṃ, kesañci aḍḍhayojanaṃ, kesañci yojanaṃ attabhāvo hoti, devadattassa pana yojanasatiko jāto.
In the hells, some have a body one gāvuta in height, some half a yojana, and some one yojana. Devadatta, however, was born with a body a hundred yojanas tall.
Trong các địa ngục, thân của một số chúng sanh cao một gāvuta, một số nửa do-tuần, một số một do-tuần, còn thân của Devadatta thì cao một trăm do-tuần.
Tiracchānesupi keci khuddakā, keci mahantā, pettivisayepi keci saṭṭhihatthā, keci asītihatthā honti, keci suvaṇṇā, keci dubbaṇṇā, tathā kālakañcikā asurā.
Among animals, some are small, some are large. In the realm of petas, some are sixty cubits tall, some eighty cubits; some are golden, some are of poor complexion; similarly, the Kāḷakañjika asuras.
Trong loài bàng sanh, một số thì nhỏ, một số thì lớn. Trong cõi ngạ quỷ, một số cao sáu mươi hắc-thủ, một số tám mươi hắc-thủ; một số có màu vàng, một số có màu xấu xí; các a-su-ra Kālakañcika cũng vậy.
Api cettha dīghapiṭṭhikapetā nāma saṭṭhiyojanikāpi honti, paṭisandhisaññā pana sabbesampi akusalavipākāhetukāva hoti.
Moreover, there are also long-backed petas who are sixty yojanas tall. But the rebirth-consciousness (paṭisandhi-saññā) of all of them is always the rootless result of unwholesome kamma.
Hơn nữa, trong đó có loài ngạ quỷ Dīghapiṭṭhika cao đến sáu mươi do-tuần, nhưng thức tái sanh của tất cả đều là quả bất thiện vô nhân.
Iti āpāyikāpi ‘‘nānattakāyā ekattasaññino’’tveva saṅkhyaṃ gacchanti.
Thus, the beings in the lower realms are also counted as “diverse in body and unified in perception.”
Do đó, các chúng sanh trong đường ác cũng được kể là “thân dị biệt, tưởng đồng nhất.”
Parittasubhā appamāṇasubhā subhakiṇhā pana tatiyajjhānabhūmikā ekattakāyā ekattasaññino.
The Parittasubhā, Appamāṇasubhā, and Subhakiṇhā devas of the third jhāna realm, however, are unified in body and unified in perception.
Còn các cõi thuộc tam thiền là Tịnh Thiểu thiên, Vô Lượng Tịnh thiên, Biến Tịnh thiên thì là thân đồng nhất, tưởng đồng nhất.
Tesaṃ vuttanayena kāyassa ceva catutthajjhānavipākavasena paṭisandhisaññāya ca ekattā.
This is due to the unity of their bodies, as stated, and the unity of their rebirth-consciousness (paṭisandhi-saññā) as the result of the fourth jhāna.
Vì thân của họ đồng nhất theo cách đã nói và thức tái sanh cũng đồng nhất do là quả của tứ thiền.
‘‘Vehapphalāpi imaṃyeva catutthaviññāṇaṭṭhitiṃ bhajanti kāyassa ceva pañcamajjhānavipākavasena paṭisandhisaññāya ca ekarūpattā.
The Vehapphala devas also inhabit this same fourth station of consciousness (viññāṇaṭṭhiti) due to the uniformity of their bodies and rebirth-consciousness (paṭisandhi-saññā) as the result of the fifth jhāna.
“Các vị trời Quảng Quả cũng thuộc về thức trú thứ tư này, vì thân và thức tái sanh của họ đồng nhất do là quả của ngũ thiền.
Suddhāvāsā pana apunarāvattanato vivaṭṭapakkhe ṭhitā, na sabbakālikā.
The Suddhāvāsa devas, however, do not return and stand on the side of liberation; they are not always present.
Còn các cõi Tịnh Cư, vì là bất lai nên thuộc về phe giải thoát, không phải luôn luôn có mặt.
Kappasatasahassampi asaṅkhyeyyampi buddhasuññe loke nuppajjanti, soḷasakappasahassabbhantare buddhesu uppajjantesuyeva uppajjanti, dhammacakkappavattissa bhagavato khandhāvāraṭṭhānasadisā honti, tasmā neva viññāṇaṭṭhitiṃ, na sattāvāsaṃ bhajantī’’ti vadanti.
They do not arise in worlds empty of Buddhas for a hundred thousand kalpas or even aeons; they arise only when Buddhas arise within sixteen thousand kalpas. They are like the encampment of the Blessed One who sets the Wheel of Dhamma in motion. Therefore, it is said that they do not inhabit a station of consciousness or a dwelling place for beings.
Họ không sanh ra trong thế giới trống không chư Phật dù một trăm ngàn kiếp hay vô số kiếp; họ chỉ sanh ra trong khoảng mười sáu ngàn kiếp khi có chư Phật xuất hiện, và họ giống như nơi đóng quân của Đức Thế Tôn khi Ngài chuyển Pháp luân. Do đó, họ không thuộc về thức trú, cũng không thuộc về chúng sanh trú,” có vị nói vậy.
Mahāsīvatthero pana ‘‘na kho pana so sāriputta āvāso sulabharūpo, yo mayā anāvuṭṭhapubbo iminā dīghena addhunā aññatra suddhāvāsehi devehī’’ti (ma. ni. 1.160) iminā suttena ‘‘suddhāvāsāpi catutthaviññāṇaṭṭhitiṃ catutthasattāvāsaṃ bhajantī’’ti vadati, taṃ appaṭibāhiyattā suttassa anuññātaṃ.
However, the Elder Mahāsīva says, based on the Sutta, “That dwelling place, Sāriputta, is not easy to obtain, which has not been inhabited by me for this long time, except for the Suddhāvāsa devas” (MN 1.160), that “the Suddhāvāsa devas also inhabit the fourth station of consciousness, the fourth dwelling place of beings.” This is permissible because the Sutta cannot be refuted.
Tuy nhiên, Trưởng lão Mahāsīva, dựa vào kinh này: “Này Sāriputta, không dễ gì tìm được một nơi cư trú mà ta chưa từng ở trong suốt thời gian dài này, ngoại trừ các vị trời ở cõi Tịnh Cư,” đã nói rằng: “Các cõi Tịnh Cư cũng thuộc về thức trú thứ tư và chúng sanh trú thứ tư.” Điều này được chấp nhận vì không thể bác bỏ được kinh.
Tasmā asaññasattaṃ apanetvā parittasubhādīsu akaniṭṭhapariyosānāsu navasu bhūmīsu sattā ‘‘ekattakāyā ekattasaññino’’ti gahetabbā.
Therefore, excluding the Asaññasatta, the beings in the nine realms from Parittasubhā up to Akaniṭṭha should be understood as “unified in body and unified in perception.”
Do đó, cần hiểu rằng, sau khi loại trừ chúng sanh vô tưởng, các chúng sanh trong chín cõi từ Tịnh Thiểu thiên đến Sắc Cứu Cánh thiên được gọi là “thân đồng nhất, tưởng đồng nhất.”
Asaññasattā pana viññāṇābhāvā ettha saṅgahaṃ na gacchanti.
The Asaññasatta, however, are not included here due to the absence of consciousness.
Còn các chúng sanh vô tưởng, do không có thức, nên không được kể vào đây.
Tathā hi anuppanne buddhe titthāyatane pabbajitā vāyokasiṇe parikammaṃ katvā catutthajjhānaṃ nibbattetvā tato vuṭṭhāya ‘‘dhī cittaṃ, dhī cittaṃ, cittassa nāma abhāvoyeva sādhu.
Indeed, those who, when no Buddha had arisen, went forth into the teachings of other sects, performed preliminary work on the air kasiṇa, gave rise to the fourth jhāna, and then emerged from it, thinking: “Fie on consciousness, fie on consciousness! It is indeed good for there to be no consciousness.
Thật vậy, khi chưa có Đức Phật xuất hiện, những người xuất gia trong ngoại đạo, sau khi thực hành đề mục biến xứ gió và chứng đắc tứ thiền, rồi xuất khỏi thiền, họ khởi lên ý muốn và sở thích rằng: “Ôi, tâm này! Ôi, tâm này! Thật tốt nếu không có tâm.
Cittañhi nissāya vadhabandhādipaccayaṃ dukkhaṃ uppajjati, citte asati nattheta’’nti khantiṃ ruciṃ uppādetvā aparihīnajjhānā kālaṃ katvā rūpapaṭisandhivasena asaññabhave nibbattanti.
For suffering, such as that caused by murder and bondage, arises dependent on consciousness; when consciousness is absent, that suffering does not exist.” Having developed this conviction and inclination, they passed away without losing their jhāna, and were reborn in the Asaṅña realm as a result of a material rebirth.
Vì nương vào tâm mà các khổ đau do bị giết, bị trói buộc,... sanh khởi; khi không có tâm, những điều đó không có.” Khi họ mạng chung mà không bị mất thiền, họ tái sanh vào cõi vô tưởng bằng sự tái sanh sắc pháp.
Yo yassa iriyāpatho manussaloke paṇihito ahosi, so tena iriyāpathena nibbattitvā pañca kappasatāni ṭhito vā nisinno vā nipanno vā hoti.
Whatever posture was adopted by one in the human world, they are reborn in that posture and remain for five hundred kalpas, either standing, sitting, or lying down.
Oai nghi nào đã được họ thiết lập ở cõi người, họ sẽ sanh ra với oai nghi đó và tồn tại trong năm trăm đại kiếp trong tư thế đứng, ngồi, hoặc nằm.
Evaṃ cittavirāgabhāvanāvasena tesaṃ tattha viññāṇuppatti na hotīti viññāṇābhāvato viññāṇaṭṭhitiṃ te na bhajanti.
Thus, due to the cultivation of dispassion for consciousness, the arising of consciousness does not occur there for them, and so due to the absence of consciousness, they do not inhabit a station of consciousness.
Như vậy, do việc tu tập nhàm chán tâm, thức không sanh khởi ở đó, và vì không có thức, họ không thuộc về thức trú.
Nevasaññānāsaññāyatanaṃ pana yatheva saññāya, evaṃ viññāṇassapi sukhumattā viññāṇaṭṭhitīsu saṅgahaṃ na gacchati.
However, the realm of Neither-perception-nor-non-perception (Nevasaññānāsaññāyatana) is not included in the stations of consciousness, just as it is not included in perception, due to the subtlety of consciousness there.
Còn Phi Tưởng Phi Phi Tưởng Xứ, cũng giống như đối với tưởng, do sự vi tế của thức nên không được bao gồm trong các thức trú.
Tañhi saññāya viya viññāṇassapi saṅkhārāvasesasukhumabhāvappattattā paribyattaviññāṇakiccābhāvato neva viññāṇaṃ, na ca sabbaso aviññāṇaṃ hotīti nevaviññāṇā nāviññāṇaṃ, tasmā paripphuṭaviññāṇakiccavantīsu viññāṇaṭṭhitīsu saṅgahaṃ na gacchati.
For there, consciousness, like perception, having attained a subtle state as a remnant of formations, and lacking clearly manifest consciousness-activity, is neither consciousness nor entirely non-consciousness. Therefore, it is 'neither consciousness nor non-consciousness' and is not included among the abodes of consciousness that possess fully manifest consciousness-activity.
Bởi vì chính cái đó, như tưởng, thức cũng do đã đạt đến trạng thái vi tế còn sót lại của các hành, do không có chức năng thức rõ ràng, nên không phải là thức, và cũng không phải hoàn toàn không phải là thức, do đó gọi là phi thức phi phi thức (nevaviññāṇā nāviññāṇaṃ); vì vậy, nó không được bao gồm trong các trú xứ của thức có chức năng thức rõ rệt.
Tasmā vinipātikehi saddhiṃ chakāmāvacaradevā manussā ca nānattakāyā nānattasaññino, paṭhamajjhānabhūmikā apāyasattā ca nānattakāyā ekattasaññino, dutiyajjhānabhūmikā ekattakāyā nānattasaññino, tatiyajjhānabhūmikā asaññasattaṃ vajjetvā sesā catutthajjhānabhūmikā ca ekattakāyā ekattasaññinoti imā catasso viññāṇaṭṭhitiyo nevasaññānāsaññāyatanaṃ vajjetvā ākāsānañcāyatanādiheṭṭhimāruppattayena saddhiṃ ‘‘satta viññāṇaṭṭhitiyo’’ti veditabbā.
Therefore, together with those in the lower realms, the six classes of Kāma-realm devas and humans are 'diverse in body, diverse in perception'; beings in the first jhāna realm and beings in the lower planes are 'diverse in body, unified in perception'; beings in the second jhāna realm are 'unified in body, diverse in perception'; and beings in the third jhāna realm, excluding the non-percipient beings, and the remaining beings in the fourth jhāna realm are 'unified in body, unified in perception' — these four abodes of consciousness, excluding the sphere of neither perception nor non-perception, together with the lower immaterial attainments beginning with the sphere of infinite space, should be understood as the "seven abodes of consciousness".
Do đó, chư thiên sáu cõi Dục giới và loài người cùng với chúng sinh trong các cõi đọa xứ là những loài có thân sai biệt, tưởng sai biệt; chúng sinh ở cõi sơ thiền và các cõi đọa xứ là những loài có thân sai biệt, tưởng đồng nhất; chúng sinh ở cõi nhị thiền là những loài có thân đồng nhất, tưởng sai biệt; chúng sinh ở cõi tam thiền và các cõi tứ thiền còn lại, trừ vô tưởng hữu tình, là những loài có thân đồng nhất, tưởng đồng nhất—bốn trú xứ của thức này, cùng với các cõi Vô sắc thấp hơn như Không Vô Biên Xứ, trừ Phi Tưởng Phi Phi Tưởng Xứ, được gọi là “bảy trú xứ của thức” (satta viññāṇaṭṭhitiyo).
Aṭṭha lokadhammāti lābho alābho yaso ayaso nindā pasaṃsā sukhaṃ dukkhanti ime aṭṭha lokassa dhammattā lokadhammā.
Eight worldly conditions are gain, loss, fame, disrepute, censure, praise, pleasure, and pain—these eight are conditions of the world, hence called worldly conditions.
Tám pháp thế gian (aṭṭha lokadhammā) là lợi, bất lợi, danh vọng, vô danh, chỉ trích, tán thán, lạc, khổ—tám pháp này là pháp của thế gian, nên gọi là pháp thế gian.
Ime hi sattalokassa avassaṃbhāvino dhammā, tasmā etehi vinimutto nāma koci satto natthi.
Indeed, these are conditions that are unavoidable for the world of beings; therefore, there is no being entirely free from them.
Những pháp này là những pháp tất yếu phải có đối với thế gian hữu tình, do đó không có chúng sinh nào thoát khỏi chúng.
Te hi aparāparaṃ kadāci lokaṃ anupatanti, kadāci te loko ca anupatati.
These, from time to time, sometimes pursue the world, and sometimes the world pursues them.
Chúng luân phiên nhau, khi thì đi theo thế gian, khi thì thế gian đi theo chúng.
Vuttampi cetaṃ ‘‘aṭṭhime, bhikkhave, lokadhammā lokaṃ anuparivattanti, loko ca aṭṭha lokadhamme anuparivattatī’’ti (a. ni. 8.6).
It has also been said: “These eight worldly conditions, bhikkhus, revolve around the world, and the world revolves around the eight worldly conditions” (A.N. 8.6).
Điều này cũng đã được nói: “Này các Tỳ-kheo, tám pháp thế gian này xoay vần theo thế gian, và thế gian xoay vần theo tám pháp thế gian” (A.N. 8.6).
Ghāsacchādanādīnaṃ laddhi, tāni eva vā laddhabbato lābho.
The acquisition of food, clothing, etc., or the things themselves that are to be acquired, is gain.
Sự thâu nhận thức ăn, y phục, v.v., hoặc chính những thứ cần được thâu nhận, gọi là lợi (lābho).
Tadabhāvo alābho.
The absence of that is loss.
Sự thiếu vắng chúng là bất lợi (alābho).
Lābhaggahaṇena cettha tabbisayo anurodho gahito, alābhaggahaṇena virodho.
By the term 'gain' here, the corresponding approval is understood; by the term 'loss', opposition is understood.
Ở đây, khi nói đến lợi, sự thuận lợi liên quan đến nó được hàm ý; khi nói đến bất lợi, sự bất lợi được hàm ý.
Evaṃ yasādīsupi tabbisayaanurodhavirodhānaṃ gahaṇaṃ veditabbaṃ.
Similarly, in the case of fame and so forth, the understanding of corresponding approval and opposition should be known.
Tương tự, trong danh vọng (yasā) v.v., cần hiểu là sự hàm ý về thuận lợi và bất lợi liên quan đến chúng.
Lābhe pana āgate alābho āgatoyeva hotīti lābho ca alābho ca vutto.
When gain arises, loss is also present; thus, both gain and loss are mentioned.
Khi lợi đến, bất lợi cũng đến, nên lợi và bất lợi được nói đến.
Yasādīsupi eseva nayo.
The same principle applies to fame and so forth.
Trong danh vọng v.v. cũng theo cùng một cách.
Tathā ca lohite sati tadupaghātavasena pubbo viya lābhādīsu anurodhe sati alābhādīsu virodho laddhāvasaro eva hoti.
Just as pus arises from blood when it is impaired, so too, when approval exists in gain and so forth, opposition in loss and so forth inevitably finds its opportunity.
Cũng vậy, khi có máu, thì có mủ do sự hư hoại của nó; tương tự, khi có sự thuận lợi trong lợi lộc v.v., thì sự bất lợi trong bất lợi v.v. cũng có cơ hội xuất hiện.
Kasmā panettha cakkhādayo ‘‘āyatanānī’’ti vuccanti?
But why are the eye, etc., called "bases" here?
Tại sao ở đây nhãn xứ v.v. lại được gọi là “xứ” (āyatanāni)?
Āyatanato (vibha. aṭṭha. 154) āyānaṃ vā tananato āyatassa ca nayanato āyatanāni.
They are bases because they lead to income (āyatana), or because they stretch out income, or because they guide what is extended.
Chúng là xứ (āyatana) do là chỗ sinh (āyatana), hoặc do làm sinh ra (tanana) các sự sinh (āya), và do dẫn dắt (nayana) cái dài (āyata).
Cakkhurūpādīsu hi taṃtaṃdvārārammaṇā cittacetasikā dhammā sena sena anubhavanādinā kiccena āyatanti uṭṭhahanti ghaṭanti vāyamanti, te ca pana āyabhūte dhamme etāni tanonti vitthārenti, idañca anamatagge saṃsāre pavattaṃ ativiya āyataṃ saṃsāradukkhaṃ yāva na nivattati, tāva nayanti pavattayanti, tasmā ‘‘āyatanānī’’ti vuccanti.
Indeed, in the eye, visual forms, etc., mental and associated mental states, by their respective functions of experiencing, etc., stretch forth, arise, strive, or exert themselves. And these (bases) extend and proliferate those states that are income. Moreover, they lead and sustain the extremely prolonged suffering of saṃsāra, which has no discernible beginning, until it ceases. Therefore, they are called "bases".
Trong nhãn, sắc v.v., các pháp tâm và tâm sở tương ứng với từng căn và cảnh, sinh khởi (āyatanti), phát sinh (uṭṭhahanti), nỗ lực (ghaṭanti) hoặc cố gắng (vāyamanti) với chức năng kinh nghiệm riêng của chúng; và những xứ này làm sinh ra và mở rộng các pháp đã sinh đó; và chúng dẫn dắt (nayanti) và duy trì (pavattayanti) khổ luân hồi rất dài (ātiva āyataṃ saṃsāradukkhaṃ) đang diễn ra trong vòng luân hồi vô thủy (anamatagge saṃsāre) cho đến khi nó chưa chấm dứt; do đó, chúng được gọi là “xứ”.
Api ca nivāsaṭṭhānaṭṭhena ākaraṭṭhena samosaraṇaṭṭhena sañjātidesaṭṭhena kāraṇaṭṭhena ca āyatanāni.
Furthermore, they are bases in the sense of a dwelling place, a source, a place of convergence, a place of origination, and a cause.
Hơn nữa, chúng là xứ theo nghĩa là nơi cư trú, là nguồn, là nơi hội tụ, là nơi sinh khởi, và là nguyên nhân.
Tathā hi loke ‘‘issarāyatanaṃ vāsudevāyatana’’ntiādīsu nivāsaṭṭhānaṃ āyatananti vuccati.
Thus, in the world, "issarāyatanaṃ vāsudevāyatanaṃ" (abode of Isvara, abode of Vāsudeva), etc., refer to a dwelling place as a base.
Thật vậy, trong thế gian, nơi cư trú được gọi là xứ, như trong “Issarāyatanaṃ, Vāsudevāyatanaṃ” (xứ của Isvara, xứ của Vasudeva) v.v.
‘‘Suvaṇṇāyatanaṃ rajatāyatana’’ntiādīsu ākaro.
"Suvaṇṇāyatanaṃ rajatāyatanaṃ" (source of gold, source of silver), etc., refer to a source.
Nguồn được gọi là xứ, như trong “Suvaṇṇāyatanaṃ, Rajatāyatanaṃ” (nguồn vàng, nguồn bạc) v.v.
Sāsane pana ‘‘manorame āyatane, sevanti naṃ vihaṅgamā’’tiādīsu (a. ni. 5.38) samosaraṇaṭṭhānaṃ.
In the Dispensation, however, "In a delightful abode, birds frequent it" (A.N. 5.38), etc., refer to a place of convergence.
Trong giáo pháp, nơi hội tụ được gọi là xứ, như trong “Manorame āyatane, sevanti naṃ vihaṅgamā” (Trong xứ đẹp đẽ, chim chóc đến nương tựa) (A.N. 5.38) v.v.
‘‘Dakkhiṇāpatho gunnaṃ āyatana’’ntiādīsu sañjātideso.
"The southern path is the base for cattle" (Dakkhiṇāpatho gunnaṃ āyatanaṃ), etc., refer to a place of origination.
Nơi sinh khởi được gọi là xứ, như trong “Dakkhiṇāpatho gunnaṃ āyatanaṃ” (miền Nam là nơi sinh của bò) v.v.
‘‘Tatra tatreva sakkhibhabbataṃ pāpuṇāti sati satiāyatane’’tiādīsu (ma. ni. 3.158; a. ni. 3.102; 5.23) kāraṇaṃ āyatananti vuccati.
"Wherever there is a base, one attains the capacity to be a witness" (M.N. 3.158; A.N. 3.102; 5.23), etc., refer to a cause as a base.
Nguyên nhân được gọi là xứ, như trong “Tatra tatreva sakkhibhabbataṃ pāpuṇāti sati sati āyatane” (ở đó, ở đó, đạt được khả năng làm chứng khi có xứ) (M.N. 3.158; A.N. 3.102; 5.23) v.v.
Cakkhuādīsu ca te te cittacetasikā dhammā nivasanti tadāyattavuttitāyāti cakkhādayo tesaṃ nivāsaṭṭhānaṃ.
And in the eye, etc., those mental and associated mental states dwell because their existence is dependent on them; thus, the eye, etc., are their dwelling place.
Và trong nhãn v.v., các pháp tâm và tâm sở đó cư trú do sự tồn tại phụ thuộc vào chúng, nên nhãn v.v. là nơi cư trú của chúng.
Cakkhādīsu ca te ākiṇṇā tannissitattā tadārammaṇattā cāti cakkhādayova nesaṃ ākaro.
And in the eye, etc., they are abundant, being dependent on them and having them as their object; thus, the eye, etc., are their source.
Và trong nhãn v.v., chúng dày đặc do nương tựa vào chúng và lấy chúng làm đối tượng, nên nhãn v.v. là nguồn của chúng.
Tattha tattha vatthudvārārammaṇavasena samosaraṇato cakkhādayova nesaṃ samosaraṇaṭṭhānaṃ.
Because they converge there and there, in terms of object, door, and support, the eye, etc., are their place of convergence.
Do hội tụ ở đó, ở đó, theo nghĩa là căn, môn và cảnh, nên nhãn v.v. là nơi hội tụ của chúng.
Tannissayārammaṇabhāvena tattheva uppattito cakkhādayova nesaṃ sañjātideso.
Because they arise right there, due to their reliance and object, the eye, etc., are their place of origination.
Do sinh khởi ngay tại đó với tư cách là chỗ nương tựa và đối tượng, nên nhãn v.v. là nơi sinh khởi của chúng.
Cakkhādīnaṃ abhāve abhāvato cakkhādayova nesaṃ kāraṇanti yathāvuttenatthena cakkhu ca taṃ āyatanañcāti cakkhāyatanaṃ.
Because they do not exist in the absence of the eye, etc., the eye, etc., are their cause. Thus, in the sense explained, the eye is that, and it is a base, hence eye-base (cakkhāyatanaṃ).
Do không có chúng khi nhãn v.v. không có, nên nhãn v.v. là nguyên nhân của chúng; theo nghĩa đã nói, nhãn và xứ đó là nhãn xứ.
Evaṃ sesānipi.
The same applies to the rest.
Các xứ còn lại cũng vậy.
Imāneva pana dvādasāyatanāni cakkhuviññāṇādichaviññāṇehi saddhiṃ aṭṭhārasa vidahanādito ‘‘dhātuyo’’ti vuccanti.
These twelve bases, along with the six types of consciousness such as eye-consciousness, are called "eighteen elements" (dhātuyo) from the perspective of their distinct arrangement, etc.
Chính mười hai xứ này, cùng với sáu thức như nhãn thức v.v., được gọi là “giới” (dhātuyo) do sự sắp đặt (vidahanā) thành mười tám.
Tathā hi cakkhādīsu ekeko dhammo yathāsambhavaṃ vidahati, dhīyate, vidhānaṃ, vidhīyate etāya, ettha vā dhīyatīti dhātūti vuccati.
Thus, each phenomenon in the eye, etc., distinctly arranges, is arranged, is an arrangement, or is arranged by it, or is arranged therein, hence it is called an element.
Thật vậy, mỗi pháp trong nhãn v.v. được gọi là giới (dhātu) vì nó sắp đặt (vidahati), được sắp đặt (dhīyate), là sự sắp đặt (vidhāna), được sắp đặt bởi nó (vidhīyate etāya), hoặc được đặt vào đó (ettha vā dhīyatīti).
Lokiyā hi dhātuyo kāraṇabhāvena vavatthitāva hutvā suvaṇṇarajatādidhātuyo viya suvaṇṇarajatādiṃ, anekappakāraṃ saṃsāradukkhaṃ vidahanti, bhārahārehi ca bhāro viya sattehi dhīyanti dhārīyanti, dukkhavidhānamattameva cetā avasavattanato.
Indeed, worldly elements, established as causes, like elements of gold, silver, etc., arrange gold, silver, etc., and diverse kinds of saṃsāric suffering; and they are borne and sustained by beings like a burden by carriers, because they (the elements) are merely arrangements of suffering, not subject to their will.
Các giới thế gian, tồn tại với tư cách là nguyên nhân, giống như các giới vàng, bạc v.v., sắp đặt (vidahanti) vàng, bạc v.v., và vô số loại khổ luân hồi; và chúng được chúng sinh mang vác (dhīyanti dhārīyanti) như gánh nặng bởi người mang gánh, vì chúng chỉ là sự sắp đặt khổ và không tự chủ.
Etāhi ca kāraṇabhūtāhi saṃsāradukkhaṃ sattehi anuvidhīyati, tathāvihitañca taṃ etāsveva dhīyati ṭhapīyati, tasmā ‘‘dhātuyo’’ti vuccanti.
And by these causal elements, saṃsāric suffering is caused to happen by beings, and that which is thus caused is deposited and placed in these very elements; therefore, they are called "elements".
Và do những giới này là nguyên nhân, khổ luân hồi được chúng sinh sắp đặt theo; và khổ đã được sắp đặt như vậy được đặt vào (dhīyati ṭhapīyati) chính chúng; do đó, chúng được gọi là “giới”.
Api ca yathā titthiyānaṃ attā nāma sabhāvato natthi, na evametā, etā pana attano sabhāvaṃ dhārentīti dhātuyo.
Furthermore, just as for sectarians, there is no such thing as a self (attā) in reality, these are not like that. These, however, uphold their own nature, hence they are elements.
Hơn nữa, giống như các ngoại đạo không có tự ngã (attā) theo bản chất, thì các pháp này không phải như vậy; mà các pháp này duy trì (dhārenti) bản chất của chính chúng, nên gọi là giới.
Yathā ca loke vicittā haritālamanosilādayo selāvayavā ‘‘dhātuyo’’ti vuccanti, evametāpi dhātuyo viya dhātuyo.
And just as various elements like orpiment and red arsenic, being parts of rocks, are called "elements" in the world, so too these are like elements, hence elements.
Và giống như trong thế gian, các phần của đá như hoàng thạch, hùng hoàng v.v. nhiều màu sắc được gọi là “giới”, thì các pháp này cũng giống như giới, nên gọi là giới.
Vicittā hetā ñāṇañeyyāvayavāti.
For these are diverse parts of knowledge and knowable objects.
Vì chúng là các phần của trí tuệ và đối tượng của trí tuệ.
Yathā vā sarīrasaṅkhātassa samudāyassa avayavabhūtesu rasasoṇitādīsu aññamaññavisabhāgalakkhaṇaparicchinnesu dhātusamaññā, evametesupi pañcakkhandhasaṅkhātassa attabhāvassa avayavesu dhātusamaññā veditabbā.
Or, just as the designation "elements" applies to the parts of the aggregate called the body, such as lymph and blood, which are distinct in their mutually dissimilar characteristics, so too should the designation "elements" be understood for the parts of existence (attabhāva) called the five aggregates.
Hoặc, giống như các tên gọi giới được áp dụng cho máu, thịt v.v. là các phần của tập hợp gọi là thân, được phân biệt bởi các đặc tính khác nhau, thì các tên gọi giới cũng cần được hiểu là áp dụng cho các phần của tự ngã gọi là năm uẩn.
Aññamaññavisabhāgalakkhaṇaparicchinnā hete cakkhādayoti.
For these eye, etc., are distinct in their mutually dissimilar characteristics.
Vì nhãn v.v. được phân biệt bởi các đặc tính khác nhau.
Api ca dhātūti nijjīvamattassetaṃ adhivacanaṃ.
Furthermore, element is a term for that which is merely lifeless.
Hơn nữa, từ giới (dhātu) này là một tên gọi cho sự không có sinh vật.
Tathā hi bhagavā ‘‘chadhāturo ayaṃ bhikkhu puriso’’tiādīsu (ma. ni. 3.343) jīvasaññāsamūhananatthaṃ dhātudesanamakāsi.
Thus, the Blessed One made the teaching of elements, as in "This person, bhikkhus, is of six elements" (M.N. 3.343), in order to remove the notion of a living essence.
Thật vậy, Đức Thế Tôn đã thuyết về giới để loại bỏ quan niệm về sinh vật, như trong “Này Tỳ-kheo, người này có sáu giới” (M.N. 3.343) v.v.
Tasmā nijjīvaṭṭhenapi dhātuyoti vuccanti.
Therefore, they are also called "elements" in the sense of being lifeless.
Do đó, chúng cũng được gọi là giới theo nghĩa không có sinh vật.
Ettha ca ‘‘āhāraṭṭhitikā’’ti paccayāyattavuttitāvacanena saṅkhārānaṃ aniccatā, tāya ca ‘‘yadaniccaṃ taṃ dukkhaṃ, yaṃ dukkhaṃ tadanattā’’ti (saṃ. ni. 3.15) vacanato dukkhānattatā ca pakāsitā hontīti tīṇipi sāmaññalakkhaṇāni gahitāni.
And here, by the statement "sustained by nutriment", which signifies their existence is dependent on conditions, the impermanence of conditioned phenomena is indicated. And by that, suffering and non-self are revealed by the saying "what is impermanent is suffering, what is suffering is non-self", thus all three common characteristics are taken.
Và ở đây, bằng lời nói “tồn tại nhờ vật thực” là sự hiện hữu phụ thuộc vào duyên, tính vô thường của các hành, và do đó, theo lời dạy “cái gì vô thường là khổ, cái gì khổ là vô ngã”, tính khổ và vô ngã cũng được tuyên thuyết, như vậy cả ba tướng chung đều được nắm bắt.
Nāmanti cattāro arūpino khandhā, te ca atthato phassādayo.
Nāma refers to the four immaterial aggregates, and these are, in essence, contact and so forth.
Danh là bốn uẩn vô sắc, và về mặt ý nghĩa, chúng là xúc, v.v.
Rūpanti bhūtupādāyarūpāni, tāni ca atthato pathavīādayoti aviseseneva salakkhaṇato saṅkhārā gahitā.
Rūpa refers to fundamental and derived material phenomena, and these are, in essence, earth element and so forth. Thus, conditioned phenomena are taken in terms of their specific characteristics without distinction.
Sắc là các sắc do bốn đại tạo và sắc y sinh, và về mặt ý nghĩa, chúng là đất, v.v. Như vậy, các hành được nắm bắt theo tự tướng một cách không phân biệt.
Taggahaṇeneva ye te savisesā kusalādayo hetuādayo ca, tepi gahitā eva hontīti āha ‘‘iti ayaṃ saṅkhāralokopi sabbathā vidito’’ti.
By that apprehension, those that are specific, such as wholesome phenomena and others, and causes and others, are also apprehended, therefore it says "thus this world of conditioned phenomena is known in every respect".
Do sự nắm bắt ấy, những pháp có phân biệt như thiện, v.v. và nhân, v.v. cũng được bao gồm. Do đó, ngài nói “như vậy, thế giới các hành này cũng được biết đến một cách toàn diện”.
Evaṃ saṅkhāralokassa sabbathā viditabhāvaṃ dassetvā idāni sattalokassapi sabbathā viditabhāvaṃ dassento ‘‘yasmā panesā’’tiādimāha.
Having thus shown that the world of conditioned phenomena is known in every respect, it now shows that the world of beings is also known in every respect, saying "since this one..." and so forth.
Sau khi đã trình bày rằng thế giới các hành được biết đến một cách toàn diện như vậy, bây giờ để trình bày rằng thế giới chúng sinh cũng được biết đến một cách toàn diện, ngài nói “bởi vì những chúng sinh này”, v.v.
Tattha āsayaṃ jānātīti āgamma cittaṃ seti etthāti āsayo migāsayo viya.
Therein, āsayaṃ jānāti (knows the disposition) means āsaya (disposition) is where the mind settles, like a deer's lair.
Trong đó, biết āsaya (tâm tánh): tâm nương vào và trú ngụ trong đó, nên gọi là āsaya, giống như nơi ở của loài nai.
Yathā migo gocarāya gantvā paccāgantvā tattheva vanagahane sayatīti so tassa āsayo, evaṃ aññathā pavattitvāpi cittaṃ āgamma yattha seti, so tassa āsayoti vuccati.
Just as a deer, having gone for pasture, returns and lies down in that forest thicket, so that is its lair; similarly, after functioning otherwise, where the mind settles by resting, that is called its āsaya.
Giống như con nai đi kiếm ăn rồi quay về nằm nghỉ trong bụi rậm đó, nên đó là āsaya của nó; cũng vậy, dù sinh khởi ở nơi khác, tâm quay về và trú ngụ ở đâu, nơi đó được gọi là āsaya của nó.
So pana sassatadiṭṭhiādivasena catubbidho.
This is fourfold, based on views of eternalism and so forth.
Và đó có bốn loại, tùy theo thường kiến, v.v.
Vuttañca –
And it is said:
Và đã được nói rằng –
Tattha sabbadiṭṭhīnaṃ sassatucchedadiṭṭhīhi saṅgahitattā sabbepi diṭṭhigatikā sattā imā eva dve diṭṭhiyo sannissitā.
Therein, since all views are encompassed by views of eternalism and annihilationism, all beings who adhere to views rely on these two views alone.
Trong đó, vì tất cả các tà kiến đều được bao gồm trong thường kiến và đoạn kiến, nên tất cả chúng sinh có khuynh hướng tà kiến đều nương tựa vào hai loại kiến này.
Yathāha ‘‘dvayanissito khvāyaṃ kaccāna loko yebhuyyena atthitañceva natthitañcā’’ti (saṃ. ni. 2.15).
As it is said, "This world, Kaccāna, is for the most part based on two things: existence and non-existence."
Như có lời dạy: “Này Kaccāna, thế giới này phần lớn nương tựa vào hai cực đoan: có và không có.”
Atthitāti hi sassataggāho adhippeto, natthitāti ucchedaggāho.
By existence is meant the grasping of eternalism, and by non-existence is meant the grasping of annihilationism.
Có ở đây chỉ sự chấp thủ thường kiến, không có chỉ sự chấp thủ đoạn kiến.
Ayaṃ tāva vaṭṭanissitānaṃ puthujjanānaṃ āsayo, vivaṭṭanissitānaṃ pana suddhasattānaṃ anulomikā khanti yathābhūtañāṇanti duvidho āsayo.
This, then, is the āsaya of ordinary individuals entangled in the cycle of existence. But for pure beings who are oriented towards liberation, āsaya is twofold: conducive patience and knowledge of things as they truly are.
Đây là āsaya của các phàm phu nương tựa vào luân hồi; còn đối với các bậc thánh nương tựa vào sự giải thoát, āsaya có hai loại: sự kham nhẫn tùy thuận và trí tuệ như thật.
Tattha ‘‘anulomikā khanti vipassanāñāṇaṃ, yathābhūtañāṇaṃ pana maggañāṇa’’nti sammohavinodaniyā vibhaṅgaṭṭhakathāyaṃ (vibha. aṭṭha. 815) vuttaṃ.
Therein, it is stated in the Sammohavinodanī Vibhaṅgatthakathā: "conducive patience is vipassanā knowledge, while knowledge of things as they truly are is magga knowledge."
Trong đó, trong Sammohavinodanī, chú giải Vibhaṅga, có nói: “sự kham nhẫn tùy thuận là tuệ quán, còn trí tuệ như thật là đạo tuệ.”
Taṃ catubbidhampi sattānaṃ āsayaṃ jānāti, jānanto ca tesaṃ diṭṭhigatānaṃ tesañca ñāṇānaṃ appavattikkhaṇepi jānāti.
He knows that fourfold āsaya of beings, and knowing it, he also knows it even at the moment when those views and those knowledges are not operating.
Ngài biết cả bốn loại āsaya đó của chúng sinh, và khi biết, ngài cũng biết chúng ngay cả trong khoảnh khắc các tà kiến và các trí tuệ ấy không khởi lên.
Vuttañhetaṃ –
For it is said:
Điều này đã được nói rằng –
Caritaṃ jānātīti ettha caritanti sucaritaduccaritaṃ.
In caritaṃ jānāti (knows the conduct), carita refers to good conduct and bad conduct.
Biết carita (hạnh): ở đây, carita là thiện hạnh và ác hạnh.
Tañhi vibhaṅge (vibha. 814 ādayo) caritaniddese niddiṭṭhaṃ.
This is described in the Vibhaṅga's section on conduct.
Vì điều đó đã được giải thích trong phần giải về hạnh trong Vibhaṅga.
Atha vā caritanti cariyā veditabbā.
Alternatively, carita should be understood as fundamental dispositions.
Hoặc, carita nên được hiểu là hành vi.
Tā pana rāgadosamohasaddhābuddhivitakkavasena cha mūlacariyā, tāsaṃ apariyanto antarabhedo, saṃsaggabhedo pana tesaṭṭhividho.
These are the six primary dispositions based on lust, hatred, delusion, faith, intelligence, and discursive thought. Their inner distinctions are endless, and their combinations are sixty-three fold.
Chúng có sáu hành vi căn bản tùy theo tham, sân, si, tín, tuệ, và tầm; sự phân chia chi tiết của chúng là vô hạn, nhưng sự phân chia theo sự kết hợp thì có sáu mươi ba loại.
Taṃ caritaṃ sabhāvato saṃkilesato vodānato samuṭṭhānato phalato nissandatoti evamādinā pakārena jānāti.
He knows that conduct in terms of its nature, defilement, purification, origination, result, and outflow, and so forth.
Ngài biết hạnh đó theo nhiều phương diện như: theo bản chất, theo sự ô nhiễm, theo sự trong sạch, theo sự phát sinh, theo quả, theo quả dị thục, v.v.
Adhimuttiṃ jānātīti ettha adhimuttīti ajjhāsayadhātu.
In adhimuttiṃ jānāti (knows the inclination), adhimutti refers to the dispositional element.
Biết adhimutti (khuynh hướng): ở đây, adhimutti là yếu tố tâm tánh.
Sā duvidhā hīnādhimutti paṇītādhimuttīti.
This is twofold: lowly inclination and sublime inclination.
Nó có hai loại: khuynh hướng thấp kém và khuynh hướng cao thượng.
Yāya hīnādhimuttikā sattā hīnādhimuttikeyeva sevanti, paṇītādhimuttikā ca paṇītādhimuttike eva.
Through which beings with lowly inclinations associate only with those of lowly inclination, and those with sublime inclinations associate only with those of sublime inclination.
Do đó, chúng sinh có khuynh hướng thấp kém chỉ giao du với những người có khuynh hướng thấp kém, và những người có khuynh hướng cao thượng chỉ giao du với những người có khuynh hướng cao thượng.
Sace hi ācariyupajjhāyā na sīlavanto honti, saddhivihārikā sīlavanto honti, te attano ācariyupajjhāyepi na upasaṅkamanti, attanā sadise sāruppabhikkhūyeva upasaṅkamanti.
For if teachers and preceptors are not virtuous, but their pupils are virtuous, these pupils do not approach their own teachers and preceptors; they approach only monks who are similar to themselves and suitable.
Nếu các vị thầy tế độ và thầy yết-ma không có giới hạnh, còn các vị đồng trú có giới hạnh, thì họ cũng không đến gần các vị thầy tế độ và thầy yết-ma của mình, mà chỉ đến gần các vị tỳ-khưu gương mẫu tương đồng với mình.
Sace ācariyupajjhāyā sāruppabhikkhū, itare asāruppā, tepi na ācariyupajjhāye upasaṅkamanti, attanā sadise hīnādhimuttike eva upasaṅkamanti.
If the teachers and preceptors are suitable monks, but the others are unsuitable, they do not approach their teachers and preceptors, but only those of lowly inclination who are similar to themselves.
Nếu các vị thầy tế độ và thầy yết-ma là những vị tỳ-khưu gương mẫu, còn những người kia không gương mẫu, thì họ cũng không đến gần các vị thầy tế độ và thầy yết-ma, mà chỉ đến gần những người có khuynh hướng thấp kém tương đồng với mình.
Tipiṭakacūḷābhayatthero kira nāgadīpe cetiyavandanāya pañcahi bhikkhusatehi saddhiṃ gacchanto ekasmiṃ gāme manussehi nimantito therena ca saddhiṃ eko asāruppabhikkhu atthi, dhuravihārepi eko asāruppabhikkhu atthi, bhikkhusaṅghesu gāmaṃ osarantesu te ubho janā kiñcāpi āgantukena nevāsiko, nevāsikena vā āgantuko na diṭṭhapubbo, evaṃ santepi ekato hutvā hasitvā hasitvā kathayamānā aṭṭhaṃsu.
It is said that Tipiṭakacūḷābhayatthera, when going to worship a cetiya in Nāgadīpa with five hundred monks, was invited by people in a certain village. There was one unsuitable monk with the Thera, and there was also one unsuitable monk in the main monastery. As the monks entered the village, even though those two individuals had never seen each other before (one being an arriving guest and the other a resident, or vice versa), they stood together, laughing and talking.
Tương truyền, Trưởng lão Tipiṭaka Cūḷābhaya, khi đi cùng năm trăm vị tỳ-khưu đến đảo Nāgadīpa để đảnh lễ bảo tháp, được người dân trong một ngôi làng thỉnh mời. Cùng với vị trưởng lão có một vị tỳ-khưu không gương mẫu; trong tu viện chính cũng có một vị tỳ-khưu không gương mẫu. Khi tăng chúng đi vào làng, hai người này, mặc dù vị khách chưa từng thấy vị chủ nhà, và vị chủ nhà cũng chưa từng thấy vị khách, dù vậy họ vẫn tụ lại với nhau, vừa cười vừa nói chuyện.
Thero disvā ‘‘sammāsambuddhena jānitvā dhātusaṃyuttaṃ (saṃ. ni. 2.85 ādayo) kathita’’nti āha.
Seeing this, the Thera said, "The Perfectly Enlightened One knew this and spoke of the Element-Connected Discourses."
Vị trưởng lão thấy vậy liền nói: “Đức Chánh Đẳng Giác đã biết rõ điều này nên mới thuyết Dhātusaṃyutta (Tương Ưng Giới).”
Evamayaṃ hīnādhimuttikādīnaṃ aññamaññopasevanādiniyāmikā ajjhāsayadhātu ajjhāsayabhāvo adhimuttīti vuccati, taṃ adhimuttiṃ jānāti.
Thus, this dispositional element, this state of disposition that regulates the mutual association of those with lowly inclinations and so forth, is called adhimutti. He knows that inclination.
Như vậy, yếu tố tâm tánh, tức là bản chất tâm tánh, quy định sự giao du lẫn nhau của những người có khuynh hướng thấp kém, v.v., được gọi là adhimutti. Ngài biết khuynh hướng đó.
‘‘Imassa adhimutti hīnā, imassa paṇītā.
"This one's inclination is lowly; this one's is sublime.
“Khuynh hướng của người này thấp kém, của người này cao thượng.
Tatthāpi imassa mudu, imassa mudutarā, imassa mudutamā’’tiādinā paṭivijjhati.
Even within those, this one's is gentle, this one's is gentler, this one's is gentlest," and so forth, he thoroughly understands.
Trong đó, khuynh hướng của người này yếu, của người này yếu hơn, của người này yếu nhất,” v.v., ngài thấu suốt như vậy.
Adhimuttiyā pana tikkhamudubhāvādiko indriyānaṃ tikkhamudubhāvādinā veditabbo.
The keenness and gentleness of inclinations should be understood in terms of the keenness and gentleness of the faculties.
Và mức độ mạnh yếu, v.v. của khuynh hướng cần được hiểu qua mức độ mạnh yếu, v.v. của các căn.
Tikkhindriyeti tikhiṇehi saddhādīhi indriyehi samannāgate.
Tikkhindriye (those with keen faculties) refers to those endowed with keen faculties such as faith and so forth.
Căn lanh lợi: những người có các căn như tín, v.v. lanh lợi.
Mudindriyeti mudukehi saddhādīhi indriyehi samannāgate.
Mudindriye (those with dull faculties) refers to those endowed with dull faculties such as faith and so forth.
Căn chậm lụt: những người có các căn như tín, v.v. chậm lụt.
Ubhayatthāpi upanissayabhūtindriyāni adhippetāni.
In both cases, the faculties serving as strong supporting conditions are intended.
Trong cả hai trường hợp, các căn làm nền tảng cho sự phát triển được nói đến.
Svākāreti sundarākāre, kalyāṇapakatike vivaṭṭajjhāsayeti attho.
Svākāre (those with good dispositions) means those with a beautiful disposition, those with a good nature, meaning those with a disposition towards liberation.
Hạng tốt: những người có hình thức tốt đẹp, nghĩa là những người có bản chất thiện lành, có tâm tánh hướng đến giải thoát.
Yesaṃ vā āsayādayo ākārā koṭṭhāsā sundarā, te svākārā.
Or those whose dispositions and other aspects, or components, are beautiful, are svākārā.
Hoặc những người có các hình thức, tức là các phần như tâm tánh, v.v. tốt đẹp, họ là hạng tốt.
Viparītā dvākārā.
The opposite are dvākārā (those with bad dispositions).
Những người ngược lại là hạng xấu.
Suviññāpaye ti sammattaniyāmaṃ viññāpetuṃ sukare saddhe paññavante ca, ye vā kathitaṃ kāraṇaṃ sallakkhenti, sukhena sakkā honti viññāpetuṃ, te suviññāpayā.
Suviññāpaye (those who are easy to instruct) refers to those who are easy to instruct in the certainty of rightness, those who are faithful and intelligent, or those who grasp what is said as a cause, and are easy to instruct. These are suviññāpayā.
Hạng dễ giáo hóa: những người dễ dàng được chỉ dạy về chánh đạo, là những người có đức tin và trí tuệ; hoặc những người thấu hiểu lý lẽ được trình bày, có thể được chỉ dạy một cách dễ dàng, họ là hạng dễ giáo hóa.
Viparītā duviññāpayā.
The opposite are duviññāpayā (those who are difficult to instruct).
Trái ngược lại, là khó làm cho hiểu được.
Bhabbe abhabbe ti ettha ye ariyamaggappaṭivedhassa anucchavikā upanissayasampannā kammāvaraṇakilesāvaraṇavipākāvaraṇarahitā, te bhabbā.
Regarding 'capable and incapable': Those who are suitable for the penetration of the Noble Path, endowed with supporting conditions, free from the hindrance of kamma, defilements, and results of kamma, they are 'capable' (bhabbā).
Ở đây, về "có khả năng, không có khả năng", những ai phù hợp với sự chứng ngộ Thánh đạo, có đầy đủ duyên hỗ trợ, không bị nghiệp chướng, phiền não chướng, quả báo chướng, thì những người đó là có khả năng (bhabbā).
Viparītā abhabbā.
The opposite are 'incapable' (abhabbā).
Ngược lại là không có khả năng (abhabbā).
Tasmāti yasmā bhagavā aparimāṇe satte āsayādito anavasesetvā jānāti, tasmā assa bhagavato sattalokopi sabbathā vidito.
'Therefore' means because the Blessed One knows immeasurable beings without exception, from their dispositions, therefore the world of beings is completely known to this Blessed One.
Do đó, vì Đức Thế Tôn biết rõ vô số chúng sinh không sót từ khuynh hướng, v.v., nên đối với Đức Thế Tôn, thế giới chúng sinh cũng được biết rõ hoàn toàn.
Evaṃ sattalokassapi sabbathā viditabhāvaṃ dassetvā idāni okāsalokassapi tatheva viditabhāvaṃ dassento āha ‘‘yathā ca sattaloko’’tiādi.
Having thus shown that the world of beings is completely known, he now says, "And just as the world of beings..." and so on, showing that the spatial world is also known in the same way.
Sau khi trình bày việc thế giới chúng sinh được biết rõ hoàn toàn như vậy, giờ đây, để trình bày việc thế giới không gian cũng được biết rõ như vậy, Ngài nói “cũng như thế giới chúng sinh”, v.v.
Okāsalokopi sabbathā viditoti sambandho.
The spatial world is also completely known—this is the connection.
Thế giới không gian cũng được biết rõ hoàn toàn, đó là sự liên kết.
Cakkavāḷanti lokadhātu.
Cakkavāḷa means a world-system.
Cakkavāḷa (luân vũ) là thế giới.
Sā hi nemimaṇḍalasadisena cakkavāḷapabbatena samantato parikkhittattā ‘‘cakkavāḷa’’nti vuccati.
Surrounded on all sides by the Cakkavāḷa mountain, which is like a rim, it is called a "Cakkavāḷa."
Thế giới ấy được bao quanh hoàn toàn bởi dãy núi Cakkavāḷa giống như vành bánh xe, nên được gọi là “Cakkavāḷa”.
Aḍḍhuḍḍhānīti upaḍḍhacatutthāni, tīṇi satāni paññāsañcāti attho.
Aḍḍhuḍḍhānī means three and a half hundreds, that is, three hundred and fifty.
Aḍḍhuḍḍhānī (ba trăm rưỡi) nghĩa là ba trăm năm mươi.
Nahutānīti dasasahassāni.
Nahutānī means ten thousands.
Nahutānī (mười ngàn) nghĩa là mười ngàn.
Saṅkhātāti kathitā.
Saṅkhātā means mentioned.
Saṅkhātā (được tính) nghĩa là được nói đến.
Yasmā pathavī nāmāyaṃ tiriyaṃ aparicchinnā, tasmā ‘‘ettakaṃ bahalattena, saṅkhātāyaṃ vasundharā’’ti bahalatoyeva paricchedo vutto.
Since this earth is limitless horizontally, the extent is stated only in terms of thickness: "This earth is measured in thickness."
Vì trái đất này theo chiều ngang là vô biên, nên chỉ có chiều dày được nói đến là “trái đất này được tính theo chiều dày là bấy nhiêu”.
Nanu cakkavāḷapabbatehi taṃtaṃcakkavāḷapathavī paricchinnāti?
But is not the earth of each Cakkavāḷa delimited by the Cakkavāḷa mountains?
Chẳng phải các trái đất luân vũ được bao quanh bởi các dãy núi luân vũ tương ứng sao?
Na tadaññacakkavāḷapathaviyā ekābaddhabhāvato.
No, because it is connected to the earth of other Cakkavāḷas.
Không, vì các trái đất luân vũ khác có sự kết nối với nhau.
Tiṇṇaṃ tiṇṇañhi pattānaṃ antarāḷasadise tiṇṇaṃ tiṇṇaṃ lokadhātūnaṃ antareyeva pathavī natthi lokantaranirayabhāvato, cakkavāḷapabbatānaṃ pana cakkavāḷapabbatantarehi sambaddhaṭṭhāne pathavī ekābaddhāva, vivaṭṭakāle saṇṭhahamānāpi pathavī yathāsaṇṭhitapathaviyā ekābaddhāva saṇṭhahati.
Indeed, just as there is no earth between three leaves, so too is there no earth between three world-systems, for there is a world-interval hell; but the earth at the points where the Cakkavāḷa mountains are connected to other Cakkavāḷa mountains is continuous. Even when the earth settles during a period of contraction, it settles continuously with the existing earth.
Giữa ba thế giới, giống như khoảng cách giữa ba chiếc lá, không có đất vì đó là địa ngục giữa các thế giới; nhưng tại những nơi mà các dãy núi Cakkavāḷa nối liền với nhau, đất là một khối liên tục. Ngay cả khi hình thành trong thời kỳ biến chuyển, đất cũng hình thành liên tục với đất đã hình thành.
Sinerupabbatuttamoti pabbatesu uttamo, pabbatoyeva vā uttamo pabbatuttamo, sinerusaṅkhāto pabbatuttamo sinerupabbatuttamo, sinerupabbatarājāti vuttaṃ hoti.
Sinerupabbatuttamo means the best among mountains, or simply "the best mountain," or the excellent mountain called Sineru, which is to say, the Sineru mountain-king.
Sinerupabbatuttamo (núi Sineru cao cả nhất) nghĩa là cao cả nhất trong các ngọn núi, hoặc ngọn núi tự nó là cao cả nhất, núi cao cả nhất có tên là Sineru, nghĩa là vua núi Sineru.
Tassa ca pācīnapassaṃ rajatamayaṃ, tasmā tassa pabhāya ajjhottharantiyā pācīnadisāya samuddodakaṃ khīraṃ viya paññāyati.
Its eastern side is made of silver, therefore, when its radiance shines upon it, the ocean water in the eastern direction appears like milk.
Phía đông của nó làm bằng bạc, nên do ánh sáng của nó bao phủ, nước biển ở phía đông hiện ra như sữa.
Dakkhiṇapassaṃ pana indanīlamaṇimayaṃ, tasmā dakkhiṇadisāya samuddodakaṃ yebhuyyena nīlavaṇṇaṃ hutvā paññāyati, tathā ākāsaṃ.
Its southern side is made of indanīla gem, therefore the ocean water in the southern direction mostly appears blue, as does the sky.
Phía nam làm bằng ngọc Indanīla, nên nước biển ở phía nam phần lớn hiện ra màu xanh lam, cũng như bầu trời.
Pacchimapassaṃ phalikamayaṃ.
Its western side is made of crystal.
Phía tây làm bằng pha lê.
Uttarapassaṃ suvaṇṇamayaṃ.
Its northern side is made of gold.
Phía bắc làm bằng vàng.
Cattāro samuddāpi sinerurasmīhi eva paricchinnā.
The four oceans are also delimited by the rays of Sineru.
Bốn đại dương cũng được phân chia bởi các tia sáng của Sineru.
Tathā hi pubbadakkhiṇapassehi nikkhantā rajatamaṇirasmiyo ekato hutvā mahāsamuddapiṭṭhena gantvā cakkavāḷapabbataṃ āhacca tiṭṭhanti, dakkhiṇapacchimapassehi nikkhantā maṇiphalikarasmiyo, pacchimuttarapassehi nikkhantā phalikasuvaṇṇarasmiyo, uttarapācīnapassehi nikkhantā suvaṇṇarajatarasmiyo ekato hutvā mahāsamuddapiṭṭhena gantvā cakkavāḷapabbataṃ āhacca tiṭṭhanti, tāsaṃ rasmīnaṃ antaresu cattāro mahāsamuddā honti.
Thus, the silver and gem rays emanating from the eastern and southern sides unite and travel across the surface of the great ocean, resting against the Cakkavāḷa mountain. The gem and crystal rays emanating from the southern and western sides, the crystal and gold rays emanating from the western and northern sides, and the gold and silver rays emanating from the northern and eastern sides unite and travel across the surface of the great ocean, resting against the Cakkavāḷa mountain. The four great oceans exist between these rays.
Thật vậy, các tia sáng bạc và ngọc phát ra từ phía đông và phía nam hợp lại, đi trên mặt đại dương và dừng lại ở dãy núi Cakkavāḷa; các tia sáng ngọc và pha lê phát ra từ phía nam và phía tây; các tia sáng pha lê và vàng phát ra từ phía tây và phía bắc; các tia sáng vàng và bạc phát ra từ phía bắc và phía đông hợp lại, đi trên mặt đại dương và dừng lại ở dãy núi Cakkavāḷa. Giữa các tia sáng đó là bốn đại dương lớn.
Tatoti sinerussa heṭṭhā upari ca vuttappamāṇato.
Tato means from the aforementioned measure of Sineru, both below and above.
Tato (từ đó) nghĩa là từ kích thước đã nói ở dưới và trên của Sineru.
Upaḍḍhupaḍḍhenāti upaḍḍhena upaḍḍhena.
Upaḍḍhupaḍḍhenā means by half and by half again.
Upaḍḍhupaḍḍhenā (bằng một nửa của một nửa) nghĩa là bằng một nửa và một nửa.
Idaṃ vuttaṃ hoti – dvācattālīsa yojanasahassāni samudde ajjhogāḷho tattakameva upari uggato yugandharapabbato, ekavīsati yojanasahassāni mahāsamudde ajjhogāḷho tattakameva ca upari uggato īsadharo pabbatoti iminā nayena sesesupi upaḍḍhupaḍḍhappamāṇatā veditabbā.
This is what is meant: the Yugandhara mountain is submerged in the ocean for forty-two thousand yojanas and rises above it by the same amount. The Īsadharo mountain is submerged in the great ocean for twenty-one thousand yojanas and rises above it by the same amount. In this manner, the half-and-half measure of the remaining mountains should be understood.
Điều này có nghĩa là: núi Yugandhara chìm sâu trong biển bốn mươi hai ngàn dojana và vươn cao đúng bấy nhiêu; núi Īsadhara chìm sâu trong đại dương hai mươi mốt ngàn dojana và vươn cao đúng bấy nhiêu. Theo cách này, kích thước một nửa của một nửa cũng cần được hiểu đối với các ngọn núi còn lại.
Yathā mahāsamuddo yāva cakkavāḷapādamūlā anupubbaninno, evaṃ yāva sinerupādamūlāti heṭṭhā sineruppamāṇato upaḍḍhappamāṇopi yugandharapabbato pathaviyaṃ suppatiṭṭhito, evaṃ īsadharādayopīti daṭṭhabbaṃ.
Just as the great ocean gradually slopes down to the base of the Cakkavāḷa, so too the Yugandhara mountain, which is half the measure of Sineru, is well-established in the earth down to the base of Sineru. Likewise for Īsadharo and the others, it should be understood.
Cũng như đại dương dần dần dốc xuống cho đến chân núi Cakkavāḷa, thì núi Yugandhara, có kích thước bằng một nửa Sineru, cũng được đặt vững chắc trên mặt đất cho đến chân núi Sineru. Tương tự, núi Īsadhara, v.v. cũng vậy, cần được hiểu như vậy.
Vuttañhetaṃ ‘‘mahāsamuddo, bhikkhave, anupubbaninno anupubbapoṇo anupubbapabbhāro’’ti (cūḷava. 184; udā. 45).
For it was said: "The great ocean, bhikkhus, slopes gradually, declines gradually, recedes gradually."
Điều này đã được nói rằng: “Này các Tỳ-khưu, đại dương dần dần dốc xuống, dần dần nghiêng xuống, dần dần thoai thoải xuống” (Tiểu Phẩm 184; Udāna 45).
Sineruyugandharādīnaṃ antare sīdantarasamuddā nāma honti.
Between Sineru, Yugandhara, and the others, there are oceans called sīdantarasamuddā (sīda-interval oceans).
Giữa Sineru và Yugandhara, v.v. có các đại dương gọi là Sīdantarasamuddā (biển chìm).
Tattha kira udakaṃ sukhumaṃ morapattamattampi pakkhittaṃ patiṭṭhātuṃ na sakkoti sīdateva, tasmā te sīdasamuddā nāma vuccanti.
It is said that in those waters, even a subtle peacock feather, when thrown, cannot stay afloat but sinks. Therefore, they are called sīda-oceans.
Ở đó, nước rất vi tế, ngay cả một chiếc lá lông công nhỏ cũng không thể nổi được mà chìm xuống. Do đó, chúng được gọi là biển chìm.
Te pana vitthārato yathākkamaṃ sineruādīnaṃ accuggamasamānapaamāṇāti vadanti.
They say that these oceans are, in breadth, equal to the heights of Sineru and the others, respectively.
Họ nói rằng những biển này có chiều rộng tương ứng với chiều cao của Sineru, v.v.
Ajjhogāḷhuggatāti ajjhogāḷhā ca uggatā ca.
Ajjhogāḷhuggatā means both submerged and risen.
Ajjhogāḷhuggatā (chìm sâu và vươn cao) nghĩa là chìm sâu và vươn cao.
Brahāti mahantā.
Brahā means great.
Brahā (to lớn) nghĩa là vĩ đại.
‘‘Ayaṃ, mahārāja, etesaṃ sabbabāhiro sudassano pabbato nāma, tadanantare karavīko nāma, so sudassanato uccataro.
"This, great king, is the outermost mountain, named Sudassana; next to it is Karavīka, which is taller than Sudassana."
“Này đại vương, đây là ngọn núi ngoài cùng nhất tên là Sudassana, liền kề nó là ngọn núi tên Karavīka, nó cao hơn Sudassana.
Ubhinnampi pana tesaṃ antare ekopi sīdantaramahāsamuddo.
And between both of them there is a single great Sīdantara ocean.
Giữa hai ngọn núi đó, có một đại dương mênh mông gọi là Sīdantara.
Karavīkassa anantare īsadharo nāma, so karavīkato uccataro.
Adjacent to Karavīka is a mountain called Īsadhara, which is higher than Karavīka.
Kế Karavīka là núi Īsadhara, cao hơn Karavīka.
Tesampi antare eko sīdantaramahāsamuddo.
Between them too there is a single great Sīdantara ocean.
Giữa hai ngọn núi đó cũng có một đại dương mênh mông gọi là Sīdantara.
Īsadharassa anantare yugandharo nāma, so īsadharato uccataro.
Adjacent to Īsadhara is a mountain called Yugandhara, which is higher than Īsadhara.
Kế Īsadhara là núi Yugandhara, cao hơn Īsadhara.
Tesampi antare eko sīdantaramahāsamuddo.
Between them too there is a single great Sīdantara ocean.
Giữa hai ngọn núi đó cũng có một đại dương mênh mông gọi là Sīdantara.
Yugandharassa anantare nemindharo nāma, so yugandharato uccataro.
Adjacent to Yugandhara is a mountain called Nemindhara, which is higher than Yugandhara.
Kế Yugandhara là núi Nemindhara, cao hơn Yugandhara.
Tesampi antare eko sīdantaramahāsamuddo.
Between them too there is a single great Sīdantara ocean.
Giữa hai ngọn núi đó cũng có một đại dương mênh mông gọi là Sīdantara.
Nemindharassa anantare vinatako nāma, so nemindharato uccataro.
Adjacent to Nemindhara is a mountain called Vinataka, which is higher than Nemindhara.
Kế Nemindhara là núi Vinataka, cao hơn Nemindhara.
Tesampi antare eko sīdantaramahāsamuddo.
Between them too there is a single great Sīdantara ocean.
Giữa hai ngọn núi đó cũng có một đại dương mênh mông gọi là Sīdantara.
Vinatakassa anantare assakaṇṇo nāma, so vinatakato uccataro.
Adjacent to Vinataka is a mountain called Assakaṇṇa, which is higher than Vinataka.
Kế Vinataka là núi Assakaṇṇa, cao hơn Vinataka.
Tesampi antare eko sīdantaramahāsamuddo.
Between them too there is a single great Sīdantara ocean.
Giữa hai ngọn núi đó cũng có một đại dương mênh mông gọi là Sīdantara.
Ete sīdantaramahāsamudde satta pabbatā anupaṭipāṭiyā samuggatā sopānasadisā hutvā ṭhitā’’ti (jā. aṭṭha. 6.22.569).
These seven mountains, having risen in sequence, stand like steps in the great Sīdantara oceans.”
Bảy ngọn núi này, với các đại dương Sīdantara xen kẽ, nổi lên theo thứ tự như những bậc thang.
Caturāsītisahassehi, kūṭehi paṭimaṇḍitoti sudassanakūṭacitrakūṭādīhi caturāsītikūṭasahassehi paṭimaṇḍito, sobhitoti attho.
Adorned with eighty-four thousand peaks means adorned, that is, beautified, with eighty-four thousand peaks such as Sudassanakūṭa, Citrakūṭa, and so on.
Được trang hoàng bởi tám mươi tư ngàn đỉnh núi, nghĩa là được trang hoàng, được tô điểm bởi tám mươi tư ngàn đỉnh núi như Sudassanakūṭa, Citrakūṭa, v.v.
Apicettha avuttopi ayaṃ viseso veditabbo (ma. ni. aṭṭha. 2.31; a. ni. aṭṭha. 3.8.19; su. ni. aṭṭha. selasuttavaṇṇanā) – ayaṃ himavā nāma pabbato samantato sandamānapañcasatanadīvicitto, yattha āyāmavitthārena ceva gambhīratāya ca paṇṇāsa paṇṇāsa yojanā diyaḍḍhayojanasataparimaṇḍalā anotattadaho kaṇṇamuṇḍadaho rathakāradaho chaddantadaho kuṇāladaho mandākinīdaho sīhappapātadahoti satta mahāsarā patiṭṭhitā.
Moreover, though not mentioned here, this special characteristic should be understood: This Himavā mountain is variegated with five hundred rivers flowing on all sides, where seven great lakes—Anotattadaha, Kaṇṇamuṇḍadaha, Rathakāradaha, Chaddantadaha, Kuṇāladaha, Mandākinīdaha, and Sīhappapātadaha—are established, each fifty yojanas in length, breadth, and depth, and one hundred and fifty yojanas in circumference.
Hơn nữa, ở đây cần biết một đặc điểm không được nói đến này là: Núi Himavā này được tô điểm bởi năm trăm con sông chảy ra từ mọi phía, nơi có bảy hồ lớn được thiết lập: hồ Anotatta, hồ Kaṇṇamuṇḍa, hồ Rathakāra, hồ Chaddanta, hồ Kuṇāla, hồ Mandākinī, hồ Sīhappapāta, mỗi hồ có chiều dài, chiều rộng và chiều sâu năm mươi do tuần, chu vi một trăm năm mươi do tuần.
Tesu anotatto sudassanakūṭaṃ citrakūṭaṃ kāḷakūṭaṃ gandhamādanakūṭaṃ kelāsakūṭanti imehi pañcahi pabbatehi parikkhitto.
Among these, Anotatta is surrounded by these five mountains: Sudassanakūṭa, Citrakūṭa, Kāḷakūṭa, Gandhamādanakūṭa, and Kelāsakūṭa.
Trong số đó, Anotatta được bao quanh bởi năm ngọn núi: Sudassanakūṭa, Citrakūṭa, Kāḷakūṭa, Gandhamādanakūṭa và Kelāsakūṭa.
Tattha sudassanakūṭaṃ sovaṇṇamayaṃ dviyojanasatubbedhaṃ antovaṅkaṃ kākamukhasaṇṭhānaṃ tameva saraṃ paṭicchādetvā ṭhitaṃ.
There, Sudassanakūṭa is golden, two hundred yojanas high, curved inwards, shaped like a crow’s mouth, and stands covering that very lake.
Trong đó, Sudassanakūṭa làm bằng vàng, cao hai trăm do tuần, uốn cong vào trong, có hình dạng giống miệng quạ, che phủ chính hồ đó.
Citrakūṭaṃ sabbaratanamayaṃ.
Citrakūṭa is made of all kinds of gems.
Citrakūṭa làm bằng tất cả các loại ngọc.
Kāḷakūṭaṃ añjanamayaṃ.
Kāḷakūṭa is made of collyrium.
Kāḷakūṭa làm bằng chì đen.
Gandhamādanakūṭaṃ sānumayaṃ abbhantare muggavaṇṇaṃ kāḷānusāriyādimūlagandho candanādisāragandho saralādipheggugandho lavaṅgāditacagandho kapiṭṭhādipapaṭikagandho sajjādirasagandho tamālādipattagandho nāgakuṅkumādipupphagandho jātiphalādiphalagandho sabbathā gandhabhāvato gandhagandhoti imehi dasahi gandhehi ussannaṃ nānappakāraosadhasañchannaṃ kāḷapakkhauposathadivase ādittamiva aṅgāraṃ jalantaṃ tiṭṭhati.
Gandhamādanakūṭa is made of rock, mugga-colored inside, abundant with these ten fragrances: root fragrances like kāḷānusārī, heartwood fragrances like sandalwood, soft wood fragrances like sarala, bark fragrances like cloves, rind fragrances like bael fruit, resin fragrances like sajjā, leaf fragrances like tamāla, flower fragrances like nāgakuṅkuma, fruit fragrances like nutmeg, and generally being fragrant in every respect, thus known as "fragrance of fragrances"; it is covered with various kinds of medicinal herbs, and on the uposatha days of the dark fortnight, it stands glowing like a burning coal.
Gandhamādanakūṭa là một sườn núi, bên trong có màu xanh đậu, nổi bật với mười loại hương: hương gốc như Kāḷānusāri, hương gỗ như gỗ đàn hương, hương vỏ cây như quế, hương vỏ quả như Kapiṭṭha, hương nhựa cây như Sajjā, hương lá như Tamāla, hương hoa như Nāgakuṅkuma, hương quả như Jātiphala, và tất cả đều là hương thơm, nên được gọi là Gandhagandha (hương của hương), được bao phủ bởi nhiều loại dược thảo, vào ngày trai giới của nửa tháng tối, nó đứng rực cháy như than hồng.
Tattheva nandamūlakaṃ (su. ni. aṭṭha. 1.35) nāma pabbhāraṃ paccekabuddhānaṃ vasanokāso.
There, Nandamūlaka is a mountain slope, an abode for Paccekabuddhas.
Chính tại đó có một hang động tên là Nandamūlaka, là nơi ở của các vị Độc Giác Phật.
Tisso guhāyo suvaṇṇaguhā maṇiguhā rajataguhāti.
There are three caves: a golden cave, a gem cave, and a silver cave.
Có ba hang động: hang vàng, hang ngọc và hang bạc.
Tattha maṇiguhādvāre mañjūsako nāma rukkho yojanaṃ ubbedhena, yojanaṃ vitthārena, so yattakāni udake vā thale vā pupphāni, sabbāni pupphati visesena paccekabuddhāgamanadivase, tassūparito sabbaratanamāḷo hoti.
At the entrance to the gem cave stands a tree called Mañjūsaka, a yojana in height and a yojana in width; it blossoms all flowers, whether in water or on land, especially on the day of a Paccekabuddha's arrival, and above it is a canopy made of all kinds of gems.
Tại cửa hang ngọc có một cây tên là Mañjūsaka, cao một do tuần, rộng một do tuần, nó nở tất cả các loại hoa, dù ở dưới nước hay trên cạn, đặc biệt vào ngày các vị Độc Giác Phật đến, phía trên nó có một mái vòm làm bằng tất cả các loại ngọc.
Tattha sammajjanakavāto kacavaraṃ chaḍḍeti, samakaraṇavāto sabbaratanamayaṃ vālikaṃ samaṃ karoti, siñcanakavāto anotattadahato ānetvā udakaṃ siñcati, sugandhakaraṇavāto sabbesaṃ gandharukkhānaṃ gandhe āneti, ocinakavāto pupphāni ocinitvā pāteti, santharaṇakavāto sabbattha santharati, sadā paññattāneva cettha āsanāni honti.
There, a sweeping wind discards rubbish, a leveling wind smooths the gem-strewn sand, a sprinkling wind brings water from the Anotatta lake and sprinkles it, a perfuming wind brings the fragrances of all fragrant trees, a picking wind picks flowers and drops them, a spreading wind spreads them everywhere, and seats are always prepared there.
Tại đó, gió quét dọn rác, gió san bằng làm cho cát ngọc bằng phẳng, gió tưới nước mang nước từ hồ Anotatta đến tưới, gió làm thơm mang hương thơm của tất cả các cây hương đến, gió hái hoa hái hoa và làm chúng rơi xuống, gió trải hoa trải khắp nơi, và luôn có những chỗ ngồi được sắp đặt sẵn ở đó.
Yesu paccekabuddhuppādadivase uposathadivase ca sabbapaccekabuddhā sannipatitvā nisīdanti, ayaṃ tattha pakati.
On these seats, on the day of a Paccekabuddha's arising and on uposatha days, all Paccekabuddhas gather and sit; this is the custom there.
Trên những chỗ ngồi này, vào ngày Độc Giác Phật xuất hiện và vào ngày trai giới, tất cả các vị Độc Giác Phật đều tụ họp và ngồi xuống, đây là thông lệ ở đó.
Abhisambuddhapaccekabuddho tattha gantvā paññattāsane nisīdati.
An enlightened Paccekabuddha goes there and sits on the prepared seat.
Một vị Độc Giác Phật mới thành tựu đến đó và ngồi trên chỗ ngồi đã được sắp đặt.
Tato sace tasmiṃ kāle aññepi paccekabuddhā saṃvijjanti, tepi taṅkhaṇaṃ sannipatitvā paññattāsanesu nisīdanti, nisīditvā kiñcideva samāpattiṃ samāpajjitvā vuṭṭhahanti.
Then, if other Paccekabuddhas are present at that time, they also immediately gather and sit on the prepared seats, and having sat, they enter into some attainment and then emerge.
Sau đó, nếu vào thời điểm đó có các vị Độc Giác Phật khác hiện diện, họ cũng lập tức tụ họp và ngồi trên các chỗ ngồi đã được sắp đặt, sau khi ngồi, họ nhập một số định và xuất định.
Tato saṅghatthero adhunāgataṃ paccekabuddhaṃ sabbesaṃ anumodanatthāya ‘‘kathamadhigata’’nti kammaṭṭhānaṃ pucchati, tadā so attano udānabyākaraṇagāthaṃ bhāsati.
Then the elder of the assembly asks the newly arrived Paccekabuddha about his meditation topic for the approval of all, saying, “How was it attained?” At that time, he recites his verse of solemn utterance (udāna).
Sau đó, vị trưởng lão Tăng hỏi vị Độc Giác Phật mới đến về đề mục thiền quán ‘‘đã chứng đắc như thế nào’’ để tất cả cùng hoan hỷ, lúc đó vị ấy nói lên bài kệ tự thán của mình.
Evamidaṃ gandhamādanakūṭaṃ paccekabuddhānaṃ āvāsaṭṭhānaṃ hotīti veditabbaṃ.
Thus, this Gandhamādanakūṭa should be understood as the dwelling place of Paccekabuddhas.
Như vậy, cần biết rằng Gandhamādanakūṭa này là nơi cư ngụ của các vị Độc Giác Phật.
Kelāsakūṭaṃ pana rajatamayaṃ.
Kelāsakūṭa, however, is made of silver.
Kelāsakūṭa thì làm bằng bạc.
Sabbāni cetāni citrakūṭādīni sudassanena samānubbedhasaṇṭhānāni tameva saraṃ paṭicchādetvā ṭhitāni.
And all these—Citrakūṭa and the others—are similar to Sudassanakūṭa in height and shape, and stand covering that very lake.
Tất cả những ngọn núi này, như Citrakūṭa, v.v., đều có chiều cao và hình dạng tương tự như Sudassana, che phủ chính hồ đó.
Sabbāni pana puthulato paññāsayojanāni, āyāmato pana ubbedhato viya dviyojanasatānevāti vadanti.
All of them are fifty yojanas wide, but in length, they say they are two hundred yojanas, like their height.
Tất cả đều rộng năm mươi do tuần, nhưng về chiều dài thì họ nói là hai trăm do tuần, giống như chiều cao.
Tāni sabbāni devānubhāvena nāgānubhāvena ca ṭhassanti, nadiyo ca tesu sandanti, taṃ sabbampi udakaṃ anotattameva pavisati, candimasūriyā dakkhiṇena vā uttarena vā gacchantā pabbatantarena tattha obhāsaṃ karonti, ujuṃ gacchantā na karonti, tenevassa ‘‘anotatta’’nti saṅkhā udapādi.
All of them remain due to the power of devas and the power of nāgas; rivers flow through them, and all that water enters Anotatta; the sun and moon, moving to the south or north, illuminate the area between the mountains, but do not do so when moving directly; for this reason, it acquired the name “Anotatta.”
Tất cả những ngọn núi đó đều đứng vững nhờ thần lực của chư thiên và thần lực của các loài rồng, các con sông cũng chảy qua chúng, tất cả nước đó đều đổ vào hồ Anotatta, mặt trăng và mặt trời khi di chuyển về phía nam hoặc phía bắc thì chiếu sáng vào giữa các ngọn núi, nhưng khi di chuyển thẳng thì không chiếu sáng, vì vậy mà nó có tên là ‘‘Anotatta’’ (không bị nung nóng).
Tattha ratanamayamanuññasopānasilātalāni nimmacchakacchapāni phalikasadisanimmalūdakāni nhānatitthāni tadupabhogīsattānaṃ sādhāraṇakammunāva suppaṭiyattāni susaṇṭhitāni honti, yesu buddhapaccekabuddhakhīṇāsavā ca iddhimanto ca isayo nhāyanti, devayakkhādayo uyyānakīḷaṃ kīḷanti.
There, pleasant bathing places with jewel-like, beautiful step-slabs, free from fish and turtles, with water as clear as crystal, are well-arranged and established by the common karma of the beings who use them, where Buddhas, Paccekabuddhas, Arahants, and powerful sages bathe, and devas, yakkhas, and others engage in garden play.
Ở đó, có những bậc đá quý thanh tịnh, những bãi tắm không có cá hay rùa, nước trong như pha lê, được chuẩn bị sẵn và sắp xếp đẹp đẽ bởi nghiệp chung của các chúng sinh hưởng dụng, nơi mà các vị Phật, Độc Giác Phật, A-la-hán và các vị ẩn sĩ có thần thông tắm rửa, chư thiên và dạ xoa vui chơi giải trí.
Tassa catūsu passesu sīhamukhaṃ hatthimukhaṃ assamukhaṃ usabhamukhanti cattāri mukhāni honti, yehi catasso nadiyo sandanti.
On its four sides are four mouths: a lion's mouth, an elephant's mouth, a horse's mouth, and a bull's mouth, through which four rivers flow.
Ở bốn phía của hồ có bốn cửa: cửa sư tử, cửa voi, cửa ngựa, cửa bò, từ đó bốn con sông chảy ra.
Sīhamukhena nikkhantanadītīre sīhā bahutarā honti, hatthimukhādīhi hatthiassausabhā.
Lions are more abundant on the riverbanks flowing from the lion's mouth, and elephants, horses, and bulls from the elephant's mouth and so on.
Bên bờ sông chảy ra từ cửa sư tử có nhiều sư tử, từ cửa voi, ngựa, bò thì có nhiều voi, ngựa, bò.
Puratthimadisato nikkhantanadī anotattaṃ tikkhattuṃ padakkhiṇaṃ katvā itarā tisso nadiyo anupagamma pācīnahimavanteneva amanussapathaṃ gantvā mahāsamuddaṃ pavisati.
The river emerging from the eastern direction circumambulates Anotatta three times, and without joining the other three rivers, it proceeds along the eastern Himavā, along a path inaccessible to humans, and enters the great ocean.
Dòng sông chảy ra từ phía đông, sau khi đi nhiễu quanh hồ Anotatta ba lần, không đi theo ba con sông kia mà đi qua vùng Himavanta phía đông, qua con đường không có người, rồi đổ vào đại dương.
Pacchimadisato ca uttaradisato ca nikkhantanadiyopi tatheva padakkhiṇaṃ katvā pacchimahimavanteneva uttarahimavanteneva ca amanussapathaṃ gantvā mahāsamuddaṃ pavisanti.
And the rivers flowing from the western and northern directions likewise circumambulate and enter the great ocean, having gone along the Western Himalayas and the Northern Himalayas through a path inaccessible to humans.
Các con sông chảy ra từ phía tây và phía bắc cũng vậy, sau khi nhiễu hữu (hồ Anotatta), đi qua dãy Hymalaya phía tây và dãy Hymalaya phía bắc theo con đường không người, rồi đổ vào đại dương.
Dakkhiṇadisato nikkhantanadī pana taṃ tikkhattuṃ padakkhiṇaṃ katvā dakkhiṇena ujukaṃ pāsāṇapiṭṭheneva saṭṭhi yojanāni gantvā pabbataṃ paharitvā vuṭṭhāya parikkhepena tigāvutappamāṇā udakadhārā hutvā ākāsena saṭṭhi yojanāni gantvā tiyaggaḷe nāma pāsāṇe patitā, pāsāṇo udakadhārāvegena bhinno.
But the river flowing from the southern direction, having circumambulated it three times, goes straight south for sixty yojanas along the surface of a rock, strikes a mountain, rises up, and, becoming a stream of water three gavutas in circumference, goes through the air for sixty yojanas and falls onto a rock called Tiyaggaḷa; the rock was split by the force of the water current.
Tuy nhiên, con sông chảy ra từ phía nam, sau khi nhiễu hữu hồ ấy ba lần, đi thẳng về phía nam qua mặt đá sáu mươi do tuần, đâm vào một ngọn núi và trồi lên, trở thành một dòng nước có chu vi ba gāvuta, đi trong không trung sáu mươi do tuần, rồi rơi xuống một tảng đá tên là Tiyaggaḷa; tảng đá bị vỡ do sức mạnh của dòng nước.
Tattha paññāsayojanappamāṇā tiyaggaḷā nāma mahāpokkharaṇī jātā, mahāpokkharaṇiyā kūlaṃ bhinditvā pāsāṇaṃ pavisitvā saṭṭhi yojanāni gatā, tato ghanapathaviṃ bhinditvā umaṅgena saṭṭhi yojanāni gantvā viñjhaṃ nāma tiracchānapabbataṃ paharitvā hatthatale pañcaṅgulisadisā pañcadhārā hutvā pavattati.
There, a great pond called Tiyaggaḷā, fifty yojanas in size, came into being. Breaking the bank of the great pond and entering the rock, it went for sixty yojanas. From there, breaking through solid earth and going through a tunnel for sixty yojanas, it strikes a transverse mountain called Viñjha and, becoming five streams like five fingers on the palm of a hand, flows on.
Tại đó, một hồ lớn tên là Tiyaggaḷa, rộng năm mươi do tuần, đã hình thành. Sau khi phá vỡ bờ hồ lớn, nó đi vào đá và chảy sáu mươi do tuần, rồi phá vỡ lớp đất cứng, đi qua một đường hầm sáu mươi do tuần, đâm vào một dãy núi ngang tên là Viñjha, rồi chảy thành năm dòng như năm ngón tay trên lòng bàn tay.
Sā tikkhattuṃ anotattaṃ padakkhiṇaṃ katvā gataṭṭhāne ‘‘āvaṭṭagaṅgā’’ti vuccati, ujukaṃ pāsāṇapiṭṭhena saṭṭhi yojanāni gataṭṭhāne ‘‘kaṇhagaṅgā’’ti, ākāsena saṭṭhi yojanāni gataṭṭhāne ‘‘ākāsagaṅgā’’ti, tiyaggaḷapāsāṇe paññāsayojanokāse ṭhitā ‘‘tiyaggaḷapokkharaṇī’’ti, kūlaṃ bhinditvā pāsāṇaṃ pavisitvā saṭṭhi yojanāni gataṭṭhāne ‘‘bahalagaṅgā’’ti, umaṅgena saṭṭhi yojanāni gataṭṭhāne ‘‘umaṅgagaṅgā’’ti vuccati.
Where it went, having circumambulated Anotatta three times, it is called ‘Āvaṭṭagaṅgā’; where it went straight along the surface of the rock for sixty yojanas, ‘Kaṇhagaṅgā’; where it went through the air for sixty yojanas, ‘Ākāsagaṅgā’; where it stood in the fifty-yojana space of the Tiyaggaḷa rock, ‘Tiyaggaḷapokkharaṇī’; where it broke the bank, entered the rock, and went for sixty yojanas, ‘Bahalagaṅgā’; and where it went through a tunnel for sixty yojanas, ‘Umaṅgagaṅgā’.
Khi nó nhiễu hữu hồ Anotatta ba lần rồi chảy đi, nó được gọi là “sông Āvaṭṭagaṅgā”; khi nó đi thẳng trên mặt đá sáu mươi do tuần, nó được gọi là “sông Kaṇhagaṅgā”; khi nó đi trong không trung sáu mươi do tuần, nó được gọi là “sông Ākāsagaṅgā”; khi nó ở trong tảng đá Tiyaggaḷa với diện tích năm mươi do tuần, nó được gọi là “hồ Tiyaggaḷa”; khi nó phá vỡ bờ và đi vào đá sáu mươi do tuần, nó được gọi là “sông Bahalagaṅgā”; khi nó đi qua đường hầm sáu mươi do tuần, nó được gọi là “sông Umaṅgagaṅgā”.
Viñjhaṃ nāma tiracchānapabbataṃ paharitvā pañcadhārā hutvā pavattaṭṭhāne pana gaṅgā yamunā aciravatī sarabhū mahīti pañcadhā saṅkhyaṃ gatā.
But where it strikes a transverse mountain called Viñjha and flows as five streams, the Gaṅgā is reckoned as fivefold: Gaṅgā, Yamunā, Aciravatī, Sarabhū, and Mahī.
Khi nó đâm vào dãy núi ngang tên là Viñjha và chảy thành năm dòng, nó được gọi là năm con sông: Gaṅgā, Yamunā, Aciravatī, Sarabhū, Mahī.
Evametā pañca mahānadiyo himavantato pabhavanti.
Thus, these five great rivers originate from the Himalayas.
Như vậy, năm con sông lớn này bắt nguồn từ dãy Hymalaya.
Chaddantadahassa pana (jā. aṭṭha. 5.16.chaddantajātakavaṇṇanā) majjhe dvādasayojanappamāṇe ṭhāne sevālo vā paṇakaṃ vā natthi, maṇikkhandhavaṇṇaṃ udakameva santiṭṭhati, tadanantaraṃ yojanavitthataṃ suddhakallahāravanaṃ taṃ udakaṃ parikkhipitvā ṭhitaṃ, tadanantaraṃ yojanavitthatameva suddhanīluppalavanaṃ taṃ parikkhipitvā ṭhitaṃ, yojanayojanavitthatāneva rattuppalasetuppalarattapadumasetapadumakumudavanāni purimaṃ purimaṃ parikkhipitvā ṭhitāni, imesaṃ pana sattannaṃ vanānaṃ anantaraṃ sabbesampi kallahārādīnaṃ vasena vomissakavanaṃ yojanavitthatameva tāni parikkhipitvā ṭhitaṃ, tadanantaraṃ nāgānaṃ kaṭippamāṇe udake yojanavitthatameva rattasālivanaṃ, tadanantaraṃ udakapariyante nīlapītalohitodātasurabhisukhumakusumasamākiṇṇaṃ khuddakagacchavananti imāni dasa vanāni yojanayojanavitthatāneva.
In the middle of Lake Chaddanta, in a place twelve yojanas in extent, there is no moss or water plants; only water the color of a gem cluster remains. Surrounding that water is a pure white water-lily forest, one yojana wide. Surrounding that, also one yojana wide, is a pure blue water-lily forest. And surrounding each preceding one are forests of red water-lilies, white water-lilies, red lotuses, white lotuses, and kumuda flowers, each one yojana wide. Beyond these seven forests, there is a mixed forest, one yojana wide, containing all kinds of water-lilies and so forth, surrounding them. Beyond that, in water up to the hips of nāgas, is a red rice field, also one yojana wide. Beyond that, at the edge of the water, is a forest of small shrubs, scattered with fragrant, delicate flowers of blue, yellow, red, and white. These ten forests are each one yojana wide.
Trong hồ Chaddanta (Jā. aṭṭha. 5.16.chaddantajātakavaṇṇanā), ở một khu vực rộng mười hai do tuần giữa hồ, không có rêu hay sâu bọ, chỉ có nước màu ngọc bích. Kế đó, một khu rừng hoa súng trắng tinh khiết rộng một do tuần bao quanh nước ấy. Kế đó, một khu rừng sen xanh tinh khiết cũng rộng một do tuần bao quanh khu rừng hoa súng. Các khu rừng sen đỏ, sen trắng, sen hồng, sen trắng và hoa súng, mỗi khu rộng một do tuần, bao quanh khu rừng trước đó. Sau bảy khu rừng này, một khu rừng hỗn hợp gồm tất cả các loại hoa súng và các loài khác, cũng rộng một do tuần, bao quanh chúng. Kế đó, một khu rừng lúa đỏ rộng một do tuần trong vùng nước ngang thắt lưng của voi. Kế đó, ở rìa nước, một khu rừng cây bụi nhỏ, rải rác những bông hoa nhỏ màu xanh lam, vàng, đỏ, trắng, thơm ngát. Mười khu rừng này đều rộng một do tuần.
Tato khuddakarājamāsamahārājamāsamuggavanaṃ, tadanantaraṃ tipusaeḷālukaalābukumbhaṇḍavallivanāni, tato pūgarukkhappamāṇaṃ ucchuvanaṃ, tato hatthidantappamāṇaphalaṃ kadalivanaṃ, tato sālavanaṃ, tadanantaraṃ cāṭippamāṇaphalaṃ panasavanaṃ, tato madhuraphalaṃ ambavanaṃ, tato ciñcavanaṃ, tato kapiṭṭhavanaṃ, tato vomissako mahāvanasaṇḍo, tato veṇuvanaṃ, veṇuvanaṃ pana parikkhipitvā satta pabbatā ṭhitā, tesaṃ bāhirantato paṭṭhāya paṭhamo cūḷakāḷapabbato nāma, dutiyo mahākāḷapabbato nāma, tato udakapassapabbato nāma, tato candapassapabbato nāma, tato sūriyapassapabbato nāma, tato maṇipassapabbato nāma, sattamo suvaṇṇapassapabbato nāma.
Then, a forest of small beans and large beans and mung beans. Beyond that, forests of cucumber, bitter gourd, bottle gourd, and pumpkin vines. Then, a sugarcane forest with canes as thick as areca nut trees. Then, a plantain forest with fruits the size of elephant tusks. Then, a sāla forest. Beyond that, a jackfruit forest with fruits the size of pots. Then, a sweet-fruited mango forest. Then, a tamarind forest. Then, a wood-apple forest. Then, a mixed great forest thicket. Then, a bamboo forest. Surrounding the bamboo forest stand seven mountains. Starting from their outer edge, the first is called Cūḷakāḷa Mountain, the second Mahākāḷa Mountain, then Udakapassa Mountain, then Candapassa Mountain, then Sūriyapassa Mountain, then Maṇipassa Mountain, and the seventh is called Suvaṇṇapassa Mountain.
Kế đó là khu rừng đậu nhỏ, đậu lớn, đậu xanh. Kế đó là các khu rừng dây bầu, bí đao, bí đỏ, bí rợ. Kế đó là khu rừng mía to bằng cây cau. Kế đó là khu rừng chuối có quả to bằng ngà voi. Kế đó là khu rừng cây sāla. Kế đó là khu rừng mít có quả to bằng cái vại. Kế đó là khu rừng xoài có quả ngọt. Kế đó là khu rừng me. Kế đó là khu rừng thị. Kế đó là một khu rừng lớn hỗn hợp. Kế đó là khu rừng tre. Bảy ngọn núi bao quanh khu rừng tre. Từ phía ngoài cùng của chúng, ngọn núi thứ nhất tên là Cūḷakāḷapabbata, ngọn thứ hai tên là Mahākāḷapabbata, kế đó là Udakapassapabbata, kế đó là Candapassapabbata, kế đó là Sūriyapassapabbata, kế đó là Maṇipassapabbata, và ngọn thứ bảy tên là Suvaṇṇapassapabbata.
So ubbedhato sattayojaniko chaddantadahaṃ parikkhipitvā pattassa mukhavaṭṭi viya ṭhito.
It is seven yojanas high and stands surrounding Lake Chaddanta like the rim of a bowl.
Ngọn núi đó cao bảy do tuần, bao quanh hồ Chaddanta như vành miệng bát.
Tassa abbhantarimapassaṃ suvaṇṇavaṇṇaṃ, tato nikkhantena obhāsena chaddantadaho samuggatabālasūriyo viya hoti.
Its inner side is golden in color, and by the light emanating from it, Lake Chaddanta appears like the rising morning sun.
Mặt bên trong của nó có màu vàng rực, và ánh sáng phát ra từ đó làm cho hồ Chaddanta trông như mặt trời sơ sinh vừa mọc.
Bāhirimapabbatesu pana eko ubbedhato cha yojanāni, eko pañca, eko cattāri, eko tīṇi, eko dve, eko yojanaṃ.
Among the outer mountains, one is six yojanas high, one five, one four, one three, one two, and one one yojana.
Trong số các ngọn núi bên ngoài, một ngọn cao sáu do tuần, một ngọn năm, một ngọn bốn, một ngọn ba, một ngọn hai, và một ngọn một do tuần.
Evaṃ sattapabbataparikkhittassa pana tassa dahassa pubbuttarakaṇṇe udakavātappaharaṇokāse mahānigrodharukkho, tassa khandho parikkhepato pañcayojaniko, ubbedhato sattayojaniko.
In the northeastern corner of that lake, surrounded by seven mountains, in a place where the wind strikes the water, stands a great banyan tree. Its trunk is five yojanas in circumference and seven yojanas high.
Như vậy, ở góc đông bắc của hồ được bao quanh bởi bảy ngọn núi đó, tại nơi có gió và nước thổi, có một cây đa lớn. Thân cây có chu vi năm do tuần, cao bảy do tuần.
Catūsu disāsu catasso sākhāyo chachayojanikā, uddhaṃ uggatasākhāpi chayojanikāva.
Its four branches in the four directions are each six yojanas long, and the upward-growing branch is also six yojanas long.
Bốn nhánh cây ở bốn hướng đều dài sáu do tuần, nhánh vươn lên trên cũng dài sáu do tuần.
Iti so mūlato paṭṭhāya ubbedhena terasayojaniko sākhānaṃ orimantato yāva pārimantā dvādasayojaniko aṭṭhahi pārohasahassehi paṭimaṇḍito muṇḍamaṇipabbato viya vilāsamāno tiṭṭhati.
Thus, from its root upwards, it is thirteen yojanas high, and from the near end of its branches to the far end, it is twelve yojanas wide, adorned with eight thousand aerial roots, standing resplendent like a bare gem mountain.
Vì vậy, từ gốc, nó cao mười ba do tuần, và từ đầu này đến đầu kia của các nhánh là mười hai do tuần. Nó được trang trí bởi tám ngàn rễ phụ, đứng sừng sững như một ngọn núi ngọc không có cây cối.
Chaddantadahassa pana pacchimadisābhāge suvaṇṇapabbate dvādasayojanikā kañcanaguhā.
In the western part of Lake Chaddanta, on a golden mountain, there is a golden cave twelve yojanas in extent.
Ở phía tây của hồ Chaddanta, trên núi vàng, có một hang vàng rộng mười hai do tuần.
Chaddanto nāgarājā vassāratte aṭṭhasahassanāgaparivuto kañcanaguhāyaṃ vasati, gimhakāle udakavātaṃ sampaṭicchamāno mahānigrodhamūle pārohantare tiṭṭhati.
During the rainy season, Chaddanta, the king of nāgas, resides in the golden cave, surrounded by eight thousand nāgas. In the summer, receiving the cool air from the water, he stands among the aerial roots at the foot of the great banyan tree.
Vua voi Chaddanta, cùng với tám ngàn con voi tùy tùng, sống trong hang vàng vào mùa mưa. Vào mùa hè, để đón gió mát từ nước, nó đứng dưới gốc cây đa lớn, giữa các rễ phụ.
Mandākiniyā pana majjhe pañcavīsatiyojanamatte ṭhāne sevālo vā paṇakaṃ vā natthi, phalikavaṇṇaṃ udakameva hoti, tato paraṃ pana nāgānaṃ kaṭippamāṇe udake aḍḍhayojanavitthataṃ setapadumavanaṃ taṃ udakaṃ parikkhipitvā ṭhitaṃ.
In the middle of the Mandākinī, in a place twenty-five yojanas in extent, there is no moss or water plants; only water clear as crystal remains. Beyond that, in water up to the hips of nāgas, a white lotus forest, half a yojana wide, stands surrounding the water.
Trong sông Mandākinī, ở một khu vực rộng hai mươi lăm do tuần giữa sông, không có rêu hay sâu bọ, chỉ có nước trong suốt như pha lê. Kế đó, một khu rừng sen trắng rộng nửa do tuần, trong vùng nước ngang thắt lưng của voi, bao quanh nước ấy.
Tattha muḷālaṃ naṅgalasīsamattaṃ hoti, bhisaṃ mahābheripokkharappamāṇaṃ hoti.
There, the lotus stem is the size of a plowshare, and the edible rhizome is the size of a great drum's skin.
Ở đó, cọng sen to bằng đầu cày, và củ sen to bằng mặt trống lớn.
Tassa ekekasmiṃ pabbantare āḷhakappamāṇaṃ khīraṃ hoti.
In each joint of it, there is milk the size of an āḷhaka measure.
Trong mỗi kẽ lá của nó có một lượng sữa bằng một āḷhaka.
Padumānaṃ pupphasamaye vāto reṇuvaṭṭiṃ uṭṭhāpetvā paduminīpattesu ṭhapeti, tattha udakaphusitāni patanti, tato ādiccapākena paccitvā pakkaayoghaṭikā viya pokkharamadhu tiṭṭhati, tadanantaraṃ tāvamahantameva rattapadumavanaṃ, tadanantaraṃ rattakumudavanaṃ, tadanantaraṃ setakumudavanaṃ, tadanantaraṃ nīluppalavanaṃ, tadanantaraṃ rattuppalavanaṃ, tadanantaraṃ sugandhasālivanaṃ, tadanantaraṃ eḷālukaalābukumbhaṇḍādīni madhurarasāni valliphalāni, tadanantaraṃ aḍḍhayojanavitthatameva ucchuvanaṃ, tattha pūgarukkhakkhandhappamāṇaṃ ucchu.
When the lotuses are in bloom, the wind raises a swirl of pollen and deposits it on the lotus leaves. Water droplets fall there, and by the heat of the sun, it ripens and stands like a ripened honey-pot, as lotus honey. Beyond that, a red lotus forest of the same great size. Beyond that, a red kumuda flower forest. Beyond that, a white kumuda flower forest. Beyond that, a blue water-lily forest. Beyond that, a red water-lily forest. Beyond that, a fragrant rice field. Beyond that, sweet-juiced vine fruits like bitter gourd, bottle gourd, and pumpkin. Beyond that, a sugarcane forest, half a yojana wide, where the sugarcane is as thick as an areca nut tree trunk.
Vào mùa hoa sen nở, gió thổi phấn hoa lên lá sen, nước mưa rơi xuống đó, rồi nhờ sức nóng mặt trời mà chín, tạo thành mật sen như những viên mật đã nấu chín. Kế đó là một khu rừng sen đỏ lớn tương tự, kế đó là khu rừng hoa súng đỏ, kế đó là khu rừng hoa súng trắng, kế đó là khu rừng sen xanh, kế đó là khu rừng sen đỏ, kế đó là khu rừng lúa thơm, kế đó là các loại quả dây leo ngọt ngào như bầu, bí đao, bí rợ, v.v. Kế đó là khu rừng mía rộng nửa do tuần, với những cây mía to bằng thân cây cau.
Tadanantaraṃ kadalivanaṃ, yato duve pakkāni khādantā kilamanti.
Beyond that, a plantain forest, where two ripe fruits are enough to cause weariness when eaten.
Kế đó là khu rừng chuối, nơi người ta mệt mỏi khi ăn hai quả chín.
Tadanantaraṃ cāṭippamāṇaphalaṃ panasavanaṃ, tadanantaraṃ ambavanaṃ, jambuvanaṃ, kapiṭṭhavananti saṅkhepato tasmiṃ dahe khāditabbayuttakaṃ phalaṃ nāma natthīti na vattabbaṃ.
Beyond that, a jackfruit forest with fruits the size of pots. Beyond that, a mango forest, a rose-apple forest, and a wood-apple forest. In short, it cannot be said that there is no fruit fit for eating in that lake.
Kế đó là khu rừng mít có quả to bằng cái vại, kế đó là khu rừng xoài, khu rừng trâm, khu rừng thị. Tóm lại, không thể nói rằng không có trái cây nào đáng ăn trong hồ đó.
Iti imasmiṃ himavati vijjamānakasattamahāsarappabhutīnaṃ pamāṇasaṇṭhānādibhedaṃ sabbameva visesaṃ bhagavā sabbathā avedi aññāsi paṭivijjhiyevāti daṭṭhabbaṃ.
Thus, it should be understood that the Blessed One knew, understood, and thoroughly comprehended in every way all the details, such as the size, shape, and other distinctions, of the seven great lakes and other existing features in this Himavā.
Như vậy, cần phải hiểu rằng Đức Bhagavā đã biết, đã thấu hiểu và đã quán triệt mọi chi tiết đặc biệt về kích thước, hình dạng, v.v., của bảy hồ lớn hiện hữu trên dãy Hy Mã Lạp Sơn này.
Tipañcayojanakkhandhaparikkhepāti pannarasayojanappamāṇakkhandhaparikkhepā, khandhassa pariṇāho pannarasayojanappamāṇoti vuttaṃ hoti.
The phrase " Tipañcayojanakkhandhaparikkhepā" means having a trunk circumference of fifteen yojanas in measure. It is said that the circumference of the trunk is fifteen yojanas in measure.
Tipañcayojanakkhandhaparikkhepā (với chu vi thân cây mười lăm dojana) nghĩa là chu vi thân cây có kích thước mười lăm dojana; có nghĩa là chu vi của thân cây có kích thước mười lăm dojana.
Nagavhayāti nagasaddena avhātabbā, rukkhābhidhānāti attho.
" Nagavhayā" means that which is to be called by the word 'naga', meaning the name of a tree.
Nagavhayā (được gọi là naga) nghĩa là được gọi bằng từ "naga", tức là tên của một cái cây.
Rukkho hi na gacchatīti nagoti vuccati.
A tree is called 'naga' because it does not move.
Cây được gọi là "naga" vì nó không di chuyển (na gacchati).
Nagavhayā jambūti yojetabbaṃ.
It should be construed as "Jambū, called Naga".
Cần phải ghép lại là "cây jambu được gọi là naga".
Paññāsayojanakkhandhasākhāyāmāti ubbedhato paññāsayojanappamāṇakkhandhāyāmā ubbedhato samantato ca paññāsayojanasākhāyāmā ca.
" Paññāsayojanakkhandhasākhāyāmā" means having a trunk length of fifty yojanas in height and branches extending fifty yojanas all around.
Paññāsayojanakkhandhasākhāyāmā (với thân cây và cành cây dài năm mươi dojana) nghĩa là thân cây có chiều cao năm mươi dojana và các cành cây có chiều cao và chiều rộng xung quanh năm mươi dojana.
Tato eva satayojanavitthiṇṇā, tāvadeva ca uggatā.
Therefore, it is also " a hundred yojanas wide, and risen just as high."
Vì lẽ đó, rộng một trăm dojana và cao cũng chừng ấy.
Jamburukkhassa hi mūlato paṭṭhāya yāva sākhāviṭapā, tāva paṇṇāsa yojanāni, tato parampi ujukaṃ uggatasākhā paṇṇāsa yojanāni, samantato ca ekekā sākhā paṇṇāsa paṇṇāsa yojanāni vaḍḍhitāni.
From the root of the Jambū tree up to its main branches is fifty yojanas; beyond that, the straight rising branches are fifty yojanas; and each branch extends fifty yojanas all around.
Thật vậy, từ gốc cây jambu cho đến các cành cây lớn là năm mươi dojana, và từ đó trở lên, các cành cây thẳng đứng cũng năm mươi dojana, và mỗi cành cây xung quanh cũng vươn dài năm mươi dojana.
Tāsu pana mahantā mahantā nadiyo sandanti, tāsaṃ nadīnaṃ ubhayatīre jambupakkānaṃ patitaṭṭhāne suvaṇṇaṅkurā uṭṭhahanti, te nadījalena vuyhamānā anupubbena mahāsamuddaṃ pavisanti, tatoyeva jambunadiyaṃ nibbattattā ‘‘jambunada’’nti taṃ suvaṇṇaṃ vuccati.
In these (branches), mighty rivers flow, and on both banks of these rivers, at the places where Jambū fruits fall, golden sprouts emerge. These, carried by the river water, gradually enter the great ocean, and it is from this that the gold is called "Jambūnada," having originated in the Jambū river.
Trên những cành cây ấy, những con sông lớn chảy xiết, và ở hai bên bờ của những con sông ấy, tại những nơi quả jambu rơi xuống, những chồi vàng mọc lên. Chúng bị nước sông cuốn trôi dần dần và đổ vào đại dương. Chính từ đó, loại vàng ấy được gọi là “jambunada” vì nó được sinh ra từ sông Jambū.
Tesu pana candamaṇḍalaṃ (dī. ni. aṭṭha. 3.121) heṭṭhā, sūriyamaṇḍalaṃ upari, antarā nesaṃ yojanaṃ hoti.
Of these, the moon's disk is below, and the sun's disk is above; there is a yojana between them.
Trong số đó, mặt trăng ở dưới, mặt trời ở trên, và khoảng cách giữa chúng là một dojana.
Candassa heṭṭhimantato sūriyassa uparimantaṃ yojanasataṃ hoti, candavimānaṃ anto maṇimayaṃ, bahi rajatena parikkhittaṃ, anto ca bahi ca sītalameva hoti.
From the lowest edge of the moon to the highest edge of the sun is one hundred yojanas. The moon's palace is made of jewels within and surrounded by silver externally; it is cold both within and without.
Từ điểm thấp nhất của mặt trăng đến điểm cao nhất của mặt trời là một trăm dojana. Thiên cung mặt trăng bên trong làm bằng ngọc, bên ngoài được bao quanh bằng bạc, cả bên trong lẫn bên ngoài đều lạnh giá.
Sūriyavimānaṃ anto kanakamayaṃ, bāhiraṃ phalikaparikkhittaṃ hoti, anto ca bahi ca uṇhameva.
The sun's palace is made of gold within and surrounded by crystal externally; it is hot both within and without.
Thiên cung mặt trời bên trong làm bằng vàng, bên ngoài được bao quanh bằng pha lê, cả bên trong lẫn bên ngoài đều nóng bức.
Cando ujukaṃ saṇikaṃ gacchati.
The moon moves slowly in a straight path.
Mặt trăng đi thẳng và chậm rãi.
So hi amāvāsiyaṃ sūriyena saddhiṃ gacchanto divase divase thokaṃ thokaṃ ohīyanto puṇṇamāsiyaṃ upaḍḍhamaggato ohīyati, tiriyaṃ pana sīghaṃ gacchati.
On the new moon day (amāvāsī), moving with the sun, it gradually falls behind each day, and on the full moon day (puṇṇamāsī), it falls behind by half a path; however, it moves quickly across (the sky).
Vào ngày không trăng (amāvāsī), nó đi cùng với mặt trời, rồi mỗi ngày một ít lại tụt lại phía sau, đến ngày rằm (puṇṇamāsī) thì nó tụt lại phía sau nửa chặng đường; nhưng theo chiều ngang thì nó đi nhanh.
Tathā hesa ekasmiṃ māse kadāci dakkhiṇato, kadāci uttarato dissati, candassa ubhosu passesu nakkhattatārakā gacchanti, cando dhenu viya vacchaṃ taṃ taṃ nakkhattaṃ upasaṅkamati, nakkhattāni pana attano gamanaṭṭhānaṃ na vijahanti, attano vīthiyāva gacchanti.
Thus, in one month, it is sometimes seen in the south, sometimes in the north. The constellations and stars move on both sides of the moon. The moon approaches each constellation like a cow approaching its calf, but the constellations do not abandon their path; they move in their own orbits.
Cũng vậy, trong một tháng, đôi khi nó xuất hiện ở phía nam, đôi khi ở phía bắc. Các vì sao và chòm sao đi ở hai bên mặt trăng. Mặt trăng đến gần từng chòm sao như bò mẹ đến gần bê con. Nhưng các chòm sao không rời bỏ vị trí di chuyển của mình, chúng đi trên quỹ đạo của riêng mình.
Sūriyassa pana ujukaṃ gamanaṃ sīghaṃ, tiriyaṃ gamanaṃ dandhaṃ.
The sun's straight movement is fast, its lateral movement is slow.
Còn mặt trời thì đi thẳng nhanh, đi ngang chậm.
Tiriyaṃ gamanaṃ nāma dakkhiṇadisato uttaradisāya, uttaradisato dakkhiṇadisāya gamanaṃ, taṃ dandhaṃ chahi chahi māsehi ijjhanato.
Lateral movement means moving from the south to the north and from the north to the south, which is slow because it is completed in six months.
Việc đi ngang nghĩa là đi từ hướng nam đến hướng bắc, và từ hướng bắc đến hướng nam; việc đó chậm vì phải mất sáu tháng để hoàn thành.
Sūriyo kāḷapakkhauposathe candena saheva gantvā tato paraṃ pāṭipadadivase yojanānaṃ satasahassaṃ candamaṇḍalaṃ ohāya gacchati attano sīghagāmitāya tassa ca dandhagāmitāya, atha cando lekhā viya paññāyati.
On the Uposatha day of the dark half, the sun travels together with the moon, and thereafter, on the first day of the fortnight, it moves ahead of the moon's disk by a hundred thousand yojanas due to its fast movement and the moon's slow movement, and then the moon appears like a thin line.
Vào ngày trai giới của kỳ trăng khuyết, mặt trời đi cùng với mặt trăng, rồi sau đó, vào ngày đầu tiên của kỳ trăng khuyết, mặt trời bỏ lại mặt trăng một trăm ngàn dojana và đi tiếp do sự nhanh chóng của nó và sự chậm chạp của mặt trăng. Lúc đó, mặt trăng xuất hiện như một đường kẻ.
Tato parampi pakkhassa dutiyāya yojanānaṃ satasahassaṃ candamaṇḍalaṃ ohāya gacchati.
Thereafter, on the second day of the fortnight, it moves ahead of the moon's disk by a hundred thousand yojanas.
Sau đó, vào ngày thứ hai của kỳ trăng khuyết, nó lại bỏ mặt trăng một trăm ngàn dojana và đi tiếp.
Evaṃ divase divase yāva sukkapakkhauposathadivasā satasahassaṃ satasahassaṃ ohāya gacchati, atha cando anukkamena vaḍḍhitvā uposathadivase paripuṇṇo hoti.
Thus, day by day, it moves ahead by a hundred thousand yojanas until the Uposatha day of the bright half, and then the moon gradually increases and becomes full on the Uposatha day.
Cứ như vậy, mỗi ngày nó lại bỏ lại một trăm ngàn dojana cho đến ngày trai giới của kỳ trăng sáng, lúc đó mặt trăng dần dần tăng lên và trở nên tròn đầy vào ngày trai giới.
Anukkamena vaḍḍhanañcettha uparibhāgato patitasūriyālokatāya heṭṭhato pavattāya sūriyassa dūrabhāvena divase divase anukkamena parihāyamānāya attano chāyāya vasena anukkamena caṇḍamaṇḍalappadesassa vaḍḍhamānassa viya dissamānatāyāti veditabbaṃ, tasmā anukkamena vaḍḍhitvā viya uposathadivase puṇṇamāyaṃ paripuṇṇamaṇḍalo hutvā dissati.
The gradual increase here should be understood as the moon's disk appearing to gradually increase due to the sun's light falling from above, and the sun's distance from below causing its shadow to gradually decrease day by day. Therefore, it appears as if it gradually increases and becomes a full disk on the full moon Uposatha day.
Sự tăng lên dần dần ở đây cần phải hiểu là do ánh sáng mặt trời chiếu xuống từ phía trên, và do mặt trời ở xa nên bóng của nó dần dần giảm đi mỗi ngày, khiến cho phần mặt trăng xuất hiện như đang tăng lên dần dần. Do đó, nó xuất hiện như thể dần dần tăng lên và trở nên tròn đầy vào ngày rằm của ngày trai giới.
Atha sūriyo pāṭipadadivase yojanānaṃ satasahassaṃ dhāvitvā puna candamaṇḍalaṃ gaṇhāti candassa dandhagatitāya attano ca sīghagatitāya, tathā dutiyāya satasahassanti evaṃ yāva uposathadivasā satasahassaṃ satasahassaṃ dhāvitvā gaṇhāti.
Then, on the first day of the fortnight, the sun races a hundred thousand yojanas and again overtakes the moon's disk due to the moon's slow movement and its own fast movement. Similarly, on the second day, it races a hundred thousand (yojanas), and so on, racing a hundred thousand (yojanas) until the Uposatha day, it overtakes.
Sau đó, vào ngày đầu tiên của kỳ trăng khuyết, mặt trời đi một trăm ngàn dojana rồi lại bắt kịp mặt trăng do sự chậm chạp của mặt trăng và sự nhanh chóng của mặt trời. Tương tự, vào ngày thứ hai là một trăm ngàn dojana, cứ như vậy cho đến ngày trai giới, nó đi một trăm ngàn dojana mỗi ngày và bắt kịp.
Atha cando anukkamena hāyitvā kāḷapakkhauposathadivase sabbaso na paññāyati, anukkamena hāyamānatā cettha anukkamena vaḍḍhamānatāya vuttanayena veditabbā.
Then the moon gradually wanes and is not visible at all on the Uposatha day of the dark half. The gradual waning here should be understood in the same way as the gradual increasing was explained.
Sau đó, mặt trăng dần dần suy giảm và hoàn toàn không xuất hiện vào ngày trai giới của kỳ trăng khuyết. Sự suy giảm dần dần ở đây cần phải hiểu theo cách đã nói về sự tăng lên dần dần.
Tattha pana chāyāya hāyamānatāya maṇḍalaṃ vaḍḍhamānaṃ viya dissati, idha ca chāyāya vaḍḍhamānatāya maṇḍalaṃ hāyamānaṃ viya dissati, tasmā anukkamena hāyitvā viya uposathadivase sabbaso na paññāyati.
There, due to the waning of the shadow, the disk appears to increase, and here, due to the increasing of the shadow, the disk appears to wane. Therefore, it appears to gradually wane and is not visible at all on the Uposatha day.
Ở đó, do bóng giảm đi, mặt trăng xuất hiện như đang tăng lên; còn ở đây, do bóng tăng lên, mặt trăng xuất hiện như đang suy giảm. Do đó, nó xuất hiện như thể dần dần suy giảm và hoàn toàn không xuất hiện vào ngày trai giới.
Candaṃ heṭṭhā katvā sūriyo upari hoti, mahatiyā pātiyā khuddakabhājanaṃ viya candamaṇḍalaṃ pidhīyati, majjhanhike gehacchāyā viya candassa chāyā na paññāyati.
With the moon below and the sun above, the moon's disk is covered like a small vessel by a large bowl; at midday, like the shadow of a house, the moon's shadow is not visible.
Mặt trăng ở dưới và mặt trời ở trên, mặt trăng bị che khuất như một chiếc bát nhỏ bị một cái đĩa lớn che. Vào giữa trưa, bóng của mặt trăng không xuất hiện như bóng của một ngôi nhà.
So chāyāya apaññāyamānāya dūre ṭhitānaṃ divā padīpo viya sayampi na paññāyati.
Since its shadow is not visible, it itself is not visible to those standing far away, like a lamp during the day.
Khi bóng của nó không xuất hiện, bản thân nó cũng không xuất hiện như một ngọn đèn vào ban ngày đối với những người đứng ở xa.
Imesaṃ pana ajavīthi nāgavīthi govīthīti tisso gamanavīthiyo honti.
These (celestial bodies) have three paths of movement: Ajavīthi, Nāgavīthi, and Govīthi.
Tuy nhiên, chúng có ba con đường di chuyển là Ajavīthi, Nāgavīthi và Govīthi.
Tattha ajānaṃ udakaṃ paṭikūlaṃ hoti, hatthināgānaṃ manāpaṃ, gunnaṃ sītuṇhasamatāya phāsu hoti.
There, water is disagreeable to goats, agreeable to lordly elephants, and comfortable for cattle due to the moderation of heat and cold.
Ở đó, nước thì khó chịu đối với dê, dễ chịu đối với voi chúa, và thuận lợi cho bò vì sự cân bằng nóng lạnh.
Tathā ca yāya vīthiyā sūriye gacchante vassavalāhakadevaputtā sūriyābhitāpasantattā attano vimānato na nikkhamanti, kīḷāpasutā hutvā na vicaranti, tadā kira sūriyavimānaṃ pakatimaggato adho otaritvā vicarati, tassa oruyha caraṇeneva candavimānampi adho oruyha carati taggatikattā, tasmā sā vīthi udakābhāvena ajānurūpatāya ‘‘ajavīthī’’ti samaññā gatā.
And similarly, along whichever path the sun travels, if the rain-cloud devaputtas, scorched by the sun's intense heat, do not emerge from their celestial mansions, nor wander about immersed in play, then, it is said, the sun's celestial mansion descends from its usual path and moves below. Due to its downward movement, the moon's celestial mansion also moves below, being dependent on its course. Therefore, that path, due to the absence of water and its suitability for goats, is known as "Ajavīthī" (Goat's Path).
Cũng vậy, trên con đường mà khi mặt trời đi qua, các vị thiên tử mây mưa (vassavalāhaka devaputtā) do bị sức nóng mặt trời thiêu đốt nên không rời khỏi cung điện của mình, không vui đùa đi lại; khi đó, cung điện mặt trời được cho là đi xuống thấp hơn con đường thông thường mà đi, và do việc nó đi xuống thấp như vậy, cung điện mặt trăng cũng đi xuống thấp mà đi vì nó cùng một quỹ đạo. Do đó, con đường ấy, vì thiếu nước, giống như dê, được gọi là ‘ajavīthī’ (đường dê).
Yāya pana vīthiyā sūriye gacchante vassavalāhakadevaputtā sūriyābhitāpābhāvato abhiṇhaṃ attano vimānato bahi nikkhamitvā kīḷāpasutā hutvā ito cito ca vicaranti, tadā kira sūriyavimānaṃ pakatimaggato uddhaṃ āruhitvā vicarati, tassa uddhaṃ āruyha caraṇeneva candavimānampi uddhaṃ āruyha carati taggatikattā, taggatikatā ca samānagati nāma vātamaṇḍalena vimānassa phellitabbattā, tasmā sā vīthi udakabahubhāvena nāgānurūpatāya ‘‘nāgavīthī’’ti samaññā gatā.
However, along whichever path the sun travels, if the rain-cloud devaputtas, due to the absence of the sun's intense heat, frequently emerge from their celestial mansions and wander about here and there, immersed in play, then, it is said, the sun's celestial mansion ascends from its usual path and moves above. Due to its upward movement, the moon's celestial mansion also moves above, being dependent on its course. And being dependent on its course means having a similar movement because the celestial mansion is propelled by the wind sphere. Therefore, that path, due to the abundance of water and its suitability for elephants, is known as "Nāgavīthī" (Elephant's Path).
Còn trên con đường mà khi mặt trời đi qua, các vị thiên tử mây mưa do không có sức nóng mặt trời nên thường xuyên rời khỏi cung điện của mình, vui đùa đi lại đây đó; khi đó, cung điện mặt trời được cho là đi lên cao hơn con đường thông thường mà đi, và do việc nó đi lên cao như vậy, cung điện mặt trăng cũng đi lên cao mà đi vì nó cùng một quỹ đạo. Và sự cùng một quỹ đạo là sự di chuyển đồng bộ, vì cung điện bị gió thổi. Do đó, con đường ấy, vì có nhiều nước, giống như voi, được gọi là ‘nāgavīthī’ (đường voi).
Yadā sūriyo uddhaṃ anārohanto adho ca anotaranto pakatimaggeneva gacchati, tadā vassavalāhakā yathākālaṃ yathāruciñca vimānato nikkhamitvā sukhena vicaranti, tena kālena kālaṃ vassanato loke utusamatā hoti, tāya utusamatāya hetubhūtāya sā candimasūriyānaṃ gati gavānurūpatāya ‘‘govīthī’’ti samaññā gatā.
When the sun travels along its usual path, neither ascending nor descending, then the rain-clouds emerge from their celestial mansions at the proper time and as they please, and wander about happily. Due to this, the season in the world has an equanimity of temperature from time to time. With this equanimity of temperature as the cause, that path of the moon and sun, due to its suitability for cattle, is known as "Govīthī" (Cow's Path).
Khi mặt trời không đi lên cao cũng không đi xuống thấp mà đi trên con đường thông thường, khi đó các vị thiên tử mây mưa tùy thời gian và tùy ý thích mà rời khỏi cung điện vui vẻ đi lại. Vào thời điểm đó, trên thế gian có sự cân bằng thời tiết, và do sự cân bằng thời tiết đó là nguyên nhân, sự di chuyển của mặt trăng và mặt trời giống như bò, được gọi là ‘govīthī’ (đường bò).
Tasmā yaṃ kālaṃ candimasūriyā ajavīthiṃ āruhanti, tadā devo ekabindumpi na vassati.
Therefore, when the moon and sun ascend the Ajavīthī, the deity does not rain a single drop.
Do đó, khi mặt trăng và mặt trời đi vào đường dê (ajavīthī), khi đó trời không mưa dù chỉ một giọt.
Yadā nāgavīthiṃ ārohanti, tadā bhinnaṃ viya nabhaṃ paggharati.
When they ascend the Nāgavīthī, the sky pours forth as if broken.
Khi đi vào đường voi (nāgavīthī), khi đó trời đổ mưa như thể bầu trời bị vỡ.
Yadā govīthiṃ ārohanti, tadā utusamatā sampajjati.
When they ascend the Govīthī, an equanimity of temperature is attained.
Khi đi vào đường bò (govīthī), khi đó thời tiết trở nên cân bằng.
Yadā pana rājāno adhammikā honti, tesaṃ adhammikatāya uparājasenāpatippabhutayo sabbe devā brahmāno ca adhammikā honti, tadā tesaṃ adhammikatāya visamaṃ candimasūriyā parivattanti.
However, when kings are unrighteous, due to their unrighteousness, all the devas, Brahmās, and those beginning with the vice-king and general, become unrighteous. Then, due to their unrighteousness, the moon and sun revolve erratically.
Tuy nhiên, khi các vị vua không có chánh pháp, do sự bất chánh của họ, tất cả các vị vua phụ, tướng lĩnh và các vị chư thiên, Phạm thiên đều trở nên bất chánh. Khi đó, do sự bất chánh của họ, mặt trăng và mặt trời di chuyển bất thường.
Tadā hi bahvābādhatādianiṭṭhaphalūpanissayabhūtassa yathāvuttassa adhammikatāsaññitassa sādhāraṇassa pāpakammassa balena visamaṃ vāyantena vāyunā phelliyamānā candimasūriyā sineruṃ parikkhipantā visamaṃ parivattanti, yathāmaggena na pavattanti.
At that time, indeed, due to the power of the common evil kamma, called unrighteousness, as described, which is the basis for undesirable results such as many ailments, the moon and sun, being propelled by the wind blowing erratically, revolve erratically as they encircle Sineru; they do not proceed along the proper path.
Khi đó, do sức mạnh của nghiệp ác chung đã nói trên, được gọi là sự bất chánh, là nguyên nhân của những quả bất lợi như nhiều bệnh tật, mặt trăng và mặt trời bị gió thổi một cách bất thường mà xoay quanh núi Sineru, di chuyển bất thường, không đi theo con đường đúng.
Vāto yathāmaggena na vāyati, ayathāmaggena vāyati, ayathāmaggena vāyanto ākāsaṭṭhavimānāni khobheti, vimānesu khobhitesu devatānaṃ kīḷanatthāya cittāni na namanti, cittesu anamantesu sītuṇhabhedo utu yathākālena na sampajjati, tasmiṃ asampajjante na sammā devo vassati, kadāci vassati, kadāci na vassati, katthaci vassati, katthaci na vassati.
The wind does not blow along the proper path, it blows along an improper path. Blowing along an improper path, it disturbs the celestial mansions in the sky. When the celestial mansions are disturbed, the minds of the deities are not inclined to play. When their minds are not inclined, the season, with its distinction of heat and cold, is not attained at the proper time. When it is not attained, the deity does not rain properly; sometimes it rains, sometimes it does not rain; sometimes it rains in one place, sometimes not in another.
Gió không thổi theo đường đúng, mà thổi theo đường sai. Khi gió thổi theo đường sai, nó làm rung chuyển các cung điện trên không. Khi các cung điện bị rung chuyển, tâm trí của các vị chư thiên không hướng đến việc vui chơi. Khi tâm trí không hướng đến, thời tiết nóng lạnh không cân bằng theo đúng thời điểm. Khi điều đó không xảy ra, trời không mưa đúng cách, đôi khi mưa, đôi khi không mưa, nơi này mưa, nơi kia không mưa.
Vassantopi vappakāle aṅkurakāle nāḷakāle pupphakāle khīraggahaṇādikālesu yathā yathā sassānaṃ upakāro na hoti, tathā tathā vassati ca vigacchati ca.
Even when it rains, it rains and ceases in such a way that it is not beneficial to the crops during the sowing season, the sprouting season, the stalk season, the flowering season, the milk-formation season, and so on.
Dù có mưa, nhưng vào thời điểm gieo trồng, nảy mầm, ra thân, ra hoa, kết sữa, v.v., nó mưa và ngừng mưa theo cách không có lợi cho cây trồng.
Tena sassāni visamapākāni honti vigatagandharasādisampadāni, ekabhājane pakkhittataṇḍulesupi ekasmiṃ padese bhattaṃ uttaṇḍulaṃ hoti, ekasmiṃ atikilinnaṃ, ekasmiṃ samapākaṃ.
Due to this, the crops ripen unevenly and lose their fragrant aroma and other good qualities. Even among grains placed in a single container, in one part, the cooked rice is uncooked, in another, it is overcooked, and in another, it is perfectly cooked.
Do đó, cây trồng có quả bất thường, mất đi hương vị và các phẩm chất khác. Ngay cả gạo nấu trong cùng một nồi, ở một chỗ cơm bị sống, ở một chỗ quá nhão, ở một chỗ chín vừa.
Taṃ paribhuttaṃ kucchiyampi sabbaso apariṇataṃ, ekadesena pariṇataṃ, supariṇatanti evaṃ tīhiyeva pakārehi paccati, pakkāsayaṃ na sammā upagacchati.
When consumed, it is not fully digested in the stomach at all, or it is digested in part, or it is well-digested; thus it cooks in only these three ways and does not reach the digestive organ properly.
Khi ăn vào, nó tiêu hóa trong bụng hoàn toàn không chín, chín một phần, hoặc chín hoàn toàn, như vậy chỉ có ba cách tiêu hóa, không đến được ruột già một cách đúng đắn.
Tena sattā bahvābādhā ceva honti appāyukā ca.
Because of this, beings suffer from many ailments and have short lives.
Do đó, chúng sinh mắc nhiều bệnh tật và đoản mệnh.
Dhammikānaṃ pana rājūnaṃ kāle vuttavipariyāyena candimasūriyā samaṃ parivattanti, yathāmaggena pavattanti, utusamatā ca sampajjati, candimasūriyā cha māse sineruto bahi nikkhamanti, cha māse anto vicaranti.
However, in the time of righteous kings, contrary to what has been said, the moon and sun revolve evenly, proceed along their proper path, and an equanimity of temperature is attained. The moon and sun emerge from Sineru for six months and wander within for six months.
Tuy nhiên, vào thời của các vị vua có chánh pháp, ngược lại với những gì đã nói, mặt trăng và mặt trời di chuyển đều đặn, đi theo con đường đúng, và thời tiết trở nên cân bằng. Mặt trăng và mặt trời đi ra ngoài núi Sineru sáu tháng, và đi vào bên trong sáu tháng.
Tathā hi sinerusamīpena taṃ padakkhiṇaṃ katvā gacchantā cha māse tato gamanavīthito bahi attano tiriyaṃ gamanena cakkavāḷābhimukhā nikkhamanti.
Thus, passing by Sineru, circumambulating it, they emerge outwards, towards the Cakkavāḷa, for six months by their horizontal movement from that path of travel.
Cũng vậy, khi đi vòng quanh núi Sineru, chúng đi ra ngoài con đường di chuyển đó trong sáu tháng, hướng về Cakkavāḷa (vòng vũ trụ) bằng cách di chuyển ngang của chúng.
Evaṃ cha māse khaṇe khaṇe sineruto apasakkanavasena tato nikkhamitvā cakkavāḷasamīpaṃ pattā.
In this way, having emerged from Sineru, gradually moving away from it moment by moment for six months, they reach near the Cakkavāḷa.
Như vậy, trong sáu tháng, từng khoảnh khắc, chúng rời khỏi Sineru và đến gần Cakkavāḷa.
Tatopi cha māse khaṇe khaṇe apasakkanavasena nikkhamitvā sinerusamīpaṃ pāpuṇantā anto vicaranti.
From there too, for six months, gradually moving away moment by moment, they wander within, reaching near Sineru.
Từ đó, trong sáu tháng, từng khoảnh khắc, chúng rời khỏi Cakkavāḷa và đến gần Sineru, đi vào bên trong.
Te hi āsāḷhīmāse sinerusamīpena caranti, tato dve māse nikkhamitvā bahi caranti.
Indeed, they travel near Sineru in the month of Āsāḷha, then emerge and travel further out for two months.
Vào tháng Āsāḷhī (tháng 7), chúng đi gần Sineru, sau đó trong hai tháng chúng đi ra ngoài.
Paṭhamakattikamāse majjhena gacchanti, tato cakkavāḷābhimukhā gantvā tayo māse cakkavāḷasamīpena vicaritvā puna nikkhamitvā citramāse majjhena gantvā tato pare dve māse sineruabhimukhā pakkhanditvā puna āsāḷhe sinerusamīpena caranti.
In the first month of Kattika, they pass through the middle, then go towards the Cakkavāḷa and, after wandering near the Cakkavāḷa for three months, they emerge again, pass through the middle in the month of Citta, and then for the next two months, they move towards Sineru, and again travel near Sineru in Āsāḷha.
Vào tháng Kattika (tháng 11) đầu tiên, chúng đi ở giữa, sau đó đi về phía Cakkavāḷa, đi gần Cakkavāḷa ba tháng, rồi lại đi ra ngoài, đi ở giữa vào tháng Citta (tháng 4), sau đó trong hai tháng tiếp theo chúng đi về phía Sineru, rồi lại đi gần Sineru vào tháng Āsāḷha.
Ettha ca sinerussa cakkavāḷassa ca yaṃ ṭhānaṃ vemajjhaṃ, tassa sinerussa ca yaṃ ṭhānaṃ vemajjhaṃ, tena gacchantā sinerusamīpena carantīti veditabbā, na sinerussa aggālindaṃ allīnā, cakkavāḷasamīpena caraṇampi imināva nayena veditabbaṃ.
Here, it should be understood that when they travel through the middle point between Sineru and the Cakkavāḷa, they are said to be traveling near Sineru, not clinging to Sineru's main balcony. Traveling near the Cakkavāḷa should also be understood in the same way.
Ở đây, cần hiểu rằng khi chúng đi qua điểm giữa của Sineru và Cakkavāḷa, chúng đi gần Sineru, chứ không phải dính sát vào đỉnh Sineru. Việc đi gần Cakkavāḷa cũng cần được hiểu theo cách này.
Yadā pana sinerussa cakkavāḷassa ujukaṃ vemajjhena gacchanti, tadā vemajjhena vicarantīti veditabbaṃ.
However, when they pass directly through the middle between Sineru and the Cakkavāḷa, it should be understood that they are traveling through the middle.
Tuy nhiên, khi chúng đi thẳng qua điểm giữa của Sineru và Cakkavāḷa, cần hiểu rằng chúng đi ở giữa.
Evaṃ vicarantā ca ekappahārena tīsupi dīpesu ālokaṃ karonti.
Traveling in this way, they illuminate all three continents simultaneously.
Khi di chuyển như vậy, chúng chiếu sáng đồng thời cả ba châu.
Ekekāya disāya nava nava yojanasatasahassāni andhakāraṃ vidhamitvā ālokaṃ dassenti.
In each direction, they dispel darkness for nine hundred thousand yojanas and provide light.
Chúng xua tan bóng tối và chiếu sáng chín trăm ngàn dojana ở mỗi phương.
Kathaṃ?
How?
Bằng cách nào?
Imasmiñhi dīpe sūriyuggamanakālo pubbavidehe majjhanhiko hoti, uttarakurūsu atthaṅgamanakālo, aparagoyāne majjhimayāmo, pubbavidehamhi uggamanakālo uttarakurūsu majjhanhiko, aparagoyāne atthaṅgamanakālo, idha majjhimayāmo, uttarakurūsu uggamanakālo aparagoyāne majjhanhiko, idha atthaṅgamanakālo, pubbavidehe majjhimayāmo, aparagoyānadīpe uggamanakālo idha majjhanhiko, pubbavidehadīpe atthaṅgamanakālo, uttarakurūsu majjhimayāmo.
Indeed, at the time of sunrise on this continent, it is midday in Pubbavideha, sunset in Uttarukuru, and the middle watch of the night in Aparagoyāna. When it is sunrise in Pubbavideha, it is midday in Uttarukuru, sunset in Aparagoyāna, and the middle watch of the night here. When it is sunrise in Uttarukuru, it is midday in Aparagoyāna, sunset here, and the middle watch of the night in Pubbavideha. When it is sunrise on the continent of Aparagoyāna, it is midday here, sunset on the continent of Pubbavideha, and the middle watch of the night in Uttarukuru.
Khi mặt trời mọc ở châu này (Jambudīpa), đó là giữa trưa ở Pubbavideha, hoàng hôn ở Uttarukuru, và nửa đêm ở Aparagoyāna. Khi mặt trời mọc ở Pubbavideha, đó là giữa trưa ở Uttarukuru, hoàng hôn ở Aparagoyāna, và nửa đêm ở đây (Jambudīpa). Khi mặt trời mọc ở Uttarukuru, đó là giữa trưa ở Aparagoyāna, hoàng hôn ở đây (Jambudīpa), và nửa đêm ở Pubbavideha. Khi mặt trời mọc ở Aparagoyāna, đó là giữa trưa ở đây (Jambudīpa), hoàng hôn ở Pubbavideha, và nửa đêm ở Uttarukuru.
Imasmiñhi dīpe ṭhitamajjhanhikavelāyaṃ pubbavidehavāsīnaṃ atthaṅgamanavasena upaḍḍhaṃ sūriyamaṇḍalaṃ paññāyati, aparagoyānavāsīnaṃ uggamanavasena upaḍḍhaṃ paññāyati.
Indeed, at the midday hour for those on this continent, half of the sun's disc appears as if setting for the inhabitants of Pubbavideha, and half appears as if rising for the inhabitants of Aparagoyāna.
Vào thời điểm giữa trưa ở châu này, một nửa đĩa mặt trời hiện ra cho cư dân Pubbavideha như là lúc hoàng hôn, và một nửa hiện ra cho cư dân Aparagoyāna như là lúc mặt trời mọc.
Evaṃ sesadīpesupi.
The same applies to the other continents.
Tương tự ở các châu khác.
Iti imināva pakārena tīsu dīpesu ekappahāreneva candimasūriyā ālokaṃ dassentīti veditabbaṃ.
Thus, it should be understood that in this very manner, the moon and sun illuminate the three continents simultaneously.
Như vậy, cần hiểu rằng mặt trăng và mặt trời chiếu sáng đồng thời ở ba châu theo cách này.
Ito aññathā pana dvīsu eva dīpesu ekappahāreneva ālokaṃ dassenti.
Otherwise, they illuminate only two continents simultaneously.
Tuy nhiên, theo một cách khác, chúng chiếu sáng đồng thời chỉ ở hai châu.
Yasmiñhi dīpe atthaṅgamanavasena upaḍḍhaṃ sūriyamaṇḍalaṃ paññāyati, atthaṅgamite tattha na paññāyati, ālokaṃ na dasseti, dvīsu eva dīpesu ekappahārena ubhayaṃ.
On whichever continent half of the sun's disc appears as if setting, it does not appear when it has set, nor does it provide light; simultaneously, both illuminate only two continents.
Ở châu nào một nửa đĩa mặt trời hiện ra như là lúc hoàng hôn, khi mặt trời lặn ở đó thì nó không hiện ra, không chiếu sáng. Cả hai đều chiếu sáng đồng thời chỉ ở hai châu.
Ekekāya disāya nava nava yojanasatasahassāni andhakāravidhamanampi imināva nayena daṭṭhabbaṃ.
The dispelling of darkness for nine hundred thousand yojanas in each direction should also be understood in this same way.
Việc xua tan bóng tối trong chín trăm ngàn do-tuần ở mỗi phương cũng nên được hiểu theo cách này.
Imasmiñhi dīpe ṭhitamajjhanhikavelāyaṃ pubbavidehavāsīnaṃ atthaṅgamanavasena upaḍḍhaṃ sūriyamaṇḍalaṃ paññāyatīti pubbavidehe navayojanasatasahassappamāṇe ṭhāne andhakāraṃ vidhamitvā ālokaṃ dasseti, tathā aparagoyāne uggamanavasena tatthāpi upaḍḍhasseva paññāyamānattā.
For when it is noon in this continent, half of the sun's orb is seen to be setting for the inhabitants of Pubbavideha, thus it dispels darkness and gives light in a place of nine hundred thousand yojanas in Pubbavideha; likewise, in Aparagoyāna, due to its rising, half is also seen there.
Bởi vì, vào lúc giữa trưa ở châu này, đối với các cư dân ở châu Pubbavideha, một nửa đĩa mặt trời hiện ra theo cách lặn, do đó nó xua tan bóng tối và chiếu sáng ở nơi có kích thước chín trăm ngàn do-tuần tại Pubbavideha; tương tự ở Aparagoyāna, theo cách mọc, cũng chỉ có một nửa hiện ra.
Pubbavidehānaṃ pana atthaṅgamite na paññāyatīti dvīsu dīpesu sabbattha andhakāraṃ vidhamitvā ālokaṃ dasseti aparagoyānepi uggate sūriye sabbattha andhakāravidhamanato.
But when it sets for Pubbavideha, it is not seen, so it dispels darkness and gives light everywhere in the two continents. When the sun has risen in Aparagoyāna, it dispels darkness everywhere.
Tuy nhiên, khi mặt trời đã lặn đối với người Pubbavideha thì không còn thấy nữa, do đó nó xua tan bóng tối và chiếu sáng khắp nơi ở hai châu; và ở Aparagoyāna cũng vậy, khi mặt trời mọc, nó xua tan bóng tối khắp nơi.
Pātubhavantā ca candimasūriyā ekatova loke pātubhavanti, tesu sūriyo paṭhamataraṃ paññāyati.
The moon and sun appear simultaneously in the world, but among them, the sun appears first.
Mặt trăng và mặt trời khi xuất hiện, chúng xuất hiện cùng lúc trên thế gian; trong số đó, mặt trời hiện ra trước tiên.
Paṭhamakappikānañhi sattānaṃ sayaṃpabhāya antarahitāya andhakāro ahosi.
For when the self-radiance of the beings of the first eon disappeared, there was darkness.
Bởi vì, đối với các chúng sinh của kiếp đầu tiên, khi ánh sáng tự thân của họ biến mất, bóng tối đã xuất hiện.
Te bhītatasitā ‘‘bhaddakaṃ vatassa, sace añño āloko bhaveyyā’’ti cintayiṃsu.
Frightened and distressed, they thought, “It would indeed be good if there were another light.”
Họ sợ hãi và kinh hoàng, suy nghĩ rằng: “Thật tốt thay, nếu có một ánh sáng khác xuất hiện.”
Tato mahājanassa sūrabhāvaṃ janayamānaṃ sūriyamaṇḍalaṃ uṭṭhahi, tenevassa ‘‘sūriyo’’ti nāmaṃ ahosi.
Then the orb of the sun arose, generating courage in the multitude, and for this reason, its name became “Sūriya” (sun).
Sau đó, đĩa mặt trời, tạo ra sự dũng cảm cho đại chúng, đã mọc lên; vì thế nó có tên là “sūriya” (mặt trời).
Tasmiṃ divasaṃ ālokaṃ katvā atthaṅgamite puna andhakāro ahosi.
When it set after making light for the day, darkness came again.
Sau khi chiếu sáng ban ngày và lặn xuống, bóng tối lại xuất hiện.
Te bhītatasitā ‘‘bhaddakaṃ vatassa, sace añño āloko uppajjeyyā’’ti cintayiṃsu.
Frightened and distressed, they thought, “It would indeed be good if another light were to arise.”
Họ sợ hãi và kinh hoàng, suy nghĩ rằng: “Thật tốt thay, nếu có một ánh sáng khác khởi lên.”
Atha nesaṃ chandaṃ ñatvā viya candamaṇḍalaṃ uṭṭhahi, tenevassa ‘‘cando’’ti nāmaṃ ahosi.
Then, as if knowing their wish, the orb of the moon arose, and for this reason, its name became “Cando” (moon).
Bấy giờ, như thể biết được ý muốn của họ, đĩa mặt trăng đã mọc lên; vì thế nó có tên là “canda” (mặt trăng).
Evaṃ candimasūriyesu pātubhūtesu nakkhattāni tārakarūpāni pātubhavanti, tato pabhuti rattindivā paññāyanti.
Thus, when the moon and sun have appeared, the constellations and star-forms appear, and from then on, day and night are perceived.
Như vậy, khi mặt trăng và mặt trời xuất hiện, các vì sao và các chòm sao cũng xuất hiện; từ đó, đêm và ngày được biết đến.
Anukkamena ca māsaḍḍhamāsautusaṃvaccharā jāyanti.
Successively, months, half-months, seasons, and years come into being.
Và tuần tự, tháng, nửa tháng, mùa và năm được hình thành.
Candimasūriyānaṃ pana pātubhūtadivaseyeva sinerucakkavāḷahimavantapabbatā cattāro ca dīpā pātubhavanti, te ca kho apubbaṃ acarimaṃ phagguṇapuṇṇamadivaseyeva pātubhavantīti veditabbaṃ.
It should be understood that on the very day the moon and sun appeared, Mount Sineru, the Cakkavāḷa mountain, the Himavanta mountains, and the four continents also appeared, and they appeared neither earlier nor later, but on the full moon day of Phagguṇa (February-March).
Cần biết rằng, vào chính ngày mặt trăng và mặt trời xuất hiện, núi Sineru, núi Cakkavāḷa, núi Himavanta và bốn châu cũng xuất hiện; và chúng xuất hiện không trước không sau, vào đúng ngày rằm tháng Phagguna.
Tāvatiṃsabhavanaṃ dasasahassayojananti ettha tettiṃsa sahapuññakārino ettha nibbattāti taṃsahacaritaṭṭhānaṃ tettiṃsaṃ, tadeva tāvatiṃsaṃ, taṃ nivāso etesanti tāvatiṃsā, devā, tesaṃ bhavanaṃ tāvatiṃsabhavanaṃ.
Regarding “Tāvatiṃsa-bhavanaṃ dasasahassa-yojanaṃ” (The abode of Tāvatiṃsa is ten thousand yojanas), the thirty-three beings who performed abundant meritorious deeds are reborn there, so the accompanying place is called Tettiṃsa (thirty-three), which itself is Tāvatiṃsa. Tāvatiṃsa (gods) means those for whom it is an abode, and their abode is Tāvatiṃsa-bhavana.
Trong câu “Cung trời Tāvatiṃsa rộng mười ngàn do-tuần”, vì ba mươi ba người cùng làm phước được sinh ra ở đây, nên nơi ở chung của họ là Tettiṃsa, chính là Tāvatiṃsa. Họ có nơi ở đó nên gọi là Tāvatiṃsā, là các vị trời; cung của họ là Tāvatiṃsabhavana.
Tathā hi maghena māṇavena saddhiṃ macalagāmake kālaṃ katvā tattha uppanne tettiṃsa devaputte upādāya assa devalokassa ayaṃ paṇṇatti jātāti vadanti.
Thus, they say that this name for the celestial realm arose from the thirty-three devaputtas who were reborn there after the layman Magha, along with his companions, passed away in the village of Macalaga.
Bởi vì, người ta nói rằng, tên gọi của cõi trời này được hình thành dựa vào ba mươi ba vị thiên tử đã sinh ra ở đó sau khi qua đời tại làng Macala cùng với chàng thanh niên Magha.
Atha vā yasmā sesacakkavāḷesupi cha kāmāvacaradevalokā atthi.
Alternatively, since there are also six kāma-realm celestial realms in other cakkavāḷas.
Hoặc là, vì ở các cakkavāḷa khác cũng có sáu cõi trời dục giới.
Vuttampi cetaṃ ‘‘sahassaṃ cātumahārājikānaṃ sahassaṃ tāvatiṃsāna’’nti.
It is also said, “A thousand for the Cātumahārājika gods, a thousand for the Tāvatiṃsa gods.”
Điều này cũng đã được nói: “Một ngàn cõi Cātumahārājika, một ngàn cõi Tāvatiṃsa.”
Tasmā nāmapaṇṇattiyevesā tassa devalokassāti veditabbā.
Therefore, it should be understood that this is merely a naming convention for that celestial realm.
Do đó, cần biết rằng đây chỉ là tên gọi của cõi trời đó.
Dasasahassayojananti idaṃ pana sakkapuraṃ sandhāya vuttanti veditabbaṃ.
And “dasasahassa-yojanaṃ” (ten thousand yojanas) should be understood as referring to Sakkapura.
Còn câu “mười ngàn do-tuần” này, cần biết rằng được nói để chỉ thành của Sakka.
Tathā hi tāvatiṃsakāyikā devā atthi pabbataṭṭhakā, atthi ākāsaṭṭhakā, tesaṃ paramparā cakkavāḷapabbataṃ pattā, tathā cātumahārājikānaṃ yāmādīnañca.
Thus, among the Tāvatiṃsa gods, some are mountain-dwelling, and some are sky-dwelling; their lineage reaches the Cakkavāḷa mountain, and similarly for the Cātumahārājika and Yāma gods, etc.
Bởi vì, trong chúng Tāvatiṃsa, có những vị trời ở trên núi, có những vị trời ở trên không trung; dòng dõi của họ kéo dài đến tận núi Cakkavāḷa; tương tự đối với các vị trời Cātumahārājika, Yāma và các cõi khác.
Ekadevalokepi hi devānaṃ paramparā cakkavāḷapabbataṃ appattā nāma natthi.
Indeed, in no single celestial realm does the lineage of the gods fail to reach the Cakkavāḷa mountain.
Bởi vì, ngay cả trong một cõi trời, không có dòng dõi chư thiên nào mà không kéo dài đến núi Cakkavāḷa.
Idaṃ pana tāvatiṃsabhavanaṃ sinerussa uparimatale dasasahassayojanike ṭhāne patiṭṭhitanti veditabbaṃ.
But this Tāvatiṃsa-bhavana should be understood as established on the uppermost level of Sineru, in a place ten thousand yojanas (in extent).
Cần biết rằng cung trời Tāvatiṃsa này được thiết lập trên đỉnh núi Sineru, tại một nơi rộng mười ngàn do-tuần.
Tassa pācīnapacchimadvārānaṃ antarā dasayojanasahassaṃ hoti, tathā dakkhiṇuttaradvārānaṃ.
The distance between its eastern and western gates is ten thousand yojanas, and similarly for its southern and northern gates.
Khoảng cách giữa các cổng phía đông và phía tây của nó là mười ngàn do-tuần, tương tự giữa các cổng phía nam và phía bắc.
Taṃ kho pana nagaraṃ dvārasahassayuttaṃ ahosi ārāmapokkharaṇīpaṭimaṇḍitaṃ.
That city was adorned with a thousand gates, and embellished with parks and ponds.
Thành phố đó có một ngàn cổng, được trang hoàng bởi các khu vườn và hồ sen.
Diyaḍḍhayojanasatāyāmo vejayantaratho (saṃ. ni. aṭṭha. 1.1.249 ādayo).
The Vejayanta chariot is one and a half hundred yojanas long.
Chiếc xe Vejayanta dài một trăm rưỡi do tuần (150 do tuần).
Tassa hi pacchimanto paṇṇāsayojano, majjhe rathapañjaro paṇṇāsayojano, rathasandhito yāva rathasīsā paṇṇāseva yojanāni.
Indeed, its rear end is fifty yojanas, the chariot cage in the middle is fifty yojanas, and from the chariot joint to the chariot head is also fifty yojanas.
Phần đuôi của nó dài năm mươi do tuần, khung xe ở giữa dài năm mươi do tuần, và từ chỗ nối xe cho đến đầu xe cũng dài năm mươi do tuần.
Tadeva pamāṇaṃ diguṇaṃ katvā ‘‘tiyojanasatāyāmo’’tipi vadantiyeva.
Doubling that same measure, they also say "three hundred yojanas long".
Lấy kích thước đó nhân đôi, người ta cũng nói là ‘‘dài ba trăm do tuần’’.
Tasmiṃ yojanikapallaṅko atthato tiṭṭhati.
In it, a yojana-sized couch (pallaṅka) actually stands.
Trên đó thực sự có một ngai vàng rộng một do tuần.
Tattha tiyojanikaṃ setacchattaṃ, ekasmiṃyeva yuge sahassaājaññayuttaṃ.
There is a three-yojana-sized white parasol there, yoked to a thousand thoroughbreds on a single yoke.
Trên đó có một lọng trắng rộng ba do tuần, chỉ trên một cái ách có một ngàn ngựa thuần chủng.
Sesālaṅkārassa pamāṇaṃ natthi.
There is no measure for the other ornaments.
Kích thước của các đồ trang sức khác thì không có.
Dhajo panassa aḍḍhatiyāni yojanasatāni uggato, yassa vātāhatassa pañcaṅgikatūriyasseva saddo niccharati.
Its banner, however, rises two and a half hundred yojanas high, from which, when struck by the wind, a sound like a five-instrument orchestra emanates.
Lá cờ của nó cao hai trăm rưỡi do tuần, khi gió thổi vào thì phát ra âm thanh như tiếng nhạc cụ ngũ tấu.
Sakkassa pana erāvaṇo nāma hatthī diyaḍḍhayojanasatiko, sopi devaputtoyeva.
Sakka's elephant named Erāvaṇa is one and a half hundred yojanas in size; he is also a devaputta.
Con voi tên Erāvaṇa của Sakka dài một trăm rưỡi do tuần, nó cũng là một thiên tử.
Na hi devalokasmiṃ tiracchānagatā honti, tasmā so uyyānakīḷāya nikkhamanakāle attabhāvaṃ vijahitvā diyaḍḍhayojanasatiko erāvaṇo nāma hatthī hoti.
Indeed, there are no animals in the deva realm; therefore, when he goes out for pleasure in the park, he gives up his own form and becomes an elephant named Erāvaṇa, one and a half hundred yojanas in size.
Vì ở cõi trời không có loài bàng sanh, cho nên khi đi ra để vui chơi trong vườn, nó bỏ thân mình và trở thành con voi tên Erāvaṇa dài một trăm rưỡi do tuần.
So tettiṃsakumbhe māpeti āvaṭṭena gāvutaaḍḍhayojanappamāṇe, sabbesaṃ majjhe sakkassa atthāya sudassanaṃ nāma tiṃsayojanikaṃ kumbhaṃ māpeti.
He creates thirty-three pitchers, each a quarter of a yojana and half a yojana in circumference, and in the middle of all of them, he creates a thirty-yojana pitcher named Sudassana for Sakka.
Nó tạo ra ba mươi ba cái vòi có kích thước khoảng nửa do tuần theo hình xoắn ốc, và ở giữa tất cả các vòi đó, nó tạo ra một vòi tên Sudassana rộng ba mươi do tuần dành cho Sakka.
Tassa upari dvādasayojaniko ratanamaṇḍapo hoti.
Above that, there is a twelve-yojana jewel pavilion.
Phía trên vòi đó có một lều báu rộng mười hai do tuần.
Tattha antarantarā sattaratanamayā yojanubbedhā dhajā uṭṭhahanti.
In it, at various points, seven-jewel banners, one yojana high, rise up.
Ở đó, xen kẽ có những lá cờ bằng bảy loại báu cao một do tuần dựng lên.
Pariyante kiṅkiṇikajālā olambanti, yassa mandavāteritassa pañcaṅgikatūriyasaddasadiso dibbagītasaddo viya ravo niccharati.
At the edges, nets of small bells hang down, from which, when stirred by a gentle breeze, a sound like a divine song, similar to the sound of a five-instrument orchestra, emanates.
Ở rìa có những chuỗi chuông nhỏ treo lủng lẳng, khi gió nhẹ thổi qua, nó phát ra âm thanh như tiếng nhạc trời, giống như tiếng nhạc cụ ngũ tấu.
Maṇḍapamajjhe sakkassa yojaniko maṇipallaṅko paññatto hoti, tattha sakko nisīdati.
In the middle of the pavilion, a yojana-sized jewel couch is arranged for Sakka; Sakka sits there.
Ở giữa lều, một ngai vàng bằng ngọc rộng một do tuần được sắp đặt cho Sakka, Sakka ngồi trên đó.
Tettiṃsāya kumbhānaṃ ekekasmiṃ kumbhe satta satta dante māpeti, tesu ekeko paṇṇāsayojanāyāmo.
On each of the thirty-three pitchers, he creates seven tusks, each fifty yojanas long.
Trên mỗi một trong ba mươi ba cái vòi, nó tạo ra bảy cái ngà, mỗi cái ngà dài năm mươi do tuần.
Ekekasmiñcettha dante satta satta pokkharaṇiyo honti, ekekāya pokkharaṇiyā satta satta paduminīgacchā, ekekasmiṃ gacche satta satta pupphāni honti, ekekassa pupphassa satta satta pattāni, ekekasmiṃ patte satta satta devadhītaro naccanti.
On each of these tusks, there are seven lotus ponds; in each pond, seven lotus stalks; on each stalk, seven flowers; on each flower, seven petals; on each petal, seven female devas dance.
Trên mỗi cái ngà này có bảy cái ao sen, trên mỗi cái ao sen có bảy bụi sen, trên mỗi bụi sen có bảy bông hoa, trên mỗi bông hoa có bảy cánh hoa, trên mỗi cánh hoa có bảy thiên nữ nhảy múa.
Evaṃ samantā paṇṇāsayojanaṭṭhāne hatthidantesuyeva naccanaṭasamajjo hoti.
Thus, all around, in the fifty-yojana area, there is a festival of dancing on the elephant tusks themselves.
Như vậy, một hội diễn ca vũ diễn ra xung quanh trên các ngà voi trong phạm vi năm mươi do tuần.
Sabbapāliphullassa pana pāricchattakassa koviḷārassa samantā pañca yojanasatāni ābhā pharati, anuvātaṃ yojanasataṃ gandho gacchati.
However, the radiance of the fully blooming Pāricchattaka koviḷāra tree spreads five hundred yojanas around, and its fragrance travels one yojana downwind.
Khi cây koviḷāra Pāricchattaka nở hoa khắp nơi, ánh sáng của nó tỏa ra xung quanh năm trăm do tuần, và hương thơm của nó bay xa một trăm do tuần theo chiều gió.
Pupphite pāricchattake ārohaṇakiccaṃ vā aṅkusaṃ gahetvā nāmanakiccaṃ vā pupphāharaṇatthaṃ caṅkoṭakakiccaṃ vā natthi.
When the Pāricchattaka blooms, there is no need for climbing, nor for bending branches with a hook, nor for a net to collect flowers.
Khi cây Pāricchattaka nở hoa, không cần phải leo lên, không cần phải dùng móc để kéo xuống, cũng không cần dùng gậy để hái hoa.
Kantanakavāto uṭṭhahitvā pupphāni vaṇṭato kantati, sampaṭicchanakavāto sampaṭicchati, pavesanakavāto sudhammadevasabhaṃ paveseti, sammajjanakavāto purāṇapupphāni nīharati, santharaṇakavāto pattakaṇṇikakesarāni racento santharati, majjhaṭṭhāne dhammāsanaṃ hoti yojanappamāṇo ratanapallaṅko, tassa upari dhāriyamānaṃ tiyojanikaṃ setacchattaṃ, tadanantaraṃ sakkassa devarañño āsanaṃ attharīyati, tato bāttiṃsāya devaputtānaṃ, tato aññesaṃ mahesakkhadevatānaṃ.
A cutting wind arises and cuts the flowers from their stalks; a receiving wind receives them; an entering wind brings them into the Sudhammā deva assembly hall; a sweeping wind removes old flowers; a spreading wind arranges them, forming patterns of petals, sepals, and stamens; in the center, a Dhamma seat is arranged, a jewel couch one yojana in size, above which a three-yojana white parasol is held; after that, the seat for Sakka, the king of devas, is spread; then for the thirty-two devaputtas; then for other powerful devas.
Gió cắt cành nổi lên cắt hoa từ cuống, gió đón nhận đón lấy, gió đưa vào đưa hoa vào hội trường chư thiên Sudhammā, gió quét dọn cuốn đi những bông hoa cũ, gió trải đặt sắp xếp những cánh hoa và nhụy hoa rồi trải ra, ở giữa có pháp tòa là một ngai vàng báu rộng một do tuần, phía trên có một lọng trắng ba do tuần được giữ, sau đó là chỗ ngồi của Sakka vị vua chư thiên được trải, sau đó là chỗ ngồi của ba mươi hai vị thiên tử, sau đó là chỗ ngồi của các vị thiên thần có oai lực lớn khác.
Aññesaṃ devatānaṃ pana pupphakaṇṇikāva āsanaṃ hoti.
For other devas, however, the flower sepals serve as their seats.
Còn chỗ ngồi của các vị thiên thần khác thì chỉ là những cánh hoa.
Devā devasabhaṃ pavisitvā nisīdanti.
The devas enter the deva assembly hall and sit down.
Chư thiên vào hội trường chư thiên và ngồi xuống.
Tato pupphehi reṇuvaṭṭi uggantvā upari kaṇṇikaṃ āhacca nipatamānā devatānaṃ tigāvutappamāṇaṃ attabhāvaṃ lākhāparikammasajjitaṃ viya karoti, tesaṃ sā kīḷā catūhi māsehi pariyosānaṃ gacchati.
Then, a shower of pollen rises from the flowers, strikes the top of the sepals, and falls down, making the bodies of the devas, three gavutas in size, appear as if adorned with lac decorations; their sport concludes in four months.
Sau đó, một luồng phấn hoa bay lên, chạm vào phần nhụy hoa phía trên rồi rơi xuống, làm cho thân thể của chư thiên cao ba phần tư do tuần trở nên như được trang điểm bằng sơn mài, trò vui đó của họ kết thúc sau bốn tháng.
Iti imāhi sampattīhi samannāgataṃ tāvatiṃsabhavanaṃ bhagavā sabbathā avedīti veditabbaṃ.
Thus, it should be understood that the Blessed One knew the Tāvatiṃsa realm, endowed with these attainments, in every way.
Như vậy, cần phải biết rằng Đức Thế Tôn đã thấu triệt hoàn toàn cõi Tāvatiṃsa với những sự thịnh vượng này.
Tathā asurabhavananti ettha devā viya na suranti na īsaranti na virocantīti asurā.
Here, regarding the Asura realm, asuras are those who do not rejoice, do not possess power, and do not shine like devas.
Cũng vậy, cõi Asura ở đây, ‘asura’ là những vị không chiếu sáng, không quyền năng, không rực rỡ như chư thiên.
Surā nāma devā, tesaṃ paṭipakkhāti vā asurā.
Or, devas are called suras, and their opponents are asuras.
Hoặc ‘asura’ là kẻ đối nghịch của ‘sura’ (chư thiên).
Sakko kira macalagāmake magho nāma māṇavo hutvā tettiṃsa purise gahetvā kalyāṇakammaṃ karonto satta vattapadāni pūretvā tattha kālakato devaloke nibbatti saddhiṃ parisāya.
It is said that Sakka, having been a youth named Magha in Macalagama, performing good deeds with thirty-three men, and fulfilling the seven practices, passed away there and was reborn in the deva realm with his retinue.
Nghe nói, Sakka khi còn là thanh niên tên Magha ở làng Macala, đã cùng ba mươi ba người đàn ông làm các việc thiện, hoàn thành bảy giới luật, sau khi chết ở đó đã tái sinh vào cõi trời cùng với đoàn tùy tùng.
Tato pubbadevā ‘‘āgantukadevaputtā āgatā, sakkāraṃ nesaṃ karomā’’ti vatvā dibbapadumāni upanāmesuṃ, upaḍḍharajjena ca nimantesuṃ.
Then the former devas, saying, "New devaputtas have arrived, let us offer them hospitality," presented divine lotuses and invited them to half the kingdom.
Khi đó, các vị cựu thiên thần nói ‘‘các thiên tử khách đã đến, chúng ta hãy tôn kính họ’’ và dâng các hoa sen trời, và mời họ chia nửa vương quốc.
Sakko upaḍḍharajjena asantuṭṭho ahosi, atha nevāsikā ‘‘āgantukadevaputtānaṃ sakkāraṃ karomā’’ti gandhapānaṃ sajjayiṃsu.
Sakka was not satisfied with half the kingdom; then the resident devas, saying, "Let us offer hospitality to the new devaputtas," prepared fragrant drinks.
Sakka không hài lòng với nửa vương quốc, sau đó các vị thiên thần bản xứ ‘‘chúng ta hãy tôn kính các thiên tử khách’’ và chuẩn bị đồ uống có hương thơm.
Sakko sakaparisāya saññaṃ adāsi ‘‘mārisā mā gandhapānaṃ pivittha, pivamānākāramattameva dassethā’’ti.
Sakka gave a sign to his retinue: "Friends, do not drink the fragrant drinks; merely show the appearance of drinking."
Sakka ra hiệu cho đoàn tùy tùng của mình ‘‘các bạn thân mến, đừng uống đồ uống có hương thơm, chỉ giả vờ như đang uống thôi’’.
Te tathā akaṃsu.
They did so.
Họ đã làm như vậy.
Nevāsikadevatā suvaṇṇasarakehi upanītaṃ gandhapānaṃ yāvadatthaṃ pivitvā mattā tattha tattha suvaṇṇapathaviyaṃ patitvā sayiṃsu.
The resident devas, having drunk the fragrant liquor presented in golden goblets to their heart's content, became intoxicated and fell asleep here and there on the golden ground.
Chư thiên cư ngụ trong thành, sau khi uống thỏa thích thức uống thơm được dâng lên bằng các chén vàng, say sưa ngã lăn ra ngủ đó đây trên nền đất vàng.
Sakko ‘‘gaṇhatha dhutte, haratha dhutte’’ti te pādesu gāhāpetvā sinerupāde khipāpesi.
Sakka, saying, "Seize the rogues, carry off the rogues!", had them seized by their feet and thrown to the foot of Mount Sineru.
Sakka (Đế Thích) ra lệnh: “Hãy bắt lấy bọn vô lại này, hãy mang bọn vô lại này đi!”, rồi khiến người nắm chân chúng ném xuống chân núi Sineru.
Sakkassa puññatejena tadanuvattakāpi sabbe tattheva patiṃsu.
By the power of Sakka's merit, all of his followers also fell there.
Nhờ phước lực của Sakka, tất cả những kẻ theo chúng cũng đều ngã xuống đó.
Atha nesaṃ kammapaccayautusamuṭṭhānaṃ sinerussa heṭṭhimatale dasayojanasahassaṃ asurabhavanaṃ nibbatti pāricchattakapaṭicchannabhūtāya citrapāṭaliyā upasobhitaṃ.
Then, due to their kamma, season, and origins, an Asura realm, ten thousand yojanas in extent, arose at the lower level of Sineru, adorned with a magnificent coral tree (cittapāṭalī), which had become covered by pāricchattaka trees.
Rồi, từ nghiệp, nhân duyên và thời tiết của chúng, một cõi Asura rộng mười ngàn dojana xuất hiện dưới chân núi Sineru, được tô điểm bởi cây champa (citrapāṭalī) che phủ.
Sakko tesaṃ nivattitvā anāgamanatthāya ārakkhaṃ ṭhapesi.
Sakka established a guard to prevent them from returning.
Sakka đã thiết lập sự bảo vệ để chúng không thể quay trở lại.
Yaṃ sandhāya vuttaṃ –
Concerning this, it is said:
Điều này được nói đến trong câu:
Tattha dvinnaṃ ayujjhapurānanti dvinnaṃ devāsuranagarānaṃ antarāti attho.
Here, dvinnaṃ ayujjhapurānaṃ means between the two cities of devas and asuras.
Ở đây, dvinnaṃ ayujjhapurānaṃ có nghĩa là giữa hai thành của chư thiên và Asura.
Dve kira nagarāni yuddhena gahetuṃ asakkuṇeyyatāya ayujjhapurāni nāma jātāni.
Indeed, these two cities came to be called Ayujjhapurāni (unconquerable cities) because they could not be taken by war.
Hai thành này được gọi là ayujjhapurāni (thành không thể chiến thắng) vì không thể chiếm được bằng chiến tranh.
Yadā hi asurā balavanto honti, atha devehi palāyitvā devanagaraṃ pavisitvā dvāre pihite asurānaṃ satasahassampi kiñci kātuṃ na sakkoti.
For when the asuras are powerful, the devas flee and enter the city of devas, and with the gates closed, even hundreds of thousands of asuras can do nothing.
Khi các Asura mạnh, chư thiên bỏ chạy vào thành của chư thiên, đóng cổng lại thì dù hàng trăm ngàn Asura cũng không thể làm gì được.
Yadā devā balavanto honti, atha asurehi palāyitvā asuranagaraṃ pavisitvā dvāre pihite sakkānaṃ satasahassampi kiñci kātuṃ na sakkoti.
When the devas are powerful, the asuras flee and enter the city of asuras, and with the gates closed, even hundreds of thousands of Sakka's forces can do nothing.
Khi chư thiên mạnh, các Asura bỏ chạy vào thành của Asura, đóng cổng lại thì dù hàng trăm ngàn Sakka cũng không thể làm gì được.
Iti imāni dve nagarāni ayujjhapurāni nāma.
Thus, these two cities are called Ayujjhapurāni.
Vì vậy, hai thành này được gọi là thành không thể chiến thắng.
Tesaṃ antarā etesu uragādīsu pañcasu ṭhānesu sakkena ārakkhā ṭhapitā.
Sakka established guards in these five places—the uragas and so on—between these two cities.
Giữa chúng, Sakka đã thiết lập sự bảo vệ ở năm nơi này: rắn, v.v.
Tattha uragasaddena nāgā gahitā.
Here, by the word uraga, nāgas are meant.
Ở đây, từ uraga chỉ loài rắn (Nāga).
Te udake mahabbalā honti, tasmā sinerussa paṭhamālinde etesaṃ ārakkhā.
They are very powerful in water, therefore, their guard is in the first balcony of Sineru.
Chúng rất mạnh dưới nước, do đó sự bảo vệ của chúng ở tầng hiên thứ nhất của núi Sineru.
Sinerussa kira samantato bahalato puthulato ca pañcayojanasahassaparimāṇāni cattāri paribhaṇḍāni tāvatiṃsabhavanassa ārakkhāya nāgehi garuḷehi kumbhaṇḍehi yakkhehi ca adhiṭṭhitāni.
Indeed, surrounding Sineru, there are four encircling bands, each five thousand yojanas thick and wide, guarding the Tāvatiṃsa realm, presided over by nāgas, garuḷas, kumbhaṇḍas, and yakkhas.
Xung quanh núi Sineru, có bốn vòng đai rộng và dày năm ngàn dojana, được các Nāga, Garuḷa, Kumbhaṇḍa và Yakkha bảo hộ để bảo vệ cõi Tāvatiṃsa.
Tehi kira sinerussa upaḍḍhaṃ pariyādinnaṃ, etāniyeva ca sinerussa ālindāni mekhalāni ca vuccanti.
Indeed, half of Sineru is occupied by them, and these are also called the balconies and girdles of Sineru.
Nửa phần trên của núi Sineru được chúng chiếm giữ, và những nơi này cũng được gọi là hiên (ālinda) và đai (mekhalā) của núi Sineru.
Karoṭisaddena supaṇṇā gahitā.
By the word karoṭi, supaṇṇas are meant.
Từ karoṭi chỉ loài chim Supaṇṇa (Garuḷa).
Tesaṃ kira karoṭi nāma pānabhojanaṃ, tena nāmaṃ labhiṃsu, dutiyālinde tesaṃ ārakkhā.
Indeed, karoṭi is their food and drink, and by that, they obtained their name; their guard is in the second balcony.
Thức ăn và đồ uống của chúng được gọi là karoṭi, do đó chúng có tên này; sự bảo vệ của chúng ở tầng hiên thứ hai.
Payassahārīsaddena kumbhaṇḍā gahitā.
By the word payassahārī, kumbhaṇḍas are meant.
Từ payassahārī chỉ loài Kumbhaṇḍa.
Dānavarakkhasā kira te, tatiyālinde tesaṃ ārakkhā.
Indeed, they are ogres (dānavarakkhasā); their guard is in the third balcony.
Chúng là những Dānavarakkhasa; sự bảo vệ của chúng ở tầng hiên thứ ba.
Madanayutasaddena yakkhā gahitā.
By the word madanayuta, yakkhas are meant.
Từ madanayuta chỉ loài Yakkha.
Visamacārino kira te yuddhasoṇḍā, catutthālinde tesaṃ ārakkhā.
Indeed, they are of wild conduct and fond of war; their guard is in the fourth balcony.
Chúng là những kẻ có hành vi bất thường và thích chiến tranh; sự bảo vệ của chúng ở tầng hiên thứ tư.
Caturo ca mahatthāti cattāro mahārājāno vuttā.
Caturo ca mahatthā refers to the four Great Kings.
Caturo ca mahatthā có nghĩa là bốn vị Đại Vương.
Te hi sinerussa tasmiṃ tasmiṃ passe yugandharādīsu pañcasataparittadīpaparivāre mahādīpe ca sāsitabbassa mahato atthassa vasena ‘‘mahatthā’’ti vuccanti, pañcamālinde tesaṃ ārakkhā.
Indeed, they are called "mahatthā" (mighty ones) because of the great possessions (attha) to be ruled in those respective parts of Sineru, such as Yugandhara and other great islands surrounded by five hundred smaller islands; their guard is in the fifth balcony.
Chúng được gọi là mahatthā (vĩ đại) vì cai quản những lợi ích lớn lao trên các đại lục và năm trăm tiểu đảo bao quanh ở mỗi phía của núi Sineru, như Yugandhara, v.v.; sự bảo vệ của chúng ở tầng hiên thứ năm.
Te pana asurā āyuvaṇṇayasaissariyasampattīhi tāvatiṃsasadisāva.
These asuras, moreover, are similar to the Tāvatiṃsa devas in terms of longevity, beauty, fame, and sovereign power.
Những Asura này có tuổi thọ, sắc đẹp, danh tiếng và quyền lực giống như chư thiên Tāvatiṃsa.
Tasmā antarā attānaṃ ajānitvā pāṭaliyā pupphitāya ‘‘nayidaṃ devanagaraṃ, tattha pāricchattako pupphati, idha pana cittapāṭalī, jarasakkena mayaṃ suraṃ pāyetvā vañcitā, devanagarañca no gahitaṃ, gacchāma tena saddhiṃ yujjhissāmā’’ti hatthiassarathe āruyha suvaṇṇarajatamaṇiphalakāni gahetvā yuddhasajjā hutvā asurabheriyo vādentā mahāsamudde udakaṃ dvidhā bhinditvā uṭṭhahanti.
Therefore, not recognizing themselves in the interim, they say when the pāṭalī tree blooms, "This is not the city of devas, for there the pāricchattaka blooms, but here is the cittapāṭalī; we were deceived by old Sakka, being made to drink liquor, and our city of devas was taken! Let us go and fight with him!" Mounting elephants, horses, and chariots, taking gold, silver, and gem plates, they become ready for battle, blowing asura war-trumpets, splitting the water of the great ocean into two, and rise up.
Vì vậy, khi cây champa (pāṭalī) nở hoa, chúng không nhận ra mình, chúng nói: “Đây không phải là thành của chư thiên, ở đó cây pāricchattaka nở hoa, còn ở đây là cây citrapāṭalī, chúng ta đã bị Sakka già lừa cho uống rượu say, và thành của chư thiên đã bị chiếm, chúng ta hãy đi chiến đấu với hắn!”, rồi chúng cưỡi voi, ngựa, xe, cầm các tấm khiên bằng vàng, bạc, ngọc, sẵn sàng chiến đấu, thổi kèn Asura và tách nước đại dương làm đôi để trỗi dậy.
Te deve vuṭṭhe vammikamakkhikā vammikaṃ viya sineruṃ abhiruhituṃ ārabhanti.
When they have risen, they begin to ascend Sineru like termites ascending a termite mound.
Khi chư thiên xuất hiện, chúng bắt đầu leo lên núi Sineru như kiến leo tổ mối.
Atha nesaṃ paṭhamaṃ nāgehi saddhiṃ yuddhaṃ hoti.
Then, their first battle takes place with the nāgas.
Rồi, trước tiên chúng chiến đấu với các Nāga.
Tasmiṃ kho pana yuddhe na kassaci chavi vā cammaṃ vā chijjati, na lohitaṃ uppajjati, kevalaṃ kumārakānaṃ dārumeṇḍakayuddhaṃ viya aññamaññaṃ santāsanamattameva hoti.
In that battle, indeed, no one's skin or hide is torn, nor is blood produced; it is merely a matter of mutual intimidation, like a game of wooden rams for children.
Trong trận chiến đó, không có da hay thịt của ai bị rách, không có máu chảy ra, mà chỉ là sự hăm dọa lẫn nhau, giống như trận chiến bằng cừu gỗ của trẻ con.
Koṭisatāpi koṭisahassāpi nāgā tehi saddhiṃ yujjhitvā asurapuraṃyeva pavesetvā nivattanti.
Hundreds of millions, even thousands of millions, of nāgas fight with them and then return, only pushing them into the asura city.
Hàng trăm ngàn, hàng ngàn vạn Nāga chiến đấu với chúng và chỉ đẩy chúng vào thành Asura rồi quay về.
Sace pana asurā balavanto honti, atha nāgā osakkitvā dutiye ālinde supaṇṇehi saddhiṃ ekato hutvā yujjhanti.
However, if the asuras are powerful, then the nāgas retreat and fight together with the supaṇṇas in the second balcony.
Nhưng nếu các Asura mạnh, các Nāga sẽ rút lui và hợp lực với các Supaṇṇa ở tầng hiên thứ hai để chiến đấu.
Esa nayo supaṇṇādīsupi.
This method also applies to the supaṇṇas and others.
Điều này cũng tương tự đối với các Supaṇṇa, v.v.
Yadā pana tāni pañcapi ṭhānāni asurā maddanti, tadā ekato sampiṇḍitānipi tāni pañca balāni osakkanti.
When the asuras crush all five of those places, then even those five united forces retreat.
Tuy nhiên, khi các Asura áp đảo cả năm nơi đó, thì cả năm lực lượng hợp lại cũng phải rút lui.
Atha cattāro mahārājāno gantvā sakkassa pavattiṃ ārocenti.
Then the four Great Kings go and report the situation to Sakka.
Rồi, bốn vị Đại Vương đi báo cáo tình hình cho Sakka.
Sakko tesaṃ vacanaṃ sutvā diyaḍḍhayojanasatikaṃ vejayantarathaṃ āruyha sayaṃ vā nikkhamati, ekaṃ vā puttaṃ peseti.
Sakka, hearing their words, mounts the Vejayanta chariot, which is one and a half hundred yojanas long, and either goes out himself or sends one of his sons.
Sakka nghe lời họ, cưỡi chiếc xe Vejayanta dài một trăm rưỡi dojana, tự mình xuất trận, hoặc sai một người con đi.
Ekasmiṃ pana divase evaṃ nikkhamitvā asure yuddhena abbhuggantvā samudde pakkhipitvā catūsu dvāresu attanā sadisā paṭimā māpetvā ṭhapeti, tasmā asurā nāgādayo jinitvā āgatāpi indapaṭimā disvā ‘‘sakko nikkhanto’’ti palāyanti.
One day, having gone out in this way, he defeats the asuras in battle, throws them into the ocean, and has statues made in his likeness and placed at the four gates; therefore, even when the asuras have defeated the nāgas and others and arrived, upon seeing the statues of Inda, they flee, thinking, "Sakka has come out!"
Vào một ngày nọ, khi xuất trận như vậy, Sakka đã đánh bại các Asura và ném chúng xuống biển, rồi đặt các bức tượng giống mình ở bốn cổng, vì vậy các Asura, dù đã chiến thắng các Nāga, v.v. khi nhìn thấy các bức tượng của Indra, chúng nghĩ “Sakka đã xuất trận!” và bỏ chạy.
Iti surānaṃ paṭipakkhāti asurā, vepacittipahārādādayo, tesaṃ bhavanaṃ asurabhavanaṃ.
Thus, the Asuras are the opponents of the Suras, such as Vepacitti and Pahārāda, and their realm is the Asura realm.
Như vậy, Asura là kẻ đối địch của Surā (chư thiên), Vepacitti và các vị khác. Cõi của chúng là Asurabhavana (cõi Asura).
Taṃ pana āyāmato ca vitthārato ca dasasahassayojananti dassetuṃ ‘‘tathā asurabhavana’’nti vuttaṃ.
It is stated, "and similarly the Asura realm," to show that it is ten thousand yojanas in length and width.
Để chỉ rõ rằng cõi đó dài và rộng mười ngàn dojana, nên đã nói “tathā asurabhavana” (cũng như cõi Asura).
Avīcimahānirayo jambudīpo cāti etthāpi tathā-saddo yojetabbo, avīcimahānirayo jambudīpo ca tathā dasasahassayojanamevāti attho.
Here also, in Avīcimahānirayo jambudīpo cā (the great Avīci hell and Jambudīpa), the word tathā (similarly) should be joined, meaning the great Avīci hell and Jambudīpa are also ten thousand yojanas in extent.
Ở đây, từ tathā cũng phải được ghép vào Avīcimahānirayo jambudīpo cā (đại địa ngục Avīci và Jambudīpa), có nghĩa là đại địa ngục Avīci và Jambudīpa cũng dài mười ngàn dojana.
Ettha ca avīcimahānirayassa abbhantaraṃ āyāmena ca vitthārena ca yojanasataṃ hoti, lohapathavī lohachadanaṃ ekekā ca bhitti navanavayojanikā hoti.
Here, the interior of the great Avīci hell is one hundred yojanas in length and width, with an iron floor and an iron roof, and each wall is nine yojanas thick.
Ở đây, bên trong đại địa ngục Avīci dài và rộng một trăm dojana, nền là đất sắt, mái là sắt, và mỗi bức tường cao chín dojana.
Puratthimāya bhittiyā acci uṭṭhahitvā pacchimaṃ bhittiṃ gahetvā taṃ vinivijjhitvā parato yojanasataṃ gacchati.
From the eastern wall, a flame rises, reaches the western wall, pierces it, and goes one hundred yojanas beyond.
Ngọn lửa từ bức tường phía đông bốc lên, bao trùm bức tường phía tây, xuyên qua nó và đi xa một trăm dojana.
Sesadisāsupi eseva nayo.
The same method applies to the other directions.
Tương tự đối với các hướng khác.
Iti jālapariyantavasena āyāmavitthārato aṭṭhārasayojanādhikāni tīṇi yojanasatāni honti, parikkhepena nava yojanasatāni catupaṇṇāsañca yojanāni.
Thus, considering the extent of the net of flames, it is three hundred and eighteen yojanas in length and width, and nine hundred and fifty-four yojanas in circumference.
Như vậy, về chiều dài và chiều rộng, tính cả các ngọn lửa bao quanh, là ba trăm mười tám dojana, và chu vi là chín trăm năm mươi bốn dojana.
Samantā pana ussadehi saddhiṃ dasayojanasahassaṃ hoti.
However, including the surrounding projections, it is ten thousand yojanas in extent.
Nhưng tổng thể, tính cả các vách núi, là mười ngàn dojana.
Kasmā panesa narako ‘‘avīcī’’ti saṅkhyaṃ gatoti?
But why is this hell known as "Avīci"?
Tại sao địa ngục này được gọi là “Avīci”?
Vīci nāma antaraṃ vuccati, tattha ca aggijālānaṃ vā sattānaṃ vā dukkhassa vā antaraṃ natthi, tasmā so ‘‘avīcī’’ti saṅkhyaṃ gato.
Vīci means an interval; there is no interval of flames, or of beings, or of suffering there, therefore it is known as "Avīci."
Vīci có nghĩa là khoảng trống, và ở đó không có khoảng trống giữa các ngọn lửa, hay giữa các chúng sinh, hay giữa các nỗi khổ; vì vậy nó được gọi là “Avīci”.
Tassa hi puratthimabhittito jālā uṭṭhahitvā saṃsibbamānayojanasataṃ gantvā bhittiṃ vinivijjhitvā parato yojanasataṃ gacchati.
For its flames rise from the eastern wall, travel one hundred yojanas weaving together, pierce the wall, and go one hundred yojanas beyond.
Thật vậy, các ngọn lửa từ bức tường phía đông bốc lên, đan xen nhau đi xa một trăm dojana, xuyên qua bức tường và đi xa một trăm dojana nữa.
Sesadisāsupi eseva nayo.
The same method applies to the other directions.
Tương tự đối với các hướng khác.
Evaṃ jālānaṃ nirantaratāya avīci.
Thus, due to the continuous nature of the flames, it is Avīci.
Như vậy, do các ngọn lửa không có khoảng trống, nên gọi là Avīci.
Abbhantare panassa yojanasatike ṭhāne nāḷiyaṃ koṭṭetvā pūritatipupiṭṭhaṃ viya sattā nirantarā, ‘‘imasmiṃ ṭhāne satto atthi, imasmiṃ ṭhāne natthī’’ti na vattabbaṃ, gacchantānaṃ ṭhitānaṃ nisinnānaṃ nipannānañca paccamānānaṃ anto natthi, gacchantā ṭhite vā nisinne vā nipanne vā na bādhenti.
Within it, in a place a hundred yojanas*, beings are continuous like sesame seeds crushed and filled into a tube. It cannot be said, "in this place there is a being, in this place there is no being." There is no end to those who are going, standing, sitting, or lying down, being cooked. Those who are going do not hinder those who are standing, sitting, or lying down.
Bên trong đó, ở một nơi rộng một trăm dojana, chúng sanh chen chúc không ngớt, như hạt mè được nghiền nát và đổ đầy vào một ống. Không thể nói rằng “ở chỗ này có chúng sanh, ở chỗ này không có chúng sanh”. Không có khoảng trống giữa những chúng sanh đang đi, đang đứng, đang ngồi, đang nằm và đang bị nung nấu; những người đang đi không làm hại những người đang đứng, đang ngồi, hay đang nằm.
Evaṃ sattānaṃ nirantaratāya avīci.
Thus, due to the continuity of beings, it is Avīci.
Như vậy, do sự liên tục của chúng sanh, (nên gọi là) Avīci.
Kāyadvāre pana cha upekkhāsahagatāni cittāni uppajjanti, ekaṃ dukkhasahagataṃ.
At the body-door, however, six cittas accompanied by equanimity arise, and one accompanied by suffering.
Tuy nhiên, ở cửa thân, sáu tâm đồng thọ xả khởi lên, một tâm đồng thọ khổ.
Evaṃ santepi yathā jivhāgge cha madhubindūni ṭhapetvā ekasmiṃ tambalohabindumhi ṭhapite anudahanabalavatāya tadeva paññāyati, itarāni abbohārikāni honti, evaṃ anudahanabalavatāya dukkhamevettha nirantaraṃ, itarāni abbohārikānīti evaṃ dukkhassa nirantaratāya avīcīti vuccati.
Even so, just as when six drops of honey are placed on the tip of the tongue along with one drop of molten copper, because of its constantly renewed power, only that* is perceived, and the others become imperceptible; so too here, because of its constantly renewed power, suffering alone is continuous, and the others are imperceptible. Thus, due to the continuity of suffering, it is called Avīci.
Mặc dù là vậy, nhưng cũng như khi đặt sáu giọt mật lên đầu lưỡi và đặt một giọt đồng thau nóng chảy lên đó, do sức mạnh liên tục của nó mà chỉ giọt đồng thau đó được nhận biết, còn những giọt kia thì không đáng kể; tương tự như vậy, do sức mạnh liên tục của nó mà chỉ có khổ liên tục ở đây, còn những cái khác thì không đáng kể. Như vậy, do sự liên tục của khổ, (nên gọi là) Avīci.
‘‘Ayañca avīcimahānirayo jambudīpassa heṭṭhā patiṭṭhito’’ti vadanti.
They say, "And this great Avīci hell is situated below Jambudīpa."
Họ nói rằng “Đại địa ngục Avīci này nằm bên dưới Jambudīpa”.
Aparagoyānaṃ sattasahassayojanantiādīsu āyāmato ca vitthārato ca pamāṇaṃ dassitanti veditabbaṃ.
In passages such as "Aparagoyānaṃ (Western Cowland) seven thousand yojanas," it should be understood that the measurement in length and width is shown.
Trong các câu như “ Aparagoyānaṃ sattasahassayojanaṃ” (Aparagoyāna bảy ngàn dojana), cần hiểu rằng kích thước về chiều dài và chiều rộng đã được chỉ ra.
Tattha jambudīpo sakaṭasaṇṭhāno, channavutiyā paṭṭanakoṭisatasahassehi chapaṇṇāsaratanāgārehi navanavutiyā doṇamukhasatasahassehi tikkhattuṃ tesaṭṭhiyā nagarasahassehi ca samannāgato.
Therein, Jambudīpa is shaped like a cart, endowed with one hundred thousand cities with ninety-six ports, fifty-six gem-mansions, one hundred thousand doṇamukhas with ninety-nine mouths, and three times sixty-three thousand cities.
Ở đó, Jambudīpa có hình dạng như một cỗ xe, với một trăm ngàn bến cảng, năm mươi sáu kho báu, chín mươi chín ngàn cửa sông (doṇamukha) và sáu mươi ba ngàn thành phố được thiết lập ba lần.
Jambudīpe kira ādito tesaṭṭhimattāni nagarasahassāni uppannāni, tathā dutiyaṃ, tathā tatiyaṃ.
In Jambudīpa, it is said that initially sixty-three thousand cities arose, likewise a second time, and likewise a third time.
Người ta nói rằng ở Jambudīpa, ban đầu có sáu mươi ba ngàn thành phố được thành lập, rồi lần thứ hai cũng vậy, và lần thứ ba cũng vậy.
Tāni pana sampiṇḍetvā satasahassaṃ, tato paraṃ asīti sahassāni ca nava sahassāni ca honti.
When these are combined, they amount to one hundred thousand, and beyond that, eighty-nine thousand.
Tổng cộng chúng là một trăm ngàn, sau đó là tám mươi ngàn và chín ngàn.
Doṇamukhanti ca mahānagarassa āyuppattiṭṭhānabhūtaṃ padhānagharaṃ vuccati.
And Doṇamukha is said to be the main house, which is the birthplace (or origin) of a great city.
Và Doṇamukha được gọi là ngôi nhà chính, là nơi khởi nguồn của một thành phố lớn.
Aparagoyāno ādāsasaṇṭhāno, pubbavideho aḍḍhacandasaṇṭhāno, uttarakuru pīṭhasaṇṭhāno.
Aparagoyāna is shaped like a mirror; Pubbavideha is shaped like a crescent moon; Uttarakuru is shaped like a stool.
Aparagoyāna có hình dạng như gương, Pubbavideha có hình dạng bán nguyệt, Uttarakuru có hình dạng hình vuông.
‘‘Taṃtaṃnivāsīnaṃ taṃtaṃparivāradīpavāsīnañca manussānaṃ mukhampi taṃtaṃsaṇṭhāna’’nti vadanti.
They say, "The faces of the humans residing in these respective places and those dwelling in the surrounding islands also have the shape of their respective regions."
Họ nói rằng “Khuôn mặt của những người dân sống ở các châu đó và những người dân sống ở các đảo phụ cận cũng có hình dạng tương ứng”.
Api cettha uttarakurukānaṃ puññānubhāvasiddho ayampi viseso veditabbo.
Moreover, here this special distinction, achieved by the power of merit of the Uttarakuru people, should be understood.
Hơn nữa, ở đây, một đặc điểm khác do phước báu của người dân Uttarakuru mà thành tựu cũng cần được biết đến.
Tattha kira tesu tesu padesesu ghananicitapattasañchannasākhāpasākhā kūṭāgārupamā manoramā rukkhā tesaṃ manussānaṃ nivesanakiccaṃ sādhenti.
There, it is said, in those various regions, trees with dense, closely packed branches and sub-branches covered with leaves, resembling pinnacled houses, charmingly serve as dwellings for those humans.
Ở đó, người ta nói rằng tại các vùng đất đó, những cây cối đẹp đẽ, có cành và nhánh rậm rạp che kín lá, giống như những ngôi nhà có chóp nhọn, phục vụ như là nơi cư trú cho những người dân đó.
Yattha sukhaṃ nivasanti, aññepi tattha rukkhā sujātā sabbadāpi pupphitaggā tiṭṭhanti.
They live comfortably there, and other well-formed trees always stand there with blossoming tops.
Ở đó, những cây khác cũng mọc tốt, luôn luôn trổ hoa.
Jalāsayāpi vikasitapadumapuṇḍarīkasogandhikādipupphasañchannā sabbakālaṃ paramasugandhā samantato pavāyantā tiṭṭhanti.
The bodies of water, too, covered with blooming lotus, white lotus, and water lily flowers, are perpetually fragrant, wafting exceedingly pleasant scents all around.
Các hồ nước cũng luôn thơm ngát với hương hoa sen, hoa súng, hoa sôgandhika và các loài hoa khác nở rộ, tỏa hương thơm ngào ngạt khắp nơi.
Sarīrampi tesaṃ atidīghatādidosarahitaṃ ārohapariṇāhasampannaṃ jarāya anabhibhūtattā valitapalitādidosavirahitaṃ yāvatāyukaṃ aparikkhīṇajavabalaparakkamasobhameva hutvā tiṭṭhati.
Their bodies are also free from defects like excessive height, being perfect in proportion and girth, and not overcome by old age, thus free from defects like wrinkles and grey hair. They remain beautiful with undiminished vitality, strength, and vigour for their entire lifespan.
Thân thể của họ cũng không có các khuyết điểm như quá cao hay quá thấp, mà cân đối về chiều cao và độ lớn, không bị già yếu nên không có các khuyết điểm như nếp nhăn hay tóc bạc, và duy trì vẻ đẹp với sức mạnh và sự nhanh nhẹn không suy giảm trong suốt cuộc đời.
Anuṭṭhānaphalūpajīvitāya na ca tesaṃ kasivaṇijjādivasena āhārapariyeṭṭhivasena dukkhaṃ atthi, tato eva na dāsadāsīkammakarādipariggaho atthi.
Living off spontaneously arising fruits, they have no suffering from agriculture, trade, or the need to seek food; therefore, there are no slaves, servants, or labourers.
Do sống nhờ hoa trái tự nhiên, họ không có khổ sở vì cày cấy, buôn bán hay tìm kiếm thức ăn. Do đó, cũng không có việc sở hữu nô lệ, người hầu hay công nhân.
Na ca tattha sītuṇhaḍaṃsamakasavātātapasarīsapavāḷādiparissayo atthi.
Nor are there dangers such as cold, heat, gnats, mosquitoes, wind, sun, reptiles, or corals.
Ở đó cũng không có các nguy hiểm như lạnh, nóng, côn trùng, muỗi, gió, nắng, rắn rết hay các loài bò sát.
Yathā nāmettha gimhānaṃ pacchime māse paccūsavelāyaṃ samasītuṇho utu hoti, evameva sabbakālaṃ tattha samasītuṇhova utu hoti, na ca nesaṃ koci upaghāto vihesā vā uppajjati.
Just as here, in the last month of summer, the weather is evenly cool and warm in the morning, so too there the weather is always evenly cool and warm; and no harm or vexation arises for them.
Cũng như ở đây, vào buổi sáng sớm của tháng cuối mùa hè, thời tiết ôn hòa, thì ở đó, thời tiết luôn luôn ôn hòa như vậy, và không có bất kỳ tổn hại hay quấy nhiễu nào xảy ra cho họ.
Akaṭṭhapākimameva sāliṃ akaṇaṃ athusaṃ suddhaṃ sugandhaṃ taṇḍulaphalaṃ niddhūmaṅgārena agginā pacitvā paribhuñjanti.
They eat naturally ripened rice, without husk or chaff, pure, fragrant, and cooked with smokeless charcoal fire.
Họ ăn gạo lúa không cần cày cấy, không vỏ trấu, sạch sẽ, thơm ngon, được nấu bằng lửa than không khói.
Tattha kira jotikapāsāṇā nāma honti, atha te tayo pāsāṇe ṭhapetvā tattha ukkhaliṃ āropenti, pāsāṇehi tejo samuṭṭhahitvā taṃ pāceti, añño sūpo vā byañjano vā na hoti, bhuñjantānaṃ cittānukūloyevassa raso hoti.
It is said that there are certain "light-stones." They place three such stones, and on them, they set a pot. Fire arises from the stones and cooks it. There is no other soup or curry; the taste is always pleasing to the minds of those who eat it.
Ở đó, có những viên đá gọi là đá sáng. Họ đặt ba viên đá đó xuống, rồi đặt nồi lên trên, lửa bốc lên từ các viên đá đó làm chín thức ăn. Không có món súp hay món ăn kèm nào khác; hương vị của nó luôn phù hợp với tâm ý của người ăn.
Taṃ pana bhuñjantānaṃ nesaṃ kuṭṭhaṃ gaṇḍo kilāso soso kāso apamāro jaroti evamādiko na koci rogo uppajjati.
As they eat it, no diseases such as leprosy, boils, skin diseases, consumption, cough, epilepsy, or old age arise for them.
Khi ăn, họ không mắc các bệnh như phong cùi, mụn nhọt, bạch biến, lao phổi, ho, động kinh, sốt, v.v.
Te taṃ ṭhānaṃ sampattānaṃ dentiyeva, macchariyacittaṃ nāma neva hoti, buddhapaccekabuddhādayopi mahiddhikā tattha gantvā piṇḍapātaṃ gaṇhanti.
They readily offer it to those who arrive there; there is never a thought of miserliness. Even Buddhas and Paccekabuddhas, who possess great psychic power, go there and receive alms.
Họ luôn cho những ai đến nơi đó; không bao giờ có tâm bỏn xẻn. Các vị Phật, Độc Giác Phật và các vị có thần thông khác cũng đến đó để thọ nhận vật thực.
Na ca te khujjā vā vāmanā vā kāṇā vā kuṇī vā khañjā vā pakkhahatā vā vikalaṅgā vā vikalindriyā vā honti.
They are not hunchbacked, nor dwarves, nor blind, nor crippled, nor lame, nor paralysed, nor physically deformed, nor with defective senses.
Họ không bị gù lưng, lùn, chột mắt, cụt tay, què, liệt nửa người, dị tật hay khiếm khuyết giác quan.
Itthiyopi tattha nātidīghā nātirassā nātikisā nātithūlā nātikāḷikā nāccodātā sobhaggappattarūpā honti.
The women there are also neither too tall nor too short, neither too thin nor too stout, neither too dark nor too fair, possessing beautiful forms.
Phụ nữ ở đó cũng không quá cao, không quá thấp, không quá gầy, không quá mập, không quá đen, không quá trắng, mà có vẻ đẹp rạng rỡ.
Tathā hi dīghaṅgulī tambanakhā alambathanā tanumajjhā puṇṇacandamukhī visālakkhī mudugattā sahibhorū odātadantā gambhīranābhī tanujaṅghā dīghanīlavellitakesī puthulasussoṇī nātilomā nālomā subhagā utusukhasamphassā saṇhā sakhilasambhāsā nānābharaṇavibhūsitā vicaranti, sabbadāpi soḷasavassuddesikā viya honti.
Indeed, they have long fingers, reddish nails, firm breasts, slender waists, faces like the full moon, large eyes, soft bodies, full thighs, white teeth, deep navels, slender calves, long, dark, curly hair, broad hips, not too hairy, not hairless, beautiful, with a pleasant touch suitable for the season, delicate, speaking gently, adorned with various ornaments, they move about, always appearing to be sixteen years old.
Thật vậy, họ có ngón tay dài, móng tay đỏ, ngực đầy đặn, eo thon, mặt tròn như trăng rằm, mắt to, thân mềm mại, đùi đẹp, răng trắng, rốn sâu, bắp chân thon, tóc dài đen xoăn, hông rộng, không quá nhiều lông hay không có lông, xinh đẹp, có xúc chạm dễ chịu theo mùa, dịu dàng, nói năng hòa nhã, và trang sức bằng nhiều loại trang sức khác nhau. Họ luôn trông như thiếu nữ mười sáu tuổi.
Purisāpi pañcavīsativassuddesikā viya, na puttā mātādīsu rajjanti, ayaṃ tattha dhammatā.
The men also appear to be twenty-five years old. Sons do not lust after mothers, etc.; this is the custom there.
Đàn ông cũng trông như hai mươi lăm tuổi. Con cái không quyến luyến cha mẹ, đó là quy luật ở đó.
Sattāhikameva ca tattha itthipurisā kāmaratiyā viharanti, tato vītarāgā viya yathāsukhaṃ gacchanti, na tattha idha viya gabbhokkantimūlakaṃ gabbhapariharaṇamūlakaṃ vā dukkhaṃ vijāyanamūlakaṃ vā dukkhaṃ hoti, rattakañcukato kañcanapaṭimā viya dārakā mātukucchito amakkhitā eva semhādinā sukheneva nikkhamanti, ayaṃ tattha dhammatā.
There, men and women engage in sensual pleasure for only seven days; thereafter, like those free from lust, they go about as they please. There is no suffering there as here, rooted in conception, or rooted in carrying the pregnancy, or rooted in childbirth. Children emerge from the mother's womb as if golden statues from a red covering, unsoiled by phlegm, etc., and with ease; this is the custom there.
Ở đó, nam nữ chỉ sống trong sự hoan lạc tình dục trong bảy ngày, sau đó họ như những người đã ly dục, đi lại tùy ý. Ở đó không có khổ đau do mang thai, do giữ thai, hay do sinh nở như ở đây. Trẻ em ra khỏi bụng mẹ một cách dễ dàng, không bị dơ bẩn bởi đờm dãi, như pho tượng vàng từ chiếc áo choàng đỏ, đó là quy luật ở đó.
Mātā pana puttaṃ vā dhītaraṃ vā vijāyitvā tesaṃ vicaraṇakappadese ṭhapetvā anapekkhā yathāruci gacchati.
A mother, having given birth to a son or daughter, places them in the area where they are to wander and, without attachment, goes wherever she wishes.
Người mẹ sau khi sinh con trai hay con gái, đặt chúng vào nơi chúng có thể đi lại, rồi không bận tâm mà đi theo ý muốn.
Tesaṃ tattha sayitānaṃ ye passanti purisā vā itthiyo vā, te attano aṅguliyo upanāmenti, tesaṃ kammabalena tato khīraṃ pavattati, tena te dārakā yāpenti.
To those lying there, any men or women who see them offer their fingers; by the power of their karma, milk flows from them, and with this, the children sustain themselves.
Khi chúng nằm ở đó, những người đàn ông hay phụ nữ nào nhìn thấy chúng, họ đưa ngón tay của mình ra, và do sức mạnh nghiệp của họ, sữa chảy ra từ đó, nhờ đó những đứa trẻ đó sống được.
Evaṃ pana vaḍḍhantā katipayadivaseyeva laddhabalā hutvā dārikā itthiyo upagacchanti, dārakā purise.
Thus, growing up, in just a few days they become strong; girls approach women, and boys approach men.
Khi lớn lên như vậy, chỉ sau vài ngày, chúng có sức mạnh, các bé gái đi theo phụ nữ, các bé trai đi theo đàn ông.
Kapparukkhato eva ca tesaṃ tattha vatthābharaṇāni nipphajjanti.
From wish-fulfilling trees alone do clothes and ornaments arise for them there.
Quần áo và trang sức của họ cũng được tạo ra từ cây như ý (kapparukkha) ở đó.
Nānāvirāgavaṇṇavicittāni hi vatthāni sukhumāni mudusukhasamphassāni tattha tattha kapparukkhesu olambantāni tiṭṭhanti.
Indeed, clothes of various pleasing colours, subtle, soft, and pleasant to touch, hang from the wish-fulfilling trees here and there.
Thật vậy, những bộ quần áo với nhiều màu sắc rực rỡ, mềm mại, có xúc chạm dễ chịu, treo lủng lẳng trên các cây như ý ở khắp nơi.
Nānāvidharaṃsijālasamujjalavividhavaṇṇaratanavinaddhāni anekavidhamālākammalatākammabhittikammavicittāni sīsūpagagīvūpagakaṭūpagahatthūpagapādūpagāni sovaṇṇamayāni ābharaṇāni ca kapparukkhato olambanti.
Golden ornaments, glittering with various coloured gems set in diverse patterns of light rays, adorned with many kinds of floral patterns, vine patterns, and wall patterns, for the head, neck, waist, hands, and feet, also hang from the wish-fulfilling trees.
Các loại trang sức bằng vàng, được nạm nhiều loại đá quý với nhiều màu sắc rực rỡ như mạng lưới ánh sáng, được trang trí bằng nhiều loại hoa văn dây leo, hoa văn tường, để đeo ở đầu, cổ, eo, tay, chân, cũng treo lủng lẳng từ cây như ý.
Tathā vīṇāmudiṅgapaṇavasammatāḷasaṅkhavaṃsavetāḷaparivārādīni vallakīpabhautikāni tūriyabhaṇḍānipi tato olambanti.
Similarly, lutes, drums, small drums, cymbals, conch shell trumpets, bamboo flutes, other accompanying instruments, and stringed instruments like the vallakī and other musical instruments also hang down from there.
Tương tự, các nhạc cụ như đàn vīṇā, mudiṅga, paṇava, sammatāḷa, saṅkha, vaṃsa, vetāḷa, và các loại nhạc khí giống như đàn vallakī, v.v., cũng treo lơ lửng từ đó.
Tattha ca bahū phalarukkhā kumbhamattāni phalāni phalanti, madhurarasāni yāni paribhuñjitvā te sattāhampi khuppipāsāhi na bādhīyanti.
And there, many fruit trees bear sweet-juiced fruits the size of jars, by eating which they are not afflicted by hunger and thirst for even seven days.
Ở đó có nhiều cây ăn quả, cho ra những trái to bằng cái chum, có vị ngọt ngào, khi ăn vào thì những chúng sinh ấy không bị đói khát quấy nhiễu trong bảy ngày.
Najjopi tattha suvisuddhajalā supatitthā ramaṇīyā akaddamā vālukatalā nātisītā nātiuṇhā surabhigandhīhi jalajapupphehi sañchannā sabbakālaṃ surabhī vāyantiyo sandanti, na tattha kaṇṭakinā kakkhaḷagacchalatā honti, akaṇṭakā pupphaphalasacchannā eva honti, candananāgarukkhā sayameva rasaṃ paggharanti.
And there, rivers with very pure water, pleasant, with good bathing places, free from mud, with sandy beds, neither too cold nor too hot, covered with fragrant aquatic flowers, always flow exhaling fragrance; thorny, rough thickets and creepers are not found there, but thornless trees covered with flowers and fruits; sandalwood and nāga trees themselves exude sap.
Các con sông ở đó cũng có nước rất trong sạch, bến bãi tốt đẹp, dễ chịu, không bùn lầy, đáy cát, không quá lạnh, không quá nóng, được bao phủ bởi các loài hoa sen tỏa hương thơm ngát, luôn luôn có gió thơm thổi qua. Ở đó không có các loài cây bụi và dây leo có gai sắc nhọn, mà chỉ có các loài cây không gai, phủ đầy hoa trái. Các cây chiên đàn và nāga tự mình tiết ra nhựa thơm.
Nahāyitukāmā ca nadītitthe ekajjhaṃ vatthābharaṇāni ṭhapetvā nadiṃ otaritvā nahāyitvā uttiṇṇā uttiṇṇā upariṭṭhimaṃ upariṭṭhimaṃ vatthābharaṇaṃ gaṇhanti, na tesaṃ evaṃ hoti ‘‘idaṃ mama, idaṃ parassā’’ti.
Those who wish to bathe, having placed their clothes and ornaments together at the river's bathing place, descend into the river, bathe, and as they emerge, they take the uppermost clothes and ornaments; it does not occur to them, "This is mine, this belongs to another."
Những ai muốn tắm thì đặt quần áo và đồ trang sức của mình cùng một chỗ ở bến sông, rồi xuống sông tắm. Sau khi lên bờ, mỗi người đều lấy quần áo và đồ trang sức ở phía trên cùng, không ai nghĩ rằng: “Đây là của tôi, đây là của người khác.”
Tato eva na tesaṃ koci viggaho vā vivādo vā, sattāhikā eva ca nesaṃ kāmaratikīḷā hoti, tato vītarāgā viya vicaranti.
Hence, there is no dispute or quarrel among them, and their sensual pleasures and games last for only seven days, after which they wander as if dispassionate.
Do đó, họ không có bất kỳ cuộc cãi vã hay tranh chấp nào. Họ chỉ hưởng thụ niềm vui dục lạc trong bảy ngày, sau đó họ sống như những người đã lìa tham ái.
Yattha ca rukkhe sayitukāmā honti, tattheva sayanaṃ upalabbhati.
And wherever they wish to sleep under a tree, a bed becomes available right there.
Họ muốn nằm ngủ ở cây nào thì giường ngủ xuất hiện ngay tại đó.
Mate ca satte na rodanti na socanti, tañca maṇḍayitvā nikkhipanti.
When beings die, they do not weep or mourn, but adorn and set down the body.
Khi có chúng sinh chết, họ không khóc than hay sầu muộn, mà trang hoàng thi thể và đặt xuống.
Tāvadeva ca tathārūpā sakuṇā upagantvā mataṃ dīpantaraṃ nenti, tasmā susānaṃ vā asuciṭṭhānaṃ vā tattha natthi, na ca tato matā nirayaṃ vā tiracchānayoniṃ vā pettivisayaṃ vā upapajjanti.
Immediately, birds of that kind come and carry the deceased to another island; therefore, there is no charnel ground or unclean place there, nor do those who die from there arise in hell, the animal realm, or the realm of hungry ghosts.
Ngay lập tức, những loài chim như vậy đến mang thi thể đến một hòn đảo khác. Vì vậy, ở đó không có nghĩa địa hay nơi ô uế, và những người chết từ đó không tái sinh vào địa ngục, loài súc sinh, hay cảnh giới ngạ quỷ.
‘‘Dhammatāsiddhassa pañcasīlassa ānubhāvena te devaloke nibbattantī’’ti vadanti.
They say, "By the power of the natural pañcasīla, they are reborn in the deva realm."
Người ta nói rằng: “Với uy lực của năm giới đã được thành tựu theo tự nhiên, họ tái sinh vào cõi trời.”
Vassasahassameva ca nesaṃ sabbakālaṃ āyuppamāṇaṃ, sabbametaṃ nesaṃ pañcasīlaṃ viya dhammatāsiddhamevāti veditabbaṃ.
And their lifespan is always one thousand years; all this is to be understood as naturally accomplished for them, like the pañcasīla.
Tuổi thọ của họ luôn là một ngàn năm. Tất cả những điều này, giống như năm giới của họ, cần được biết là đã được thành tựu theo tự nhiên.
Tadantaresūti tesaṃ cakkavāḷānaṃ antaresu.
Tadantaresūti: in the intervals between those cakkavāḷas.
Tadantaresu (giữa những thứ đó) nghĩa là giữa các cakkavāḷa (hệ thống thế giới) ấy.
Lokantarikanirayāti lokānaṃ lokadhātūnaṃ antaro vivaro lokantaro, tattha bhavā lokantarikā, nirayā.
Lokantarikanirayāti: the space, the chasm, between worlds, between world-elements, is lokantara; those that are there are lokantarikā, nirayas.
Lokantarikanirayā (các địa ngục Lokantarika) nghĩa là khoảng trống, khe hở giữa các lokadhātu (thế giới) là lokantara (khe hở thế giới), các địa ngục tồn tại ở đó là lokantarika.
Tiṇṇañhi sakaṭacakkānaṃ pattānaṃ vā aññamaññaṃ āsannabhāvena ṭhapitānaṃ antarasadisesu tiṇṇaṃ tiṇṇaṃ cakkavāḷānaṃ antaresu ekeko lokantarikanirayo.
Just as three cartwheels or three leaves are placed close to each other, so in the similar spaces between every three cakkavāḷas, there is one Lokantarika hell.
Thật vậy, giống như ba bánh xe bò hoặc ba chiếc đĩa được đặt gần nhau, giữa ba cakkavāḷa có một địa ngục Lokantarika.
So pana parimāṇato aṭṭhayojanasahassappamāṇo hoti niccavivaṭo heṭṭhā upari ca kenaci na pihito.
It is eight thousand yojanas in extent, always open, and not covered by anything above or below.
Địa ngục đó có kích thước tám ngàn dojun, luôn luôn mở, không bị che đậy ở phía dưới và phía trên bởi bất cứ thứ gì.
Yathā hi heṭṭhā udakassa pidhāyikā pathavī natthīti asaṃvutā lokantarikanirayā, evaṃ uparipi cakkavāḷesu viya devavimānānaṃ abhāvato asaṃvutā apihitā cakkhuviññāṇuppattinivāraṇasamatthena ca andhakārena samannāgatā.
Just as there is no earth covering the water below, so the Lokantarika hells are uncovered, and similarly, above, due to the absence of deva mansions as in other cakkavāḷas, they are uncovered and not obscured, and are endowed with darkness capable of preventing the arising of eye-consciousness.
Giống như các địa ngục Lokantarika không có đất che phủ ở phía dưới, vì không có đất ngăn nước, thì tương tự, ở phía trên cũng không có các lâu đài của chư thiên như trong các cakkavāḷa, nên chúng không bị che phủ, không bị che đậy, và được bao trùm bởi bóng tối có khả năng ngăn cản sự phát sinh của nhãn thức.
Tattha kira cakkhuviññāṇaṃ na jāyati ālokassa abhāvato.
There, it is said, eye-consciousness does not arise due to the absence of light.
Người ta nói rằng ở đó nhãn thức không phát sinh vì không có ánh sáng.
Tīsu dīpesu ekappahārena ālokakaraṇasamatthāpi candimasūriyā tattha ālokaṃ na dassenti.
Even the sun and moon, capable of illuminating three continents at once, do not shed light there.
Mặt trăng và mặt trời, dù có khả năng chiếu sáng cùng lúc ba châu, cũng không chiếu sáng ở đó.
Te hi yugandharasamappamāṇe ākāsappadese vicaraṇato cakkavāḷapabbatassa vemajjhena vicaranti, cakkavāḷapabbatañca atikkamma lokantarikanirayā, tasmā te tattha ālokaṃ na dassentīti cakkhuviññāṇaṃ nuppajjati.
For they travel in an aerial space equal to Mount Yugandhara, moving through the middle of the Cakkavāḷa mountain; and the Lokantarika hells are beyond the Cakkavāḷa mountain; therefore, they do not shed light there, and so eye-consciousness does not arise.
Vì chúng di chuyển trong không gian có kích thước bằng núi Yugandhara, nên chúng di chuyển ở giữa núi cakkavāḷa. Còn các địa ngục Lokantarika thì ở vượt ra ngoài núi cakkavāḷa. Do đó, chúng không chiếu sáng ở đó, và nhãn thức không phát sinh.
Yadā pana sabbaññubodhisattassa paṭisandhiggahaṇādīsu obhāso uppajjati, tadā cakkhuviññāṇaṃ uppajjati.
However, when radiance appears, such as at the time of the Bodhisatta's conception, then eye-consciousness arises.
Tuy nhiên, khi ánh sáng phát sinh trong các dịp như sự thọ sinh của Bồ tát Toàn Giác, thì nhãn thức phát sinh.
‘‘Aññepi kira bho santi sattā idhūpapannā’’ti taṃ divasaṃ aññamaññaṃ passanti.
"Indeed, sirs, there are other beings born here!" they exclaim, seeing one another on that day.
Vào ngày đó, họ nhìn thấy lẫn nhau và nói: “Này các bạn, còn có những chúng sinh khác tái sinh ở đây!”
Ayaṃ pana obhāso ekaṃ yāgupānamattampi na tiṭṭhati, accharāsaṅghāṭamattameva vijjobhāso viya niccharitvā ‘‘kiṃ ida’’nti bhaṇantānaṃyeva antaradhāyati.
But this radiance does not last even for the time it takes to drink one cup of gruel; it flashes like lightning for merely the snapping of a finger, and vanishes even as they exclaim, "What is this?"
Nhưng ánh sáng này không tồn tại lâu bằng một lần uống cháo, mà chỉ lóe lên như ánh chớp trong chốc lát rồi biến mất ngay khi họ đang nói: “Cái gì đây?”
Kiṃ pana kammaṃ katvā tattha sattā nibbattantīti?
What kamma do beings perform to be reborn there?
Vậy thì, chúng sinh ở đó tái sinh do đã tạo nghiệp gì?
Bhāriyaṃ dāruṇaṃ garukaṃ mātāpitūnaṃ dhammikasamaṇabrāhmaṇānañca upari aparādhaṃ aññañca divase divase pāṇavadhādiṃ sāhasikakammaṃ katvā uppajjanti tambapaṇṇidīpe abhayacoranāgacorādayo viya.
Having committed serious, dreadful, and weighty offenses against parents, and righteous recluses and brahmins, and other daily acts of violence like taking lives, they are reborn there, like Abhaya, Cora, Nāgacora, and others in Tambapaṇṇidīpa.
Họ tái sinh ở đó sau khi đã tạo những nghiệp ác nặng nề, tàn bạo, nghiêm trọng như phạm tội với cha mẹ, các sa-môn, bà-la-môn chân chính, và các nghiệp bạo lực khác như sát sinh hàng ngày, giống như những tên cướp Abhaya và Nāga ở đảo Tambapaṇṇi.
Tesaṃ attabhāvo tigāvutiko hoti, vaggulīnaṃ viya dīghanakhā honti.
Their bodies are three gāvutas tall, and they have long claws like bats.
Thân thể của họ cao ba gāvuta, móng tay dài như dơi.
Te rukkhe vagguliyo viya nakhehi cakkavāḷapāde lagganti, yadā saṃsappantā aññamaññassa hatthapāsagatā honti, atha ‘‘bhakkho no laddho’’ti maññamānā khādanatthaṃ gaṇhituṃ upakkamantā viparivattitvā lokasandhārake udake patanti, vāte paharantepi madhukaphalāni viya chijjitvā udake patanti, patitamattāva accantakhāre udake piṭṭhapiṇḍaṃ viya vilīyanti atisītalabhāvato ātapasantāpābhāvena.
They cling to the base of the cakkavāḷa with their claws like bats cling to trees; when they crawl and come within arm's reach of each other, thinking "We have found prey," and attempting to seize it to eat, they turn over and fall into the world-sustaining water, or they are torn off like kapok fruits by the wind and fall into the water; as soon as they fall, they dissolve like a lump of flour in the extremely saline water, due to its extreme coldness and lack of warmth.
Họ bám vào chân núi cakkavāḷa bằng móng tay như dơi bám vào cây. Khi họ bò trườn và lọt vào tầm tay của nhau, họ nghĩ: “Chúng ta đã tìm thấy thức ăn,” rồi cố gắng bắt để ăn, nhưng họ bị lộn ngược và rơi xuống nước duy trì thế giới. Ngay cả khi gió thổi mạnh, họ cũng bị đứt lìa như trái madhuka và rơi xuống nước. Ngay khi rơi xuống, họ tan rã như một viên bột mì trong nước cực mặn, do quá lạnh và không có sức nóng của mặt trời.
Atisītalabhāvameva hi sandhāya accantakhāratā vuttā.
For it is in reference to its extreme coldness that its extreme salinity is mentioned.
Thật vậy, sự cực mặn được nói đến là để chỉ sự quá lạnh.
Na hi taṃ kappasaṇṭhahanaudakaṃ sampattikaramahāmeghavuṭṭhaṃ pathavīsandhārakaṃ kappavināsakaudakaṃ viya khāraṃ bhavituṃ arahati.
For that water, which sustains the kappa and rains down from the great clouds that bring prosperity, should not be as saline as the water that destroys the kappa and sustains the earth.
Vì nước duy trì thế giới, được mưa từ những đám mây lớn vào lúc thế giới hình thành, không thể mặn như nước hủy diệt thế giới vào lúc thế giới bị hủy diệt.
Tathā hi sati pathavīpi vilīyeyya, tesaṃ vā pāpakammabalena petānaṃ pakatiudakassa pubbakheḷabhāvāpatti viya tassa udakassa tadā khārabhāvappatti hotīti vuttaṃ ‘‘accantakhāre udake piṭṭhapiṇḍaṃ viya vilīyantī’’ti.
If that were the case, the earth would also dissolve; rather, it is said that by the power of their evil kamma, just as ordinary water becomes like pus and phlegm for hungry ghosts, so that water becomes saline at that time, hence it is stated, "they dissolve like a lump of flour in the extremely saline water."
Nếu vậy, đất cũng sẽ tan rã. Do sức mạnh của ác nghiệp của những chúng sinh ấy, giống như nước bình thường của ngạ quỷ biến thành đờm dãi, nước đó lúc đó trở nên mặn. Vì vậy, người ta nói: “họ tan rã như một viên bột mì trong nước cực mặn.”
Anantānīti aparimāṇāni, ‘‘ettakānī’’ti aññehi minituṃ asakkuṇeyyāni.
Anantānīti: immeasurable, uncountable; unable to be measured by others as "this many."
Anantāni (vô lượng) nghĩa là không giới hạn, không thể đo lường được bởi người khác rằng “có bấy nhiêu.”
Tāni ca bhagavā anantena buddhañāṇena avedi ‘‘ananto ākāso, ananto sattanikāyo, anantāni cakkavāḷānī’’ti.
And the Bhagavā knew them with infinite Buddha-knowledge, saying, "Space is infinite, the multitude of beings is infinite, the cakkavāḷas are infinite."
Đức Thế Tôn đã biết những điều đó bằng Phật trí vô lượng: “Không gian vô lượng, chúng sinh vô lượng, các cakkavāḷa vô lượng.”
Tividhampi hi anantaṃ buddhañāṇena paricchindati sayampi anantattā.
For the Buddha-knowledge comprehends all three kinds of infinitude, being itself infinite.
Thật vậy, Phật trí có thể phân biệt được ba loại vô lượng vì chính nó cũng vô lượng.
Yāvatakañhi ñeyyaṃ, tāvatakaṃ ñāṇaṃ.
For as vast as the knowable is, so vast is the knowledge.
Thật vậy, trí tuệ bao nhiêu thì đối tượng nhận thức bấy nhiêu.
Yāvatakaṃ ñāṇaṃ, tāvatakameva ñeyyaṃ.
As vast as the knowledge is, so vast is the knowable.
Trí tuệ bao nhiêu thì đối tượng nhận thức cũng bấy nhiêu.
Ñeyyapariyantikaṃ ñāṇaṃ, ñāṇapariyantikaṃ ñeyyanti.
Knowledge extends to the knowable, and the knowable extends to knowledge.
Trí tuệ là giới hạn của đối tượng nhận thức, đối tượng nhận thức là giới hạn của trí tuệ.
Tena vuttaṃ ‘‘anantena buddhañāṇena avedī’’tiādi.
Therefore, it is said, " with infinite Buddha-knowledge he knew," and so on.
Do đó, đã nói “Ngài đã biết bằng Phật trí vô lượng” v.v.
Anantatā cassa anantañeyyappaṭivijjhaneneva veditabbā tattha appaṭihatacārattā.
Its infinitude is to be understood precisely by its penetration of the infinite knowable, due to its unobstructed movement therein.
Sự vô lượng của trí tuệ đó cần được biết qua việc thấu triệt các đối tượng nhận thức vô lượng, vì trí tuệ đó không bị cản trở trong việc hoạt động ở đó.
Idāni yathāvuttamatthaṃ nigamento āha ‘‘evamassa okāsalokopi sabbathā vidito’’ti.
Now, concluding the meaning thus stated, he says, " Thus, even the space-world was known to him in every way."
Bây giờ, để kết luận ý nghĩa đã nói, Đức Phật nói: “Như vậy, thế giới không gian cũng được biết đến hoàn toàn.”
Api cettha vivaṭṭādīnampi viditatā vattabbā, tasmā vivaṭṭādayopi ādito pabhuti evaṃ veditabbā – saṃvaṭṭo saṃvaṭṭaṭṭhāyī vivaṭṭo vivaṭṭaṭṭhāyīti kappassa cattāri asaṅkhyeyyāni.
Moreover, the knowledge of the vivaṭṭa (unfolding) and so on should also be mentioned here; therefore, the vivaṭṭa and so on should be understood from the beginning as follows: saṃvaṭṭa (contracting), saṃvaṭṭaṭṭhāyī (contracting-abiding), vivaṭṭa (unfolding), vivaṭṭaṭṭhāyī (unfolding-abiding)—these are the four asaṅkheyya kappas.
Hơn nữa, ở đây cũng cần nói về sự hiểu biết về các thời kỳ vivaṭṭa (hình thành) v.v. Do đó, các thời kỳ vivaṭṭa v.v. cần được biết như sau từ ban đầu: saṃvaṭṭa (hoại), saṃvaṭṭaṭṭhāyī (hoại trụ), vivaṭṭa (thành), vivaṭṭaṭṭhāyī (thành trụ) là bốn a-tăng-kỳ kiếp.
Tattha saṃvaṭṭanaṃ vinassanaṃ saṃvaṭṭo, vinassamāno asaṅkhyeyyakappo.
Therein, saṃvaṭṭana (contracting) or destruction is saṃvaṭṭa, the asaṅkheyya kappa that is being destroyed.
Trong đó, sự hoại diệt là saṃvaṭṭa, tức là kiếp a-tăng-kỳ đang hoại diệt.
So pana atthato kāloyeva, tadā pavattamānasaṅkhāravasenassa vināso veditabbo.
This is, in essence, simply time; its destruction is to be understood in terms of the formations occurring at that time.
Thật ra, đó chỉ là thời gian, sự hoại diệt của nó cần được hiểu theo các hành đang diễn ra lúc đó.
Saṃvaṭṭato uddhaṃ tathāṭhāyīkālo saṃvaṭṭaṭṭhāyī.
The period of abiding in that state after the saṃvaṭṭa is saṃvaṭṭaṭṭhāyī.
Thời gian tồn tại như vậy sau thời kỳ saṃvaṭṭa là saṃvaṭṭaṭṭhāyī.
Vivaṭṭanaṃ nibbattanaṃ vaḍḍhanaṃ vā vivaṭṭo, vaḍḍhamāno asaṅkhyeyyakappo.
Vivaṭṭana (unfolding), arising, or growth is vivaṭṭa, the asaṅkheyya kappa that is growing.
Sự phát sinh, sự hình thành, hay sự tăng trưởng là vivaṭṭa, tức là kiếp a-tăng-kỳ đang tăng trưởng.
Sopi atthato kāloyeva, tadā pavattamānasaṅkhāravasenassa vaḍḍhi veditabbā.
This, too, is in essence simply time; its growth is to be understood in terms of the formations occurring at that time.
Nó cũng thật ra chỉ là thời gian, sự tăng trưởng của nó cần được hiểu theo các hành đang diễn ra lúc đó.
Vivaṭṭato uddhaṃ tathāṭhāyīkālo vivaṭṭaṭṭhāyī.
The period of abiding in that state after the vivaṭṭa is vivaṭṭaṭṭhāyī.
Thời gian tồn tại như vậy sau thời kỳ vivaṭṭa là vivaṭṭaṭṭhāyī.
Tattha tayo saṃvaṭṭā tejosaṃvaṭṭo āposaṃvaṭṭo vāyosaṃvaṭṭoti.
Therein, there are three types of saṃvaṭṭa: fire-saṃvaṭṭa, water-saṃvaṭṭa, and wind-saṃvaṭṭa.
Trong đó có ba loại saṃvaṭṭa: tejosaṃvaṭṭa (hoại do lửa), āposaṃvaṭṭa (hoại do nước), vāyosaṃvaṭṭa (hoại do gió).
Tisso saṃvaṭṭasīmā ābhassarā subhakiṇhā vehapphalāti.
There are three limits of dissolution: Ābhassara, Subhakiṇha, and Vehapphala.
Có ba giới hạn hủy diệt: cõi Quang Âm (Ābhassarā), cõi Biến Tịnh (Subhakiṇhā), và cõi Quảng Quả (Vehapphalā).
Yadā kappo tejena saṃvaṭṭati, tadā ābhassarato heṭṭhā agginā ḍayhati.
When the eon dissolves by fire, then it burns with fire below the Ābhassara*.
Khi kiếp bị hủy diệt bởi lửa, lúc đó từ cõi Quang Âm trở xuống bị lửa thiêu cháy.
Yadā āpena saṃvaṭṭati, tadā subhakiṇhato heṭṭhā udakena vilīyati.
When it dissolves by water, then it dissolves with water below the Subhakiṇha*.
Khi kiếp bị hủy diệt bởi nước, lúc đó từ cõi Biến Tịnh trở xuống bị nước hòa tan.
Yadā vāyunā saṃvaṭṭati, tadā vehapphalato heṭṭhā vātena viddhaṃsati.
When it dissolves by wind, then it is destroyed by wind below the Vehapphala*.
Khi kiếp bị hủy diệt bởi gió, lúc đó từ cõi Quảng Quả trở xuống bị gió thổi tan.
Vitthārato pana tīsupi saṃvaṭṭakālesu ekaṃ buddhakkhettaṃ vinassati.
In detail, however, in all three times of dissolution, one buddha-field perishes.
Tuy nhiên, nói rộng ra, trong cả ba thời kỳ hủy diệt, một Phật độ bị hoại diệt.
Buddhakkhettaṃ nāma tividhaṃ hoti jātikkhettaṃ āṇākkhettaṃ visayakkhettañca.
A buddha-field is of three kinds: the birth-field, the authority-field, and the scope-field.
Phật độ có ba loại: cõi sanh (jātikkhetta), cõi uy lực (āṇākkhetta), và cõi đối tượng (visayakkhetta).
Tattha jātikkhettaṃ dasasahassacakkavāḷapariyantaṃ hoti, yaṃ tathāgatassa paṭisandhiggahaṇādīsu kampati.
Among these, the birth-field extends over ten thousand world-systems, and it trembles when the Tathāgata takes rebirth and so on.
Trong đó, cõi sanh (jātikkhetta) là giới hạn của mười ngàn luân vũ, nơi rung động khi Như Lai thọ sanh, v.v.
Yattake hi ṭhāne tathāgatassa paṭisandhiñāṇādiñāṇānubhāvo puññaphalasamuttejito saraseneva paṭivijambhati, taṃ sabbampi buddhaṅkurassa nibbattanakkhettaṃ nāmāti buddhakkhettanti vuccati.
Indeed, any place where the power of the Tathāgata's knowledge, such as the knowledge of rebirth, stimulated by the fruit of merit, spontaneously manifests, all of that is called the 'birth-field of the Buddha-sprout,' and thus it is called a buddha-field.
Ở bất cứ nơi nào mà uy lực của trí tuệ thọ sanh của Như Lai, v.v., được thúc đẩy bởi quả phước, tự nhiên hiển lộ, tất cả những nơi đó được gọi là cõi sanh của Phật tử, tức là Phật độ.
Āṇākkhettaṃ pana koṭisatasahassacakkavāḷapariyantaṃ, yattha ratanasuttaṃ (khu. pā. 6.1 ādayo; su. ni. 224 ādayo) khandhaparittaṃ (a. ni. 4.67; jā. 1.2.105-106; cūḷava. 251 ādayo) dhajaggaparittaṃ (saṃ. ni. 1.249) āṭānāṭiyaparittaṃ (dī. ni. 3.275 ādayo) moraparittanti (jā. 1.2.17-18) imesaṃ parittānaṃ ānubhāvo vattati.
The authority-field, however, extends over a hundred thousand crores of world-systems, where the power of these protective verses — the Ratana Sutta, the Khandha Paritta, the Dhajagga Paritta, the Āṭānāṭiya Paritta, and the Mora Paritta — prevails.
Còn cõi uy lực (āṇākkhetta) là giới hạn của một trăm ngàn vạn luân vũ, nơi uy lực của các bài kinh hộ trì này được lan tỏa: Kinh Châu Báu (Ratanasutta) (Khu. pā. 6.1 tt.; Su. ni. 224 tt.), Khẩn nguyện Hộ trì các loài bò sát (Khandhaparitta) (A. ni. 4.67; Jā. 1.2.105-106; Cūḷava. 251 tt.), Khẩn nguyện Hộ trì ngọn cờ (Dhajaggaparitta) (Saṃ. ni. 1.249), Khẩn nguyện Hộ trì Āṭānāṭiya (Āṭānāṭiyaparitta) (Dī. ni. 3.275 tt.), và Khẩn nguyện Hộ trì chim Khổng tước (Moraparitta) (Jā. 1.2.17-18).
Iddhimā hi cetovasippatto āṇākkhettapariyāpanne yattha katthaci cakkavāḷe ṭhatvā attano atthāya parittaṃ katvā tattheva aññaṃ cakkavāḷaṃ gatopi kataparitto eva hoti.
Indeed, an individual endowed with psychic power who has mastered the mind, standing in any world-system within the authority-field and having recited a protective verse for their own benefit, is still considered to have recited it even if they go to another world-system.
Quả thật, một người có thần thông, thành thạo trong việc điều khiển tâm, dù đứng ở bất cứ luân vũ nào thuộc cõi uy lực, sau khi đã trì tụng kinh hộ trì vì lợi ích của mình, dù đã đến một luân vũ khác, vẫn được xem là đã trì tụng kinh hộ trì.
Ekacakkavāḷe ṭhatvā sabbasattānaṃ atthāya paritte kate āṇākkhette sabbasattānampi abhisambhuṇāteva parittānubhāvo tattha devatāhi parittānaṃ sampaṭicchitabbato, tasmā taṃ āṇākkhettanti vuccati.
When a protective verse is recited for the benefit of all beings while standing in one world-system, its power reaches all beings in the authority-field because the devas there accept the protective verses; therefore, it is called the authority-field.
Khi kinh hộ trì được trì tụng vì lợi ích của tất cả chúng sanh trong một luân vũ, uy lực của kinh hộ trì cũng bao trùm tất cả chúng sanh trong cõi uy lực, vì các vị thiên nhân ở đó phải tiếp nhận sự hộ trì; do đó, nó được gọi là cõi uy lực.
Visayakkhettaṃ pana anantaṃ aparimāṇaṃ.
The scope-field, however, is infinite and immeasurable.
Còn cõi đối tượng (visayakkhetta) thì vô biên, vô lượng.
Anantāparimāṇesu hi cakkavāḷesu yaṃ yaṃ tathāgato ākaṅkhati, taṃ taṃ jānāti ākaṅkhappaṭibaddhavuttitāya buddhañāṇassa.
Indeed, in infinite and immeasurable world-systems, whatever the Tathāgata desires to know, that he knows, because the Buddha's knowledge operates in dependence on his desire.
Quả thật, trong các luân vũ vô biên vô lượng, bất cứ điều gì Như Lai mong muốn, Ngài đều biết, vì trí tuệ của Phật hoạt động tùy thuộc vào sự mong muốn.
Evametesu tīsu buddhakkhettesu ekaṃ āṇākkhettaṃ vinassati, tasmiṃ pana vinassante jātikkhettaṃ vinaṭṭhameva hoti.
Thus, among these three buddha-fields, the authority-field perishes; and when it perishes, the birth-field is already perished.
Như vậy, trong ba Phật độ này, một cõi uy lực bị hoại diệt, và khi nó hoại diệt thì cõi sanh cũng đã hoại diệt.
Vinassantampi ekatova vinassati, saṇṭhahantampi ekatova saṇṭhahati, tassevaṃ vināso saṇṭhahanañca veditabbaṃ.
Even when perishing, it perishes together; even when establishing itself, it establishes itself together. Its perishing and establishing should be understood in this way.
Khi hoại diệt thì hoại diệt đồng loạt, khi hình thành thì hình thành đồng loạt, sự hoại diệt và hình thành của nó phải được hiểu như vậy.
Yasmiṃ samaye kappo agginā nassati, āditova kappavināsakamahāmegho uṭṭhahitvā koṭisatasahassacakkavāḷe ekaṃ mahāvassaṃ vassati, manussā tuṭṭhā sabbabījāni nīharitvā vapanti, sassesu pana gokhāyitamattesu jātesu gadrabharavaṃ ravanto ekabindumpi na vassati, tadā pacchinnapacchinnameva hoti vassaṃ.
At the time when the eon perishes by fire, first the great cloud causing the eon's destruction arises and pours a great rain over a hundred thousand crores of world-systems. People, delighted, bring out all seeds and sow them. But when the crops have grown to the extent of a cow's fodder, it does not rain a single drop, braying like a donkey; then the rain ceases completely.
Vào thời điểm kiếp bị hoại diệt bởi lửa, ban đầu một đám mây lớn gây hoại diệt kiếp nổi lên và đổ một trận mưa lớn trên hàng trăm ngàn vạn luân vũ. Con người vui mừng mang tất cả hạt giống ra gieo trồng. Nhưng khi cây cối chỉ vừa đủ cho bò ăn, đám mây đó sẽ gầm lên như tiếng lừa và không đổ một giọt mưa nào nữa. Lúc đó, mưa sẽ hoàn toàn chấm dứt.
Idaṃ sandhāya hi bhagavatā ‘‘hoti so, bhikkhave, samayo yaṃ bahūni vassāni bahūni vassasatāni bahūni vassasahassāni bahūni vassasatasahassāni devo na vassatī’’ti (a. ni. 7.66) vuttaṃ.
It is with reference to this that the Blessed One said: “There comes a time, monks, when for many years, many hundreds of years, many thousands of years, many hundreds of thousands of years, the deva does not rain.”
Chính vì điều này mà Đức Thế Tôn đã nói: “Này các Tỳ-kheo, có một thời điểm mà nhiều năm, nhiều trăm năm, nhiều ngàn năm, nhiều trăm ngàn năm, trời không mưa” (A. ni. 7.66).
Vassūpajīvinopi sattā kālaṃ katvā parittābhādibrahmaloke nibbattanti, pupphaphalūpajīviniyo ca devatā.
Beings dependent on rain die and are reborn in the Brahma-realms such as Parittābha, as do devas dependent on flowers and fruits.
Những chúng sanh sống nhờ mưa cũng chết và tái sanh vào các cõi Phạm thiên như cõi Thiểu Quang (Parittābhā), v.v., và các vị thiên nhân sống nhờ hoa quả cũng vậy.
Evaṃ dīghe addhāne vītivatte tattha tattha udakaṃ parikkhayaṃ gacchati, athānupubbena macchakacchapāpi kālaṃ katvā brahmaloke nibbattanti nerayikasattāpi.
As a long period passes in this way, water in various places dries up. Then, gradually, fish and tortoises also die and are reborn in the Brahma-realms, as are hell-beings.
Sau một thời gian dài như vậy, nước ở khắp nơi cạn kiệt. Rồi dần dần, cá và rùa cũng chết và tái sanh vào cõi Phạm thiên, ngay cả chúng sanh địa ngục cũng vậy.
Tattha nerayikā sattamasūriyapātubhāve vinassantīti eke.
Some say that hell-beings perish at the appearance of the seventh sun.
Một số người nói rằng chúng sanh địa ngục hoại diệt khi mặt trời thứ bảy xuất hiện.
Jhānaṃ pana vinā natthi brahmaloke nibbatti, etesañca keci dubbhikkhapīḷitā, keci abhabbā jhānādhigamāya, te kathaṃ tattha nibbattantīti?
However, without jhāna, there is no rebirth in the Brahma-realm. And some of these are afflicted by famine, some are incapable of attaining jhāna; how then are they reborn there?
Nhưng không có sự tái sanh vào cõi Phạm thiên nếu không có thiền định. Một số trong số họ bị đói kém hành hạ, một số không có khả năng chứng đắc thiền định, vậy làm sao họ có thể tái sanh vào đó?
Devaloke paṭiladdhajjhānavasena.
By virtue of having attained jhāna in the deva-realm.
Là nhờ thiền định đã thành tựu ở cõi trời.
Tadā hi ‘‘vassasatasahassassa accayena kappavuṭṭhānaṃ bhavissatī’’ti lokabyūhā nāma kāmāvacaradevā muttasirā vikiṇṇakesā rudammukhā assūni hatthehi puñchamānā rattavatthanivatthā ativiya virūpavesadhārino hutvā manussapathe vicarantā evaṃ ārocenti ‘‘mārisā mārisā ito vassasatasahassassa accayena kappavuṭṭhānaṃ bhavissati, ayaṃ loko vinassissati, mahāsamuddopi ussussissati, ayañca mahāpathavī sineru ca pabbatarājā ḍayhissanti vinassissanti, yāva brahmalokā lokavināso bhavissati, mettaṃ mārisā bhāvetha, karuṇaṃ, muditaṃ, upekkhaṃ mārisā bhāvetha, mātaraṃ upaṭṭhahatha, pitaraṃ upaṭṭhahatha, kule jeṭṭhāpacāyino hothā’’ti.
For at that time, devas named Lokabyūhā, who are Kāmāvacara devas, with disheveled hair, scattered locks, crying faces, wiping away tears with their hands, dressed in red garments, adopting an extremely unsightly appearance, wander on human paths and proclaim thus: "Friends, friends, after a hundred thousand years from now, there will be the dissolution of the eon. This world will perish. The great ocean will dry up. And this great earth and Sineru, the king of mountains, will burn and perish. The destruction of the world will extend up to the Brahma-realm. Friends, develop loving-kindness; friends, develop compassion, appreciative joy, and equanimity. Wait upon your mother, wait upon your father; be respectful to the elders in your family."
Vào lúc đó, các vị thiên nhân cõi Dục giới tên là Lokabyūhā, đầu bù tóc rối, mặt khóc lóc, lau nước mắt bằng tay, mặc y phục đỏ, mang hình dáng vô cùng xấu xí, đi khắp đường người và báo tin như sau: “Này các hiền giả, này các hiền giả! Sau một trăm ngàn năm nữa sẽ có sự hoại diệt của kiếp. Thế giới này sẽ bị hủy diệt, đại dương bao la cũng sẽ cạn khô, và đại địa này cùng núi chúa Sineru sẽ bốc cháy và hoại diệt. Sự hoại diệt của thế giới sẽ xảy ra cho đến tận cõi Phạm thiên. Này các hiền giả, hãy tu tập tâm từ, bi, hỷ, xả. Này các hiền giả, hãy phụng dưỡng mẹ, phụng dưỡng cha, hãy kính trọng người lớn tuổi trong gia đình.”
Te pana devā lokaṃ byūhenti sampiṇḍentīti ‘‘lokabyūhā’’ti vuccanti.
These devas arrange and gather the world, hence they are called "Lokabyūhā".
Các vị thiên nhân đó được gọi là “Lokabyūhā” vì họ sắp đặt (byūhenti) và tập hợp (sampiṇḍenti) thế giới.
Te kira disvā manussā yattha katthaci ṭhitāpi nisinnāpi saṃvegajātā sambhamappattāva hutvā tesaṃ āsanne ṭhāne sannipatanti.
It is said that seeing them, humans, whether standing or sitting anywhere, become agitated and alarmed, and gather in places near them.
Người ta nói rằng khi con người nhìn thấy họ, dù đang đứng hay đang ngồi ở bất cứ đâu, họ đều cảm thấy xúc động và bối rối, rồi tụ tập lại gần các vị thiên nhân đó.
Kathaṃ panete kappavuṭṭhānaṃ jānantīti?
But how do they know about the eon's dissolution?
Nhưng làm sao các vị này biết được sự hoại diệt của kiếp?
‘‘Dhammatāya sañcoditā’’ti ācariyā.
"They are impelled by Dhamma," say the teachers.
Các bậc thầy nói: “Do được thúc đẩy bởi Pháp tính (Dhammatā).”
‘‘Tādisanimittadassanenā’’ti eke.
"By seeing such signs," say some.
Một số người nói: “Do nhìn thấy những điềm báo như vậy.”
‘‘Brahmadevatāhi uyyojitā’’ti apare.
"They are sent by the Brahma-devas," say others.
Những người khác nói: “Do được các vị Phạm thiên sai bảo.”
Tesaṃ pana vacanaṃ sutvā yebhuyyena manussā ca bhummadevatā ca saṃvegajātā aññamaññaṃ muducittā hutvā mettādīni puññāni karitvā devaloke nibbattanti.
Having heard their words, most humans and earth-devas become agitated, and being soft-hearted towards each other, they perform merits such as loving-kindness and are reborn in the deva-realm.
Nghe lời họ nói, phần lớn con người và địa thiên cảm thấy xúc động, tâm trở nên nhu hòa với nhau, thực hành các phước thiện như tâm từ, rồi tái sanh vào cõi trời.
Tattha dibbasudhābhojanaṃ bhuñjitvā tato vāyokasiṇe parikammaṃ katvā jhānaṃ paṭilabhanti.
There they partake of divine nectar food, and then, by performing preliminary work on the air kasiṇa, they attain jhāna.
Ở đó, họ thọ hưởng thức ăn cam lồ của chư thiên, rồi từ đó thực hành sơ khởi trên biến xứ gió và chứng đắc thiền định.
Devānaṃ kira sukhasamphassavātaggahaṇapaacayena vāyokasiṇe jhānāni sukheneva ijjhanti.
It is said that for devas, jhānas are easily accomplished through the comfort-giving air kasiṇa by taking comfortable air contact.
Thiền định trên biến xứ gió của chư thiên được thành tựu dễ dàng nhờ sự tiếp nhận gió có xúc giác an lạc.
Tadaññe pana āpāyikā sattā aparāpariyavedanīyena kammena devaloke nibbattanti.
Other beings, however, those from lower realms, are reborn in the deva-realm due to karma that ripens in successive existences.
Còn những chúng sanh ác đạo khác thì tái sanh vào cõi trời nhờ nghiệp dị thục về sau.
Aparāpariyavedanīyakammarahito hi saṃsāre saṃsaranto nāma satto natthi.
Indeed, there is no being wandering in saṃsāra who is without karma that ripens in successive existences.
Thật vậy, không có chúng sanh nào luân hồi trong vòng sanh tử mà không có nghiệp dị thục về sau.
Tepi tattha tatheva jhānaṃ paṭilabhanti.
They too attain jhāna there in the same way.
Họ cũng chứng đắc thiền định ở đó theo cách tương tự.
Evaṃ devaloke paṭiladdhajjhānavasena sabbepi brahmaloke nibbattanti.
Thus, by virtue of having attained jhāna in the deva-realm, all are reborn in the Brahma-realm.
Như vậy, tất cả đều tái sanh vào cõi Phạm thiên nhờ thiền định đã thành tựu ở cõi trời.
Idañca yebhuyyavasena vuttaṃ.
And this is stated mostly.
Điều này được nói theo nghĩa phần lớn.
Keci pana ‘‘apāyasattā saṃvaṭṭamānalokadhātūhi aññesu lokadhātūsupi nibbattanti.
Some, however, say: "Beings from the lower realms are also reborn in other world-systems apart from the dissolving world-systems.
Tuy nhiên, một số người nói: “Chúng sanh ác đạo cũng tái sanh vào các thế giới khác ngoài những thế giới đang bị hoại diệt.
Na hi sabbe apāyasattā tadā rūpārūpabhavesu uppajjantīti sakkā viññātuṃ apāyesu dīghāyukānaṃ devalokūpapattiyā asambhavato.
For it cannot be known that all beings from the lower realms are reborn in rūpa or arūpa existences at that time, as rebirth in the deva-realm is impossible for those with long lifespans in the lower realms.
Không thể hiểu rằng tất cả chúng sanh ác đạo vào lúc đó đều sanh vào các cõi hữu sắc hoặc vô sắc, vì những chúng sanh có tuổi thọ dài trong các ác đạo không thể tái sanh vào cõi trời.
Niyatamicchādiṭṭhiko pana vinassamānepi kappe nirayato na muccatiyeva, tasmā so tattha anibbattitvā piṭṭhicakkavāḷe nibbattati.
A person of fixed wrong view, however, is not released from hell even in a dissolving eon; therefore, instead of being reborn there, he is reborn in a 'back' world-system.
Còn kẻ tà kiến cố định thì dù kiếp đang hoại diệt cũng không thoát khỏi địa ngục, do đó, kẻ đó không tái sanh ở đó mà tái sanh vào một luân vũ phía sau.
Niyatamicchādiṭṭhiyā hi samannāgatassa bhavato vuṭṭhānaṃ nāma natthi.
Indeed, for one endowed with fixed wrong view, there is no emergence from existence.
Thật vậy, không có sự thoát khỏi vòng sanh tử đối với người có tà kiến cố định.
Tāya hi samannāgatassa neva saggo atthi, na maggo, tasmā so saṃvaṭṭamānacakkavāḷato aññattha niraye nibbattitvā paccati.
For one endowed with it, there is neither heaven nor the path; therefore, he is reborn in hell elsewhere, apart from the dissolving world-system, and suffers there.
Đối với người có tà kiến đó, không có cõi trời, không có đạo lộ, do đó, kẻ đó tái sanh vào một địa ngục ở nơi khác ngoài luân vũ đang hoại diệt và chịu khổ.
Kiṃ pana piṭṭhicakkavāḷaṃ na jhāyatīti?
But does not the 'back' world-system also burn?
Nhưng luân vũ phía sau có bị thiêu cháy không?
Jhāyati.
It does burn.
Có.
Tasmiṃ jhāyamānepi esa ākāse ekasmiṃ padese paccatī’’ti vadanti.
Even while that is burning, he suffers in one place in the air," they say.
Dù nó đang bị thiêu cháy, kẻ đó vẫn chịu khổ ở một nơi trong không gian.”
Vassūpacchedato pana uddhaṃ dīghassa addhuno accayena dutiyo sūriyo pātubhavati, pātubhūte pana tasmiṃ neva rattiparicchedo, na divāparicchedo paññāyati.
Then, after the passing of a long period of time from the cessation of the rains, a second sun appears. When it has appeared, no division of night or division of day is discernible.
Nhưng sau khi mưa chấm dứt, do sự trôi qua của một thời gian dài, mặt trời thứ hai xuất hiện. Và khi mặt trời ấy xuất hiện, sự phân định đêm và ngày không còn được nhận biết.
Eko sūriyo uṭṭheti, eko atthaṃ gacchati, avicchinnasūriyasantāpova loko hoti.
One sun rises, another sun sets; the world experiences the continuous heat of the sun.
Một mặt trời mọc lên, một mặt trời lặn xuống, thế gian bị sức nóng của mặt trời thiêu đốt không gián đoạn.
Yathā ca kappavuṭṭhānakālato pubbe uppannasūriyavimāne sūriyadevaputto hoti, evaṃ kappavināsakasūriye natthi.
And just as there is a sun-deva in the sun-mansion that arose before the time of the world-age's establishment, so it is not in the sun that destroys the world-age.
Và cũng như có vị thiên tử mặt trời trong lâu đài mặt trời đã khởi sanh trước thời kỳ kiếp hình thành, cũng vậy, trong mặt trời hủy diệt kiếp thì không có.
Kappavuṭṭhānakāle pana yathā aññe kāmāvacaradevā, evaṃ sūriyadevaputtopi jhānaṃ nibbattetvā brahmalokaṃ upapajjati.
But at the time of the world's re-evolution, just like other devas of the sense-sphere, the sun-deva also, having produced a jhāna, is reborn in the brahmaloka.
Còn trong thời kỳ kiếp hình thành, cũng như các vị trời khác ở cõi Dục, vị thiên tử mặt trời cũng chứng đắc thiền và sanh về cõi Phạm thiên.
Sūriyamaṇḍalaṃ pana pabhassaratarañceva tejavantatarañca hutvā pavattati.
The solar orb, however, continues to exist, having become more luminous and more brilliant.
Còn vầng mặt trời thì trở nên rực rỡ hơn và uy lực hơn mà tồn tại.
Taṃ antaradhāyitvā aññameva uppajjatīti apare.
Others say that it vanishes and a new one arises.
Những người khác cho rằng, vầng mặt trời ấy biến mất và một vầng mặt trời khác khởi sanh.
Tattha pakatisūriye vattamāne ākāse valāhakāpi dhūmasikhāpi vattanti, kappavināsakasūriye vattamāne vigatadhūmavalāhakaṃ ādāsamaṇḍalaṃ viya nimmalaṃ nabhaṃ hoti.
In that regard, when the normal sun is present, there are clouds and wisps of smoke in the sky; when the world-destroying sun is present, the sky is clear, like a polished mirror, devoid of smoke and clouds.
Trong đó, khi mặt trời bình thường tồn tại, trên bầu trời có cả mây và cột khói; khi mặt trời hủy diệt kiếp tồn tại, bầu trời không còn khói và mây, trong sạch như một tấm gương soi.
Ṭhapetvā pañca mahānadiyo sesakunnadiādīsu udakaṃ sussati.
Leaving aside the five great rivers, the water in the remaining small rivers and so on dries up.
Ngoại trừ năm con sông lớn, nước ở các con sông nhỏ và các nơi khác đều khô cạn.
Tatopi dīghassa addhuno accayena sattamo sūriyo pātubhavati, yassa pātubhāvā sakalacakkavāḷaṃ ekajālaṃ hoti saddhiṃ koṭisatasahassacakkavāḷehi, yojanasatikādibhedāni sinerukūṭāni palujjitvā ākāseyeva antaradhāyanti.
After the passing of an even longer time, a seventh sun appears, due to whose appearance the entire cakkavāḷa becomes a single mass of flame, along with the hundred thousand koṭi of cakkavāḷas; the peaks of Sineru, of a hundred yojanas and more, crumble and vanish right into the sky.
Từ đó, do sự trôi qua của một thời gian dài, mặt trời thứ bảy xuất hiện, do sự xuất hiện của nó mà toàn thể thế giới chuyển vận trở thành một ngọn lửa, cùng với trăm ngàn ức thế giới chuyển vận; các đỉnh núi Tu-di có kích thước khác nhau từ một trăm do-tuần trở lên đều vỡ tan và biến mất ngay trên hư không.
Sā aggijālā uṭṭhahitvā cātumahārājike gaṇhāti.
That mass of fire arises and seizes the realm of the Cātumahārājika devas.
Ngọn lửa ấy bùng lên và thiêu đốt cõi Tứ Đại Thiên Vương.
Tattha kanakavimānaratanavimānamaṇivimānāni jhāpetvā tāvatiṃsabhavanaṃ gaṇhāti.
Having burned up the golden mansions, jewel mansions, and gem mansions there, it seizes the Tāvatiṃsa realm.
Thiêu rụi các lâu đài bằng vàng, lâu đài bằng bảo châu, lâu đài bằng ngọc ở đó xong, ngọn lửa thiêu đốt cõi trời Ba Mươi Ba.
Etenevūpāyena yāva paṭhamajjhānabhūmiṃ gaṇhāti, tattha tayopi brahmaloke jhāpetvā ābhassare āhacca tiṭṭhati.
By this same method, it seizes up to the first jhāna realm; having burned up the three brahmalokas there, it comes to a stop upon reaching the Ābhassara realm.
Cũng bằng phương cách này, ngọn lửa thiêu đốt cho đến cõi Sơ thiền, thiêu rụi cả ba cõi Phạm thiên ở đó rồi dừng lại khi chạm đến cõi Quang Âm.
Sā yāva aṇumattampi saṅkhāragataṃ atthi, tāva na nibbāyati.
As long as there is even a minute amount of conditioned existence, it is not extinguished.
Chừng nào còn có dù chỉ một chút hành pháp nhỏ nhất, chừng đó ngọn lửa không tắt.
Sabbasaṅkhāraparikkhayā pana sappitelajjhāpanaggisikhā viya chārikampi anavasesetvā nibbāyati.
But with the complete destruction of all conditioned things, like the flame from burning ghee or oil, it is extinguished without leaving even ash behind.
Nhưng khi tất cả các hành pháp đã cạn kiệt, ngọn lửa tắt đi không để lại cả tro, giống như ngọn lửa thiêu đốt dầu bơ.
Heṭṭhāākāsena saha upariākāso eko hoti mahandhakāro.
The space below and the space above become one, a great darkness.
Hư không ở dưới và hư không ở trên hợp thành một, trở thành một màn đêm tối vĩ đại.
Evaṃ ekamasaṅkhyeyyaṃ ekaṅgaṇaṃ hutvā ṭhite lokasannivāse lokassa saṇṭhānatthāya devo vassituṃ ārabhati, āditova antaraṭṭhake himapāto viya hoti.
When the world-system has thus stood as a single empty space for one incalculable aeon, for the re-formation of the world, a great rain begins to fall; at first, it is like a fall of mist in the eight intermediate directions.
Khi thế giới đã trở thành một khoảng không duy nhất như vậy trong một a-tăng-kỳ, để thế giới được tái lập, trời bắt đầu mưa; ban đầu, mưa giống như tuyết rơi trong tám khoảng thời gian.
Tato kaṇamattā taṇḍulamattā muggamāsabadaraāmalakaeḷālukakumbhaṇḍaalābumattā udakadhārā hutvā anukkamena usabhadveusabhaaḍḍhagāvutagāvutaaḍḍhayojanayojanadviyojana…pe… yojanasatayojanasahassamattā hutvā koṭisatasahassacakkavāḷagabbhantaraṃ yāva avinaṭṭhabrahmalokā pūretvā antaradhāyati.
Then, drops of water the size of broken rice, the size of rice grains, the size of green gram, black gram, jujube fruit, myrobalan fruit, cucumber, gourd, and pumpkin, having become streams of water measuring a usabha, two usabhas, half a gāvuta, a gāvuta, half a yojana, a yojana, two yojanas... and so on... up to a hundred yojanas and a thousand yojanas, fill the interior of the hundred thousand koṭi of cakkavāḷas up to the undestroyed brahmalokas and then disappear.
Từ đó, các dòng nước lần lượt có kích thước bằng hạt cám, hạt gạo, hạt đậu xanh, hạt đậu đen, quả táo, quả amla, quả bầu đắng, quả bầu nậm, rồi bằng một usabha, hai usabha, nửa gāvuta, một gāvuta, nửa do-tuần, một do-tuần, hai do-tuần... cho đến một trăm do-tuần, một ngàn do-tuần, làm đầy bên trong trăm ngàn ức thế giới chuyển vận cho đến cõi Phạm thiên chưa bị hủy diệt rồi biến mất.
Taṃ udakaṃ heṭṭhā ca tiriyañca vāto samuṭṭhahitvā ghanaṃ karoti parivaṭumaṃ paduminīpatte udakabindusadisaṃ.
The wind, rising up from below and from the sides, solidifies that water, making it spherical, like a drop of water on a lotus leaf.
Gió từ phía dưới và từ các phía nổi lên làm cho khối nước đó trở nên đặc lại, tròn trịa như giọt nước trên lá sen.
Kathaṃ tāvamahantaṃ udakarāsiṃ ghanaṃ karotīti ce?
If it is asked, how does it solidify such a great mass of water?
Nếu hỏi làm thế nào gió có thể làm cho một khối nước lớn như vậy trở nên đặc lại?
Vivarasampadānato vātassāti.
It is said: due to the wind providing space.
Là do gió tạo ra các khoảng trống.
Tañhissa tahiṃ tahiṃ vivaraṃ deti.
For it gives it space here and there.
Bởi vì gió tạo ra các khoảng trống cho nước ở nơi này nơi kia.
Taṃ evaṃ vātena sampiṇḍiyamānaṃ ghanaṃ kariyamānaṃ parikkhayamānaṃ anupubbena heṭṭhā otarati.
That water, being thus compacted, solidified, and diminished by the wind, gradually descends downwards.
Khối nước ấy, bị gió nén lại, làm cho đặc lại, cạn dần, rồi từ từ hạ xuống.
Otiṇṇe otiṇṇe udake brahmalokaṭṭhāne brahmaloko, uparicatukāmāvacaradevalokaṭṭhāne ca devalokā pātubhavanti.
As the water descends, the brahmaloka appears in the location of the brahmaloka, and the devalokas appear in the locations of the four upper sense-sphere devalokas.
Khi nước hạ xuống, ở vị trí của cõi Phạm thiên, cõi Phạm thiên xuất hiện; và ở vị trí của bốn cõi trời Dục giới phía trên, các cõi trời xuất hiện.
Cātumahārājikatāvatiṃsabhavanāni pana pathavīsambandhatāya na tāva pātubhavanti.
However, the Cātumahārājika and Tāvatiṃsa realms, being connected to the earth, do not yet appear.
Tuy nhiên, cõi Tứ Đại Thiên Vương và cõi Ba Mươi Ba chưa xuất hiện ngay vì chúng có liên quan đến mặt đất.
Purimapathaviṭṭhānaṃ otiṇṇe pana balavavātā uppajjanti, te taṃ pihitadvāre dhammakaraṇe ṭhitaudakamiva nirussāsaṃ katvā rumbhanti.
But when it has descended to the former location of the earth, strong winds arise; they churn it, making it breathless, like water kept in a water-strainer with a closed lid.
Khi nước hạ xuống đến vị trí của mặt đất trước kia, những cơn gió mạnh nổi lên, chúng làm cho khối nước ấy bị dồn nén không còn không khí, giống như nước chứa trong một cái lọc có cửa đóng kín.
Madhurodakaṃ parikkhayaṃ gacchamānaṃ upari rasapathaviṃ samuṭṭhāpeti, udakapiṭṭhe uppalinīpattaṃ viya pathavī saṇṭhāti.
As the sweet water diminishes, it causes the savory earth to form on top; the earth forms on the surface of the water like a lotus leaf.
Nước ngọt cạn dần, làm nổi lên lớp địa vị ở trên; mặt đất hình thành trên mặt nước như lá sen.
Sā vaṇṇasampannā ceva hoti gandharasasampannā ca nirudakapāyāsassa upari paṭalaṃ viya.
It is endowed with color, and endowed with scent and taste, like the skin on top of waterless milk-rice.
Lớp địa vị ấy vừa có màu sắc đẹp, vừa có mùi thơm và vị ngon, giống như lớp váng trên mặt cháo sữa không có nước.
Ettha pana mahābodhipallaṅkaṭṭhānaṃ vinassamāne loke pacchā vinassati, saṇṭhahamāne paṭhamaṃ saṇṭhahatīti veditabbaṃ.
Here, it should be understood that when the world is being destroyed, the site of the Great Bodhi-tree's throne is the last to be destroyed; when it is re-forming, it is the first to form.
Ở đây, cần phải hiểu rằng, nơi bồ-đoàn của Đại Bồ-đề là nơi bị hủy diệt sau cùng khi thế giới hoại diệt, và là nơi được hình thành đầu tiên khi thế giới tái lập.
Tadā ca ābhassarabrahmaloke paṭhamatarābhinibbattā sattā āyukkhayā vā puññakkhayā vā tato cavitvā opapātikā hutvā idhūpapajjanti, te honti sayaṃpabhā antalikkhacarā, te taṃ rasapathaviṃ sāyitvā taṇhābhibhūtā āluppakārakaṃ paribhuñjituṃ upakkamanti.
And at that time, beings who were first reborn in the Ābhassara brahmaloka, due to the exhaustion of their lifespan or the exhaustion of their merit, pass away from there and are reborn here by spontaneous generation; they are self-luminous and travel through the air. Having tasted that savory earth, they are overcome by craving and begin to consume it in lumps.
Và vào lúc đó, các chúng sanh được tái sanh đầu tiên ở cõi Phạm thiên Quang Âm, do hết tuổi thọ hoặc hết phước, từ đó chết đi và hóa sanh ở đây. Họ có ánh sáng tự thân, đi lại trong hư không. Họ nếm lớp địa vị ấy, bị ái dục chi phối, bắt đầu ăn từng miếng một.
Atha tesaṃ sayaṃpabhā antaradhāyati, andhakāro hoti.
Then their self-luminosity vanishes, and there is darkness.
Bấy giờ, ánh sáng tự thân của họ biến mất, bóng tối xuất hiện.
Te andhakāraṃ disvā bhāyanti.
Seeing the darkness, they become afraid.
Họ thấy bóng tối và sợ hãi.
Tato tesaṃ bhayaṃ nāsetvā sūrabhāvaṃ janayantaṃ paripuṇṇapaññāsayojanaṃ sūriyamaṇḍalaṃ pātubhavati.
Then, dispelling their fear and generating courage, the solar orb, a full fifty yojanas in size, appears.
Sau đó, để xua tan nỗi sợ hãi và tạo ra sự dũng cảm cho họ, vầng mặt trời tròn đầy năm mươi do-tuần xuất hiện.
Te taṃ disvā ‘‘ālokaṃ paṭilabhimhā’’ti haṭṭhatuṭṭhā hutvā ‘‘amhākaṃ bhītānaṃ bhayaṃ nāsetvā sūrabhāvaṃ janayanto uṭṭhito, tasmā sūriyo hotū’’ti sūriyotvevassa nāmaṃ karonti.
Seeing it, delighted and pleased, they think, “We have obtained light,” and “He has arisen dispelling the fear of us who were frightened and generating courage, therefore let him be the sun (sūriya),” and they give it the name “sun”.
Họ thấy vầng mặt trời ấy, vui mừng hoan hỷ rằng: "Chúng ta đã có lại ánh sáng", và đặt tên cho nó là sūriyo (mặt trời) rằng: "Vì đã mọc lên để xua tan nỗi sợ hãi của chúng ta đang khiếp sợ và tạo ra sự dũng cảm, nên hãy là mặt trời".
Evaṃ candimasūriyesu pātubhūtesu nakkhattāni tārakarūpāni pātubhavanti, tato pabhuti rattindivā paññāyanti, anukkamena ca māsaḍḍhamāsautusaṃvaccharā, candimasūriyānaṃ pātubhūtadivaseyeva sinerucakkavāḷahimavantapabbatā dīpasamuddā ca pātubhavanti.
Thus, when the moon and sun have appeared, the constellations and starry forms appear. From then on, night and day are distinguished, and in sequence, months, half-months, seasons, and years. On the very day the moon and sun appear, the Sineru, Cakkavāḷa, and Himālaya mountains, as well as the continents and oceans, appear.
Như vậy, khi mặt trăng và mặt trời xuất hiện, các chòm sao và các vì sao cũng xuất hiện. Từ đó, đêm và ngày được nhận biết, và lần lượt là tháng, nửa tháng, mùa và năm. Vào chính ngày mặt trăng và mặt trời xuất hiện, núi Tu-di, núi Thiết-vi, núi Hy-mã-lạp-sơn, các châu và các biển cũng xuất hiện.
Te ca kho apubbaṃ acarimaṃ phagguṇapuṇṇamadivaseyeva pātubhavanti.
And they appear neither before nor after, but on the very day of the Phagguṇa full moon.
Và chúng xuất hiện không trước không sau, chính vào ngày rằm tháng Phagguna.
Kathaṃ?
How?
Bằng cách nào?
Yathā nāma kaṅgubhatte paccamāne ekappahāreneva pubbuḷakā uṭṭhahanti, eke padesā thūpathūpā honti, eke ninnaninnā, eke samasamā, evameva thūpathūpaṭṭhāne pabbatā honti, ninnaninnaṭṭhāne samuddā, samasamaṭṭhāne dīpāti.
Just as when millet rice is cooking, bubbles rise up all at once, some places become heaped up, some places sunken down, some places level, just so, mountains arise in the heaped-up places, oceans in the sunken-down places, and islands in the level places.
Cũng như khi nấu cháo kê, chỉ một lúc là các bọt khí nổi lên, một số chỗ lồi lên, một số chỗ lõm xuống, một số chỗ bằng phẳng; cũng vậy, tại những chỗ lồi lên thì có núi, tại những chỗ lõm xuống thì có biển, tại những chỗ bằng phẳng thì có các hòn đảo.
Atha tesaṃ sattānaṃ rasapathaviṃ paribhuñjantānaṃ kammena ekacce vaṇṇavanto honti, ekacce dubbaṇṇā honti.
Then, as those beings consumed the essence of the earth, due to their kamma, some became beautiful, and some became ugly.
Rồi khi những chúng sinh đó đang thọ hưởng địa vị ngọt ngào (rasapathavī), do nghiệp mà một số thì có vẻ đẹp, một số thì xấu xí.
Tattha vaṇṇavanto dubbaṇṇe atimaññanti, tesaṃ atimānapaccayā sāpi rasapathavī antaradhāyati, bhūmipappaṭako pātubhavati.
Among them, the beautiful ones disdained the ugly ones; due to their excessive pride, that rasapathavī (essence of the earth) disappeared, and bhūmipappaṭako (earth-scum/skin) appeared.
Trong số đó, những người có vẻ đẹp khinh thường những người xấu xí. Do sự kiêu mạn đó của họ, địa vị ngọt ngào (rasapathavī) ấy cũng biến mất, và váng đất (bhūmipappaṭako) xuất hiện.
Atha nesaṃ teneva nayena sopi antaradhāyati, atha padālatā pātubhavati.
Then, in the same way, that too disappeared for them, and then padālatā (creeper) appeared.
Rồi theo cách đó, váng đất ấy cũng biến mất, và dây leo (padālatā) xuất hiện.
Teneva nayena sāpi antaradhāyati, akaṭṭhapāko sāli pātubhavati akaṇo athuso sugandho taṇḍulaphalo.
In the same way, that too disappeared, and then sāli (rice) appeared, which ripened without cultivation, was without husk or chaff, fragrant, and yielded grains.
Cũng theo cách đó, dây leo ấy cũng biến mất, và lúa (sāli) không cần cày cấy, không vỏ trấu, thơm tho, có hạt gạo xuất hiện.
Tato nesaṃ bhājanāni uppajjanti.
From that, vessels arose for them.
Từ đó, các vật dụng của họ xuất hiện.
Te sāliṃ bhājane ṭhapetvā pāsāṇapiṭṭhiyaṃ ṭhapenti, sayameva jālasikhā uṭṭhahitvā taṃ pacati.
They placed the sāli in vessels and put them on a rock surface; a flame of fire arose by itself and cooked it.
Họ đặt lúa vào vật dụng rồi đặt lên mặt đá, tự nhiên ngọn lửa bùng lên và nấu chín nó.
So hoti odano sumanajātipupphasadiso, na tassa sūpena vā byañjanena vā karaṇīyaṃ atthi, yaṃ yaṃ rasaṃ bhuñjitukāmā honti, taṃtaṃrasova hoti.
That cooked rice became like the jasmine flower; it had no need for curry or sauce; whatever taste they wished to enjoy, that very taste it became.
Cơm ấy giống như hoa lài, không cần canh hay món ăn kèm, họ muốn ăn vị gì thì cơm ấy có vị đó.
Tesaṃ taṃ oḷārikaṃ āhāraṃ āharayataṃ tato pabhuti muttakarīsaṃ sañjāyati.
As they consumed that gross food, from then on, urine and feces arose in them.
Khi họ ăn loại thức ăn thô thiển đó, từ đó trở đi, đại tiện và tiểu tiện bắt đầu xuất hiện.
Tathā hi rasapathavī bhūmipappaṭako padālatāti ime tāva paribhuttā sudhāhāro viya khudaṃ vinodetvā rasaharaṇīhi rasameva paribyūhentā tiṭṭhanti vatthuno sukhumabhāvena, na nissandā, sukhumabhāveneva gahaṇindhanameva ca hoti.
Indeed, the rasapathavī, bhūmipappaṭaka, and padālatā, when consumed, would, like ambrosial food, assuage hunger and distribute only essences through the nutrient channels, due to the subtle nature of the substance; there were no excretions, and due to their subtle nature, they served only as fuel for the body.
Thật vậy, địa vị ngọt ngào (rasapathavī), váng đất (bhūmipappaṭako), dây leo (padālatā) – những thứ này khi được thọ hưởng, giống như thức ăn cam lồ, chỉ làm tiêu tan cơn đói và lan tỏa chất ngọt qua các mạch dinh dưỡng, chúng tồn tại do sự vi tế của vật chất, không có chất thải, và do sự vi tế, chúng chỉ là nhiên liệu cho sự hấp thụ.
Odano pana paribhutto rasaṃ vaḍḍhentopi vatthuno oḷārikabhāveneva nissandaṃ vissajjento passāvaṃ karīsañca uppādeti.
Cooked rice, however, when consumed, though it promotes the essences, due to the gross nature of the substance, it releases excretions, producing urine and feces.
Nhưng cơm khi được thọ hưởng, dù cũng làm tăng chất ngọt, nhưng do sự thô thiển của vật chất, nó thải ra chất thải, tạo ra nước tiểu và phân.
Atha tesaṃ nikkhamanatthāya vaṇamukhāni pabhijjanti.
Then, for their excretion, orifices broke open.
Rồi để cho chất thải thoát ra, các lỗ tiết bài tiết xuất hiện.
Purisassa purisabhāvo, itthiyā itthibhāvo pātubhavati.
The male nature appeared in males, and the female nature appeared in females.
Tính nam của người nam, tính nữ của người nữ xuất hiện.
Purimattabhāvesu hi pavattaupacārajjhānānubhāvena yāva sattasantānesu kāmarāgo vikkhambhanavegena samito, na tāva bahalakāmarāgūpanissayāni itthipurisindriyāni pāturahesuṃ.
For in their previous existences, due to the power of the jhānas of proximate absorption that had arisen, until sensual passion was suppressed by the force of suppression in the stream of beings, the male and female faculties, which are the basis for strong sensual passion, had not yet appeared.
Thật vậy, do năng lực của các thiền định cận hành đã được thực hành trong các đời trước, chừng nào dục ái còn bị trấn áp bởi sức mạnh của sự trấn áp trong dòng tâm thức của chúng sinh, chừng đó các căn nam nữ, vốn là duyên của dục ái thô thiển, chưa xuất hiện.
Yadā panassa vicchinnatāya bahalakāmarāgo laddhāvasaro ahosi, tadā tadupanissayāni tāni sattānaṃ attabhāvesu sañjāyiṃsu, tadā itthī purisaṃ, puriso ca itthiṃ ativelaṃ upanijjhāyati.
But when, due to its cessation, strong sensual passion found an opportunity, then those faculties, which are its basis, arose in the bodies of beings, and then women gazed excessively at men, and men at women.
Nhưng khi dục ái thô thiển có cơ hội do sự gián đoạn của thiền định, thì các căn đó, vốn là duyên của dục ái, xuất hiện trong các thân của chúng sinh. Lúc đó, người nữ nhìn người nam, và người nam nhìn người nữ một cách quá mức.
Tesaṃ ativelaṃ upanijjhāyanapaccayā kāmapariḷāho uppajjati, tato methunaṃ dhammaṃ paṭisevanti.
Due to their excessive gazing, the fever of passion arose, and then they engaged in sexual intercourse.
Do sự nhìn ngắm quá mức đó của họ, sự thiêu đốt của dục vọng phát sinh, rồi họ thực hành pháp dâm dục (methunaṃ dhammaṃ).
Te asaddhammapaṭisevanapaccayā viññūhi garahiyamānā viheṭhiyamānā tassa asaddhammassa paṭicchādanahetu agārāni karonti.
As a result of engaging in this unwholesome practice, being blamed and tormented by the wise, they built houses to conceal that unwholesome practice.
Do việc thực hành pháp bất thiện đó, họ bị những người hiểu biết quở trách và quấy rầy, vì thế, để che giấu pháp bất thiện đó, họ xây nhà (agārāni).
Te agāraṃ ajjhāvasamānā anukkamena aññatarassa alasajātikassa sattassa diṭṭhānugatiṃ āpajjantā sannidhiṃ karonti.
Dwelling in houses, they gradually followed the example of a certain lazy being and began to store food.
Khi sống trong nhà, dần dần họ bắt chước thói quen của một chúng sinh lười biếng nào đó và tích trữ lương thực.
Tato pabhuti kaṇopi thusopi taṇḍulaṃ pariyonandhanti, lāyitaṭṭhānampi na paṭiviruhati.
From that time on, the husk and chaff covered the rice, and the reaped places did not grow back.
Từ đó trở đi, vỏ trấu và vỏ lúa bao bọc hạt gạo, và chỗ đã gặt hái không mọc lại nữa.
Te sannipatitvā anutthunanti ‘‘pāpakā vata bho dhammā sattesu pātubhūtā, mayañhi pubbe manomayā ahumhā’’ti, aggaññasutte (dī. ni. 3.128) vuttanayena vitthāretabbaṃ.
They gathered and lamented, "Indeed, unwholesome practices have arisen among beings; for we were formerly mind-born," as extensively described in the Aggañña Sutta.
Họ tụ họp lại và than thở: “Than ôi, những pháp bất thiện đã xuất hiện trong chúng sinh! Trước đây chúng ta là những hữu tình do ý sinh ra”, nên cần phải trình bày chi tiết theo cách đã nói trong kinh Khởi Thế (Aggaññasutta) (Dī. Ni. 3.128).
Tato mariyādaṃ ṭhapenti, athaññataro satto aññassa bhāgaṃ adinnaṃ ādiyati, taṃ dvikkhattuṃ paribhāsetvā tatiyavāre pāṇileḍḍudaṇḍehi paharanti.
Then they established boundaries; then a certain being took what was not given, a share belonging to another. After blaming him twice, on the third occasion, they struck him with hands, clods of earth, and sticks.
Rồi họ đặt ra giới hạn. Sau đó, một chúng sinh nào đó lấy phần của người khác mà không được cho. Người đó bị khiển trách hai lần, đến lần thứ ba thì bị đánh bằng tay, đất đá hoặc gậy.
Te evaṃ adinnādāne kalahamusāvādadaṇḍādānesu uppannesu ca sannipatitvā cintayanti ‘‘yannūna mayaṃ ekaṃ sattaṃ sammanneyyāma, yo no sammā khīyitabbaṃ khīyeyya, garahitabbaṃ garaheyya, pabbājetabbaṃ pabbājeyya, mayaṃ panassa sālīnaṃ bhāgamanuppadassāmā’’ti.
When taking what was not given, quarrels, false speech, and assault thus arose, they gathered and reflected, "Why don't we appoint a certain being, who will rightly rebuke what should be rebuked, censure what should be censured, and banish whom should be banished? We, in turn, will give him a share of the sāli."
Khi những hành vi lấy của không cho, tranh cãi, nói dối, và đánh đập như vậy phát sinh, họ tụ họp lại và suy nghĩ: “Chúng ta hãy bầu chọn một chúng sinh, người sẽ quở trách những gì đáng quở trách, khiển trách những gì đáng khiển trách, trục xuất những gì đáng trục xuất. Chúng ta sẽ cung cấp phần lúa cho người đó.”
Evaṃ katasanniṭṭhānesu pana sattesu imasmiṃ tāva kappe ayameva bhagavā bodhisattabhūto tena samayena tesu sattesu abhirūpataro ca dassanīyataro ca mahesakkhataro ca buddhisampanno paṭibalo niggahapaggahaṃ kātuṃ.
When the beings had thus resolved, in this very eon, the Blessed One, who was then a Bodhisatta, was at that time among those beings the most handsome, the most pleasing to behold, the most powerful, endowed with wisdom, and capable of both rebuking and commending.
Trong số những chúng sinh đã quyết định như vậy, trong kiếp này, chính vị Thế Tôn này, khi còn là Bồ tát, vào thời điểm đó, là người đẹp đẽ hơn, dễ nhìn hơn, có oai lực lớn hơn, đầy trí tuệ và có khả năng trừng phạt và khen thưởng trong số những chúng sinh đó.
Te taṃ upasaṅkamitvā yācitvā sammanniṃsu.
They approached him, requested him, and appointed him.
Họ đến gặp Ngài, thỉnh cầu và bầu chọn Ngài.
So tena mahājanena sammatoti mahāsammato, khettānaṃ adhipatīti khattiyo, dhammena samena paresaṃ rañjetīti rājāti tīhi nāmehi paññāyittha.
He was renowned by three names: Mahāsammata (the Great Elect) because he was appointed by the great multitude, Khattiya (Noble Warrior) because he was the lord of the fields, and Rājā (King) because he delighted others righteously and impartially.
Ngài được đại chúng bầu chọn nên gọi là Mahāsammata (Đại Chúng Tuyển), là chúa tể của ruộng đất nên gọi là Khattiya (Sát Đế Lợi), làm vui lòng người khác bằng pháp và sự công bằng nên gọi là Rājā (Vua) – Ngài được biết đến với ba danh hiệu này.
Yañhi loke acchariyaṭṭhānaṃ, bodhisattova tattha ādipurisoti evaṃ bodhisattaṃ ādiṃ katvā khattiyamaṇḍale saṇṭhite anupubbena brāhmaṇādayopi vaṇṇā saṇṭhahiṃsu.
Indeed, wherever there is an extraordinary phenomenon in the world, the Bodhisatta is the first person there. Thus, with the Bodhisatta as the first, the Khattiya order was established, and gradually the other castes, such as the brāhmaṇas, were also established.
Thật vậy, những gì là điều kỳ diệu trên thế gian, Bồ tát là người đầu tiên ở đó. Như vậy, lấy Bồ tát làm khởi điểm, khi giai cấp Sát Đế Lợi được thiết lập, dần dần các giai cấp khác như Bà La Môn cũng được thiết lập.
Tattha kappavināsakamahāmeghato yāva jālopacchedo, idamekamasaṅkhyeyyaṃ saṃvaṭṭoti vuccati.
From the great cloud that destroys the eon up to the cessation of the fire, this first asaṅkhyeyya (immeasurable period) is called Saṃvaṭṭa (Contraction).
Trong đó, từ đám mây lớn hủy diệt kiếp cho đến khi ngọn lửa bị dập tắt, giai đoạn này được gọi là một saṃvaṭṭo (kiếp hoại) vô số kiếp (asaṅkhyeyya).
Kappavināsakajālopacchedato yāva koṭisatasahassacakkavāḷaparipūrako sampattimahāmegho, idaṃ dutiyamasaṅkhyeyyaṃ saṃvaṭṭaṭṭhāyīti vuccati.
From the cessation of the fire that destroys the eon up to the great cloud of prosperity that fills the hundred thousand koṭis of world-systems, this second asaṅkhyeyya is called Saṃvaṭṭaṭṭhāyī (Remaining in Contraction).
Từ khi ngọn lửa hủy diệt kiếp bị dập tắt cho đến khi đám mây lớn tạo thành lấp đầy trăm ngàn vạn thế giới, giai đoạn này được gọi là saṃvaṭṭaṭṭhāyī (kiếp hoại trụ) vô số kiếp thứ hai.
Sampattimahāmeghato yāva candimasūriyapātubhāvo, idaṃ tatiyamasaṅkhyeyyaṃ vivaṭṭoti vuccati.
From the great cloud of prosperity up to the appearance of the moon and sun, this third asaṅkhyeyya is called Vivaṭṭa (Expansion).
Từ đám mây lớn tạo thành cho đến khi mặt trăng và mặt trời xuất hiện, giai đoạn này được gọi là vivaṭṭo (kiếp thành) vô số kiếp thứ ba.
Candimasūriyapātubhāvato yāva puna kappavināsakamahāmegho, idaṃ catutthamasaṅkhyeyyaṃ vivaṭṭaṭṭhāyīti vuccati.
From the appearance of the moon and sun up to the great cloud that again destroys the eon, this fourth asaṅkhyeyya is called Vivaṭṭaṭṭhāyī (Remaining in Expansion).
Từ khi mặt trăng và mặt trời xuất hiện cho đến khi đám mây lớn hủy diệt kiếp lại xuất hiện, giai đoạn này được gọi là vivaṭṭaṭṭhāyī (kiếp thành trụ) vô số kiếp thứ tư.
Vivaṭṭaṭṭhāyīasaṅkhyeyyaṃ catusaṭṭhiantarakappasaṅgahaṃ.
The Vivaṭṭaṭṭhāyī asaṅkhyeyya comprises sixty-four intermediate eons.
Vô số kiếp thành trụ bao gồm sáu mươi bốn tiểu kiếp.
‘‘Vīsatiantarakappasaṅgaha’’nti keci.
Some say it comprises twenty intermediate eons.
Một số nói “bao gồm hai mươi tiểu kiếp”.
Sesāsaṅkhyeyyāni kālato tena samappamāṇāneva.
The other asaṅkhyeyyas are equal in duration.
Các vô số kiếp còn lại có cùng thời gian như vậy.
Imāni cattāri asaṅkhyeyyāni eko mahākappo hoti.
These four asaṅkhyeyyas constitute one Great Eon (mahākappo).
Bốn vô số kiếp này tạo thành một đại kiếp.
Evaṃ tāva agginā vināso ca saṇṭhahanañca veditabbaṃ.
Thus, the destruction and re-establishment by fire should be understood.
Như vậy, sự hủy diệt và sự hình thành do lửa cần được hiểu.
Yasmiṃ pana samaye kappo udakena nassati, āditova kappavināsakamahāmegho vuṭṭhahitvāti pubbe vuttanayeneva vitthāretabbaṃ.
When an eon is destroyed by water, it should be described in the same way as stated before, beginning with the great cloud that destroys the eon having poured down.
Vào thời điểm mà kiếp bị hủy diệt bởi nước, cần phải trình bày chi tiết theo cách đã nói trước đây, bắt đầu từ việc đám mây lớn hủy diệt kiếp mưa xuống.
Ayaṃ pana viseso – yathā tattha dutiyasūriyo, evamidha kappavināsako khārudakamahāmegho vuṭṭhāti.
This, however, is the difference – just as there was a second sun, here there pours down a great cloud of saline water that destroys the eon.
Tuy nhiên, có sự khác biệt này: cũng như ở đó có mặt trời thứ hai, ở đây đám mây lớn nước mặn hủy diệt kiếp mưa xuống.
So ādito sukhumaṃ sukhumaṃ vassanto anukkamena mahādhārāhi koṭisatasahassacakkavāḷānaṃ pūrento vassati.
Beginning to rain very finely, it gradually rains with massive downpours, filling the hundred thousand koṭis of world-systems.
Ban đầu, nó mưa nhỏ dần, rồi dần dần mưa với những dòng lớn lấp đầy trăm ngàn vạn thế giới.
Khārudakena phuṭṭhaphuṭṭhā pathavīpabbatādayo vilīyanti, udakaṃ samantato vātehi dhārīyati.
The earth, mountains, and so forth, touched by the saline water, dissolve, and the water is held all around by winds.
Đất đai và núi non, hễ bị nước mặn chạm vào là tan chảy, nước được gió giữ lại khắp nơi.
Pathaviyā heṭṭhimantato pabhuti yāva dutiyajjhānabhūmiṃ udakaṃ gaṇhāti.
The water extends from the lowest part of the earth up to the second jhāna realm.
Nước chiếm giữ từ đáy đất cho đến tầng thiền thứ hai.
Tena hi khārudakena phuṭṭhaphuṭṭhā pathavīpabbatādayo udake pakkhittaloṇasakkharā viya vilīyanteva, tasmā pathavīsandhārakaudakena saddhiṃ ekūdakameva taṃ hotīti keci.
Indeed, the earth, mountains, and so forth, touched by that saline water, dissolve just like salt crystals placed in water; therefore, some say that it becomes one with the water that supports the earth.
Do đó, đất đai và núi non, hễ bị nước mặn chạm vào là tan chảy như muối cục bị bỏ vào nước. Vì vậy, một số nói rằng nước đó trở thành một khối nước duy nhất với nước giữ đất.
Apare pana ‘‘pathavīsandhārakaudakaṃ taṃ sandhārakavāyukkhandhañca anavasesato vināsetvā sabbattha sayameva eko ghanabhūto tiṭṭhatī’’ti vadanti, taṃ yuttaṃ.
Others, however, say, "The water that supports the earth and that supporting mass of wind are completely destroyed, and the water itself becomes a single solidified mass everywhere," which is reasonable.
Tuy nhiên, những người khác nói: “Nước đó hủy diệt hoàn toàn nước giữ đất và khối gió giữ nước, rồi tự nó trở thành một khối đặc duy nhất ở khắp mọi nơi”, điều đó hợp lý.
Upari pana chapi brahmaloke vilīyāpetvā subhakiṇhe āhacca tiṭṭhati, taṃ yāva aṇumattampi saṅkhāragataṃ atthi, tāva na vūpasammati, udakānugataṃ pana sabbaṃ saṅkhāragataṃ abhibhavitvā sahasā vūpasammati, antaradhānaṃ gacchati.
And above, having dissolved the six Brahma realms as well, it stops, reaching the Subhakiṇha realm. As long as even a tiny bit of conditioned existence remains, it does not cease. But, having overcome all conditioned existence by means of water, it quickly ceases and disappears.
Tuy nhiên, ở phía trên, nó làm tan rã sáu cõi Phạm thiên và dừng lại ở cõi Subhakiṇha. Chừng nào còn dù chỉ một chút pháp hữu vi (saṅkhāragata), chừng đó nó chưa lắng xuống. Nhưng khi nước bao trùm tất cả pháp hữu vi, nó nhanh chóng lắng xuống và biến mất.
Heṭṭhāākāsena saha upariākāso eko hoti mahandhakāroti sabbaṃ vuttasadisaṃ.
The lower space together with the upper space becomes one great darkness; all is similar to what has been stated.
Cùng với không gian bên dưới, không gian bên trên trở thành một khối tối tăm vĩ đại – tất cả đều giống như đã nói.
Kevalaṃ panidha ābhassarabrahmalokaṃ ādiṃ katvā loko pātubhavati.
However, in this case, the world reappears, beginning with the Ābhassara Brahma realm.
Tuy nhiên, ở đây, thế giới xuất hiện bắt đầu từ cõi Phạm thiên Ābhassara.
Subhakiṇhato cavitvā ābhassaraṭṭhānādīsu sattā nibbattanti.
Passing away from the Subhakiṇha realm, beings are reborn in the Ābhassara realm and so forth.
Chúng sanh sau khi chết từ cõi Subhakiṇha tái sanh vào cõi Ābhassara và các nơi khác.
Tattha kappavināsakamahāmeghato yāva kappavināsakakhārudakopacchedo, idamekamasaṅkhyeyyaṃ.
There, from the great cloud that destroys the kappa up to the cessation of the destructive salt water of the kappa, this is one asaṅkhyeyya.
Trong đó, từ đám mây lớn hủy diệt kiếp cho đến khi nước muối hủy diệt kiếp chấm dứt, đây là một a-tăng-kỳ (asaṅkhyeyya).
Udakupacchedato yāva sampattimahāmegho, idaṃ dutiyamasaṅkhyeyyaṃ.
From the cessation of water up to the reappearing great cloud, this is the second asaṅkhyeyya.
Từ khi nước chấm dứt cho đến đám mây lớn hình thành, đây là a-tăng-kỳ thứ hai.
Sampattimahāmeghato yāva candimasūriyapātubhāvo, idaṃ tatiyamasaṅkhyeyyaṃ.
From the reappearing great cloud up to the reappearance of the moon and sun, this is the third asaṅkhyeyya.
Từ đám mây lớn hình thành cho đến khi mặt trăng và mặt trời xuất hiện, đây là a-tăng-kỳ thứ ba.
Candimasūriyapātubhāvato yāva kappavināsakamahaāmegho, idaṃ catutthamasaṅkhyeyyaṃ.
From the reappearance of the moon and sun up to the great cloud that destroys the kappa, this is the fourth asaṅkhyeyya.
Từ khi mặt trăng và mặt trời xuất hiện cho đến đám mây lớn hủy diệt kiếp, đây là a-tăng-kỳ thứ tư.
Imāni cattāri asaṅkhyeyyāni eko mahākappo hoti.
These four asaṅkhyeyyas constitute one great kappa.
Bốn a-tăng-kỳ này hợp thành một đại kiếp (mahākappo).
Evaṃ udakena vināso ca saṇṭhahanañca veditabbaṃ.
Thus, the destruction and re-establishment by water should be understood.
Như vậy, sự hủy diệt và sự hình thành bởi nước cần được hiểu.
Yasmiṃ samaye kappo vātena nassati, āditova kappavināsakamahāmegho vuṭṭhahitvāti pubbe vuttanayeneva vitthāretabbaṃ.
At the time when a kappa is destroyed by wind, it should be elaborated in the manner previously stated, beginning with "the great cloud that destroys the kappa having arisen".
Khi kiếp bị hủy diệt bởi gió, cần phải giải thích chi tiết theo cách đã nói trước đây, bắt đầu từ việc đám mây lớn hủy diệt kiếp xuất hiện.
Ayaṃ pana viseso – yathā tattha dutiyasūriyo, evamidha kappavināsanatthaṃ vāto samuṭṭhāti.
But this is the distinction: just as there was a second sun, so here, wind arises to destroy the kappa.
Tuy nhiên, đây là điểm khác biệt – như mặt trời thứ hai ở đó, thì ở đây gió nổi lên để hủy diệt kiếp.
So paṭhamaṃ thūlarajaṃ uṭṭhāpeti, tato saṇharajaṃ sukhumavālikaṃ thūlavālikaṃ sakkharapāsāṇādayoti yāvakūṭāgāramatte pāsāṇe visamaṭṭhāne ṭhitamahārukkhe ca uṭṭhāpeti.
It first stirs up coarse dust, then fine dust, fine sand, coarse sand, gravel, and rocks, and so on, stirring up rocks the size of multi-storied mansions and great trees standing in uneven places.
Trước tiên, nó thổi tung bụi thô, sau đó là bụi mịn, cát nhỏ, cát thô, sỏi đá, v.v., cho đến khi nó thổi tung những tảng đá lớn bằng một ngôi nhà có mái nhọn và những cây cổ thụ lớn đứng ở những nơi không bằng phẳng.
Te pathavito nabhamuggatā na puna patanti, tattheva cuṇṇavicuṇṇā hutvā abhāvaṃ gacchanti.
These, having risen from the earth into the sky, do not fall back down; they become utterly pulverised and cease to exist right there.
Chúng bay lên không trung từ mặt đất và không rơi xuống nữa, mà tan tành thành từng mảnh và biến mất ngay tại đó.
Athānukkamena heṭṭhā mahāpathaviyā vāto samuṭṭhahitvā pathaviṃ parivattetvā uddhaṃ mūlaṃ katvā ākāse khipati.
Then, gradually, wind arises from the great earth below, rolls up the earth, and flings it into the sky with its root upwards.
Sau đó, gió dần dần nổi lên từ lòng đất, lật tung trái đất, đưa rễ lên trên và ném vào không trung.
Yojanasatappamāṇāpi pathavippadesā dviyojanatiyojanacatuyojanapañcayojanachayojanasattayojanappamāṇāpi pabhijjitvā vātavegukkhittā ākāseyeva cuṇṇavicuṇṇā hutvā abhāvaṃ gacchanti.
Even sections of earth a hundred yojanas in size, or two, three, four, five, six, or seven yojanas in size, break apart and, being tossed by the force of the wind, become utterly pulverised and cease to exist right in the sky.
Ngay cả những vùng đất rộng hàng trăm dojana, hoặc hai, ba, bốn, năm, sáu, bảy dojana, cũng bị vỡ ra, bị gió cuốn lên cao, tan tành thành từng mảnh và biến mất trong không trung.
Cakkavāḷapabbatampi sinerupabbatampi vāto ukkhipitvā ākāse khipati.
The wind lifts up the Cakkavāḷa mountain and the Sineru mountain and flings them into the sky.
Gió cũng cuốn núi Cakkavāḷa và núi Sineru lên và ném vào không trung.
Te aññamaññaṃ abhihantvā cuṇṇavicuṇṇā hutvā vinassanti.
They collide with each other, become utterly pulverised, and are destroyed.
Chúng va chạm vào nhau, tan tành thành từng mảnh và bị hủy diệt.
Etenevūpāyena bhūmaṭṭhakavimānāni ca ākāsaṭṭhakavimānāni ca vināsento chakāmāvacaradevaloke vināsetvā koṭisatasahassacakkavāḷāni vināseti.
By this same method, destroying both the terrestrial mansions and the celestial mansions, it destroys the six Kāma realms and then destroys hundreds of thousands of koṭis of cakkavāḷas.
Bằng cách này, nó hủy diệt các cung điện trên mặt đất và các cung điện trên không, hủy diệt sáu cõi trời Dục giới, và hủy diệt hàng trăm ngàn vạn thế giới Cakkavāḷa.
Tattha cakkavāḷā cakkavāḷehi, himavantā himavantehi, sinerū sinerūhi aññamaññaṃ samāgantvā cuṇṇavicuṇṇā hutvā vinassanti.
There, cakkavāḷas collide with cakkavāḷas, Himavanta mountains with Himavanta mountains, and Sineru mountains with Sineru mountains, becoming utterly pulverised and destroyed.
Trong đó, các Cakkavāḷa va chạm với các Cakkavāḷa khác, các Himavanta với các Himavanta khác, các Sineru với các Sineru khác, tan tành thành từng mảnh và bị hủy diệt.
Pathavito yāva tatiyajjhānabhūmi vāto gaṇhāti, navapi brahmaloke vināsetvā vehapphale āhacca tiṭṭhati.
The wind seizes from the earth up to the third jhāna realm, destroying nine Brahma realms, and stops, reaching the Vehapphala realm.
Gió cuốn từ mặt đất cho đến cõi thiền thứ ba, hủy diệt chín cõi Phạm thiên và dừng lại ở cõi Vehapphala.
Evaṃ pathavīsandhārakaudakena taṃsandhārakavātena ca saddhiṃ sabbasaṅkhāragataṃ vināsetvā sayampi vinassati avaṭṭhānassa kāraṇābhāvato.
Thus, destroying all conditioned existence together with the water that supports the earth and the wind that supports that water, it also destroys itself, because there is no cause for its continued existence.
Như vậy, sau khi hủy diệt tất cả pháp hữu vi cùng với nước nâng đỡ trái đất và gió nâng đỡ nước đó, chính nó cũng bị hủy diệt vì không có nguyên nhân để tồn tại.
Heṭṭhāākāsena saha upariākāso eko hoti mahandhakāroti sabbaṃ vuttasadisaṃ.
The lower space together with the upper space becomes one great darkness; all is similar to what has been stated.
Cùng với không gian bên dưới, không gian bên trên trở thành một khối tối tăm vĩ đại – tất cả đều giống như đã nói.
Idha pana subhakiṇhabrahmalokaṃ ādiṃ katvā loko pātubhavati.
But here, the world reappears, beginning with the Subhakiṇha Brahma realm.
Tuy nhiên, ở đây, thế giới xuất hiện bắt đầu từ cõi Phạm thiên Subhakiṇha.
Vehapphalato cavitvā subhakiṇhaṭṭhānādīsu sattā nibbattanti.
Passing away from the Vehapphala realm, beings are reborn in the Subhakiṇha realm and so forth.
Chúng sanh sau khi chết từ cõi Vehapphala tái sanh vào cõi Subhakiṇha và các nơi khác.
Tattha kappavināsakamahāmeghato yāva kappavināsakavātupacchedo, idamekamasaṅkhyeyyaṃ.
There, from the great cloud that destroys the kappa up to the cessation of the destructive wind of the kappa, this is one asaṅkhyeyya.
Trong đó, từ đám mây lớn hủy diệt kiếp cho đến khi gió hủy diệt kiếp chấm dứt, đây là một a-tăng-kỳ.
Vātupacchedato yāva sampattimahāmegho, idaṃ dutiyamasaṅkhyeyyantiādi vuttanayameva.
From the cessation of wind up to the reappearing great cloud, this is the second asaṅkhyeyya, and so on, as previously stated.
Từ khi gió chấm dứt cho đến đám mây lớn hình thành, đây là a-tăng-kỳ thứ hai, v.v., theo cách đã nói.
Evaṃ vātena vināso ca saṇṭhahanañca veditabbaṃ.
Thus, the destruction and re-establishment by wind should be understood.
Như vậy, sự hủy diệt và sự hình thành bởi gió cần được hiểu.
Atha kiṃkāraṇā evaṃ loko vinassati.
Now, for what reason does the world thus perish?
Vậy do nguyên nhân nào mà thế giới bị hủy diệt như vậy?
Yadipi hi saṅkhārānaṃ ahetuko sarasanirodho vināsakābhāvato, santānanirodho pana hetuvirahito natthi.
Although the self-cessation of conditioned things is causeless due to the absence of a destroyer, there is no cessation of continuity without a cause.
Mặc dù sự diệt tận tự nhiên của các pháp hữu vi là vô nhân vì không có gì hủy diệt chúng, nhưng sự diệt tận của dòng tương tục thì không thể không có nguyên nhân.
Yathā taṃ sattanikāyesūti bhājanalokassapi sahetukena vināsena bhavitabbaṃ, tasmā kimevaṃ lokavināse kāraṇanti?
Just as it is in the case of living beings, so the receptacle-world must also have a destruction with a cause. Therefore, what is the cause for such a destruction of the world?
Như vậy đối với các loài hữu tình, thế giới vật chất cũng phải bị hủy diệt có nguyên nhân. Vậy nguyên nhân nào gây ra sự hủy diệt thế giới như vậy?
Akusalamūlaṃ kāraṇaṃ.
Unwholesome roots are the cause.
Gốc rễ của bất thiện là nguyên nhân.
Yathā hi tattha nibbattanakasattānaṃ puññabalena paṭhamaṃ loko vivaṭṭati, evaṃ tesaṃ pāpakammabalena saṃvaṭṭati, tasmā akusalamūlesu ussannesu evaṃ loko vinassati.
Just as the world first evolves through the power of the merits of the beings reborn there, so it devolves through the power of their evil deeds. Therefore, when unwholesome roots abound, the world is thus destroyed.
Như nhờ sức mạnh phước đức của chúng sanh tái sanh mà thế giới bắt đầu hình thành, thì cũng nhờ sức mạnh ác nghiệp của chúng mà thế giới bị hoại diệt. Do đó, khi các gốc rễ bất thiện tăng thịnh, thế giới bị hủy diệt như vậy.
Yathā hi rāgadosamohānaṃ adhikabhāvena yathākkamaṃ rogantarakappo satthantarakappo dubbhikkhantarakappoti ime tividhā antarakappā vivaṭṭaṭṭhāyimhi asaṅkhyeyyakappe jāyanti.
For example, due to the prevalence of greed, hatred, and delusion, respectively, periods of illness, periods of weapons, and periods of famine—these three types of intervening periods—arise during the asaṅkhyeyya-kappa of expansion and duration.
Như khi tham, sân, si tăng trưởng, các kiếp trung gian bệnh tật, kiếp trung gian chiến tranh, kiếp trung gian nạn đói – ba loại kiếp trung gian này – xuất hiện trong a-tăng-kỳ kiếp an trú và hình thành.
Evamete yathāvuttā tayo saṃvaṭṭā rāgādīnaṃ adhikabhāveneva honti.
Similarly, these three kinds of devolution, as described, occur precisely due to the prevalence of greed and so forth.
Tương tự, ba sự hoại diệt đã nói trên cũng xảy ra do sự tăng trưởng của tham, v.v.
Tattha rāge ussannatare agginā vinassati, dose ussannatare udakena vinassati.
There, when greed is more prevalent, it is destroyed by fire; when hatred is more prevalent, it is destroyed by water.
Trong đó, khi tham tăng trưởng quá mức, thế giới bị hủy diệt bởi lửa; khi sân tăng trưởng quá mức, thế giới bị hủy diệt bởi nước.
Dose hi ussannatare adhikatarena dosena viya tikkhatarena khārudakena vināso yuttoti.
For it is fitting that when hatred is more prevalent, the destruction should be by an extremely sharp corrosive water, as if by an excess of hatred itself.
Quả thật, khi sân tăng trưởng quá mức, sự hủy diệt bởi nước muối cực mạnh, giống như sân quá mức, là hợp lý.
Keci pana ‘‘dose ussannatare agginā, rāge udakenā’’ti vadanti, tesaṃ kira ayamadhippāyo – pākaṭasattusadisassa dosassa aggisadisatā, apākaṭasattusadisassa rāgassa khārudakasadisatā ca yuttāti.
Some, however, say, "When hatred is more prevalent, by fire; when greed, by water." Their intention, they say, is that hatred, being like an obvious enemy, is akin to fire, and greed, being like a hidden enemy, is akin to corrosive water.
Tuy nhiên, một số người nói rằng “khi sân tăng trưởng quá mức, bởi lửa; khi tham tăng trưởng quá mức, bởi nước.” Ý của họ là sự giống nhau của sân với kẻ thù rõ ràng là lửa, và sự giống nhau của tham với kẻ thù không rõ ràng là nước muối, là hợp lý.
Mohe pana ussannatare vātena vinassati.
But when delusion is more prevalent, it is destroyed by wind.
Nhưng khi si tăng trưởng quá mức, thế giới bị hủy diệt bởi gió.
Evaṃ vinassantopi ca nirantarameva satta vāre agginā nassati, aṭṭhame vāre udakena, puna satta vāre agginā, aṭṭhame udakenāti evaṃ aṭṭhame aṭṭhame vāre vinassanto sattakkhattuṃ udakena vinassitvā puna satta vāre agginā nassati.
Even when thus destroyed, it is destroyed by fire seven times in succession, by water on the eighth turn; again by fire seven times, by water on the eighth turn—thus, being destroyed on every eighth turn, having been destroyed by water seven times, it is again destroyed by fire seven times.
Mặc dù bị hủy diệt như vậy, thế giới liên tục bị hủy diệt bởi lửa bảy lần, lần thứ tám bởi nước; rồi lại bảy lần bởi lửa, lần thứ tám bởi nước. Cứ như vậy, cứ mỗi lần thứ tám bị hủy diệt, sau khi bị hủy diệt bởi nước bảy lần, nó lại bị hủy diệt bởi lửa bảy lần nữa.
Ettāvatā tesaṭṭhi kappā atītā honti.
By this time, sixty-three kappas have passed.
Đến đây, sáu mươi ba kiếp đã trôi qua.
Etthantare udakena nassanavāraṃ sampattampi paṭibāhitvā laddhokāso vāto paripuṇṇacatusaṭṭhikappāyuke subhakiṇhe viddhaṃsento lokaṃ vināseti.
During this interval, the wind, having overcome the turn for destruction by water, and finding opportunity, destroys the world, annihilating the Subhakiṇha beings whose lifespan is a full sixty-four kappas.
Trong khoảng thời gian này, gió, mặc dù đến lượt bị hủy diệt bởi nước, đã vượt qua và có cơ hội, hủy diệt thế giới, làm tan rã cõi Subhakiṇha có tuổi thọ trọn vẹn sáu mươi bốn kiếp.
Ettha pana rāgo sattānaṃ bahulaṃ pavattatīti aggivasena bahuso lokavināso veditabbo.
Here, however, it should be understood that the destruction of the world mostly occurs by fire because greed prevails among beings.
Ở đây, tham thường xuyên thịnh hành trong chúng sanh, nên sự hủy diệt thế giới chủ yếu là do lửa cần được hiểu.
Iti evaṃ imehi kāraṇehi vinassitvā saṇṭhahantaṃ saṇṭhahitvā ṭhitañca okāsalokaṃ bhagavā yāthāvato avedīti evampissa sabbathā okāsaloko viditoti daṭṭhabbaṃ.
Thus, it should be seen that the Blessed One truly understood the world of space—how it is destroyed by these causes, re-established after destruction, and exists after re-establishment—and that he thus understood the world of space in every way.
Như vậy, Đức Thế Tôn đã thấu triệt thế giới vật chất, vốn bị hủy diệt và hình thành, và sau khi hình thành thì tồn tại, bằng những nguyên nhân này. Như vậy, cần phải thấy rằng đối với Ngài, thế giới vật chất được biết đến một cách toàn diện.
Idāni anuttaroti padassa atthaṃ saṃvaṇṇento āha ‘‘attano pana guṇehī’’tiādi.
Now, explaining the meaning of the word Anuttaro, it states, " by his own qualities" and so on.
Bây giờ, để giải thích ý nghĩa của từ anuttaro (Vô thượng), Ngài nói “attano pana guṇehī” (nhưng bởi các đức tính của chính mình), v.v.
Tattha attanoti nissakkatthe sāmivacanametaṃ, attatoti attho.
There, attano is a genitive case in the sense of possession; the meaning is "by himself".
Trong đó, attano là một từ sở hữu cách trong nghĩa không sở hữu, nghĩa là “của chính mình.”
Guṇehi attano visiṭṭhatarassāti sambandho.
The connection is "superior to himself by qualities".
Mối liên hệ là “không có ai cao quý hơn chính mình bởi các đức tính.”
Taraggahaṇañcettha ‘‘anuttaro’’ti padassa atthaniddesatāya kataṃ, na visiṭṭhassa kassaci atthitāya.
The addition of 'tara' (more) here is done for the purpose of defining the meaning of the word "anuttaro", not because there actually exists anyone superior.
Ở đây, việc thêm tiếp vĩ ngữ so sánh hơn (-tara) là để chỉ rõ ý nghĩa của từ “anuttaro,” chứ không phải vì có ai đó cao quý hơn.
Sadevake hi loke sadisakappopi nāma koci tathāgatassa natthi, kuto sadiso, visiṭṭhe pana kā kathā.
Indeed, in the world with its devas, there is no one who is even similar in any way to the Tathāgata, much less equal; what then of one superior?
Quả thật, trong thế giới chư thiên và loài người, không có ai có thể được xem là tương tự với Như Lai, huống chi là tương đương, còn nói gì đến bậc ưu việt hơn.
Kassacīti kassacipi.
Kassacī means anyone at all.
Kassacī có nghĩa là của bất kỳ ai.
Abhibhavatīti sīlasampadāya upanissayabhūtānaṃ hirottappamettākaruṇānaṃ visesapaccayānaṃ saddhāsativīriyapaññānañca ukkaṃsappattiyā samudāgamato paṭṭhāya na aññasādhāraṇo savāsanapaṭipakkhassa pahīnattā ukkaṃsapāramippatto satthu sīlaguṇo, tena bhagavā sadevakaṃ lokaṃ aññadatthu abhibhuyya pavattati, na sayaṃ kenaci abhibhuyyatīti adhippāyo.
Abhibhavatī (overcomes) means that the Teacher's virtue, which is the culmination of perfection, is not shared by others. This is because, from the very beginning of its attainment, it has reached the highest degree of development, due to the special conditions of shame, dread of wrongdoing, loving-kindness, and compassion, which are the proximate causes for the perfection of virtue, as well as faith, mindfulness, energy, and wisdom. Therefore, the Blessed One exists by overcoming the world with its devas; he himself is not overcome by anyone—this is the intention.
Abhibhavatī có nghĩa là: Bởi vì đức tính giới hạnh của Bậc Đạo Sư là không chung với ai khác, đã đạt đến sự hoàn hảo tối thượng do sự đoạn trừ đối thủ cùng với tập khí, bắt đầu từ sự phát triển các yếu tố đặc biệt như lòng hổ thẹn (hiri), ghê sợ tội lỗi (ottappa), từ (mettā), bi (karuṇā) – những yếu tố làm nền tảng cho sự thành tựu giới hạnh, cùng với sự đạt đến đỉnh cao của đức tin (saddhā), niệm (sati), tinh tấn (vīriya) và tuệ (paññā). Do đó, Đức Thế Tôn vượt trội hơn toàn bộ thế giới chư thiên và loài người, Ngài tồn tại mà không bị ai khác vượt trội. Đó là ý nghĩa.
Evaṃ samādhiguṇādīsupi yathārahaṃ vattabbaṃ.
In the same way, it should be stated appropriately regarding qualities like concentration and so on.
Tương tự, đối với các đức tính định (samādhi) v.v… cũng nên nói một cách thích hợp.
Sīlādayo cete lokiyalokuttaramissakā veditabbā, vimuttiñāṇadassanaṃ pana lokiyaṃ kāmāvacarameva.
These virtues and so on should be understood as a mixture of worldly and supra-mundane, but the knowledge and vision of liberation is merely worldly, pertaining to the sense-sphere.
Giới hạnh v.v… này nên được hiểu là pha trộn giữa thế gian và xuất thế gian, nhưng giải thoát (vimutti) và tri kiến (ñāṇadassana) thì chỉ thuần là thế gian, thuộc cõi Dục (kāmāvacara).
Yadi evaṃ kathaṃ tena sadevakaṃ lokaṃ abhibhavatīti?
If so, how does he overcome the world with its devas by that?
Nếu vậy, làm sao Ngài lại vượt trội hơn thế giới chư thiên và loài người bằng điều đó?
Tassapi ānubhāvato asadisattā.
Due to the incomparable power of that as well.
Bởi vì năng lực của nó cũng không thể so sánh được.
Tampi hi visayato pavattito pavattiākārato ca uttaritarameva.
For that too is superior in terms of its object, its occurrence, and its mode of occurrence.
Nó cũng ưu việt hơn về đối tượng, về sự vận hành và về cách thức vận hành.
Tañhi anaññasādhāraṇaṃ satthu vimuttiguṇaṃ ārabbha pavattati, pavattamānañca atakkāvacaraṃ paramagambhīraṃ saṇhaṃ sukhumaṃ sātisayaṃ paṭipakkhadhammānaṃ suppahīnattā suṭṭhu pākaṭaṃ vibhūtataraṃ katvā pavattati, sammadeva ca vasībhāvassa pāpakattā bhavaṅgaparivāsassa ca atiparittakattā lahu lahu pavattatīti.
For it arises concerning the Teacher’s quality of liberation, which is not shared by others, and as it arises, it becomes immeasurable, exceedingly profound, subtle, delicate, extraordinary, clearly manifest, and greatly revealed due to the complete eradication of opposing qualities, and it arises swiftly, as it quickly brings about mastery and the duration of bhavaṅga (life-continuum) is extremely short.
Thật vậy, nó vận hành dựa trên đức tính giải thoát của Bậc Đạo Sư, vốn không chung với ai khác; và khi vận hành, nó vượt ngoài tầm suy luận, cực kỳ sâu xa, vi tế, tinh vi, siêu việt, và do sự đoạn trừ hoàn toàn các pháp đối nghịch, nó vận hành một cách rất rõ ràng, hiển lộ hơn; và do sự thành tựu hoàn toàn năng lực làm chủ, cùng với thời gian trú trong hữu phần (bhavaṅga) cực kỳ ngắn ngủi, nó vận hành rất nhanh chóng.
Evaṃ sīlādiguṇehi bhagavato uttaritarassa abhāvaṃ dassetvā idāni sadisassapi abhāvaṃ dassetuṃ ‘‘sīlaguṇenapi asamo’’tiādi vuttaṃ.
Having thus shown the absence of anyone superior to the Blessed One in terms of qualities such as virtue, it is now said "asamo even in the quality of virtue" and so on, to show the absence of even an equal.
Sau khi trình bày rằng không có điều gì ưu việt hơn Đức Thế Tôn về các đức tính giới hạnh v.v…, bây giờ để trình bày rằng cũng không có điều gì tương đương, nên đã nói “sīlaguṇenapi asamo” (cũng không ai bằng về đức tính giới hạnh) v.v…
Tattha asamoti ekasmiṃ kāle natthi etassa sīlādiguṇena samo sadisoti asamo.
Therein, asamo (unequalled) means there is no one equal or similar to him in terms of qualities such as virtue at any time.
Ở đó, asamo có nghĩa là: Vào một thời điểm, không có ai tương đương hoặc giống như Ngài về đức tính giới hạnh v.v… nên gọi là asama.
Tathā asamehi samo asamasamo.
Likewise, asamasamo (unequalled among the unequalled) means equal to the unequalled.
Tương tự, asamasamo có nghĩa là bằng với những người không ai bằng.
Asamā vā samā etassāti asamasamo.
Or, one whose equals are unequalled, hence asamasamo.
Hoặc, asamasamo có nghĩa là những người không ai bằng thì bằng với Ngài.
Sīlādiguṇena natthi etassa paṭimāti appaṭimo.
There is no image or counterpart to him in terms of qualities such as virtue, hence appaṭimo (peerless).
Không có hình ảnh nào của Ngài về đức tính giới hạnh v.v… nên gọi là appaṭimo (không ai sánh bằng).
Sesapadadvayepi eseva nayo.
The same method applies to the remaining two terms.
Đối với hai từ còn lại cũng theo cách này.
Tattha upamāmattaṃ paṭimā, sadisūpamā paṭibhāgo, yugaggāhavasena ṭhito paṭipuggaloti veditabbo.
Therein, upamā (comparison) is merely an image, paṭibhāgo (counterpart) is a similar comparison, and paṭipuggala (opponent) should be understood as one standing in opposition.
Ở đó, upamā (ví dụ) là hình ảnh, paṭibhāgo (sự tương tự) là ví dụ tương đương, paṭipuggalo (người đối lại) nên được hiểu là người đứng ở vị trí đối lập.
‘‘Yāvatā, bhikkhave, sattā apadā vā dvipadā vā catuppadā vā bahuppadā vā rūpino vā arūpino vā saññino vā asaññino vā nevasaññīnāsaññino vā, tathāgato tesaṃ aggamakkhāyati arahaṃ sammāsambuddho.
"Bhikkhus, among all beings, whether footless, two-footed, four-footed, or many-footed, whether with form or formless, with perception or without perception, or neither with nor without perception, the Tathāgata, Arahant, Perfectly Self-Enlightened One, is declared to be the foremost among them.
“Này các tỳ khưu, trong tất cả chúng sanh, dù không chân, hai chân, bốn chân hay nhiều chân, dù có sắc hay không sắc, dù có tưởng hay không tưởng, dù không tưởng cũng không phải không tưởng, Như Lai được gọi là tối thượng, bậc A-la-hán, Chánh Đẳng Giác.
Ye, bhikkhave, buddhe pasannā, agge te pasannā.
Bhikkhus, those who have faith in the Buddha, have faith in the foremost.
Này các tỳ khưu, những ai tịnh tín nơi Đức Phật, họ tịnh tín nơi bậc tối thượng.
Agge kho pana pasannānaṃ aggo vipāko hotī’’ti (a. ni. 4.34; itivu. 90) –
Indeed, for those who have faith in the foremost, the foremost result arises."
Và này các tỳ khưu, những ai tịnh tín nơi bậc tối thượng, quả báo của họ là tối thượng.”
Purisadammasārathītiādīsu damitabbāti dammā, damituṃ araharūpā.
In "Charioteer of beings to be tamed" and so on, dammā means those to be tamed, those worthy of being tamed.
Trong các câu Purisadammasārathī (Người điều ngự các bậc đáng điều phục) v.v… dammā là những người cần được điều phục, những người xứng đáng được điều phục.
Purisā ca te dammā cāti purisadammā.
And they are men, and they are to be tamed, hence purisadammā (men to be tamed).
Họ là những người và họ là những người đáng điều phục, nên gọi là purisadammā.
Visesanassa cettha paranipātaṃ katvā niddeso, dammapurisāti attho.
Here, the modifier is placed after the modified word; the meaning is dammapurisā (tameable men).
Ở đây, tính từ được đặt sau danh từ, có nghĩa là dammapurisā (những người đáng điều phục).
‘‘Satipi mātugāmassapi dammabhāve purisaggahaṇaṃ ukkaṭṭhaparicchedavasenā’’ti vadanti.
They say: "Even though women are also tameable, the term 'men' is used to signify the highest category."
Họ nói rằng: “Dù có cả phụ nữ cũng là người đáng điều phục, nhưng việc dùng từ ‘purisa’ (người nam) là để chỉ sự phân loại ở mức độ ưu việt.”
Sāretīti imassa atthaṃ dassento āha ‘‘dametī’’tiādi.
Showing the meaning of sāretī (he trains), it says "dametī" and so on.
Để trình bày ý nghĩa của sāretī (điều khiển), đã nói “dametī” (điều phục) v.v…
Tattha dametīti sameti, kāyasamādīhi yojetīti attho.
Therein, dametī means he pacifies, meaning he yokes them with bodily composure and so on.
Ở đó, dametī có nghĩa là sameti (làm cho an tịnh), tức là làm cho hòa hợp với sự an tịnh thân (kāyasamādhi) v.v….
Taṃ pana kāyasamādīhi yojanaṃ yathārahaṃ tadaṅgavinayādīsu patiṭṭhāpanaṃ hotīti āha ‘‘vinetīti vuttaṃ hotī’’ti.
And that yoking with bodily composure and so on means establishing them appropriately in the eradication of defilements and so on; thus it is said: "it means he disciplines."
Sự hòa hợp với sự an tịnh thân đó là sự thiết lập một cách thích hợp vào sự điều phục từng phần (tadaṅgavinaya) v.v… nên đã nói “vinetīti vuttaṃ hotī” (có nghĩa là dẫn dắt).
Adantāti idaṃ sabbena sabbaṃ damataṃ anupagatā purisadammāti vuttāti katvā vuttaṃ.
Adantā (untamed) is stated having meant that these men to be tamed are those who have not attained taming in any way.
Adantā (chưa được điều phục) được nói như vậy vì nó được nói rằng những người đáng điều phục hoàn toàn chưa được điều phục.
Ye pana vippakatadammabhāvā sabbathā dametabbataṃ nātivattā, tepi purisadammā eva, yato te satthā dameti.
However, those whose taming is incomplete, who have not completely transcended tamableness, are also "men to be tamed," because the Teacher tames them.
Tuy nhiên, những người đã được điều phục một phần nhưng chưa hoàn toàn vượt qua khả năng điều phục, họ cũng là những người đáng điều phục, bởi vì Bậc Đạo Sư điều phục họ.
Bhagavā hi visuddhasīlassa paṭhamajjhānaṃ ācikkhati, paṭhamajjhānalābhino dutiyajjhānantiādinā tassa tassa uparūpari visesaṃ ācikkhanto ekadesena dantepi sameti.
For the Blessed One teaches the first jhāna to one of pure virtue, and the second jhāna to one who has attained the first jhāna, and so on, thus guiding even those who are partially tamed by teaching them higher and higher distinctions.
Đức Thế Tôn giảng về sơ thiền cho người có giới hạnh thanh tịnh, giảng về nhị thiền cho người đạt sơ thiền v.v… Như vậy, Ngài giảng về sự ưu việt ngày càng tăng, và Ngài cũng làm cho những người đã được điều phục một phần trở nên an tịnh.
Teneva vuttaṃ visuddhimagge (visuddhi. 1.139) ‘‘api ca so bhagavā visuddhasīlādīnaṃ paṭhamajjhānādīni sotāpannādīnañca uttarimaggappaṭipadaṃ ācikkhanto dantepi dametiyevā’’ti.
Therefore, it is said in the Visuddhimagga: "Moreover, that Blessed One, by teaching the first jhānas and so on to those of pure virtue and so on, and the higher path-practice to stream-winners and so on, still tames even those who are already tamed."
Chính vì thế, trong Thanh Tịnh Đạo đã nói: “Hơn nữa, Đức Thế Tôn giảng về sơ thiền v.v… cho những người có giới hạnh thanh tịnh v.v…, và giảng về con đường tu tập cao hơn cho những bậc Dự Lưu v.v…, Ngài vẫn điều phục cả những người đã được điều phục.”
Atha vā sabbena sabbaṃ adantā ekadesena dantā ca idha adantaggahaṇeneva saṅgahitāti veditabbaṃ.
Alternatively, it should be understood that both the completely untamed and the partially tamed are included by the term "untamed" here.
Hoặc, nên biết rằng những người hoàn toàn chưa được điều phục và những người đã được điều phục một phần đều được bao gồm trong từ “adantā” (chưa được điều phục) ở đây.
Dametuṃ yuttāti damanārahā.
Dametuṃ yuttā means worthy of taming.
Dametuṃ yuttā có nghĩa là những người xứng đáng được điều phục.
Tathā hi buddhā bhagavanto paccekabuddhā aggasāvakā mahāsāvakā cakkavattino aññe ca mahānubhāvā sattā tattheva uppajjanti.
Indeed, the Buddhas, Paccekabuddhas, Chief Disciples, Great Disciples, Cakkavattins, and other beings of great power are born there.
Thật vậy, các Đức Phật, các Đức Phật Độc Giác, các vị Đại Đệ Tử, các vị Thượng Thủ Đệ Tử, các vị Chuyển Luân Vương và các chúng sanh có đại oai lực khác đều xuất hiện ở đó.
Tehi samānarūpāditāya pana saddhiṃ parittadīpavāsīhi itaramahādīpavāsinopi manussātveva paññāyiṃsūti eke.
Some say that due to their similarity in form etc., the residents of other great continents, along with those of the small islands, are also designated as humans.
Một số người nói rằng: “Và những người sống ở các đại châu khác cũng được gọi là loài người vì có hình dạng tương tự v.v… với những người sống ở các tiểu châu.”
Apare pana bhaṇanti – lobhādīhi ca alobhādīhi ca sahitassa manassa ussannatāya manussā.
Others say: humans are so called due to the abundance of mind, which is accompanied by both greed and so on, and non-greed and so on.
Những người khác lại nói: “Manussā (loài người) là những người có tâm ý phát triển mạnh mẽ do tham ái v.v… và do không tham ái v.v….”
Ye hi sattā manussajātikā, tesu visesato lobhādayo alobhādayo ca ussannā, te lobhādiussannatāya apāyamaggaṃ, alobhādiussannatāya sugatimaggaṃ nibbānagāmimaggañca pūrenti, tasmā lobhādīhi alobhādīhi ca sahitassa manassa ussannatāya parittadīpavāsīhi saddhiṃ catumahādīpavāsino sattavisesā manussāti vuccanti.
Indeed, among those beings of human species, greed and so forth, and non-greed and so forth are especially abundant. Due to the abundance of greed and so forth, they fulfill the path to the lower realms; and due to the abundance of non-greed and so forth, they fulfill the path to the happy destinations and the path leading to Nibbāna. Therefore, due to the abundance of a mind endowed with greed and so forth, and non-greed and so forth, these special beings, residents of the four great continents together with residents of the small islands, are called 'humans' (manussā).
Bởi vì nơi những chúng sanh thuộc loài người, đặc biệt có tham, v.v. và vô tham, v.v. phát triển mạnh. Do sự phát triển mạnh của tham, v.v., họ đi đến con đường đọa xứ; do sự phát triển mạnh của vô tham, v.v., họ hoàn thành con đường thiện thú và con đường dẫn đến Nibbāna. Do đó, bởi tâm ý có tham, v.v. và vô tham, v.v. phát triển mạnh, những chúng sanh đặc biệt sống ở bốn đại châu cùng với những người sống ở các tiểu đảo được gọi là manussa (loài người).
Lokiyā pana ‘‘manuno apaccabhāvena manussā’’ti vadanti.
Worldlings, however, say that 'humans' (manussā) are 'the offspring of Manu'.
Tuy nhiên, những người thế gian nói rằng: “Manussa là con cháu của Manu.”
Manu nāma paṭhamakappiko lokamariyādāya ādibhūto hitāhitavidhāyako sattānaṃ pituṭṭhāniyo, yo sāsane mahāsammatoti vuccati, paccakkhato paramparāya ca tassa ovādānusāsaniyaṃ ṭhitā tassa puttasadisatāya manussā mānusāti ca vuccanti.
Manu is the first being of the aeon, the originator of worldly customs, a dispenser of what is beneficial and harmful, standing in the place of a father to beings, and is called Mahāsammata in the Teaching. Since they directly and traditionally follow his advice and instruction, and are like his children, they are called 'humans' (manussā) or 'mānusa'.
Manu là vị tổ đầu tiên của thế giới, là người thiết lập các quy tắc thế gian, là người ban hành điều lợi và điều hại, là người cha của chúng sanh, trong Giáo Pháp được gọi là Mahāsammata. Những người sống theo lời khuyên và chỉ dạy của Ngài, trực tiếp hoặc qua truyền thống, giống như con cái của Ngài, nên được gọi là manussa và mānusa.
Tato eva hi te māṇavā ‘‘manujā’’ti ca voharīyanti, manussā ca te purisā cāti manussapurisā.
For this very reason, those young men (māṇavā) are also referred to as 'manujā', and they are humans and also men, hence 'human men' (manussa-purisā).
Vì vậy, những thanh niên đó cũng được gọi là manuja (người sinh ra từ Manu). Manussapurisā là những người đàn ông là loài người.
Amanussapurisāti ettha na manussāti amanussā.
Here, in amanussapurisā (non-human men), 'non-human' (amanussā) means 'not human'.
Trong cụm từ Amanussapurisā (những người không phải loài người), amanussa là những người không phải loài người.
Taṃsadisatā ettha jotīyati.
Similarity to humans is indicated here.
Ở đây, sự tương tự được làm rõ.
Tena manussattamattaṃ natthi, aññaṃ samānanti yakkhādayo amanussāti adhippetā.
Thus, humanity itself is absent, but other qualities are similar, meaning yakkhas and so forth are intended as non-humans (amanussā).
Do đó, không có trạng thái người, nhưng những thứ khác thì giống nhau, nên các loài dạ xoa, v.v. được coi là amanussa (phi nhân).
Na ye keci manussehi aññe, tathā tiracchānapurisānaṃ visuṃ gahaṇaṃ kataṃ.
Not just any beings other than humans, for a separate mention of animal men (tiracchāna-purisā) has been made.
Không phải bất kỳ ai khác ngoài loài người, cũng như các loài thú vật được đề cập riêng biệt.
Yakkhādayo eva ca niddiṭṭhā.
Only yakkhas and so forth are specified.
Và chỉ có các loài dạ xoa, v.v. được chỉ định.
Apalālo himavantavāsī, cūḷodaramahodarā nāgadīpavāsino, aggisikhadhūmasikhā sīhaḷadīpavāsino nibbisā katā dosavisassa vinodanena.
Apalālo, a resident of the Himavanta; Cūḷodara and Mahodara, residents of Nāgadīpa; Aggisikha and Dhūmasikha, residents of Sīhaḷadīpa—were rendered non-venomous by dispelling the venom of hatred.
Apalāla sống ở Himavanta, Cūḷodara và Mahodara sống ở Nāgadīpa, Aggisikha và Dhūmasikha sống ở Sīhaḷadīpa đã được làm cho vô độc bằng cách loại bỏ nọc độc của sự sân hận.
Tenāha ‘‘saraṇesu ca sīlesu ca patiṭṭhāpitā’’ti.
Therefore it is said: ‘‘established in the refuges and in the precepts’’.
Vì vậy, Ngài nói: “đã được an lập trong các giới và các nơi nương tựa”.
Kūṭadantādayoti ādi-saddena ghoramukhaupāligahapatiādīnaṃ saṅgaho daṭṭhabbo.
In Kūṭadantādayo, by the word ādi, the inclusion of Ghoramukha, Upāligahapati and others should be understood.
Trong Kūṭadantādayo, cần hiểu rằng từ v.v. bao gồm Ghoramukha, Upāligahapati, v.v.
Sakkādayoti ādi-saddena ajakalāpayakkhabakabrahmādīnaṃ saṅgaho daṭṭhabbo.
In Sakkādayo, by the word ādi, the inclusion of Ajakalāpayakkha, Bakabrahmā and others should be understood.
Trong Sakkādayo, cần hiểu rằng từ v.v. bao gồm Ajakalāpa-yakkha, Baka-brahmā, v.v.
Etesaṃ pana damanaṃ tattha tattha vuttanayeneva sakkā viññātunti atippapañcabhāvato idha na vuccati.
However, their taming can be understood by the methods stated here and there, so it is not mentioned in detail here due to its extensive nature.
Tuy nhiên, việc chế ngự những vị này có thể được hiểu theo cách đã nói ở từng nơi, nên ở đây không nói đến vì quá dài dòng.
Idañcettha suttaṃ vitthāretabbanti idaṃ kesīsuttaṃ ‘‘vinītā vicitrehi vinayanūpāyehī’’ti etasmiṃ atthe vitthāretabbaṃ yathārahaṃ saṇhādīhi upāyehi vinayanassa dīpanato.
Idañcettha suttaṃ vitthāretabbaṃ (This Sutta should be elaborated here) means that this Kesīsutta should be elaborated in the sense of ‘‘trained by various means of training’’ because it expounds training by appropriate subtle and other methods.
Idañcettha suttaṃ vitthāretabbaṃ (Kinh này cần được giải thích rộng rãi ở đây) – kinh Kesī này cần được giải thích rộng rãi theo ý nghĩa “đã được điều phục bằng các phương tiện điều phục đa dạng”, vì nó làm sáng tỏ sự điều phục bằng các phương tiện tinh tế, v.v. một cách thích đáng.
Atthapadanti atthābhibyañjanakaṃ padaṃ, vākyanti attho.
Atthapadaṃ means a word that manifests meaning; its meaning is 'sentence'.
Atthapadaṃ (câu có nghĩa) có nghĩa là một câu biểu đạt ý nghĩa, tức là một câu văn.
Vākyena hi atthābhibyatti, na nāmādipadamattena, ekapadabhāvena ca anaññasādhāraṇo satthu purisadammasārathibhāvo dassito hoti.
For meaning is manifested by a sentence, not merely by a noun or other single word; and by being a single word, the Teacher’s unique role as a trainer of men to be tamed is shown.
Bởi vì ý nghĩa được biểu đạt bằng câu văn, chứ không chỉ bằng các từ danh từ, v.v. Và trạng thái một từ cho thấy rằng đặc tính Người điều ngự những người đáng điều phục của Bậc Đạo Sư là độc nhất vô nhị.
Tenāha ‘‘bhagavā hī’’tiādi.
Therefore, it is said: ‘‘Bhagavā hī’’tiādi (Indeed, the Blessed One...) and so forth.
Vì vậy, Ngài nói: “Bhagavā hī” (Thế Tôn quả thật là), v.v.
Aṭṭha disāti aṭṭha samāpattiyo.
Aṭṭha disā (eight directions) refers to the eight attainments.
Aṭṭha disā (tám phương) là tám thiền định (samāpatti).
Tā hi aññamaññaṃ sambandhāpi asaṃkiṇṇabhāvena dissanti apadissanti, disā viyāti vā disā.
Though these are interconnected, they appear distinct and separate, like directions, hence 'directions'.
Chúng, dù có liên hệ với nhau, nhưng vẫn được nhìn thấy và biểu hiện một cách không lẫn lộn, giống như các phương hướng.
Asajjamānāti na sajjamānā vasībhāvappattiyā nissaṅgacārā.
Asajjamānā means not clinging, moving without hindrance due to having attained mastery.
Asajjamānā (không bị vướng mắc) có nghĩa là không bị vướng mắc, đạt đến trạng thái thuần thục, di chuyển không bị cản trở.
Dhāvantīti javanavuttiyogato dhāvanti.
Dhāvantī (they run) means they run due to being engaged in swift activity.
Dhāvantī (chạy) có nghĩa là chạy do có sự vận hành nhanh chóng.
Ekaṃyeva disaṃ dhāvatīti attano kāyaṃ aparivattantoti adhippāyo, satthārā pana damitā purisadammā ekiriyāpatheneva aṭṭha disā dhāvanti.
Ekaṃyeva disaṃ dhāvatī (runs in only one direction) means the intention is that it does not turn its body; but men tamed by the Teacher run in eight directions in only one posture.
Ekaṃyeva disaṃ dhāvatī (chỉ chạy về một hướng) có ý nghĩa là không thay đổi thân mình. Tuy nhiên, những người đáng điều phục đã được Bậc Đạo Sư điều phục thì chạy về tám hướng chỉ với một tư thế.
Tenāha ‘‘ekapallaṅkeneva nisinnā’’ti.
Therefore it is said: ‘‘sitting in one posture’’.
Vì vậy, Ngài nói: “ekapallaṅkeneva nisinnā” (chỉ ngồi kiết già).
Aṭṭha disāti ca nidassanamattametaṃ lokiyehi agatapubbaṃ nirodhasamāpattidisaṃ amatadisañca pakkhandanato.
And aṭṭha disā (eight directions) is merely an example, as they penetrate the direction of the attainment of cessation and the direction of the deathless, which worldlings have not reached before.
Và aṭṭha disā (tám phương) này chỉ là một ví dụ, vì họ đã đi đến phương nirodhasamāpatti (diệt tận định) và phương bất tử (amatadisā), những nơi mà người thế gian chưa từng đến.
Diṭṭhadhammikasamparāyikaparamatthehītiādīsu diṭṭhadhammo vuccati paccakkho attabhāvo, tattha niyuttoti diṭṭhadhammiko, idhalokattho.
Among diṭṭhadhammikasamparāyikaparamatthehītiādi (with benefits pertaining to this life, the next, and the ultimate good), 'diṭṭhadhamma' refers to the present existence; 'diṭṭhadhammika' means pertaining to it, the good of this world.
Trong Diṭṭhadhammikasamparāyikaparamatthehi, v.v., diṭṭhadhamma được gọi là tự thân hiện tại, diṭṭhadhammika là liên quan đến điều đó, tức là lợi ích thế gian này.
Kammakilesavasena samparetabbato sammā gantabbato samparāyo, paraloko.
Because it is to be reached by means of kamma and defilements, or to be rightly gone to, it is 'samparāya', the next world.
Samparāya là thế giới sau, vì nó được liên kết bởi nghiệp và phiền não, và vì nó là nơi phải đi đến đúng đắn.
Tattha niyuttoti samparāyiko, paralokattho.
'Samparāyika' means pertaining to it, the good of the next world.
Samparāyika là liên quan đến điều đó, tức là lợi ích thế giới sau.
Paramo uttamo attho paramattho, nibbānaṃ.
'Paramattha' is the supreme, ultimate good, Nibbāna.
Paramattha là lợi ích tối thượng, cao cả, tức là Nibbāna.
Tehi diṭṭhadhammikasamparāyikaparamatthehi.
By these, the benefits pertaining to this life, the next, and the ultimate good.
Bằng những lợi ích thế gian này, lợi ích thế giới sau và lợi ích tối thượng.
Yathārahanti yathānurūpaṃ, tesu tesu atthesu yo yo puggalo yaṃ yaṃ arahati, tadanurūpaṃ.
Yathārahaṃ means appropriately, in accordance with what each person is worthy of in those respective matters.
Yathārahaṃ (tùy theo mức độ) có nghĩa là phù hợp, tương ứng với điều mà mỗi người xứng đáng trong các vấn đề đó.
Anusāsatīti vineti tasmiṃ tasmiṃ atthe patiṭṭhāpeti.
Anusāsatī (he instructs) means he trains, establishes them in that particular matter.
Anusāsatī (dạy bảo) có nghĩa là điều phục, an lập vào vấn đề đó.
Saha atthena vattatīti sattho, bhaṇḍamūlena vaṇijjāya desantaraṃ gacchanto janasamūho.
Sattho is a group of people, a caravan, that travels to another country for trade with merchandise and capital; it means 'with purpose/meaning'.
Sattho (đoàn lữ hành) là một nhóm người đi đến một quốc gia khác để buôn bán bằng vốn hàng hóa, vì nó đi cùng với lợi ích.
Hitupadesādivasena paripāletabbo sāsitabbo so etassa atthīti satthā satthavāho niruttinayena.
He possesses that which is to be protected and guided through beneficial instruction, and so forth, hence satthā (teacher, caravan leader) by way of etymology.
Satthā (Bậc Đạo Sư), theo ngữ nguyên học, là satthavāha (người dẫn đầu đoàn lữ hành), vì Ngài có trách nhiệm bảo vệ và dạy dỗ thông qua những lời khuyên hữu ích, v.v.
So viya bhagavāti āha ‘‘satthā viyāti satthā, bhagavā satthavāho’’ti.
Just like him is the Blessed One, so it is said: ‘‘satthā viya satthā, bhagavā satthavāho’’ (A teacher is like a caravan leader; the Blessed One is a caravan leader).
Thế Tôn giống như người đó, nên Ngài nói: “Satthā viyāti satthā, Bhagavā satthavāho” (Satthā là như một người dẫn đường, Thế Tôn là người dẫn đầu đoàn lữ hành).
Idāni tamatthaṃ niddesapāḷinayena dassetuṃ ‘‘yathā satthavāho’’tiādi vuttaṃ.
Now, in order to show that meaning in the manner of the analytical Pāḷi, ‘‘yathā satthavāho’’tiādi (just as a caravan leader...) and so forth was stated.
Bây giờ, để chỉ rõ ý nghĩa đó theo cách của bản văn giải thích, Ngài đã nói “yathā satthavāho” (như người dẫn đầu đoàn lữ hành), v.v.
Tattha sattheti satthike jane.
There, satthe (in the caravan) means among the people of the caravan.
Trong đó, satthe (trong đoàn lữ hành) có nghĩa là trong những người thuộc đoàn lữ hành.
Kaṃ udakaṃ tārenti etthāti kantāro, nirudako araññappadeso.
Where do they cross the water (kaṃ udakaṃ tārenti)? Hence kantāro, a waterless forest region.
Kantāro (sa mạc) là nơi không có nước, một vùng rừng hoang, nơi người ta vượt qua nước.
Ruḷhīvasena pana itaropi araññappadeso tathā vuccati.
But conventionally, any other forest region is also so called.
Tuy nhiên, theo cách dùng thông thường, một vùng rừng hoang khác cũng được gọi như vậy.
Corakantāranti corehi adhiṭṭhitakantāraṃ, tathā vāḷakantāraṃ.
Corakantāraṃ (a wilderness of thieves) is a wilderness infested by thieves; similarly vāḷakantāraṃ (a wilderness of wild beasts).
Corakantāraṃ (sa mạc của cướp) là sa mạc bị cướp chiếm giữ, và tương tự là vāḷakantāraṃ (sa mạc của thú dữ).
Dubbhikkhakantāranti dullabhabhikkhaṃ kantāraṃ.
Dubbhikkhakantāraṃ (a wilderness of famine) is a wilderness where almsfood is difficult to obtain.
Dubbhikkhakantāraṃ (sa mạc đói kém) là sa mạc khan hiếm vật thực.
Tāretīti akhemantaṭṭhānaṃ atikkāmeti.
Tāretī (he crosses) means he causes them to pass beyond an unsafe place.
Tāretī (vượt qua) có nghĩa là vượt qua nơi không an toàn.
Uttāretītiādi upasaggena padaṃ vaḍḍhetvā vuttaṃ.
Uttāretītiādi (he brings across, etc.) is stated by augmenting the word with a prefix.
Uttāretī (đưa qua) v.v. được nói bằng cách thêm tiền tố vào từ.
Atha vā uttāretīti khemantabhūmiṃ upanento tāreti.
Alternatively, uttāretī means he causes them to cross by bringing them to a safe land.
Hoặc uttāretī có nghĩa là đưa qua bằng cách dẫn đến vùng an toàn.
Nittāretīti akhemantaṭṭhānato nikkhāmento tāreti.
Nittāretī means he causes them to cross by leading them out of an unsafe place.
Nittāretī (đưa ra khỏi) có nghĩa là đưa qua bằng cách đưa ra khỏi nơi không an toàn.
Patāretīti pariggahetvā tāreti, hatthena pariggahetvā tāreti viya tāretīti attho.
Patāretī means he causes them to cross by taking hold of them, as if he causes them to cross by taking them by the hand.
Patāretī (đưa qua bằng cách nắm giữ) có nghĩa là đưa qua bằng cách nắm giữ, như thể nắm tay đưa qua.
Sabbampetaṃ tāraṇuttāraṇādi khemaṭṭhāne ṭhapanamevāti āha ‘‘khemantabhūmiṃ sampāpetī’’ti.
All this crossing, bringing across, and so forth is simply establishing them in a safe place, so it is said: ‘‘khemantabhūmiṃ sampāpetī’’ (he brings them to a safe land).
Tất cả những điều này, như việc đưa qua, đưa ra khỏi, v.v., đều là việc đặt vào nơi an toàn, nên Ngài nói: “khemantabhūmiṃ sampāpetī” (đưa đến vùng an toàn).
Satteti veneyyasatte.
Satte (beings) refers to trainable beings.
Satte (chúng sanh) là những chúng sanh có thể được điều phục.
Mahāgahanatāya mahānatthatāya dunnittharatāya ca jātiyeva kantāro jātikantāro, taṃ jātikantāraṃ.
Existence itself is a wilderness, jātikantāro, because it is extremely dense, causes great misfortune, and is difficult to escape; that wilderness of existence.
Sự sinh ra chính là sa mạc jātikantāro (sa mạc của sự sinh), do sự hiểm trở lớn, sự bất lợi lớn và sự khó vượt qua; sa mạc của sự sinh đó.
Ukkaṭṭhaparicchedavasenāti ukkaṭṭhasattaparicchedavasena.
Ukkaṭṭhaparicchedavasenā (by way of defining the highest) means by way of defining the highest beings.
Ukkaṭṭhaparicchedavasena (theo cách phân loại chúng sanh ưu việt) có nghĩa là theo cách phân loại chúng sanh ưu việt.
Devamanussā eva hi ukkaṭṭhasattā, na tiracchānādayo.
For devas and humans are indeed the highest beings, not animals and so forth.
Quả thật, chư thiên và loài người là những chúng sanh ưu việt, chứ không phải các loài súc sanh, v.v.
Etanti ‘‘devamanussāna’’nti etaṃ vacanaṃ.
Etaṃ (this) refers to the statement ‘‘devamanussānaṃ’’ (of devas and humans).
Etaṃ (điều này) là lời nói “chư thiên và loài người”.
Bhabbapuggalaparicchedavasenāti sammattaniyāmokkamanassa yogyapuggalassa paricchindanavasena.
Bhabbapuggalaparicchedavasenā (by way of defining worthy individuals) means by way of defining individuals fit for progressing to definite rightness (sammattaniyāma).
Bhabbapuggalaparicchedavasena (theo cách phân loại những người có khả năng) có nghĩa là theo cách phân loại những người có khả năng đạt đến sự chắc chắn đúng đắn.
Bhagavatoti nissakke sāmivacanaṃ yathā ‘‘upajjhāyato ajjhetī’’ti.
Bhagavato is a possessive case in the sense of 'from', as in ‘‘upajjhāyato ajjhetī’’ (he studies from the preceptor).
Bhagavato (của Thế Tôn) là cách dùng sở hữu cách (sāmivacana) trong trường hợp sở hữu (nissakka), như trong câu “upajjhāyato ajjhetī” (học từ vị thầy tế độ).
Bhagavato santike vāti attho.
The meaning is 'from the presence of the Blessed One'.
Có nghĩa là ở nơi Thế Tôn.
Upanissayasampattinti tihetukapaṭisandhiādikaṃ maggaphalādhigamassa balavakāraṇaṃ.
Upanissayasampattiṃ (abundance of supporting conditions) means a strong cause for attaining the paths and fruits, such as rebirth with three roots (tihetuka-paṭisandhi).
Upanissayasampatti (sự thành tựu của duyên mạnh) là điều kiện mạnh mẽ để đạt được đạo quả, như sự tái sinh với ba nhân (tihetukapaṭisandhi), v.v.
Gaggarāyāti gaggarāya nāma rañño deviyā, tāya vā kāritattā ‘‘gaggarā’’ti laddhanāmāya.
Gaggarāyā (of Gaggarā) means of the queen named Gaggarā, or named ‘‘Gaggarā’’ because it was built by her.
Gaggarāyā (của Gaggarā) là của hoàng hậu tên Gaggarā, hoặc được đặt tên là “Gaggarā” vì được bà ấy xây dựng.
Sare nimittaṃ aggahesīti ‘‘dhammo eso vuccatī’’ti dhammasaññāya sare nimittaṃ gaṇhi, gaṇhanto ca pasannacitto parisapariyante nipajji.
Sare nimittaṃ aggahesī (he took a sign in the voice) means he took a sign in the voice with the perception of Dhamma, thinking, ‘‘This is Dhamma being spoken.’’ And as he took it, with a delighted mind, he lay down at the edge of the assembly.
Sare nimittaṃ aggahesī (ghi nhận dấu hiệu nơi âm thanh) có nghĩa là ghi nhận dấu hiệu nơi âm thanh với nhận thức về Pháp, rằng “đây là Pháp đang được thuyết giảng”. Khi ghi nhận, với tâm hoan hỷ, ông nằm xuống ở rìa hội chúng.
Sannirumbhitvā aṭṭhāsīti tassa sīse daṇḍassa ṭhapitabhāvaṃ apassanto tattha daṇḍaṃ uppīḷetvā aṭṭhāsi.
Sannirumbhitvā aṭṭhāsī (he stood pressing down) means, not seeing the stick placed on his head, he pressed the stick there and stood.
Sannirumbhitvā aṭṭhāsī (đứng yên không động) có nghĩa là không thấy cây gậy được đặt trên đầu ông, ông đã đứng yên bằng cách ấn cây gậy vào đó.
Maṇḍūkopi daṇḍe ṭhapitepi uppīḷitepi dhammagatena pasādena vissaramakarontova kālamakāsi.
Even with the stick placed and pressed upon, the frog made no discordant sound out of the delight in the Dhamma and passed away.
Dù cây gậy được đặt lên và bị ấn xuống, con ếch đã qua đời mà không phát ra tiếng động nào, với sự hoan hỷ do nghe Pháp.
Devaloke nibbattasattānaṃ ayaṃ dhammatā, yā ‘‘kutohaṃ idha nibbatto, tattha kinnu kho kammamakāsi’’nti āvajjanā.
This is the nature of beings reborn in the deva world, that is, the reflection, ‘‘Where have I been reborn here? What kamma did I perform there?’’
Đây là bản chất của những chúng sanh tái sinh ở cõi trời, đó là sự suy tư “tôi đã tái sinh ở đây từ đâu, tôi đã làm nghiệp gì ở đó?”.
Tasmā attano purimabhavassa diṭṭhattā āha ‘‘are ahampi nāma idha nibbatto’’ti.
Therefore, having seen his previous existence, he said: ‘‘Are ahampi nāma idha nibbatto’’ (Oh, I too have indeed been reborn here!).
Do đó, vì đã thấy kiếp trước của mình, ông nói: “are ahampi nāma idha nibbatto” (ồ, ta cũng đã tái sinh ở đây!).
Bhagavato pāde sirasā vandīti kataññutāsaṃvaḍḍhitena pemagāravabahumānena vandi.
He worshiped with love, reverence, and great respect, increased by gratitude, saying, " I worshiped the Blessed One's feet with my head."
Đảnh lễ chân Đức Thế Tôn nghĩa là đã đảnh lễ với lòng biết ơn, lòng yêu kính và sự tôn trọng lớn lao được tăng trưởng.
Jānantova pucchīti mahājanassa kammaphalaṃ buddhānubhāvañca paccakkhaṃ kātukāmo bhagavā ‘‘ko me vandatī’’ti gāthāya pucchi.
The Blessed One, desiring to make visible to the great multitude the results of kamma and the Buddha's power, asked with the verse, " Knowing, he asked, 'Who worships me?'"
Dù đã biết nhưng vẫn hỏi nghĩa là Đức Thế Tôn, vì muốn khiến cho quả của nghiệp và thần thông của chư Phật trở thành điều hiển nhiên đối với đại chúng, đã hỏi bằng câu kệ “Ai đảnh lễ ta?”.
Tattha (vi. va. aṭṭha. 857) koti devanāgayakkhagandhabbādīsu ko, katamoti attho.
Therein, " ko" means "who" among devas, nāgas, yakkhas, gandhabbas, and so on; that is, "which one?"
Trong đó, ko (ai) nghĩa là ai trong số chư thiên, long vương, dạ xoa, càn thát bà, v.v..., là loại nào.
Meti mama.
" Me" means "my."
Me (ta) nghĩa là của ta.
Pādānīti pāde.
" Pādāni" means "feet."
Pādāni (chân) nghĩa là đôi chân.
Iddhiyāti imāya evarūpāya deviddhiyā.
" Iddhiyā" means "by such divine power."
Iddhiyā (với thần thông) nghĩa là với thần thông chư thiên như thế này.
Yasasāti iminā edisena yasena ca parivārena ca.
" Yasasā" means "by such renown and entourage."
Yasasā (với uy tín) nghĩa là với uy tín và quyến thuộc như thế này.
Jalanti vijjotamāno.
" Jalaṃ" means "shining."
Jalaṃ (chói sáng) nghĩa là đang chiếu sáng.
Abhikkantenāti ativiya kantena kāmanīyena sundarena.
" Abhikkantenā" means "by one exceedingly charming, desirable, beautiful."
Abhikkantena (với vẻ đẹp tuyệt vời) nghĩa là với vẻ đẹp tuyệt vời, đáng mong muốn, thanh tú.
Vaṇṇenāti chavivaṇṇena sarīravaṇṇanibhāya.
" Vaṇṇenā" means "by skin complexion, by the luster of the body."
Vaṇṇena (với sắc thái) nghĩa là với sắc thái da thịt, với vẻ rạng rỡ của thân thể.
Sabbā obhāsayaṃ disāti sabbā dasapi disā pabhāsento, cando viya sūriyo viya ca ekobhāsaṃ ekālokaṃ karontoti attho.
" Sabbā obhāsayaṃ disā" means illuminating all ten directions; that is, making a single radiance, a single light, like the moon or the sun.
Sabbā obhāsayaṃ disā (chiếu sáng khắp mọi phương) nghĩa là chiếu sáng khắp mười phương, có nghĩa là làm cho một sự chiếu sáng, một ánh sáng, như mặt trăng và mặt trời.
Evaṃ pana bhagavatā pucchito devaputto attānaṃ pavedento ‘‘maṇḍūkohaṃ pure āsi’’nti gāthamāha.
Thus questioned by the Blessed One, the deva-son, revealing himself, recited the verse, " I was formerly a frog."
Khi được Đức Thế Tôn hỏi như vậy, vị thiên tử đã tự giới thiệu mình và nói câu kệ “Trước đây ta là một con ếch”.
Tattha pureti purimajātiyaṃ.
Therein, " pure" means "in a former birth."
Trong đó, pure (trước đây) nghĩa là trong kiếp trước.
Udaketi idaṃ tadā attano uppattiṭṭhānadassanaṃ.
" Udake" – this indicates his place of origin at that time.
Udake (trong nước) đây là sự chỉ ra nơi sinh ra của mình vào lúc đó.
Udake maṇḍūkoti tena uddhumāyikādikassa thale maṇḍūkassa nivattanaṃ kataṃ hoti.
" Udake maṇḍūko" thus excludes a frog on land, such as an uddhumāyika (a bloated frog).
Udake maṇḍūko (con ếch trong nước) nghĩa là đã loại trừ con ếch trên cạn, chẳng hạn như con ếch bị sưng phù.
Gāvo caranti etthāti gocaro, gunnaṃ ghāsesanaṭṭhānaṃ.
"Gocaro" is where cows graze, the place where cattle seek food.
Nơi mà bò ăn cỏ được gọi là gocaro (bãi chăn thả), là nơi bò tìm cỏ.
Idha pana gocaro viyāti gocaro, vāri udakaṃ gocaro etassāti vārigocaro.
Here, however, "gocaro" means "like a pasture"; " vārigocaro" means "water is its pasture."
Ở đây, gocaro (bãi chăn thả) cũng giống như gocaro, vārigocaro (sinh vật sống dưới nước) là sinh vật có nước (vāri) làm bãi chăn thả (gocaro).
Udakacārīpi hi koci kacchapādi avārigocaropi hotīti ‘‘vārigocaro’’ti visesetvā vuttaṃ.
Some aquatic creatures, like turtles, can also be non-aquatic, so it is specified as " vārigocaro" to differentiate.
Ngay cả một số loài sống dưới nước như rùa, v.v..., cũng không phải là vārigocaro, vì vậy đã được đặc biệt nói là “vārigocaro”.
Tava dhammaṃ suṇantassāti brahmassarena karavīkarutamañjunā desentassa tava dhammaṃ ‘‘dhammo eso vuccatī’’ti sare nimittaggāhavasena suṇantassa.
" Tava dhammaṃ suṇantassā" means while listening to your Dhamma, which you teach with a Brahma-like voice, a pleasant karavīka-bird-like sound, understanding the teaching as "this is Dhamma" by grasping the sign in the sound.
Tava dhammaṃ suṇantassa (khi nghe Pháp của Ngài) nghĩa là khi nghe Pháp của Ngài được thuyết giảng bằng giọng Phạm âm, tiếng chim karavīka du dương, có nghĩa là nghe theo sự nắm bắt dấu hiệu của âm thanh, “Pháp này đang được nói đến”.
Anādare cetaṃ sāmivacanaṃ.
And this genitive case is used in the sense of disregard.
Và đây là sāmivacana (cách nói sở hữu) trong trường hợp không quan tâm.
Avadhī vacchapālakoti vacche rakkhanto gopālakadārako mama samīpaṃ āgantvā daṇḍamolubbha tiṭṭhanto mama sīse daṇḍaṃ sannirumbhitvā maṃ māresīti attho.
" Avadhī vacchapālako" means that the cowherd boy, while tending calves, came near me, stood leaning on a stick, pressed the stick onto my head, and killed me.
Avadhī vacchapālako (người chăn bò đã giết) nghĩa là người chăn bò, khi đang chăn bò, đã đến gần ta, đứng dựa vào gậy và dùng gậy đập vào đầu ta, giết chết ta.
Yaṃ pana kiñcīti ettha yanti aniyamitavacanaṃ, tathā kiñcīti.
In " yaṃ pana kiñcī," " yaṃ" is an unspecified term, as is " kiñcī."
Nói hai câu kệ này xong, Ngài rời đi.
Panāti vacanālaṅkāramattaṃ.
" Pana" is merely an ornamental particle of speech.
Trong yaṃ pana kiñcī (bất cứ điều gì), yaṃ là lời nói không xác định, và kiñcī cũng vậy.
Tasmā yaṃ kiñcīti ñeyyassa anavasesapariyādānaṃ kataṃ hoti.
Therefore, "yaṃ kiñcī" means the complete, exhaustive comprehension of all that is knowable.
Pana chỉ là một từ trang sức cho câu nói.
Panāti vā visesatthadīpako nipāto.
Or, " Pana" is an indeclinable particle indicating a special meaning.
Do đó, yaṃ kiñcī (bất cứ điều gì) có nghĩa là đã bao trùm tất cả những gì cần biết mà không bỏ sót.
Tena ‘‘sammāsambuddho’’ti iminā saṅkhepato vitthārato ca satthu catusaccābhisambodho vutto.
By this, the omniscience of the Teacher regarding the Four Noble Truths, expressed concisely and extensively, is referred to as "Sammāsambuddho."
Hoặc pana là một tiểu từ chỉ rõ ý nghĩa đặc biệt.
Buddhoti pana iminā tadaññassapi ñeyyassa avabodho.
But by " Buddho," the comprehension of other knowable things is also implied.
Với điều đó, sự giác ngộ Tứ Thánh Đế của Bậc Đạo Sư, một cách tóm tắt và chi tiết, đã được nói đến bằng từ “Sammāsambuddho” (Chánh Đẳng Giác).
Purimena vā satthu paṭivedhañāṇānubhāvo, pacchimena desanāñāṇānubhāvo.
Or, the former refers to the Teacher's penetrative knowledge and power, and the latter to his teaching knowledge and power.
Còn với từ Buddho (Phật), là sự giác ngộ về những điều cần biết khác.
Pī-ti upari vuccamāno viseso jotīyati.
The particle " pi" illuminates the distinction mentioned above.
Hoặc với từ trước là oai lực của trí tuệ chứng ngộ của Bậc Đạo Sư, với từ sau là oai lực của trí tuệ thuyết pháp.
Vimokkhantikañāṇavasenāti ettha sabbaso paṭipakkhehi vimuccatīti vimokkho, aggamaggo, tassa anto, aggaphalaṃ, tasmiṃ laddhe laddhabbato tattha bhavaṃ vimokkhantikaṃ, ñāṇaṃ sabbaññutaññāṇena saddhiṃ sabbampi buddhañāṇaṃ.
In " vimokkhantikañāṇavasena," "vimokkho" refers to liberation from all opposing forces, the highest path. Its "anto" (end) is the highest fruition. Because it is attained when that fruition is achieved, it is " vimokkhantikaṃ." " ñāṇaṃ" means all Buddha-knowledge, including omniscience.
Pī (cũng) làm sáng tỏ sự đặc biệt sẽ được nói ở trên.
‘‘Sabbaññutāya buddho, sabbadassāvitāya buddho, anaññaneyyatāya buddho, visavitāya buddho, khīṇāsavasaṅkhātena buddho, nirupalepasaṅkhātena buddho, ekantavītarāgoti buddho, ekantavītadosoti buddho, ekantavītamohoti buddho, ekantanikkilesoti buddho, ekāyanamaggaṃ gatoti buddho, eko anuttaraṃ sammāsambodhiṃ abhisambuddhoti buddho, abuddhivihatattā buddhipaṭilābhā buddho.
"Buddha" by omniscience, "Buddha" by seeing all, "Buddha" by not being led by another, "Buddha" by developing, "Buddha" by being one whose defilements are destroyed, "Buddha" by being one who is unblemished, "Buddha" by being one utterly free from passion, "Buddha" by being one utterly free from hatred, "Buddha" by being one utterly free from delusion, "Buddha" by being one utterly free from defilements, "Buddha" by having gone on the one-way path, "Buddha" by having fully awakened to the unsurpassed perfect awakening alone, "Buddha" by having attained wisdom through the removal of ignorance.
Trong evaṃ pavatto (diễn ra như vậy) –
Buddhoti netaṃ nāmaṃ mātarā kataṃ, na pitarā kataṃ, na bhātarā kataṃ, na bhaginiyā kataṃ, na mittāmaccehi kataṃ, na ñātisālohitehi kataṃ, na samaṇabrāhmaṇehi kataṃ, na devatāhi kataṃ, vimokkhantikametaṃ buddhānaṃ bhagavantānaṃ bodhiyā mūle saha sabbaññutaññāṇassa paṭilābhā sacchikā paññatti yadidaṃ buddho’’ti (mahāni. 192) –
"Buddha"—this is not a name given by a mother, nor by a father, nor by a brother, nor by a sister, nor by friends and acquaintances, nor by relatives by blood, nor by ascetics and brahmins, nor by devas. This is a true designation of the Buddhas, the Blessed Ones, an ultimate liberation term, when omniscience is attained at the foot of the Bodhi tree.
“Là Phật do sự Toàn Giác, là Phật do sự Toàn Tri, là Phật do không cần ai dẫn dắt, là Phật do sự phát triển, là Phật do sự đoạn tận các lậu hoặc, là Phật do sự không nhiễm ô, là Phật do hoàn toàn ly tham, là Phật do hoàn toàn ly sân, là Phật do hoàn toàn ly si, là Phật do hoàn toàn không phiền não, là Phật do đã đi trên con đường độc nhất, là Phật do một mình đã giác ngộ Vô Thượng Chánh Đẳng Giác, là Phật do sự đoạn trừ vô minh và sự thành tựu trí tuệ. Phật không phải là cái tên do mẹ đặt, không phải do cha đặt, không phải do anh em đặt, không phải do chị em đặt, không phải do bạn bè thân hữu đặt, không phải do bà con dòng họ đặt, không phải do các sa môn, bà la môn đặt, không phải do chư thiên đặt, đó là một danh xưng chân thật của chư Phật, chư Thế Tôn, được thành tựu tại cội Bồ Đề cùng với sự thành tựu trí tuệ Toàn Giác, đó chính là Phật.” (Mahāni. 192) –
Tattha (paṭi. ma. aṭṭha. 2.1.162; mahāni. aṭṭha. 192) yathā loke avagantā ‘‘avagato’’ti vuccati, evaṃ bujjhitā saccānīti buddho suddhakattuvasena.
Therein, just as one who comprehends is called "comprehended" in the world, so " bujjhitā saccānīti buddho" means "Buddha" because he has comprehended the truths, based on the agent.
Trong đó (Paṭi. Ma. Aṭṭha. 2.1.162; Mahāni. Aṭṭha. 192), giống như trong đời, người hiểu biết được gọi là “avagato” (đã hiểu), tương tự, bujjhitā saccānīti buddho (người đã giác ngộ các sự thật nên là Phật) là ý nghĩa thuần túy.
Yathā paṇṇasosā vātā ‘‘paṇṇasusā’’ti vuccanti, evaṃ bodhetā pajāyāti buddho hetukattuvasena.
Just as withered leaves are called "withered by wind," so " bodhetā pajāyāti buddho" means "Buddha" because he causes beings to awaken, based on the cause.
Giống như lá khô bị gió thổi được gọi là “paṇṇasusā” (lá khô), tương tự, bodhetā pajāyāti buddho (người làm cho chúng sinh giác ngộ nên là Phật) là ý nghĩa nhân quả.
Hetuattho cettha antonīto.
The causal sense is implicitly contained here.
Ở đây, ý nghĩa nhân quả được ngụ ý.
Sabbaññutāya buddhoti sabbadhammabujjhanasamatthāya buddhiyā buddhoti attho.
" Sabbaññutāya buddho" means "Buddha" by virtue of his wisdom capable of comprehending all phenomena.
Sabbaññutāya buddho (là Phật do sự Toàn Giác) nghĩa là là Phật do trí tuệ có khả năng giác ngộ tất cả các pháp.
Sabbadassāvitāya buddhoti sabbadhammabodhanasamatthāya buddhiyā buddhoti attho.
" Sabbadassāvitāya buddho" means "Buddha" by virtue of his wisdom capable of knowing all phenomena.
Sabbadassāvitāya buddho (là Phật do sự Toàn Tri) nghĩa là là Phật do trí tuệ có khả năng làm cho tất cả các pháp được giác ngộ.
Anaññaneyyatāya buddhoti aññena abodhito sayameva buddhattā buddhoti attho.
" Anaññaneyyatāya buddho" means "Buddha" because he awoke by himself, not taught by another.
Anaññaneyyatāya buddho (là Phật do không cần ai dẫn dắt) nghĩa là là Phật do tự mình giác ngộ mà không cần người khác làm cho giác ngộ.
Visavitāya buddhoti nānāguṇavisavanato padumamiva vikasanaṭṭhena buddhoti attho.
" Visavitāya buddho" means "Buddha" in the sense of blooming like a lotus due to the blossoming of various qualities.
Visavitāya buddho (là Phật do sự phát triển) nghĩa là là Phật do sự phát triển các phẩm chất khác nhau, giống như hoa sen nở rộ.
Khīṇāsavasaṅkhātena buddhoti evamādīhi chahi padehi cittasaṅkocakaradhammappahānena niddākkhayavibuddho puriso viya sabbakilesaniddākkhayavibuddhattā buddhoti vuttaṃ hoti.
" Khīṇāsavasaṅkhātena buddho" means that by these six terms, he is called "Buddha" because, like a person awakened from sleep through the abandonment of mind-constricting defilements, he is fully awakened from the sleep of all defilements.
Khīṇāsavasaṅkhātena buddho (là Phật do sự đoạn tận các lậu hoặc) và sáu từ khác như vậy có nghĩa là là Phật do đã hoàn toàn giác ngộ khỏi tất cả các phiền não ngủ ngầm, giống như một người đã hoàn toàn tỉnh giấc khỏi giấc ngủ do sự đoạn trừ các pháp gây co rút tâm.
Tattha saṅkhā saṅkhātanti atthato ekattā saṅkhātenāti vacanassa koṭṭhāsenāti attho.
Therein, "saṅkhā" and "saṅkhātaṃ" are essentially one; so " saṅkhātena" means "by a part of speech."
Trong đó, saṅkhā và saṅkhāta có cùng ý nghĩa, nên saṅkhātena có nghĩa là một phần.
Taṇhālepadiṭṭhilepābhāvena nirupalepasaṅkhātena.
" Nirupalepasaṅkhātena" refers to being unblemished due to the absence of the stains of craving and wrong views.
Nirupalepasaṅkhātena (do sự không nhiễm ô) là do không có sự nhiễm ô của tham ái và tà kiến.
Savāsanānaṃ sabbakilesānaṃ pahīnattā ekantavacaneneva visesetvā ‘‘ekantavītarāgo’’tiādi vuttaṃ.
Because all defilements, along with their latent tendencies (vāsanā), have been abandoned, it is specifically stated with the term expressing absoluteness, such as " ekantavītarāgo" (utterly free from passion).
Do tất cả các phiền não cùng với khuynh hướng tiềm ẩn đã được đoạn trừ, nên đã được đặc biệt nói là “ekantavītarāgo” (hoàn toàn ly tham), v.v..., bằng cách sử dụng từ “hoàn toàn”.
Ekantanikkilesoti rāgadosamohāvasesehi sabbakilesehi nikkileso.
" Ekantanikkileso" means utterly free from defilements, from the remaining defilements of passion, hatred, and delusion.
Ekantanikkileso (hoàn toàn không phiền não) là không có phiền não với tất cả các phiền não còn lại như tham, sân, si.
Ekāyanamaggaṃ gatoti buddhoti gamanatthānaṃ buddhiatthatā viya buddhiatthānampi gamanatthatā labbhatīti ekāyanamaggaṃ gatattā buddhoti vuccatīti attho.
" Ekāyanamaggaṃ gatoti buddho" means just as the meaning of going is obtained for the meaning of wisdom, so too the meaning of going is obtained for the meaning of the place of wisdom; thus, he is called "Buddha" because he has gone on the one-way path.
Ekāyanamaggaṃ gatoti buddho (là Phật do đã đi trên con đường độc nhất) nghĩa là giống như ý nghĩa của sự đi lại có được từ ý nghĩa của trí tuệ, ý nghĩa của sự đi lại cũng có được từ ý nghĩa của trí tuệ, do đó được gọi là Phật vì đã đi trên con đường độc nhất.
Eko anuttaraṃ sammāsambodhiṃ abhisambuddhoti buddhoti na parehi buddhattā buddho, atha kho sayameva anuttaraṃ sammāsambodhiṃ abhisambuddhattā buddhoti attho.
" Eko anuttaraṃ sammāsambodhiṃ abhisambuddhoti buddho" means he is "Buddha" not because he was enlightened by others, but because he himself was fully enlightened to the unsurpassed perfect awakening.
Eko anuttaraṃ sammāsambodhiṃ abhisambuddhoti buddho (là Phật do một mình đã giác ngộ Vô Thượng Chánh Đẳng Giác) nghĩa là không phải là Phật do người khác làm cho giác ngộ, mà là Phật do tự mình đã giác ngộ Vô Thượng Chánh Đẳng Giác.
Abuddhivihatattā buddhipaṭilābhā buddhoti buddhi buddhaṃ bodhoti anatthantaraṃ.
The term "Buddha" signifies one who has attained wisdom due to the eradication of ignorance; "wisdom illuminates a Buddha" means there is no difference in meaning.
Vì đã tiêu diệt vô minh và chứng đắc trí tuệ, nên là bậc Giác ngộ (Buddha) – "buddhi" (trí tuệ) và "buddhaṃ bodhoti" (làm cho giác ngộ) không khác nghĩa.
Tattha yathā rattaguṇayogato ratto paṭo, evaṃ buddhaguṇayogato buddhoti ñāpanatthaṃ vuttaṃ.
There, it is stated to make it known that just as a cloth is called red due to its redness, so too is one called a Buddha due to possessing the qualities of a Buddha.
Ở đây, giống như một tấm vải đỏ vì có thuộc tính màu đỏ, thì bậc Giác ngộ (Buddha) được nói là như vậy vì có thuộc tính giác ngộ, để làm rõ điều đó.
Tato paraṃ buddhoti netaṃ nāmantiādi atthānugatāyaṃ paññattīti bodhanatthaṃ vuttanti evamettha imināpi kāraṇena bhagavā buddhoti veditabbo.
Furthermore, "Buddha is not merely a name," but a designation (paññatti) that conforms to reality, it is stated to make this known. Thus, for this reason too, the Blessed One (Bhagavā) should be understood as a Buddha.
Hơn nữa, "Buddha không phải là một tên gọi" v.v... được nói để cho biết rằng đây là một sự chế định (paññatti) phù hợp với ý nghĩa. Do đó, vì lý do này, Đức Thế Tôn cũng được gọi là Buddha.
Idāni bhagavāti imassa atthaṃ dassento āha ‘‘bhagavāti idaṃ panassā’’tiādi.
Now, explaining the meaning of Bhagavā, it is said, "This, moreover, is his 'Bhagavā'" and so on.
Bây giờ, để chỉ rõ ý nghĩa của từ Bhagavā (Thế Tôn), Luận sư nói: "Bhagavā là tên gọi này của Ngài" v.v...
Tattha assāti bhagavato.
There, "assā" means of the Blessed One.
Ở đây, assā nghĩa là của Đức Thế Tôn.
Guṇavisiṭṭhasattuttamagarugāravādhivacananti sabbehi sīlādiguṇehi visiṭṭhassa tato eva sabbasattehi uttamassa garuno gāravavasena vuccamānavacanametaṃ bhagavāti.
"Guṇavisiṭṭhasattuttamagarugāravādhivacanaṃ" means this word "Bhagavā" is spoken out of respect for him who is superior with all qualities like sīla, and therefore supreme among all beings, and worthy of veneration.
Guṇavisiṭṭhasattuttamagarugāravādhivacana (tên gọi tôn kính bậc tối thượng trong các chúng sanh, người có các đức tính thù thắng) – đây là tên gọi Bhagāvā, được xưng tụng với lòng tôn kính đối với bậc tối thượng trong tất cả chúng sanh, vì Ngài thù thắng với tất cả các đức tính như giới v.v... và vì lẽ đó, Ngài đáng được tôn kính.
Tathā hi lokanātho aparimitanirupamappabhāvasīlādiguṇavisesasamaṅgitāya sabbānatthaparihārapubbaṅgamāya niravasesahitasukhavidhānatapparāya niratisayāya payogasampattiyā sadevamanussāya pajāya accantupakāritāya ca aparimāṇāsu lokadhātūsu aparimāṇānaṃ sattānaṃ uttamaṃ gāravaṭṭhānanti.
Indeed, the Protector of the World, being endowed with immeasurable and incomparable special qualities like power and sīla, and being intent on providing complete well-being and happiness, preceded by the prevention of all harm, and due to his exceedingly beneficial actions for the world with its devas and humans, is the supreme object of veneration for immeasurable beings in immeasurable world-systems.
Thật vậy, bậc Lãnh đạo thế gian (Lokanātha) là đối tượng tôn kính tối thượng của vô số chúng sanh trong vô số thế giới, vì Ngài sở hữu những đức tính thù thắng như giới v.v... với năng lực vô song và vô hạn, vì Ngài luôn tận tâm mang lại lợi ích và hạnh phúc vô biên, đi trước mọi sự loại bỏ bất lợi, và vì Ngài đã mang lại lợi ích to lớn cho chúng sanh cả cõi trời và loài người.
Bhagavāti vacanaṃ seṭṭhanti seṭṭhavācakaṃ vacanaṃ seṭṭhaguṇasahacaraṇato ‘‘seṭṭha’’nti vuttaṃ.
"Bhagavā is the best word" means the word signifying "best" is called "best" due to its association with excellent qualities.
Bhagavāti vacanaṃ seṭṭha (Lời Bhagāvā là tối thượng) – lời nói chỉ về điều tối thượng được gọi là "tối thượng" vì nó đi kèm với những đức tính tối thượng.
Atha vā vuccatīti vacanaṃ, attho, tasmā yo ‘‘bhagavā’’ti vacanena vacanīyo attho, so seṭṭhoti attho.
Alternatively, "vacanaṃ" means meaning, that which is spoken; therefore, the meaning which is to be expressed by the word "Bhagavā" is supreme—that is the meaning.
Hoặc, "vacana" là điều được nói, là ý nghĩa; do đó, ý nghĩa được nói bằng từ "Bhagavā" là tối thượng.
Bhagavāti vacanamuttamanti etthāpi eseva nayo.
The same principle applies to "Bhagavā is the excellent word".
Bhagavāti vacanamuttama (Lời Bhagāvā là tối thượng nhất) – ở đây cũng áp dụng nguyên tắc tương tự.
Gāravayuttoti garubhāvayutto garuguṇayogato.
"Gāravayutto" means endowed with venerableness, due to possessing venerable qualities.
Gāravayutto (đáng được tôn kính) – có phẩm chất đáng kính, vì có những đức tính đáng kính.
Garukaraṇaṃ vā sātisayaṃ arahatīti gāravayutto, gāravārahoti attho.
Or, it means "gāravayutto" because he is highly worthy of reverence; that is, he is worthy of respect.
Hoặc, Ngài xứng đáng được tôn kính đặc biệt, nên được gọi là gāravayutto, nghĩa là đáng được tôn kính.
‘‘Sippādisikkhāpakā garū honti, na ca gāravayuttā, ayaṃ pana tādiso na hoti, tasmā ‘garū’ti vatvā ‘gāravayutto’ti vutta’’nti keci.
Some say, "Teachers of skills and so on are 'garu' (revered), but they are not 'gāravayutta' (endowed with reverence); but he is not like that, therefore, having said 'garu', it is added 'gāravayutto'."
Một số người nói: "Những người dạy nghề v.v... là thầy (garu), nhưng không phải là gāravayutto (đáng được tôn kính). Tuy nhiên, vị này không phải như vậy, do đó, sau khi nói 'garu' (thầy), lại nói 'gāravayutto' (đáng được tôn kính)."
Guṇavisesahetukaṃ ‘‘bhagavā’’ti idaṃ bhagavato nāmanti saṅkhepato vuttamatthaṃ vitthārato vibhajitukāmo nāmaṃyeva tāva atthuddhāravasena dassento ‘‘catubbidhañhi nāma’’ntiādimāha.
Desiring to elaborate in detail the meaning briefly stated that the name "Bhagavā" is due to special qualities, he first presents the name in terms of its various meanings, saying, "Indeed, there are four kinds of names" and so on.
Để giải thích chi tiết ý nghĩa đã được trình bày tóm tắt rằng tên gọi "Bhagavā" của Đức Thế Tôn là do những đức tính thù thắng, Luận sư bắt đầu bằng cách trình bày ý nghĩa của tên gọi đó: "Tên gọi có bốn loại" v.v...
Tattha āvatthikanti avatthāya viditaṃ taṃ taṃ avatthaṃ upādāya paññattaṃ voharitaṃ.
There, "āvatthikaṃ" means known by circumstance, designated or called by reason of that particular circumstance.
Ở đây, āvatthika (tên gọi theo trạng thái) – được biết theo trạng thái, được chế định và sử dụng tùy theo trạng thái đó.
Tathā liṅgikaṃ tena tena liṅgena voharitaṃ.
Similarly, "liṅgikaṃ" means called by that particular sign.
Tương tự, liṅgika (tên gọi theo dấu hiệu) – được sử dụng theo dấu hiệu đó.
Nemittikanti nimittato āgataṃ.
"Nemittikaṃ" means derived from a cause or sign.
Nemittika (tên gọi theo điềm báo) – xuất phát từ điềm báo.
Adhiccasamuppannanti yadicchāya pavattaṃ, yadicchāya āgataṃ yadicchakaṃ.
"Adhiccasamuppannaṃ" means arisen by chance, that which comes by chance, accidental.
Adhiccasamuppanna (tên gọi ngẫu nhiên) – phát sinh ngẫu nhiên, xuất hiện ngẫu nhiên, tùy ý.
Idāni āvatthikādīni nāmāni sarūpato dassento āha ‘‘tattha vaccho dammo balibaddo’’tiādi.
Now, showing the nature of the names such as āvatthika, it is said, "There, 'calf', 'tamed', 'ox'" and so on.
Bây giờ, để trình bày các tên gọi theo trạng thái v.v... theo bản chất của chúng, Luận sư nói: "Trong đó, bê con, bò tơ, bò đực" v.v...
Tattha paṭhamena ādi-saddena bālo yuvā vuḍḍhoti evamādiṃ saṅgaṇhāti, dutiyena muṇḍī jaṭīti evamādiṃ, tatiyena bahussuto dhammakathiko jhāyīti evamādiṃ, catutthena aghapadīpanaṃ pāvacananti evamādiṃ saṅgaṇhāti.
There, the first word "ādi" (and so on) includes "child, youth, elder," and so forth; the second includes "shaven-headed, matted-haired," and so forth; the third includes "learned, Dhamma preacher, meditator," and so forth; the fourth includes "Pāvacana (scripture) that illuminates difficult points," and so forth.
Ở đây, từ ādi (v.v...) thứ nhất bao gồm các trường hợp như trẻ con, thanh niên, người già v.v...; từ thứ hai bao gồm các trường hợp như đầu trọc, tóc bện v.v...; từ thứ ba bao gồm các trường hợp như đa văn, thuyết pháp, thiền giả v.v...; từ thứ tư bao gồm các trường hợp như "lời dạy làm sáng tỏ những điều khó hiểu" v.v...
Nemittikanti vuttamatthaṃ byatirekavasena patiṭṭhāpetuṃ ‘‘na mahāmāyāyā’’tiādi vuttaṃ.
To establish the meaning of "Nemittikaṃ" through contrast, "not by Mahāmāyā" and so on is stated.
Để xác lập ý nghĩa đã nói là nemittika (tên gọi theo điềm báo) theo cách loại trừ, Luận sư nói: "Không phải do Đại Ma-da" v.v...
Vimokkhantikanti iminā pana idaṃ nāmaṃ ariyāya jātiyā jātakkhaṇeyeva jātanti dasseti.
By "Vimokkhantikaṃ," it shows that this name arose at the very moment of birth in the noble lineage.
Với từ vimokkhantika (kết thúc bằng sự giải thoát) này, Luận sư chỉ ra rằng tên gọi này xuất hiện ngay vào khoảnh khắc sinh ra với dòng dõi Thánh.
Yadi vimokkhantikaṃ, atha kasmā aññehi khīṇāsavehi asādhāraṇanti āha ‘‘saha sabbaññutaññāṇassa paṭilābhā’’ti.
If it is "Vimokkhantikaṃ," then why is it not shared with other Arahants (khīṇāsava)? He replies, "simultaneous with the attainment of Omniscience."
Nếu là vimokkhantika, vậy tại sao nó không phải là của chung với các vị A-la-hán khác? Luận sư nói: "cùng với sự chứng đắc Nhất thiết trí".
Buddhānañhi arahattaphalaṃ nipphajjamānaṃ sabbaññutaññāṇādīhi sabbehi buddhaguṇehi saddhiṃyeva nipphajjati.
For Buddhas, the fruition of Arahantship arises simultaneously with all the qualities of a Buddha, such as Omniscience.
Quả vị A-la-hán của chư Phật thành tựu cùng với tất cả các đức tính Phật như Nhất thiết trí v.v...
Tena vuttaṃ ‘‘vimokkhantika’’nti.
Therefore, it is called "vimokkhantikaṃ."
Do đó, được nói là "vimokkhantika".
Sacchikā paññattīti sabbadhammānaṃ sacchikiriyāya nimittā paññatti.
"Sacchikā paññattī" means a designation that serves as a sign for the direct realization of all phenomena.
Sacchikā paññattī (sự chế định có thật) – là sự chế định có dấu hiệu của sự chứng ngộ tất cả các pháp.
Atha vā sacchikā paññattīti paccakkhasiddhā paññatti.
Alternatively, "sacchikā paññattī" means a designation verified by direct perception.
Hoặc, sacchikā paññattī là sự chế định đã được chứng minh trực tiếp.
Yaṃguṇanimittā hi sā, te satthu paccakkhabhūtā, taṃguṇā viya sāpi sacchikatā eva nāma hoti, na paresaṃ vohāramattenāti adhippāyo.
The intent is that the qualities for which it is a designation are directly perceived by the Master; like those qualities, the designation itself is also realized, not merely by the usage of others.
Ý nghĩa là: những đức tính mà sự chế định đó dựa vào, chúng là hiện tiền đối với Đức Đạo Sư; giống như những đức tính đó, sự chế định đó cũng thực sự được chứng ngộ, không chỉ là sự sử dụng của người khác.
Vadantīti mahātherassa garubhāvato bahuvacanenāha, saṅgītikārehi vā katamanuvādaṃ sandhāya.
"Vadantī" (they say) is in the plural due to the venerable status of the Mahāthera, or it refers to the recitation made by the compilers of the Sangīti (councils).
Vadantī (họ nói) – Luận sư dùng số nhiều vì sự tôn kính đối với Đại Trưởng lão, hoặc liên quan đến lời tụng đã được các vị Kết tập kinh điển thực hiện.
Issariyādibhedo bhago assa atthīti bhagī.
One who possesses "bhaga," which refers to sovereignty and so on, is bhagī.
Vì có phần (bhaga) của quyền lực v.v... nên là Bhagī.
Maggaphalādiariyadhammaratanaṃ araññavanapatthāni pantāni senāsanāni appasaddādiguṇayuttāni bhaji sevi sīlenāti bhajī, bhajanasīloti attho.
One who resorted to and practiced (bhaji sevi) the noble Dhamma gems such as the path and fruition, and secluded abodes in forests, wildernesses, and isolated places, endowed with qualities like quietude, through sīla, is bhajī; meaning, one who is accustomed to practice.
Vì Ngài đã thực hành (bhaji), đã sống theo những pháp bảo Thánh như đạo quả, những nơi cư ngụ hẻo lánh trong rừng núi, những nơi yên tĩnh, ít tiếng ồn, vắng vẻ, thích hợp cho sự độc cư, nên là Bhajī, nghĩa là có thói quen thực hành.
Bhāgīti cīvarapiṇḍapātādīnaṃ catunnaṃ paccayānañceva atthadhammavimuttirasassa ca adhisīlādīnañca bhāgīti attho.
"Bhāgī" means one who partakes of the four requisites such as robes and almsfood, and the essence of Dhamma, Vimutti, and adhisīla and so on.
Bhāgī (người thụ hưởng) – nghĩa là người thụ hưởng bốn vật dụng như y, bát, v.v... và hương vị giải thoát của Pháp, và các pháp Tăng thượng giới v.v...
Vibhaji pavibhaji dhammaratananti vibhattavā.
One who distributed and widely distributed the gem of Dhamma is vibhattavā.
Vì Ngài đã phân chia, đã phân bố Pháp bảo, nên là Vibhattavā.
Akāsi bhagganti rāgādipāpadhammaṃ bhaggaṃ akāsīti bhagavāti attho.
"Akāsi bhaggaṃ" means one who shattered (bhaggaṃ akāsi) evil defilements like greed; that is the meaning of Bhagavā.
Akāsi bhagga (đã phá hủy) – nghĩa là đã phá hủy các pháp ác như tham ái v.v... nên là Bhagavā.
Garupi loke bhagavāti vuccatīti āha ‘‘garū’’ti.
It is said "garu" because a revered one is also called Bhagavā in the world.
Vì bậc đáng kính (garu) cũng được gọi là Bhagavā trong thế gian, nên Luận sư nói "garu".
Yasmā garu, tasmāpi bhagavāti vuttaṃ hoti.
Since he is revered, he is therefore called Bhagavā.
Vì là bậc đáng kính, nên cũng được gọi là Bhagavā.
Hetuattho hi iti-saddo.
The word "iti" here indicates a reason.
Từ iti (vì vậy) có ý nghĩa là nguyên nhân.
So ca yattha iti-saddo natthi bhagītiādīsu, tattha paccekaṃ yojetabbo.
And this should be applied to each term individually, even where "iti" is not explicitly present, as in "bhagī" and so on.
Và nó phải được gắn với từng từ riêng lẻ ở những chỗ không có từ iti, như trong Bhagī v.v...
Bhāgyamassa atthīti bhāgyavā.
One who has good fortune is bhāgyavā.
Vì có phước báu (bhāgya), nên là Bhāgyavā.
Bahūhi ñāyehīti kāyabhāvanādikehi anekehi bhāvanākkamehi.
"Bahūhi ñāyehī" means by many methods, such as the various sequences of development of the body.
Bahūhi ñāyehī (bằng nhiều phương pháp) – bằng nhiều cách tu tập như tu tập thân v.v...
Subhāvitattanoti sammadeva bhāvitasabhāvassa.
"Subhāvitattano" means of one whose nature is well-developed.
Subhāvitattano (người có tự tánh được tu tập tốt đẹp) – người có tự tánh đã được tu tập một cách hoàn hảo.
Paccatte cetaṃ sāmivacanaṃ, tena subhāvitattāti vuttaṃ hoti, subhāvitasabhāvoti attho.
This is a genitive case in the sense of "paccatta" (own self), so it means "subhāvitattā"; the meaning is "of one whose nature is well-developed."
Và đây là cách nói sở hữu cách (sāmivacana) trong nghĩa "riêng biệt", do đó được nói là subhāvitattā, nghĩa là người có tự tánh được tu tập tốt đẹp.
Mahāgaṇṭhipade pana ‘‘subhāvitattano subhāvitakāyo’’ti vuttaṃ.
In the Mahāgaṇṭhipada, however, it is stated, "subhāvitattano subhāvitakāyo" (of one whose self is well-developed, whose body is well-developed).
Tuy nhiên, trong Mahāgaṇṭhipada, được nói là "subhāvitattano subhāvitakāyo" (thân thể của người có tự tánh được tu tập tốt đẹp).
Bhavānaṃ antaṃ nibbānaṃ gatoti bhavantago.
One who has reached Nibbāna, the end of existences, is bhavantago.
Vì đã đi đến tận cùng của các cõi hữu (bhava), tức là Niết bàn, nên là Bhavantago.
‘‘Bhagavāti gāravādhivacanametaṃ.
"Bhagavā: this is a term of reverence.
"Bhagavā là tên gọi tôn kính này.
Apica bhaggarāgoti bhagavā, bhaggadosoti bhagavā, bhaggamohoti bhagavā, bhaggamānoti bhagavā, bhaggadiṭṭhīti bhagavā, bhaggataṇhoti bhagavā, bhaggakilesoti bhagavā, bhaji vibhaji pavibhaji dhammaratananti bhagavā, bhavānaṃ antakaroti bhagavā, bhāvitakāyo bhāvitasīlo bhāvitacitto bhāvitapaññoti bhagavā, bhaji vā bhagavā araññavanapatthāni pantāni senāsanāni appasaddāni appanigghosāni vijanavātāni manussarāhasseyyakāni paṭisallānasāruppānīti bhagavā.
Moreover, Bhagavā because he has shattered greed (bhaggarāga); Bhagavā because he has shattered hatred (bhaggadosa); Bhagavā because he has shattered delusion (bhaggamoha); Bhagavā because he has shattered conceit (bhaggamāna); Bhagavā because he has shattered wrong views (bhaggadiṭṭhī); Bhagavā because he has shattered craving (bhaggataṇhā); Bhagavā because he has shattered defilements (bhaggakilesa); Bhagavā because he resorted to, distributed, and widely distributed the gem of Dhamma; Bhagavā because he is the end-maker of existences (bhavānaṃ antakaro); Bhagavā because his body is developed (bhāvitakāyo), his sīla is developed (bhāvitasīlo), his mind is developed (bhāvitacitto), his wisdom is developed (bhāvitapañño); or Bhagavā because he resorted to secluded abodes in forests, wildernesses, and isolated places, which are quiet, free from noise, devoid of people, suitable for human meditation and seclusion.
Hơn nữa, vì đã phá hủy tham ái nên là Bhagavā; vì đã phá hủy sân hận nên là Bhagavā; vì đã phá hủy si mê nên là Bhagavā; vì đã phá hủy kiêu mạn nên là Bhagavā; vì đã phá hủy tà kiến nên là Bhagavā; vì đã phá hủy khát ái nên là Bhagavā; vì đã phá hủy phiền não nên là Bhagavā; vì đã thực hành, đã phân chia, đã phân bố Pháp bảo nên là Bhagavā; vì đã chấm dứt các cõi hữu nên là Bhagavā; vì đã tu tập thân, tu tập giới, tu tập tâm, tu tập tuệ nên là Bhagavā; hoặc vì Bhagavā đã thực hành các nơi cư ngụ hẻo lánh trong rừng núi, những nơi yên tĩnh, ít tiếng ồn, vắng vẻ, thích hợp cho sự độc cư nên là Bhagavā.
Bhāgī vā bhagavā cīvarapiṇḍapātasenāsanagilānapaccayabhesajjaparikkhārānanti bhagavā.
Or Bhagavā because he partakes of robes, almsfood, dwellings, and medicines for the sick.
Hoặc vì Bhagavā là người thụ hưởng y, bát, sàng tọa, thuốc men cho người bệnh nên là Bhagavā.
Bhāgī vā bhagavā attharasassa dhammarasassa vimuttirasassa adhisīlassa adhicittassa adhipaññāyāti bhagavā.
Or Bhagavā because he partakes of the essence of purpose, the essence of Dhamma, the essence of liberation, higher sīla, higher mind, higher wisdom.
Hoặc vì Bhagavā là người thụ hưởng hương vị của lợi ích, hương vị của Pháp, hương vị của giải thoát, Tăng thượng giới, Tăng thượng tâm, Tăng thượng tuệ nên là Bhagavā.
Bhāgī vā bhagavā catunnaṃ jhānānaṃ catunnaṃ appamaññānaṃ catunnaṃ arūpasamāpattīnanti bhagavā.
Or Bhagavā because he partakes of the four jhāna, the four Brahmavihāras, the four formless attainments.
Hoặc vì Bhagavā là người thụ hưởng bốn thiền, bốn vô lượng tâm, bốn thiền vô sắc nên là Bhagavā.
Bhāgī vā bhagavā aṭṭhannaṃ vimokkhānaṃ aṭṭhannaṃ abhibhāyatanānaṃ navannaṃ anupubbavihārasamāpattīnanti bhagavā.
Or Bhagavā because he partakes of the eight liberations (vimokkha), the eight spheres of mastery (abhibhāyatana), the nine successive abidings (anupubbavihārasamāpatti).
Hoặc vì Bhagavā là người thụ hưởng tám giải thoát, tám thắng xứ, chín thứ lớp an trú thiền nên là Bhagavā.
Bhāgī vā bhagavā dasannaṃ saññābhāvanānaṃ dasannaṃ kasiṇasamāpattīnaṃ ānāpānassatisamādhissa asubhasamāpattiyāti bhagavā.
Or Bhagavā because he partakes of the ten contemplations of perceptions (saññābhāvanā), the ten kasiṇa attainments, the meditation on mindfulness of breathing (ānāpānassati samādhi), and the meditation on unpleasantness (asubha samāpatti).
Hoặc vì Bhagavā là người thụ hưởng mười pháp tu tập tưởng, mười pháp thiền chỉ biến xứ, định niệm hơi thở vào ra, thiền bất tịnh nên là Bhagavā.
Bhāgī vā bhagavā catunnaṃ satipaṭṭhānānaṃ catunnaṃ sammappadhānānaṃ catunnaṃ iddhipādānaṃ pañcannaṃ indriyānaṃ pañcannaṃ balānaṃ sattannaṃ bojjhaṅgānaṃ ariyassa aṭṭhaṅgikassa maggassāti bhagavā.
Or the Blessed One is a partaker of the four foundations of mindfulness, the four right exertions, the four bases of psychic power, the five faculties, the five powers, the seven factors of enlightenment, and the Noble Eightfold Path. Thus, 'Bhagavā'.
Hoặc Thế Tôn là bậc chia sẻ Tứ Niệm Xứ, Tứ Chánh Cần, Tứ Như Ý Túc, Ngũ Căn, Ngũ Lực, Thất Giác Chi, và Bát Chánh Đạo.
Bhāgī vā bhagavā dasannaṃ tathāgatabalānaṃ catunnaṃ vesārajjānaṃ catunnaṃ paṭisambhidānaṃ channaṃ abhiññānaṃ channaṃ buddhadhammānanti bhagavā.
Or the Blessed One is a partaker of the ten powers of a Tathāgata, the four confidences, the four analytical knowledges, the six supernormal powers, and the six unique qualities of a Buddha. Thus, 'Bhagavā'.
Hoặc Thế Tôn là bậc chia sẻ Mười Lực của Như Lai, Tứ Vô Sở Úy, Tứ Vô Ngại Giải, Lục Thông, và Sáu Phật Pháp.
Bhagavāti netaṃ nāmaṃ…pe… sacchikā paññatti yadidaṃ bhagavā’’ti (mahāni. 84).
"Bhagavā" is not a name… it is a true designation, namely, "Bhagavā".
“Thế Tôn” không phải là một danh xưng…pe… mà là một sự chế định có thật, đó là Thế Tôn” (Mahāni. 84).
Ettha ca ‘‘gāravādhivacana’’ntiādīni yadipi gāthāyaṃ āgatapadānukkamena na niddiṭṭhāni, yathārahaṃ pana tesaṃ sabbesampi niddesabhāvena veditabbāni.
Here, although "gāravādhivacana" and so on are not explained in the sequence of the words appearing in the verse, they should be understood as explanations of all of them, as appropriate.
Trong đoạn này, mặc dù các từ như “gāravādhivacana” (lời tôn kính) v.v… không được giải thích theo thứ tự các từ xuất hiện trong kệ ngôn, nhưng chúng nên được hiểu là đã được giải thích một cách thích đáng.
Tattha gāravādhivacananti garūnaṃ garubhāvavācakaṃ vacanaṃ.
Therein, gāravādhivacana means a term signifying the venerable state of venerables.
Trong đó, gāravādhivacana (lời tôn kính) là lời nói biểu thị sự tôn kính đối với các bậc đáng kính.
Bhajīti bhāgaso kathesi.
Bhajī means he taught in sections.
Bhajī (chia sẻ) có nghĩa là thuyết giảng từng phần.
Tenāha ‘‘vibhaji pavibhaji dhammaratana’’nti.
Therefore, it is said: "He divided and subdivided the jewel of the Dhamma."
Vì vậy, được nói là: “vibhaji pavibhaji dhammaratana” (chia sẻ, phân chia Pháp bảo).
Maggaphalādi ariyadhammoyeva dhammaratanaṃ.
The Noble Dhamma, such as the path and fruition, is indeed the jewel of the Dhamma.
Pháp cao thượng, tức là đạo và quả, chính là dhammaratana (Pháp bảo).
Puna bhajīti imassa sevīti attho.
Again, bhajī means 'he resorted to' or 'he cultivated'.
Lại nữa, bhajī (chia sẻ) có nghĩa là thực hành.
Bhāgīti bhāgābhidheyyavā.
Bhāgī means one who possesses a share.
Bhāgī (bậc chia sẻ) có nghĩa là bậc có phần.
Puna bhāgīti ettha bhajanasīloti attho.
Again, bhāgī here means one who is accustomed to cultivating.
Lại nữa, trong từ bhāgī (bậc chia sẻ), có nghĩa là bậc có thói quen thực hành.
Attharasassāti atthasannissayassa rasassa.
Of the taste of meaning (attharasa) means the taste associated with meaning.
Attharasassā (vị nghĩa) là vị của sự nương tựa vào nghĩa.
Vimuttāyatanasīse hi ṭhatvā dhammaṃ kathentassa suṇantassa ca tadatthaṃ ārabbha uppajjanakapītisomanassaṃ attharaso.
For one who teaches the Dhamma by standing at the pinnacle of liberation (vimuttāyatana) and for one who listens, the joy and happiness that arise concerning that meaning is the taste of meaning (attharasa).
Khi thuyết Pháp đứng trên đỉnh của giải thoát, sự hoan hỷ và hân hoan phát sinh nơi người nghe khi liên quan đến ý nghĩa đó, chính là attharaso (vị nghĩa).
Dhammaṃ ārabbha dhammaraso.
Concerning the Dhamma, it is the taste of Dhamma (dhammarasa).
Liên quan đến Pháp, đó là dhammaraso (vị Pháp).
Yaṃ sandhāya vuttaṃ ‘‘labhati atthavedaṃ, labhati dhammaveda’’nti (a. ni. 6.10).
Referring to which it is said: "He gains the taste of meaning, he gains the taste of Dhamma."
Điều này được nói đến trong câu: “labhati atthavedaṃ, labhati dhammaveda” (đạt được sự hiểu biết về nghĩa, đạt được sự hiểu biết về Pháp) (A.N. 6.10).
Vimuttirasassāti vimuttibhūtassa vimuttisannissayassa vā rasassa.
Of the taste of liberation (vimuttirasa) means the taste that is liberation, or the taste associated with liberation.
Vimuttirasassā (vị giải thoát) là vị của giải thoát hoặc vị của sự nương tựa vào giải thoát.
Saññābhāvanānanti aniccasaññādīnaṃ dasannaṃ saññābhāvanānaṃ.
Of the developments of perception (saññābhāvanānaṃ) means the ten developments of perception, such as the perception of impermanence (anicca-saññā).
Saññābhāvanāna (sự tu tập các tưởng) là mười sự tu tập các tưởng như tưởng vô thường v.v…
Channaṃ buddhadhammānanti cha asādhāraṇañāṇāni sandhāya vuttaṃ.
Of the six unique qualities of a Buddha (channaṃ buddhadhammānaṃ) refers to the six uncommon knowledges.
Channaṃ buddhadhammāna (sáu Phật Pháp) được nói đến để chỉ sáu trí tuệ không chung với ai khác.
Tattha tattha bhagavātisaddasiddhi niruttinayeneva veditabbā.
In each case, the derivation of the word 'Bhagavā' should be understood according to the grammatical method.
Ở mỗi chỗ đó, sự thành lập của từ “bhagavā” (Thế Tôn) nên được hiểu theo phương pháp ngữ nguyên học.
Yadipi ‘‘bhāgyavā’’tiādīhi padehi vuccamāno attho ‘‘bhagī bhajī’’ti (mahāni. 84) niddesagāthāya saṅgahito eva, tathāpi padasiddhiatthavibhāgaatthayojanādisahito saṃvaṇṇanānayo tato aññākāroti vuttaṃ ‘‘ayaṃ pana aparo nayo’’ti.
Although the meaning expressed by words like "bhāgyavā" and so on is already included in the explanatory verse "bhagī bhajī", the method of commentary, including the derivation of words, analysis of meaning, and application of meaning, is different from that; therefore, it is said: "This, however, is another method."
Mặc dù ý nghĩa được diễn tả bằng các từ như “bhāgyavā” (bậc có phước) v.v… đã được bao gồm trong kệ ngôn giải thích “bhagī bhajī” (Mahāni. 84), nhưng vì phương pháp chú giải kèm theo sự thành lập từ, phân tích ý nghĩa và giải thích ý nghĩa khác với phương pháp đó, nên được nói là “ayaṃ pana aparo nayo” (đây là một phương pháp khác).
Vaṇṇavipariyāyoti etanti ettha itisaddo ādiattho, tena vaṇṇavikāro vaṇṇalopo dhātuatthena niyojanañcāti imaṃ tividhaṃ lakkhaṇaṃ saṅgaṇhāti.
In "vaṇṇavipariyāyoti eta", the word iti has the meaning of 'etc.'; therefore, it includes these three characteristics: change of letter, elision of letter, and application according to the meaning of the root.
Trong câu “Vaṇṇavipariyāyoti eta” (đây là sự thay đổi âm vị), từ iti có nghĩa là v.v…, do đó nó bao gồm ba đặc điểm này: sự biến đổi âm vị, sự lược bỏ âm vị và sự liên kết với ý nghĩa gốc.
Saddanayenāti saddalakkhaṇanayena.
By the linguistic method (saddanayena) means by the method of linguistic characteristics.
Saddanayenā (theo ngữ pháp) có nghĩa là theo phương pháp ngữ pháp.
Pisodarādīnaṃ saddānaṃ ākatigaṇabhāvato vuttaṃ ‘‘pisodarādipakkhepalakkhaṇaṃ gahetvā’’ti.
Because words like 'pisodara' are of the 'ākati' group, it is said: "taking the characteristic of inclusion as in 'pisodara' and so on."
Vì các từ như pisodara v.v… thuộc nhóm “ākati-gaṇa” (nhóm từ mẫu), nên được nói là “pisodarādipakkhepalakkhaṇaṃ gahetvā” (lấy đặc điểm thêm vào như pisodara v.v…)
Pakkhipanameva lakkhaṇaṃ.
Inclusion itself is the characteristic.
Thêm vào chính là đặc điểm.
Tappariyāpannatākaraṇañhi pakkhipanaṃ.
For inclusion means to bring into that category.
Vì việc biến nó thành một phần chính là sự thêm vào.
Pārappattanti paramukkaṃsagataṃ pāramībhāvappattaṃ.
Pārappattaṃ means reached the highest excellence, attained the state of perfections (pāramī).
Pārappatta (đã đạt đến bờ bên kia) là đã đạt đến sự siêu việt tột cùng, đã đạt đến trạng thái Ba-la-mật.
Bhāgyanti kusalaṃ.
Bhāgyaṃ means wholesome karma.
Bhāgya (phước báu) là thiện nghiệp.
Tattha maggakusalaṃ lokuttarasukhanibbattakaṃ, itaraṃ lokiyasukhanibbattakaṃ, itarampi vā vivaṭṭupanissayaṃ pariyāyato lokuttarasukhanibbattakaṃ siyā.
Of these, path-wholesome karma produces supramundane happiness, while other wholesome karma produces mundane happiness; or even other wholesome karma, as a condition for aversion (to rebirth), might indirectly produce supramundane happiness.
Trong đó, thiện nghiệp của đạo là nhân sinh ra hạnh phúc siêu thế, còn các thiện nghiệp khác là nhân sinh ra hạnh phúc thế gian, hoặc các thiện nghiệp khác có thể là nhân sinh ra hạnh phúc siêu thế một cách gián tiếp, nhờ có sự nương tựa vào sự thoát ly.
Idāni bhagavāti imassa atthaṃ vibhajitvā dassento āha ‘‘yasmā panā’’tiādi.
Now, in order to explain the meaning of Bhagavā, he says: "yasmā panā" and so on.
Bây giờ, để phân tích và trình bày ý nghĩa của từ bhagavā (Thế Tôn), ngài nói “yasmā panā” (vì vậy) v.v…
Tattha lobhādayo ekakavasena gahitā, tathā viparītamanasikāro vipallāsabhāvasāmaññena, ahirikādayo dukavasena.
Therein, greed (lobha) and so on are taken individually, likewise, wrong attention (viparīta-manasikāra) by the general nature of perversion, and lack of shame (ahirikā) and so on in pairs.
Trong đó, tham v.v… được lấy theo từng cái một, cũng như sự tác ý sai lầm được lấy theo nghĩa chung của sự điên đảo, còn vô tàm v.v… được lấy theo từng cặp.
Tattha kujjhanalakkhaṇo kodho, so navavidhaāghātavatthusambhavo.
Therein, anger (kodha) has the characteristic of being vexed; it arises from the nine objects of resentment.
Trong đó, kodho (sân hận) có đặc điểm là sự tức giận, nó phát sinh từ chín căn bản của sự thù hận.
‘‘Akkocchi maṃ avadhi ma’’ntiādinā (dha. pa. 3-4) punappunaṃ kujjhanavasena cittapariyonandhano upanāho.
Hostility (upanāha) is the mental state of being continuously vexed with thoughts like "He insulted me, he struck me" and so on.
Upanāho (oán kết) là sự che lấp tâm thức do tức giận lặp đi lặp lại với ý nghĩ “nó mắng tôi, nó đánh tôi” v.v… (Dhammapada 3-4).
Ubhayampi paṭighoyeva, so pavattinānattato bhinditvā vutto.
Both are forms of aversion, but they are spoken of separately due to the difference in their manifestation.
Cả hai đều là sân hận, nhưng được phân biệt và nói ra do sự đa dạng trong cách phát sinh.
Sakiṃ uppanno kodho kodhoyeva, taduttari upanāho.
Anger that arises once is anger; if it continues, it is hostility.
Sân hận vừa mới phát sinh là sân hận, sau đó là oán kết.
Vuttañcetaṃ ‘‘pubbakāle kodho, aparakāle upanāho’’ti (vibha. 891).
It is said: "In the initial stage, it is anger; in the later stage, it is hostility."
Điều này đã được nói: “trước là sân hận, sau là oán kết” (Vibh. 891).
Agāriyassa (ma. ni. aṭṭha. 1.71) anagāriyassa vā sukatakaraṇavināsano makkho.
Denigration (makkha) is the destroyer of good deeds done, whether by a householder or a renunciant.
Makkho (phiền não) là sự phá hoại những việc tốt đẹp đã làm của người tại gia (M.N. Aṭṭha. 1.71) hoặc người xuất gia.
Agāriyopi hi kenaci anukampakena daliddo samāno ucce ṭhāne ṭhapito aparena samayena ‘‘kiṃ tayā mayhaṃ kata’’nti tassa sukatakaraṇaṃ vināseti.
A householder, even though poor, being placed in a high position by someone sympathetic, later destroys that person's good deed by saying, "What have you done for me?"
Người tại gia, nếu là người nghèo được ai đó giúp đỡ đưa lên địa vị cao, sau một thời gian lại nói: “Ngươi đã làm gì cho ta?”, và phá hoại những việc tốt đẹp người đó đã làm.
Anagāriyopi sāmaṇerakālato pabhuti ācariyena vā upajjhāyena vā catūhi paccayehi uddesaparipucchādīhi ca anuggahetvā dhammakathānayappakaraṇakosallādīni sikkhāpito aparena samayena rājarājamahāmattādīhi sakkato garukato ācariyupajjhāyesu acittīkato caramāno ‘‘ayaṃ amhehi daharakāle evaṃ anuggahito saṃvaḍḍhito ca, atha ca panidāni nissineho jāto’’ti vuccamāno ‘‘kiṃ mayhaṃ tumhehi kata’’nti tesaṃ sukatakaraṇaṃ vināseti, tasseso pubbakāritālakkhaṇassa guṇassa vināsano udakapuñchaniyā viya sarīrānugataṃ udakaṃ nipuñchanto makkho.
Likewise, a renunciant, from the time of being a novice (sāmaṇera), having been supported by an ācariya or upajjhāya with the four requisites and by instruction, questioning, and so on, and having been taught skills in Dhamma talks, exposition, and so on, is later honored and respected by kings, chief ministers, and so on, but becomes disrespectful towards his ācariya and upajjhāya. When it is said, "He was thus supported and brought up by us when he was young, yet now he has become heartless," he destroys their good deed by saying, "What have you done for me?" This denigration is like a water-wipe (udaka-puñchanī), wiping away the water that clings to the body, thereby destroying the quality of having done good in the past.
Người xuất gia, từ khi còn là Sa-di, được thầy hoặc Hòa thượng giúp đỡ bằng tứ vật dụng, bằng việc giảng dạy và hỏi đáp v.v…, được dạy dỗ về sự khéo léo trong cách thuyết Pháp và các kinh điển, sau một thời gian được vua, quan đại thần v.v… tôn kính, trọng vọng, trở nên không còn tôn trọng thầy và Hòa thượng của mình, khi bị nói: “Người này khi còn nhỏ đã được chúng ta giúp đỡ và nuôi dưỡng như vậy, vậy mà bây giờ lại trở nên vô ơn”, thì người đó nói: “Các ông đã làm gì cho tôi?”, và phá hoại những việc tốt đẹp mà các vị đó đã làm cho mình; đó là makkho (phiền não) phá hoại đức tính của người đã làm ơn trước, giống như khăn lau nước lau sạch nước bám trên cơ thể.
Tathā hi so paresaṃ guṇānaṃ makkhanaṭṭhena ‘‘makkho’’ti vuccati.
Thus, it is called makkha because it defiles (makkhati) the good qualities of others.
Quả thật, nó được gọi là “makkho” vì nó làm ô uế (makkhana) các đức tính của người khác.
Paḷāsatīti paḷāso, parassa guṇe dassetvā attano guṇehi same karotīti attho.
Rivalry (paḷāsa) means 'he equates'; that is, he makes his own qualities equal to the qualities of another by exposing the other's qualities.
Paḷāsatīti paḷāso (kiêu căng), có nghĩa là sau khi phô bày đức tính của người khác, nó làm cho đức tính của mình ngang bằng với họ.
So pana bahussutepi puggale ajjhottharitvā ‘‘īdisassa ca bahussutassa aniyatā gati, tava vā mama vā ko viseso’’ti, rattaññū cirapabbajite puggale ajjhottharitvā ‘‘tvampi imasmiṃ sāsane pabbajito, ahampi pabbajito, tvampi sīlamatte ṭhito, ahampī’’tiādinā nayena uppajjamāno yugaggāho.
This is the 'yugaggāha' (taking both sides) that arises when one overshadows a very learned person, thinking, "The destination of such a learned person is uncertain; what difference is there between you and me?" or when one overshadows a 'rattaññū' (one who knows the night, i.e., long-ordained) person, thinking, "You too are ordained in this dispensation, and I too am ordained; you too stand firm in morality, and I too," and so on.
Paḷāso này là sự chấp thủ ngang hàng (yugaggāho) phát sinh khi nó lấn át một người đa văn, nói rằng: “Một người đa văn như vậy thì vận mệnh không chắc chắn, ngươi hay ta có gì khác biệt?”, hoặc khi nó lấn át một người có tuổi hạ cao, đã xuất gia lâu năm, nói rằng: “Ngươi cũng xuất gia trong giáo pháp này, ta cũng xuất gia, ngươi cũng giữ giới, ta cũng vậy” v.v…
Yugaggāhalakkhaṇo hi paḷāso.
For rivalry (paḷāsa) has the characteristic of taking both sides (yugaggāha).
Quả thật, paḷāso có đặc điểm là sự chấp thủ ngang hàng.
Paresaṃ sakkārādīni khīyamānā usūyamānā issā.
Envy (issā) is begrudging and feeling resentment when others receive honor and so on.
Issā (đố kỵ) là sự ghen ghét, đố kỵ khi thấy người khác được tôn kính v.v…
Attano sampattiyā nigūhanaṃ parehi sādhāraṇabhāvaṃ asahamānaṃ macchariyaṃ.
Stinginess (macchariya) is the concealment of one's own possessions, unable to bear their common sharing with others.
Macchariyaṃ (keo kiệt) là sự che giấu tài sản của mình, không muốn chia sẻ với người khác.
Vañcanikacariyabhūtā māyā, sā sakadosapaṭicchādanalakkhaṇā.
Deceit (māyā) is behavior characterized by trickery; its characteristic is the concealment of one's own faults.
Māyā (giả dối) là hành vi lừa dối, có đặc điểm là che giấu lỗi lầm của mình.
Tathā hi sā attano vijjamānadosapaṭicchādanato cakkhumohanamāyā viyāti ‘‘māyā’’ti vuccati.
Thus, it is called māyā because it conceals one's existing faults, like an illusion that deludes the eyes.
Quả thật, nó được gọi là “māyā” vì nó che giấu những lỗi lầm hiện có của mình, giống như ảo ảnh làm mê hoặc mắt.
Attano avijjamānaguṇappakāsanalakkhaṇaṃ kerāṭikabhāvena uppajjamānaṃ sāṭheyyaṃ.
Fraudulence (sāṭheyyaṃ) is the characteristic of proclaiming one's non-existent qualities, arising from a deceptive nature.
Sāṭheyyaṃ (xảo trá) là sự phô bày những đức tính không có của mình, phát sinh dưới hình thức lừa đảo.
Asantaguṇadīpanañhi ‘‘kerāṭiya’’nti vuccati.
Indeed, the displaying of non-existent qualities is called kerāṭiyaṃ (deceptiveness).
Quả thật, sự phô bày những đức tính không có được gọi là “kerāṭiya” (lừa đảo).
Kerāṭiko hi puggalo āyanamaccho viya hoti.
A deceptive person (kerāṭiko) is like an āyana fish.
Người lừa đảo giống như cá āyana.
Āyanamaccho nāma sappamukhamacchavālā ekā macchajāti.
An āyana fish is a type of fish that has the head of a snake and the tail of a fish.
Cá āyana là một loài cá có đầu giống rắn và vảy cá.
So kira macchānaṃ naṅguṭṭhaṃ dasseti, sappānaṃ sīsaṃ ‘‘tumhākaṃ sadiso aha’’nti jānāpetuṃ, evameva kerāṭiko puggalo yaṃ yaṃ suttantikaṃ vā ābhidhammikaṃ vā upasaṅkamati, taṃ taṃ evaṃ vadati ‘‘ahaṃ tumhākaṃ antevāsī, tumhe mayhaṃ anukampakā, nāhaṃ tumhe muñcāmī’’ti.
It is said to show its tail to fish and its head to snakes to make them know, "I am like you." In the same way, a deceptive person, whoever he approaches, whether a Suttantika or an Abhidhammika, says this: "I am your disciple, you are sympathetic to me, I will not abandon you."
Nó được cho là cho cá thấy đuôi, và cho rắn thấy đầu để chúng biết rằng “ta giống như các ngươi”; cũng vậy, người lừa đảo khi tiếp cận bất kỳ vị Suttantika (học giả Kinh tạng) hoặc Abhidhammika (học giả Luận tạng) nào, thì nói rằng: “Con là đệ tử của quý vị, quý vị là bậc từ bi của con, con sẽ không rời bỏ quý vị”.
Evamete ‘‘sagāravo ayaṃ amhesu sappatisso’’ti maññissanti, tassevaṃ kerāṭikabhāvena uppajjamānaṃ sāṭheyyaṃ.
Thus, they will think, "This one is respectful towards us, he is attentive." Such a fraudulence arising from a deceptive nature is sāṭheyyaṃ.
Như vậy, họ sẽ nghĩ rằng “người này tôn kính chúng ta, người này có lòng tôn trọng”; sāṭheyyaṃ (xảo trá) phát sinh dưới hình thức lừa đảo như vậy.
Sabbaso maddavābhāvena vātabharitabhastasadisassa thaddhabhāvassa anonamitadaṇḍasadisatāya paggahitasiraanivātavuttikāyassa ca kārako thambho.
Obstinacy (thambho) causes a state of stiffness, like a wind-filled bellows, due to a complete lack of pliability, and a body with raised veins and an unyielding posture, like an unbent stick.
Thambho (ngang bướng) là yếu tố gây ra sự cứng nhắc, giống như một cái túi đầy gió, hoàn toàn không mềm dẻo, và một cơ thể có gân cốt căng thẳng, không co lại được, giống như một cây gậy không thể uốn cong.
Taduttarikaraṇo sārambho.
Arrogance (sārambho) is the act of surpassing that.
Sārambho (kiêu căng) là sự vượt quá mức đó.
So duvidhena labbhati akusalavasena ceva kusalavasena ca.
It is obtained in two ways: by way of unwholesome and by way of wholesome.
Nó được tìm thấy theo hai cách: theo cách bất thiện và theo cách thiện.
Tattha agāriyassa parena kataṃ alaṅkārādiṃ disvā taddiguṇataddiguṇakaraṇena uppajjamāno, anagāriyassa ca yattakaṃ yattakaṃ paro pariyāpuṇāti vā katheti vā, mānavasena taddiguṇataddiguṇakaraṇena uppajjamāno akusalo.
Among these, for a householder, it is unwholesome when it arises by doubling what another has done, such as decorations, upon seeing them; and for a homeless one, when it arises by continually doubling (one's own knowledge or teaching) out of conceit, regarding whatever another learns or teaches.
Trong đó, đối với gia chủ, sự kiêu mạn bất thiện khởi lên khi thấy trang sức, v.v. do người khác làm, và muốn làm cho mình gấp đôi, gấp ba như thế; còn đối với người xuất gia, nó khởi lên do kiêu mạn khi thấy người khác học được bao nhiêu hay thuyết giảng bao nhiêu, và muốn làm cho mình gấp đôi, gấp ba như thế.
Tena hi samannāgato puggalo taddiguṇaṃ taddiguṇaṃ karoti.
Indeed, a person endowed with that does double and redouble.
Do đó, người có được sự kiêu mạn ấy làm cho mình gấp đôi, gấp ba.
Agāriyo samāno ekenekasmiṃ gharavatthusmiṃ sajjite aparo dve vatthūni sajjeti, aparo cattāro, aparo aṭṭha, aparo soḷasa.
Being a householder, if one person furnishes one house-plot, another furnishes two plots, another four, another eight, another sixteen.
Là gia chủ, một người trang bị một vật phẩm trong nhà, người khác trang bị hai vật phẩm, người khác nữa bốn, người khác tám, người khác mười sáu.
Anagāriyo samāno ekenekasmiṃ nikāye gahite ‘‘nāhaṃ etassa heṭṭhā bhavissāmī’’ti aparo dve gaṇhāti, aparo tayo, aparo cattāro, aparo pañca.
Being a homeless one, if one person takes up one collection (nikāya), thinking, 'I will not be inferior to him,' another takes up two, another three, another four, another five.
Là người xuất gia, một người nắm giữ một bộ kinh, người khác nói: “Tôi sẽ không đứng dưới người này,” rồi nắm giữ hai bộ, người khác ba, người khác bốn, người khác năm.
Sārambhavasena hi gaṇhituṃ na vaṭṭati.
It is not proper to take up out of rivalry.
Thật vậy, không nên nắm giữ theo cách ganh đua.
Akusalapakkho hesa nirayagāmimaggo.
This unwholesome aspect is a path leading to hell.
Đây là phe bất thiện, là con đường dẫn đến địa ngục.
Agāriyassa pana paraṃ ekaṃ salākabhattaṃ dentaṃ disvā attano dve vā tīṇi vā dātukāmatāya uppajjamāno, anagāriyassa ca parena ekanikāye gahite mānaṃ anissāya kevalaṃ taṃ disvā attano ālasiyaṃ abhibhuyya dve nikāye gahetukāmatāya uppajjamāno kusalo.
However, for a householder, it is wholesome when it arises from seeing another give one ticket-meal and wishing to give two or three oneself; and for a homeless one, when, without relying on conceit, seeing another take up one collection, it arises from wishing to overcome one's laziness and take up two collections.
Nhưng đối với gia chủ, sự kiêu mạn thiện khởi lên khi thấy người khác dâng một phần cơm phiếu, và muốn tự mình dâng hai hoặc ba phần; còn đối với người xuất gia, nó khởi lên khi thấy người khác nắm giữ một bộ kinh, không dựa vào kiêu mạn mà chỉ thấy điều đó, rồi vượt qua sự lười biếng của mình và muốn nắm giữ hai bộ kinh.
Kusalapakkhavasena hi ekasmiṃ ekaṃ salākabhattaṃ dente dve, dve dente cattāri dātuṃ vaṭṭati.
Indeed, in the wholesome aspect, it is proper to give two when one gives one ticket-meal, and four when one gives two.
Thật vậy, theo phe thiện, khi một người dâng một phần cơm phiếu, thì được phép dâng hai; khi dâng hai, thì được phép dâng bốn.
Bhikkhunāpi parena ekasmiṃ nikāye gahite ‘‘dve nikāye gahetvā sajjhāyantassa me phāsu hotī’’ti vivaṭṭapakkhe ṭhatvā taduttari gaṇhituṃ vaṭṭati, idha pana akusalapakkhiyo taduttarikaraṇo ‘‘sārambho’’ti vutto.
Even for a bhikkhu, when another takes up one collection, it is proper to take up more than that, standing in the aspect of removal (of unwholesome states), thinking, "It will be comfortable for me to recite having taken up two collections"; but here, the act of doing more in the unwholesome aspect is called "rivalry."
Vị tỳ khưu cũng vậy, khi người khác nắm giữ một bộ kinh, vị ấy có thể nắm giữ nhiều hơn, đứng về phía không chấp thủ, nghĩ rằng: “Khi tôi nắm giữ hai bộ kinh và tụng đọc, tôi sẽ được an lạc.” Nhưng ở đây, việc làm cho mình nhiều hơn theo phe bất thiện được gọi là “ganh đua” (sārambho).
Jātiādīni nissāya seyyassa ‘‘seyyohamasmī’’tiādinā unnativasena paggaṇhanavasena pavatto māno.
Conceit (Māna) is that which arises by way of exalting oneself, such as "I am superior," based on being superior due to birth and so forth.
Sự kiêu mạn (māno) là sự tự tôn, tự đề cao khởi lên do tự cho mình là hơn người khác dựa trên địa vị xã hội, v.v., với ý nghĩ “Tôi là người cao quý hơn.”
Abbhunnativasena pavatto atimāno.
Excessive conceit (Atimāna) is that which arises by way of excessive exultation.
Sự tự đắc (atimāno) là sự tự đề cao một cách quá đáng.
Pubbe kenaci attānaṃ sadisaṃ katvā pacchā tato adhikato dahato uppajjamānako atimānoti veditabbo.
Excessive conceit should be understood as arising when one previously considered oneself equal to someone else, but later considers oneself superior to them.
Sự tự đắc cần được hiểu là sự kiêu mạn khởi lên khi trước đó đã tự cho mình ngang bằng với ai đó, nhưng sau đó lại tự cho mình hơn hẳn người đó.
Jātiādiṃ paṭicca majjanākāro mado, sopi atthato māno eva.
Intoxication (Mada) is the state of being infatuated, based on birth and so forth; in essence, it is also conceit (māna).
Sự say đắm (majjanākāro) khởi lên dựa trên địa vị xã hội, v.v. là kiêu căng (mado); về bản chất, nó cũng là kiêu mạn.
So pana jātimado gottamado ārogyamado yobbanamado jīvitamado lābhamado sakkāramado garukāramado purekkhāramado parivāramado bhogamado vaṇṇamado sutamado paṭibhānamado rattaññumado piṇḍapātikamado anavaññattimado iriyāpathamado iddhimado yasamado sīlamado jhānamado sippamado ārohamado pariṇāhamado saṇṭhānamado pāripūrimadoti anekavidho.
It is of many kinds: intoxication with birth, intoxication with clan, intoxication with health, intoxication with youth, intoxication with life, intoxication with gain, intoxication with honour, intoxication with respect, intoxication with being a leader, intoxication with retinue, intoxication with wealth, intoxication with beauty, intoxication with learning, intoxication with ready wit, intoxication with seniority, intoxication with the alms-round, intoxication with not being despised, intoxication with postures, intoxication with psychic power, intoxication with fame, intoxication with sīla, intoxication with jhāna, intoxication with skill, intoxication with height, intoxication with girth, intoxication with physique, intoxication with completeness.
Tuy nhiên, nó có nhiều loại: kiêu căng về dòng dõi, kiêu căng về gia tộc, kiêu căng về sức khỏe, kiêu căng về tuổi trẻ, kiêu căng về sự sống, kiêu căng về lợi lộc, kiêu căng về sự cung kính, kiêu căng về sự tôn trọng, kiêu căng về sự được đi trước, kiêu căng về quyến thuộc, kiêu căng về tài sản, kiêu căng về sắc đẹp, kiêu căng về học vấn, kiêu căng về trí tuệ ứng đối, kiêu căng về sự lâu năm, kiêu căng về hạnh khất thực, kiêu căng về sự không bị khinh miệt, kiêu căng về oai nghi, kiêu căng về thần thông, kiêu căng về danh tiếng, kiêu căng về giới đức, kiêu căng về thiền định, kiêu căng về nghề nghiệp, kiêu căng về chiều cao, kiêu căng về bề ngang, kiêu căng về hình dáng, kiêu căng về sự hoàn hảo.
Tattha (vibha. aṭṭha. 843-844) jātiṃ nissāya uppanno majjanākārappavatto māno jātimado, so khattiyādīnaṃ catunnampi vaṇṇānaṃ uppajjati.
Among these (Vibh.A. 843-844), intoxication with birth (jātimada) is conceit arising in the form of infatuation based on birth; it arises in all four castes, such as Khattiyas.
Trong đó, kiêu mạn khởi lên do say đắm vào dòng dõi được gọi là kiêu căng về dòng dõi (jātimado); nó khởi lên ở cả bốn giai cấp: Sát đế lỵ, v.v.
Jātisampanno hi khattiyo ‘‘mādiso añño natthi, avasesā antarā uṭṭhāya khattiyā jātā, ahaṃ pana vaṃsāgatakhattiyo’’ti mānaṃ karoti.
A Khattiya, perfect in birth, becomes conceited, thinking, "There is no other like me; others are Khattiyas who have arisen by chance, but I am a Khattiya of ancestral lineage."
Một Sát đế lỵ có dòng dõi cao quý kiêu mạn rằng: “Không có ai giống như ta, những Sát đế lỵ khác chỉ là thứ xuất thân từ chỗ thấp kém, còn ta là Sát đế lỵ có dòng dõi truyền thống.”
Brāhmaṇādīsupi eseva nayo.
The same method applies to Brahmins and others.
Đối với Bà la môn, v.v. cũng theo cách này.
Gottaṃ nissāya uppanno majjanākārappavatto māno gottamado, sopi khattiyādīnaṃ catunnampi vaṇṇānaṃ uppajjati.
Intoxication with clan (gottamada) is conceit arising in the form of infatuation based on clan; it also arises in all four castes, such as Khattiyas.
Kiêu mạn khởi lên do say đắm vào gia tộc được gọi là kiêu căng về gia tộc (gottamado); nó cũng khởi lên ở cả bốn giai cấp: Sát đế lỵ, v.v.
Khattiyopi hi ‘‘ahaṃ koṇḍaññagotto, ahaṃ ādiccagotto’’ti mānaṃ karoti.
Indeed, a Khattiya becomes conceited, thinking, "I am of the Kondañña clan, I am of the Ādicca clan."
Một Sát đế lỵ cũng kiêu mạn rằng: “Ta thuộc dòng Koṇḍañña, ta thuộc dòng Ādicca.”
Brāhmaṇopi ‘‘ahaṃ kassapagotto, ahaṃ bhāradvājagotto’’ti mānaṃ karoti.
A Brahmin also becomes conceited, thinking, "I am of the Kassapa clan, I am of the Bhāradvāja clan."
Một Bà la môn cũng kiêu mạn rằng: “Ta thuộc dòng Kassapa, ta thuộc dòng Bhāradvāja.”
Vessopi suddopi attano attano kulagottaṃ nissāya mānaṃ karoti.
Even a merchant (vessa) or a Suddha becomes conceited based on their respective family and clan.
Một Phệ xá hay một Thủ đà la cũng kiêu mạn dựa trên gia tộc của riêng mình.
Ārogyamadādīsupi ‘‘ahaṃ arogo, sesā rogabahulā, kaṇḍuvanamattampi mayhaṃ byādhi nāma natthī’’ti majjanavasena uppanno māno ārogyamado nāma.
Among intoxications like health, the conceit that arises by way of infatuation, thinking, "I am healthy, others are prone to illness; I have no ailment, not even a slight itch," is called intoxication with health (ārogyamada).
Trong các loại kiêu căng về sức khỏe, v.v. thì kiêu mạn khởi lên do say đắm với ý nghĩ: “Ta không bệnh tật, những chúng sanh khác thường hay bệnh tật, ta không có bệnh tật dù chỉ là một vết ngứa,” được gọi là kiêu căng về sức khỏe (ārogyamado).
‘‘Ahaṃ taruṇo, avasesasattānaṃ attabhāvo papāte ṭhitarukkhasadiso, ahaṃ pana paṭhamavaye ṭhito’’ti majjanavasena uppanno māno yobbanamado.
The conceit that arises by way of infatuation, thinking, "I am young, the bodies of other beings are like trees on a cliff, but I am in the prime of life," is intoxication with youth (yobbanamada).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Ta còn trẻ, thân thể của những chúng sanh khác giống như cây đứng trên vách đá, còn ta thì đang ở tuổi thanh xuân,” là kiêu căng về tuổi trẻ (yobbanamado).
‘‘Ahaṃ ciraṃ jīviṃ, ciraṃ jīvāmi, ciraṃ jīvissāmi, sukhaṃ jīviṃ, sukhaṃ jīvāmi, sukhaṃ jīvissāmī’’ti majjanavasena uppanno māno jīvitamado nāma.
The conceit that arises by way of infatuation, thinking, "I have lived long, I am living long, I will live long; I have lived comfortably, I am living comfortably, I will live comfortably," is called intoxication with life (jīvitamada).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Ta đã sống lâu, ta đang sống lâu, ta sẽ sống lâu, ta đã sống an lạc, ta đang sống an lạc, ta sẽ sống an lạc,” được gọi là kiêu căng về sự sống (jīvitamado).
‘‘Ahaṃ lābhī, avasesā sattā appalābhā, mayhaṃ pana lābhassa pamāṇaṃ natthī’’ti majjanavasena uppanno māno lābhamado nāma.
The conceit that arises by way of infatuation, thinking, "I am one who gains, other beings have little gain; but there is no limit to my gains," is called intoxication with gain (lābhamado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Ta có nhiều lợi lộc, những chúng sanh khác có ít lợi lộc, còn lợi lộc của ta thì không thể đo lường được,” được gọi là kiêu căng về lợi lộc (lābhamado).
‘‘Avasesā sattā yaṃ vā taṃ vā labhanti, ahaṃ pana sukataṃ paṇītaṃ cīvarādipaccayaṃ labhāmī’’ti majjanavasena uppanno māno sakkāramado nāma.
The conceit that arises by way of infatuation, thinking, "Other beings obtain whatever little they can, but I obtain well-made, exquisite requisites such as robes," is called intoxication with honour (sakkāramado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Những chúng sanh khác nhận được bất cứ thứ gì, còn ta thì nhận được y phục và các vật dụng khác một cách tốt đẹp và tinh xảo,” được gọi là kiêu căng về sự cung kính (sakkāramado).
‘‘Avasesabhikkhūnaṃ pādapiṭṭhiyaṃ akkamitvā gacchantā manussā ‘ayaṃ samaṇo’tipi na vandanti, maṃ pana disvā vandanti, pāsāṇacchattaṃ viya garukaṃ katvā aggikkhandhaṃ viya ca durāsadaṃ katvā maññantī’’ti majjanavasena uppanno māno garukāramado nāma.
The conceit that arises by way of infatuation, thinking, "People do not even pay homage to other bhikkhus, walking over their heels, not even considering them as 'ascetics,' but upon seeing me, they pay homage, treating me with great respect like a rock-umbrella, and considering me unapproachable like a blazing fire," is called intoxication with respect (garukāramado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Những người đi qua lại trên gót chân của các vị tỳ khưu khác thậm chí không đảnh lễ các vị ấy là ‘vị Sa môn này,’ còn khi thấy ta thì họ đảnh lễ, họ tôn trọng ta như một cây dù bằng đá, và xem ta là khó tiếp cận như một đống lửa,” được gọi là kiêu căng về sự tôn trọng (garukāramado).
‘‘Uppanno pañho mayhameva mukhena chijjati, bhikkhācāraṃ gacchantāpi āgacchantāpi mameva purato katvā parivāretvā gacchantī’’ti majjanavasena uppanno māno purekkhāramado nāma.
The conceit that arises by way of infatuation, thinking, "Any arisen problem is resolved through my mouth; when going for alms or returning, people always place me in front, surrounding me as they go," is called intoxication with being a leader (purekkhāramado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Vấn đề phát sinh chỉ được giải quyết qua miệng ta, những người đi khất thực cũng như trở về đều đi trước ta và vây quanh ta,” được gọi là kiêu căng về sự được đi trước (purekkhāramado).
Agāriyassa tāva mahāparivārassa ‘‘purisasatampi purisasahassampi maṃ parivāretī’’ti, anagāriyassa ‘‘samaṇasatampi samaṇasahassampi maṃ parivāreti, sesā appaparivārā, ahaṃ mahāparivāro ceva suciparivāro cā’’ti majjanavasena uppanno māno parivāramado nāma.
For a householder with a large retinue, thinking, "A hundred or a thousand men surround me"; and for a homeless one, thinking, "A hundred or a thousand ascetics surround me; others have small retinues, but I have a large and pure retinue," this conceit that arises by way of infatuation is called intoxication with retinue (parivāramado).
Đối với gia chủ có nhiều quyến thuộc, kiêu mạn khởi lên do say đắm với ý nghĩ: “Một trăm người, một ngàn người vây quanh ta”; đối với người xuất gia, kiêu mạn khởi lên với ý nghĩ: “Một trăm vị Sa môn, một ngàn vị Sa môn vây quanh ta, những người khác có ít quyến thuộc, còn ta có nhiều quyến thuộc và quyến thuộc thanh tịnh,” được gọi là kiêu căng về quyến thuộc (parivāramado).
‘‘Avasesā sattā attano paribhogamattakampi na labhanti, mayhaṃ pana nidhānagatasseva dhanassa pamāṇaṃ natthī’’ti majjanavasena uppanno māno bhogamado nāma.
The conceit that arises by way of infatuation, thinking, "Other beings do not even obtain enough for their own use, but there is no limit to my wealth, as if it were stored in a treasure," is called intoxication with wealth (bhogamado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Những chúng sanh khác thậm chí không có đủ để dùng, còn tài sản của ta thì như một kho tàng không thể đo lường được,” được gọi là kiêu căng về tài sản (bhogamado).
‘‘Avasesā sattā dubbaṇṇā durūpā, ahaṃ abhirūpo pāsādiko’’tipi ‘‘avasesasattā nigguṇā patthaṭaakittino, mayhaṃ pana kittisaddo devamanussesu pākaṭo ‘itipi thero bahussuto, itipi sīlavā, itipi dhutaguṇayutto’’’ti, evaṃ sarīravaṇṇaṃ guṇavaṇṇañca paṭicca majjanavasena uppanno māno vaṇṇamado nāma.
The conceit that arises by way of infatuation, thinking, "Other beings are ugly, ill-favoured, but I am handsome and pleasing," or "Other beings are without virtue, of diffused ill-repute, but my fame is renowned among devas and humans: 'Indeed, this elder is learned, indeed, he is virtuous, indeed, he is endowed with ascetic practices'," thus arising by way of infatuation concerning physical beauty and virtuous qualities, is called intoxication with beauty (vaṇṇamado).
Kiêu mạn khởi lên do say đắm dựa trên vẻ đẹp hình thể và phẩm chất, với ý nghĩ: “Những chúng sanh khác xấu xí, dung mạo kém, còn ta thì đẹp đẽ, đáng kính” hoặc “Những chúng sanh khác không có phẩm chất, danh tiếng của họ không lan rộng, còn danh tiếng của ta thì nổi tiếng trong chư thiên và loài người rằng ‘vị Trưởng lão này là người đa văn, vị này là người giữ giới, vị này là người thực hành các hạnh đầu đà,’” được gọi là kiêu căng về sắc đẹp (vaṇṇamado).
‘‘Avasesā sattā appassutā, ahaṃ pana bahussuto’’ti majjanavasena uppanno māno sutamado nāma.
The conceit that arises by way of infatuation, thinking, "Other beings have little learning, but I am very learned," is called intoxication with learning (sutamado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Những chúng sanh khác ít học, còn ta thì đa văn,” được gọi là kiêu căng về học vấn (sutamado).
‘‘Avasesā sattā appaṭibhānā, mayhaṃ pana paṭibhānassa pamāṇaṃ natthī’’ti majjanavasena uppanno māno paṭibhānamado nāma.
The conceit that arises by way of infatuation, thinking, "Other beings have little ready wit, but there is no limit to my ready wit," is called intoxication with ready wit (paṭibhānamado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Những chúng sanh khác ít trí tuệ ứng đối, còn trí tuệ ứng đối của ta thì không thể đo lường được,” được gọi là kiêu căng về trí tuệ ứng đối (paṭibhānamado).
‘‘Ahaṃ rattaññū asukaṃ buddhavaṃsaṃ rājavaṃsaṃ janapadavaṃsaṃ gāmavaṃsaṃ rattindivaparicchedaṃ nakkhattamuhuttayogaṃ jānāmī’’ti majjanavasena uppanno māno rattaññumado nāma.
The conceit that arises by way of infatuation, thinking, "I am a veteran (rattaññū); I know such and such a lineage of Buddhas, a lineage of kings, a lineage of countries, a lineage of villages, the division of nights and days, and the conjunctions of constellations and auspicious moments," is called intoxication with seniority (rattaññumado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Ta là người có kinh nghiệm lâu năm, ta biết lịch sử chư Phật, lịch sử các vị vua, lịch sử các quốc gia, lịch sử các làng mạc, sự phân chia ngày đêm, sự kết hợp của các chòm sao và thời khắc,” được gọi là kiêu căng về sự lâu năm (rattaññumado).
‘‘Avasesā bhikkhū antarā piṇḍapātikā jātā, ahaṃ pana jātipiṇḍapātiko’’ti majjanavasena uppanno māno piṇḍapātikamado nāma.
The conceit that arises by way of infatuation, thinking, "Other bhikkhus became alms-food eaters by chance, but I am an alms-food eater by birth," is called intoxication with the alms-round (piṇḍapātikamado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Những vị tỳ khưu khác chỉ là người thực hành hạnh khất thực giữa chừng, còn ta là người thực hành hạnh khất thực từ khi sinh ra,” được gọi là kiêu căng về hạnh khất thực (piṇḍapātikamado).
‘‘Avasesā sattā uññātā avaññātā, ahaṃ pana anavaññāto’’ti majjanavasena uppanno māno anavaññattimado nāma.
The conceit that arises by way of infatuation, thinking, "Other beings are scorned and despised, but I am not despised," is called intoxication with not being despised (anavaññattimado).
Kiêu mạn khởi lên do say đắm với ý nghĩ: “Những chúng sanh khác bị xem thường, bị khinh miệt, còn ta thì không bị khinh miệt,” được gọi là kiêu căng về sự không bị khinh miệt (anavaññattimado).
‘‘Avasesānaṃ sattānaṃ iriyāpatho apāsādiko, mayhaṃ pana pāsādiko’’ti majjanavasena uppanno māno iriyāpathamado nāma.
The conceit arising from the exultation, "The deportment of other beings is unpleasing, but mine is pleasing," is called deportment-conceit (iriyāpathamada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Oai nghi của các chúng sanh khác là không đáng ưa, còn của ta thì đáng ưa’’, được gọi là kiêu mạn về oai nghi (iriyāpathamado).
‘‘Avasesā sattā chinnapakkhakākasadisā, ahaṃ pana mahiddhiko mahānubhāvo’’ti vā ‘‘ahaṃ yaṃ yaṃ kammaṃ karomi, taṃ taṃ ijjhatī’’ti vā majjanavasena uppanno māno iddhimado nāma.
The conceit arising from the exultation, "Other beings are like crows with broken wings, but I am very powerful and influential," or "Whatever action I undertake, that succeeds," is called power-conceit (iddhimada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Các chúng sanh khác giống như quạ bị cắt cánh, còn ta thì có đại thần thông, có đại uy lực’’, hoặc ‘‘Ta làm bất cứ việc gì, việc đó đều thành công’’, được gọi là kiêu mạn về thần thông (iddhimado).
Yasamado pana agārikenapi anagārikenapi dīpetabbo.
Fame-conceit (yasamada), however, should be explained in terms of both householders and renunciants.
Còn kiêu mạn về danh tiếng (yasamado) có thể được giải thích cho cả gia chủ và người xuất gia.
Agārikopi hi ekacco aṭṭhārasasu seṇīsu ekissā jeṭṭhako hoti, tassa ‘‘avasese purise ahaṃ paṭṭhapemi, ahaṃ vicāremī’’ti, anagārikopi ekacco katthaci jeṭṭhako hoti, tassa ‘‘avasesā bhikkhū mayhaṃ ovāde vattanti, ahaṃ jeṭṭhako’’ti majjanavasena uppanno māno yasamado nāma.
For indeed, some householder is the chief of one of the eighteen guilds, and for him, the thought is, "I appoint other men; I supervise them." And some renunciant is the chief in some place, and for him, the thought is, "The other bhikkhus follow my advice; I am the chief." The conceit arising from this exultation is called fame-conceit (yasamada).
Quả thật, một số gia chủ là người đứng đầu trong một trong mười tám nghiệp đoàn, đối với người ấy, sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Ta bổ nhiệm những người khác, ta quản lý họ.’’ Và một số người xuất gia là người đứng đầu ở một nơi nào đó, đối với người ấy, sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Các tỳ khưu khác tuân theo lời khuyên của ta, ta là người đứng đầu.’’ Đó được gọi là kiêu mạn về danh tiếng (yasamado).
‘‘Avasesā sattā dussīlā, ahaṃ pana sīlavā’’ti majjanavasena uppanno māno sīlamado nāma.
The conceit arising from the exultation, "Other beings are immoral, but I am virtuous," is called virtue-conceit (sīlamada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Các chúng sanh khác là kẻ ác giới, còn ta thì có giới hạnh’’, được gọi là kiêu mạn về giới hạnh (sīlamado).
‘‘Avasesānaṃ sattānaṃ kukkuṭassa udakapānamattepi kāle cittekaggatā natthi, ahaṃ pana upacārappanānaṃ lābhī’’ti majjanavasena uppanno māno jhānamado nāma.
The conceit arising from the exultation, "Other beings do not have concentration of mind even for the time it takes a fowl to drink water, but I am a recipient of access and absorption," is called jhana-conceit (jhānamada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Các chúng sanh khác không có tâm định chỉ trong thời gian một con gà uống nước, còn ta thì thành tựu cận định và an chỉ định’’, được gọi là kiêu mạn về thiền định (jhānamado).
‘‘Avasesā sattā nissippā, ahaṃ sippavā’’ti majjanavasena uppanno māno sippamado nāma.
The conceit arising from the exultation, "Other beings are unskilled, but I am skilled," is called skill-conceit (sippamada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Các chúng sanh khác là không có tài năng, còn ta thì có tài năng’’, được gọi là kiêu mạn về tài năng (sippamado).
‘‘Avasesā sattā rassā, ahaṃ dīgho’’ti majjanavasena uppanno māno ārohamado nāma.
The conceit arising from the exultation, "Other beings are short, but I am tall," is called stature-conceit (ārohamada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Các chúng sanh khác thì lùn, còn ta thì cao’’, được gọi là kiêu mạn về chiều cao (ārohamado).
‘‘Avasesā sattā rassā vā honti dīghā vā, ahaṃ nigrodhaparimaṇḍalo’’ti majjanavasena uppanno māno pariṇāhamado nāma.
The conceit arising from the exultation, "Other beings are either short or tall, but I am proportioned like a banyan tree," is called girth-conceit (pariṇāhamada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Các chúng sanh khác hoặc lùn hoặc cao, còn ta thì có thân hình tròn trịa như cây bàng’’, được gọi là kiêu mạn về chu vi thân thể (pariṇāhamado).
‘‘Avasesānaṃ sattānaṃ sarīrasaṇṭhānaṃ virūpaṃ bībhacchaṃ, mayhaṃ pana manāpaṃ pāsādika’’nti majjanavasena uppanno māno saṇṭhānamado nāma.
The conceit arising from the exultation, "The bodily form of other beings is ugly and repulsive, but mine is pleasant and pleasing," is called form-conceit (saṇṭhānamada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Hình dáng thân thể của các chúng sanh khác là xấu xí, ghê tởm, còn của ta thì khả ái, đáng ưa’’, được gọi là kiêu mạn về hình dáng (saṇṭhānamado).
‘‘Avasesānaṃ sattānaṃ sarīre bahū dosā, mayhaṃ pana sarīre kesaggamattampi vajjaṃ natthī’’ti majjanavasena uppanno māno pāripūrimado nāma.
The conceit arising from the exultation, "Other beings have many defects in their bodies, but in my body, there is not even a hair-tip's worth of fault," is called perfection-conceit (pāripūrimada).
Sự kiêu mạn khởi lên do nghĩ rằng: ‘‘Trên thân thể của các chúng sanh khác có nhiều lỗi lầm, còn trên thân thể của ta không có dù chỉ một sợi tóc lỗi lầm’’, được gọi là kiêu mạn về sự hoàn hảo (pāripūrimado).
Evamayaṃ sabbopi jātiādiṃ nissāya majjanākāravasappavatto māno idha ‘‘mado’’ti vutto.
Thus, all this conceit, arising from exultation based on birth and so on, is here referred to as "mado" (conceit).
Như vậy, tất cả sự kiêu mạn này, khởi lên do thái độ tự mãn dựa trên chủng tộc, v.v., ở đây được gọi là ‘‘mado’’ (kiêu mạn).
Kāmaguṇesu cittassa vossaggo pamādo, pañcasu kāmaguṇesu satiyā aniggaṇhitvā cittassa vossajjanaṃ, sativirahoti vuttaṃ hoti.
The mind's abandonment in sensual pleasures is negligence (pamādo); it means the mind's abandonment without restraining mindfulness regarding the five sense pleasures, that is to say, the absence of mindfulness.
Sự buông thả tâm vào các dục lạc là phóng dật (pamādo), tức là sự buông thả tâm mà không kiềm chế chánh niệm đối với năm dục lạc, có nghĩa là thiếu chánh niệm.
Taṇhāvijjā pākaṭāyeva.
Craving and ignorance (taṇhāvijjā) are obvious.
Ái và vô minh (taṇhāvijjā) thì đã rõ.
Lobhādayo ca puna tividhākusalamūlanti tikavasena gahitā.
Greed and the others are again taken as a triad in the term three kinds of unwholesome roots (tividhākusalamūla).
Tham, v.v., lại được gọi là ba căn bất thiện (tividhākusalamūla) theo cách phân loại ba loại.
Duccaritādīsupi tividha-saddo paccekaṃ yojetabbo.
In the case of misconduct and so on, the word three kinds (tividha) should be applied to each separately.
Trong các ác hạnh, v.v., từ ba loại (tividha) cũng phải được ghép riêng biệt.
Tattha kāyaduccaritādīni tividhaduccaritāni.
Among them, bodily misconduct and so on are the three kinds of misconduct (tividhaduccaritāni).
Trong đó, các ác hạnh về thân, v.v., là ba ác hạnh (tividhaduccaritāni).
Taṇhāsaṃkilesādayo tividhasaṃkilesā.
Craving defilements and so on are the three kinds of defilements (tividhasaṃkilesā).
Các phiền não như ái, v.v., là ba phiền não (tividhasaṃkilesā).
Rāgamalādayo malīnabhāvakarattā tividhamalāni.
Greed-stains and so on are the three kinds of stains (tividhamalāni) because they cause defilement.
Các cấu uế như tham, v.v., vì làm cho tâm bị ô uế nên là ba cấu uế (tividhamalāni).
Rāgādayo hi cittaṃ malīnaṃ karonti, malaṃ gāhāpenti, tasmā ‘‘malānī’’ti vuccanti.
Indeed, greed and others defile the mind, they cause it to accumulate impurities; therefore, they are called "malāni" (stains).
Tham, v.v., làm cho tâm bị ô uế, làm cho tâm nhiễm ô, do đó chúng được gọi là ‘‘malāni’’ (cấu uế).
‘‘Rāgo visamaṃ, doso visamaṃ, moho visama’’nti (vibha. 924) evaṃ vuttā rāgādayo ‘‘kāyavisamaṃ vacīvisamaṃ manovisama’’nti (vibha. 924) evamāgatā kāyaduccaritādayo ca tividhavisamāni.
Greed and others, spoken of as "Greed is uneven, hatred is uneven, delusion is uneven" (Vibh. 924), and bodily misconduct and others, presented as "bodily unevenness, verbal unevenness, mental unevenness" (Vibh. 924), are the three kinds of unevennesses (tividhavisamāni).
Tham, v.v., được nói là: ‘‘Tham là bất bình đẳng, sân là bất bình đẳng, si là bất bình đẳng’’ (Vb. 924), và các ác hạnh về thân, v.v., được nói là: ‘‘Bất bình đẳng về thân, bất bình đẳng về lời nói, bất bình đẳng về ý’’ (Vb. 924), là ba sự bất bình đẳng (tividhavisamāni).
Tāni pana yasmā rāgādīsu ceva kāyaduccaritādīsu ca sattā pakkhalanti, pakkhalitā ca sāsanatopi sugatitopi patanti, tasmā pakkhalanapātahetubhāvato ‘‘visamānī’’ti vuccanti.
However, since beings stumble on greed and so on, and on bodily misconduct and so on, and having stumbled, fall from both the Dispensation and a good destination, they are called "visamāni" (unevennesses) because they are causes of stumbling and falling.
Tuy nhiên, bởi vì các chúng sanh trượt ngã vào tham, v.v., và các ác hạnh về thân, v.v., và khi trượt ngã, họ rơi khỏi giáo pháp và thiện thú, do đó, vì là nguyên nhân của sự trượt ngã và rơi rớt, chúng được gọi là ‘‘visamāni’’ (bất bình đẳng).
‘‘Kāmasaññā byāpādasaññā vihiṃsāsaññā’’ti (vibha. 911) evamāgatā kāmādipaṭisaṃyuttā saññā tividhasaññā.
Perceptions connected with sensuality and so on, as presented by "perception of sensuality, perception of ill will, perception of harming" (Vibh. 911), are the three kinds of perceptions (tividhasaññā).
Các tưởng liên hệ đến dục, v.v., được nói là: ‘‘Dục tưởng, sân tưởng, hại tưởng’’ (Vb. 911), là ba loại tưởng (tividhasaññā).
Tathā ‘‘kāmavitakko byāpādavitakko vihiṃsāvitakko’’ti evamāgatā tividhavitakkā.
Likewise, thoughts (vitakkā) as presented by "thought of sensuality, thought of ill will, thought of harming" are the three kinds of thoughts (tividhavitakkā).
Cũng vậy, các tầm được nói là: ‘‘Dục tầm, sân tầm, hại tầm’’, là ba loại tầm (tividhavitakkā).
Taṇhāpapañco diṭṭhipapañco mānapapañcoti ime tividhapapañcā.
These — craving-proliferation, view-proliferation, conceit-proliferation — are the three kinds of proliferations (tividhapapañcā).
Ái hý luận, kiến hý luận, mạn hý luận, đây là ba loại hý luận (tividhapapañcā).
Vaṭṭasmiṃ satte papañcentīti taṇhādayo ‘‘papañcā’’ti vuccanti.
Craving and others are called "papañcā" (proliferations) because they cause beings to proliferate in the cycle of existence.
Ái, v.v., được gọi là ‘‘papañcā’’ (hý luận) vì chúng làm cho chúng sanh bị trói buộc trong vòng luân hồi.
Catubbidhavipariyesātiādīsu catubbidha-saddo paccekaṃ yojetabbo.
In four kinds of perversions (catubbidhavipariyesā) and so on, the word four kinds (catubbidha) should be applied to each separately.
Trong bốn loại điên đảo (catubbidhavipariyesā), v.v., từ bốn loại (catubbidha) phải được ghép riêng biệt.
Tattha aniccādīni vatthūni niccantiādinā nayena viparītato esantīti vipariyesā.
Among these, perversions (vipariyesā) mean seeking things like impermanence in the opposite way, as permanence and so on.
Trong đó, các đối tượng như vô thường, v.v., được tìm kiếm một cách sai lầm theo cách nghĩ rằng là thường, v.v., do đó là điên đảo (vipariyesā).
‘‘Anicce niccanti saññāvipariyeso cittavipariyeso diṭṭhivipariyeso, dukkhe sukhanti saññāvipariyeso cittavipariyeso diṭṭhivipariyeso, asubhe subhanti saññāvipariyeso cittavipariyeso diṭṭhivipariyeso, anattani attāti saññāvipariyeso cittavipariyeso diṭṭhivipariyeso’’ti evamāgatā dvādasa vipallāsā catunnaṃ aniccādivatthūnaṃ vasena ‘‘catubbidhavipariyesā’’ti vuttā.
The twelve perversions, presented as "perversion of perception, perversion of mind, perversion of view regarding the impermanent as permanent; perversion of perception, perversion of mind, perversion of view regarding suffering as happiness; perversion of perception, perversion of mind, perversion of view regarding the unattractive as attractive; perversion of perception, perversion of mind, perversion of view regarding non-self as self" are called four kinds of perversions (catubbidhavipariyesā) based on the four objects: impermanent and so on.
Mười hai sự đảo lộn được nói là: ‘‘Đối với vô thường là thường: tưởng điên đảo, tâm điên đảo, kiến điên đảo; đối với khổ là lạc: tưởng điên đảo, tâm điên đảo, kiến điên đảo; đối với bất tịnh là tịnh: tưởng điên đảo, tâm điên đảo, kiến điên đảo; đối với vô ngã là ngã: tưởng điên đảo, tâm điên đảo, kiến điên đảo’’, được gọi là bốn loại điên đảo (catubbidhavipariyesā) theo bốn đối tượng vô thường, v.v.
Ettha pana cittakiccassa dubbalaṭṭhāne diṭṭhivirahitāya akusalasaññāya sakakiccassa balavakāle saññāvipallāso veditabbo, diṭṭhivirahitasseva akusalacittassa sakakiccassa balavakāle cittavipallāso, diṭṭhisampayuttacitte diṭṭhivipallāso.
Here, the perversion of perception should be understood as occurring when the mind's function is weak, and unwholesome perception, devoid of wrong view, is strong in its own function; the perversion of mind as occurring when unwholesome consciousness, devoid of wrong view, is strong in its own function; and the perversion of view as occurring in consciousness conjoined with wrong view.
Ở đây, tưởng điên đảo cần được hiểu là khi chức năng của tâm yếu kém, tưởng bất thiện không kèm theo tà kiến mạnh mẽ trong chức năng của nó; tâm điên đảo là khi tâm bất thiện không kèm theo tà kiến mạnh mẽ trong chức năng của nó; kiến điên đảo là khi có tà kiến đi kèm với tâm.
Tasmā sabbadubbalo saññāvipallāso, tato balavataro cittavipallāso, sabbabalavataro diṭṭhivipallāso.
Therefore, the perversion of perception is the weakest, the perversion of mind is stronger than that, and the perversion of view is the strongest of all.
Do đó, tưởng điên đảo là yếu nhất, tâm điên đảo mạnh hơn, và kiến điên đảo là mạnh nhất.
Ajātabuddhidārakassa kahāpaṇadassanaṃ viya saññā ārammaṇassa upaṭṭhānākāramattagahaṇato.
Perception is like the sight of a coin by a child whose intelligence is not yet born, as it merely grasps the aspect of the object's appearance.
Tưởng giống như đứa trẻ chưa phát triển trí tuệ nhìn thấy đồng tiền, chỉ nắm bắt được hình thức xuất hiện của đối tượng.
Gāmikapurisassa kahāpaṇadassanaṃ viya cittaṃ lakkhaṇappaṭivedhassapi sampādanato.
Mind is like the sight of a coin by a villager, as it even accomplishes the penetration of characteristics.
Tâm giống như người dân quê nhìn thấy đồng tiền, cũng có thể nhận biết được đặc tính.
Kammārassa mahāsaṇḍāsena ayogahaṇaṃ viya diṭṭhi abhinivesaparāmasanato.
View is like a blacksmith grasping iron with large tongs, as it clings with strong attachment.
Kiến giống như người thợ rèn dùng kẹp lớn kẹp sắt, bám chặt vào đối tượng.
Tattha cattāro diṭṭhivipallāsā, aniccānattesu niccantiādivasappavattā cattāro saññācittavipallāsāti ime aṭṭha vipallāsā sotāpattimaggena pahīyanti.
Among these, the four perversions of view, and the eight perversions of perception and mind that arise based on the impermanent and non-self as permanent and so on, are abandoned by the path of stream-entry.
Trong đó, bốn kiến điên đảo, và tám tưởng điên đảo và tâm điên đảo đối với vô thường, vô ngã là thường, v.v., được đoạn trừ bằng đạo Tu-đà-hoàn.
Asubhe subhanti saññācittavipallāsā sakadāgāmimaggena tanukā honti, anāgāmimaggena pahīyanti.
The perversions of perception and mind regarding the unattractive as attractive become attenuated by the path of once-returning and are abandoned by the path of non-returning.
Tưởng điên đảo và tâm điên đảo đối với bất tịnh là tịnh thì giảm bớt bằng đạo Tư-đà-hàm, và được đoạn trừ bằng đạo A-na-hàm.
Dukkhe sukhanti saññācittavipallāsā arahattamaggena pahīyantīti veditabbā.
The perversions of perception and mind regarding suffering as happiness are to be understood as abandoned by the path of arahantship.
Tưởng điên đảo và tâm điên đảo đối với khổ là lạc thì được đoạn trừ bằng đạo A-la-hán.
‘‘Kāmāsavo bhavāsavo diṭṭhāsavo avijjāsavo’’ti (cūḷani. jatukaṇṇimāṇavapucchāniddesa 69) evamāgatā kāmataṇhādayo cattāro āsavanti cakkhuādito sandanti pavattantīti āsavā.
Craving for sensuality and others, presented as "the canker of sensuality, the canker of existence, the canker of views, the canker of ignorance" (Cūḷani. Jatukaṇṇimāṇavapucchāniddesa 69), are the four cankers (āsavā) because they flow, or proceed, from the eye and so on.
Các ái dục, v.v., được nói là: ‘‘Dục lậu, hữu lậu, kiến lậu, vô minh lậu’’ (Cūḷani. Jatukaṇṇimāṇavapucchāniddesa 69), là bốn loại lậu hoặc (āsavā) vì chúng chảy ra, khởi lên từ mắt, v.v.
Kiñcāpi cakkhuādito kusalādīnampi pavatti atthi, kāmāsavādayo eva pana vaṇato yūsaṃ viya paggharaṇakaasucibhāvena sandanti, tasmā te eva ‘‘āsavā’’ti vuccanti.
Although wholesome states and so on also proceed from the eye and so on, it is only the cankers of sensuality and others that flow like pus from a wound, being impure and oozing; therefore, only they are called "āsavā" (cankers).
Mặc dù các pháp thiện, v.v., cũng khởi lên từ mắt, v.v., nhưng chỉ có các dục lậu, v.v., mới chảy ra như mủ từ vết thương, với tính chất bất tịnh chảy tràn, do đó chúng mới được gọi là ‘‘āsavā’’ (lậu hoặc).
Tattha hi paggharaṇakaasucimhi niruḷho āsavasaddoti.
For here, the word "āsava" is firmly established for oozing impurity.
Trong đó, từ āsava được dùng để chỉ chất bất tịnh chảy tràn.
Atha vā dhammato yāva gotrabhuṃ, okāsato yāva bhavaggaṃ savanti gacchanti ārammaṇakaraṇavasena pavattantīti āsavā, ete dhamme etañca okāsaṃ antokaritvā pavattantīti attho.
Alternatively, cankers (āsavā) mean that they flow or go in terms of phenomena as far as the gotrabhu-citta, and in terms of space as far as the highest existence, proceeding by taking objects as their support; the meaning is that they proceed by enclosing these phenomena and this space.
Hoặc nữa, chúng chảy ra, đi đến từ pháp cho đến Gotrabhu (chuyển tộc), từ không gian cho đến Bhavagga (đỉnh hữu), khởi lên theo cách làm đối tượng, do đó là āsavā, nghĩa là chúng khởi lên bao gồm các pháp này và không gian này.
Avadhiattho hi ā-kāro.
For the letter ā denotes a boundary.
Chữ ā có nghĩa là giới hạn.
Avadhi ca mariyādābhividhibhedato duvidho.
A boundary, moreover, is of two kinds: delimitation (mariyādā) and inclusion (abhividhi).
Giới hạn thì có hai loại: giới hạn bao gồm và giới hạn không bao gồm.
Tattha mariyādaṃ kiriyaṃ bahikatvā pavattati yathā ‘‘āpāṭaliputtaṃ vuṭṭho devo’’ti, abhividhi pana kiriyaṃ byāpetvā pavattati yathā ‘‘ābhavaggaṃ bhagavato yaso pavattatī’’ti, abhividhiattho cāyaṃ ā-kāro idha gahito, tasmā te dhamme tañca okāsaṃ antokaritvā ārammaṇakaraṇavasena savantīti ‘‘āsavā’’ti vuccanti.
There, in the sense of a boundary, the action proceeds by excluding, as in “The deva rained up to Pāṭaliputta.” But in the sense of inclusivity, the action proceeds by pervading, as in “The Blessed One’s fame extends up to the Bhavagga.” And this particle “ā” is taken here in the sense of inclusivity. Therefore, because they flow, in the sense of making those dhammas and that location their object by including them, they are called “āsavā.”
Ở đó, hành động giới hạn xảy ra bằng cách loại trừ ranh giới, như "vị trời mưa đến Pāṭaliputta" (mưa đến ranh giới Pāṭaliputta rồi dừng lại); còn hành động bao trùm xảy ra bằng cách lan tỏa, như "danh tiếng của Thế Tôn lan đến tận đỉnh hữu". Và ý nghĩa bao trùm của tiền tố ā này được lấy ở đây. Do đó, vì chúng chảy (savantīti) bằng cách bao trùm những pháp ấy và cả nơi chốn ấy, lấy chúng làm đối tượng, nên chúng được gọi là āsavā (lậu hoặc).
Cirapārivāsiyaṭṭhena madirādayo āsavā viyātipi āsavā.
They are also “āsavā” because, like spirits and so on which have been kept for a long time, they are of long-standing residence.
Chúng cũng là āsavā theo nghĩa là những thứ đã được ủ lâu ngày, giống như rượu bia và các loại khác.
Lokasmiñhi cirapārivāsikā madirādayo ‘‘āsavā’’ti vuccanti.
For in the world, long-stored liquor and so on are called “āsavā”.
Trong đời, rượu bia và các loại khác đã được ủ lâu ngày được gọi là "āsavā".
Yadi ca cirapārivāsiyaṭṭhena āsavā, eteyeva bhavitumarahanti.
And if āsavā are in the sense of being long-stored, then these very ones are fit to be so.
Và nếu chúng là āsavā theo nghĩa đã được ủ lâu ngày, thì chỉ những điều này mới có thể là như vậy.
Vuttañhetaṃ ‘‘purimā, bhikkhave, koṭi na paññāyati avijjāya, ito pubbe avijjā nāhosī’’tiādi (a. ni. 10.61).
For this has been said: “Monks, a first point of ignorance is not discerned, such that before this, there was no ignorance,” and so on.
Điều này đã được nói: "Này các Tỳ-kheo, không thể nhận biết điểm khởi đầu của vô minh, không có vô minh trước đó," v.v. (A.X.61).
Aññesu pana yathāvutte dhamme okāsañca ārammaṇaṃ katvā pavattamānesu mānādīsu ca vijjamānesu attattaniyādiggāhavasena abhibyāpanaṃ madanakaraṇavasena āsavasadisatā ca etesaṃyeva, na aññesanti dvīsupi atthavikappesu etesuyeva āsavasaddo niruḷhoti daṭṭhabbo.
Furthermore, in both interpretations of the meaning, it should be seen that the term āsava is established only for these, and not for others, because for them alone there is the pervasion by way of grasping at ‘self’ and ‘mine’ and the resemblance to an intoxicant by way of causing intoxication, while other aforementioned things are occurring having made opportunity and an object, and while pride and so on are present.
Tuy nhiên, khi những pháp được nói trên và nơi chốn được lấy làm đối tượng, và khi những sự kiêu mạn v.v. tồn tại, thì sự bao trùm theo nghĩa chấp thủ "ta" và "của ta" v.v., và sự tương đồng với āsava theo nghĩa làm cho say đắm, chỉ thuộc về những điều này, chứ không phải những điều khác. Do đó, cần phải hiểu rằng từ āsava được thiết lập vững chắc cho những điều này trong cả hai cách giải thích ý nghĩa.
Āyataṃ vā saṃsāradukkhaṃ savanti pasavantītipi āsavā.
Or, they are āsavā because they flow and pour forth the long suffering of saṃsāra.
Chúng cũng là āsavā vì chúng làm chảy (savanti), làm phát sinh khổ đau luân hồi lâu dài (āyataṃ saṃsāradukkhaṃ).
Na hi taṃ kiñci saṃsāradukkhaṃ atthi, yaṃ āsavehi vinā uppajjeyya.
For there is no suffering of saṃsāra whatsoever that could arise without the āsavā.
Thật vậy, không có khổ đau luân hồi nào có thể phát sinh mà không có các āsava.
‘‘Abhijjhā kāyagantho byāpādo kāyagantho sīlabbataparāmāso kāyagantho idaṃsaccābhiniveso kāyagantho’’ti (saṃ. ni. 5.175; mahāni. 29, 147) evamāgatā abhijjhādayo cattāro yassa saṃvijjanti, taṃ cutipaṭisandhivasena vaṭṭasmiṃ ganthenti ghaṭentīti ganthā.
The four things beginning with covetousness that have come down as: “The bodily tie of covetousness, the bodily tie of ill will, the bodily tie of adherence to rules and observances, the bodily tie of insistent adherence to this as the only truth”—if these are found in someone, they are ganthā (ties) because they tie or bind that person to the round of rebirth by way of death and relinking.
Bốn điều như tham lam, sân hận, giới cấm thủ, và chấp thủ "đây là sự thật" được nói đến như "Tham lam là một thân kiết sử, sân hận là một thân kiết sử, giới cấm thủ là một thân kiết sử, chấp thủ 'đây là sự thật' là một thân kiết sử" (S.V.175; Mahāniddesa 29, 147), những điều này ganthenti (kết buộc) hoặc ghaṭentīti (nối liền) người nào có chúng vào vòng luân hồi theo nghĩa tái sinh và tử vong, nên chúng được gọi là ganthā (kiết sử).
‘‘Kāmogho bhavogho diṭṭhogho avijjogho’’ti (saṃ. ni. 5.172; mahāni. 14; cūḷani. mettagūmāṇavapucchāniddesa 21) evamāgatā cattāro kāmataṇhādayo yassa saṃvijjanti, taṃ vaṭṭasmiṃ ohananti osīdāpentīti oghā.
The four things beginning with sensual craving that have come down as: “The flood of sensuality, the flood of existence, the flood of views, the flood of ignorance”—if these are found in someone, they are oghā (floods) because they overwhelm or submerge that person in the round of rebirth.
Bốn điều như dục lậu, hữu lậu, tà kiến lậu, và vô minh lậu được nói đến như "Dục lậu, hữu lậu, tà kiến lậu, vô minh lậu" (S.V.172; Mahāniddesa 14; Cūḷaniddesa, Mettagūmāṇavapucchāniddesa 21), những điều này ohananti (nhấn chìm) hoặc osīdāpentīti (làm cho chìm xuống) người nào có chúng vào vòng luân hồi, nên chúng được gọi là oghā (bộc lưu).
Teyeva ‘‘kāmayogo bhavayogo diṭṭhiyogo avijjāyogo’’ti (saṃ. ni. 5.173; a. ni. 4.10) evamāgatā vaṭṭasmiṃ yojentīti yogā.
Those same things that have come down as: “The yoke of sensuality, the yoke of existence, the yoke of views, the yoke of ignorance,” are yogā (yokes) because they yoke one to the round of rebirth.
Chính những điều đó, được nói đến như "dục trói buộc, hữu trói buộc, kiến trói buộc, vô minh trói buộc" (S.V.173; A.IV.10), yojentīti (kết nối) người nào có chúng vào vòng luân hồi, nên chúng được gọi là yogā (kiết phược).
Ariyā etāya na gacchantīti agati, sā chandādivasena catubbidhā.
That by which noble ones do not go is agati (a wrong course); it is fourfold by way of desire and so on.
Các bậc Thánh không đi theo những điều này, nên chúng là agati (ác thú, con đường sai trái); chúng có bốn loại theo nghĩa dục, sân, v.v.
‘‘Cīvarahetu vā bhikkhuno taṇhā uppajjamānā uppajjati, piṇḍapāta, senāsana, itibhavābhavahetu vā bhikkhuno taṇhā uppajjamānā uppajjatī’’ti (a. ni. 4.9) evamāgatā cattāro taṇhuppādā.
The four things that have come down as: “Craving arises in a monk on account of robes, or craving arises on account of almsfood, lodging, or on account of this or that state of existence,” are the four taṇhuppādā (arisings of craving).
Bốn taṇhuppādā (nguồn gốc của tham ái) được nói đến như "Này các Tỳ-kheo, khi tham ái khởi lên, nó khởi lên vì y phục, hoặc vì đồ ăn khất thực, hoặc vì chỗ ở, hoặc vì sự tồn tại và không tồn tại" (A.IV.9).
Tattha itibhavābhavahetūti ettha itīti nidassane nipāto, yathā cīvarādihetu, evaṃ bhavābhavahetupīti attho.
Therein, in the phrase “itibhavābhavahetū” (on account of this or that state of existence), “iti” is an indicative particle; the meaning is: just as on account of robes and so on, so also on account of this or that state of existence.
Ở đây, trong itibhavābhavahetū (vì sự tồn tại và không tồn tại), itī là một giới từ biểu thị sự ví dụ, nghĩa là "cũng như vì y phục v.v., thì cũng vậy vì sự tồn tại và không tồn tại".
Bhavābhavoti cettha paṇītapaṇītatarāni telamadhuphāṇitādīni adhippetāni.
And here by “bhavābhava” are meant fine and finer things such as oil, honey, molasses, and so on.
Và ở đây, bhavābhavo (sự tồn tại và không tồn tại) ám chỉ những thứ tinh tế hơn và tinh tế nhất như dầu, mật, đường thốt nốt, v.v.
Kāmupādānādīni cattāri upādānāni.
The four upādāna are those beginning with grasping at sensual pleasures.
Bốn upādānāni (thủ) là dục thủ, v.v.
Pañca cetokhilātiādīsu ‘‘buddhe kaṅkhati, dhamme, saṅghe, sikkhāya kaṅkhati, sabrahmacārīsu kupito hoti anattamano āhatacitto khilajāto’’ti (ma. ni. 1.185; dī. ni. 3.319) evamāgatāni pañca cetokhilāni, ceto khilayati thaddhabhāvaṃ āpajjati etehīti cetokhilāni.
In the section beginning with “Pañca cetokhilā” (the five mental barrennesses), the five things that have come down as: “He is uncertain about the Buddha, he is uncertain about the Dhamma, the Saṅgha, he is uncertain about the training, he is angry and displeased with his companions in the holy life, his heart wounded, in a state of barrenness,” are the five mental barrennesses. They are cetokhilāni because the mind becomes barren, enters a state of rigidity, through them.
Trong pañca cetokhilā (năm chướng ngại tâm) v.v., năm chướng ngại tâm được nói đến như "nghi ngờ Phật, nghi ngờ Pháp, nghi ngờ Tăng, nghi ngờ Giới, tức giận và bất mãn với các bạn đồng phạm hạnh, tâm bị tổn thương, trở nên cứng rắn" (M.I.185; D.III.319). Chúng được gọi là cetokhilāni (chướng ngại tâm) vì tâm trở nên cứng nhắc, thô cứng bởi chúng.
Vinibandhādīsupi pañca-saddo paccekaṃ yojetabbo.
In “vinibandhādīsu” (in the bondages, etc.) also, the word “pañca” (five) should be applied to each.
Trong vinibandhādīsu (các trói buộc tâm v.v.) cũng vậy, từ pañca (năm) phải được ghép riêng lẻ.
‘‘Kāme avītarāgo hoti, kāye avītarāgo, rūpe avītarāgo, yāvadatthaṃ udarāvadehakaṃ bhuñjitvā seyyasukhaṃ passasukhaṃ middhasukhaṃ anuyutto viharati, aññataraṃ devanikāyaṃ paṇidhāya brahmacariyaṃ caratī’’ti (ma. ni. 1.186; dī. ni. 3.320) āgatā pañca cittaṃ bandhitvā muṭṭhiyaṃ katvā viya gaṇhantīti cetovinibandhā.
The five things that have come down as: “He is not free from lust for sensual pleasures, he is not free from lust for the body, he is not free from lust for forms, he eats his fill, as much as his belly can hold, and dwells committed to the pleasure of lying down, the pleasure of lolling, the pleasure of torpor, he lives the holy life aspiring to some order of gods,” are cetovinibandhā (mental bondages) because they bind the mind and seize it as if in a fist.
Năm điều được nói đến như "chưa ly tham dục, chưa ly tham thân, chưa ly tham sắc, ăn uống quá độ đến mức no căng bụng, sống buông thả theo sự an lạc của giấc ngủ, sự an lạc của sự nằm nghỉ, sự an lạc của sự uể oải, thực hành phạm hạnh với mục đích tái sinh vào một cõi trời nào đó" (M.I.186; D.III.320), chúng được gọi là cetovinibandhā (trói buộc tâm) vì chúng trói buộc tâm và nắm giữ nó như nắm trong nắm tay.
Ete hi taṇhāppavattibhāvato kusalappavattiyā avasarāppadānavasena cittaṃ bandhaṃ viya samorodhetvā gaṇhanti.
For these, by being manifestations of craving, seize the mind by constricting it, as it were, through not giving an opportunity for the arising of what is wholesome.
Thật vậy, những điều này, do sự phát sinh của tham ái, trói buộc và kiềm chế tâm như một sự ràng buộc, không cho phép cơ hội cho sự phát sinh của các pháp thiện.
Saddatthato pana ceto virūpaṃ nibandhīyati saṃyamīyati etehīti cetovinibandhā.
From the perspective of word-meaning, however, they are cetovinibandhā because the mind is variously bound, restrained, by them.
Tuy nhiên, theo nghĩa từ ngữ, chúng là cetovinibandhā vì tâm bị trói buộc một cách sai lệch, bị kiềm chế bởi chúng.
Kāmacchandādīni pañca kusaladhamme nīvārenti āvarantīti nīvaraṇāni.
The five things beginning with sensual desire are nīvaraṇāni (hindrances) because they hinder or obstruct wholesome states.
Năm điều như dục tham, v.v., nīvārenti (ngăn chặn) và āvarantīti (che lấp) các pháp thiện, nên chúng là nīvaraṇāni (triền cái).
Rūpābhinandanādayo pañcābhinandanā.
The pañcābhinandanā (five kinds of delight) are those beginning with delight in forms.
Năm pañcābhinandanā (năm sự hoan hỷ) là hoan hỷ sắc, v.v.
Cha vivādamūlātiādīsu kodho makkho issā sāṭheyyaṃ pāpicchatā sandiṭṭhiparāmāsoti imāni cha vivādamūlāni.
In the section beginning with “Cha vivādamūlā” (the six roots of disputes), these are the six roots of disputes: anger, contempt, envy, craftiness, evil desire, and adherence to one’s own views.
Trong cha vivādamūlā (sáu nguồn gốc tranh chấp) v.v., đây là sáu nguồn gốc tranh chấp: sân hận, lừa dối, ganh tỵ, xảo quyệt, ác dục, và chấp thủ tà kiến.
Yasmā kuddho vā kodhavasena…pe… sandiṭṭhiparāmāsī vā sandiṭṭhiparāmasitāya kalahaṃ viggahaṃ vivādaṃ āpajjati, tasmā kodhādayo ‘‘cha vivādamūlānī’’ti vuccanti.
Because a person who is angry, through anger… and so on… or who adheres to their own views, through adherence to their own views, enters into quarrels, conflicts, and disputes, therefore anger and the others are called the “six roots of disputes.”
Vì người tức giận do sân hận... v.v... hoặc người chấp thủ tà kiến do chấp thủ tà kiến mà rơi vào cãi vã, tranh chấp, bất hòa, nên sân hận v.v. được gọi là "sáu nguồn gốc tranh chấp".
Rūpataṇhāsaddataṇhādayo cha taṇhākāyā.
The cha taṇhākāyā (six bodies of craving) are craving for forms, craving for sounds, and so on.
Sáu taṇhākāyā (thân ái) là sắc ái, thanh ái, v.v.
Kāmarāgapaṭighadiṭṭhivicikicchābhavarāgamānāvijjā sattānusayā.
The sattānusayā (seven underlying tendencies) are sensual lust, aversion, views, doubt, conceit, lust for existence, and ignorance.
Bảy sattānusayā (tùy miên) là dục tham, sân hận, tà kiến, hoài nghi, hữu tham, mạn, và vô minh.
Thāmagataṭṭhena appahīnaṭṭhena ca anusentīti anusayā.
They are anusayā because they lie dormant in the sense of being powerful and in the sense of being unabandoned.
Chúng là anusayā (tùy miên) vì chúng tiềm ẩn theo nghĩa đã trở nên mạnh mẽ và chưa được đoạn trừ.
Micchādiṭṭhimicchāsaṅkappamicchāvācāmicchākammantamicchāājīvamicchāvāyāmamicchāsatimicchāsamādhī aṭṭha micchattā.
The aṭṭha micchattā (eight wrongnesses) are wrong view, wrong intention, wrong speech, wrong action, wrong livelihood, wrong effort, wrong mindfulness, and wrong concentration.
Tám aṭṭha micchattā (tám tà) là tà kiến, tà tư duy, tà ngữ, tà nghiệp, tà mạng, tà tinh tấn, tà niệm, tà định.
‘‘Taṇhaṃ paṭicca pariyesanā, pariyesanaṃ paṭicca lābho, lābhaṃ paṭicca vinicchayo, vinicchayaṃ paṭicca chandarāgo, chandarāgaṃ paṭicca ajjhosānaṃ, ajjhosānaṃ paṭicca pariggaho, pariggahaṃ paṭicca macchariyaṃ, macchariyaṃ paṭicca ārakkho, ārakkhādhikaraṇaṃ daṇḍādānasatthādānakalahaviggahavivādatuvaṃtuvaṃpesuññamusāvādā aneke pāpakā akusalā dhammā sambhavantī’’ti (dī. ni. 2.103; 3.359) evamāgatā pariyesanādayo nava taṇhāmūlakā.
The nava taṇhāmūlakā (nine things rooted in craving) are searching and so on, which have come down as: “Dependent on craving, there is searching; dependent on searching, there is acquisition; dependent on acquisition, there is decision; dependent on decision, there is desire and lust; dependent on desire and lust, there is attachment; dependent on attachment, there is possession; dependent on possession, there is stinginess; dependent on stinginess, there is safeguarding; and because of safeguarding, various evil, unwholesome states come into being: the taking up of clubs and weapons, quarrels, conflicts, disputes, ‘you, you’, slander, and lies.”
Những điều như tìm kiếm, v.v., được nói đến như "Do tham ái mà có tìm kiếm; do tìm kiếm mà có lợi lộc; do lợi lộc mà có quyết định; do quyết định mà có dục tham; do dục tham mà có chấp thủ; do chấp thủ mà có sở hữu; do sở hữu mà có keo kiệt; do keo kiệt mà có bảo vệ; do bảo vệ mà có việc cầm gậy, cầm dao, cãi vã, tranh chấp, bất hòa, vu khống, nói dối, và nhiều pháp bất thiện khác phát sinh" (D.II.103; D.III.359), đây là nava taṇhāmūlakā (chín điều có gốc rễ từ tham ái).
Tattha (dī. ni. aṭṭha. 2.103) taṇhaṃ paṭiccāti taṇhaṃ nissāya.
Therein, “taṇhaṃ paṭicca” (dependent on craving) means relying on craving.
Ở đây (D.A.II.103), taṇhaṃ paṭiccā (do tham ái) nghĩa là nương vào tham ái.
Pariyesanāti rūpādiārammaṇapariyesanā.
“Pariyesanā” (searching) is the searching for objects such as forms.
Pariyesanā (tìm kiếm) là tìm kiếm các đối tượng như sắc, v.v.
Sā hi taṇhāya sati hoti.
For that occurs when there is craving.
Thật vậy, điều đó xảy ra khi có tham ái.
Lābhoti rūpādiārammaṇapaṭilābho.
“Lābho” (acquisition) is the acquisition of objects such as forms.
Lābho (lợi lộc) là sự đạt được các đối tượng như sắc, v.v.
So hi pariyesanāya sati hoti.
For that occurs when there is searching.
Thật vậy, điều đó xảy ra khi có tìm kiếm.
Vinicchayoti idha vitakko adhippeto.
“Vinicchayo” (decision) here refers to thought.
Vinicchayo (quyết định) ở đây ám chỉ tầm (vitakka).
Lābhaṃ labhitvā hi iṭṭhāniṭṭhaṃ sundarāsundarañca vitakkeneva vinicchinati ‘‘ettakaṃ me rūpārammaṇatthāya bhavissati, ettakaṃ saddādiārammaṇatthāya, ettakaṃ mayhaṃ bhavissati, ettakaṃ parassa, ettakaṃ paribhuñjissāmi, ettakaṃ nidahissāmī’’ti.
For having acquired an acquisition, one decides what is agreeable and disagreeable, beautiful and ugly, only through thought, thinking: “This much will be for my object of form, this much for objects of sound and so on; this much will be for me, this much for another; this much I will enjoy, this much I will put away.”
Sau khi đạt được lợi lộc, người ta quyết định điều đáng ưa và không đáng ưa, điều đẹp và không đẹp, chỉ bằng tầm: "Chừng này sẽ là cho đối tượng sắc của tôi, chừng này cho đối tượng thanh v.v., chừng này sẽ là của tôi, chừng này của người khác, chừng này tôi sẽ hưởng thụ, chừng này tôi sẽ cất giữ".
Tena vuttaṃ ‘‘lābhaṃ paṭicca vinicchayo’’ti.
Therefore it is said, “dependent on acquisition, there is decision.”
Vì thế đã nói "do lợi lộc mà có quyết định".
Chandarāgoti evaṃ akusalavitakkena vitakkite vatthusmiṃ dubbalarāgo ca balavarāgo ca uppajjati.
“Chandarāgo” (desire and lust): thus, in a thing considered with unwholesome thought, both weak lust and strong lust arise.
Chandarāgo (dục tham) là sự phát sinh tham ái yếu và tham ái mạnh đối với sự vật đã được tầm cầu bằng tầm bất thiện như vậy.
Chandoti hi idha dubbalarāgassādhivacanaṃ.
For “chando” (desire) is here a term for weak lust.
Thật vậy, chando (dục) ở đây là tên gọi của tham ái yếu.
Ajjhosānanti ahaṃ mamanti balavasanniṭṭhānaṃ.
“Ajjhosāna” (attachment) is a strong conviction of ‘I’ and ‘mine’.
Ajjhosāna (chấp thủ) là sự quyết định mạnh mẽ "tôi" và "của tôi".
Pariggahoti taṇhādiṭṭhivasena pariggahakaraṇaṃ.
“Pariggaho” (possession) is the act of taking possession by way of craving and views.
Pariggaho (sở hữu) là hành động sở hữu theo nghĩa tham ái và tà kiến.
Macchariyanti parehi sādhāraṇabhāvassa asahanatā.
“Macchariya” (stinginess) is the inability to endure a state of sharing with others.
Macchariya (keo kiệt) là sự không chịu đựng được việc chia sẻ với người khác.
Tenevassa porāṇā evaṃ vacanatthaṃ vadanti ‘‘idaṃ acchariyaṃ mayhameva hotu, mā aññassa acchariyaṃ hotūti pavattattā macchariyanti vuccatī’’ti.
For that very reason, the ancients state its etymology thus: “It is called macchariya because it proceeds with the thought, ‘Let this wonderful thing be for me alone, let it not be a wonderful thing for another.’”
Vì lý do này, các bậc cổ đức giải thích ý nghĩa của từ này như sau: "Nó được gọi là macchariya vì nó phát sinh với ý nghĩ 'điều kỳ diệu này chỉ nên thuộc về tôi, đừng để nó thuộc về người khác'."
Ārakkhoti dvārapidahanamañjusagopanādivasena suṭṭhu rakkhaṇaṃ.
“Ārakkho” (safeguarding) is thorough protection by means of shutting doors, securing chests, and so on.
Ārakkho (bảo vệ) là sự bảo vệ cẩn thận bằng cách đóng cửa, cất giữ trong rương, v.v.
Adhikarotīti adhikaraṇaṃ, kāraṇassetaṃ nāmaṃ.
'It governs' is adhikaraṇa; this is the name of a matter.
Adhikaraṇa là sự kiện, là tên của một nguyên nhân.
Ārakkhādhikaraṇanti bhāvanapuṃsakaṃ, ārakkhahetūti attho.
Ārakkhādhikaraṇa is a neuter noun expressing state, meaning 'on account of protection'.
Ārakkhādhikaraṇa là danh từ trung tính chỉ trạng thái, có nghĩa là nguyên nhân bảo vệ.
Daṇḍādānādīsu paranisedhanatthaṃ daṇḍassa ādānaṃ daṇḍādānaṃ.
Among matters like the taking of staffs, the taking of a staff for the purpose of restraining others is daṇḍādāna.
Daṇḍādāna là việc cầm gậy để ngăn cản người khác trong các việc như cầm gậy.
Ekatodhārādino satthassa ādānaṃ satthādānaṃ.
The taking of a weapon, such as a single-edged blade, is satthādāna.
Satthādāna là việc cầm vũ khí như dao một lưỡi.
Kalahoti kāyakalahopi vācākalahopi.
Kalaha refers to either a physical quarrel or a verbal quarrel.
Kalaha là tranh cãi bằng thân hoặc tranh cãi bằng lời nói.
Purimo purimo virodho viggaho.
The earlier form of opposition is viggaha.
Viggaha là sự đối kháng trước đó.
Pacchimo pacchimo vivādo.
The later form is vivāda.
Vivāda là sự tranh chấp sau đó.
Tuvaṃ tuvanti agāravavacanaṃ, tvaṃ tvanti attho.
Tuvaṃ tuvaṃ is a disrespectful address, meaning 'you, you'.
Tuvaṃ tuvaṃ là lời nói thiếu tôn trọng, có nghĩa là “ngươi, ngươi”.
Pāṇātipātaadinnādānakāmesumicchācāramusāvādapisuṇavācāpharusavācāsamphappalāpaabhijjhābyāpādamicchādiṭṭhī dasa akusalakammapathā.
Killing living beings, taking what is not given, sexual misconduct, false speech, slanderous speech, harsh speech, frivolous talk, covetousness, ill will, and wrong view are the ten unwholesome courses of action.
Sát sinh, trộm cắp, tà dâm, nói dối, nói lời đâm thọc, nói lời thô ác, nói lời vô ích, tham lam, sân hận, tà kiến – đó là mười ác nghiệp đạo.
Cattāro sassatavādā cattāro ekaccasassatavādā cattāro antānantikā cattāro amarāvikkhepikā dve adhiccasamuppannikā soḷasa saññīvādā aṭṭha asaññīvādā aṭṭha nevasaññīnāsaññīvādā satta ucchedavādā pañca paramadiṭṭhadhammanibbānavādāti etāni dvāsaṭṭhi diṭṭhigatāni.
The four eternalist views, the four partial eternalist views, the four views on finitude and infinitude, the four evasive views, the two fortuitous origination views, the sixteen views of percipient existence, the eight views of non-percipient existence, the eight views of neither percipient nor non-percipient existence, the seven annihilationist views, and the five views of supreme visible Nibbāna in this very life—these are the sixty-two wrong views.
Bốn thường kiến, bốn một phần thường kiến, bốn biên kiến, bốn hoài nghi, hai vô nhân kiến, mười sáu tưởng kiến, tám vô tưởng kiến, tám phi tưởng phi phi tưởng kiến, bảy đoạn kiến, năm hiện tại niết bàn kiến tối thượng – đó là sáu mươi hai tà kiến.
Rūpataṇhādichataṇhāyeva paccekaṃ kāmataṇhābhavataṇhāvibhavataṇhāvasena aṭṭhārasa honti.
The cravings, such as craving for form, individually become eighteen as craving for sensual pleasures, craving for existence, and craving for non-existence.
Chỉ riêng sáu loại ái như sắc ái, v.v., mỗi loại trở thành mười tám theo ba loại dục ái, hữu ái, phi hữu ái.
Tathā hi rūpārammaṇā taṇhā, rūpe vā taṇhāti rūpataṇhā, sā kāmarāgabhāvena rūpaṃ assādentī pavattamānā kāmataṇhā, sassatadiṭṭhisahagatarāgabhāvena ‘‘rūpaṃ niccaṃ dhuvaṃ sassata’’nti evaṃ assādentī pavattamānā bhavataṇhā, ucchedadiṭṭhisahagatarāgabhāvena ‘‘rūpaṃ ucchijjati vinassati pecca na bhavatī’’ti evaṃ assādentī pavattamānā vibhavataṇhāti evaṃ tividhā hoti.
Thus, craving that has form as its object, or craving in form, is rūpataṇhā (craving for form). When it proceeds while savoring form through the aspect of sensual passion, it is kāma-taṇhā (craving for sensual pleasures). When it proceeds while savoring in the manner of "form is permanent, stable, eternal" through the aspect of passion associated with eternalist view, it is bhava-taṇhā (craving for existence). When it proceeds while savoring in the manner of "form is annihilated, perishes, does not exist after death" through the aspect of passion associated with annihilationist view, it is vibhava-taṇhā (craving for non-existence). In this way, it is of three kinds.
Thật vậy, ái đối với sắc cảnh, hay ái trong sắc, gọi là sắc ái. Ái này khi diễn tiến bằng cách thưởng thức sắc dưới dạng dục tham thì là dục ái; khi diễn tiến bằng cách thưởng thức sắc như “sắc là thường, kiên cố, vĩnh cửu” dưới dạng tham dục đi kèm với thường kiến thì là hữu ái; khi diễn tiến bằng cách thưởng thức sắc như “sắc bị đoạn diệt, hoại diệt, sau khi chết sẽ không còn” dưới dạng tham dục đi kèm với đoạn kiến thì là phi hữu ái. Như vậy, ái có ba loại.
Yathā ca rūpataṇhā, evaṃ saddataṇhādayopīti etāni aṭṭhārasa taṇhāvicaritāni honti, tāni ajjhattarūpādīsu aṭṭhārasa, bahiddhārūpādīsu aṭṭhārasāti chattiṃsa, iti atītāni chattiṃsa, anāgatāni chattiṃsa, paccuppannāni chattiṃsāti aṭṭhasatataṇhāvicaritāni, aṭṭhuttarasatataṇhāvicaritānīti attho.
And just as with craving for form, so it is with craving for sounds, and so on. These become eighteen types of diversified craving. These are eighteen in internal forms, etc., and eighteen in external forms, etc., making thirty-six. Thus, thirty-six in the past, thirty-six in the future, and thirty-six in the present, which makes aṭṭhasatataṇhāvicaritāni, meaning one hundred and eight types of diversified craving.
Cũng như sắc ái, thì thinh ái, v.v., cũng vậy. Như vậy có mười tám sự diễn tiến của ái. Những điều đó có mười tám trong nội sắc, v.v., và mười tám trong ngoại sắc, v.v., tổng cộng là ba mươi sáu. Như vậy, ba mươi sáu trong quá khứ, ba mươi sáu trong vị lai, ba mươi sáu trong hiện tại – đó là một trăm lẻ tám sự diễn tiến của ái, có nghĩa là một trăm lẻ tám sự diễn tiến của ái.
Pabheda-saddo paccekaṃ sambandhitabbo.
The word pabheda (variety) should be connected individually.
Từ Pabheda (loại, phân loại) cần được liên hệ với từng từ.
Tatthāyaṃ yojanā ‘‘lobhappabhedo dosappabhedo yāva aṭṭhasatataṇhāvicaritappabhedo’’ti.
Here, the connection is "the variety of greed, the variety of hatred, up to the variety of one hundred and eight types of diversified craving."
Ở đây, cách ghép từ là “loại tham, loại sân, cho đến loại một trăm lẻ tám sự diễn tiến của ái”.
Sabbadarathapariḷāhakilesasatasahassānīti sabbāni sattānaṃ darathapariḷāhakarāni kilesānaṃ anekāni satasahassāni.
Sabbadarathapariḷāhakilesasatasahassāni means all hundreds of thousands of defilements that cause distress and anguish to beings.
Sabbadarathapariḷāhakilesasatasahassāni có nghĩa là tất cả hàng trăm ngàn phiền não gây ra sự lo lắng, phiền muộn cho chúng sinh.
Ārammaṇādivibhāgato hi pavattiākāravibhāgato ca anantappabhedā kilesā.
Indeed, defilements are of infinite varieties due to their division by object, etc., and their division by the mode of arising.
Thật vậy, phiền não có vô số loại theo sự phân chia đối tượng, v.v., và theo sự phân chia cách thức diễn tiến.
Saṅkhepato vātiādīsu sampati āyatiñca sattānaṃ anatthāvahattā māraṇaṭṭhena vibādhanaṭṭhena kilesāva māroti kilesamāro.
Regarding saṅkhepato vā (or in brief), etc.: defilements themselves are Māra due to their nature of killing and hindering, as they bring harm to beings both now and in the future; this is kilesamāra (Māra of defilements).
Trong Saṅkhepato vā (hay nói tóm lại), v.v., phiền não chính là ma (Māra) vì chúng gây hại cho chúng sinh ở hiện tại và tương lai theo nghĩa giết hại (māraṇaṭṭhena) và gây chướng ngại (vibādhanaṭṭhena). Đó là Kilesamāra (ma phiền não).
Vadhakaṭṭhena khandhāva māroti khandhamāro.
The aggregates themselves are Māra due to their nature of killing; this is khandhamāra (Māra of aggregates).
Các uẩn chính là ma theo nghĩa sát hại (vadhakaṭṭhena). Đó là Khandhamāra (ma uẩn).
Tathā hi vuttaṃ ‘‘vadhakaṃ rūpaṃ, vadhakaṃ rūpanti yathābhūtaṃ nappajānātī’’tiādi.
Thus, it is said: "Form is a slayer, form is a slayer, one does not rightly understand it as it truly is," and so on.
Thật vậy, đã nói rằng “sắc là kẻ sát hại, không như thật biết rằng sắc là kẻ sát hại”, v.v.
Jātijarādimahābyasananibbattanena abhisaṅkhārova māro abhisaṅkhāramāro.
Fabrication itself is Māra because it produces great calamities like birth and old age; this is abhisaṅkhāramāra (Māra of fabrication).
Các hành chính là ma vì chúng tạo ra những tai họa lớn như sinh, già, v.v. Đó là Abhisaṅkhāramāra (ma hành).
Saṃkilesanimittaṃ hutvā guṇamāraṇaṭṭhena devaputtova māroti devaputtamāro.
The son of a deity is Māra because, as a cause of defilement, he has the nature of killing virtues; this is devaputtamāra (Māra, the son of a deity).
Chư thiên chính là ma theo nghĩa giết hại các thiện pháp bằng cách trở thành nguyên nhân của sự ô nhiễm. Đó là Devaputtamāra (ma chư thiên).
Sattānaṃ jīvitassa jīvitaparikkhārānañca jānikaraṇena mahābādharūpattā maccu eva māroti maccumāro.
Death itself is Māra because, being in the form of a great obstacle, it causes the loss of beings' lives and their requisites for living; this is maccumāra (Māra of death).
Cái chết chính là ma vì nó gây hại đến sự sống và các vật dụng cần thiết cho sự sống của chúng sinh, mang hình thức của một chướng ngại lớn. Đó là Maccumāra (ma chết).
Tattha samucchedappahānavasena sabbaso appavattikaraṇena kilesamāraṃ, samudayappahānapariññāvasena khandhamāraṃ, sahāyavekallakaraṇavasena sabbaso appavattikaraṇena abhisaṅkhāramāraṃ, balavidhamanavisayātikkamanavasena devaputtamaccumārañca abhañji, bhagge akāsīti attho.
Of these, he shattered the Māra of defilements by making it completely cease through eradication by cutting off; the Māra of aggregates through full comprehension and abandonment of origination; the Māra of fabrication by making it completely cease through the absence of supporting conditions; and the Māra, the son of a deity, and the Māra of death through weakening their power and transcending their domain. To shatter means to make powerless.
Ở đây, Ngài đã phá vỡ (abhañji), nghĩa là đã làm cho tan vỡ (bhagge akāsī): Kilesamāra bằng cách làm cho chúng hoàn toàn không còn diễn tiến thông qua sự đoạn diệt hoàn toàn; Khandhamāra bằng sự hiểu biết về sự đoạn diệt của nguồn gốc; Abhisaṅkhāramāra bằng cách làm cho chúng hoàn toàn không còn diễn tiến thông qua việc làm cho các điều kiện hỗ trợ bị thiếu hụt; và Devaputtamāra cùng Maccumāra bằng cách phá hoại sức mạnh và vượt qua phạm vi của chúng.
Parissayānanti upaddavānaṃ.
Parissayāna means dangers.
Parissayānaṃ có nghĩa là các hiểm nguy.
Satapuññajalakkhaṇadharassāti aneka sata puñña nibbattamahā purisalakkhaṇadharassa.
Satapuññajalakkhaṇadharassa means 'who possesses the marks of a Great Man produced by many hundreds of merits'.
Satapuññajalakkhaṇadharassa có nghĩa là người mang các tướng đại nhân được tạo ra bởi hàng trăm phước báu.
Ettha hi ‘‘kevalaṃ satamattena puññakammena ekekalakkhaṇaṃ nibbatta’’nti imamatthaṃ na rocayiṃsu aṭṭhakathācariyā ‘‘evaṃ sante yo koci buddho bhaveyyā’’ti, anantāsu pana lokadhātūsu yattakā sattā, tehi sabbehi paccekaṃ satakkhattuṃ katāni dānādīni puññakammāni yattakāni, tato ekekaṃ puññakammaṃ mahāsattena sataguṇaṃ kataṃ satanti adhippetanti imamatthaṃ rocayiṃsu.
Here, the Aṭṭhakathā teachers did not accept the meaning that "each mark is produced by merely a hundred meritorious deeds," saying, "if so, anyone could become a Buddha." Instead, they accepted the meaning that "the sum of merits meant here is that amount where each meritorious deed performed by a Great Being is multiplied a hundredfold by the number of meritorious deeds of giving, etc., performed a hundred times by all beings in infinite world systems."
Ở đây, các vị Luận sư đã không chấp nhận ý nghĩa rằng “chỉ riêng một trăm phước nghiệp đã tạo ra từng tướng” vì “nếu vậy thì bất cứ ai cũng có thể trở thành Phật”. Thay vào đó, các vị đã chấp nhận ý nghĩa rằng “số lượng phước nghiệp cúng dường, v.v., mà tất cả chúng sinh trong vô số cõi giới đã thực hiện một trăm lần mỗi người, thì một phước nghiệp trong số đó được Đại Sĩ thực hiện gấp trăm lần, đó là ý nghĩa của sata (trăm)”.
Tasmā idha sata-saddo bahubhāvapariyāyo, na saṅkhyāvisesavacanoti daṭṭhabbo ‘‘satagghaṃ sataṃ devamanussā’’tiādīsu viya.
Therefore, the word sata here is a synonym for 'many', not a specific numeral, as seen in phrases like "satagghaṃ sataṃ devamanussā" (a hundredfold, a hundred gods and humans).
Do đó, từ sata ở đây là một từ chỉ số nhiều, không phải là một từ chỉ số lượng cụ thể, như trong các câu “giá trị trăm vàng”, “trăm chư thiên và loài người”.
Rūpakāyasampatti dīpitā hoti itarāsaṃ phalasampadānaṃ mūlabhāvato adhiṭṭhānabhāvato ca.
Rūpakāyasampatti dīpitā hoti (the perfection of the physical body is revealed) because it is the foundation and basis for the other perfections of fruit.
Rūpakāyasampatti dīpitā hoti (sự thành tựu thân sắc được hiển bày) vì thân sắc là gốc rễ và cơ sở của các thành tựu quả khác.
Dīpitā hotīti idaṃ dhammakāyasampattītiādīsupi yojetabbaṃ.
This phrase dīpitā hotīti (is revealed) should also be applied to "dhammakāyasampattīti" (perfection of the Dhamma-body), and so on.
Dīpitā hoti (được hiển bày) này cũng cần được áp dụng cho các câu như “sự thành tựu pháp thân”, v.v.
Tattha pahānasampadāpubbakattā ñāṇasampadādīnaṃ dhammakāyasampatti dīpitā hotīti veditabbaṃ.
There, it should be understood that the perfection of the Dhamma-body is revealed because the perfection of knowledge, etc., is preceded by the perfection of abandonment.
Ở đây, cần hiểu rằng sự thành tựu pháp thân được hiển bày vì sự thành tựu đoạn trừ là điều kiện tiên quyết cho sự thành tựu trí tuệ, v.v.
Lokiyasarikkhakānaṃ bahumatabhāvoti ettha bhāgyavantatāya lokiyānaṃ bahumatabhāvo, bhaggadosatāya sarikkhakānaṃ bahumatabhāvoti yojetabbaṃ.
Regarding lokiyasarikkhakānaṃ bahumatabhāvo (being highly esteemed by worldlings and those of similar standing), it should be interpreted as 'highly esteemed by worldlings due to his good fortune, and highly esteemed by those of similar standing (monastics, recluses, etc.) due to his vanquished defilements'.
Trong Lokiyasarikkhakānaṃ bahumatabhāvo (được thế gian và những người cùng cảnh ngộ tôn kính), cần ghép từ như sau: được thế gian tôn kính vì có phước báu, và được những người cùng cảnh ngộ tôn kính vì đã đoạn trừ các lỗi lầm.
Evaṃ ito paresupi yathākkamaṃ yojanā veditabbā.
In this way, the interpretation should be understood sequentially for what follows.
Tương tự, cách ghép từ này cũng cần được hiểu cho các câu tiếp theo.
Puññavantaṃ gahaṭṭhā khattiyādayo abhigacchanti, pahīnadosaṃ dosavinayāya dhammaṃ desetīti pabbajitā tāpasaparibbājakādayo abhigacchantīti āha ‘‘gahaṭṭhapabbajitehi abhigamanīyatā’’ti.
Householders, such as khattiyas, approach the fortunate one, and renunciants, such as ascetics and wanderers, approach the one with vanquished defilements for the discipline of defilements and for him to teach the Dhamma; thus it is said "gahaṭṭhapabbajitehi abhigamanīyatā" (being approachable by householders and renunciants).
Các gia chủ như dòng sát đế lỵ đến gần người có phước báu; các vị xuất gia, tu sĩ khổ hạnh, du sĩ, v.v., đến gần người đã đoạn trừ lỗi lầm để nghe thuyết pháp về sự chế ngự lỗi lầm. Do đó, nói rằng “được gia chủ và người xuất gia đến gần”.
Abhigatānañca tesaṃ kāyacittadukkhāpanayane paṭibalabhāvo āmisadānadhammadānehi upakārasabbhāvato rūpakāyaṃ tassa pasādacakkhunā, dhammakāyaṃ paññācakkhunā disvā dukkhadvayassa paṭippassambhanatoti veditabbo.
And his ability to alleviate the physical and mental suffering of those who have approached him, due to his capacity to benefit them through gifts of material things and gifts of Dhamma, is to be understood as their suffering of two kinds ceasing upon seeing his physical body with the eye of faith and his Dhamma-body with the eye of wisdom.
Và khả năng làm giảm bớt khổ đau về thân và tâm cho những người đã đến gần đó cần được hiểu là do sự giúp đỡ bằng cách bố thí vật chất và bố thí pháp, và bằng cách nhìn thấy thân sắc của Ngài bằng nhãn căn tịnh tín, và pháp thân bằng tuệ nhãn, từ đó làm cho hai loại khổ đau được lắng dịu.
Bhāgyavantatāya upagatānaṃ āmisadānaṃ deti, bhaggadosatāya dhammadānaṃ detīti āha ‘‘āmisadānadhammadānehi upakāritā’’ti.
He gives material gifts to those who approach him due to his good fortune, and he gives the gift of Dhamma due to his vanquished defilements; thus it is said "āmisadānadhammadānehi upakāritā" (his beneficial nature through gifts of material things and gifts of Dhamma).
Ngài bố thí vật chất cho những người đến gần vì Ngài có phước báu; Ngài bố thí pháp vì Ngài đã đoạn trừ lỗi lầm. Do đó, nói rằng “giúp đỡ bằng bố thí vật chất và bố thí pháp”.
Lokiyalokuttarasukhehi ca saṃyojanasamatthatā dīpitā hotīti ‘‘pubbe āmisadānadhammadānehi mayā ayaṃ lokaggabhāvo adhigato, tasmā tumhehipi evameva paṭipajjitabba’’nti evaṃ sammāpaṭipattiyaṃ niyojanena abhigatānaṃ lokiyalokuttarasukhehi saṃyojanasamatthatā ca dīpitā hoti.
Lokiyalokuttarasukhehi ca saṃyojanasamatthatā dīpitā hoti (and his ability to connect* with mundane and supramundane happiness is revealed): Furthermore, his ability to connect those who have approached him with mundane and supramundane happiness is revealed by enjoining them to right practice, saying, "Previously, through gifts of material things and gifts of Dhamma, I attained this supreme position in the world; therefore, you too should practice in the same way."
Lokiyalokuttarasukhehi ca saṃyojanasamatthatā dīpitā hoti (và khả năng kết nối với các hạnh phúc thế gian và xuất thế gian được hiển bày) có nghĩa là khả năng kết nối những người đã đến gần với các hạnh phúc thế gian và xuất thế gian bằng cách khuyên nhủ họ thực hành đúng đắn, như “trước đây, nhờ bố thí vật chất và bố thí pháp mà ta đã đạt được địa vị tối thượng trong thế gian này, do đó các con cũng phải thực hành như vậy”.
Sakacitte issariyaṃ nāma attano cittassa vasībhāvāpādanaṃyeva, paṭikūlādīsu appaṭikūlasaññitādivihārasiddhi, adhiṭṭhāniddhiādiko iddhividhopi cittissariyameva cittabhāvanāya vasībhāvappattiyā ijjhanato.
Sakacitte issariyaṃ (mastery over one's own mind) means precisely the bringing of one's mind under control; the attainment of dwelling in perceptions of non-repulsiveness towards repulsive things, etc.; and the various kinds of psychic power, such as the power of resolution, are also mastery over the mind, because they are accomplished through the mind's development and attainment of mastery.
Sakacitte issariyaṃ (quyền năng trên tâm mình) chính là việc làm cho tâm mình trở nên thuần thục, thành tựu các trú xứ như nhận thức điều không đáng ghét trong những điều đáng ghét, và các loại thần thông như thần thông biến hóa, v.v., cũng là quyền năng trên tâm vì chúng thành tựu do sự thuần thục thông qua việc tu tập tâm.
Aṇimālaghimādikanti ādi-saddena mahimā patti pākammaṃ īsitā vasitā yatthakāmāvasāyitāti ime chapi saṅgahitā.
Aṇimālaghimādikaṃ (the power of minuteness, lightness, etc.): the word ādi (etc.) includes the other six: mahimā (greatness), patti (reaching), pākammaṃ (mastery), īsitā (lordship), vasitā (control), and yatthakāmāvasāyitā (power to do as one wishes).
Aṇimālaghimādikaṃ (như Aṇimā, Laghimā, v.v.) – từ ādi (v.v.) bao gồm sáu loại thần thông này: Mahimā (biến lớn), Patti (đạt được), Pākammaṃ (tự tại), Īsitā (quyền uy), Vasitā (chủ tể), Yatthakāmāvasāyitā (muốn gì được nấy).
Tattha kāyassa aṇubhāvakaraṇaṃ aṇimā.
Among these, making the body minute is aṇimā.
Trong đó, việc làm cho thân trở nên nhỏ bé là Aṇimā.
Ākāse padasā gamanādīnaṃ arahabhāvena lahubhāvo laghimā.
Lightness, in the sense of being able to walk in the sky, etc., is laghimā.
Sự nhẹ nhàng, do khả năng đi lại trên không, v.v., là Laghimā.
Mahattaṃ mahimā kāyassa mahantatāpādanaṃ.
Greatness is mahimā, which is the ability to make the body immense.
Sự vĩ đại là Mahimā, việc làm cho thân trở nên to lớn.
Iṭṭhadesassa pāpuṇanaṃ patti.
Reaching the desired place is patti.
Việc đạt đến nơi mong muốn là Patti.
Adhiṭṭhānādivasena icchitanipphādanaṃ pākammaṃ.
The accomplishment of what is wished for by means of determination and so on is pākammaṃ.
Việc thực hiện những điều mong muốn thông qua sự phát nguyện, v.v., là pākamma (sự nỗ lực).
Sayaṃvasitā issarabhāvo īsitā.
Self-mastery, the state of sovereignty, is īsitā.
Quyền làm chủ, trạng thái tự tại là īsitā (quyền năng).
Iddhividhe vasībhāvo vasitā.
Mastery in the kinds of psychic power is vasitā.
Sự thành thạo trong các thần thông là vasitā (sự thuần thục).
Ākāsena vā gacchato aññaṃ vā kiñci karoto yattha katthaci vosānappatti yatthakāmāvasāyitā.
The attainment of conclusion anywhere whatsoever, whether traveling through the sky or doing anything else, is yatthakāmāvasāyitā.
Khả năng đạt đến bất cứ nơi nào mong muốn khi đi trên không hoặc làm bất cứ điều gì khác là yatthakāmāvasāyitā (tùy ý đi đến).
‘‘Kumārakarūpādidassana’’ntipi vadanti.
They also say it is “the seeing of forms such as that of a young boy.”
Người ta cũng nói là "thể hiện hình dạng của một đứa trẻ", v.v.
Evamidaṃ aṭṭhavidhaṃ lokiyasammataṃ issariyaṃ.
Thus, this is the eightfold sovereignty accepted in the world.
Đây là tám loại uy quyền được thế gian công nhận.
Taṃ pana bhagavato iddhividhantogadhaṃ anaññasādhāraṇañcāti āha ‘‘sabbakāraparipūraṃ atthī’’ti.
But that which is included in the variety of psychic powers of the Blessed One is also not shared by others; thus, he said, “exists, complete in all aspects.”
Điều đó thuộc về thần thông của Đức Thế Tôn và là điều không ai khác có được, nên nói rằng "có đầy đủ mọi phương diện".
Tathā lokuttaro dhammo atthīti sambandho.
Likewise, there is a connection with “the supramundane dhamma exists.”
Tương tự, có liên quan đến việc có Pháp siêu thế.
Evaṃ yasādīsupi atthi-saddo yojetabbo.
In this way, the word atthi should be applied to fame and so forth as well.
Tương tự, từ "atthi" (có) cũng nên được áp dụng cho danh tiếng, v.v.
Kesañci yaso padesavutti ayathābhūtaguṇasannissayattā aparisuddho ca hoti, na evaṃ tathāgatassāti dassetuṃ ‘‘lokattayabyāpako’’ti vuttaṃ.
The fame of some is limited to a region and is impure because it is based on qualities not in accordance with reality; to show that it is not so for the Tathāgata, it was said, “pervading the three worlds.”
Danh tiếng của một số người chỉ giới hạn ở một vùng, không trong sạch vì dựa trên những phẩm chất không đúng sự thật; để chỉ ra rằng Đức Như Lai không như vậy, nên nói "lan khắp ba cõi".
Tattha idha adhigatasatthuguṇānaṃ āruppe uppannānaṃ ‘‘itipi so bhagavā’’tiādinā bhagavato yaso pākaṭo hotīti āha ‘‘lokattayabyāpako’’ti.
Therein, to show that the fame of the Blessed One, beginning with “Thus is that Blessed One,” is manifest to those who have realized the Teacher’s qualities and have been reborn in the formless realm, he said, “pervading the three worlds.”
Ở đây, danh tiếng của Đức Thế Tôn hiển lộ qua câu "Đức Thế Tôn là bậc như vậy" đối với những người đã đạt được phẩm chất của bậc Đạo Sư ở đây và những người đã sinh vào cõi vô sắc, nên nói "lan khắp ba cõi".
Yathābhuccaguṇādhigatoti yathābhūtaguṇehi adhigato.
Acquired through genuine qualities means acquired through qualities that are in accordance with reality.
Yathābhuccaguṇādhigato (đạt được các phẩm chất chân thật) tức là đạt được bằng các phẩm chất đúng sự thật.
Ativiya parisuddhoti yathābhūtaguṇādhigatattā eva accantaparisuddho.
Exceedingly pure means completely pure precisely because it is acquired through genuine qualities.
Ativiya parisuddho (cực kỳ trong sạch) tức là hoàn toàn trong sạch vì đã đạt được các phẩm chất đúng sự thật.
Sabbākāraparipūrāti anavasesalakkhaṇānubyañjanādisampattiyā sabbākārehi paripuṇṇā.
Complete in all aspects means perfect in all aspects through the possession of all the major and minor marks and so forth.
Sabbākāraparipūrā (đầy đủ mọi phương diện) tức là đầy đủ mọi phương diện với sự viên mãn của các tướng chính và tướng phụ không còn sót lại.
Sabbaṅgapaccaṅgasirīti sabbesaṃ aṅgapaccaṅgānaṃ sobhā.
The splendor of all the major and minor limbs means the beauty of all the major and minor limbs.
Sabbaṅgapaccaṅgasirī (vẻ đẹp của tất cả các chi và tiểu chi) tức là vẻ đẹp của tất cả các chi và tiểu chi.
Yaṃ yaṃ etena icchitaṃ patthitanti ‘‘tiṇṇo tāreyya’’ntiādinā yaṃ yaṃ etena lokanāthena manovacīpaṇidhānavasena icchitaṃ kāyapaṇidhānavasena patthitaṃ.
Whatever was wished and aspired for by him means whatever was wished for by this Lord of the World by way of resolutions of mind and speech, and aspired for by way of resolutions of body, beginning with “Having crossed over, may I lead others to cross over.”
Yaṃ yaṃ etena icchitaṃ patthitaṃ (điều gì được Ngài mong muốn, ước nguyện) tức là điều gì được vị Thế Chủ này mong muốn bằng sự phát nguyện của ý và lời, ước nguyện bằng sự phát nguyện của thân, như "đã vượt qua thì sẽ độ thoát", v.v.
Tathevāti paṇidhānānurūpameva.
Just so means in accordance with the resolution.
Tathevā (cũng vậy) tức là đúng như sự phát nguyện.
Sammāvāyāmasaṅkhāto payattoti vīriyapāramibhāvappatto ariyamaggapariyāpanno ca sammāvāyāmasaṅkhāto ussāho.
The effort called right endeavor means the exertion called right endeavor which has reached the state of the perfection of energy and is included in the noble path.
Sammāvāyāmasaṅkhāto payatto (sự nỗ lực được gọi là Chánh Tinh Tấn) tức là sự tinh tấn được gọi là Chánh Tinh Tấn, đã đạt đến mức độ Ba-la-mật của tinh tấn và thuộc về Bát Chánh Đạo.
Kusalādīhi bhedehīti sabbattikadukapadasaṅgahitehi kusalādippabhedehi.
By divisions such as wholesome means by the various divisions such as wholesome, etc., which are included in all the triads and dyads.
Kusalādīhi bhedehī (bằng các loại thiện, v.v.) tức là bằng các loại thiện, v.v., bao gồm các từ nhóm ba và nhóm hai.
Paṭiccasamuppādādīhīti ādi-saddena na kevalaṃ vibhaṅgapāḷiyaṃ āgatā satipaṭṭhānādayova saṅgahitā, atha kho saṅgahādayo samayavimuttādayo ṭhapanādayo tikapaṭṭhānādayo ca saṅgahitāti veditabbaṃ.
By dependent origination and so forth, with the word ādi, it should be understood that not only the foundations of mindfulness, etc., which appear in the Vibhaṅga-pāḷi are included, but also the Compendia, etc., the temporally liberated, etc., the establishments, etc., the Paṭṭhāna of triads, etc., are included.
Paṭiccasamuppādādīhī (bằng Duyên khởi, v.v.) cần hiểu rằng từ ādi (v.v.) không chỉ bao gồm Tứ Niệm Xứ, v.v., được đề cập trong Vibhaṅga Pāḷi, mà còn bao gồm Saṅgaha, v.v., Samayavimutta, v.v., Ṭhapanā, v.v., và Tikapaṭṭhāna, v.v.
Pīḷanasaṅkhatasantāpavipariṇāmaṭṭhena vā dukkhamariyasaccantiādīsu pīḷanaṭṭho taṃsamaṅgino sattassa hiṃsanaṃ avipphārikatākaraṇaṃ.
In the phrase beginning with the noble truth of suffering in the sense of affliction, being conditioned, torment, and change, the sense of affliction is the harming of a being possessing it, the causing of non-diffusion.
Trong các câu như "Pīḷanasaṅkhatasantāpavipariṇāmaṭṭhena vā dukkhamariyasaccaṃ" (Khổ Thánh Đế theo nghĩa bị bức bách, bị tạo tác, bị thiêu đốt, và biến hoại), pīḷanaṭṭho (nghĩa bị bức bách) là sự làm hại, làm cho chúng sinh bị tổn thương, không được an vui.
Saṅkhataṭṭho samecca saṅgamma sambhūya paccayehi katabhāvo.
The sense of being conditioned is the state of having been made by conditions that have met, gathered, and come together.
Saṅkhataṭṭho (nghĩa bị tạo tác) là trạng thái được tạo ra bởi các duyên, bằng cách tụ hợp, kết hợp.
Santāpaṭṭho dukkhadukkhatādīhi santāpanaṃ paridahanaṃ.
The sense of torment is the burning and scorching by suffering due to pain and so forth.
Santāpaṭṭho (nghĩa bị thiêu đốt) là sự thiêu đốt, làm cho nóng bức bởi khổ khổ, v.v.
Vipariṇāmaṭṭho jarāya maraṇena cāti dvidhā vipariṇāmetabbatā.
The sense of change is the liability to be changed in two ways: by old age and by death.
Vipariṇāmaṭṭho (nghĩa biến hoại) là sự biến hoại theo hai cách: bởi già và bởi chết.
Samudayassa āyūhanaṭṭho dukkhassa nibbattanavasena sampiṇḍanaṃ.
The sense of accumulation for the origin is the piling up by way of producing suffering.
Āyūhanaṭṭho (nghĩa tích lũy) của Tập đế là sự tích tụ theo nghĩa tạo ra khổ.
Nidānaṭṭho ‘‘idaṃ taṃ dukkha’’nti nidassentassa viya samuṭṭhāpanaṃ.
The sense of a condition is the causing to arise, as if pointing out, “This is that suffering.”
Nidānaṭṭho (nghĩa nguyên nhân) là sự phát sinh như thể chỉ ra "đây là khổ đó".
Saṃyogaṭṭho saṃsāradukkhena saṃyojanaṃ.
The sense of a bond is the connecting with the suffering of saṃsāra.
Saṃyogaṭṭho (nghĩa kết hợp) là sự kết hợp với khổ luân hồi.
Palibodhaṭṭho maggādhigamassa nivāraṇaṃ.
The sense of an obstacle is the preventing of the attainment of the path.
Palibodhaṭṭho (nghĩa chướng ngại) là sự ngăn cản việc đạt đến Đạo.
Nirodhassa nissaraṇaṭṭho sabbūpadhīnaṃ paṭinissaggasabhāvattā tato vinissaṭatā, taṃnissaraṇanimittatā vā.
The sense of escape for cessation is the being released from it, because of its nature of relinquishing all attachments, or it being a sign for that escape.
Nissaraṇaṭṭho (nghĩa thoát ly) của Diệt đế là sự thoát ly khỏi tất cả các phiền não bởi vì nó có bản chất là sự từ bỏ tất cả các phiền não, hoặc là nguyên nhân của sự thoát ly đó.
Vivekaṭṭho sabbasaṅkhāravisaṃyuttatā.
The sense of seclusion is the being disjoined from all conditioned things.
Vivekaṭṭho (nghĩa ly dục) là sự không liên hệ với tất cả các hành.
Asaṅkhataṭṭho kenacipi paccayena anabhisaṅkhatatā.
The sense of the unconditioned is the not being conditioned by any cause whatsoever.
Asaṅkhataṭṭho (nghĩa vô vi) là sự không bị tạo tác bởi bất kỳ duyên nào.
Amataṭṭho niccasabhāvattā maraṇābhāvo, sattānaṃ maraṇābhāvahetutā vā.
The sense of the deathless is the absence of death because of its permanent nature, or its being a cause for the absence of death for beings.
Amataṭṭho (nghĩa bất tử) là sự không chết vì có bản chất thường hằng, hoặc là nguyên nhân của sự không chết cho chúng sinh.
Maggassa niyyānaṭṭho vaṭṭadukkhato nikkamanaṭṭho.
The sense of leading out for the path is the sense of departing from the suffering of the round of rebirth.
Niyyānaṭṭho (nghĩa dẫn đến thoát ly) của Đạo là nghĩa thoát ra khỏi khổ luân hồi.
Hetuattho nibbānassa sampāpakabhāvo.
The sense of a cause is the state of bringing about Nibbāna.
Hetuattho (nghĩa nhân) là trạng thái dẫn đến Niết Bàn.
Dassanaṭṭho accantasukhumassa nibbānassa sacchikaraṇaṃ.
The sense of seeing is the direct realization of the extremely subtle Nibbāna.
Dassanaṭṭho (nghĩa thấy) là sự chứng ngộ Niết Bàn cực kỳ vi tế.
Ādhipateyyaṭṭho catusaccadassane sampayuttānaṃ ādhipaccakaraṇaṃ, ārammaṇādhipatibhāvo vā visesato maggādhipativacanato.
The sense of sovereignty is the exercising of dominance over the associated states in the seeing of the four truths, or its state of being a dominant object, especially since “the path as dominant” is mentioned.
Ādhipateyyaṭṭho (nghĩa chủ tể) là sự làm chủ đối với những pháp tương ưng trong việc thấy Tứ Thánh Đế, hoặc là trạng thái làm chủ đối với đối tượng, đặc biệt là do lời nói về Đạo làm chủ.
Satipi hi jhānādīnaṃ ārammaṇādhipatibhāve ‘‘jhānādhipatino dhammā’’ti evamādiṃ avatvā ‘‘maggādhipatino dhammā’’icceva vuttaṃ, tasmā viññāyati ‘‘atthi maggassa ārammaṇādhipatibhāve viseso’’ti.
For although jhāna and so on can be a dominant object, it is not said, “dhammas with jhāna as dominant,” and so forth, but rather it is said, “dhammas with the path as dominant.” Therefore, it is understood that “there is a special quality in the path’s state of being a dominant object.”
Mặc dù các thiền định, v.v., có trạng thái làm chủ đối với đối tượng, nhưng không nói "các pháp làm chủ thiền định, v.v.", mà chỉ nói "các pháp làm chủ Đạo", do đó, có thể hiểu rằng "có sự đặc biệt trong trạng thái làm chủ đối với đối tượng của Đạo".
Eteyeva ca pīḷanādayo soḷasākārāti vuccanti.
These very things, affliction and so forth, are called the sixteen aspects.
Chính những nghĩa bức bách, v.v., này được gọi là mười sáu phương diện.
Dibbabrahmaariyavihāretiādīsu kasiṇādiārammaṇāni rūpāvacarajjhānāni dibbavihāro.
In the phrase beginning with divine, brahma, and noble abidings, the rūpāvacara-jhānas with kasiṇas, etc., as their objects are the divine abiding.
Trong các câu như "Dibbabrahmaariyavihāre" (các trú xứ thiên, phạm, thánh), các thiền sắc giới với các đối tượng như kasiṇa, v.v., là dibbavihāro (thiên trú).
Mettādijjhānāni brahmavihāro.
The jhānas of loving-kindness and so forth are the brahma-abiding.
Các thiền từ bi, v.v., là brahmavihāro (phạm trú).
Phalasamāpatti ariyavihāro.
The attainment of fruition is the noble abiding.
Quả định là ariyavihāro (thánh trú).
Kāmehi vivekaṭṭhakāyatāvasena ekībhāvo kāyaviveko.
The state of being unified through solitude from sensual pleasures is bodily seclusion.
Sự hợp nhất theo nghĩa ly dục khỏi các dục là kāyaviveko (thân ly).
Paṭhamajjhānādinā nīvaraṇādīhi vivittacittatā cittaviveko.
The mind being secluded from the hindrances and so on through the first jhāna and so forth is mental seclusion.
Tâm ly dục khỏi các triền cái, v.v., bằng sơ thiền, v.v., là cittaviveko (tâm ly).
Upadhiviveko nibbānaṃ.
Seclusion from attachments is Nibbāna.
Upadhiviveko (y cứ ly) là Niết Bàn.
Upadhīti cettha cattāro upadhī kāmupadhi khandhupadhi kilesupadhi abhisaṅkhārupadhīti.
And here, as for attachments, there are four attachments: the attachment of sensual pleasures, the attachment of the aggregates, the attachment of defilements, and the attachment of volitional formations.
Ở đây, upadhī (y cứ) có bốn loại: kāmupadhi (y cứ dục), khandhupadhi (y cứ uẩn), kilesupadhi (y cứ phiền não), abhisaṅkhārupadhi (y cứ hành).
Kāmāpi hi ‘‘yaṃ pañca kāmaguṇe paṭicca uppajjati sukhaṃ somanassaṃ, ayaṃ kāmānaṃ assādo’’ti (ma. ni. 1.166) evaṃ vuttassa sukhassa adhiṭṭhānabhāvato upadhīyati ettha sukhanti iminā vacanatthena ‘‘upadhī’’ti vuccanti, khandhāpi khandhamūlakassa dukkhassa adhiṭṭhānabhāvato, kilesāpi apāyadukkhassa adhiṭṭhānabhāvato, abhisaṅkhārāpi bhavadukkhassa adhiṭṭhānabhāvato vuttanayena ‘‘upadhī’’ti vuccanti.
For sensual pleasures are called “upadhi” with the etymological meaning “pleasure is placed upon this,” because they are the foundation for the pleasure spoken of thus: “The pleasure and happiness that arise in dependence on these five strands of sensual pleasure, this is the gratification in sensual pleasures”; the aggregates are also called “upadhi” by the stated method because they are the foundation for the suffering based on the aggregates; the defilements, because they are the foundation for the suffering of the lower realms; and the volitional formations, because they are the foundation for the suffering of existence.
Các dục cũng được gọi là "upadhī" theo nghĩa là "hạnh phúc được dựa vào đây", bởi vì chúng là nền tảng của hạnh phúc được nói đến như "sự vị ngọt của các dục là niềm vui và sự hoan hỷ phát sinh do năm dục công đức" (Majjhima Nikāya 1.166); các uẩn cũng vậy, vì chúng là nền tảng của khổ bắt nguồn từ uẩn; các phiền não cũng vậy, vì chúng là nền tảng của khổ đọa xứ; các hành cũng vậy, vì chúng là nền tảng của khổ hữu, được gọi là "upadhī" theo cách đã nói.
Imehi pana catūhi upadhīhi vivittatāya nibbānaṃ ‘‘upadhiviveko’’ti vuccati.
But because it is secluded from these four attachments, Nibbāna is called “seclusion from attachments.”
Niết Bàn được gọi là "upadhiviveko" vì nó ly dục khỏi bốn loại y cứ này.
Suññatākārena nibbānaṃ ārammaṇaṃ katvā pavatto ariyamaggo suññatavimokkho.
The noble path that proceeds by making Nibbāna its object in the mode of emptiness is the liberation through emptiness.
Bát Chánh Đạo phát sinh khi lấy Niết Bàn làm đối tượng theo phương diện không (suññatā) là suññatavimokkho (không giải thoát).
So hi suññatāya dhātuyā uppannattā suññato, kilesehi ca vimuttattā vimokkho.
For it is “from emptiness” (suññato) because it has arisen from the element of emptiness, and it is “liberation” (vimokkho) because it is liberated from the defilements.
Nó là không vì phát sinh trong giới không, và là giải thoát vì đã giải thoát khỏi các phiền não.
Eteneva nayena appaṇihitākārena nibbānaṃ ārammaṇaṃ katvā pavatto appaṇihitavimokkho.
By this same method, the path that proceeds by making Nibbāna its object in the mode of the signless is the signless liberation.
Theo cách tương tự, Bát Chánh Đạo phát sinh khi lấy Niết Bàn làm đối tượng theo phương diện không mong cầu là appaṇihitavimokkho (vô nguyện giải thoát).
Animittākārena nibbānaṃ ārammaṇaṃ katvā pavatto animittavimokkho.
The path that proceeds by making Nibbāna its object in the mode of the undirected is the undirected liberation.
Bát Chánh Đạo phát sinh khi lấy Niết Bàn làm đối tượng theo phương diện vô tướng là animittavimokkho (vô tướng giải thoát).
Atha vā suññatānupassanāsaṅkhātāya anattānupassanāya vasena paṭiladdho ariyamaggo āgamanavasena ‘‘suññatavimokkho’’ti vuccati.
Alternatively, the noble path obtained by way of the insight into not-self, known as the contemplation of emptiness, is called “liberation through emptiness” by way of its approach.
Hoặc, Bát Chánh Đạo đạt được thông qua sự quán chiếu vô ngã, được gọi là quán chiếu không (suññatānupassanā), được gọi là "suññatavimokkho" theo nghĩa đạt đến.
Tathā appaṇihitānupassanāsaṅkhātāya dukkhānupassanāya vasena paṭiladdho appaṇihitavimokkho.
Similarly, the path obtained by way of the insight into suffering, known as the contemplation of the undirected, is the undirected liberation.
Tương tự, vô nguyện giải thoát đạt được thông qua sự quán chiếu khổ, được gọi là quán chiếu vô nguyện (appaṇihitānupassanā).
Animittānupassanāsaṅkhātāya aniccānupassanāya vasena paṭiladdho ‘‘animittavimokkho’’ti veditabbo.
The path obtained by way of the insight into impermanence, known as the contemplation of the signless, should be known as the “signless liberation.”
Vô tướng giải thoát đạt được thông qua sự quán chiếu vô thường, được gọi là quán chiếu vô tướng (animittānupassanā).
Vuttañhetaṃ –
For this has been said:
Điều này đã được nói:
Kilesābhisaṅkhāravasena bhavesu paribbhamanaṃ, tañca taṇhāpadhānanti āha ‘‘taṇhāsaṅkhātaṃ gamana’’nti.
The wandering in existences by way of defilements and volitional formations—and that is primarily craving; thus, he said, “the going called craving.”
Sự luân chuyển trong các cõi hữu do phiền não và hành, điều đó lấy tham ái làm chủ đạo, nên nói "sự đi lại được gọi là tham ái".
Vantanti ariyamaggamukhena uggiritaṃ puna apaccāgamanavasena chaḍḍitaṃ.
Vomited means spewed out by the mouth of the noble path, discarded in a way that it does not return again.
Vantaṃ (đã nhổ bỏ) tức là đã nhổ ra qua cửa Bát Chánh Đạo, đã vứt bỏ theo nghĩa không bao giờ quay trở lại.
Bhagavāti vuccati niruttinayenāti dassento āha ‘‘yathā loke’’tiādi.
He is called Bhagavā according to the method of etymology; showing this, he said, “Just as in the world,” and so on.
Để chỉ ra rằng Đức Thế Tôn được gọi theo phương pháp ngữ nguyên học, nên nói "yathā loke" (như trong thế gian), v.v.
Yathā loke niruttinayena ekekapadato ekekamakkharaṃ gahetvā ‘‘mekhalā’’ti vuttaṃ, evamidhāpīti attho.
Just as in the world, by way of etymology, taking one letter from each word, it is said "mekhalā" (girdle), so also it is here, this is the meaning.
Như trong đời, theo phương pháp từ nguyên học, người ta lấy từng chữ cái từ mỗi từ để tạo thành từ “mekhalā” (dây lưng), thì ở đây cũng vậy, đó là ý nghĩa.
Mehanassāti guyhappadesassa.
Mehanassa means of the private part.
Mehanassā (của cơ quan sinh dục) là của vùng kín.
Khassāti okāsassa.
Khassa means of the space.
Khassā (của khoảng trống) là của khoảng trống.
Tattha kathaṃ bhāgavāti bhagavā?
Among these, how is bhāgavā meaning Bhagavā?
Trong đó, làm thế nào bhāgavā là Bhagavā?
Ye te sīlādayo dhammakkhandhā guṇakoṭṭhāsā, te anaññasādhāraṇā niratisayā tathāgatassa atthi upalabbhanti.
Those aggregates of qualities, the groups of virtues such as sīla, etc., which are incomparable and unsurpassed, exist and are found in the Tathāgata.
Những pháp uẩn như giới v.v… là những phần công đức vô song, không ai khác có thể sánh bằng, được tìm thấy nơi Đức Như Lai.
Tathā hissa sīlaṃ samādhi paññā vimutti vimuttiñāṇadassanaṃ, hirī ottappaṃ, saddhā vīriyaṃ, sati sampajaññaṃ, sīlavisuddhi diṭṭhivisuddhi, samatho vipassanā, tīṇi kusalamūlāni, tīṇi sucaritāni, tayo sammāvitakkā, tisso anavajjasaññā, tisso dhātuyo, cattāro satipaṭṭhānā, cattāro sammappadhānā, cattāro iddhipādā, cattāro ariyamaggā, cattāri ariyaphalāni, catasso paṭisambhidā, catuyoniparicchedakañāṇāni, cattāro ariyavaṃsā, cattāri vesārajjañāṇāni, pañca padhāniyaṅgāni, pañcaṅgiko sammāsamādhi, pañcañāṇiko sammāsamādhi, pañcindriyāni, pañca balāni, pañca nissāraṇīyā dhātuyo, pañca vimuttāyatanañāṇāni, pañca vimuttiparipācanīyā saññā, cha anussatiṭṭhānāni, cha gāravā, cha nissāraṇīyā dhātuyo, cha satatavihārā, cha anuttariyāni, chanibbedhabhāgiyā saññā, cha abhiññā, cha asādhāraṇañāṇāni, satta aparihānīyā dhammā, satta ariyadhanāni, satta bojjhaṅgāni, satta sappurisadhammā, satta nijjaravatthūni, satta saññā, sattadakkhiṇeyyapuggaladesanā, sattakhīṇāsavabaladesanā, aṭṭhapaññāpaṭilābhahetudesanā, aṭṭha sammattāni, aṭṭhalokadhammātikkamo, aṭṭha ārambhavatthūni, aṭṭhaakkhaṇadesanā, aṭṭha mahāpurisavitakkā, aṭṭhaabhibhāyatanadesanā, aṭṭha vimokkhā, nava yonisomanasikāramūlakā dhammā, nava pārisuddhipadhāniyaṅgāni, navasattāvāsadesanā, nava āghātappaṭivinayā, nava saññā, nava nānattā, nava anupubbavihārā, dasa nāthakaraṇā dhammā, dasa kasiṇāyatanāni, dasa kusalakammapathā, dasa sammattāni, dasa ariyavāsā, dasa asekkhadhammā, dasa tathāgatabalāni, ekādasa mettānisaṃsā, dvādasa dhammacakkākārā, terasa dhutaguṇā, cuddasa buddhañāṇāni, pañcadasa vimuttiparipācanīyā dhammā, soḷasavidhā ānāpānassati, soḷasa aparantapanīyā dhammā, aṭṭhārasa buddhadhammā, ekūnavīsati paccavekkhaṇañāṇāni, catucattālīsa ñāṇavatthūni, paññāsa udayabbayañāṇāni, paropaṇṇāsa kusaladhammā, sattasattati ñāṇavatthūni, catuvīsatikoṭisatasahassasamāpattisañcārimahāvajirañāṇaṃ, anantanayasamantapaṭṭhānapavicayapaccavekkhaṇadesanāñāṇāni, tathā anantāsu lokadhātūsu anantānaṃ sattānaṃ āsayādivibhāvanañāṇāni cāti evamādayo anantāparimāṇabhedā anaññasādhāraṇā niratisayā guṇabhāgā guṇakoṭṭhāsā saṃvijjanti upalabbhanti, tasmā yathāvuttavibhāgā guṇabhāgā assa atthīti bhāgavāti vattabbe ākārassa rassattaṃ katvā ‘‘bhagavā’’ti vutto.
For example, his sīla, samādhi, paññā, vimutti, vimuttiñāṇadassana; hirī, ottappa; saddhā, vīriya, sati, sampajañña; sīlavisuddhi, diṭṭhivisuddhi; samatha, vipassanā; the three roots of wholesome actions; the three good conducts; the three right thoughts; the three blameless perceptions; the three elements; the four foundations of mindfulness; the four right exertions; the four bases of psychic power; the four Noble Paths; the four Noble Fruits; the four analytical knowledges (paṭisambhidā); the knowledges for discerning the four origins; the four Noble Traditions; the four knowledges of fearlessness (vesārajja); the five factors of striving; the five-factored right concentration; the five-knowledge right concentration; the five faculties; the five powers; the five elements conducive to liberation; the five knowledges of liberation's attainment; the five perceptions conducive to the ripening of liberation; the six objects of recollection (anussati); the six respects; the six elements conducive to liberation; the six continuous abidings; the six unsurpassed things; the six perceptions conducive to penetration; the six direct knowledges (abhiññā); the six extraordinary knowledges; the seven conditions of non-decline; the seven Noble Treasures; the seven factors of awakening (bojjhaṅga); the seven qualities of a good person; the seven bases of wearing away (nijjaravatthu); the seven perceptions; the teaching on the seven persons worthy of offerings; the teaching on the seven powers of an Arahant; the teaching on the eight causes for attaining wisdom; the eight rightnesses; the transcendence of the eight worldly conditions; the eight bases for exertion; the teaching on the eight unfortunate moments; the eight thoughts of a Great Man; the teaching on the eight spheres of mastery (abhibhāyatana); the eight liberations (vimokkha); the nine dhammas rooted in wise attention (yonisomanasikāra); the nine factors of striving for purification; the teaching on the nine abodes of beings; the nine ways of subduing resentment; the nine perceptions; the nine diversities; the nine successive abidings; the ten dhammas that make one a protector; the ten kasiṇa bases; the ten wholesome courses of action; the ten rightnesses; the ten Noble Abodes; the ten qualities of a trainee (asekha); the ten powers of a Tathāgata; the eleven benefits of loving-kindness; the twelve aspects of the Wheel of Dhamma; the thirteen ascetic practices (dhutaguṇa); the fourteen Buddha-knowledges; the fifteen dhammas conducive to the ripening of liberation; the sixteen-fold mindfulness of breathing (ānāpānassati); the sixteen dhammas for purifying the future; the eighteen Buddha-qualities; the nineteen knowledges of reviewing; the forty-four knowledge-objects; the fifty knowledges of rise and fall; the fifty-four wholesome dhammas; the seventy-seven knowledge-objects; the great adamantine knowledge that pervades hundreds of thousands of crores of samāpattis twenty-four-fold; the knowledges of teachings, reviewing, and discerning based on analysis of endless modes in all directions; and similarly, the knowledges of discerning the dispositions, etc., of countless beings in countless world-systems—thus, such countless and immeasurable, unique and unsurpassed divisions of qualities and groups of qualities exist and are found in him. Therefore, because he possesses the qualities and groups of qualities described, he is called bhāgavā, by shortening the long 'ā' of ākāra to 'a', he is called "Bhagavā".
Thật vậy, giới, định, tuệ, giải thoát, giải thoát tri kiến của Ngài; tàm, quý; tín, tấn; niệm, tỉnh giác; giới thanh tịnh, kiến thanh tịnh; chỉ, quán; ba căn lành; ba thiện hạnh; ba chánh tư duy; ba tưởng vô tội; ba giới; bốn niệm xứ; bốn chánh cần; bốn thần túc; bốn Thánh đạo; bốn Thánh quả; bốn phân tích trí; các trí phân biệt bốn loại sanh; bốn Thánh chủng; bốn trí vô úy; năm chi cần tinh tấn; chánh định năm chi; chánh định năm trí; năm căn; năm lực; năm giới thoát ly; năm trí giải thoát xứ; năm tưởng làm chín muồi giải thoát; sáu niệm xứ; sáu sự cung kính; sáu giới thoát ly; sáu trú thường xuyên; sáu vô thượng; sáu tưởng thuộc về sự thâm nhập; sáu thắng trí; sáu trí không chung với ai khác; bảy pháp không thoái chuyển; bảy Thánh tài; bảy giác chi; bảy pháp của bậc chân nhân; bảy sự tiêu trừ; bảy tưởng; sự thuyết giảng về bảy hạng người đáng cúng dường; sự thuyết giảng về bảy lực của bậc lậu tận; sự thuyết giảng về tám nguyên nhân thành tựu trí tuệ; tám chánh pháp; sự vượt qua tám pháp thế gian; tám sự khởi đầu; sự thuyết giảng về tám sát-na không; tám đại nhân tư duy; sự thuyết giảng về tám thắng xứ; tám giải thoát; chín pháp căn bản của tác ý đúng đắn; chín chi cần tinh tấn thanh tịnh; sự thuyết giảng về chín trú xứ của chúng sanh; chín sự diệt trừ hiềm hận; chín tưởng; chín sự sai khác; chín trú xứ tuần tự; mười pháp làm chỗ nương tựa; mười xứ biến xứ; mười nghiệp đạo thiện; mười chánh pháp; mười Thánh trú; mười pháp vô học; mười lực của Đức Như Lai; mười một lợi ích của tâm từ; mười hai khía cạnh của bánh xe pháp; mười ba hạnh đầu đà; mười bốn trí của Đức Phật; mười lăm pháp làm chín muồi giải thoát; mười sáu loại quán niệm hơi thở; mười sáu pháp không làm phiền não người khác; mười tám Phật pháp; mười chín trí quán xét; bốn mươi bốn trí sở y; năm mươi trí sanh diệt; năm mươi lăm pháp thiện; bảy mươi bảy trí sở y; trí kim cương vĩ đại vận hành trong hai mươi bốn tỷ trăm ngàn định; các trí thuyết giảng về sự quán xét phân tích các phương pháp vô tận; cũng như các trí phân biệt căn tánh v.v… của vô số chúng sanh trong vô số thế giới; v.v… như vậy, vô số, vô lượng, vô biên các phần công đức, các phần phẩm chất vô song, không ai khác có thể sánh bằng, được tìm thấy, được hiện hữu. Do đó, vì có những phần công đức như đã nói, nên khi nói bhāgavā, thì chữ ā được rút ngắn thành a để trở thành ‘‘bhagavā’’.
Evaṃ tāva bhāgavāti bhagavā.
Thus, bhāgavā means Bhagavā.
Như vậy, bhāgavā là Bhagavā.
Kathaṃ bhatavāti bhagavā?
How is bhatavā meaning Bhagavā?
Làm thế nào bhatavā là Bhagavā?
Ye te sabbalokahitāya ussukkamāpannehi manussattādike aṭṭha dhamme samodhānetvā sammāsambodhiyā katamahābhinīhārehi mahābodhisattehi paripūretabbā dānapāramī sīlanekkhammapaññāvīriyakhantisaccaadhiṭṭhānamettāupekkhāpāramīti dasa pāramiyo dasa upapāramiyo dasa paramatthapāramiyoti samatiṃsa pāramiyo, dānādīni cattāri saṅgahavatthūni, cattāri adhiṭṭhānāni, attapariccāgo nayanadhanarajjaputtadārapariccāgoti pañca mahāpariccāgā, pubbayogo, pubbacariyā, dhammakkhānaṃ, ñātatthacariyā, lokatthacariyā, buddhatthacariyāti evamādayo saṅkhepato vā puññasambhārañāṇasambhārā buddhakarā dhammā, te mahābhinīhārato paṭṭhāya kappānaṃ satasahassādhikāni cattāri asaṅkhyeyyāni yathā hānabhāgiyā saṃkilesabhāgiyā ṭhitibhāgiyā vā na honti, atha kho uttaruttari visesabhāgiyāva honti, evaṃ sakkaccaṃ nirantaraṃ anavasesato bhatā sambhatā assa atthīti bhatavāti bhagavā niruttinayena ta-kārassa ga-kāraṃ katvā.
Those thirty pāramīs (ten pāramīs, ten upapāramīs, ten paramatthapāramīs) – namely, dāna-pāramī, sīla, nekkhamma, paññā, vīriya, khanti, sacca, adhiṭṭhāna, mettā, upekkhā-pāramīs – which the great bodhisattas, having combined the eight qualities such as being human, etc., and having made a great aspiration for perfect enlightenment for the welfare of all worlds, must fulfill; the four bases of sympathy (saṅgahavatthu) such as giving; the four determinations; the five great sacrifices: self-sacrifice, sacrificing eyes, wealth, kingdom, children and wife; previous connections; previous conduct; teaching the Dhamma; working for the good of relatives; working for the good of the world; working for the good of the Buddha-hood; and other such dhammas that lead to Buddhahood, in brief, accumulations of merit and accumulations of knowledge – from the great aspiration onwards, for four incalculables and a hundred thousand aeons, these did not become factors of decline, defilement, or stagnation, but rather became increasingly special factors. Thus, because these were accumulated, gathered, and existed in him earnestly and continuously, without remainder, bhatavā means Bhagavā, by changing the letter 'ta' to 'ga' according to etymology.
Vì những Ba-la-mật như bố thí Ba-la-mật, trì giới Ba-la-mật, xuất ly Ba-la-mật, trí tuệ Ba-la-mật, tinh tấn Ba-la-mật, nhẫn nại Ba-la-mật, chân thật Ba-la-mật, quyết định Ba-la-mật, từ bi Ba-la-mật, xả Ba-la-mật—tức mười Ba-la-mật, mười Ba-la-mật phụ, mười Ba-la-mật tối thượng, tổng cộng ba mươi Ba-la-mật—mà các vị Đại Bồ-tát đã viên mãn sau khi phát đại nguyện thành Chánh Đẳng Chánh Giác, hội đủ tám pháp như nhân loại v.v… với lòng hăng hái vì lợi ích của tất cả chúng sanh; bốn nhiếp pháp như bố thí v.v…; bốn quyết định; năm đại thí như thí thân, thí mắt, thí tài sản, thí vợ con; sự tu tập từ kiếp trước, sự tu tập của các bậc thầy từ kiếp trước, sự thuyết pháp, sự làm lợi ích cho bà con, sự làm lợi ích cho thế gian, sự làm lợi ích cho Phật quả—tức là các pháp tạo thành Phật quả, tóm lại là các tư lương phước đức và trí tuệ—từ khi phát đại nguyện cho đến bốn A-tăng-kỳ và một trăm ngàn đại kiếp, không hề có sự thoái hóa, không hề bị ô nhiễm, không hề dừng lại, mà chỉ tiến bộ ngày càng tăng lên. Vì Ngài đã tích lũy, đã hoàn thành một cách cẩn trọng, liên tục, không sót một chút nào, nên bhatavā là Bhagavā, theo phương pháp từ nguyên học, biến chữ ta thành ga.
Atha vā bhatavāti teyeva yathāvutte buddhakare dhamme vuttanayena bhari sambhari, paripūresīti attho.
Alternatively, bhatavā means that he cultivated, amassed, and perfected those very dhammas that lead to Buddhahood as described.
Hoặc bhatavā có nghĩa là Ngài đã gánh vác, đã tích lũy, đã viên mãn các pháp tạo thành Phật quả như đã nói ở trên theo phương pháp đã trình bày.
Evampi bhatavāti bhagavā.
Even so, bhatavā means Bhagavā.
Như vậy, bhatavā cũng là Bhagavā.
Kathaṃ bhāge vanīti bhagavā?
How is bhāge vanī meaning Bhagavā?
Làm thế nào bhāge vanī là Bhagavā?
Ye te catuvīsatikoṭisatasahassasaṅkhā devasikaṃ vaḷañjanakasamāpattibhāgā, te anavasesato lokahitatthaṃ attano ca diṭṭhadhammasukhavihāratthaṃ niccakappaṃ vani bhaji sevi bahulamakāsīti bhāge vanīti bhagavā.
Those portions of samāpatti, amounting to twenty-four hundred thousand crores daily, he constantly vanī (resorted to, practiced, made abundant) without remainder for the welfare of the world and for his own comfortable dwelling in this very life. Thus, bhāge vanī means Bhagavā.
Vì Ngài đã thường xuyên thực hành, đã thường xuyên thực hiện, đã thường xuyên thọ dụng các phần định (samāpatti) được sử dụng hàng ngày, tổng cộng hai mươi bốn tỷ trăm ngàn, không bỏ sót một chút nào, vì lợi ích của thế gian và vì sự an lạc trong hiện tại của chính mình, nên bhāge vanī là Bhagavā.
Atha vā abhiññeyyadhammesu kusalādīsu khandhādīsu ca ye te pariññeyyādivasena saṅkhepato vā catubbidhā abhisamayabhāgā, vitthārato pana ‘‘cakkhu pariññeyyaṃ, sotaṃ pariññeyyaṃ…pe… jarāmaraṇaṃ pariññeyya’’ntiādinā (paṭi. ma. 1.21) aneke pariññeyyabhāgā, ‘‘cakkhussa samudayo pahātabbo…pe… jarāmaraṇassa samudayo pahātabbo’’tiādinā nayena pahātabbabhāgā, ‘‘cakkhussa nirodho…pe… jarāmaraṇassa nirodho sacchikātabbo’’tiādinā sacchikātabbabhāgā, ‘‘cakkhussa nirodhagāminī paṭipadā’’tiādinā ‘‘cattāro satipaṭṭhānā’’tiādinā ca anekabhedā bhāvetabbabhāgā ca dhammā vuttā, te sabbe vani bhaji yathārahaṃ gocarabhāvanāsevanānaṃ vasena sevi.
Alternatively, regarding the knowable dhammas, such as wholesome qualities, aggregates, etc., those four kinds of comprehension, in brief, based on what is to be fully understood (pariññeyya) etc., and in detail, various portions to be fully understood as stated in "The eye is to be fully understood, the ear is to be fully understood... old age and death are to be fully understood" ; the portions to be abandoned, in the manner of "The origin of the eye is to be abandoned... the origin of old age and death is to be abandoned"; the portions to be realized, in the manner of "The cessation of the eye... the cessation of old age and death is to be realized"; and the various kinds of portions to be developed, such as "The path leading to the cessation of the eye" and "The four foundations of mindfulness" – he vanī (resorted to) all these dhammas, practiced them, and cultivated them appropriately through the practice of mental objects and development.
Hoặc, trong các pháp cần phải thắng tri, như các pháp thiện v.v… các uẩn v.v… có những phần cần phải thắng tri một cách tóm tắt theo bốn loại thắng tri (abhisamaya), hoặc một cách chi tiết theo nhiều phần cần phải thắng tri như “mắt cần phải thắng tri, tai cần phải thắng tri… v.v… già chết cần phải thắng tri” (Paṭisambhidāmagga 1.21); các phần cần phải đoạn trừ theo cách “sự sanh khởi của mắt cần phải đoạn trừ… v.v… sự sanh khởi của già chết cần phải đoạn trừ”; các phần cần phải chứng ngộ theo cách “sự diệt trừ của mắt… v.v… sự diệt trừ của già chết cần phải chứng ngộ”; và các phần cần phải tu tập với nhiều loại khác nhau theo cách “con đường dẫn đến sự diệt trừ của mắt” v.v… và “bốn niệm xứ” v.v… Ngài đã thực hành tất cả các pháp đó, đã thọ dụng chúng một cách thích đáng theo phương pháp hành trì và tu tập.
Evampi bhāge vanīti bhagavā.
Even so, bhāge vanī means Bhagavā.
Như vậy, bhāge vanī cũng là Bhagavā.
Atha vā ye ime sīlādayo dhammakkhandhā sāvakehi sādhāraṇā guṇakoṭṭhāsā guṇabhāgā, kinti nu kho te vineyyasantānesu patiṭṭhapeyyanti mahākaruṇāya vani abhipatthayi, sā cassa abhipatthanā yathādhippetaphalāvahā ahosi.
Or, it was with great compassion that he yearned, thinking: "How might these aggregates of Dhamma, such as virtue, which are common portions of qualities shared by disciples, be established in the minds of those to be trained?" And that yearning of his resulted in the desired outcome.
Hoặc giả, những uẩn pháp như giới, v.v., là những phần phẩm chất, những phần công đức chung với các đệ tử, Ngài đã mong cầu với đại bi rằng: “Làm sao để chúng có thể được thiết lập trong tâm dòng của những người đáng được giáo hóa?” Và sự mong cầu ấy của Ngài đã mang lại kết quả như ý nguyện.
Evampi bhāge vanīti bhagavā.
Thus, "he yearned for portions" (bhāge vanīti), hence Bhagavā.
Vì đã mong cầu những phần như vậy, nên Ngài là Bhagavā.
Kathaṃ bhage vanīti bhagavā?
How is it that he " yearned for portions" (bhage vanīti), hence Bhagavā?
Làm thế nào Ngài là Bhagavā vì đã thọ hưởng (vani) các phần (bhage)?
Samāsato tāva katapuññehi payogasampannehi yathāvibhavaṃ bhajīyantīti bhagā, lokiyalokuttarasampattiyo.
In brief, "portions" (bhagā) are worldly and supramundane achievements, which are enjoyed by those who have performed merit and are endowed with effort, according to their means.
Nói tóm tắt, những điều được những người đã tạo phước và có sự tinh tấn thọ hưởng tùy theo khả năng, đó là các phần (bhagā), tức là các thành tựu thế gian và siêu thế.
Tattha lokiye tāva tathāgato sambodhito pubbe bodhisattabhūto paramukkaṃsagate vani bhaji sevi, yattha patiṭṭhāya niravasesato buddhakaradhamme samannānento buddhadhamme paripācesi.
Among these, in the worldly sphere, before his enlightenment, the Tathāgata, as a Bodhisatta, yearned for, enjoyed, and cultivated the most exalted attainments, wherein establishing himself, he completely cultivated the qualities that lead to Buddhahood, perfecting the Buddha-qualities.
Trong đó, về thế gian, trước khi giác ngộ, khi còn là một vị Bồ Tát, bậc Như Lai đã thọ hưởng (vani), đã thực hành (bhaji), đã phụng sự (sevi) những điều đạt đến tột đỉnh, nhờ đó Ngài đã hoàn thiện các pháp làm Phật bằng cách thực hành đầy đủ các Phật pháp không còn sót lại.
Buddhabhūto pana te niravajjasukhūpasaṃhite anaññasādhāraṇe lokuttarepi vani bhaji sevi.
Having become a Buddha, he then yearned for, enjoyed, and cultivated those supramundane achievements, which are blameless, conducive to happiness, and not shared by others.
Sau khi thành Phật, Ngài cũng đã thọ hưởng (vani), đã thực hành (bhaji), đã phụng sự (sevi) những điều siêu thế vô tội, an lạc và vô song ấy.
Vittārato pana padesarajjaissariyacakkavattisampattidevarajjasampattiādivasena jhānavimokkhasamādhisamāpattiñāṇadassanamaggabhāvanāphalasacchikiriyādiuttarimanussadhammavasena ca anekavihite anaññasādhāraṇe bhage vani bhaji sevi.
In detail, he yearned for, enjoyed, and cultivated various unique portions such as the supreme happiness of a regional king, the sovereignty of a Cakkavatti, the kingship of devas, and also the supramundane qualities like jhāna, vimokkha, samādhi, samāpatti, knowledge, insight, path-development, and fruit-realization.
Nói rộng ra, Ngài đã thọ hưởng (vani), đã thực hành (bhaji), đã phụng sự (sevi) vô số các phần vô song khác nhau, như các thành tựu về vương quốc, quyền lực, địa vị Chuyển Luân Thánh Vương, thành tựu về chư thiên, v.v., và các pháp thượng nhân như thiền định, giải thoát, định, thành tựu định, trí tuệ, kiến giải, tu tập đạo, chứng đắc quả, v.v.
Evaṃ bhage vanīti bhagavā.
Thus, "he yearned for portions" (bhage vanīti), hence Bhagavā.
Vì đã thọ hưởng những phần như vậy, nên Ngài là Bhagavā.
Kathaṃ bhattavāti bhagavā?
How is it that he is " endowed with devotees" (bhattavā), hence Bhagavā?
Làm thế nào Ngài là Bhagavā vì có nhiều người sùng mộ (bhattavā)?
Bhattā daḷhabhattikā assa bahū atthīti bhattavā.
He has many devotees (bhattā) who are firmly devoted to him, hence he is endowed with devotees (bhattavā).
Vì Ngài có nhiều người sùng mộ (bhattā) với lòng sùng mộ kiên định, nên Ngài là bhattavā.
Tathāgato hi mahākaruṇāsabbaññutaññāṇādiaparimitanirupamappabhāvaguṇavisesasamaṅgībhāvato sabbasattāuttamo, sabbānatthaparihārapubbaṅgamāya niravasesahitasukhavidhānatapparāya niratisayāya payogasampattiyā sadevamanussāya pajāya accantupakāritāya dvattiṃsa mahāpurisalakkhaṇāsīti anubyañjana byāmappabhādi anaññasādhāraṇavisesapaṭimaṇḍitarūpakāyatāya yathābhuccaguṇādhigatena ‘‘itipi so bhagavā’’tiādinayappavattena lokattayabyāpinā suvipulena suvisuddhena ca thutighosena samannāgatattā ukkaṃsapāramippattāsu appicchatāsantuṭṭhitāādīsu suppatiṭṭhitabhāvato dasabalacatuvesārajjādiniratisayaguṇavisesasamaṅgībhāvato ca rūpappamāṇo rūpappasanno, ghosappamāṇo ghosappasanno, lūkhappamāṇo lūkhappasanno, dhammappamāṇo dhammappasannoti evaṃ catuppamāṇike lokasannivāse sabbathāpi pasādāvahabhāvena samantapāsādikattā aparimāṇānaṃ sattānaṃ sadevamanussānaṃ ādarabahumānagāravāyatanatāya paramapemasambhattiṭṭhānaṃ.
Indeed, the Tathāgata is supreme among all beings due to his possession of immeasurable and incomparable noble qualities such as great compassion and omniscience; he is an absolute benefactor to all beings, both devas and humans, through his unsurpassed accomplishment in diligently providing all welfare and happiness, preceded by the removal of all suffering; he possesses a physical body adorned with thirty-two major marks of a Great Man, eighty minor characteristics, and a fathom-long aura, unique and extraordinary; he is endowed with a vast and extremely pure voice of praise pervading the three worlds, arising from his truly attained qualities, as expressed in phrases like "Iti pi so Bhagavā"; he is well-established in the highest perfections of qualities such as little-wishing and contentment; and he is endowed with unsurpassed excellent qualities such as the ten powers and four kinds of intrepidity. Therefore, whether people are impressed by his form, impressed by his voice, impressed by his simple lifestyle, or impressed by the Dhamma, in this fourfold world-assemblage, he is universally pleasing in all ways, thereby being an object of reverence, esteem, and respect for countless beings, both devas and humans, and a source of supreme love and devotion.
Thật vậy, bậc Như Lai, do có vô lượng và vô song các phẩm chất đặc biệt như đại bi, trí tuệ toàn tri, v.v., nên Ngài là tối thượng trong tất cả chúng sanh; do có sự tinh tấn siêu việt, chuyên tâm mang lại lợi ích và an lạc vô tận, loại bỏ mọi điều bất lợi, nên Ngài là Đấng có công đức lớn lao đối với chúng sanh cả cõi trời và người; do có thân tướng được trang điểm bằng ba mươi hai tướng đại nhân, tám mươi tướng tùy hình, hào quang một tầm, v.v., những đặc điểm vô song; do có tiếng khen ngợi rộng lớn, trong sạch, vang dội khắp ba cõi, bắt đầu bằng câu “Itipi so Bhagavā” (Đức Thế Tôn là như vậy), v.v., dựa trên các phẩm chất chân thật đã đạt được; do đã an trú vững chắc trong các pháp Ba-la-mật tối thượng như thiểu dục, tri túc, v.v.; và do có vô song các phẩm chất đặc biệt như mười lực, bốn vô úy, v.v., nên Ngài là Đấng được hoan hỷ vì hình tướng, được hoan hỷ vì âm thanh, được hoan hỷ vì sự thô sơ, được hoan hỷ vì Pháp—như vậy, Ngài là Đấng toàn diện, mang lại sự hoan hỷ trong mọi phương diện cho tất cả chúng sanh trong thế giới bốn loại, là đối tượng của sự tôn kính, quý trọng, và là nơi nương tựa của tình yêu thương và sự sùng mộ tối thượng của vô lượng chúng sanh cả cõi trời và người.
Ye cassa ovāde patiṭṭhitā aveccappasādena samannāgatā honti, kenaci asaṃhāriyā tesaṃ sambhatti samaṇena vā brāhmaṇena vā devena vā mārena vā brahmunā vāti.
And those who are established in his admonition and endowed with unwavering faith cannot be shaken by any ascetic, brahmin, deva, Māra, or Brahmā in their devotion.
Và những ai đã an trú trong lời giáo huấn của Ngài, có niềm tin bất động, sự sùng mộ của họ không thể bị lay chuyển bởi bất kỳ vị Sa-môn, Bà-la-môn, chư thiên, Ma vương hay Phạm thiên nào.
Tathā hi te attano jīvitapaaccāgepi tattha pasādaṃ na pariccajanti tassa vā āṇaṃ daḷhabhattibhāvato.
Indeed, even at the cost of their own lives, they do not abandon their faith in him or his instruction, due to their firm devotion.
Thật vậy, họ không từ bỏ niềm tin vào Ngài hoặc lời dạy của Ngài, ngay cả khi phải hy sinh mạng sống, vì lòng sùng mộ kiên định.
Tenevāha –
Therefore, it is said:
Chính vì thế mà Ngài đã nói –
Kathaṃ bhage vamīti bhagavā?
How is it that he " emitted portions" (bhage vamīti), hence Bhagavā?
Làm thế nào Ngài là Bhagavā vì đã từ bỏ (vamī) các phần (bhage)?
Yasmā tathāgato bodhisattabhūtopi purimāsu jātīsu pāramiyo pūrento bhagasaṅkhātaṃ siriṃ issariyaṃ yasañca vami uggiri, kheḷapiṇḍaṃ viya anapekkho chaḍḍayi.
Because the Tathāgata, even as a Bodhisatta in previous existences, while fulfilling the Pāramīs, emitted and spewed forth "portions" such as glory, sovereignty, and fame, casting them off without attachment, like a lump of saliva.
Vì khi còn là một vị Bồ Tát trong các kiếp trước, Ngài đã hoàn thành các Ba-la-mật, đã từ bỏ (vami), đã nhổ bỏ (uggiri) sự giàu sang, quyền lực và danh tiếng được gọi là các phần (bhaga), đã vứt bỏ chúng không chút luyến tiếc như một cục đờm.
Tathā hissa somanassakumārakāle(jā. 1.15.211 ādayo) hatthipālakumārakāle(jā. 1.15.337 ādayo) ayogharapaṇḍitakāle(jā. 1.15.363 ādayo) mūgapakkhapaṇḍitakāle(jā. 2.22.1 ādayo) cūḷasutasomakāleti (jā. 2.17.195 ādayo) evamādīsu nekkhammapāramīpūraṇavasena devarajjasadisāya rajjasiriyā pariccattattabhāvānaṃ pamāṇaṃ natthi, carimattabhāvepi hatthagataṃ cakkavattisiriṃ devalokādhipaccasaasaṃ catudīpissariyaṃ cakkavattisampattisannissayaṃ sattaratanasamujjalaṃ yasañca tiṇāyapi amaññamāno nirapekkho pahāya abhinikkhamitvā sammāsambodhiṃ abhisambuddho, tasmā ime siriādike bhage vamīti bhagavā.
Thus, there is no limit to the instances where he, in lives such as that of Somanassa Kumāra, Hatthipāla Kumāra, Ayoghara Paṇḍita, Mūgapakkha Paṇḍita, and Cūḷasutasoma, renounced royal glory, similar to that of a deva king, for the sake of fulfilling the perfection of renunciation. And even in his last existence, he cast off without attachment the sovereign glory of a Cakkavatti that was within his grasp—the rulership of the deva world, the sovereignty over the four continents, the seven gems that adorn the Cakkavatti's wealth—considering them not even as a blade of grass. He went forth, attained Supreme Perfect Enlightenment, and therefore, because he emitted these "portions" such as glory, he is Bhagavā.
Thật vậy, không thể đếm hết số lần Ngài đã từ bỏ thân phận của mình trong các kiếp như Somanassakumāra (Jā. 1.15.211, v.v.), Hatthipālakumāra (Jā. 1.15.337, v.v.), Ayogharapaṇḍita (Jā. 1.15.363, v.v.), Mūgapakkha Paṇḍita (Jā. 2.22.1, v.v.), Cūḷasutasoma (Jā. 2.17.195, v.v.), v.v., bằng cách hoàn thành Ba-la-mật xuất ly, từ bỏ sự giàu sang vương quyền tương tự như vương quyền chư thiên. Ngay cả trong kiếp cuối cùng, Ngài đã từ bỏ sự giàu sang Chuyển Luân Thánh Vương trong tầm tay, sự thống trị cõi trời, quyền lực trên bốn châu, danh tiếng rực rỡ với bảy báu, coi chúng như cỏ rác, không chút luyến tiếc, xuất gia và chứng đắc Chánh Đẳng Giác. Vì vậy, Ngài là Bhagavā vì đã từ bỏ (vami) những phần như sự giàu sang, v.v.
Atha vā bhāni nāma nakkhattāni, tehi samaṃ gacchanti pavattantīti bhagā, sineruyugandharauttarakuruhimavantādibhājanalokavisesasannissayā sobhā kappaṭṭhāyibhāvato, tepi bhagavā vami taṃnivāsisattāvāsasamatikkamanato tappaṭibaddhachandarāgappahānena pajahīti.
Alternatively, "bhā" means constellations (nakkhattāni), and "gā" means those that go together or prevail with them; hence, "bhagā" refers to the beautiful special worlds that serve as bases for Mount Sineru, Yugandhara, Uttarukuru, Himavanta, and others, due to their lasting for an eon. The Bhagavā also emitted these (bhage vami), in that he transcended the abodes of beings dwelling there and abandoned the craving and attachment associated with them.
Hoặc giả, bhāni có nghĩa là các vì sao. Chúng vận hành cùng với các vì sao, tức là các phần (bhagā), là vẻ đẹp nương vào các thế giới đặc biệt như Sineru, Yugandhara, Uttarakuru, Himavanta, v.v., tồn tại trong một kiếp. Ngài cũng đã từ bỏ (vami) những phần ấy bằng cách vượt qua nơi cư trú của chúng sanh trong đó, và bằng cách đoạn trừ tham ái và dục vọng liên quan đến chúng.
Evampi bhage vamīti bhagavā.
Thus, "he emitted portions" (bhage vamīti), hence Bhagavā.
Vì đã từ bỏ những phần như vậy, nên Ngài là Bhagavā.
Kathaṃ bhāge vamīti bhagavā?
How is it that he " emitted portions" (bhāge vamīti), hence Bhagavā?
Làm thế nào Ngài là Bhagavā vì đã từ bỏ (vamī) các phần (bhāge)?
Bhāgā nāma sabhāgadhammakoṭṭhāsā, te khandhāyatanadhātādivasena, tatthāpi rūpavedanādivasena atītādivasena ca anekavidhā, te ca bhagavā sabbaṃ papañcaṃ sabbaṃ yogaṃ sabbaṃ ganthaṃ sabbaṃ saṃyojanaṃ samucchinditvā amatadhātuṃ samadhigacchanto vami uggiri, anapekkho chaḍḍayi na paccāgami.
"Portions" (bhāgā) are common divisions of phenomena, which are of many kinds, such as aggregates, sense bases, and elements, and also form, feeling, etc., and past, etc. Having cut off all proliferation, all bondage, all ties, all fetters, the Bhagavā attained the deathless element, thereby emitting and spewing them forth, casting them off without attachment, and never returning to them.
Các phần (bhāgā) là những phần của các pháp tương tự, chúng có nhiều loại khác nhau theo các uẩn, xứ, giới, v.v., và trong đó cũng có các loại như sắc, thọ, v.v., quá khứ, v.v. Đức Thế Tôn đã từ bỏ (vami), đã nhổ bỏ (uggiri) tất cả những phần ấy bằng cách đoạn trừ tất cả hý luận, tất cả ách phược, tất cả triền phược, tất cả kiết sử, và chứng đắc Pháp giới bất tử. Ngài đã vứt bỏ chúng không chút luyến tiếc và không bao giờ quay lại.
Tathā hesa sabbatthakameva pathaviṃ āpaṃ tejaṃ vāyaṃ, cakkhuṃ sotaṃ ghānaṃ jivhaṃ kāyaṃ manaṃ, rūpe sadde gandhe rase phoṭṭhabbe dhamme, cakkhuviññāṇaṃ…pe… manoviññāṇaṃ, cakkhusamphassaṃ…pe… manosamphassaṃ, cakkhusamphassajaṃ vedanaṃ…pe… manosamphassajaṃ vedanaṃ, cakkhusamphassajaṃ saññaṃ…pe… manosamphassajaṃ saññaṃ, cakkhusamphassajaṃ cetanaṃ…pe… manosamphassajaṃ cetanaṃ, rūpataṇhaṃ…pe… dhammataṇhaṃ, rūpavitakkaṃ…pe… dhammavitakkaṃ, rūpavicāraṃ…pe… dhammavicārantiādinā anupadadhammavibhāgavasenapi sabbeva dhammakoṭṭhāse anavasesato vami uggiri, anapekkhapariccāgena chaḍḍayi.
Thus, in the manner of analyzing Anupada Dhamma, he completely emitted and spewed forth all divisions of phenomena without remainder—earth, water, fire, wind; eye, ear, nose, tongue, body, mind; forms, sounds, odors, tastes, tactile objects, mental objects; eye-consciousness... ear-consciousness... mind-consciousness; eye-contact... mind-contact; feeling born of eye-contact... feeling born of mind-contact; perception born of eye-contact... perception born of mind-contact; volition born of eye-contact... volition born of mind-contact; craving for forms... craving for mental objects; thought about forms... thought about mental objects; examination of forms... examination of mental objects, etc.—casting them off with non-attachment.
Thật vậy, Ngài đã từ bỏ (vami), đã nhổ bỏ (uggiri) tất cả các phần của pháp một cách hoàn toàn không sót lại, bằng cách phân chia từng pháp như đất, nước, lửa, gió; mắt, tai, mũi, lưỡi, thân, ý; sắc, thanh, hương, vị, xúc, pháp; nhãn thức… cho đến ý thức; nhãn xúc… cho đến ý xúc; thọ do nhãn xúc sinh… cho đến thọ do ý xúc sinh; tưởng do nhãn xúc sinh… cho đến tưởng do ý xúc sinh; tư do nhãn xúc sinh… cho đến tư do ý xúc sinh; sắc ái… cho đến pháp ái; sắc tầm… cho đến pháp tầm; sắc tứ… cho đến pháp tứ, v.v., bằng cách từ bỏ không luyến tiếc.
Vuttañhetaṃ ‘‘yaṃ taṃ, ānanda, cattaṃ vantaṃ muttaṃ pahīnaṃ paṭinissaṭṭhaṃ, taṃ tathāgato puna paccāgamissatīti netaṃ ṭhānaṃ vijjatī’’ti (dī. ni. 2.183).
For it has been said: "That which, Ānanda, has been given up, vomited forth, released, abandoned, relinquished—it is not possible for the Tathāgata to turn back to that again."
Điều này đã được nói: “Này Ānanda, cái gì đã được từ bỏ, đã được nhổ bỏ, đã được giải thoát, đã được đoạn trừ, đã được xả ly, điều Như Lai sẽ không bao giờ quay trở lại với điều đó, điều này là không thể có.”
Evampi bhāge vamīti bhagavā.
In this way too, he vomited forth shares, thus Bhagavā.
Cũng vậy, Đức Thế Tôn nhổ bỏ các phần (ác pháp).
Atha vā bhāge vamīti sabbepi kusalākusale sāvajjānavajje hīnapaṇīte kaṇhasukkasappaṭibhāge dhamme ariyamaggañāṇamukhena vami uggiri, anapekkho pariccaji pajahi, paresañca tathattāya dhammaṃ desesi.
Or, he vomited forth shares means he vomited forth, disgorged all wholesome and unwholesome, blameworthy and blameless, inferior and excellent, dark and bright opposing qualities (dhamma) through the wisdom of the Noble Path, relinquishing them without attachment, abandoning them, and taught the Dhamma for others to achieve the same state.
Hoặc là, nhổ bỏ các phần nghĩa là Đức Thế Tôn đã nhổ bỏ, đã ói ra, đã xả ly không luyến tiếc, đã đoạn trừ tất cả các pháp thiện và bất thiện, có tội và không tội, hạ liệt và thù thắng, thuộc phần đen và phần trắng, bằng trí tuệ đạo Thánh, và đã thuyết pháp cho người khác để họ cũng đạt được như vậy.
Vuttampi cetaṃ ‘‘dhammāpi vo, bhikkhave, pahātabbā pageva adhammā (ma. ni. 240).
And it has also been said: "Even the Dhamma, bhikkhus, should be abandoned, how much more so the non-Dhamma.
Điều này cũng đã được nói: “Này các tỳ khưu, các pháp còn phải từ bỏ, huống chi là phi pháp.
Kullūpamaṃ vo, bhikkhave, dhammaṃ desessāmi nittharaṇatthāya, no gahaṇatthāyā’’tiādi (ma. ni. 1.240).
I shall teach you the Dhamma, bhikkhus, by means of a raft simile, for the purpose of crossing over, not for grasping," and so on.
Này các tỳ khưu, Ta sẽ thuyết pháp cho các ông như chiếc bè để vượt qua, không phải để nắm giữ,” v.v.
Evampi bhāge vamīti bhagavā.
In this way too, he vomited forth shares, thus Bhagavā.
Cũng vậy, Đức Thế Tôn nhổ bỏ các phần (ác pháp).
Ettha ca yasmā saṅkhepato attahitasampattiparahitapaṭipattivasena duvidhā buddhaguṇā, tāsu attahitasampatti pahānasampadāñāṇasampadābhedato duvidhā ānubhāvasampadādīnaṃ tadavinābhāvena tadantogadhattā.
Here, since the Buddha's qualities are briefly twofold, being the accomplishment of one's own welfare and the practice for the welfare of others, among these, the accomplishment of one's own welfare is twofold through the distinction of the accomplishment of abandonment and the accomplishment of knowledge, as the accomplishment of potency and others are included therein by being inseparable from them.
Ở đây, vì các đức tính của chư Phật tóm tắt có hai loại theo sự thành tựu lợi ích cho mình và sự thực hành lợi ích cho người, trong đó, sự thành tựu lợi ích cho mình có hai loại theo sự thành tựu đoạn trừ và sự thành tựu trí tuệ, vì sự thành tựu uy lực, v.v., đều nằm trong đó do không thể tách rời khỏi chúng.
Parahitapaṭipatti payogāsayabhedato duvidhā.
The practice for the welfare of others is twofold through the distinction of method and intention.
Sự thực hành lợi ích cho người có hai loại theo phương pháp và ý định.
Tattha payogato lābhasakkārādinirapekkhacittassa sabbadukkhaniyyānikadhammūpadeso, āsayato paṭiviruddhesupi niccaṃ hitesitā ñāṇaparipākakālāgamanādiparahitappaṭipatti.
Among these, by method, it is the teaching of Dhamma leading to the cessation of all suffering by a mind unattached to gain, honor, etc.; by intention, it is the constant wishing for welfare even for those who are contrary, and the practice for the welfare of others, such as the arrival of the time for the ripening of knowledge.
Trong đó, về phương pháp là sự thuyết pháp dẫn đến thoát khỏi mọi khổ đau của một tâm không mong cầu lợi lộc, danh tiếng, v.v.; về ý định là sự mong muốn lợi ích thường xuyên cho người khác ngay cả đối với những người chống đối, sự thực hành lợi ích cho người như thời điểm trí tuệ chín muồi, v.v.
Āmisapaṭiggahaṇādināpi atthacariyā parahitapaapatti hotiyeva, tasmā tesampi vibhāvanavasena pāḷiyaṃ ‘‘araha’’ntiādīnaṃ padānaṃ gahaṇaṃ veditabbaṃ.
Practicing welfare through accepting material things and so on is indeed a practice for the welfare of others; therefore, to elucidate these, the acceptance of terms like " Arahant" in the Pāli should be understood.
Sự thực hành lợi ích cho người cũng là sự hành thiện bằng cách nhận vật thực, v.v., do đó, sự sử dụng các từ như “A-la-hán” v.v., trong Pāḷi cần được hiểu là để làm sáng tỏ những điều đó.
Tattha arahanti iminā padena pahānasampadāvasena bhagavato attahitasampatti vibhāvitā, sammāsambuddho lokavidūti ca imehi padehi ñāṇasampadāvasena.
Here, by the term " Arahant," the Bhagavā's accomplishment of his own welfare is elucidated in terms of the accomplishment of abandonment; and by the terms " Sammāsambuddha, lokavidū," it is elucidated in terms of the accomplishment of knowledge.
Trong đó, với từ A-la-hán, sự thành tựu lợi ích cho mình của Đức Thế Tôn được làm sáng tỏ theo sự thành tựu đoạn trừ; và với các từ Chánh Đẳng Giác, Bậc Hiểu Rõ Thế Gian, sự thành tựu trí tuệ được làm sáng tỏ.
Nanu ca ‘‘lokavidū’’ti imināpi sammāsambuddhatā vibhāvīyatīti?
But is it not the case that even by the term "lokavidū," the state of Sammāsambuddha is elucidated?
Há chẳng phải với từ “Bậc Hiểu Rõ Thế Gian” cũng làm sáng tỏ sự Chánh Đẳng Giác sao?
Saccaṃ vibhāvīyati, atthi pana viseso ‘‘sammāsambuddho’’ti iminā sabbaññutaññāṇānubhāvo vibhāvito, ‘‘lokavidū’’ti pana iminā āsayānusayañāṇādīnampi ānubhāvo vibhāvitoti.
Indeed, it is elucidated, but there is a distinction: by "Sammāsambuddha," the potency of omniscience is elucidated; by "lokavidū," the potency of knowledge of inclinations and underlying tendencies (āsayānusayañāṇa) and so on is elucidated.
Đúng là có làm sáng tỏ, nhưng có sự khác biệt: với từ “Chánh Đẳng Giác”, uy lực của trí tuệ toàn tri được làm sáng tỏ, còn với từ “Bậc Hiểu Rõ Thế Gian” thì uy lực của trí tuệ hiểu rõ khuynh hướng và tùy miên, v.v., cũng được làm sáng tỏ.
Vijjācaraṇasampannoti iminā sabbāpi bhagavato attahitasampatti vibhāvitā.
By " Vijjācaraṇasampanna," all of the Bhagavā's accomplishment of his own welfare is elucidated.
Với từ Minh Hạnh Túc, tất cả sự thành tựu lợi ích cho mình của Đức Thế Tôn được làm sáng tỏ.
Sugatoti pana iminā samudāgamato paṭṭhāya bhagavato attahitasampatti parahitapaṭipatti ca vibhāvitā.
By " Sugata," however, the Bhagavā's accomplishment of his own welfare and practice for the welfare of others are elucidated, starting from his arising.
Còn với từ Thiện Thệ, sự thành tựu lợi ích cho mình và sự thực hành lợi ích cho người của Đức Thế Tôn từ khi khởi đầu (con đường) được làm sáng tỏ.
Anuttaro purisadammasārathi satthā devamanussānanti imehi padehi bhagavato parahitapaṭipatti vibhāvitā.
By the terms " Anuttaro purisadammasārathi satthā devamanussāna," the Bhagavā's practice for the welfare of others is elucidated.
Với các từ Vô Thượng Sĩ Điều Ngự Trượng Phu, Bậc Đạo Sư Của Chư Thiên Và Loài Người, sự thực hành lợi ích cho người của Đức Thế Tôn được làm sáng tỏ.
Buddhoti iminā bhagavato attahitasampatti parahitapaṭipatti ca vibhāvitā.
By " Buddha," the Bhagavā's accomplishment of his own welfare and practice for the welfare of others are elucidated.
Với từ Phật, sự thành tựu lợi ích cho mình và sự thực hành lợi ích cho người của Đức Thế Tôn được làm sáng tỏ.
Evañca katvā ‘‘sammāsambuddho’’ti vatvā ‘‘buddho’’ti vacanaṃ samatthitaṃ hoti.
And having done so, saying "Buddha" after saying "Sammāsambuddha" becomes justifiable.
Và khi đã làm như vậy, việc nói “Phật” sau khi nói “Chánh Đẳng Giác” là hợp lý.
Tenevāha ‘‘attanāpi bujjhi, aññepi satte bodhesī’’tiādi.
Therefore it is said: "He himself awakened, and he awakened other beings," and so on.
Do đó đã nói: “Tự mình giác ngộ, và cũng làm cho các chúng sanh khác giác ngộ,” v.v.
Bhagavāti ca imināpi samudāgamato paṭṭhāya bhagavato sabbā attahitasampatti parahitapaṭipatti ca vibhāvitā.
And by " Bhagavā," all of the Bhagavā's accomplishment of his own welfare and practice for the welfare of others are elucidated, starting from his arising.
Và với từ Thế Tôn, tất cả sự thành tựu lợi ích cho mình và sự thực hành lợi ích cho người của Đức Thế Tôn từ khi khởi đầu (con đường) cũng được làm sáng tỏ.
Aparo nayo – hetuphalasattupakāravasena saṅkhepato tividhā buddhaguṇā.
Another way: The Buddha's qualities are briefly threefold, in terms of cause, fruit, and benefit to beings.
Một cách khác – các đức tính của chư Phật tóm tắt có ba loại theo nhân, quả và sự giúp đỡ chúng sanh.
Tattha arahaṃ sammāsambuddho vijjācaraṇasampanno lokavidūti imehi padehi phalasampattivasena buddhaguṇā vibhāvitā.
Here, by the terms " Arahant, Sammāsambuddha, Vijjācaraṇasampanna, Lokavidū," the Buddha's qualities are elucidated in terms of the accomplishment of fruit.
Trong đó, với các từ A-la-hán, Chánh Đẳng Giác, Minh Hạnh Túc, Bậc Hiểu Rõ Thế Gian, các đức tính của chư Phật được làm sáng tỏ theo sự thành tựu quả.
Anuttaro purisadammasārathi satthā devamanussānanti imehi sattupakāravasena buddhaguṇā pakāsitā.
By " Anuttaro purisadammasārathi satthā devamanussāna," the Buddha's qualities are proclaimed in terms of benefit to beings.
Với các từ Vô Thượng Sĩ Điều Ngự Trượng Phu, Bậc Đạo Sư Của Chư Thiên Và Loài Người, các đức tính của chư Phật được làm sáng tỏ theo sự giúp đỡ chúng sanh.
Buddhoti iminā phalavasena sattupakāravasena ca buddhaguṇā vibhāvitā.
By " Buddha," the Buddha's qualities are elucidated in terms of fruit and benefit to beings.
Với từ Phật, các đức tính của chư Phật được làm sáng tỏ theo quả và theo sự giúp đỡ chúng sanh.
Sugato bhagavāti pana imehi padehi hetuphalasattupakāravasena buddhaguṇā vibhāvitāti veditabbaṃ.
And by the terms " Sugata, Bhagavā," the Buddha's qualities are understood to be elucidated in terms of cause, fruit, and benefit to beings.
Còn với các từ Thiện Thệ, Thế Tôn, các đức tính của chư Phật được làm sáng tỏ theo nhân, quả và sự giúp đỡ chúng sanh, cần phải hiểu như vậy.
So imaṃ lokantiādīsu so bhagavāti yo ‘‘araha’’ntiādinā kittitaguṇo, so bhagavā.
In " So imaṃ lokaṃ" and so on, " So Bhagavā" refers to that Bhagavā whose qualities have been praised by "Arahant" and so on.
Trong So imaṃ lokantiādīsu (Ngài thế gian này, v.v.), so bhagavā (Đức Thế Tôn ấy) là Đức Thế Tôn có các đức tính đã được ca ngợi bằng “A-la-hán” v.v.
Imaṃ lokanti nayidaṃ mahājanassa sammukhāmattaṃ sandhāya vuttaṃ, atha kho anavasesaṃ pariyādāyāti dassetuṃ ‘‘sadevaka’’ntiādi vuttaṃ.
" Imaṃ lokaṃ" is not said referring merely to that which is before the general populace, but " sadevaka" and so on are said to show that it is without remainder, all-encompassing.
Imaṃ lokaṃ (thế gian này) không phải chỉ nói về cái đối diện với đại chúng, mà để chỉ ra rằng không còn gì sót lại, nên đã nói “sadevaka” (cùng với chư thiên) v.v.
Tenāha ‘‘idāni vattabbaṃ nidassetī’’ti.
Therefore he says: " Now he points out what is to be stated."
Do đó đã nói “idāni vattabbaṃ nidassetī” (bây giờ chỉ ra điều cần nói).
Pajātattāti yathāsakaṃ kammakilesehi nibbattattā.
" Pajātattā" means having arisen from their respective kamma and defilements.
Pajātattā (do đã được sanh) nghĩa là do đã được tạo ra bởi nghiệp và phiền não của riêng mỗi người.
Sadevakavacanena pañcakāmāvacaradevaggahaṇaṃ pārisesañāyenāti veditabbaṃ itaresaṃ padantarehi saṅgahitattā.
It should be understood that the comprehension of the five sense-sphere devas by the word sadevaka is by the principle of remainder, as the others are encompassed by other terms.
Sự thâu tóm chư thiên cõi dục giới ngũ phần bằng từ sadevakavacana (lời cùng với chư thiên) cần được hiểu theo phép suy luận loại trừ, vì những người khác đã được thâu tóm bởi các từ khác.
Sadevakanti ca avayavena viggaho samudāyo samāsattho.
And " Sadevaka" is a compound meaning the totality, the resolution by its components.
Và sadevaka (cùng với chư thiên) là một hợp thể, một ý nghĩa của hợp từ theo từng thành phần.
Samārakavacanena chaṭṭhakāmāvacaradevaggahaṇaṃ paccāsattiñāyenāti daṭṭhabbaṃ.
The comprehension of the six sense-sphere devas by the word samāraka should be seen by the principle of contiguity.
Sự thâu tóm chư thiên cõi dục giới thứ sáu bằng từ samārakavacana (lời cùng với Ma-vương) cần được thấy theo phép suy luận gần gũi.
Tattha hi so jāto taṃnivāsī ca.
For it is there that he is born and dwells.
Vì ở đó, Ma-vương đã được sanh ra và cư ngụ.
Sabrahmakavacanena brahmakāyikādibrahmaggahaṇanti etthāpi eseva nayo.
In " sabrahmakavacanena brahmakāyikādibrahmaggahaṇa" (comprehension of Brahmās such as the Brahmakāyikā devas by the word sabrahmaka), the same method applies.
Trong sabrahmakavacanena brahmakāyikādibrahmaggahaṇa (sự thâu tóm Phạm thiên thân Phạm thiên, v.v., bằng lời cùng với Phạm thiên), cũng theo cách tương tự.
Paccatthikā…pe… samaṇabrāhmaṇaggahaṇanti nidassanamattametaṃ apaccatthikānaṃ asamitābāhitapāpānañca samaṇabrāhmaṇānaṃ sassamaṇabrāhmaṇīvacanena gahitattā.
" Paccatthikā…pe… samaṇabrāhmaṇaggahaṇa" is merely an example, since non-enemies and samaṇas and brāhmaṇas who have not calmed and cast out evil are included by the term "sassamaṇabrāhmaṇī."
Paccatthikā…pe… samaṇabrāhmaṇaggahaṇa (kẻ thù… v.v… sự thâu tóm các sa-môn và bà-la-môn) đây chỉ là một ví dụ, vì các sa-môn và bà-la-môn không phải là kẻ thù và không có các ác pháp đã được dẹp yên hay loại bỏ, đã được thâu tóm bằng từ sassamaṇabrāhmaṇī (cùng với các sa-môn và bà-la-môn).
Kāmaṃ ‘‘sadevaka’’ntiādivisesanānaṃ vasena sattavisayo lokasaddoti viññāyati tulyayogavisayattā tesaṃ, ‘‘salomako sapakkhako’’tiādīsu pana atulyayogepi ayaṃ samāso labbhatīti byabhicāradassanato pajāgahaṇanti āha ‘‘pajāvacanena sattalokaggahaṇa’’nti.
Although the word "loka" (world) as "satta-loka" (world of beings) is understood by means of the qualifiers "sadevaka" and so on, due to their having a similar range of application, in cases like "salomako sapakkhako" (with hair, with wings), this compound is found even in dissimilar applications, and thus to avoid the fallacy of equivocation, he says " pajāvacanena sattalokaggahaṇa" (the comprehension of the world of beings by the word pajā).
Mặc dù từ loka (thế gian) được hiểu là lĩnh vực của chúng sanh theo các tính từ đặc biệt như “sadevaka” (cùng với chư thiên) v.v., vì chúng có cùng phạm vi áp dụng, nhưng vì trong các trường hợp như “salomako sapakkhako” (cùng với lông, cùng với cánh) v.v., hợp từ này cũng được tìm thấy ngay cả khi không có cùng phạm vi áp dụng, do thấy sự sai lệch, nên đã nói sự thâu tóm chúng sanh bằng từ pajāvacanena sattalokaggahaṇa (sự thâu tóm thế gian chúng sanh bằng từ chúng sanh).
Sadevakādivacanena upapattidevānaṃ, sassamaṇabrāhmaṇīvacanena visuddhidevānañca gahitattā āha ‘‘sadevamanussavacanena sammutidevaavasesamanussaggahaṇa’’nti.
Since the devas by birth (upapattideva) are included by "sadevaka" and other terms, and the pure devas (visuddhideva) are included by "sassamaṇabrāhmaṇī," he says " sadevamanussavacanena sammutidevaavasesamanussaggahaṇa" (the comprehension of conventional devas and remaining humans by the word sadevamanussa).
Vì các vị trời tái sanh đã được thâu tóm bằng từ sadevakādi (cùng với chư thiên, v.v.), và các vị trời thanh tịnh đã được thâu tóm bằng từ sassamaṇabrāhmaṇī (cùng với các sa-môn và bà-la-môn), nên đã nói “sadevamanussavacanena sammutidevaavasesamanussaggahaṇa” (sự thâu tóm các vị trời quy ước và phần còn lại của loài người bằng từ cùng với chư thiên và loài người).
Tattha sammutidevā rājāno.
Here, conventional devas are kings.
Trong đó, sammutidevā (các vị trời quy ước) là các vị vua.
Avasesamanussaggahaṇanti samaṇabrāhmaṇehi avasesamanussaggahaṇaṃ.
" Avasesamanussaggahaṇa" means the comprehension of humans other than samaṇas and brāhmaṇas.
Avasesamanussaggahaṇa (sự thâu tóm phần còn lại của loài người) là sự thâu tóm phần còn lại của loài người ngoài các sa-môn và bà-la-môn.
Tīhi padehīti sadevakasamārakasabarhmakavacanehi.
" By three terms" refers to the terms sadevaka, samāraka, and sabrahmaka.
Tīhi padehīti (bằng ba từ) là bằng các từ sadevaka (cùng với chư thiên), samāraka (cùng với Ma-vương) và sabrahmaka (cùng với Phạm thiên).
Dvīhīti sassamaṇabrāhmaṇiṃ sadevamanussanti imehi dvīhi padehi.
" By two" refers to these two terms: sassamaṇabrāhmaṇī and sadevamanussa.
Dvīhīti (bằng hai từ) là bằng hai từ này: sassamaṇabrāhmaṇiṃ (cùng với các sa-môn và bà-la-môn) và sadevamanussanti (cùng với chư thiên và loài người).
Arūpī sattā attano āneñjavihārena viharantā dibbantīti devāti imaṃ nibbacanaṃ labhantīti āha ‘‘sadevakaggahaṇena arūpāvacaraloko gahito’’ti.
Since formless beings (arūpī sattā), dwelling with their imperturbable abiding (āneñjavihāra), shine (dibbatīti), thus attaining this explanation of devas, he says " sadevakaggahaṇena arūpāvacaraloko gahito" (the formless realm is understood by the term sadevaka).
Các chúng sanh vô sắc sống trong trạng thái an tịnh của riêng mình được gọi là chư thiên (dibba), nên đã nói “sadevakaggahaṇena arūpāvacaraloko gahito” (thế giới vô sắc giới được thâu tóm bằng sự thâu tóm cùng với chư thiên).
Tenevāha bhagavā ‘‘ākāsānañcāyatanūpagānaṃ devānaṃ sahabyata’’ntiādi (a. ni. 3.117).
Therefore the Bhagavā said: "The companionship of devas who have attained the base of infinite space," and so on.
Do đó Đức Thế Tôn đã nói: “Sự đồng hành với chư thiên đạt đến cõi Không Vô Biên Xứ,” v.v.
Chakāmāvacaradevalokassa savisesaṃ mārassa vase vattanato āha ‘‘samārakaggahaṇena chakāmāvacaradevaloko’’ti.
Because the six sense-sphere deva realms are especially subject to Māra's power, he says " samārakaggahaṇena chakāmāvacaradevaloko" (the six sense-sphere deva realms are understood by the term samāraka).
Vì cõi trời dục giới sáu tầng đặc biệt nằm dưới quyền kiểm soát của Ma-vương, nên đã nói “samārakaggahaṇena chakāmāvacaradevaloko” (cõi trời dục giới sáu tầng được thâu tóm bằng sự thâu tóm cùng với Ma-vương).
Arūpībrahmalokassa visuṃ gahitattā āha ‘‘rūpī brahmaloko’’ti.
Since the formless Brahmā realm is taken separately, he says " rūpī brahmaloko" (the form Brahmā realm).
Vì cõi trời Phạm thiên vô sắc đã được thâu tóm riêng, nên đã nói “rūpī brahmaloko” (cõi trời Phạm thiên hữu sắc).
Catuparisavasenāti khattiyaparisā, brāhmaṇagahapatisamaṇacātumahārājikatāvatiṃsamārabrahmaparisāti imāsu aṭṭhasu parisāsu khattiyādicatuparisavasena.
" Catuparisavasenā" (by means of the four assemblies) refers to the khattiya assembly, brāhmaṇa assembly, householder assembly, samaṇa assembly, and the Cātumahārājika, Tāvatiṃsa, Māra, and Brahmā assemblies—among these eight assemblies, by means of the four assemblies beginning with khattiya.
Catuparisavasenāti (theo bốn hội chúng) là theo bốn hội chúng trong tám hội chúng này: hội chúng Sát-đế-lợi, hội chúng Bà-la-môn, hội chúng Gia-chủ, hội chúng Sa-môn, hội chúng Tứ Đại Thiên Vương, hội chúng Đao Lợi, hội chúng Ma-vương, hội chúng Phạm thiên.
Itarā pana catasso parisā samārakaggahaṇena gahitā evāti.
The other four assemblies are already included by the term samāraka.
Còn bốn hội chúng kia đã được thâu tóm bằng sự thâu tóm cùng với Ma-vương.
Kathaṃ panettha catuparisavasena manussaloko gahito?
How, then, is the human world included here by means of the four assemblies?
Thế thì, làm thế nào mà thế giới loài người lại được thâu tóm theo bốn hội chúng ở đây?
‘‘Sassamaṇabrāhmaṇi’’nti iminā samaṇaparisā brāhmaṇaparisā ca gahitā honti, ‘‘sadevamanussa’’nti iminā khattiyaparisā gahapatiparisā ca gahitā, ‘‘paja’’nti iminā pana imāyeva catasso parisā vuttā, catuparisasaṅkhātaṃ pajanti vuttaṃ hoti, kathaṃ pana sammutidevehi saha manussaloko gahito?
By ‘‘sassamaṇabrāhmaṇi’’ (with recluses and brahmins), the assembly of recluses and the assembly of brahmins are included; by ‘‘sadevamanussa’’ (with devas and humans), the assembly of khattiyas and the assembly of householders are included; by ‘‘pajā’’ (populace), these four assemblies themselves are stated. It means the populace, consisting of the four assemblies, is spoken of. How, then, is the human world, together with conventional devas, included?
Với cụm từ “cùng với các Sa-môn và Bà-la-môn” (sassamaṇabrāhmaṇi), hội chúng Sa-môn và hội chúng Bà-la-môn được bao gồm. Với cụm từ “cùng với chư thiên và loài người” (sadevamanussa), hội chúng Sát-đế-lợi và hội chúng gia chủ được bao gồm. Còn với cụm từ “chúng sinh” (pajā), chính bốn hội chúng này đã được nói đến; tức là chúng sinh được nói đến là bốn hội chúng. Nhưng làm thế nào mà thế giới loài người cùng với các vị trời quy ước (sammutideva) lại được bao gồm?
Etthāpi ‘‘sassamaṇabrāhmaṇi’’nti iminā samaṇabrāhmaṇā gahitā, ‘‘sadevamanussa’’nti iminā sammutidevasaṅkhātā khattiyā, gahapatisuddasaṅkhātā avasesamanussā ca gahitā honti.
Even here, by ‘‘sassamaṇabrāhmaṇi’’, recluses and brahmins are included; by ‘‘sadevamanussa’’, khattiyas, known as conventional devas, and the remaining humans, known as householders and pure humans, are included.
Ở đây, với cụm từ “cùng với các Sa-môn và Bà-la-môn” (sassamaṇabrāhmaṇi), các Sa-môn và Bà-la-môn được bao gồm. Với cụm từ “cùng với chư thiên và loài người” (sadevamanussa), các Sát-đế-lợi được gọi là chư thiên quy ước (sammutideva), và những loài người còn lại được gọi là gia chủ và thủ-đà (gahapatisuddha) cũng được bao gồm.
Ito pana aññesaṃ manussasattānaṃ abhāvato ‘‘paja’’nti iminā catūhi pakārehi ṭhitā eteyeva manussasattā vuttāti daṭṭhabbaṃ.
Since there are no other human beings apart from these, it should be understood that by ‘‘pajā’’, these very human beings, existing in four ways, are meant.
Từ đây, do không có các loài hữu tình khác ngoài loài người, nên phải hiểu rằng với cụm từ “chúng sinh” (pajā), chính những loài hữu tình loài người này, tồn tại theo bốn cách, đã được nói đến.
Evaṃ vikappadvayepi pajāggahaṇena catuparisādivasena ṭhitānaṃ manussānaṃyeva gahitattā idāni ‘‘paja’’nti iminā avasesasatte saṅgahetvā dassetukāmo āha ‘‘avasesasabbasattaloko vā’’ti.
Thus, in both interpretations, because humans existing as the four assemblies are included by the term "pajā," now, desiring to include the remaining beings by "pajā," he says, "or the world of all remaining beings."
Như vậy, trong cả hai cách phân loại, do việc nắm bắt “chúng sinh” đã bao gồm những loài người tồn tại dưới dạng bốn hội chúng, nên bây giờ, muốn chỉ ra rằng cụm từ “chúng sinh” này bao gồm các loài hữu tình còn lại, nên đã nói “hoặc toàn bộ thế giới các loài hữu tình còn lại”.
Tattha nāgagaruḷādivasena avasesasattaloko veditabbo.
Therein, the world of remaining beings should be understood as comprising nāgas, garuḷas, and so forth.
Ở đây, thế giới các loài hữu tình còn lại phải được hiểu là các loài như Nāga, Garuḷa, v.v.
Etthāpi catuparisavasena sammutidevehi vā saha avasesasabbasattaloko vāti yojetabbaṃ.
Even here, it should be construed as "the world of all remaining beings, together with conventional devas, in terms of the four assemblies."
Ở đây cũng vậy, phải phối hợp rằng “hoặc toàn bộ thế giới các loài hữu tình còn lại cùng với các vị trời quy ước theo bốn hội chúng”.
Catuparisasahito avasesasuddhanāgasupaṇṇanerayikādisattaloko, catudhā ṭhitamanussasahito vā avasesanāgasupaṇṇanerayikādisattaloko gahitoti vuttaṃ hoti.
It is said that the world of remaining pure beings like nāgas, supaṇṇas, and hell-beings, together with the four assemblies, or the world of remaining beings like nāgas, supaṇṇas, and hell-beings, together with humans existing in four ways, is included.
Tức là, thế giới các loài hữu tình còn lại như Nāga, Supaṇṇa, chúng sinh địa ngục thuần túy, cùng với bốn hội chúng đã được bao gồm, hoặc thế giới các loài hữu tình còn lại như Nāga, Supaṇṇa, chúng sinh địa ngục, cùng với loài người tồn tại theo bốn cách đã được bao gồm.
Ettāvatā bhāgaso lokaṃ gahetvā yojanaṃ dassetvā idāni tena tena visesena abhāgaso lokaṃ gahetvā yojanaṃ dassetuṃ ‘‘apicetthā’’tiādi vuttaṃ.
Having thus shown the partial inclusion of the world by parts, now, to show the inclusion of the world in its entirety through specific distinctions, the phrase "apicetthā" (furthermore, here) and so on is stated.
Cho đến đây, sau khi đã chỉ ra cách phối hợp bằng cách nắm bắt thế giới theo từng phần, bây giờ, để chỉ ra cách phối hợp bằng cách nắm bắt thế giới một cách không phân chia theo từng đặc điểm đó, nên đã nói “hơn nữa, ở đây” và tiếp theo.
Tattha ukkaṭṭhaparicchedatoti ukkaṃsagativijānanena.
Therein, ukkaṭṭhaparicchedato means by understanding the excellent destination.
Ở đây, “từ sự phân định tối thượng” (ukkaṭṭhaparicchedato) có nghĩa là từ sự hiểu biết về trạng thái tối thượng.
Pañcasu hi gatīsu devagatipariyāpannāva seṭṭhā, tatthāpi arūpino dūrasamussāritakilesadukkhatāya santapaṇītaāneñjavihārasamaṅgitāya ativiya dīghāyukatāyāti evamādīhi visesehi ativiya ukkaṭṭhā.
Among the five destinations, the divine destination is indeed the noblest; and even within that, the formless beings are exceedingly excellent due to having far-removed defilements and suffering, being endowed with tranquil, sublime, and imperturbable abodes, and having exceedingly long lives, and so forth.
Trong năm cõi, cõi trời là tối thắng, và trong đó, các vị trời vô sắc còn tối thượng hơn nữa nhờ việc đã loại bỏ phiền não khổ đau từ xa, nhờ sự an tịnh, vi diệu, và sự thành tựu các trú xứ bất động (āneñjavihāra), nhờ tuổi thọ cực kỳ dài, v.v., và các đặc điểm khác.
Brahmā mahānubhāvoti dasasahassiyaṃ mahābrahmuno vasena vadati.
Brahmā mahānubhāvo (Brahmā of great power) refers to Mahābrahmā in the ten-thousandfold world system.
“Phạm thiên Đại uy lực” (Brahmā mahānubhāvo) được nói đến theo nghĩa của Đại Phạm thiên trong một ngàn thế giới.
‘‘Ukkaṭṭhaparicchedato’’ti hi vuttaṃ.
For it was said, "by the highest delimitation."
Vì đã nói “từ sự phân định tối thượng”.
Anuttaranti seṭṭhaṃ navalokuttaraṃ.
Anuttaraṃ (unsurpassed) refers to the noble, unsurpassed supramundane (ninefold).*
“Vô thượng” (Anuttaraṃ) là chín pháp siêu thế tối thắng.
Anusandhikkamoti atthānañceva padānañca anusandhānukkamo.
Anusandhikkamo is the sequence of connection of meanings and words.
“Trình tự liên kết” (Anusandhikkamo) là trình tự liên kết của các ý nghĩa và các từ ngữ.
Porāṇā panettha evaṃ vaṇṇayanti – sadevakanti devatāhi saddhiṃ avasesaṃ lokaṃ.
The ancients explain it thus: sadevakaṃ (with devas) means the entire world together with devas.
Các bậc cổ đức ở đây đã giải thích như sau: “cùng với chư thiên” (sadevakaṃ) là thế giới còn lại cùng với các vị trời.
Samārakanti mārena saddhiṃ avasesaṃ lokaṃ.
Samārakaṃ (with Māra) means the entire world together with Māra.
“Cùng với Ma-la” (samārakaṃ) là thế giới còn lại cùng với Ma-la.
Sabrahmakanti brahmehi saddhiṃ avasesaṃ lokaṃ.
Sabrahmakaṃ (with Brahmās) means the entire world together with Brahmās.
“Cùng với Phạm thiên” (sabrahmakaṃ) là thế giới còn lại cùng với các Phạm thiên.
Evaṃ sabbepi tibhavūpage satte devamārabrahmasahitatāsaṅkhātehi tīhi pakārehi ‘‘sadevaka’’ntiādīsu tīsu padesu pakkhipitvā puna dvīhi padehi pariyādiyanto ‘‘sassamaṇabrāhmaṇiṃ pajaṃ sadevamanussa’’nti āha.
Thus, having included all beings inhabiting the three existences in these three ways—together with devas, Māra, and Brahmā—in the three terms such as ‘‘sadevakaṃ’’, he then encompasses them again with two terms, saying ‘‘sassamaṇabrāhmaṇiṃ pajaṃ sadevamanussaṃ’’ (the populace with recluses and brahmins, with devas and humans).
Như vậy, sau khi đã bao gồm tất cả các loài hữu tình trong ba cõi vào ba cách thức được gọi là cùng với chư thiên, Ma-la, và Phạm thiên trong ba cụm từ “cùng với chư thiên” (sadevakaṃ) và tiếp theo, lại tiếp tục bao gồm chúng bằng hai cụm từ “chúng sinh cùng với Sa-môn và Bà-la-môn, cùng với chư thiên và loài người” (sassamaṇabrāhmaṇiṃ pajaṃ sadevamanussaṃ).
Evaṃ pañcahipi padehi sadevakattādinā tena tena pakārena tedhātukameva pariyādinnanti.
In this way, the entire three realms are encompassed by all five terms, each in its respective manner, such as being with devas.
Như vậy, toàn bộ ba cõi đã được bao gồm theo từng cách thức đó, như cùng với chư thiên, v.v., bằng cả năm cụm từ.
Abhiññāti yakāralopenāyaṃ niddeso, abhijānitvāti ayamettha atthoti āha ‘‘abhiññāya adhikena ñāṇena ñatvā’’ti.
Abhiññā – this is an explanation by the elision of the letter 'ya'; the meaning here is "having known by direct knowledge," thus he says "abhiññāya adhikena ñāṇena ñatvā" (having known by superior knowledge, by special knowledge).
“Abhiññā” (thắng trí) là một cách trình bày do lược bỏ chữ ‘ya’, ở đây có nghĩa là ‘sau khi biết rõ’ (abhijānitvā), nên đã nói “sau khi biết rõ bằng trí tuệ đặc biệt” (abhiññāya adhikena ñāṇena ñatvā).
Anumānādipaṭikkhepoti anumānaupamānaatthāpattiādipaṭikkhepo ekappamāṇattā.
Anumānādipaṭikkhepo (rejection of inference and so forth) is the rejection of inference, analogy, implication, and so forth, because there is only one valid means of knowledge.
“Bác bỏ suy luận, v.v.” (Anumānādipaṭikkhepo) là bác bỏ suy luận (anumāna), tỷ dụ (upamāna), nghĩa thành (atthāpatti), v.v., vì tất cả đều là một loại lượng.
Sabbattha appaṭihatañāṇacāratāya hi sabbapaccakkhā buddhā bhagavanto.
For the Buddhas, the Bhagavats, are omniscient due to the unimpeded activity of their knowledge everywhere.
Quả thật, các vị Phật, Thế Tôn, là những bậc thấy biết trực tiếp mọi thứ (sabbapaccakkhā) vì trí tuệ của các Ngài không bị chướng ngại ở bất cứ đâu.
Anuttaraṃ vivekasukhanti phalasamāpattisukhaṃ.
Anuttaraṃ vivekasukhaṃ (unsurpassed bliss of seclusion) is the bliss of fruition attainment.
“Anuttaraṃ vivekasukhaṃ” (hỷ lạc viễn ly vô thượng) là hỷ lạc của quả định (phalasamāpatti).
Tena vīthimissāpi kadāci bhagavato dhammadesanā hotīti hitvāpīti pisaddaggahaṇaṃ.
That is why, sometimes the Bhagavā's teaching may be mixed with a mental process (vīthi), which is why the word hitvāpi (even having relinquished) includes the particle 'pi'.
Do đó, đôi khi giáo pháp của Thế Tôn cũng có thể bị gián đoạn, nên có sự bao gồm của từ ‘pī’ (cũng) trong “dù đã từ bỏ” (hitvāpi).
Bhagavā hi dhammaṃ desento yasmiṃ khaṇe parisā sādhukāraṃ vā deti, yathāsutaṃ vā dhammaṃ paccavekkhati, taṃ khaṇaṃ pubbabhāgena paricchinditvā phalasamāpattiṃ samāpajjati, yathāparicchedañca samāpattito vuṭṭhāya ṭhitaṭṭhānato paṭṭhāya dhammaṃ deseti.
Indeed, when the Bhagavā teaches the Dhamma, at the moment when the assembly applauds or reflects on the Dhamma as heard, he delimits that moment in its preceding part and attains fruition attainment. And, having arisen from the attainment according to the delimitation, he teaches the Dhamma from that standing point onwards.
Vì khi Thế Tôn thuyết pháp, vào khoảnh khắc hội chúng tán thán (sādhukāra) hoặc quán xét giáo pháp đã nghe, Ngài phân định khoảnh khắc đó bằng phần trước và nhập quả định. Sau khi xuất định theo sự phân định đó, Ngài thuyết pháp từ nơi đã đứng.
Appaṃ vā bahuṃ vā desentoti ugghaṭitaññussa vasena appaṃ vā, vipañcitaññussa neyyassa vā vasena bahuṃ vā desento.
Appaṃ vā bahuṃ vā desento (teaching little or much) means teaching little for those with quick understanding, or much for those with elaborate understanding or those who are trainable.
“Dù thuyết ít hay nhiều” (Appaṃ vā bahuṃ vā desento) có nghĩa là thuyết ít cho người có trí tuệ khai mở (ugghaṭitaññu), hoặc thuyết nhiều cho người có trí tuệ phân tích (vipaṇcitaññu) hoặc người cần được hướng dẫn (neyya).
Ādikalyāṇādippakārameva desetīti ādimhipi kalyāṇaṃ bhaddakaṃ anavajjameva katvā deseti.
Ādikalyāṇādippakārameva desetī (teaches in a manner that is excellent in the beginning, etc.) means he teaches making it excellent, good, and faultless even in the beginning.
“Thuyết giảng theo cách thức tốt đẹp ở phần đầu, v.v.” (Ādikalyāṇādippakārameva deseti) có nghĩa là thuyết giảng làm cho phần đầu cũng tốt đẹp, đáng khen, không có lỗi.
Majjhepi pariyosānepi kalyāṇaṃ bhaddakaṃ anavajjameva katvā desetīti vuttaṃ hoti.
It means he teaches making it excellent, good, and faultless even in the middle and at the end.
Nghĩa là, thuyết giảng làm cho phần giữa và phần cuối cũng tốt đẹp, đáng khen, không có lỗi.
Dhammassa hi kalyāṇatā niyyānikatāya niyyānikatā ca sabbaso anavajjabhāvena.
For the excellence of the Dhamma lies in its leading to liberation (niyyānika), and its leading to liberation lies in its being entirely faultless.
Quả thật, sự tốt đẹp của giáo pháp là ở chỗ dẫn đến giải thoát (niyyānika), và sự dẫn đến giải thoát là ở chỗ hoàn toàn không có lỗi.
Samantabhaddakattāti sabbabhāgehi sundarattā.
Samantabhaddakattā (due to being wholesome in every respect) means due to being beautiful in all aspects.
“Samantabhaddakattā” (vì tốt đẹp khắp mọi mặt) có nghĩa là vì đẹp đẽ ở mọi khía cạnh.
Dhammassāti pariyattidhammassa.
Dhammassa refers to the Dhamma of study (pariyatti).
“Dhammassa” (của giáo pháp) là giáo pháp thuộc về Tạng Kinh (pariyattidhamma).
Kiñcāpi avayavavinimutto samudāyo nāma paramatthato koci natthi, yesu pana avayavesu samudāyarūpena apekkhitesu gāthāti samaññā, taṃ tato bhinnaṃ viya katvā saṃsāmivohāraṃ āropetvā dassento ‘‘paṭhamapādena ādikalyāṇā’’tiādimāha.
Although there is no such thing as a collection existing as a separate ultimate reality apart from its constituent parts, yet, when these parts are regarded as a collection, a verse is designated. Presenting this as if it were separate from that, and imposing the usage of owner and owned, he states ‘‘paṭhamapādena ādikalyāṇā’’ (excellent in the beginning by the first foot) and so forth.
Mặc dù trên thực tế không có một tổng thể nào tách rời khỏi các thành phần, nhưng khi một tập hợp được xem xét dưới dạng tổng thể trong đó các thành phần được gọi là bài kệ (gāthā), thì để chỉ ra điều đó như thể nó tách biệt khỏi tổng thể và áp đặt cách nói về mối quan hệ chủ-sở hữu, nên đã nói “với câu đầu là phần đầu tốt đẹp” (paṭhamapādena ādikalyāṇā) và tiếp theo.
Ekānusandhikanti idaṃ nātibahuvibhāgaṃ yathānusandhinā ekānusandhikaṃ sandhāya vuttaṃ.
Ekānusandhikaṃ (having one sequence) refers to a text that does not have many divisions, meaning it has a single sequence according to its connection.
“Ekānusandhikaṃ” (liên kết một mạch) cụm từ này được nói đến để chỉ một sự liên kết không quá nhiều phân đoạn, theo một mạch liên kết duy nhất.
Itarassa pana teneva desetabbadhammavibhāgena ādimajjhapariyosānabhāgā labbhantīti.
As for the other, the beginning, middle, and end parts are obtained by that very division of the Dhamma to be taught.
Còn đối với loại khác, các phần đầu, giữa và cuối được tìm thấy qua sự phân loại giáo pháp cần được thuyết giảng đó.
Nidānenāti ānandattherena ṭhapitakāladesadesakaparisādiapadisanalakkhaṇena nidānaganthena.
Nidānenā (by the introduction) refers to the introductory text characterized by the indications of time, place, speaker, and assembly, as established by the Elder Ānanda.
“Nidānena” (với phần dẫn nhập) là với phần dẫn nhập (nidāna) có đặc điểm là chỉ ra thời gian, địa điểm, người thuyết giảng, hội chúng, v.v., do Trưởng lão Ānanda đặt ra.
Nigamenāti ‘‘idamavocā’’tiādikena ‘‘iti yaṃ taṃ vuttaṃ, idametaṃ paṭicca vutta’’nti vā yathāvuttatthanigamanena.
Nigamenā (by the conclusion) refers to the conclusion of the stated meaning, such as ‘‘idamavocā’’ (thus he spoke) and so forth, or ‘‘iti yaṃ taṃ vuttaṃ, idametaṃ paṭicca vuttaṃ’’ (thus what was said, was said with reference to this).
“Nigamena” (với phần kết luận) là với phần kết luận (nigamana) như “Đức Phật đã nói như vậy” (idamavocā) và tiếp theo, hoặc với phần kết luận về ý nghĩa đã nói như “điều đã nói đó, là điều đã nói dựa trên điều này”.
Saṅgītikārakehi ṭhapitānipi hi nidānanigamanāni dassetvā tīṇi piṭakāni satthu desanāya anuvidhānato tadantogadhāneva.
Even the introductions and conclusions established by the compilers of the Councils are included within the Buddha's teaching, as they conform to the Teacher's discourses contained in the three Piṭakas.
Các phần dẫn nhập và kết luận do các vị kết tập kinh điển đặt ra cũng được chỉ ra là nằm trong giáo huấn của Đức Phật, vì chúng tuân theo giáo huấn của Bậc Đạo Sư.
Teneva dīghanikāyaṭṭhakathāyaṃ ‘‘ekānusandhikassa suttassa nidānaṃ ādi, idamavocāti pariyosānaṃ, ubhinnamantarā majjha’’nti (dī. ni. aṭṭha. 1.190) vuttaṃ.
Hence, in the Dīghanikāyaṭṭhakathā, it is stated: ‘‘For a Sutta with a single sequence, the introduction is the beginning, ‘thus he spoke’ is the end, and what lies between the two is the middle’’ (Dī. Ni. Aṭṭha. 1.190).
Chính vì vậy, trong Chú giải Trường Bộ Kinh (Dīghanikāyaṭṭhakathā) đã nói: “Phần dẫn nhập (nidāna) là phần đầu của một bài kinh liên kết một mạch (ekānusandhika), ‘Đức Phật đã nói như vậy’ (idamavocā) là phần cuối, và phần giữa là khoảng giữa của cả hai” (Dī. Ni. Aṭṭha. 1.190).
Evaṃ vuttassa satthusāsanassa pakāsako pariyattidhammo.
This is the teaching of the Buddhas.’’ (Dī. Ni. 2.90; Dha. Pa. 183; Netti. 30, 50) – This is the Dhamma of study (pariyatti) that illuminates the Teacher’s Dispensation thus stated.
Thanh lọc tâm mình, đây là lời dạy của chư Phật.” (Dī. Ni. 2.90; Dha. Pa. 183; Netti. 30, 50) – là giáo pháp thuộc về Tạng Kinh (pariyattidhamma) công bố giáo lý của Bậc Đạo Sư đã được nói như vậy.
Sīlamūlakattā sāsanassa ‘‘sīlena ādikalyāṇo’’ti vuttaṃ.
Because the Dispensation is rooted in sīla (morality), it is said, ‘‘sīlena ādikalyāṇo’’ (excellent in the beginning by sīla).
Vì giáo lý có nền tảng là giới (sīla), nên đã nói “tốt đẹp ở phần đầu với giới” (sīlena ādikalyāṇo).
Samathādīnaṃ sāsanasampattiyā vemajjhabhāvato āha ‘‘samathavipassanāmaggaphalehi majjhekalyāṇo’’ti.
Since samatha (tranquility) and so forth are in the middle of the Dispensation's accomplishments, he says, ‘‘samathavipassanāmaggaphalehi majjhekalyāṇo’’ (excellent in the middle by tranquility, insight, paths, and fruits).
Vì sự thành tựu của giáo lý như tịnh chỉ (samatha), v.v., nằm ở phần giữa, nên đã nói “tốt đẹp ở phần giữa với tịnh chỉ, tuệ quán, đạo và quả” (samathavipassanāmaggaphalehi majjhekalyāṇo).
Nibbānādhigamato uttari karaṇīyābhāvato vuttaṃ ‘‘nibbānena pariyosānakalyāṇo’’ti.
Because there is nothing further to be done after the attainment of Nibbāna, it is said, ‘‘nibbānena pariyosānakalyāṇo’’ (excellent at the end by Nibbāna).
Vì không còn việc gì phải làm thêm sau khi đạt được Nibbāna, nên đã nói “tốt đẹp ở phần cuối với Nibbāna” (nibbānena pariyosānakalyāṇo).
Sāsane sammāpaṭipatti nāma paññāya hoti, tassā ca sīlaṃ samādhi ca mūlanti āha ‘‘sīlasamādhīhi vā ādikalyāṇo’’ti.
Right practice in the Dispensation is achieved through paññā (wisdom), and sīla and samādhi (concentration) are its roots, thus he says, ‘‘sīlasamādhīhi vā ādikalyāṇo’’ (or excellent in the beginning by sīla and samādhi).
Thực hành đúng đắn trong giáo lý là nhờ trí tuệ (paññā), và giới (sīla) cùng định (samādhi) là nền tảng của trí tuệ, nên đã nói “hoặc tốt đẹp ở phần đầu với giới và định” (sīlasamādhīhi vā ādikalyāṇo).
Paññā pana anubodhapaavedhavasena duvidhāti tadubhayampi gaṇhanto ‘‘vipassanāmaggehi majjhekalyāṇo’’ti āha.
Wisdom, however, is twofold, in terms of comprehension and penetration; thus, encompassing both, he says, ‘‘vipassanāmaggehi majjhekalyāṇo’’ (excellent in the middle by insight and paths).
Còn trí tuệ thì có hai loại theo nghĩa giác ngộ (anubodha) và thâm nhập (paavedha), nên khi bao gồm cả hai, đã nói “tốt đẹp ở phần giữa với tuệ quán và đạo” (vipassanāmaggehi majjhekalyāṇo).
Tassā nipphattiphalakiccaṃ nibbānasacchikiriyā, tato paraṃ kattabbaṃ natthīti dassento āha ‘‘phalanibbānehi pariyosānakalyāṇo’’ti.
Indicating that its function of accomplished result is the realization of Nibbāna, and that there is nothing further to be done, he said, “excellent in the end by fruits and Nibbāna.”
Để chỉ rằng công việc thành tựu quả của nó là sự chứng đắc Nibbāna, và sau đó không có gì phải làm nữa, nên nói: “tuyệt hảo ở đoạn cuối bằng các quả và Nibbāna.”
Phalaggahaṇena vā saupādisesaṃ nibbānamāha, itarena itaraṃ tadubhayañca sāsanasampattiyā osānanti āha ‘‘phalanibbānehi pariyosānakalyāṇo’’ti.
Or, by the term 'fruit' he means Nibbāna with a remainder of aggregates, and by the other (term 'Nibbāna') the other (Nibbāna without remainder); and both of these are the culmination of the Dispensation's perfection. So he said, “excellent in the end by fruits and Nibbāna.”
Hoặc, bằng cách nắm giữ quả, nói về Nibbāna còn dư y; bằng cái khác là Nibbāna vô dư y. Và cả hai điều đó là sự kết thúc của sự thành tựu giáo pháp, nên nói: “tuyệt hảo ở đoạn cuối bằng các quả và Nibbāna.”
Buddhasubodhitāya vā ādikalyāṇoti buddhassa subodhitā sammāsambuddhatā, tāya ādikalyāṇo tappabhavattā.
Or, excellent in the beginning by the perfect enlightenment of the Buddha means: the perfect enlightenment of the Buddha is Perfect Self-Enlightenment (sammāsambuddhatā); by that it is excellent in the beginning, because it originates from that.
Hoặc, “tuyệt hảo ở đoạn đầu do sự giác ngộ của Đức Phật” (Buddhasubodhitāya vā ādikalyāṇo) là sự giác ngộ đúng đắn của Đức Phật (sammāsambuddhatā), do đó tuyệt hảo ở đoạn đầu do sự phát sinh từ đó.
Sabbaso saṃkilesappahānaṃ vodānapāripūrī ca dhammasudhammatā, tāya majjhekalyāṇo taṃsarīrattā.
The complete abandonment of defilements and the perfection of purification is the perfect nature of the Dhamma; by that it is excellent in the middle, as it embodies that.
Sự đoạn trừ hoàn toàn các phiền não và sự viên mãn thanh tịnh là sự diệu pháp của giáo pháp (dhammasudhammatā), do đó “tuyệt hảo ở đoạn giữa” (majjhekalyāṇo) vì có bản chất như vậy.
Satthārā yathānusiṭṭhaṃ tathā paṭipatti saṅghasuppaṭipatti, tāya pariyosānakalyāṇo tāya sāsanassa loke suppatiṭṭhitabhāvato.
Practice in accordance with the Teacher's instructions is the perfect practice of the Saṅgha; by that it is excellent in the end, because through that the Dispensation is well-established in the world.
Sự thực hành đúng như Đức Đạo Sư đã chỉ dạy là sự thực hành tốt đẹp của Tăng chúng (saṅghasuppaṭipatti), do đó “tuyệt hảo ở đoạn cuối” (pariyosānakalyāṇo) vì giáo pháp được an lập vững chắc trên thế gian nhờ sự thực hành đó.
Tanti sāsanadhammaṃ.
That refers to the Dhamma of the Dispensation.
“Nó” (Taṃ) là giáo pháp.
Tathattāyāti yathattāya bhagavatā dhammo desito, tathattāya tathabhāvāya.
Tathattāya means: for that very nature, for that state, just as the Dhamma was taught by the Blessed One.
“Như vậy” (Tathattāya) là giáo pháp được Đức Thế Tôn thuyết giảng như thế nào, thì trở thành như thế ấy.
So pana abhisambodhi paccekabodhi sāvakabodhīti tividho ito aññathā nibbānādhigamassa abhāvato.
This (enlightenment), moreover, is of three kinds: the enlightenment of a Buddha, the enlightenment of a Paccekabuddha, and the enlightenment of a disciple; because there is no other way to attain Nibbāna.
Sự giác ngộ đó có ba loại: chánh đẳng chánh giác (abhisambodhi), độc giác (paccekabodhi), và thinh văn giác (sāvakabodhi), vì không có sự chứng đắc Nibbāna nào khác ngoài ba loại này.
Tattha sabbaguṇehi aggabhāvato itarabodhidvayamūlatāya ca paṭhamāya bodhiyā ādikalyāṇatā, guṇehi vemajjhabhāvato dutiyāya majjhekalyāṇatā, tadubhayatāya vā vosānatāya ca sāsanadhammassa tatiyāya pariyosānakalyāṇatā vuttā.
Among these, the excellence of the first enlightenment in the beginning is stated due to its supreme nature in all virtues and its being the root of the other two enlightenments; the excellence of the second in the middle is due to its intermediate position in virtues; and the excellence of the Dispensation Dhamma in the end by the third is due to both of these (being its cause) or due to its culmination.
Trong đó, sự tuyệt hảo ở đoạn đầu được nói đến là do sự giác ngộ thứ nhất vì nó là tối thượng trong tất cả các đức tính và là cội nguồn của hai loại giác ngộ còn lại; sự tuyệt hảo ở đoạn giữa là do sự giác ngộ thứ hai vì nó ở mức trung bình về các đức tính; sự tuyệt hảo ở đoạn cuối của giáo pháp được nói đến là do sự giác ngộ thứ ba vì nó chứa đựng cả hai loại trên và là sự kết thúc.
Tathā paṭipannoti yathā samathavipassanāsukhaṃ āvahati, yathā vā satthārā anusiṭṭhaṃ, tathā paṭipanno sāsanadhammo.
One who has so practised refers to the Dhamma of the Dispensation practiced as it brings about the joy of samatha and vipassanā, or as it was instructed by the Teacher.
“Thực hành như vậy” (Tathā paṭipanno) là giáo pháp được thực hành như nó mang lại an lạc của samatha và vipassanā, hoặc như Đức Đạo Sư đã chỉ dạy.
Tādibhāvāvahanatoti chaḷaṅgupekkhāvasena iṭṭhādīsu tādibhāvassa lokadhammehi anupalepassa āvahanato.
By bringing about the state of equanimity means: by bringing about the state of equanimity (tādibhāva) in desirable things and others, in the sense of the six-limbed equanimity (chaḷaṅgupekkhā), that is, non-clinging to worldly conditions.
“Do mang lại trạng thái như vậy” (Tādibhāvāvahanato) là do mang lại trạng thái như vậy, không bị ô nhiễm bởi các pháp thế gian đối với những điều khả ái, vân vân, nhờ sự xả sáu chi.
Nāthappabhavattāti pabhavati etasmāti pabhavo, uppattiṭṭhānaṃ, nāthova pabhavo etassāti nāthappabhavo, tassa bhāvo nāthappabhavattaṃ, tasmā sāsanadhammassa nāthahetukattāti attho.
Nāthappabhavattā means: that from which something arises is its origin (pabhava), its place of arising; that which has the Protector (Nātha) as its origin is nāthappabhava; its state is nāthappabhavattaṃ; therefore, the Dhamma of the Dispensation is caused by the Protector—this is the meaning.
“Do phát sinh từ Đức Đạo Sư” (Nāthappabhavattā): pabhava là nơi phát sinh, là nơi khởi nguồn; nāthappabhava là nơi phát sinh của Đức Đạo Sư; nāthappabhavatta là trạng thái của nāthappabhava, do đó có nghĩa là giáo pháp có nguyên nhân từ Đức Đạo Sư.
Atthasuddhiyā majjhekalyāṇoti nirupakkilesatāya niyyānikatā atthasuddhi, tāya majjhekalyāṇo.
Excellent in the middle by purity of meaning means: purity of meaning is freedom from defilements and being conducive to liberation; by that it is excellent in the middle.
“Tuyệt hảo ở đoạn giữa do sự thanh tịnh về ý nghĩa” (Atthasuddhiyā majjhekalyāṇo) là sự thanh tịnh về ý nghĩa là sự dẫn đến giải thoát do không có phiền não, do đó tuyệt hảo ở đoạn giữa.
Kiccasuddhiyā pariyosānakalyāṇoti suppaṭipattisaṅkhātakiccassa suddhiyā pariyosānakalyāṇo suppaṭipattipariyosānattā sāsanadhammassa.
Excellent in the end by purity of action means: excellent in the end by the purity of the action consisting of perfect practice, because the Dhamma of the Dispensation culminates in perfect practice.
“Tuyệt hảo ở đoạn cuối do sự thanh tịnh về công việc” (Kiccasuddhiyā pariyosānakalyāṇo) là tuyệt hảo ở đoạn cuối do sự thanh tịnh của công việc được gọi là sự thực hành tốt đẹp, vì giáo pháp kết thúc bằng sự thực hành tốt đẹp.
Yathāvuttamatthaṃ nigamento āha ‘‘tasmā’’tiādi.
Concluding the aforementioned meaning, he says “tasmā” and so on.
Để kết luận ý nghĩa đã nói, nói “do đó” (tasmā), vân vân.
Sāsanabrahmacariyantiādīsu avisesena tisso sikkhā sakalo ca tantidhammo sāsanabrahmacariyaṃ.
In sāsanabrahmacariyaṃ and so on, without distinction, the three trainings (sikkhā) and the entire Canonical Dhamma constitute the holy life of the Dispensation (sāsanabrahmacariyaṃ).
Trong “phạm hạnh của giáo pháp” (sāsanabrahmacariyaṃ) vân vân, ba học pháp và toàn bộ giáo lý (tantidhammo) là phạm hạnh của giáo pháp một cách không phân biệt.
Yaṃ sandhāya vuttaṃ ‘‘katamesānaṃ kho, bhante, buddhānaṃ bhagavantānaṃ brahmacariyaṃ na ciraṭṭhitikamahosī’’tiādi (pārā. 18).
It is in reference to this that it was said, “Among which Buddhas, Blessed Ones, Venerable Sir, was the holy life not long-lasting?” and so on.
Điều này được nói đến trong câu: “Bạch Thế Tôn, phạm hạnh của những Đức Phật Thế Tôn nào đã không tồn tại lâu dài?” vân vân (pārā. 18).
Ariyo aṭṭhaṅgiko maggo maggabrahmacariyaṃ.
The Noble Eightfold Path is the holy life of the path (maggabrahmacariyaṃ).
Bát chánh đạo là phạm hạnh của con đường (maggabrahmacariyaṃ).
Yaṃ sandhāya vuttaṃ ‘‘khīṇā jāti, vusitaṃ brahmacariyaṃ, kataṃ karaṇīya’’nti (pārā. 14).
It is in reference to this that it was said, “Destroyed is birth, lived is the holy life, done is what had to be done.”
Điều này được nói đến trong câu: “Sanh đã tận, phạm hạnh đã thành, việc cần làm đã làm” (pārā. 14).
Yathānurūpanti yathārahaṃ.
Yathānurūpaṃ means: appropriately.
“Tương xứng” (Yathānurūpaṃ) là phù hợp.
Sikkhattayasaṅgahañhi sāsanabrahmacariyaṃ atthasampattiyā sātthaṃ, tathā maggabrahmacariyaṃ.
Indeed, the holy life of the Dispensation, which encompasses the three trainings, is sātthaṃ (with meaning) by the perfection of meaning, and similarly the holy life of the path.
Phạm hạnh của giáo pháp bao gồm ba học pháp thì có ý nghĩa (sātthaṃ) do sự thành tựu ý nghĩa, cũng như phạm hạnh của con đường.
Itaraṃ pana tantidhammasaṅkhātaṃ sāsanabrahmacariyaṃ yathāvuttenatthena sātthaṃ sabyañjanañca.
The other holy life of the Dispensation, consisting of the Canonical Dhamma, is sātthaṃ sabyañjanañca (with meaning and with well-formed expression) by the meaning stated above.
Nhưng phạm hạnh của giáo pháp được gọi là giáo lý thì có ý nghĩa và có văn tự (sātthaṃ sabyañjanañca) với ý nghĩa đã nói.
Atthasampattiyāti sampannatthatāya.
Atthasampattiyā means: by the perfection of meaning.
“Do sự thành tựu ý nghĩa” (Atthasampattiyā) là do ý nghĩa đầy đủ.
Sampattiattho hi idha sahasaddo.
Here, the prefix 'sa-' (in sātthaṃ) means 'accompanied by' or 'having'.
Ở đây, tiền tố “sa” có nghĩa là thành tựu.
Byañjanasampattiyāti etthāpi eseva nayo.
Byañjanasampattiyā (by the perfection of expression): the same method applies here.
“Do sự thành tựu văn tự” (Byañjanasampattiyā) cũng theo cách tương tự.
Yassa hi yāgubhattādiitthipurisādivaṇṇanānissitā desanā hoti, na so sātthaṃ deseti niyyānatthavirahato tassā desanāya.
Indeed, a discourse that involves descriptions like those of porridge, meals, men, women, etc., is not taught with meaning, because that discourse lacks the meaning of leading to liberation.
Thật vậy, nếu lời thuyết giảng của ai đó liên quan đến việc mô tả cháo, cơm, đàn ông, đàn bà, vân vân, thì lời thuyết giảng đó không có ý nghĩa, vì không có ý nghĩa dẫn đến giải thoát.
Bhagavā pana tathārūpaṃ desanaṃ pahāya catusatipaṭṭhānādinissitaṃ desanaṃ deseti, tasmā ‘‘atthasampattiyā sātthaṃ desetī’’ti vuccati.
However, the Blessed One, abandoning such a discourse, teaches a discourse based on the four foundations of mindfulness (catusatipaṭṭhāna) and so on. Therefore, it is said, “He teaches with meaning by the perfection of meaning.”
Nhưng Đức Thế Tôn đã từ bỏ những lời thuyết giảng như vậy và thuyết giảng những lời liên quan đến Tứ Niệm Xứ, vân vân, do đó được gọi là “thuyết giảng có ý nghĩa do sự thành tựu ý nghĩa.”
Yassa pana desanā sithiladhanitādibhedesu byañjanesu ekappakāreneva dvippakāreneva vā byañjanena yuttatāya ekabyañjanādiyuttā vā damiḷabhāsā viya, vivaṭakaraṇatāya oṭṭhe aphusāpetvā uccāretabbato sabbaniroṭṭhabyañjanā vā kirātabhāsā viya, sabbattheva vissajjanīyayuttatāya sabbavissaṭṭhabyañjanā vā yavanabhāsā viya, sabbattheva sānusāratāya sabbaniggahītabyañjanā vā pādasikādi milakkhubhāsā viya, tassa byañjanapāripūriyā abhāvato abyañjanā nāma desanā hoti.
But if a discourse is made up of expressions of only one kind or two kinds in terms of soft and hard consonants, etc., like the Tamil language which uses only one or two kinds of expression; or if it is pronounced without the lips touching, due to its openness, like the Kirāta language which has no labial consonants; or if it is always accompanied by a visarga, like the Yavana language which has all words ending in a visarga; or if it is always accompanied by a nasal sound, like the language of the Mleccha such as the Pādasika, then that discourse is called "without perfect expression" (abyañjanā) due to the absence of the perfection of expression.
Nếu lời thuyết giảng của ai đó chỉ có một loại văn tự hoặc hai loại văn tự trong các loại văn tự như lỏng lẻo, chặt chẽ, vân vân, như ngôn ngữ Damila, hoặc là tất cả các văn tự không có môi (sabbaniroṭṭhabyañjanā) vì phải phát âm mà không chạm môi để mở miệng, như ngôn ngữ Kirāta, hoặc là tất cả các văn tự có âm bật hơi (sabbavissaṭṭhabyañjanā) vì luôn có âm bật hơi, như ngôn ngữ Yavana, hoặc là tất cả các văn tự có âm mũi (sabbaniggahītabyañjanā) vì luôn có âm mũi, như ngôn ngữ của những người Mleccha như Padasika, vân vân, thì lời thuyết giảng đó được gọi là không có văn tự (abyañjanā) vì thiếu sự đầy đủ của văn tự.
Sabbāpi hi esā byañjanekadesavaseneva pavattiyā aparipuṇṇabyañjanāti katvā ‘‘abyañjanā’’ti vuccati.
All of these are called “without perfect expression” (abyañjanā) because they proceed only in part of the expressions and are thus imperfect in expression.
Thật vậy, tất cả những điều này được gọi là “không có văn tự” vì chúng là những văn tự không đầy đủ do chỉ có một phần của văn tự.
Bhagavā pana –
However, the Blessed One –
Nhưng Đức Thế Tôn –
Idāni ‘‘sātthaṃ sabyañjana’’nti ettha nettinayenapi atthaṃ dassetuṃ ‘‘saṅkāsanaṃ…pe… sabyañjana’’nti vuttaṃ.
Now, to show the meaning of “sātthaṃ sabyañjanaṃ” even from the perspective of the Nettī, it is stated “saṅkāsanaṃ…pe… sabyañjanaṃ.”
Bây giờ, để chỉ ý nghĩa theo phương pháp Netti trong câu “có ý nghĩa và có văn tự” (sātthaṃ sabyañjanaṃ), đã nói “saṅkāsanaṃ…pe… sabyañjana”.
Tattha yadipi nettiyaṃ ‘‘byañjanamukhena byañjanatthaggahaṇaṃ hotīti akkharaṃ pada’’ntiādinā byañjanapadāni paṭhamaṃ uddiṭṭhāni, idha pana pāḷiyaṃ ‘‘sātthaṃ sabyañjana’’nti āgatattā atthapadāniyeva paṭhamaṃ dassetuṃ ‘‘saṅkāsanapakāsanā’’tiādi vuttaṃ.
Although in the Nettī the words relating to expression are first enumerated, as in “by means of expression, the meaning of expression is grasped, that is, syllables and words,” etc., here, because “sātthaṃ sabyañjanaṃ” occurs in the Pāḷi, the words relating to meaning are shown first, hence “saṅkāsana-pakāsanā” and so on, is stated.
Trong đó, mặc dù trong Netti các từ văn tự được đề cập trước tiên với câu “sự nắm giữ ý nghĩa của văn tự thông qua văn tự là chữ và từ,” vân vân, nhưng ở đây trong Pāḷi vì có câu “sātthaṃ sabyañjanaṃ” nên để chỉ các từ ý nghĩa trước tiên, đã nói “saṅkāsanapakāsanā” vân vân.
Tattha saṅkhepato kāsanaṃ dīpanaṃ saṅkāsanaṃ.
Among these, saṅkāsanaṃ is the brief exposition or explanation.
Trong đó, sự làm rõ, sự minh họa một cách tóm tắt là saṅkāsanaṃ.
Kāsananti ca kāsīyati dīpīyati vibhāvīyatīti attho.
And kāsanaṃ means that which is shown, explained, or made clear.
Và kāsana có nghĩa là được làm rõ, được minh họa, được giải thích.
‘‘Maññamāno kho bhikkhu baddho mārassa amaññamāno mutto’’tiādīsu viya saṅkhepena dīpanaṃ saṅkāsanaṃ nāma.
A brief explanation, such as in “A bhikkhu who assumes is bound by Māra; one who does not assume is freed,” is called saṅkāsanaṃ.
Sự minh họa tóm tắt được gọi là saṅkāsanaṃ, như trong các câu “Này Tỷ-kheo, người cho rằng mình bị trói buộc bởi Ma vương, người không cho rằng mình được giải thoát,” vân vân.
Tattakena hi tena bhikkhunā paṭividdhaṃ.
For by that much (explanation) the bhikkhu penetrated (the truth).
Thật vậy, Tỷ-kheo đó đã thấu hiểu chỉ với chừng đó.
Tenāha ‘‘aññātaṃ bhagavā’’tiādi.
Therefore he said, 'Understood, Blessed One,' and so on.
Do đó, Ngài nói: “Bạch Thế Tôn, con đã hiểu” và vân vân.
Paṭhamaṃ kāsanaṃ pakāsanaṃ.
The first disclosing is pakāsanaṃ.
Sự trình bày ban đầu là pakāsana (giải thích, làm sáng tỏ).
‘‘Sabbaṃ, bhikkhave, āditta’’nti evamādīsu pacchā kathitabbamatthaṃ paṭhamaṃ vacanena dīpanaṃ pakāsanaṃ nāma.
In phrases like 'All, monks, is aflame,' pakāsanaṃ is the initial pointing out by words of a meaning to be stated later.
Trong các trường hợp như “Này các Tỳ-khưu, tất cả đều bị đốt cháy”, việc trình bày ý nghĩa sẽ được nói sau bằng lời nói ban đầu được gọi là pakāsana.
Ādikammasmiñhi ayaṃ pa-saddo ‘‘paññapeti paṭṭhapetī’’tiādīsu viya.
Indeed, in the initial action, this prefix 'pa-' is like in 'paññapeti' (establishes) and 'paṭṭhapeti' (sets forth), and so on.
Trong ādikamma (hành động ban đầu) này, tiền tố pa- giống như trong paññapeti (thiết lập, công bố) và paṭṭhapeti (thiết lập, bắt đầu) v.v.
Tikkhindriyāpekkhañcetaṃ padadvayaṃ uddesabhāvato.
And these two terms relate to those with keen faculties, due to their nature as an outline (uddesa).
Hai từ này (saṅkāsana và pakāsana) được dành cho những người có căn tánh bén nhạy, vì chúng là uddesa (tóm tắt).
Tikkhindriyo hi saṅkhepato paṭhamañca vuttamatthaṃ paṭipajjati.
For a person with keen faculties comprehends the meaning stated briefly and initially.
Quả thật, người có căn tánh bén nhạy sẽ thực hành ý nghĩa đã được nói một cách tóm tắt và ban đầu.
Saṃkhittassa vitthāravacanaṃ sakiṃ vuttassa puna vacanañca vivaraṇavibhajanāni, yathā ‘‘kusalā dhammā’’ti saṅkhepato sakiṃyeva ca vuttassa atthassa ‘‘katame dhammā kusalā?
Elaborating on what is concise, and repeating what has been stated once, are vivaraṇa (elucidation) and vibhajana (differentiation), as for instance, the meaning stated concisely and only once as 'wholesome phenomena,' (kusalā dhammā) when asked, 'What are wholesome phenomena?
Sự diễn giải chi tiết của điều đã được tóm tắt và sự lặp lại của điều đã được nói một lần là vivaraṇa (diễn giải) và vibhajana (phân tích), chẳng hạn như ý nghĩa của “các pháp thiện” đã được nói một cách tóm tắt và chỉ một lần, được nói lại một cách chi tiết theo cách diễn giải và phân tích, như “những pháp nào là thiện?
Yasmiṃ samaye kāmāvacaraṃ kusalaṃ citta’’ntiādinā vitthārato vivaraṇavasena vibhajanavasena ca puna vacanaṃ.
At what time does wholesome citta pertaining to the sense-sphere arise?' and so on, repeating the meaning by way of elaboration and differentiation.
Vào thời điểm nào tâm thiện thuộc cõi dục giới khởi lên?” và vân vân.
Majjhimindriyāpekkhametaṃ padadvayaṃ niddesabhāvato.
These two terms relate to those with medium faculties, due to their nature as a detailed explanation (niddesa).
Hai từ này (vivaraṇa và vibhajana) được dành cho những người có căn tánh trung bình, vì chúng là niddesa (giải thích).
Vivaṭassa vitthāratarābhidhānaṃ vibhattassa ca pakārehi ñāpanaṃ vineyyānaṃ cittaparitosanaṃ uttānīkaraṇapaññāpanāni, yathā ‘‘phasso hotī’’tiādinā vivaṭavibhattassa atthassa ‘‘katamo tasmiṃ samaye phasso hoti?
Further detailed explanation of what is elucidated, and making known by various modes what has been differentiated, thereby gladdening the minds of the trainees, are uttānīkaraṇa (making manifest) and paññāpanā (declaration), as for instance, the meaning that has been elucidated and differentiated as 'there is contact' (phasso hoti), when asked, 'What is contact at that time?
Việc trình bày chi tiết hơn điều đã được diễn giải và việc làm cho điều đã được phân tích trở nên dễ hiểu hơn bằng cách làm hài lòng tâm trí của những người cần được giáo hóa là uttānīkaraṇa (làm cho dễ hiểu) và paññāpanā (thiết lập), ví dụ như ý nghĩa đã được diễn giải và phân tích bằng “xúc khởi lên” và vân vân, được làm cho dễ hiểu và thiết lập bằng “xúc nào vào thời điểm đó?
Yo tasmiṃ samaye phasso phusanā saṃphusanā’’tiādinā uttānīkiriyā paññāpanā ca.
That contact, touching, complete touching, at that time,' and so on, is making manifest and declaration.
Xúc, sự tiếp xúc, sự va chạm nào vào thời điểm đó?” và vân vân.
Mudindriyāpekkhametaṃ padadvayaṃ paṭiniddesabhāvato.
These two terms relate to those with dull faculties, due to their nature as a detailed counter-explanation (paṭiniddesa).
Hai từ này (uttānīkaraṇa và paññāpanā) được dành cho những người có căn tánh kém nhạy, vì chúng là paṭiniddesa (giải thích lại).
Atha vā ‘‘sabbaṃ, bhikkhave, āditta’’nti evaṃ paṭhamaṃ dīpitamatthaṃ puna pākaṭaṃ katvā dīpanena ‘‘kiñca, bhikkhave, sabbaṃ ādittaṃ?
Alternatively, the exposition that develops and describes the meaning initially pointed out as 'All, monks, is aflame,' by making it clear again with phrases like 'And what, monks, is all aflame?
Hoặc là, việc thuyết pháp bằng cách làm cho ý nghĩa đã được trình bày ban đầu như “Này các Tỳ-khưu, tất cả đều bị đốt cháy” trở nên rõ ràng hơn, bằng cách trình bày chi tiết điều đã được tóm tắt và lặp lại điều đã được nói một lần, như “Này các Tỳ-khưu, tất cả những gì đều bị đốt cháy?
Cakkhu, bhikkhave, ādittaṃ, rūpā ādittā’’ti evamādinā saṃkhittassa vitthārābhidhānena sakiṃ vuttassa punapi abhidhānena vitthāretvā desanaṃ vivaraṇaṃ nāma.
The eye, monks, is aflame; forms are aflame,' and so on, by elaborating what is concise and repeating what has been stated once, is called vivaraṇa.
Này các Tỳ-khưu, mắt bị đốt cháy, các sắc bị đốt cháy” và vân vân, được gọi là vivaraṇa (diễn giải).
‘‘Kusalā dhammā’’ti saṅkhepena nikkhittassa ‘‘katame dhammā kusalā?
Differentiating the wholesome phenomena that were elucidated in detail from the concise statement 'wholesome phenomena' (kusalā dhammā) when asked, 'What are wholesome phenomena?
Việc phân chia các pháp thiện đã được diễn giải theo cách niddesa (giải thích) như “các pháp nào là thiện?
Yasmiṃ samaye kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hotī’’ti niddesavasena vivarite kusale dhamme ‘‘tasmiṃ samaye phasso hoti vedanā hotī’’ti vibhāgakaraṇaṃ vibhajanaṃ nāma.
At what time does wholesome citta pertaining to the sense-sphere arise?' with 'At that time there is contact, there is feeling,' is called vibhajanaṃ.
Vào thời điểm nào tâm thiện thuộc cõi dục giới khởi lên?” từ điều đã được tóm tắt là “các pháp thiện”, thành “vào thời điểm đó xúc khởi lên, thọ khởi lên” được gọi là vibhajana (phân tích).
Vivaṭassa vitthārābhidhānena vibhattassa ca upamābhidhānena uttāniṃ karotīti vivaraṇena vivaritatthassa ‘‘katamo tasmiṃ samaye phasso hoti?
That which makes manifest by means of an elaborated description of what has been elucidated and by means of an illustrative description of what has been differentiated, thus, the further elaborated statement of the meaning elucidated by vivaraṇa, 'What is contact at that time?
Việc làm cho ý nghĩa đã được diễn giải trở nên dễ hiểu bằng cách trình bày chi tiết điều đã được diễn giải và bằng cách trình bày ví dụ cho điều đã được phân tích, tức là việc nói rõ hơn nữa ý nghĩa đã được diễn giải bằng cách diễn giải như “xúc nào vào thời điểm đó?
Yo tasmiṃ samaye phasso phusanā saṃphusanā’’ti ativivaritvā kathanaṃ, vibhajanena vibhattassa ‘‘seyyathāpi, bhikkhave, gāvī niccammā, evameva khvāyaṃ bhikkhave phassāhāro daṭṭhabboti vadāmī’’ti evamādiupamākathanañca uttānīkaraṇaṃ nāma.
That contact, touching, complete touching, at that time,' and the illustrative statement of what has been differentiated by vibhajanaṃ, 'Just as, monks, a cow without skin, just so, monks, I say that the nutriment of contact should be seen,' and so on, is called uttānīkaraṇaṃ.
Xúc, sự tiếp xúc, sự va chạm nào vào thời điểm đó?” và việc nói ví dụ như “Này các Tỳ-khưu, ví như một con bò không da, cũng vậy, này các Tỳ-khưu, ta nói rằng thức ăn xúc cần được xem xét” và vân vân, được gọi là uttānīkaraṇa (làm cho dễ hiểu).
Dhammaṃ suṇantānaṃ dhammadesanena vicittena anekavidhena somanassassa uppādanaṃ atikhiṇabuddhīnaṃ anekavidhena ñāṇatikhiṇakaraṇañca paññatti nāma sotūnaṃ cittatosanena cittanisānena ca paññāpanaṃ paññattīti katvā.
Producing joy in various and manifold ways for those listening to the Dhamma through the Dhamma-teaching, and sharpening the knowledge of those with extremely keen intellects in various ways, is called paññatti, based on the idea that it declares (paññāpeti) by gladdening the minds and sharpening the minds of the listeners.
Việc tạo ra sự hoan hỷ trong tâm của những người nghe pháp bằng cách thuyết pháp đa dạng và phong phú, và việc làm cho trí tuệ của những người có trí tuệ rất bén nhạy trở nên bén nhạy hơn theo nhiều cách khác nhau, được gọi là paññatti (sự thiết lập), vì nó là sự thiết lập bằng cách làm hài lòng tâm trí và mài sắc tâm trí của người nghe.
Atthapadasamāyogato sātthanti pariyattiatthassa saṅkāsanādiatthapadarūpattā yathāvuttachaatthapadasamāyogato sātthaṃ.
Sātthaṃ (with meaning) because of the combination of terms of meaning (atthapada), being in the form of the terms of meaning for the meaning of the Pariyatti, such as making clear, and due to the combination of the six terms of meaning as stated.
Sāttha (có ý nghĩa) do sự kết hợp của các từ ngữ ý nghĩa (atthapada), tức là do bản chất của các từ ngữ ý nghĩa như saṅkāsana (làm sáng tỏ) v.v., là sự kết hợp của sáu từ ngữ ý nghĩa đã nói ở trên, nên nó là sāttha.
Saṅkāsanapakāsanādayo hi atthākārattā ‘‘atthapadānī’’ti vuccanti.
Indeed, making clear (saṅkāsana), manifesting (pakāsana), and so on, are called atthapadāni (terms of meaning) because they are modes of meaning.
Quả thật, saṅkāsana và pakāsana v.v. được gọi là atthapadāni (các từ ngữ ý nghĩa) vì chúng là các dạng của ý nghĩa.
Atthoyeva hi byañjanapadehi saṅkāsīyati pakāsīyati vivarīyati vibhajīyati uttānī karīyati paññāpīyati.
For indeed, the meaning itself is made clear, manifested, elucidated, differentiated, made manifest, and declared by the terms of expression (byañjanapada).
Chính ý nghĩa được làm sáng tỏ, được trình bày, được diễn giải, được phân tích, được làm cho dễ hiểu, được thiết lập bằng các từ ngữ biểu đạt.
Akkharapadabyañjanākāraniruttiniddesasampattiyāti ettha ‘‘saṭṭhi vassasahassānī’’ti evamādīsu sa-kāra du-kāra so-kārādi viya uccāraṇavelāya apariyosite pade vaṇṇo akkharaṃ pariyāyavasena akkharaṇato avevacanato.
Here, in phrases like 'sixty thousand years,' the sound (vaṇṇa) such as 'sa,' 'du,' 'so,' and so on, which is part of a word not yet completed during pronunciation, is an akkharaṃ (letter/syllable) by way of being unchangeable and having no synonym.
Trong akkharapadabyañjanākāraniruttiniddesasampattiyā (sự hoàn hảo của chữ cái, từ ngữ, câu, cách thức, ngữ nguyên và giải thích), akkhara (chữ cái) là âm tiết trong một từ chưa kết thúc khi phát âm, giống như âm sa, du, so v.v. trong “sáu mươi ngàn năm” và vân vân, do không có từ đồng nghĩa (avevacana) theo nghĩa gián tiếp (pariyāya).
Na hi vaṇṇassa pariyāyo vijjati.
For indeed, there is no synonym for a sound.
Quả thật, không có từ đồng nghĩa cho một âm tiết.
Yathā hi padaṃ savevacanatāya atthavasena pariyāyaṃ carantaṃ sañcarantaṃ viya hoti, na evaṃ vaṇṇo avevacanattā.
Just as a word, by having synonyms, moves about as if by way of meaning, not so a sound, because it has no synonyms.
Vì một từ, do có từ đồng nghĩa, có thể di chuyển hoặc lưu chuyển theo ý nghĩa, nhưng một âm tiết thì không, do không có từ đồng nghĩa.
Ekakkharaṃ vā padaṃ akkharaṃ ‘‘mā evaṃ kira ta’’ntiādīsu mā-kārādayo viya.
Or a single-syllable word is an akkharaṃ, like 'mā' and so on in 'mā evaṃ kira ta' (don't do it like that).
Hoặc một từ một âm tiết là akkhara, giống như các âm mā v.v. trong “mā evaṃ kira ta” (chớ làm như vậy).
Keci pana ‘‘tīsu dvāresu parisuddhapayogabhāvena visuddhakaraṇaṭṭhānānaṃ cittena pavattitadesanāvācāhi akkharaṇato avevacanato akathitattā akkharanti saññitā.
Some say, however, that it is designated as akkharaṃ because it is not spoken (akathitattā) and is unchangeable (avevacanato), arising from the pure application in the three doors (of action), from the speech of teaching activated by the mind at the places of purification.
Tuy nhiên, một số người nói rằng: “Nó được gọi là akkhara vì nó không được nói ra (akathita) do không có từ đồng nghĩa (avevacana) và không có âm tiết (akkharaṇa) từ những lời thuyết pháp được phát ra bằng tâm của những nơi thanh tịnh do sự thanh tịnh của việc sử dụng ở ba cửa.
Taṃ pārāyanikabrāhmaṇānaṃ manasā pucchitapañhānaṃ vasena bhagavatā ratanaghare nisīditvā sammasitapaṭṭhānamahāpakaraṇavasena ca gahetabba’’nti vadanti.
This should be understood as referring to the questions asked mentally by the brahmins of the Pārāyana and the Mahāpakaraṇa established by the Blessed One after contemplating while seated in the jewel-house.
Điều đó cần được hiểu theo các câu hỏi được các Bà-la-môn thuộc Pārāyana hỏi bằng tâm và theo Mahāpakaraṇa Paṭṭhāna được Thế Tôn suy xét khi ngồi trong ngôi nhà báu.”
Vibhattiyantaṃ atthassa ñāpanato padaṃ.
A word ending in an inflection (vibhatti) is a padaṃ (word) because it makes meaning known.
Pada (từ) là từ có tận cùng bằng biến cách, vì nó biểu thị ý nghĩa.
Pajjati attho etenāti hi padaṃ.
For indeed, that by which meaning proceeds is a word.
Quả thật, ý nghĩa được biết đến nhờ nó, nên nó là pada.
Taṃ nāmapadaṃ ākhyātapadaṃ upasaggapadaṃ nipātapadanti catubbidhaṃ.
That is fourfold: noun-word (nāmapada), verb-word (ākhyātapada), prefix-word (upasaggapada), and particle-word (nipātapaada).
Nó có bốn loại: danh từ (nāmapada), động từ (ākhyātapada), giới từ (upasaggapada), và tiểu từ (nipātāpada).
Tattha phasso vedanā cittanti evamādikaṃ dabbapadhānaṃ nāmapadaṃ.
Among these, 'phasso' (contact), 'vedanā' (feeling), 'cittaṃ' (mind), and so on, which are primarily substantial, are nāmapadaṃ.
Trong đó, điều chủ yếu là vật chất, như xúc, thọ, tâm và vân vân, là nāmapada (danh từ).
Nāmapadehi dabbamāvibhūtarūpaṃ, kiriyā anāvibhūtarūpā.
By noun-words, the substance is manifest; the action is unmanifest.
Bằng danh từ, vật chất được biểu hiện, hành động thì không được biểu hiện.
Phusati vedayati vijānātīti evamādikaṃ kiriyāpadhānaṃ ākhyātapadaṃ.
'Phusati' (touches), 'vedayati' (feels), 'vijānāti' (knows), and so on, which are primarily verbal, are ākhyātapadaṃ.
Điều chủ yếu là hành động, như xúc chạm, cảm thọ, nhận biết và vân vân, là ākhyātapada (động từ).
Ākhyātapadehi kiriyā āvibhūtarūpā, dabbamanāvibhūtarūpaṃ.
By verb-words, the action is manifest; the substance is unmanifest.
Bằng động từ, hành động được biểu hiện, vật chất thì không được biểu hiện.
Yathā ‘‘cirappavāsi’’nti ettha pa-saddo vasanakiriyāya viyogavisiṭṭhataṃ dīpeti, evaṃ kiriyāvisesadīpanato kiriyāvisesāvabodhanimittaṃ.
Just as in 'cirappavāsi' (long-absent), the prefix 'pa-' indicates a specific quality of separation from the action of dwelling, so it is a sign of understanding a specific quality of action, due to indicating a specific quality of action.
Giống như trong “cirappavāsi” (người đã đi xa lâu), tiền tố pa- biểu thị sự đặc biệt của sự xa cách đối với hành động cư trú, cũng vậy, nó là dấu hiệu cho sự hiểu biết về sự đặc biệt của hành động do biểu thị sự đặc biệt của hành động.
Pa-iti evamādikaṃ upasaggapadaṃ.
'Pa-' and so on are upasaggapadaṃ.
Các từ như pa- và vân vân là upasaggapada (giới từ).
Kiriyāya dabbassa ca sarūpavisesappakāsanahetubhūtaṃ evanti evamādikaṃ nipātapadaṃ.
'Evaṃ' (thus) and so on, which are causes for manifesting specific qualities of action and substance, are nipātapaadaṃ.
Các từ như evaṃ (như vậy) và vân vân, là nguyên nhân biểu thị sự đặc biệt về bản chất của hành động và vật chất, là nipātāpada (tiểu từ).
‘‘Evaṃ manasi karotha, mā evaṃ manasākatthā’’tiādīsu hi kiriyāvisesadīpanato kiriyāvisesassa jotako evaṃsaddo, ‘‘evaṃsīlā evaṃdhammā’’tiādīsu dabbavisesassa.
For in 'evaṃ manasi karotha' (do thus attend) and 'mā evaṃ manasākatthā' (do not thus attend), and so on, the word 'evaṃ' indicates a specific quality of action, while in 'evaṃsīlā evaṃdhammā' (of such conduct, of such nature), and so on, it indicates a specific quality of substance.
Trong “evaṃ manasi karotha” (hãy tác ý như vậy) và “mā evaṃ manasākatthā” (chớ tác ý như vậy) và vân vân, từ evaṃ là từ biểu thị sự đặc biệt của hành động, do biểu thị sự đặc biệt của hành động; trong “evaṃsīlā evaṃdhammā” (những người có giới hạnh như vậy, những người có pháp như vậy) và vân vân, là sự đặc biệt của vật chất.
Saṅkhepato vuttaṃ padābhihitaṃ atthaṃ byañjetīti byañjanaṃ, vākyaṃ.
That which clarifies the meaning expressed by a word stated concisely is byañjanaṃ (expression), which is a sentence.
Byañjana (câu) là câu, vì nó biểu thị ý nghĩa được nói tóm tắt bằng từ ngữ.
‘‘Cattāro iddhipādā’’ti saṅkhepena kathitamatthaṃ ‘‘katame cattāro?
Or a sentence itself is byañjanaṃ because it makes clear the meaning stated concisely as 'four bases of spiritual power' (cattāro iddhipādā), by saying 'What are the four?
Hoặc là, câu chính là byañjana, vì nó làm cho ý nghĩa đã được nói tóm tắt là “bốn thần túc” trở nên rõ ràng bằng “bốn cái nào?
Idha, bhikkhave, bhikkhu chandasamādhipadhānasaṅkhārasamannāgataṃ iddhipādaṃ bhāveti, vīriya, citta, vīmaṃsasamādhipadhānasaṅkhārasamannāgataṃ iddhipādaṃ bhāvetī’’tiādinā pākaṭaṃ karotīti vākyameva byañjanaṃ, taṃ pana atthato padasamudāyoti daṭṭhabbaṃ.
Here, monks, a bhikkhu develops the basis of spiritual power endowed with concentration due to desire and volitional formations of striving; the basis of spiritual power endowed with concentration due to energy, mind, and investigation and volitional formations of striving,' and so on, and that should be seen as a collection of words in terms of meaning.
Này các Tỳ-khưu, ở đây, một Tỳ-khưu tu tập thần túc có đầy đủ định do dục, tinh tấn, tâm, và quán sát” và vân vân; nhưng cần được hiểu rằng nó là một tập hợp các từ ngữ theo nghĩa.
Saākhyātaṃ sanipātaṃ sakārakaṃ savisesanaṃ vākyanti hi vadanti.
For indeed, they say a sentence is that which has a verb, has a particle, has a case, and has an adjective.
Quả thật, người ta nói rằng một câu là câu có động từ, có tiểu từ, có cách và có bổ ngữ.
Nanu ca padenapi attho byañjīyatīti padampi byañjananti āpajjatīti?
But is it not the case that meaning is also made clear by a word, so a word would also become an expression?
Không phải chăng ý nghĩa cũng được biểu thị bằng từ ngữ, vậy từ ngữ cũng trở thành byañjana?
Taṃ na.
That is not so.
Điều đó không đúng.
Padamattasavanepi hi adhikārādivasena labbhamānehi padantarehi anusandhānaṃ katvāva atthasampaṭipatti hotīti vākyameva atthaṃ byañjayatīti.
For even upon hearing just a word, comprehension of the meaning occurs only by connecting it with other words obtained by way of context and so on, so only a sentence makes the meaning clear.
Ngay cả khi chỉ nghe một từ, sự hiểu biết về ý nghĩa cũng chỉ xảy ra sau khi đã liên kết với các từ khác có được theo quyền hạn và vân vân, do đó chỉ có câu mới biểu thị ý nghĩa.
Pakārato vākyavibhāgo ākāro.
The division of a sentence into types is ākāro (mode/aspect).
Sự phân chia câu theo cách thức là ākāra (cách thức).
‘‘Tattha katamo chando?
Differentiating the same sentence in various ways, as in 'What is desire there?
Việc phân chia câu đã được nói theo nhiều cách khác nhau, như “Trong đó, dục là gì?
Yo chando chandikatā kattukamyatā’’ti evamādīsu kathitasseva vākyassa anekavidhena vibhāgakaraṇaṃ ākāro nāma.
That desire, desiring, wishing to do,' and so on, is called ākāro.
Dục là sự ham muốn, sự muốn làm” và vân vân, được gọi là ākāra.
Ākārābhihitaṃ nibbacanaṃ nirutti.
An etymological explanation (nibbacana) expressed by way of a mode is nirutti (interpretation/etymology).
Sự giải thích được biểu thị bằng ākāra là nirutti (ngữ nguyên).
‘‘Phasso vedanā’’ti evamādīsu ākārena kathitaṃ ‘‘phusatīti phasso, vedayatīti vedanā’’ti nīharitvā vitthāravacanaṃ nirutti nāma.
The detailed explanation, extracting (the meaning) as ‘‘it contacts, so it is contact (phasso); it feels, so it is feeling (vedanā)’’, in cases such as ‘‘Contact is feeling’’, is called Nirutti (interpretation).
Việc giải thích chi tiết, rút ra từ "cái chạm là xúc (phasso), cái cảm nhận là thọ (vedanā)", được nói theo cách như "xúc (phasso), thọ (vedanā)" và những từ tương tự, được gọi là nirutti (thích nghĩa).
‘‘Nibbānaṃ maggati, nibbānatthikehi vā maggīyati, kilese vā mārento gacchatīti maggo’’tiādinā nibbacanavitthāro niravasesadesanattā niddeso.
The extensive explanation such as ‘‘It seeks Nibbāna, or is sought by those desiring Nibbāna, or it goes while killing defilements, therefore it is the path (maggo)’’, being a complete teaching, is called Niddesa (exposition).
Việc giải thích chi tiết theo trình tự trước sau, bắt đầu bằng "cái tìm cầu Nibbāna, hoặc được những người tìm cầu Nibbāna tìm cầu, hoặc cái đi tiêu diệt các phiền não là đạo (magga)", do là sự thuyết giảng không còn sót lại gì, nên gọi là niddesa (chỉ giáo).
Atha vā vedayatīti vedanāti nibbacanaladdhapadesu sukhadukkhaadukkhamasukhāsu sukhayatīti sukhā, dukkhayatīti dukkhā, neva dukkhayati na sukhayatīti adukkhamasukhāti atthavitthāro niravasesena kathitattā niddeso nāma.
Alternatively, in the words derived from interpretation like ‘‘it feels, so it is feeling (vedanā)’’, the detailed explanation of their meaning—namely, ‘‘it feels pleasure, so it is pleasure (sukhā); it feels pain, so it is pain (dukkhā); it feels neither pain nor pleasure, so it is neither-pain-nor-pleasure (adukkhamasukhā)’’—being taught completely, is called Niddesa.
Hoặc, trong những từ ngữ có được sự giải thích như "cái cảm nhận là thọ (vedanā)", sự giải thích ý nghĩa rằng "cái làm cho sung sướng là lạc (sukha), cái làm cho đau khổ là khổ (dukkha), cái không làm cho đau khổ cũng không làm cho sung sướng là bất khổ bất lạc (adukkhamasukha)", do được thuyết giảng không còn sót lại gì, nên gọi là niddesa.
Etesaṃ akkharādīnaṃ byañjanapadānaṃ sampattiyā sampannatāya sabyañjanaṃ.
Due to the completeness of these letters and other elements, and expressive words, it is sabyañjanaṃ (complete in expression).
Do sự đầy đủ của những từ ngữ biểu thị (byañjanapada) như các mẫu tự (akkhara) này, nên gọi là sabyañjanaṃ (có văn).
Evaṃ panassa atthapadasamāyogo byañjanapadasampatti ca veditabbā.
Thus, the combination of its words of meaning and the completeness of its expressive words should be understood.
Như vậy, sự kết hợp của các từ ngữ ý nghĩa (atthapada) và sự đầy đủ của các từ ngữ biểu thị (byañjanapada) của Pháp ấy cần phải được hiểu.
Tattha bhagavā akkharehi saṅkāseti, padehi pakāseti, byañjanehi vivarati, ākārehi vibhajati, niruttīhi uttāniṃ karoti, niddesehi paññapeti.
Therein, the Bhagavā indicates with letters, illuminates with words, clarifies with expressions, categorizes with modes, makes clear with interpretations, and expounds with expositions.
Trong đó, Đức Thế Tôn biểu lộ bằng các mẫu tự (akkhara), làm sáng tỏ bằng các từ ngữ (pada), mở ra bằng các từ ngữ biểu thị (byañjana), phân chia bằng các khía cạnh (ākāra), làm cho rõ ràng bằng các thích nghĩa (nirutti), và trình bày bằng các chỉ giáo (niddesa).
Tathā hi padāvayavaggahaṇamukhena padaggahaṇaṃ, gahitena ca padena padatthāvabodho gahitapubbasaṅketassa hotīti bhagavā akkharehi saṅkāseti.
Indeed, the understanding of words through the grasping of word-components, and the comprehension of the meaning of words by means of the grasped word, occurs for one who has grasped the preceding convention; thus, the Bhagavā indicates with letters.
Thật vậy, do việc nắm bắt từ ngữ thông qua việc nắm bắt các thành phần của từ ngữ, và do sự hiểu biết ý nghĩa của từ ngữ đã nắm bắt được xảy ra cho người đã nắm bắt được dấu hiệu trước đó, nên Đức Thế Tôn biểu lộ bằng các mẫu tự.
Yasmā pana akkharehi saṃkhittena dīpiyamāno attho padapariyosāne vākyassa apariyositattā padena paṭhamaṃ pakāsito dīpito hoti, tasmā padehi pakāseti.
However, since the meaning, though briefly indicated by letters, is first illuminated and revealed by a word because the sentence is not yet concluded at the word's end, therefore He illuminates with words.
Tuy nhiên, vì ý nghĩa được làm sáng tỏ một cách tóm tắt bằng các mẫu tự được làm sáng tỏ và được biểu lộ trước tiên bằng từ ngữ do câu chưa kết thúc khi từ ngữ kết thúc, nên Ngài làm sáng tỏ bằng các từ ngữ.
Vākyapariyosāne pana so attho vivarito vivaṭo kato hotīti byañjanehi vivarati.
At the conclusion of the sentence, that meaning is clarified and made evident; thus, He clarifies with expressions.
Tuy nhiên, khi câu kết thúc, ý nghĩa đó được mở ra, được làm cho rõ ràng, nên Ngài mở ra bằng các từ ngữ biểu thị.
Yasmā ca pakārehi vākyabhede kate tadattho vibhatto nāma hoti, tasmā ākārehi vibhajati.
And since, when distinctions are made in sentences by various modes, their meaning becomes differentiated, therefore He categorizes with modes.
Và vì khi các loại câu được tạo ra bằng các cách thức, ý nghĩa của chúng được phân chia, nên Ngài phân chia bằng các khía cạnh.
Tathā vākyāvayavānaṃ paccekaṃ nibbacanavibhāge kate so attho pākaṭo hotīti niruttīhi uttāniṃ karoti.
Likewise, when the components of a sentence are individually interpreted and differentiated, that meaning becomes manifest; thus, He makes clear with interpretations.
Tương tự, khi các thành phần của câu được giải thích và phân tích riêng lẻ, ý nghĩa đó trở nên rõ ràng, nên Ngài làm cho rõ ràng bằng các thích nghĩa.
Katanibbacanehi pana vākyāvayavehi vitthāravasena niravasesato desitehi veneyyānaṃ cittaparitosanaṃ buddhinisānañca kataṃ hotīti niddesehi paññapeti.
Furthermore, when the interpreted sentence components are extensively and completely taught, they bring satisfaction to the minds of those to be trained and sharpen their wisdom; thus, He expounds with expositions.
Tuy nhiên, khi các thành phần của câu đã được thích nghĩa được thuyết giảng một cách chi tiết và không còn sót lại gì, sự hài lòng của tâm và sự bén nhạy của trí tuệ của những người đáng được giáo hóa được tạo ra, nên Ngài trình bày bằng các chỉ giáo.
Apica bhagavā akkharehi ugghaṭetvā padehi vineti ugghaṭitaññuṃ, byañjanehi vipañcetvā ākārehi vineti vipañcitaññuṃ, niruttīhi netvā niddesehi vineti neyyaṃ.
Moreover, the Bhagavā, having prompted with letters, guides the ugghaṭitaññu (one who understands by mere prompting) with words; having expounded with expressions, He guides the vīpañcitaññu (one who understands by detailed explanation) with modes; having led with interpretations, He guides the neyya (one who needs to be led) with expositions.
Hơn nữa, Đức Thế Tôn giáo hóa người có khả năng hiểu ngay (ugghaṭitaññu) bằng cách biểu lộ bằng các mẫu tự và hướng dẫn bằng các từ ngữ; Ngài giáo hóa người có khả năng hiểu rộng (vipaṇcitaññu) bằng cách mở rộng bằng các từ ngữ biểu thị và hướng dẫn bằng các khía cạnh; Ngài giáo hóa người đáng được giáo hóa (neyya) bằng cách dẫn dắt bằng các thích nghĩa và hướng dẫn bằng các chỉ giáo.
Evañcāyaṃ dhammo ugghaṭiyamāno ugghaṭitaññuṃ vineti, vipañciyamāno vipañcitaññuṃ, nīyamāno neyyaṃ.
And so, this Dhamma, when prompted, guides the ugghaṭitaññu; when expounded, it guides the vīpañcitaññu; when led, it guides the neyya.
Và như vậy, Pháp này khi được biểu lộ thì giáo hóa người có khả năng hiểu ngay, khi được mở rộng thì giáo hóa người có khả năng hiểu rộng, khi được dẫn dắt thì giáo hóa người đáng được giáo hóa.
Tattha ugghaṭanā ādi, vipañcanā majjhe, nayanaṃ ante.
Therein, prompting is the beginning, expounding is the middle, and leading is the end.
Trong đó, sự biểu lộ là phần đầu, sự mở rộng là phần giữa, sự dẫn dắt là phần cuối.
Evaṃ tīsu kālesu tidhā desito dosattayavidhamano guṇattayāvaho tividhavineyyavinayanoti evampi tividhakalyāṇoyaṃ dhammo atthabyañjanapāripūriyā sāttho sabyañjanoti veditabbo.
Thus, this Dhamma, taught in three ways at three times, dispelling the three taints and bringing about the three virtues, training the three types of trainees—in this way too, being excellent in three ways, it should be understood as sātthaṃ (complete in meaning) and sabyañjanaṃ (complete in expression) due to the perfection of meaning and expression.
Như vậy, Pháp này được thuyết giảng ba cách trong ba thời điểm, tiêu diệt ba loại lỗi lầm, mang lại ba loại công đức, giáo hóa ba loại người đáng được giáo hóa, nên cũng được biết là có ba phần tốt đẹp, có ý nghĩa (sāttha) và có văn (sabyañjana) do sự đầy đủ về ý nghĩa và văn tự.
Vuttañhetaṃ nettipakaraṇe (netti. 9) –
For it is said in the Nettipakaraṇa:
Điều này đã được nói trong Nettipakaraṇa (Netti. 9):
‘‘Tattha bhagavā akkharehi saṅkāseti, padehi pakāseti, byañjanehi vivarati, ākārehi vibhajati, niruttīhi uttāniṃ karoti, niddesehi paññapeti.
‘‘Therein, the Bhagavā indicates with letters, illuminates with words, clarifies with expressions, categorizes with modes, makes clear with interpretations, and expounds with expositions.
"Trong đó, Đức Thế Tôn biểu lộ bằng các mẫu tự, làm sáng tỏ bằng các từ ngữ, mở ra bằng các từ ngữ biểu thị, phân chia bằng các khía cạnh, làm cho rõ ràng bằng các thích nghĩa, và trình bày bằng các chỉ giáo.
Tattha bhagavā akkharehi ca padehi ca ugghaṭeti, byañjanehi ca ākārehi ca vipañceti, niruttīhi ca niddesehi ca vitthāreti.
Therein, the Bhagavā prompts with letters and words, expounds with expressions and modes, and elaborates with interpretations and expositions.
Trong đó, Đức Thế Tôn biểu lộ bằng các mẫu tự và các từ ngữ; Ngài mở rộng bằng các từ ngữ biểu thị và các khía cạnh; Ngài giải thích chi tiết bằng các thích nghĩa và các chỉ giáo.
Tattha ugghaṭanā ādi, vipañcanā majjhe, vitthāranā pariyosānaṃ.
Therein, prompting is the beginning, expounding is the middle, and elaborating is the conclusion.
Trong đó, sự biểu lộ là phần đầu, sự mở rộng là phần giữa, sự giải thích chi tiết là phần kết thúc.
Soyaṃ dhammavinayo ugghaṭiyanto ugghaṭitaññuṃ puggalaṃ vineti, tena naṃ āhu ādikalyāṇoti.
This Dhamma-Vinaya, when prompted, guides the ugghaṭitaññu individual; therefore, it is called ādikalyāṇa (excellent in the beginning).
Pháp và Luật này khi được biểu lộ thì giáo hóa người có khả năng hiểu ngay, vì thế họ gọi là tốt đẹp ở phần đầu.
Vipañciyanto vipañcitaññuṃ puggalaṃ vineti, tena naṃ āhu majjhekalyāṇoti.
When expounded, it guides the vīpañcitaññu individual; therefore, it is called majjhekalyāṇa (excellent in the middle).
Khi được mở rộng thì giáo hóa người có khả năng hiểu rộng, vì thế họ gọi là tốt đẹp ở phần giữa.
Vitthāriyanto neyyaṃ puggalaṃ vineti, tena naṃ āhu pariyosānakalyāṇotī’’ti.
When elaborated, it guides the neyya individual; therefore, it is called pariyosānakalyāṇa (excellent in the conclusion).’’
Khi được giải thích chi tiết thì giáo hóa người đáng được giáo hóa, vì thế họ gọi là tốt đẹp ở phần kết thúc."
Atthagambhīratātiādīsu attho nāma tantiattho.
Among atthagambhīratā and so on, meaning (attho) refers to the meaning of the Canon.
Trong "sự thâm sâu về ý nghĩa" (atthagambhīratā) và những điều tương tự, ý nghĩa (attho) là ý nghĩa của Kinh điển (tantiattho).
Dhammo tanti.
Dhamma refers to the Canon.
Pháp (dhammo) là Kinh điển (tanti).
Paṭivedho tantiyā tantiatthassa ca yathābhūtāvabodho.
Penetration (paṭivedho) refers to the true understanding of the Canon and the meaning of the Canon.
Sự thấu hiểu (paṭivedho) là sự hiểu biết đúng như thật về Kinh điển và ý nghĩa của Kinh điển.
Desanā nāma manasā vavatthāpitāya tantiyā desanā.
Teaching (desanā) refers to the teaching of the Canon as mentally determined.
Sự thuyết giảng (desanā) là sự thuyết giảng Kinh điển đã được sắp đặt trong tâm.
Te panete atthādayo yasmā sasādīhi viya mahāsamuddo mandabuddhīhi dukkhogāhā alabbhaneyyapatiṭṭhā ca, tasmā gambhīrā.
These meanings and so on are profound (gambhīrā) because, like the great ocean, they are difficult for those of dull intellect to fathom and impossible to find a footing in, like beasts and so on.
Những ý nghĩa này và những điều tương tự, vì chúng khó tiếp cận và không thể tìm thấy nền tảng đối với những người trí tuệ kém cỏi, giống như đại dương đối với các loài chó và cá sấu, nên chúng thâm sâu (gambhīra).
Atha vā attho nāma hetuphalaṃ.
Alternatively, meaning (attho) refers to cause and effect.
Hoặc, ý nghĩa là nhân và quả.
Dhammo hetu.
Dhamma refers to cause.
Pháp là nhân.
Desanā paññatti, yathādhammaṃ dhammābhilāpo.
Teaching (desanā) refers to designation, or the exposition of the Dhamma in accordance with the Dhamma.
Sự thuyết giảng là sự chế định, sự diễn đạt Pháp đúng theo Pháp.
Anulomapaṭilomasaṅkhepavitthārādivasena vā kathanaṃ.
Or it is the discourse in terms of direct and reverse order, summary and detail, and so on.
Hoặc là sự nói theo cách thuận, nghịch, tóm tắt, chi tiết, v.v.
Paṭivedho abhisamayo, atthānurūpaṃ dhammesu, dhammānurūpaṃ atthesu, paññattipathānurūpaṃ paññattīsu avabodho.
Penetration (paṭivedho) refers to realization, the understanding of meanings in accordance with the Dhamma, of the Dhamma in accordance with meanings, and of designations in accordance with the path of designation.
Sự thấu hiểu là sự chứng ngộ, sự hiểu biết đúng theo ý nghĩa trong các Pháp, đúng theo Pháp trong các ý nghĩa, đúng theo con đường chế định trong các chế định.
Tesaṃ tesaṃ vā dhammānaṃ paṭivijjhitabbo lakkhaṇasaṅkhāto aviparītasabhāvo.
Or it is the undistorted inherent nature, called the characteristic, of those various dhammas that is to be penetrated.
Hoặc là bản chất không sai lệch, được gọi là đặc tính, cần phải được thấu hiểu của các Pháp đó.
Tepi cete atthādayo yasmā anupacitakusalasambhārehi duppaññehi sasādīhi viya mahāsamuddo dukkhogāhā alabbhaneyyapatiṭṭhā ca, tasmā gambhīrā.
And these meanings and so on are profound (gambhīrā) because, like the great ocean to beasts and so on, they are difficult to fathom and impossible to find a footing in for dull-witted individuals who have not accumulated meritorious provisions.
Và những ý nghĩa này và những điều tương tự, vì chúng khó tiếp cận và không thể tìm thấy nền tảng đối với những người ngu dốt, những người chưa tích lũy đầy đủ các công đức, giống như đại dương đối với các loài chó và cá sấu, nên chúng thâm sâu.
Tesu paṭivedhassapi atthasannissitattā vuttaṃ ‘‘atthagambhīratāpaṭivedhagambhīratāhi sāttha’’nti atthaguṇadīpanato.
Among these, because penetration is based on meaning, it is said: ‘‘sāttha (complete in meaning) by profoundness of meaning and profoundness of penetration’’, thereby illustrating the quality of meaning.
Trong đó, do sự thấu hiểu cũng nương tựa vào ý nghĩa, nên đã nói "có ý nghĩa (sāttha) do sự thâm sâu về ý nghĩa và sự thâm sâu về sự thấu hiểu" (atthagambhīratāpaṭivedhagambhīratāhi sātthaṃ), để làm sáng tỏ phẩm chất của ý nghĩa.
Tāsaṃ dhammadesanānaṃ byañjanasannissitattā vuttaṃ ‘‘dhammagambhīratādesanāgambhīratāhi sabyañjana’’nti tāsaṃ byañjanasampattidīpanato.
Because those Dhamma teachings are based on expression, it is said: ‘‘sabyañjana (complete in expression) by profoundness of Dhamma and profoundness of teaching’’, thereby illustrating the perfection of those expressions.
Do các sự thuyết giảng Pháp đó nương tựa vào văn tự, nên đã nói "có văn (sabyañjana) do sự thâm sâu về Pháp và sự thâm sâu về sự thuyết giảng" (dhammagambhīratādesanāgambhīratāhi sabyañjanaṃ), để làm sáng tỏ sự đầy đủ về văn tự của chúng.
Atthesu pabhedagataṃ ñāṇaṃ atthapaṭisambhidā, atthadhammaniruttipaṭisambhidāsu pabhedagataṃ ñāṇaṃ paṭibhānapaṭisambhidāti imissāpi paṭisambhidāya atthavisayattā āha ‘‘atthapaṭibhānapaṭisambhidāvisayato sāttha’’nti atthasampattiyā asati tadabhāvato.
The knowledge that has reached differentiation concerning meanings is atthapaṭisambhidā (analytical knowledge of meaning); the knowledge that has reached differentiation concerning attha, dhamma, and nirutti (expression) is paṭibhānapaṭisambhidā (analytical knowledge of ready wit). Since this paṭisambhidā (analytical knowledge) also has meaning as its domain, it says: ‘‘sāttha (complete in meaning) by way of the domain of analytical knowledge of meaning and ready wit’’, because if there is no perfection of meaning, that (knowledge) cannot exist.
Trí tuệ đạt được sự phân biệt trong các ý nghĩa là atthapaṭisambhidā (vô ngại giải về nghĩa), trí tuệ đạt được sự phân biệt trong atthadhammaniruttipaṭisambhidā (vô ngại giải về nghĩa, pháp, thích nghĩa) là paṭibhānapaṭisambhidā (vô ngại giải về biện tài). Do vô ngại giải này cũng có đối tượng là ý nghĩa, nên đã nói "có ý nghĩa (sāttha) do đối tượng của vô ngại giải về nghĩa và biện tài" (atthapaṭibhānapaṭisambhidāvisayato sātthaṃ), vì nếu không có sự đầy đủ về ý nghĩa thì điều đó không tồn tại.
Dhammoti tanti.
Dhamma refers to the Canon.
Pháp (dhammo) là Kinh điển (tanti).
Niruttīti tantipadānaṃ niddhāretvā vacanaṃ.
Nirutti (interpretation/expression) refers to the clear articulation of the words of the Canon.
Thích nghĩa (nirutti) là việc giải thích các từ ngữ của Kinh điển.
Tattha pabhedagatāni ñāṇāni dhammaniruttipaṭisambhidāti āha ‘‘dhammaniruttipaṭisambhidāvisayato sabyañjana’’nti asati byañjanasampattiyā tadabhāvato.
Therein, the knowledge that has reached differentiation is dhammaniruttipaṭisambhidā (analytical knowledge of Dhamma and expression); thus, it says: ‘‘sabyañjana (complete in expression) by way of the domain of analytical knowledge of Dhamma and expression’’, because if there is no perfection of expression, that (knowledge) cannot exist.
Trong đó, trí tuệ đạt được sự phân biệt là dhammaniruttipaṭisambhidā (vô ngại giải về pháp và thích nghĩa). Nên đã nói "có văn (sabyañjana) do đối tượng của vô ngại giải về pháp và thích nghĩa" (dhammaniruttipaṭisambhidāvisayato sabyañjanaṃ), vì nếu không có sự đầy đủ về văn tự thì điều đó không tồn tại.
Parikkhakajanappasādakantīti ettha iti-saddo hetuattho.
In parikkhakajanappasādakantī (pleasing to those who investigate), the word iti has the meaning of cause.
Trong "sự làm hài lòng những người khảo sát" (parikkhakajanappasādakantī), từ iti có nghĩa là nguyên nhân.
Yasmā parikkhakajanānaṃ kiṃkusalagavesīnaṃ pasādāvahaṃ, tasmā sātthaṃ.
Because it brings satisfaction to those who investigate, those who seek what is wholesome, it is sātthaṃ (complete in meaning).
Vì nó mang lại sự hài lòng cho những người khảo sát, những người tìm kiếm điều thiện, nên nó có ý nghĩa (sātthaṃ).
Atthasampannanti phalena hetuno anumānaṃ nadīpūrena viya upari vuṭṭhipavattiyā.
Its completeness in meaning is an inference of the cause from the effect, like the continuous rainfall upstream from the swelling of a river.
Sự đầy đủ về ý nghĩa được suy luận từ kết quả đến nguyên nhân, giống như sự kiện mưa trên thượng nguồn được suy luận từ sự dâng nước của con sông.
Sātthakatā panassa paṇḍitavedanīyatāya, sā paramagambhīrasaṇhasukhumabhāvato veditabbā.
Its state of being sāttha should be understood by its paṇḍitavedanīyatāya (being understandable by the wise), as it is supremely profound, subtle, and intricate.
Tuy nhiên, sự có ý nghĩa của nó cần được hiểu là do những người trí tuệ cảm nhận được, vì nó có bản chất cực kỳ thâm sâu, vi tế và tinh vi.
Vuttañhetaṃ ‘‘gambhīro duddaso’’tiādi.
This is stated: ‘‘profound, difficult to see’’ and so on.
Điều này đã được nói: "thâm sâu, khó thấy", v.v.
Lokiyajanappasādakanti sabyañjananti yasmā lokiyajanassa pasādāvahaṃ, tasmā sabyañjanaṃ.
Lokiyajanappasādakanti sabyañjana (pleasing to ordinary people, thus complete in expression) means that because it brings satisfaction to ordinary people, it is sabyañjanaṃ (complete in expression).
"Có văn (sabyañjana) do làm hài lòng những người thế gian" (lokiyajanappasādakanti sabyañjanaṃ) là vì nó mang lại sự hài lòng cho những người thế gian, nên nó có văn.
Lokiyajano hi byañjanasampattiyā tussati.
Indeed, ordinary people are pleased by the perfection of expression.
Vì người thế gian hài lòng với sự đầy đủ về văn tự.
Idhāpi phalena hetuno anumānaṃ.
Here too, it is an inference of the cause from the effect.
Ở đây cũng vậy, sự suy luận từ kết quả đến nguyên nhân.
Sabyañjanatā panassa saddheyyatāya, sā ādikalyāṇādibhāvato veditabbā.
Its state of being sabyañjana should be understood by its saddheyyatāya (being believable), as it is excellent in the beginning and so on.
Tuy nhiên, sự có văn của nó cần được hiểu là do đáng tin cậy, vì nó có bản chất tốt đẹp ở phần đầu, v.v.
Atha vā paṇḍitavedanīyato sātthanti paññāpadaṭṭhānatāya atthasampannataṃ āha, tato parikkhakajanappasādakaṃ saddheyyato sabyañjananti saddhāpadaṭṭhānatāya byañjanasampannataṃ, tato lokiyajanappasādatanti evamettha attho daṭṭhabbo.
Alternatively, ‘‘sāttha (complete in meaning) by being understandable by the wise’’ refers to its completeness in meaning due to wisdom being its proximate cause; then ‘‘sabyañjana (complete in expression) by being pleasing to those who investigate, by being believable’’ refers to its completeness in expression due to faith being its proximate cause; then its pleasingness to ordinary people — thus, the meaning should be understood here.
Hoặc, "có ý nghĩa (sāttha) do những người trí tuệ cảm nhận được" nói về sự đầy đủ về ý nghĩa do là nền tảng của trí tuệ; sau đó, "có văn (sabyañjana) do làm hài lòng những người khảo sát và đáng tin cậy" nói về sự đầy đủ về văn tự do là nền tảng của đức tin; sau đó, sự làm hài lòng những người thế gian – ý nghĩa ở đây cần được hiểu như vậy.
Gambhīrādhippāyato sātthanti adhippāyato agādhāpāratāya atthasampannaṃ aññathā tadabhāvato.
‘‘Sāttha (complete in meaning) due to profound intention’’ means it is complete in meaning due to the unfathomable depth of its intention; otherwise, it would not be so.
"Có ý nghĩa (sāttha) do ý định thâm sâu" (gambhīrādhippāyato sātthaṃ) là có ý nghĩa do ý định không thể đo lường và không có bờ bến, nếu không thì điều đó không tồn tại.
Uttānapadato sabyañjananti subodhasaddakatāya byañjanasampannaṃ paramagambhīrassapi atthassa vineyyānaṃ suviññeyyabhāvāpādanato.
With clear terms and phrasing means endowed with phrasing because of its easy-to-understand words, by making even a most profound meaning easily comprehensible to those to be trained.
Uttānapadato sabyañjananti (có văn cú rõ ràng và đầy đủ văn tự) là do có từ ngữ dễ hiểu, đầy đủ văn tự, khiến cho ý nghĩa dù vô cùng sâu sắc cũng trở nên dễ nhận biết đối với chúng sanh cần được giáo hóa.
Sabbopesa atthasampattiyā sātthaṃ, byañjanasampattiyā sabyañjananti sabbapaṭhamaṃ vuttasseva atthadvayassa papañcoti daṭṭhabbo.
All of this is meaningful due to the excellence of the meaning, and has good phrasing due to the excellence of the phrasing; this should be seen as an elaboration of the two meanings stated at the very beginning.
Tất cả điều này nên được hiểu là sự giải rộng của hai ý nghĩa đã được nói đến ngay từ đầu, rằng: có ý nghĩa do sự đầy đủ về ý nghĩa, đầy đủ văn tự do sự đầy đủ về văn tự.
Tathā ceva tattha tattha saṃvaṇṇitaṃ.
And it is commented upon in that way in various places.
Và điều ấy đã được giải thích ở các nơi như vậy.
Tathā hettha vikappassa samuccayassa vā aggahaṇaṃ.
Likewise, here there is no acceptance of an alternative or a conjunction.
Cũng vậy, ở đây không có việc chấp nhận sự lựa chọn hay sự kết hợp.
Upanetabbassa abhāvatoti pakkhipitabbassa vodānatthassa avuttassa abhāvato.
Because of the absence of what is to be added means because of the absence of an unstated matter of purification that is to be included.
Upanetabbassa abhāvatoti (do không có gì cần thêm vào) là do không có ý nghĩa thanh tịnh nào cần được thêm vào mà chưa được nói đến.
Kevalasaddo sakalādhivacananti āha ‘‘sakalaparipuṇṇabhāvenā’’ti, sabbabhāgehi paripuṇṇatāyāti attho.
The word kevala is a term for ‘entire,’ thus he said “by way of being entirely complete”; the meaning is: by being complete in all parts.
Từ kevala là một từ đồng nghĩa với "toàn thể", nên ngài nói ‘‘sakalaparipuṇṇabhāvenā’’ti (do tính chất toàn thể và trọn vẹn), nghĩa là do sự trọn vẹn về mọi phương diện.
Apanetabbassāti saṃkilesadhammassa.
Of what is to be removed means: of a defiling state.
Apanetabbassāti (của điều cần loại bỏ) là của pháp ô nhiễm.
Imasmiṃ aṅkurapetavatthumhi (pe. va. 275, 277) veyyāvaccaṃ ‘‘brahmacariya’’nti vuttaṃ.
In this Aṅkura Petavatthu, service is called “brahmacariya.”
Trong Aṅkurapetavatthu này, sự phục vụ được gọi là “phạm hạnh”.
‘‘Evaṃ kho taṃ bhikkhave tittiriyaṃ nāma brahmacariyaṃ ahosī’’ti (cūḷava. 311) imasmiṃ tittirajātake pañcasikkhāpadasīlaṃ ‘‘brahmacariya’’nti vuttaṃ.
“Thus, monks, there was that brahmacariya of the partridge.” In this Tittira Jātaka, the virtue of the five training rules is called “brahmacariya.”
“Này các Tỳ-khưu, như vậy, phạm hạnh gọi là tittiriya đã có”, trong Tittirajātaka này, năm học giới được gọi là “phạm hạnh”.
‘‘Taṃ kho pana me pañcasikha brahmacariyaṃ neva nibbidāya na virāgāya na nirodhāya yāvadeva brahmalokūpapattiyā’’ti imasmiṃ mahāgovindasutte (dī. ni. 2.329) catasso appamaññāyo ‘‘brahmacariya’’nti vuttā.
“But that brahmacariya of mine, Pañcasikha, leads not to disenchantment, not to dispassion, not to cessation… only to rebirth in the Brahmā world.” In this Mahāgovinda Sutta, the four boundless states are called “brahmacariya.”
“Này Pañcasikha, nhưng phạm hạnh ấy của ta không đưa đến yếm ly, không đưa đến ly tham, không đưa đến đoạn diệt, … chỉ đưa đến sự tái sanh vào cõi Phạm thiên”, trong Mahāgovindasutta này, bốn vô lượng tâm được gọi là “phạm hạnh”.
‘‘Pare abrahmacārī bhavissanti, mayamettha brahmacārī bhavissāmā’’ti imasmiṃ sallekhasutte (ma. ni. 1.83) methunavirati ‘‘brahmacariya’’nti vuttā.
“Others will not be celibate, but we here will be celibate.” In this Sallekha Sutta, abstinence from sexual intercourse is called “brahmacariya.”
“Những người khác sẽ không phải là người sống phạm hạnh, ở đây chúng ta sẽ là người sống phạm hạnh”, trong Sallekhasutta này, sự tiết dục được gọi là “phạm hạnh”.
Evaṃ (jā. 2.22.429) nimijātake attadamanavasena kato aṭṭhaṅgiko uposatho ‘‘brahmacariya’’nti vutto.
Thus, in the Nimi Jātaka, the eight-factored Uposatha undertaken by way of self-taming is called “brahmacariya.”
Như vậy, trong Nimijātaka, tám chi phần Uposatha được thực hành với ý nghĩa tự điều phục được gọi là “phạm hạnh”.
‘‘Idaṃ kho pana me, pañcasikha, brahmacariyaṃ ekantanibbidāya virāgāya…pe… ayameva ariyo aṭṭhaṅgiko maggo’’ti mahāgovindasuttasmiṃyeva (dī. ni. 2.329) ariyamaggo ‘‘brahmacariya’’nti vutto.
“But this brahmacariya of mine, Pañcasikha, leads exclusively to disenchantment, to dispassion… this very noble eightfold path.” In the same Mahāgovinda Sutta, the noble path is called “brahmacariya.”
“Này Pañcasikha, nhưng phạm hạnh này của Ta hoàn toàn đưa đến yếm ly, ly tham… chính là Bát Thánh đạo này”, cũng trong Mahāgovindasutta, Thánh đạo được gọi là “phạm hạnh”.
‘‘Tayidaṃ brahmacariyaṃ iddhañceva phītañca vitthārikaṃ bāhujaññaṃ puthubhūtaṃ yāvadeva manussehi suppakāsita’’nti pāsādikasutte (dī. ni. 3.174) sikkhattayasaṅgahaṃ sakalasāsanaṃ ‘‘brahmacariya’’nti vuttaṃ.
“This brahmacariya is prosperous and flourishing, extensive, widely known, widespread, well-proclaimed among humans.” In the Pāsādika Sutta, the entire Dispensation, which is a collection of the threefold training, is called “brahmacariya.”
“Phạm hạnh này thịnh vượng, phát triển, lan rộng, được nhiều người biết đến, phổ biến, được công bố rõ ràng cho đến loài người”, trong Pāsādikasutta, toàn bộ giáo pháp bao gồm ba học được gọi là “phạm hạnh”.
Imasmimpi ṭhāne idameva ‘‘brahmacariya’’nti adhippetanti āha ‘‘sikkhattayapariggahitattā’’tiādi.
In this context also, this very thing is intended as “brahmacariya,” so he says “because it is comprised of the threefold training,” etc.
Ở đây cũng vậy, chính điều này được ngụ ý là “phạm hạnh”, nên ngài nói ‘‘sikkhattayapariggahitattā’’ti (do được bao gồm bởi ba học) và các câu tiếp theo.
Seṭṭhehīti buddhādīhi seṭṭhehi.
By the best means by the best ones, such as the Buddha.
Seṭṭhehīti (bởi các bậc tối thượng) là bởi các bậc tối thượng như Đức Phật.
Seṭṭhaṭṭhena brahmabhūtaṃ vā cariyaṃ brahmacariyaṃ.
Or, a conduct that is holy in the sense of being the best is brahmacariya.
Hoặc, sự thực hành cao thượng với ý nghĩa tối thượng là brahmacariyaṃ.
Sanidānanti heṭṭhā vuttalakkhaṇena nidānena sanidānaṃ.
With its source means having a source with the characteristics mentioned below.
Sanidānanti (có nhân duyên) là có nhân duyên với đặc tính đã được nói ở dưới.
Sauppattikanti saaṭṭhuppattikaṃ.
With its origin means with the story of its origin.
Sauppattikanti (có nguồn gốc) là có sự tích khởi nguyên.
Veneyyānaṃ anurūpatoti veneyyānaṃ cariyādianurūpato.
According to the disciples means according to the character, and so on, of the disciples to be trained.
Veneyyānaṃ anurūpatoti (tương ứng với chúng sanh cần được giáo hóa) là tương ứng với hạnh kiểm và các yếu tố khác của chúng sanh cần được giáo hóa.
Atthassāti desiyamānassa sīlādiatthassa.
Of the meaning means of the meaning of virtue and so forth that is being taught.
Atthassāti (của ý nghĩa) là của ý nghĩa về giới và các pháp khác đang được thuyết giảng.
Hetudāharaṇayuttatoti ‘‘taṃ kissa hetu seyyathāpi, bhikkhave’’ti ca ādinā tattha tattha hetupamaggahaṇena hetudāharaṇehi yuttato.
Because it is endowed with reason and example means because it is endowed with reason and example through the taking up of reasons and similes in various places, with phrases such as “What is the reason for that? It is like this, monks.”
Hetudāharaṇayuttatoti (do hợp với lý do và ví dụ) là do hợp với lý do và ví dụ, bằng cách nêu ra lý do và ví dụ ở các nơi với các câu như “Này các Tỳ-khưu, lý do là gì? Ví như”.
Saddhāpaṭilābhenāti ‘‘te taṃ dhammaṃ sutvā tathāgate saddhaṃ paṭilabhantī’’tiādinā vuttasaddhāpaṭilābhena.
Through the acquisition of faith means through the acquisition of faith stated in such passages as, “Having heard that Dhamma, they acquire faith in the Tathāgata.”
Saddhāpaṭilābhenāti (do sự chứng đắc đức tin) là do sự chứng đắc đức tin được nói đến qua các câu như “Họ sau khi nghe pháp ấy, chứng đắc đức tin nơi Như Lai”.
Paṭipattiyāti sīlavisuddhiyādisammāpaṭipattiyā, paṭipattinimittanti attho.
Through the practice means through the right practice of the purification of virtue and so on; the meaning is, it is a sign of practice.
Paṭipattiyāti (do sự thực hành) là do sự thực hành chân chánh như giới thanh tịnh, nghĩa là do dấu hiệu của sự thực hành.
Adhigamabyattitoti saccappaṭivedhena adhigamaveyyattiyasabbhāvato sātthaṃ kapilamatādi viya tucchaṃ niratthakaṃ ahutvā atthasampannanti katvā.
From the manifestation of realization: Because there is the reality of proficiency in realization through the penetration of the truths, it is meaningful, not being empty and worthless like the teachings of Kapila and others, and is thus endowed with meaning.
Adhigamabyattitoti (do sự hiển bày của sự chứng ngộ) là do sự tồn tại của sự thông suốt trong chứng ngộ qua việc thấu triệt chân lý, nên có ý nghĩa, không phải là rỗng tuếch, vô ích như học thuyết của Kapila, mà là đầy đủ ý nghĩa.
Pariyattiyāti pariyattidhammaparicayena.
Through the scriptural learning means by familiarity with the Dhamma of the scriptures.
Pariyattiyāti (do sự học thuộc) là do sự quen thuộc với pháp học.
Āgamabyattitoti durakkhātadhammesu paricayaṃ karontassa viya sammohaṃ ajanetvā bāhusaccaveyyattiyasabbhāvato sabyañjanaṃ.
From the manifestation of the scriptures: Because it does not generate confusion like one who practices wrongly taught doctrines, but has the reality of proficiency in great learning, it is with phrasing.
Āgamabyattitoti (do sự hiển bày của kinh điển) là do không gây ra sự mê mờ như người thực hành quen thuộc với các giáo pháp được tuyên thuyết sai lầm, mà do sự tồn tại của sự thông suốt trong đa văn, nên sabyañjanaṃ (đầy đủ văn tự).
Byañjanasampattiyā hi sati āgamabyattīti.
For when there is accomplishment in phrasing, there is manifestation of the scriptures.
Bởi vì khi có sự đầy đủ về văn tự thì mới có sự thông suốt về kinh điển.
Sīlādipañcadhammakkhandhayuttatoti sīlādīhi pañcahi dhammakoṭṭhāsehi avirahitattā.
Because it is endowed with the five aggregates of the Dhamma, beginning with virtue means because it is not devoid of the five portions of the Dhamma, beginning with virtue.
Sīlādipañcadhammakkhandhayuttatoti (do hợp với năm pháp uẩn gồm giới, v.v.) là do không tách rời khỏi năm pháp uẩn gồm giới, v.v.
Kevalaparipuṇṇanti anavasesena samantato puṇṇaṃ pūritaṃ.
Entirely complete means filled and fulfilled on all sides, without remainder.
Kevalaparipuṇṇanti (hoàn toàn trọn vẹn) là trọn vẹn, được làm cho đầy đủ một cách toàn diện, không thiếu sót.
Nirupakkilesatoti diṭṭhimānādiupakkilesābhāvato.
From being without defilements means because of the absence of defilements such as views and conceit.
Nirupakkilesatoti (do không có phiền não) là do không có các phiền não như tà kiến, ngã mạn, v.v.
Nittharaṇatthāyāti vaṭṭadukkhato nissaraṇāya.
For the purpose of crossing over means for escaping from the suffering of the cycle of existence.
Nittharaṇatthāyāti (vì mục đích giải thoát) là để thoát ra khỏi khổ luân hồi.
Lokāmisanirapekkhatoti kathañcipi taṇhāsannissayassa anissayato parisuddhaṃ.
From being unconcerned with worldly allurements: Because in no way does it rely on the support of craving, it is perfectly pure.
Lokāmisanirapekkhatoti (do không quyến luyến thế lợi) là do không nương tựa vào bất kỳ sự nương tựa nào của ái dục, nên parisuddhaṃ (thanh tịnh).
Idaṃ vuttaṃ hoti – yo ‘‘imaṃ dhammadesanaṃ nissāya lābhaṃ vā sakkāraṃ vā labhissāmī’’ti deseti, tassa aparisuddhā desanā hoti.
This is what is said: for one who teaches thinking, “By means of this Dhamma teaching, I will obtain gain or honor,” his teaching is impure.
Điều này được nói như sau: người nào thuyết giảng với ý nghĩ “nhờ bài thuyết pháp này, ta sẽ nhận được lợi lộc hay danh vọng”, bài thuyết pháp của người ấy là không thanh tịnh.
Bhagavā pana lokāmisanirapekkho hitapharaṇena mettābhāvanāya muduhadayo ullumpanasabhāvasaṇṭhitena cittena deseti, tasmā tassa desanā parisuddhāti.
The Blessed One, however, teaches unconcerned with worldly allurements, with a heart softened by the cultivation of loving-kindness through the pervasion of welfare, and with a mind established in an uplifting nature; therefore, his teaching is perfectly pure.
Còn Đức Thế Tôn, Ngài không quyến luyến thế lợi, với trái tim mềm mại do lòng từ bi lan tỏa lợi ích, Ngài thuyết giảng với tâm ý vững chắc trong bản chất cứu vớt, vì thế bài thuyết pháp của Ngài là thanh tịnh.
Ādīsu (jā. 2.18.101) sundare.
And so on (Jā. 2.18.101), in the sense of 'beautiful'.
Và các trường hợp tương tự trong nghĩa tốt đẹp.
Idhāpi sundareyeva daṭṭhabboti āha ‘‘sādhu kho panāti sundaraṃ kho panā’’ti.
Here too, it should be understood as 'beautiful', therefore it says: ‘‘sādhu kho pana means sundaraṃ kho pana’’ (indeed good means indeed beautiful).
Ở đây cũng nên hiểu là tốt đẹp, vì vậy đã nói: "Sādhu kho panā" nghĩa là "thật tốt đẹp thay".
Tattha sundaranti bhaddakaṃ.
There, sundaraṃ means auspicious.
Trong đó, sundaraṃ là tốt lành.
Bhaddakatā ca passantassa hitasukhāvahabhāvenāti āha ‘‘atthāvahaṃ sukhāvaha’’nti.
And auspiciousness is in the sense of bringing benefit and happiness to one who sees, therefore it says: ‘‘atthāvahaṃ sukhāvahaṃ’’ (bringing benefit, bringing happiness).
Sự tốt lành là mang lại lợi ích và hạnh phúc cho người thấy, vì vậy đã nói: "atthāvahaṃ sukhāvahaṃ" (mang lại lợi ích, mang lại hạnh phúc).
Tattha atthāvahanti diṭṭhadhammikasamparāyikaparamatthasaññitahitāvahaṃ.
There, atthāvahaṃ (bringing benefit) means bringing benefit (hita) which is understood as welfare in this life, welfare in the next life, and ultimate welfare.
Trong đó, atthāvahaṃ là mang lại lợi ích được gọi là lợi ích tối thượng (paramattha), lợi ích hiện tại (diṭṭhadhammika) và lợi ích đời sau (samparāyika).
Sukhāvahanti yathāvuttatividhasukhāvahaṃ.
Sukhāvahaṃ (bringing happiness) means bringing the aforementioned three kinds of happiness.
Sukhāvahaṃ là mang lại ba loại hạnh phúc như đã nói.
Tathārūpānanti tādisānaṃ.
Tathārūpānaṃ means of such a nature.
Tathārūpānaṃ là những người như vậy.
Yādisehi pana guṇehi bhagavā samannāgato, tehi catuppamāṇikassa lokassa sabbakālepi accantāya pasādanīyo tesaṃ yathābhūtasabhāvattāti dassento ‘‘yathārūpo’’tiādimāha.
And to show that the Bhagavā, endowed with such qualities, is always supremely inspiring to the world with its four kinds of assessors, because of the true nature of those qualities, he says ‘‘yathārūpo’’ and so on.
Để chỉ ra rằng với những phẩm chất mà Đức Thế Tôn đầy đủ, Ngài luôn luôn rất đáng được bốn loại người trên thế gian này hoan hỷ vì bản chất chân thật của những phẩm chất đó, nên đã nói "yathārūpo" và tiếp theo.
Tattha yathābhucca…pe… arahatanti iminā dhammappamāṇānaṃ lūkhappamāṇānañca sattānaṃ bhagavato pasādāvahataṃ dasseti, taṃdassanena ca itaresampi rūpappamāṇaghosappamāṇānaṃ pasādāvahatā dassitā hotīti daṭṭhabbaṃ tadavinābhāvato.
There, by yathābhucca…pe… arahataṃ is shown the inspiring quality of the Bhagavā for beings who are assessors by Dhamma and assessors by harshness, and by showing this, the inspiring quality for others, who are assessors by appearance and assessors by sound, is also shown; this should be understood as such due to their inseparability.
Trong đó, yathābhucca…pe… arahataṃ (chân thật…pe… bậc A-la-hán) với điều này, chỉ ra sự đáng hoan hỷ của Đức Thế Tôn đối với những chúng sinh lấy Dhamma làm tiêu chuẩn và những chúng sinh thô lậu; và với sự chỉ ra đó, sự đáng hoan hỷ đối với những người khác lấy hình tướng (rūpa) và âm thanh (ghosa) làm tiêu chuẩn cũng được chỉ ra, điều này nên được hiểu là không thể tách rời.
Brahmacariyaṃ pakāsetīti kittisaddo abbhuggatoti evamettha sambandhoti āha ‘‘dassanamattampi sādhu hotīti evamajjhāsayaṃ katvā’’tiādi.
‘He proclaims the Brahmacariya’ means that a reputation has arisen; this is how the connection here should be understood, therefore he says: ‘‘thinking that even the mere sight is good’’ and so on.
"Tuyên bố Phạm hạnh" nghĩa là danh tiếng đã vang xa; mối liên hệ ở đây là như vậy, vì vậy đã nói "dassanamattampi sādhu hotīti evamajjhāsayaṃ katvā" và tiếp theo.
Tattha dassanamattampi sādhu hotīti ettha kosiyasakuṇavatthu kathetabbaṃ.
There, concerning dassanamattampi sādhu hoti (even the mere sight is good), the story of Kosiyasakuṇa should be told.
Trong đó, đối với "dassanamattampi sādhu hoti" (chỉ cần nhìn thấy cũng là tốt lành), câu chuyện về chim Kosīya nên được kể.
2. Yena vā kāraṇenāti hetumhi idaṃ karaṇavacanaṃ.
2. Yena vā kāraṇenā (for whatever reason)—this instrumental case is in the sense of cause.
2. Yena vā kāraṇena (vì lý do nào đó): đây là từ chỉ nguyên nhân (karaṇavacana) trong nghĩa nguyên nhân (hetu).
Hetuattho hi kiriyākāraṇaṃ, na karaṇaṃ viya kiriyattho, tasmā nānappakāraguṇavisesādhigamatthā idha upasaṅkamanakiriyāti ‘‘annena vasatī’’tiādīsu viya hetuatthamevetaṃ karaṇavacanaṃ yuttaṃ, na karaṇatthaṃ tassa ayujjamānattāti vuttaṃ ‘‘yena vā kāraṇenā’’ti.
For the sense of cause (hetu) is the reason for an action (kiriya), not the action itself as in the instrumental (karaṇa); therefore, the coming (upasaṅkamanakiriya) here is for the purpose of attaining various special qualities, hence this instrumental case is appropriate in the sense of cause (hetu), as in ‘‘He lives by food’’, not in the sense of instrument, as that would be unfitting, thus it is said ‘‘yena vā kāraṇenā’’.
Vì nghĩa nguyên nhân là nguyên nhân của hành động, chứ không phải nghĩa hành động như công cụ (karaṇa); do đó, ở đây, hành động đến gần (upasaṅkamana) là để đạt được các phẩm chất đặc biệt khác nhau, nên từ chỉ nguyên nhân này thích hợp với nghĩa nguyên nhân, như trong "annena vasati" (sống nhờ thức ăn), chứ không phải nghĩa công cụ, vì điều đó không phù hợp; vì vậy đã nói "yena vā kāraṇena".
Avibhāgato hi satatappavattaniratisayasāduvipulāmatarasasaddhammaphalatāyassa sāduphalaniccaphalitamahārukkhena bhagavā upamito.
For the Bhagavā is likened to a great tree always laden with delicious fruit, due to the immeasurable, continuous, excellent, delicious, abundant nectar-like fruit of the Saddhamma, undivided.
Vì không phân biệt, Đức Thế Tôn được ví như một cây đại thụ luôn kết trái ngọt ngào, do quả của Chánh Dhamma là vị ngọt, dồi dào, bất tử, luôn luôn và vượt trội.
Sāduphalūpabhogādhippāyaggahaṇeneva hi mahārukkhassa sāduphalatā gahitāti.
For the delicious fruitfulness of the great tree is understood precisely by the intention to enjoy delicious fruit.
Vì quả ngọt của cây đại thụ được hiểu là nhờ ý định hưởng thụ quả ngọt.
Upasaṅkamīti upasaṅkamanto.
Upasaṅkamī means approaching.
Upasaṅkamī (đã đến gần) nghĩa là đang đến gần.
Sampattakāmatāya hi kiñci ṭhānaṃ gacchanto taṃtaṃpadesātikkamanena upasaṅkami upasaṅkamantoti vattabbataṃ labhati.
Indeed, one who goes to a certain place with a desired purpose is said to approach by passing various places, or to be approaching.
Vì người đi đến một nơi nào đó với ý định đạt được điều mình muốn, bằng cách vượt qua các địa điểm khác nhau, được gọi là "đến gần" hoặc "đang đến gần".
Tenāha ‘‘gatoti vuttaṃ hotī’’ti, upagatoti attho.
Therefore it says: ‘‘gatoti vuttaṃ hoti’’ (it means he went), the meaning is he arrived.
Vì vậy đã nói "gatoti vuttaṃ hoti" (nghĩa là đã đi đến), tức là đã đến.
Upasaṅkamitvāti pubbakālakiriyāniddesoti āha ‘‘upasaṅkamanapariyosānadīpana’’nti.
Upasaṅkamitvā (having approached) is an indication of a past participle, therefore it says: ‘‘indicating the completion of the approach’’.
Upasaṅkamitvā (sau khi đến gần) là một cách diễn đạt hành động quá khứ, vì vậy đã nói "upasaṅkamanapariyosānadīpanaṃ" (chỉ ra sự kết thúc của việc đến gần).
Tatoti yaṃ ṭhānaṃ patto upasaṅkamīti vutto, tato upagataṭṭhānato.
Tato (from there) means from the place he arrived at, which is described as having approached.
Tato (từ đó) nghĩa là từ nơi đã đến gần, tức là từ nơi đã đạt được.
Āsannataraṃ ṭhānanti pañhaṃ vā pucchituṃ dhammaṃ vā sotuṃ sakkuṇeyyaṭṭhānaṃ.
Āsannataraṃ ṭhānaṃ (a very near place) means a place where one can ask a question or listen to the Dhamma.
Āsannataraṃ ṭhānaṃ (nơi gần hơn) là nơi có thể hỏi câu hỏi hoặc nghe Dhamma.
Yathā khamanīyādīni pucchantoti yathā bhagavā ‘‘kacci te brāhmaṇa khamanīyaṃ, kacci yāpanīya’’ntiādinā khamanīyādīni pucchanto tena brāhmaṇena saddhiṃ samappavattamodo ahosi.
Yathā khamanīyādīni pucchanto (just as he inquired about well-being, etc.): just as the Bhagavā, inquiring about well-being and so on, with phrases like ‘‘I hope, brahmin, you are well, I hope you are keeping up’’, became equally pleased with that brahmin.
Yathā khamanīyādīni pucchanto (như khi hỏi về sự chịu đựng, v.v.): như Đức Thế Tôn đã hỏi về sự chịu đựng, v.v., bằng cách nói "Này Bà-la-môn, ông có chịu đựng được không? Ông có sống được không?", và đã trò chuyện vui vẻ với Bà-la-môn đó.
Pubbabhāsitāya tadanukaraṇena evaṃ sopi brāhmaṇo bhagavatā saddhiṃ samappavattamodo ahosīti yojanā.
The connection is: because it was previously spoken, the brahmin also, by imitating that, became equally pleased with the Bhagavā.
Liên kết câu là: Bà-la-môn đó cũng đã trò chuyện vui vẻ với Đức Thế Tôn bằng cách bắt chước lời nói đã được nói trước đó.
Taṃ pana samappavattamodataṃ upamāya dassetuṃ ‘‘sītodakaṃ viyā’’tiādi vuttaṃ.
And to show that equality of pleasure through a simile, ‘‘sītodakaṃ viyā’’ (like cool water) and so on is said.
Để chỉ ra sự trò chuyện vui vẻ đó bằng một ví dụ, đã nói "sītodakaṃ viyā" (như nước mát lạnh) và tiếp theo.
Sammoditanti saṃsanditaṃ.
Sammoditaṃ means blended.
Sammoditaṃ là hòa hợp.
Ekībhāvanti sammodanakiriyāya samānataṃ ekarūpataṃ.
Ekībhāvaṃ means sameness, uniformity, in the action of pleasantries.
Ekībhāvaṃ là sự tương đồng, sự đồng nhất trong hành động trò chuyện vui vẻ.
Khamanīyanti ‘‘idaṃ catucakkaṃ navadvāraṃ sarīrayantaṃ dukkhabahulatāya sabhāvato dussahaṃ, kacci khamituṃ sakkuṇeyyanti pucchati.
Khamanīyaṃ (well-being): He asks, ‘‘This body-machine with four wheels and nine doors, which is by nature difficult to bear due to its abundance of suffering, can you endure it?’’
Khamanīyaṃ (có chịu đựng được không): "Cái cỗ máy thân thể bốn bánh xe, chín cửa này, vốn dĩ khó chịu đựng vì đầy rẫy khổ đau, ông có chịu đựng được không?" là câu hỏi.
Yāpanīyanti paccayāyattavuttikaṃ cirappabandhasaṅkhātāya yāpanāya kacci yāpetuṃ sakkuṇeyyaṃ.
Yāpanīyaṃ (keeping up): This life, dependent on requisites, consisting of a long continuum, can you keep it up?
Yāpanīyaṃ (có sống được không): "Có sống được không với sự sống phụ thuộc vào các yếu tố duy trì, được gọi là sự sống lâu dài?"
Sīsarogādiābādhābhāvena kacci appābādhaṃ.
Kacci appābādhaṃ (I hope you are not afflicted) refers to the absence of ailments like head diseases.
Kacci appābādhaṃ (có ít bệnh tật không) nghĩa là không có các bệnh như đau đầu, v.v.
Dukkhajīvikābhāvena kacci appātaṅkaṃ.
Kacci appātaṅkaṃ (I hope you are not distressed) refers to the absence of a life of suffering.
Kacci appātaṅkaṃ (có ít phiền não không) nghĩa là không có cuộc sống khổ sở.
Taṃtaṃkiccakaraṇe uṭṭhānasukhatāya kacci lahuṭṭhānaṃ.
Kacci lahuṭṭhānaṃ (I hope you are light in rising) refers to ease in rising to perform various duties.
Kacci lahuṭṭhānaṃ (có dễ dàng đứng dậy không) nghĩa là dễ dàng đứng dậy để thực hiện các công việc.
Tadanurūpabalayogato kacci balaṃ.
Kacci balaṃ (I hope you have strength) refers to having suitable strength.
Kacci balaṃ (có sức lực không) nghĩa là có sức lực phù hợp.
Sukhavihārasambhavena kacci phāsuvihāro atthīti tattha tattha kaccisaddaṃ yojetvā attho veditabbo.
Kacci phāsuvihāro (I hope you abide comfortably) refers to the possibility of comfortable abiding. The meaning should be understood by connecting the word ‘kacci’ (I hope) in each case.
Kacci phāsuvihāro (có sống thoải mái không) nghĩa là có sự sống an lạc, ý nghĩa nên được hiểu bằng cách kết hợp từ "kacci" ở từng nơi.
Balappattā pīti pītiyeva.
Balappattā pīti is just pīti (joy).
Pīti (hỷ) là chính là sự đạt được niềm vui.
Taruṇapīti pāmojjaṃ.
Taruṇapīti is pāmojjaṃ (gladness).
Pāmojjaṃ (hoan hỷ) là niềm vui mới chớm.
Sammodaṃ janeti karotīti sammodanikaṃ, tadeva sammodanīyanti āha ‘‘sammodajananato’’ti.
Sammodaṃ janeti karoti (it generates, makes gladness), therefore sammodanikaṃ; this itself is sammodanīyaṃ, hence it says: ‘‘sammodajananato’’ (because it generates gladness).
Điều gì tạo ra sự hòa hợp, làm cho hòa hợp thì gọi là sammodanikaṃ, chính điều đó là sammodanīyaṃ, vì vậy đã nói "sammodajananato" (do tạo ra sự hòa hợp).
Sammoditabbato sammodanīyanti idaṃ pana atthaṃ dassento ‘‘sammodituṃ yuttabhāvato’’ti āha.
To show the meaning that sammodanīyaṃ (to be glad) is because it should be rejoiced in, he says: ‘‘sammodituṃ yuttabhāvato’’ (because it is fitting to rejoice).
Để chỉ ra ý nghĩa này, tức là "đáng được hòa hợp", đã nói "sammodituṃ yuttabhāvato" (do có trạng thái thích hợp để hòa hợp).
Saritabbabhāvatoti anussaritabbabhāvato.
Saritabbabhāvato (because it should be remembered) means because it should be recollected.
Saritabbabhāvato (do có trạng thái đáng được nhớ đến) nghĩa là do có trạng thái đáng được hồi tưởng.
‘‘Saraṇīya’’nti vattabbe dīghaṃ katvā ‘‘sāraṇīya’’nti vuttaṃ.
Instead of saying ‘‘saraṇīyaṃ’’, by lengthening it, ‘‘sāraṇīyaṃ’’ is said.
Thay vì nói "saraṇīyaṃ", đã nói "sāraṇīyaṃ" bằng cách kéo dài nguyên âm.
Suyyamānasukhatoti āpāthamadhuratamāha.
Suyyamānasukhato (from the pleasure of being heard) refers to its utmost sweetness upon initial reception.
Suyyamānasukhato (do sự an lạc khi được nghe) chỉ sự ngọt ngào nhất khi mới tiếp xúc.
Anussariyamānasukhatoti vimaddaramaṇīyataṃ.
Anussariyamānasukhato (from the pleasure of being recollected) refers to its delightful charm even upon reflection.
Anussariyamānasukhato (do sự an lạc khi được hồi tưởng) chỉ sự thú vị khi được chiêm nghiệm.
Byañjanaparisuddhatāyāti sabhāvaniruttibhāvena tassā kathāya vacanacāturiyamāha.
Byañjanaparisuddhatāya (by the purity of expression) refers to the skillfulness of words in that discourse, being of true and natural expression.
Byañjanaparisuddhatāya (do sự trong sáng của văn phong) chỉ sự khéo léo trong cách diễn đạt của lời nói đó, với bản chất tự nhiên và ngữ pháp.
Atthaparisuddhatāyāti atthassa nirupakkilesataṃ.
Atthaparisuddhatāya (by the purity of meaning) refers to the meaning being undefiled.
Atthaparisuddhatāya (do sự trong sáng của ý nghĩa) chỉ ý nghĩa không có tạp nhiễm.
Anekehi pariyāyehīti anekehi kāraṇehi.
Anekehi pariyāhehi (by various methods) means by various reasons.
Anekehi pariyāhehi (bằng nhiều phương cách) nghĩa là bằng nhiều lý do.
Atidūraaccāsannapaṭikkhepena nātidūranāccāsannaṃ nāma gahitaṃ, taṃ pana avakaṃsato ubhinnaṃ pasāritahatthāsaṅghaṭṭanena daṭṭhabbaṃ.
By rejecting 'too far' and 'too near', 'neither too far nor too near' is taken; that, however, should be understood as the distance where two outstretched hands do not touch.
Bằng cách loại bỏ quá xa và quá gần, đã chọn nghĩa không quá xa cũng không quá gần; điều đó nên được hiểu là khi cả hai duỗi tay ra thì không chạm vào nhau.
Gīvaṃ pasāretvāti gīvaṃ parivattanavasena pasāretvā.
Gīvaṃ pasāretvā (stretching out his neck) means stretching out his neck by turning it.
Gīvaṃ pasāretvā (vươn cổ) nghĩa là vươn cổ bằng cách xoay cổ.
Meti kattuatthe sāmivacananti āha ‘‘mayā suta’’nti.
Me (by me) is in the agentive sense of the possessive, hence it says: ‘‘mayā sutaṃ’’ (heard by me).
Me (của tôi) là từ chỉ sở hữu trong nghĩa chủ ngữ, vì vậy đã nói "mayā sutaṃ" (tôi đã nghe).
Jātibrāhmaṇeti jātiyā brāhmaṇe, na bāhitapāpatāyāti vuttaṃ hoti.
Jātibrāhmaṇe (by birth a brahmin) means a brahmin by birth, not by having banished evil deeds.
Jātibrāhmaṇe (Bà-la-môn theo dòng dõi) nghĩa là Bà-la-môn theo dòng dõi, không phải do đã loại bỏ điều ác.
Khaṇḍiccādibhāvaṃ āpāditeti khaṇḍitadantapalitakesādibhāvaṃ sampāpite.
Khaṇḍiccādibhāvaṃ āpādite (having reached the state of broken teeth, etc.) means having attained the state of broken teeth, graying hair, and so on.
Khaṇḍiccādibhāvaṃ āpādite (đã đạt đến trạng thái răng sứt, v.v.) nghĩa là đã đạt đến trạng thái răng sứt, tóc bạc, v.v.
Vuḍḍhimariyādappatteti vuḍḍhiparicchedaṃ sampatte, vuḍḍhipariyantappatteti vuttaṃ hoti.
Vuḍḍhimariyādappatte (having reached the limit of old age) means having reached the boundary of old age, meaning having reached the end of old age.
Vuḍḍhimariyādappatte (đã đạt đến giới hạn tuổi già) nghĩa là đã đạt đến giới hạn của tuổi già, tức là đã đạt đến cuối cùng của tuổi già.
Jātimahallakatāyāti uppattiyā mahallakabhāvena.
Jātimahallakatāya (by being advanced in age by birth) means by being old due to birth.
Jātimahallakatāya (do tuổi tác cao theo dòng dõi) nghĩa là do tuổi tác cao theo sự sinh ra.
Mahattaṃ lāti gaṇhātīti mahallako, jātiyā mahallako, na vibhavādināti jātimahallako.
Mahallako (old) is one who grasps greatness (mahattaṃ lāti); jātimahallako (old by birth) means old by birth, not by wealth and so on.
Người đạt được sự vĩ đại được gọi là mahallako; người vĩ đại do dòng dõi, không phải do tài sản, v.v., là jātimahallako.
Addhānanti dīghakālaṃ.
Addhānaṃ means for a long time.
Addhānaṃ là thời gian dài.
Kittako pana soti āha ‘‘dve tayo rājaparivaṭṭe’’ti, dvinnaṃ tiṇṇaṃ rājūnaṃ rajjapasāsanapaṭipāṭiyoti attho.
How long is that? He says: ‘‘dve tayo rājaparivaṭṭe’’ (two or three successions of kings), meaning through the reigns of two or three kings in succession.
"Bao nhiêu?" đã nói "dve tayo rājaparivaṭṭe" (hai ba triều vua), nghĩa là trong sự kế tục trị vì của hai ba vị vua.
‘‘Addhagate’’ti vatvā kathaṃ vayogahaṇaṃ osānavayāpekkhanti āha ‘‘pacchimavayaṃ anuppatte’’ti.
Having said ‘‘addhagate’’ (advanced in years), how is the taking of age (vayogahaṇaṃ) referring to the final age? He says: ‘‘pacchimavayaṃ anuppatte’’ (having reached the last stage of life).
Sau khi nói "addhagate" (đã đi qua một thời gian dài), tại sao lại chỉ tuổi tác ở cuối đời? Đã nói "pacchimavayaṃ anuppatte" (đã đạt đến tuổi già cuối cùng).
Pacchimo tatiyabhāgoti sattasaṭṭhito paṭṭhāya pacchimavayo koṭṭhāso.
Pacchimo tatiyabhāgo (the last third part) is the final portion of life from sixty-seven years onwards.
Pacchimo tatiyabhāgo (phần thứ ba cuối cùng) là phần tuổi già cuối cùng bắt đầu từ sáu mươi bảy tuổi.
Dutiye atthavikappe jiṇṇeti nāyaṃ jiṇṇatā vayomattena, atha kho kulaparivaṭṭena purāṇatāyāti āha ‘‘jiṇṇeti porāṇe’’tiādi.
In the second interpretation of the meaning, jiṇṇe (old) does not refer to oldness merely by age, but to ancientness by family succession, hence it says: ‘‘jiṇṇe means porāṇe’’ (old means ancient) and so on.
Trong cách giải thích thứ hai về ý nghĩa, jiṇṇe (già yếu) không phải là sự già yếu chỉ do tuổi tác, mà là sự lâu đời theo dòng dõi, vì vậy đã nói "jiṇṇeti porāṇe" (già yếu nghĩa là cổ xưa) và tiếp theo.
Tena tesaṃ brāhmaṇānaṃ kulavasena uditoditabhāvamāha.
By this, it shows their continuous prominence by family line among those brahmins.
Điều đó chỉ ra rằng những Bà-la-môn đó đã nổi tiếng theo dòng dõi.
‘‘Vayoanuppatte’’ti iminā jātivuḍḍhiyā vakkhamānattā guṇavuḍḍhiyā tato sātisayattā ca ‘‘vuḍḍheti sīlācārādiguṇavuḍḍhiyutte’’ti āha.
Since ‘‘vayoanuppatte’’ (having reached old age) indicates growth by birth (jātivuḍḍhi), and growth by qualities is superior to that, he says: ‘‘vuḍḍhe means endowed with growth in qualities such as sīla and good conduct’’.
Với "vayoanuppatte" (đã đạt đến tuổi già), vì sự tăng trưởng về dòng dõi sẽ được nói đến, và sự tăng trưởng về phẩm chất vượt trội hơn điều đó, nên đã nói "vuḍḍheti sīlācārādiguṇavuḍḍhiyutte" (trưởng lão nghĩa là đầy đủ phẩm chất như giới hạnh, v.v.).
Tathā jātimahallakatāyapi teneva vakkhamānattā mahallaketi padena vibhavamahattatā yojitā.
Similarly, since being advanced in age will be explained by that very term, the word mahallaka here signifies greatness of prosperity.
Tương tự, về sự cao tuổi do sinh ra, vì đã được nói đến ở đó, nên với từ mahallake (lớn/già) thì sự vĩ đại về tài sản được áp dụng.
Maggapaṭipanneti brāhmaṇānaṃ paṭipattividhiṃ upagate taṃ avokkamma caraṇato.
Maggapaṭipanne (those who have entered the path) means having entered the Brahminical mode of conduct and acting without neglecting it.
Từ Maggapaṭipanne (người thực hành con đường) là vì không bỏ qua sự thực hành đó, đã đạt đến phương pháp thực hành của các Bà-la-môn.
Antimavayanti pacchimavayaṃ.
Antimavayaṃ means the last stage of life.
Antimavayaṃ (tuổi cuối cùng) là tuổi già.
Paccuṭṭhānaṃ nāma āsanā vuṭṭhānanti āha ‘‘nāsanā vuṭṭhahatī’’ti, nisinnāsanato na vuṭṭhātīti attho.
Rising up (paccuṭṭhāna) means rising from one's seat, as stated, "does not rise from his seat"; this means he does not rise from the seat he is sitting on.
Paccuṭṭhāna (đứng dậy chào đón) có nghĩa là đứng dậy khỏi chỗ ngồi, nên đã nói ‘‘nāsanā vuṭṭhahatī’’ (không đứng dậy khỏi chỗ ngồi), nghĩa là không đứng dậy khỏi chỗ ngồi của mình.
Ettha ca jiṇṇe…pe… vayoanuppatteti upayogavacanaṃ āsanā vuṭṭhānakiriyāpekkhaṃ na hoti, tasmā jiṇṇe…pe… vayoanuppatte disvāti ajjhāhāraṃ katvā attho veditabbo.
Here, the locative case in 'jiṇṇe…pe… vayoanuppatte' is not related to the act of rising from one's seat; therefore, the meaning should be understood by supplying 'having seen', thus: 'having seen those who are old…and have reached old age'.
Ở đây, "jiṇṇe…pe… vayoanuppatte" (người già…pe… đã đến tuổi) là cách dùng ngữ pháp chỉ công cụ, không liên quan đến hành động đứng dậy khỏi chỗ ngồi; do đó, cần phải thêm vào "disvā" (thấy) để hiểu nghĩa là "thấy người già…pe… đã đến tuổi".
Atha vā paccuggamanakiriyāpekkhaṃ upayogavacanaṃ, tasmā na paccuṭṭhetīti uṭṭhāya paccuggamanaṃ na karotīti attho veditabbo.
Or, the locative case is related to the act of going forth to meet; therefore, 'does not rise up' should be understood to mean 'does not rise and go forth to meet'.
Hoặc cách dùng ngữ pháp chỉ công cụ này liên quan đến hành động đi ra đón; do đó, na paccuṭṭhetī (không đứng dậy chào đón) phải được hiểu là không đứng dậy và đi ra đón.
Paccuggamanampi hi paccuṭṭhānanti vuccati.
Indeed, going forth to meet is also called rising up.
Đi ra đón cũng được gọi là paccuṭṭhāna (đứng dậy chào đón).
Vuttañhetaṃ ‘‘ācariyaṃ pana dūratova disvā paccuṭṭhāya paccuggamanakaraṇaṃ paccuṭṭhānaṃ nāmā’’ti.
For it has been said: 'Rising up (paccuṭṭhāna) is indeed the act of rising and going forth to meet one's teacher, having seen him from afar'.
Điều này đã được nói: "Thấy vị A-xà-lê từ xa, đứng dậy và đi ra đón được gọi là paccuṭṭhāna."
Nāsanā vuṭṭhātīti iminā pana paccuggamanābhāvassa upalakkhaṇamattaṃ dassitanti daṭṭhabbaṃ.
However, by 'does not rise from his seat', it should be understood that only the absence of going forth to meet is indicated.
Tuy nhiên, với câu "nāsanā vuṭṭhātīti" (không đứng dậy khỏi chỗ ngồi), chỉ là một dấu hiệu cho thấy sự không có mặt của việc đi ra đón.
Vibhāvane nāma attheti pakativibhāvanasaṅkhāte atthe, na abhivādeti vāti na abhivādetabbanti sallakkhetīti vuttaṃ hoti.
Vibhāvane nāma atthe (in the sense of manifesting) means in the sense of making clear the inherent nature; na abhivādeti vā (does not salute or) means he does not perceive him as one to be saluted.
Vibhāvane nāma atthe (về ý nghĩa của sự biểu lộ) là về ý nghĩa của sự biểu lộ tự nhiên, na abhivādeti vā (không đảnh lễ) có nghĩa là không nhận ra rằng cần phải đảnh lễ.
Taṃ aññāṇanti ‘‘ayaṃ mama abhivādanādīni kātuṃ araharūpo na hotī’’ti ajānanavasena pavattaṃ aññāṇaṃ.
Taṃ aññāṇaṃ (that ignorance) means the ignorance arising from not knowing, as in 'this person is not worthy of my salutations and so on'.
Taṃ aññāṇaṃ (sự vô minh đó) là sự vô minh phát sinh do không biết rằng "người này không xứng đáng để tôi đảnh lễ, v.v."
Olokentoti ‘‘dukkhaṃ kho agāravo viharati appatisso, kiṃ nu kho ahaṃ samaṇaṃ vā brāhmaṇaṃ vā sakkareyyaṃ, garuṃ kareyya’’ntiādisuttavasena (a. ni. 4.21) ñāṇacakkhunā olokento.
Olokento (looking at) means looking with the eye of wisdom, in accordance with suttas such as: 'Indeed, he lives disrespectfully, without deference; "why should I honor or respect any ascetic or brahmin?"'.
Olokento (quan sát) là quan sát bằng tuệ nhãn theo các kinh điển như "Này các Tỷ-kheo, người sống không tôn kính, không khiêm tốn thì sống khổ sở. Tôi sẽ tôn kính, trọng vọng vị Sa-môn hay Bà-la-môn nào?" (A.N. 4.21).
Nipaccakārārahanti paṇipātārahaṃ.
Nipaccakārārahaṃ means worthy of prostration.
Nipaccakārārahaṃ (xứng đáng được lễ bái) là xứng đáng được phủ phục.
Sampatijātoti muhuttajāto, jātasamanantaramevāti vuttaṃ hoti.
Sampatijāto means born just now; it means immediately after birth.
Sampatijāto (vừa mới sinh) là vừa mới sinh ra trong khoảnh khắc, có nghĩa là ngay sau khi sinh.
Uttarena mukhoti uttarābhimukho, uttaradisābhimukhoti vuttaṃ hoti.
Uttarena mukho means facing north; it means facing the northern direction.
Uttarena mukho (mặt hướng về phía bắc) là uttarābhimukho, có nghĩa là mặt hướng về phương bắc.
Sattapadavītihārena gantvā sakalaṃ dasasahassilokadhātuṃ olokesinti idaṃ ‘‘dhammatā esā, bhikkhave, sampatijāto bodhisatto samehi pādehi patiṭṭhahitvā uttarābhimukho sattapadavītihārena gacchati, setamhi chatte anudhāriyamāne sabbā disā viloketi, āsabhiñca vācaṃ bhāsatī’’ti evaṃ pāḷiyaṃ (dī. ni. 2.31) sattapadavītihārūpariṭṭhitassa viya sabbadisānuvilokanassa kathitattā vuttaṃ, na panetaṃ evaṃ daṭṭhabbaṃ, sattapadavītihārato pageva disāvilokanassa katattā.
Sattapadavītihārena gantvā sakalaṃ dasasahassilokadhātuṃ olokesi (having walked seven steps, he looked at the entire ten-thousand-world-system) is stated because in the Pāḷi it is said: "This is the custom, bhikkhus, that a Bodhisatta, immediately after birth, stands firmly on his feet and walks seven steps facing north, with a white parasol held over him, surveys all directions, and utters the bull's roar," thereby speaking of surveying all directions as if it occurs after walking seven steps; but this should not be understood in this way, because the surveying of directions takes place before the seven steps.
Sattapadavītihārena gantvā sakalaṃ dasasahassilokadhātuṃ olokesi (đi bảy bước và quan sát toàn bộ mười ngàn thế giới) được nói ra vì trong kinh điển (Dī.Nī. 2.31) đã nói rằng "Này các Tỷ-kheo, đây là một quy luật: Bồ-tát vừa mới sinh ra, đứng vững trên hai bàn chân bằng phẳng, mặt hướng về phía bắc, đi bảy bước, trong khi lọng trắng được che, Ngài nhìn khắp mọi hướng và nói lời dũng mãnh", như thể việc nhìn khắp mọi hướng xảy ra sau khi đi bảy bước, nhưng không nên hiểu như vậy, vì việc nhìn khắp mọi hướng đã xảy ra trước khi đi bảy bước.
Mahāsatto hi manussānaṃ hatthato muccitvā puratthimadisaṃ olokesi, anekāni cakkavāḷasahassāni ekaṅgaṇāni ahesuṃ.
For the Great Being, having been released from the hands of humans, looked towards the eastern direction, and thousands of world-systems became as one vast courtyard.
Đại sĩ sau khi thoát khỏi tay loài người, đã nhìn về phương đông, và hàng ngàn vạn thế giới trở thành một mặt phẳng.
Tattha devamanussā gandhamālādīhi pūjayamānā ‘‘mahāpurisa idha tumhehi sadisopi natthi, kuto uttaritaro’’ti āhaṃsu.
There, devas and humans, worshipping with perfumes and garlands, said: "Great man, there is none equal to you here, how much less superior!"
Ở đó, chư thiên và loài người đã cúng dường bằng hương hoa, v.v., và nói: "Đại nhân, ở đây không có ai giống như Ngài, huống chi là hơn Ngài!"
Evaṃ catasso disā catasso anudisā heṭṭhā uparīti dasapi disā anuviloketvā attano sadisaṃ adisvā ‘‘ayaṃ uttarā disā’’ti sattapadavītihārena agamāsīti veditabbo.
Having thus surveyed the four cardinal directions, the four intermediate directions, below, and above—all ten directions—and finding no one equal to himself, he should be understood to have walked seven steps, thinking, "This is the northern direction."
Tương tự, sau khi nhìn khắp mười phương (bốn phương chính, bốn phương phụ, dưới và trên) và không thấy ai giống mình, Ngài đã đi bảy bước và nói: "Đây là phương bắc".
Olokesinti mama puññānubhāvena lokavivaraṇapāṭihāriye jāte paññāyamānaṃ dasasahassilokadhātuṃ maṃsacakkhunāva olokesinti attho.
Olokesi (he looked) means he looked with his physical eye at the ten-thousand-world-system, which became manifest when the miracle of the world's opening occurred through the power of his merit.
Olokesi (quan sát) có nghĩa là khi thần thông mở ra thế giới do phước báu của ta, Ngài đã quan sát mười ngàn thế giới hiển lộ bằng nhục nhãn.
Mahāpurisoti jātigottakulappadesādivasena mahantapuriso.
Mahāpuriso (great man) means a great person in terms of birth, lineage, clan, region, and so on.
Mahāpuriso (đại nhân) là một người vĩ đại về dòng dõi, gia tộc, địa phương, v.v.
Aggoti guṇehi sabbapadhāno.
Aggo (foremost) means supreme among all in qualities.
Aggo (tối thượng) là người đứng đầu nhất về các phẩm chất.
Jeṭṭhoti guṇavaseneva sabbesaṃ vuḍḍhatamo, guṇehi mahallakatamoti vuttaṃ hoti.
Jeṭṭho (eldest) means most advanced of all by virtue of qualities; it means most venerable in qualities.
Jeṭṭho (trưởng lão) là người cao tuổi nhất trong tất cả về phẩm chất, có nghĩa là người vĩ đại nhất về phẩm chất.
Seṭṭhoti guṇavaseneva sabbesaṃ pasatthatamo.
Seṭṭho (best) means most praised of all by virtue of qualities.
Seṭṭho (tối thắng) là người được ca ngợi nhất trong tất cả về phẩm chất.
Atthato pana pacchimāni dve purimasseva vevacanānīti veditabbaṃ.
But in meaning, the latter two are synonyms of the former, as should be understood.
Tuy nhiên, về nghĩa, hai từ sau là đồng nghĩa với từ đầu tiên.
Tayāti nissakke karaṇavacanaṃ.
Tayā (by you) is the instrumental case of separation.
Tayā (bởi Ngài) là cách dùng ngữ pháp chỉ công cụ ở thể không sở hữu.
Uttaritaroti adhikataro.
Uttaritaro (more superior) means more excellent.
Uttaritaro (hơn nữa) là cao hơn.
Patimānesīti pūjesi.
Patimānesī (he honored) means he worshipped.
Patimānesī (tôn kính) là cúng dường.
Āsabhinti uttamaṃ.
Āsabhi (bull's) means supreme.
Āsabhaṃ (dũng mãnh) là tối thượng.
Mayhaṃ abhivādanādiraho puggaloti mayhaṃ abhivādanādikiriyāya araho anucchaviko puggalo.
Mayhaṃ abhivādanādiraho puggalo (a person worthy of my salutation and so on) means a person suitable and worthy of my acts of salutation and so on.
Mayhaṃ abhivādanādiraho puggalo (người xứng đáng được tôi đảnh lễ, v.v.) là người xứng đáng, thích hợp cho hành động đảnh lễ, v.v. của tôi.
Niccasāpekkhatāya panettha samāso daṭṭhabbo.
Here, the compound should be understood due to constant expectation.
Ở đây, cần hiểu là một hợp từ do sự mong đợi thường xuyên.
Tathāgatāti tathāgatato, tathāgatassa santikāti vuttaṃ hoti.
Tathāgatā (from the Tathāgata) means from the Tathāgata, or from the presence of the Tathāgata.
Tathāgatā (từ Như Lai) là từ Như Lai, có nghĩa là từ nơi Như Lai.
Evarūpanti abhivādanādisabhāvaṃ.
Evarūpaṃ (such a kind) means a state such as salutation.
Evarūpaṃ (như vậy) là bản chất của việc đảnh lễ, v.v.
Paripākasithilabandhananti paripākena sithilabandhanaṃ.
Paripākasithilabandhanaṃ (whose bonds are loosened by ripening) means whose bonds are loosened through ripening.
Paripākasithilabandhanaṃ (sự ràng buộc lỏng lẻo do chín muồi) là sự ràng buộc lỏng lẻo do sự chín muồi.
3. Taṃ vacananti ‘‘nāhaṃ taṃ brāhmaṇā’’tiādivacanaṃ.
3. Taṃ vacanaṃ (that utterance) means the utterance beginning with "I am not a brahmin...".
3. Taṃ vacanaṃ (lời nói đó) là lời nói "Này Bà-la-môn, tôi không phải là người như vậy", v.v.
‘‘Nāhaṃ arasarūpo, mādisā vā arasarūpā’’ti vutte brāhmaṇo thaddho bhaveyya.
If it were said "I am not unworthy of flavor, or those like me are not unworthy of flavor," the brahmin might become stubborn.
Nếu nói "Tôi không phải là người không có hương vị, hoặc những người như tôi không có hương vị", thì Bà-la-môn sẽ trở nên cứng nhắc.
Tena vuttaṃ ‘‘cittamudubhāvajananattha’’nti.
Therefore, it is said, "for generating softness of mind."
Do đó đã nói ‘‘cittamudubhāvajananattha’’ (để làm cho tâm trở nên mềm mại).
Ayañhi pariyāyasaddo desanāvārakāraṇesu vattatīti ettha pariyāyeti desetabbamatthaṃ avagameti bodhetīti pariyāyo, desanā.
Regarding the statement, "this word 'pariyāya' is used in the sense of teaching, turn, and cause," here, pariyāya means teaching, in the sense that it makes known or enlightens about the meaning to be taught.
Trong câu "Ayañhi pariyāyasaddo desanāvārakāraṇesu vattatī" (Từ pariyāya này được dùng trong các ý nghĩa giảng dạy, lượt và nguyên nhân), pariyāya (giảng dạy) là làm cho hiểu, làm cho giác ngộ điều cần được giảng dạy, tức là sự giảng dạy.
Pariyāyati aparāparaṃ parivattetīti pariyāyo, vāro.
Pariyāya means turn, in the sense that it revolves again and again.
Pariyāya (lượt) là xoay chuyển hết lần này đến lần khác, tức là lượt.
Pariyāyati attano phalaṃ pariggahetvā vattati, tassa vā kāraṇabhāvaṃ gacchatīti pariyāyo, kāraṇanti evaṃ pariyāyasaddassa desanāvārakāraṇesu pavatti veditabbā.
Pariyāya means cause, in the sense that it comprehends its own result and operates, or it becomes the cause of that result. Thus, the usage of the word 'pariyāya' in the sense of teaching, turn, and cause should be understood.
Pariyāya (nguyên nhân) là nắm giữ quả của mình và duy trì, hoặc trở thành nguyên nhân của điều đó, tức là nguyên nhân; như vậy, cần hiểu cách dùng từ pariyāya trong các ý nghĩa giảng dạy, lượt và nguyên nhân.
Aññāya saṇṭhaheyyāti arahatte patiṭṭhaheyya.
Aññāya saṇṭhaheyyā (he would be established by knowing) means he would be established in arahantship.
Aññāya saṇṭhaheyyā (sẽ an trú trong sự hiểu biết) là sẽ an trú trong A-la-hán quả.
Katamo pana soti pariyāyāpekkho pulliṅganiddeso, katamo so pariyāyoti attho.
Katamo pana so (which one is that?) is a masculine singular reference dependent on 'pariyāya'; it means "which pariyāya is that?".
Katamo pana so (vậy đó là gì?) là cách dùng ngữ pháp giống đực ám chỉ pariyāya, có nghĩa là pariyāya nào.
Jātivasenāti khattiyādijātivasena.
Jātivasena (by birth) means by birth as a khattiya and so on.
Jātivasenā (theo dòng dõi) là theo dòng dõi Sát-đế-lợi, v.v.
Upapattivasenāti devesu upapattivasena.
Upapattivasena (by rebirth) means by rebirth among devas.
Upapattivasenā (theo sự tái sinh) là theo sự tái sinh vào cõi trời.
Seṭṭhasammatānampīti api-saddena pageva aseṭṭhasammatānanti dasseti.
Seṭṭhasammatānampi (even of those considered supreme) – by the particle api, it shows that this applies even more so to those not considered supreme.
Seṭṭhasammatānampī (ngay cả những người được xem là tối thắng) – từ api (cũng) cho thấy rằng ngay cả những người trước đây không được xem là tối thắng.
Abhinandantānanti sappītikataṇhāvasena pamodamānānaṃ.
Abhinandantānaṃ (delighting) means rejoicing with joyful craving.
Abhinandantānaṃ (những người hoan hỷ) là những người vui mừng do ái dục có hỷ.
Rajjantānanti balavarāgavasena rajjantānaṃ.
Rajjantānaṃ (being attached) means being attached with powerful craving.
Rajjantānaṃ (những người bị dính mắc) là những người bị dính mắc do ái dục mạnh mẽ.
Rūpādiparibhogena uppannataṇhāyuttasomanassavedanā rūpato nibbattitvā hadayatappanato ambarasādayo viya ‘‘rūparasā’’ti vuccanti.
Feelings of joy associated with craving, which arise from the enjoyment of rūpas and so on, and which, being born from rūpa, delight the heart, are called "rūparasa" (flavor of forms) just as ambergris and other substances.
Cảm thọ hỷ lạc phát sinh do hưởng thụ sắc, v.v., giống như các loại nước ép từ trái cây, đã phát sinh từ sắc và làm thỏa mãn trái tim, nên được gọi là ‘‘rūparasā’’ (hương vị của sắc).
Āviñchantīti ākaḍḍhanti.
Āviñchantī (they drag) means they pull.
Āviñchantī (kéo) là lôi kéo.
Vatthārammaṇādisāmaggiyanti vatthuārammaṇādikāraṇasāmaggiyaṃ.
Vatthārammaṇādisāmaggiyaṃ (the combination of basis and object, etc.) means the combination of causal conditions such as basis and object.
Vatthārammaṇādisāmaggiyaṃ (sự kết hợp của căn, cảnh, v.v.) là sự kết hợp của các nguyên nhân như căn và cảnh.
Anukkhipantoti attukkaṃsanavasena kathite brāhmaṇassa asappāyabhāvato attānaṃ anukkhipanto anukkaṃsento.
Anukkhipanto (not exalting) means not exalting or praising oneself through self-aggrandizement, because it would be unsuitable for the brahmin.
Anukkhipanto (không tự đề cao) là không tự đề cao, không tự tán dương mình, vì điều đó không phù hợp với Bà-la-môn.
Etasmiṃ panatthe karaṇe sāmivacananti ‘‘jahitā’’ti etasmiṃ atthe.
Etasmiṃ panatthe karaṇe sāmivacanaṃ (here, the possessive case is used in the sense of the instrumental) in this sense, 'jahitā' (abandoned).
Etasmiṃ panatthe karaṇe sāmivacanaṃ (trong ý nghĩa này, cách dùng ngữ pháp sở hữu thay cho cách dùng ngữ pháp công cụ) là trong ý nghĩa "jahitā" (đã từ bỏ).
Tathāgatassāti karaṇe sāmivacanaṃ, tathāgatena jahitāti attho.
Tathāgatassā is the possessive case in the sense of the instrumental; it means 'abandoned by the Tathāgata'.
Tathāgatassā (của Như Lai) là cách dùng ngữ pháp sở hữu thay cho cách dùng ngữ pháp công cụ, có nghĩa là "do Như Lai từ bỏ".
Mūlanti bhavamūlaṃ.
Mūlaṃ (root) means the root of existence.
Mūlaṃ (gốc rễ) là gốc rễ của sự hiện hữu.
‘‘Tālavatthuvatthukatā’’ti vattabbe ‘‘oṭṭhamukho’’tiādīsu viya majjhepadalopaṃ katvā akārañca dīghaṃ katvā ‘‘tālāvatthukatā’’ti vuttanti āha ‘‘tālavatthu viya nesaṃ vatthu katanti tālāvatthukatā’’ti.
It is said "tālāvatthukatā" (made like the ground of a palm tree) by shortening the middle syllable and lengthening the 'a' sound, similar to 'oṭṭhamukho' and so on, when it should have been 'tālavatthuvatthukatā', meaning: "their basis is made like the basis of a palm tree, thus 'tālāvatthukatā'."
Thay vì nói "Tālavatthuvatthukatā", đã nói "tālāvatthukatā" bằng cách bỏ đi một phần giữa và kéo dài nguyên âm "a", giống như trong "oṭṭhamukho" (môi miệng), nên đã nói ‘‘tālavatthu viya nesaṃ vatthu katanti tālāvatthukatā’’ (như nền của cây thốt nốt, nền của chúng đã được tạo ra, nên gọi là tālāvatthukatā).
Tattha tālassa vatthu tālavatthu.
There, the basis of a palm tree is tālavatthu.
Trong đó, nền của cây thốt nốt là tālavatthu.
Yathā ārāmassa vatthubhūtapubbo padeso ārāmassa abhāve ‘‘ārāmavatthū’’ti vuccati, evaṃ tālassa patiṭṭhitokāso samūlaṃ uddharite tāle padesamatte ṭhite tālassa vatthubhūtapubbattā ‘‘tālavatthū’’ti vuccati.
Just as a place that was formerly the basis of a park is called "ārāmavatthu" (ground of a park) in the absence of the park, so too, the place where a palm tree was established, when the palm tree is uprooted entirely and only the ground remains, is called "tālavatthu" because it was formerly the basis of the palm tree.
Giống như một khu vực trước đây là nền của một khu vườn được gọi là "ārāmavatthu" (nền vườn) khi khu vườn không còn, thì tương tự, khi cây thốt nốt bị nhổ tận gốc và chỉ còn lại một vùng đất, nơi đó trước đây là nền của cây thốt nốt, nên được gọi là "tālavatthu".
Nesanti rūparasādīnaṃ.
Nesaṃ (of these) means of rūpas and flavors, etc.
Nesaṃ (của chúng) là của sắc vị, v.v.
Kathaṃ pana tālavatthu viya nesaṃ vatthu katanti āha ‘‘yathā hī’’tiādi.
But how was their case made like the palmyra-stump case? Thus he says, “Just as,” etc.
Nhưng bằng cách nào nền tảng của chúng được làm cho giống như cây thốt nốt bị chặt ngọn? (Để trả lời,) ngài đã nói câu bắt đầu là ‘yathā hī’.
Rūpādiparibhogena uppannataṇhāyuttasomanassavedanāsaṅkhātarūparasādīnaṃ cittasantānassa adhiṭṭhānabhāvato vuttaṃ ‘‘tesaṃ pubbe uppannapubbabhāvena vatthumatte cittasantāne kate’’ti.
Because the continuity of consciousness is the foundation for the taste of forms, etc.—which is defined as the pleasant feeling associated with craving that has arisen through the enjoyment of forms, etc.—it is said: “when the mere continuity of consciousness, their previously arisen former state, has been made a basis.”
Do là nền tảng của dòng tâm đối với các vị như sắc, vị, v.v... được gọi là thọ hỷ đi kèm với tham ái đã sanh khởi do sự hưởng thụ sắc, v.v..., nên đã được nói là ‘do dòng tâm, vốn là nền tảng, đã được thực hiện trước đây bằng sự sanh khởi trước đó của chúng’.
Tattha pubbeti pure, sarāgakāleti vuttaṃ hoti.
Therein, previously means before; what is said is: at a time when there was passion.
Trong đó, pubbe là trước đây, có nghĩa là vào thời còn tham ái.
Tālāvatthukatāti vuccantīti tālavatthu viya attano vatthussa katattā rūparasādayo ‘‘tālāvatthukatā’’ti vuccanti.
"Are called tālāvatthukatā" means: because their foundation has been made like a palmyra stump, forms, tastes, and so on are called "tālāvatthukatā".
Tālāvatthukatāti vuccantīti do nền tảng của chính chúng đã được làm cho giống như cây thốt nốt bị chặt ngọn, nên sắc, vị, v.v... được gọi là ‘tālāvatthukatā’.
Etena pahīnakilesānaṃ puna uppattiyā abhāvo dassito.
By this, the non-existence of re-arising for those whose defilements are abandoned is shown.
Qua đó, sự không sanh khởi trở lại của các phiền não đã được đoạn trừ được chỉ ra.
Aviruḷhidhammattāti aviruḷhisabhāvatāya.
"Having the nature of non-sprouting" means because of having a non-sprouting nature.
Aviruḷhidhammattāti do có bản chất không tăng trưởng.
Matthakacchinno tālo pattaphalādīnaṃ avatthubhūto tālāvatthūti āha ‘‘matthakacchinnatālo viya katā’’ti.
Just as a palmyra tree with its top cut off, which is not a basis for leaves, fruits, and so on, is a palmyra stump, so he said, "made like a palmyra tree with its top cut off".
Cây thốt nốt bị chặt ngọn, không còn là nền tảng cho lá, quả, v.v..., chính là cây thốt nốt bị chặt ngọn. (Do đó,) ngài nói ‘được làm cho giống như cây thốt nốt bị chặt ngọn’.
Etena ‘‘tālāvatthu viya katāti tālāvatthukatā’’ti ayaṃ viggaho dassito.
By this, the analysis "made like a palmyra stump, thus tālāvatthukatā" is shown.
Qua đó, cách giải thích này được chỉ ra: “được làm cho giống như cây thốt nốt bị chặt ngọn nên là tālāvatthukatā”.
Ettha pana avatthubhūto tālo viya katāti avatthutālākatāti vattabbe visesanassa padassa paranipātaṃ katvā ‘‘tālāvatthukatā’’ti vuttanti daṭṭhabbaṃ.
Here, however, it should be seen that although it should be said avatthutālākatā, meaning "made like a palmyra tree that is not a basis," it is said as "tālāvatthukatā" by placing the qualifying word after.
Tuy nhiên, ở đây, đáng lẽ phải nói là ‘avatthutālākatā’ với nghĩa là được làm cho giống như cây thốt nốt không còn là nền tảng, nhưng cần hiểu rằng từ ‘tālāvatthukatā’ đã được nói ra bằng cách đặt tính từ ở sau.
Iminā panatthena idaṃ dasseti – rūparasādivacanena vipākadhammadhammā hutvā pubbe uppannā kusalākusaladhammā gahitā, te uppannāpi matthakasadisānaṃ taṇhāvijjānaṃ maggasatthena chinnattā āyatiṃ tālapattasadise vipākakkhandhe nibbattetuṃ asamatthā jātā, tasmā tālāvatthu viya katāti tālāvatthukatā rūparasādayoti.
By this meaning, this is what is shown: by the words "forms, tastes, etc.," wholesome and unwholesome dhammas that previously arose as having the nature of resulting are taken. Though they have arisen, because cravings and ignorance, which are like the top*, have been cut by the sword of the path, they have become incapable of producing in the future resultant aggregates, which are like palmyra leaves. Therefore, forms, tastes, and so on are tālāvatthukatā, made like a palmyra stump.
Và bằng ý nghĩa này, điều này được chỉ ra: qua từ sắc, vị, v.v..., các pháp thiện và bất thiện đã sanh khởi trước đây, vốn là các pháp thuộc về quả, được bao gồm. Chúng, dù đã sanh khởi, nhưng do tham ái và vô minh tương tự như ngọn cây đã bị chặt đứt bởi thanh gươm đạo, nên đã trở nên không có khả năng tạo ra các uẩn quả tương tự như lá thốt nốt trong tương lai. Do đó, sắc, vị, v.v... được làm cho giống như cây thốt nốt bị chặt ngọn, nên là tālāvatthukatā.
Imasmiñhi atthe ‘‘abhinandantāna’’nti iminā padena kusalasomanassampi saṅgahitanti vadanti.
Regarding this meaning, they say that wholesome joy is also included by the phrase "of those who delight".
Trong ý nghĩa này, các vị nói rằng ngay cả thọ hỷ thiện cũng được bao gồm bởi từ ‘abhinandantānaṃ’.
5. Kulasamudācārakammanti kulācārasaṅkhātaṃ kammaṃ, kulacārittanti vuttaṃ hoti.
5. "The practice of family custom" means the action designated as family custom; it means family tradition.
5. Kulasamudācārakammanti nghiệp được gọi là tập tục của dòng dõi, có nghĩa là truyền thống dòng dõi.
Akiriyanti akaraṇabhāvaṃ.
"Akiriya" means the state of not doing.
Akiriyanti trạng thái không làm.
Duṭṭhu caritaṃ duccaritaṃ, kāyadvāre bāhullavuttito kāyato pavattaṃ duccaritanti kāyaduccaritaṃ.
Wrongly done is misconduct. Because it occurs predominantly through the body door, misconduct that proceeds from the body is "bodily misconduct".
Hành vi xấu là duccarita (hành vi xấu). Do thường được nói đến ở thân môn, nên hành vi xấu phát sinh từ thân là kāyaduccarita (thân ác hành).
Taṃ sarūpato dassento ‘‘tattha cā’’tiādimāha.
Showing it in its own nature, he said, "And in that context", and so on.
Để chỉ ra bản chất của nó, ngài nói ‘tattha cā’.
Pāṇātipātaadinnādānamicchācāracetanā veditabbāti ettha (itivu. aṭṭha. 74) pāṇoti paramatthato jīvitindriyaṃ, vohārato satto.
"The volitions for killing living beings, taking what is not given, and sexual misconduct should be understood". Here, a "living being" (pāṇo) is ultimately the life faculty, conventionally a being.
Pāṇātipātaadinnādānamicchācāracetanā veditabbāti ở đây, pāṇa (sinh mạng) theo nghĩa chân đế là mạng căn, theo nghĩa quy ước là chúng sanh.
Jīvitindriyañcettha rūpārūpavasena veditabbaṃ.
And here the life faculty should be understood by way of material and immaterial.
Và mạng căn ở đây cần được hiểu theo phương diện sắc và phi sắc.
Rūpajīvitindriye hi vikopite itarampi taṃsambandhatāya vinassati.
For when the material life faculty is damaged, the other, being connected to it, is also destroyed.
Bởi vì khi mạng căn sắc bị hủy hoại, mạng căn kia cũng bị hủy diệt do có liên quan đến nó.
Sattoti ca khandhasantāno gahetabbo.
And by "being" (satto), the continuity of aggregates should be understood.
Và satto (chúng sanh) cần được hiểu là dòng tương tục của các uẩn.
Tattha hi sattapaññatti.
For the designation "being" applies there.
Bởi vì khái niệm chúng sanh được đặt ra ở đó.
Saraseneva patanasabhāvassa antarā eva atīva pātanaṃ atipāto, saṇikaṃ patituṃ adatvā sīghaṃ pātananti attho.
Excessive killing (atipāto) is causing to fall very much in the middle of what has the nature of falling by its own nature; it means causing to fall quickly, not allowing it to fall slowly.
Atipāto là sự làm rơi rớt quá mức ngay từ đầu đối với cái có bản chất tự rơi rớt, có nghĩa là làm cho rơi rớt nhanh chóng mà không để cho nó rơi rớt từ từ.
Atikkamma vā satthādīhi abhibhavitvā pātanaṃ atipāto, pāṇassa atipāto pāṇātipāto, pāṇavadho pāṇaghātoti vuttaṃ hoti.
Or, atipāto is killing by transgressing, by overpowering with weapons and so on. The killing of a living being is pāṇātipāto; it means the slaying of a living being, the destruction of a living being.
Hoặc atipāto là sự làm rơi rớt bằng cách vượt qua, chế ngự bằng khí giới, v.v... Atipāto của pāṇa (sinh mạng) là pāṇātipāto, có nghĩa là sự giết hại sinh mạng, sự sát hại sinh mạng.
Atthato pana pāṇe pāṇasaññino parassa jīvitindriyupacchedakapayogasamuṭṭhāpikā kāyavacīdvārānamaññatarappavattā vadhakacetanā.
In terms of meaning, however, it is the volition to kill, which proceeds from one of the two doors, bodily or verbal, and which gives rise to an action that severs the life faculty of another who is perceived as a living being.
Tuy nhiên, về mặt ý nghĩa, đó là tác ý giết hại phát sinh từ một trong hai thân môn hoặc khẩu môn, tạo ra hành động cắt đứt mạng căn của người khác, trong khi có nhận thức rằng đó là sinh mạng.
Yāya hi cetanāya vattamānassa jīvitindriyassa nissayabhūtesu mahābhūtesu upakkamakaraṇahetukamahābhūtapaccayā uppajjanakamahābhūtā nuppajjissanti, sā tādisappayogasamuṭṭhāpikā cetanā pāṇātipāto.
For that volition which gives rise to such an action, by which the great elements that would have arisen as conditions from the great elements that are the cause for undertaking an attack on the great elements which are the support of the present life faculty will not arise, is the killing of a living being.
Bởi vì, tác ý nào tạo ra hành động như vậy, mà do đó các đại chủng có khả năng sanh khởi do các đại chủng làm duyên, vốn là nguyên nhân của việc thực hiện phương tiện đối với các đại chủng đang là cơ sở của mạng căn hiện tại, sẽ không sanh khởi, thì tác ý đó là pāṇātipāto.
Laddhupakkamāni hi bhūtāni itarabhūtāni viya na visadānīti samānajātiyānaṃ kāraṇāni na honti.
For the elements that have been subjected to an attack, unlike other elements, are not clear, and thus are not causes for those of a similar kind.
Bởi vì các đại chủng đã bị tác động thì không còn trong sáng như các đại chủng khác, nên chúng không thể làm nguyên nhân cho các (đại chủng) cùng loại.
Etthāha – khaṇe khaṇe nirujjhanasabhāvesu saṅkhāresu ko hantā, ko vā haññati, yadi cittacetasikasantāno, so arūpatāya na chedanabhedanādivasena vikopanasamattho, napi vikopanīyo.
Here one might say: Among formations that have the nature of ceasing moment by moment, who is the killer, and who is killed? If it is the continuity of mind and mental factors, that, being immaterial, is not capable of being damaged by way of cutting, piercing, and so on, nor can it be damaged.
Ở đây có người nói: trong các pháp hữu vi có bản chất hoại diệt trong từng khoảnh khắc, ai là người giết, ai là người bị giết? Nếu là dòng tâm và tâm sở, thì do là pháp vô sắc, nó không có khả năng bị hủy hoại theo cách cắt, đập, v.v..., và cũng không thể bị hủy hoại.
Atha rūpasantāno, so acetanatāya kaṭṭhakaliṅgarūpamoti na tattha chedanādinā pāṇātipāto labbhati yathā matasarīre.
If it is the continuity of matter, that, being non-sentient, is like a piece of wood or a log, so the killing of a living being is not obtained by cutting it, etc., just as with a dead body.
Nếu là dòng sắc, thì do không có tác ý, nó giống như khúc gỗ, nên không thể có sự sát sanh bằng cách cắt, đập, v.v... ở đó, giống như trong một thân xác đã chết.
Payogopi pāṇātipātassa paharaṇappahārādi atītesu vā saṅkhāresu bhaveyya anāgatesu vā paccuppannesu vā, tattha na tāva atītānāgatesu sambhavati tesaṃ abhāvato, paccuppannesu ca saṅkhārānaṃ khaṇikattā saraseneva nirujjhanasabhāvatāya vināsābhimukhesu nippayojano payogo siyā, vināsassa ca kāraṇarahitattā na paharaṇappahārādippayogahetukaṃ maraṇaṃ, nirīhakatāya ca saṅkhārānaṃ kassa so payogo, khaṇikattā vadhādhippāyasamakālabhijjanato kassa kiriyā, pariyosānakālānavaṭṭhānato kassa vā pāṇātipātakammabaddhoti?
Furthermore, the action of killing a living being, such as striking with a weapon, could be with respect to past, future, or present formations. In that regard, it is not possible with respect to past and future ones, as they do not exist. And with respect to present formations, because they are momentary and have the nature of ceasing by themselves, the action would be useless towards those which are heading for destruction. And since destruction is without a cause, death is not caused by the action of striking with a weapon, etc. And due to the inaction of formations, whose action is it? And due to its momentariness, since it is destroyed at the same time as the intention to kill, whose deed is it? And since it does not remain at the time of completion, to whom does the kamma of killing a living being accrue?
Hành động sát sanh như đánh, đập, v.v... có thể xảy ra đối với các pháp hữu vi trong quá khứ, tương lai, hoặc hiện tại. Trong đó, nó không thể xảy ra đối với quá khứ và tương lai vì chúng không tồn tại. Còn đối với hiện tại, do các pháp hữu vi là nhất thời, có bản chất tự hoại diệt, nên hành động đó trở nên vô ích đối với những gì đang hướng đến sự hủy diệt. Và do sự hủy diệt không có nguyên nhân, nên cái chết không phải do hành động đánh, đập, v.v... làm nguyên nhân. Và do các pháp hữu vi không có chủ thể, hành động đó là của ai? Do tính nhất thời, nó tan rã cùng lúc với ý định giết hại, vậy đó là hành động của ai? Do không tồn tại ở thời điểm kết thúc, nghiệp sát sanh ràng buộc vào ai?
Vuccate – yathāvuttavadhakacetanāsahito saṅkhārānaṃ puñjo sattasaṅkhāto hantā.
It is said: The collection of formations accompanied by the aforementioned volition to kill, designated as a being, is the killer.
Xin được trả lời: tập hợp các pháp hữu vi, được gọi là chúng sanh, đi kèm với tác ý giết hại như đã nói, chính là kẻ giết.
Tena pavattitavadhappayoganimittaṃ apagatusmāviññāṇajīvitindriyo matavohārappavattinibandhano yathāvuttavadhappayogakaraṇe uppajjanāraho rūpārūpadhammasamūho haññati, kevalo vā cittacetasikasantāno.
What is killed is the group of material and immaterial dhammas which are fit to arise when the aforesaid action of killing is performed, which is the basis for the conventional term "dead" due to the departure of heat, consciousness, and the life faculty, caused by the lethal action set in motion by that being; or it is simply the continuity of mind and mental factors.
Tập hợp các pháp sắc và phi sắc, có khả năng sanh khởi khi thực hiện hành động giết hại như đã nói, là cơ sở cho quy ước "chết", với hơi ấm, thức và mạng căn đã mất đi do hành động giết hại được thực hiện bởi kẻ đó, chính là đối tượng bị giết; hoặc chỉ riêng dòng tâm và tâm sở.
Vadhappayogāvisayabhāvepi tassa pañcavokārabhave rūpasantānādhīnavuttitāya rūpasantāne parena payojitajīvitindriyupacchedakapayogavasena tannibbattivinibandhakavisadisarūpuppattiyā vihate vicchedo hotīti na pāṇātipātassa asambhavo, napi ahetuko pāṇātipāto, na ca payogo nippayojano.
Although it is not an object of a lethal action, in the five-aggregate existence, because its state is dependent on the continuity of matter, its cessation occurs when the arising of dissimilar matter, which is the binding cause of its production, is impeded by way of a life-faculty-severing action instigated by another upon the continuity of matter. Thus, the impossibility of killing a living being does not hold, nor is the killing of a living being uncaused, nor is the action useless.
Mặc dù nó không phải là đối tượng của hành động giết hại, nhưng trong cõi năm uẩn, do sự tồn tại của nó phụ thuộc vào dòng sắc, nên khi dòng sắc bị gián đoạn do sự sanh khởi của sắc không trong sáng, vốn là nguyên nhân cản trở sự hình thành của nó, thông qua hành động cắt đứt mạng căn do người khác thực hiện, thì sự gián đoạn (của dòng tâm) xảy ra. Do đó, không phải là không có sự sát sanh, cũng không phải sự sát sanh không có nguyên nhân, và hành động đó cũng không phải là vô ích.
Paccuppannesu saṅkhāresu katapayogavasena tadanantaraṃ uppajjanārahassa saṅkhārakalāpassa tathā anuppattito khaṇikānaṃ saṅkhārānaṃ khaṇikamaraṇassa idha maraṇabhāvena anadhippetattā santatimaraṇassa ca yathāvuttanayena sahetukabhāvato na ahetukaṃ maraṇaṃ, na ca katturahito pāṇātipātapayogo nirīhakesupi saṅkhāresu sannihitatāmattena upakārakesu attano attano anurūpaphaluppādaniyatesu kāraṇesu kattuvohārasiddhito yathā ‘‘padīpo pakāseti, nisākarova candimā’’ti.
Due to the application having been made regarding present volitional formations, and due to the non-arising of the cluster of volitional formations that are fit to arise immediately thereafter, and because the momentary death of momentary volitional formations is not intended here as "death," and because continuity-death, as explained, is caused, death is not without cause. Nor is the act of taking life without an agent, for the designation of "agent" is established for causes that are fixed to produce their respective results, even in passive volitional formations that are merely instrumental due to their presence, just as it is said, "The lamp illuminates, and the moon is like the night-maker."
Vì các hành (saṅkhāra) hiện tại, do cách thức áp dụng (katapayogavasena), tập hợp các hành đáng sinh khởi ngay sau đó không thể sinh khởi như vậy; và vì cái chết từng sát-na (khaṇikamaraṇa) của các hành từng sát-na không được coi là cái chết ở đây; và vì cái chết liên tục (santatimaraṇa) có nhân theo cách đã nói, nên cái chết không phải là vô nhân. Và sự áp dụng của sát sinh (pāṇātipāta) không phải là không có chủ thể hành động, vì trong các nhân (kāraṇa) vốn chỉ hỗ trợ bằng sự hiện diện trong các hành không có ý chí (nirīhakesu saṅkhāresu), và vốn chắc chắn tạo ra quả tương ứng của riêng chúng, thì danh xưng chủ thể hành động được thiết lập, giống như ‘ngọn đèn chiếu sáng, mặt trăng như ánh trăng’.
Na ca kevalassa vadhādhippāyasahabhuno cittacetasikakalāpassa pāṇātipāto icchitabbo santānavasena avaṭṭhitasseva paṭijānanato.
Nor should the mere aggregate of consciousness and mental factors concomitant with the intention to kill be desired as pāṇātipāta, for it is acknowledged only as existing in continuity.
Và không nên chấp nhận sát sinh chỉ là tập hợp tâm và sở hữu tâm đi kèm với ý định giết hại, vì nó được nhận biết là tồn tại theo dòng tương tục.
Santānavasena vattamānānañca padīpādīnaṃ atthakiriyā dissatīti attheva pāṇātipātena kammabaddho.
And since the active functioning of things like lamps is seen when they exist in continuity, one is indeed bound by kamma through pāṇātipāta.
Và vì chức năng của đèn, v.v., vốn tồn tại theo dòng tương tục, được nhìn thấy, nên sát sinh ràng buộc nghiệp là có thật.
Ayañca vicāro adinnādānādīsupi yathāsambhavaṃ vibhāvetabbo.
This analysis should also be explained, where appropriate, in cases like adinnādāna.
Và sự phân tích này cũng nên được trình bày chi tiết trong các trường hợp như trộm cắp, v.v., tùy theo khả năng.
So (ma. ni. aṭṭha. 1.89; dha. sa. aṭṭha. akusalakammapathakathā) ca pāṇātipāto guṇavirahitesu tiracchānagatādīsu pāṇesu khuddake pāṇe appasāvajjo, mahante mahāsāvajjo.
That taking of life (pāṇātipāta), when committed against beings devoid of virtue, such as animals, is of light offense when the being is small, and of heavy offense when it is large.
Sát sinh (pāṇātipāta) đó, đối với chúng sinh không có đức hạnh như loài súc sinh, v.v., thì việc sát hại chúng sinh nhỏ là ít tội lỗi, còn sát hại chúng sinh lớn là rất tội lỗi.
Payogamahantatāya, payogasamattepi vatthumahantatāya.
Because of the magnitude of the endeavor, or because of the magnitude of the object even with an equal endeavor.
Vì sự nghiêm trọng của hành động (payogamahantatāya), và ngay cả khi hành động tương đương, vì sự nghiêm trọng của đối tượng (vatthumahantatāya).
Guṇavantesu manussādīsu appaguṇe pāṇe appasāvajjo, mahāguṇe mahāsāvajjo.
Against virtuous beings like humans, it is of light offense when the being has few virtues, and of heavy offense when it has great virtues.
Đối với chúng sinh có đức hạnh như loài người, v.v., thì việc sát hại chúng sinh ít đức hạnh là ít tội lỗi, còn sát hại chúng sinh nhiều đức hạnh là rất tội lỗi.
Sarīraguṇānaṃ pana samabhāve satipi kilesānaṃ upakkamānañca mudutāya appasāvajjo, tibbatāya mahāsāvajjoti veditabbo.
Even when the bodily qualities are equal, it should be understood that it is of light offense when the defilements and endeavors are mild, and of heavy offense when they are intense.
Tuy nhiên, ngay cả khi các đức tính thân thể là như nhau, thì do phiền não và ý định yếu ớt mà ít tội lỗi, còn do phiền não và ý định mãnh liệt mà rất tội lỗi, nên cần phải hiểu như vậy.
Kāyavācāhi na dinnanti adinnaṃ, parasantakaṃ, tassa ādānaṃ adinnādānaṃ.
That which is not given by body or speech is not given (adinna), another's property; the taking of that is taking what is not given (adinnādāna).
Không được cho bằng thân hay lời nói, đó là vật không được cho (adinna), là tài sản của người khác. Việc lấy vật đó là trộm cắp (adinnādāna).
Parassaharaṇaṃ theyyaṃ, corikāti vuttaṃ hoti.
It means stealing another's property, or thievery, or robbery.
Có nghĩa là lấy đi của người khác, trộm cắp, ăn cắp.
Atthato pana parapariggahe parapariggahitasaññino tadādāyakaupakkamasamuṭṭhāpikā kāyavacīdvārānamaññataradvārappavattā theyyacetanā.
In essence, it is the volition of theft, arisen from an endeavor to take what is grasped by another, with the perception that it is grasped by another, and occurring through one of the two doors, body or speech.
Tuy nhiên, về mặt ý nghĩa, đó là ý muốn trộm cắp (theyyacetanā) phát sinh từ hành động lấy đi của người khác, do nhận thức đó là tài sản của người khác, và được thực hiện qua một trong hai cửa thân hoặc lời nói.
Taṃ hīne parasantake appasāvajjaṃ, paṇīte mahāsāvajjaṃ.
This is of light offense when the other's property is inferior, and of heavy offense when it is superior.
Việc đó, đối với tài sản thấp kém của người khác là ít tội lỗi, đối với tài sản quý giá là rất tội lỗi.
Vatthupaṇītatāya.
Because of the superiority of the object.
Vì sự quý giá của đối tượng (vatthupaṇītatāya).
Vatthusamatte sati guṇādhikānaṃ santake vatthusmiṃ mahāsāvajjaṃ, taṃtaṃguṇādhikaṃ upādāya tato tato hīnaguṇassa santake vatthusmiṃ appasāvajjaṃ.
When the object is equal, it is of heavy offense with respect to the property of those with greater virtues, and of light offense with respect to the property of those with lesser virtues, in accordance with their respective virtues.
Khi đối tượng là như nhau, thì đối với tài sản của người có nhiều đức hạnh là rất tội lỗi, còn đối với tài sản của người có ít đức hạnh hơn, tùy theo mức độ đức hạnh, là ít tội lỗi.
Micchā caraṇaṃ micchācāro, methunasamācāresu ekantanindito lāmakācāro.
Wrong conduct is sexual misconduct (micchācāra), which is utterly condemned and evil conduct among sexual behaviors.
Hành động sai trái là tà dâm (micchācāra), là hành vi xấu xa, bị lên án tuyệt đối trong các hành vi giao cấu.
So pana lakkhaṇato asaddhammādhippāyena kāyadvārappavattā agamanīyaṭṭhānavītikkamacetanā.
By characteristic, it is the volition transgressing an unsuitable object, arising through the bodily door with the intention of unchastity.
Tuy nhiên, về mặt đặc tính, đó là ý muốn vượt qua những nơi không nên đến (agamanīyaṭṭhāna) phát sinh qua cửa thân, với ý định hành vi bất thiện (asaddhamma).
So panesa micchācāro sīlādiguṇavirahite agamanīyaṭṭhāne appasāvajjo, sīlādiguṇasampanne mahāsāvajjo.
This sexual misconduct is of light offense with an unsuitable object devoid of virtues like sīla, and of heavy offense with one endowed with virtues like sīla.
Tà dâm này, đối với nơi không nên đến mà không có các đức hạnh như giới, v.v., là ít tội lỗi, còn đối với nơi có đầy đủ các đức hạnh như giới, v.v., là rất tội lỗi.
Tassa cattāro sambhārā – agamanīyavatthu, tasmiṃ sevanacittaṃ, sevanapayogo, maggenamaggappaṭipattiadhivāsananti.
Its four requisites are: an unsuitable object, the intention to engage in it, the endeavor to engage in it, and the acquiescence in the performance through the path or non-path.
Bốn yếu tố của nó là: đối tượng không nên đến (agamanīyavatthu), tâm muốn giao cấu với đối tượng đó, hành động giao cấu, và sự chấp nhận hành vi sai trái qua đường đó.
Eko payogo sāhatthiko eva.
The endeavor is only by oneself.
Hành động chỉ là tự mình thực hiện.
Vacīdvāre bāhullavuttito vācato pavattaṃ duccaritanti vacīduccaritaṃ.
Bad conduct arising from speech, predominantly occurring through the door of speech, is verbal misconduct (vacīduccarita).
Hành vi bất thiện phát sinh từ lời nói, do phần lớn được thực hiện qua cửa lời nói, nên gọi là ác ngữ (vacīduccarita).
Taṃ sarūpato dassento āha ‘‘musāvādapisuṇavācāpharusavācāsamphappalāpacetanā veditabbā’’ti.
Showing its nature, it is said: "False speech, slanderous speech, harsh speech, and frivolous talk should be understood as volition."
Để trình bày bản chất của nó, kinh nói: “Nên biết đó là ý muốn nói dối, nói lời đâm thọc, nói lời thô tục, nói lời vô ích.”
Tattha musāti abhūtaṃ atacchaṃ vatthu.
Among these, false (musā) means an unreal, untrue thing.
Trong đó, musā là sự việc không có thật, không đúng.
Musā vadīyati vuccati etāyāti musāvādo, atathaṃ vatthuṃ tathato paraṃ viññāpetukāmassa tathāviññattisamuṭṭhāpikā cetanā.
It is called false speech (musāvāda) because an untrue thing is spoken by it; it is the volition that causes another to understand an untrue thing as true, by one who wishes to make another understand it as such.
Nói dối (musāvādo) là lời nói dối, là ý muốn làm cho người khác hiểu một sự việc không đúng là đúng, và là ý muốn phát sinh sự hiểu biết đó.
So yamatthaṃ bhañjati, tassa appatāya appasāvajjo, mahantatāya mahāsāvajjo.
It is of light offense when the matter it distorts is small, and of heavy offense when it is great.
Lời nói dối đó, nếu sự việc bị xuyên tạc là nhỏ thì ít tội lỗi, nếu lớn thì rất tội lỗi.
Apica gahaṭṭhānaṃ attano santakaṃ adātukāmatāya natthīti ādinayappavatto appasāvajjo, sakkhinā hutvā atthabhañjanatthaṃ vutto mahāsāvajjo.
Furthermore, among householders, it is of light offense when it occurs in a way such as saying "there isn't any" out of unwillingness to give one's property, and of heavy offense when spoken as a witness to distort a matter.
Hơn nữa, đối với gia chủ, lời nói dối kiểu “không có” vì không muốn cho tài sản của mình là ít tội lỗi, còn lời nói dối được nói ra để xuyên tạc sự việc với tư cách là nhân chứng thì rất tội lỗi.
Pabbajitānaṃ appakampi telaṃ vā sappiṃ vā labhitvā hasādhippāyena ‘‘ajja gāme telaṃ nadī maññe sandatī’’ti pūraṇakathānayena pavatto appasāvajjo, adiṭṭhaṃyeva pana diṭṭhantiādinā nayena vadantānaṃ mahāsāvajjo.
Among renunciants, even obtaining a small amount of oil or ghee, it is of light offense when spoken playfully, for instance, in an exaggerating manner, "Today, it's as if the village river is flowing with oil!" But it is of heavy offense for those who say things like "I saw what was unseen."
Đối với người xuất gia, việc nhận được một ít dầu hoặc bơ rồi nói đùa kiểu “hôm nay ở làng, dầu chảy như sông vậy” là ít tội lỗi, còn việc nói những điều chưa thấy là đã thấy, v.v., thì rất tội lỗi.
Tassa cattāro sambhārā honti – atathaṃ vatthu, visaṃvādanacittaṃ, tajjo vāyāmo, parassa tadatthaviññāpananti.
Its four requisites are: an untrue thing, the intention to deceive, the corresponding effort, and the other's understanding of that matter.
Bốn yếu tố của nó là: sự việc không đúng, tâm muốn lừa dối, nỗ lực tương ứng, và làm cho người khác hiểu sự việc đó.
Eko payogo sāhatthikova.
The endeavor is only by oneself.
Hành động chỉ là tự mình thực hiện.
So kāyena vā kāyapaṭibaddhena vā vācāya vā paravisaṃvādakakiriyākaraṇe daṭṭhabbo.
It should be seen in the act of deceiving another by body or by that which is connected to the body, or by speech.
Việc đó nên được xem xét khi làm cho người khác bị lừa dối bằng thân hoặc bằng vật liên quan đến thân, hoặc bằng lời nói.
Tāya ce kiriyāya paro tamatthaṃ jānāti, ayaṃ kiriyāsamuṭṭhāpikacetanākkhaṇeyeva musāvādakammunā bajjhati.
If, by that action, the other person knows the matter, then at the very moment of the volition that initiates the action, one is bound by the kamma of false speech.
Nếu người khác hiểu sự việc đó qua hành động đó, thì người đó bị ràng buộc bởi nghiệp nói dối ngay trong sát-na của ý muốn phát sinh hành động đó.
Yasmā pana yathā kāyakāyapaṭibaddhavācāhi paraṃ visaṃvādeti, tathā ‘‘idamassa bhaṇāhī’’ti āṇāpentopi, paṇṇaṃ likhitvā purato nissajjantopi, ‘‘ayaṃ attho evaṃ veditabbo’’ti kuṭṭādīsu likhitvā ṭhapentopi, tasmā ettha āṇattikanissaggiyathāvarāpi payogā yujjanti.
However, just as one deceives another by body, or by that which is connected to the body, or by speech, so too are acts of commanding, "Tell him this," or writing a letter and placing it before someone, or writing, "This meaning should be understood thus," on a wall, also appropriate endeavors here.
Tuy nhiên, vì người ta có thể lừa dối người khác bằng thân, bằng vật liên quan đến thân, hoặc bằng lời nói, cũng như bằng cách ra lệnh “hãy nói điều này cho người đó”, hoặc bằng cách viết thư rồi đặt trước mặt, hoặc bằng cách viết “ý này nên được hiểu như vậy” trên tường, v.v., nên ở đây, các hành động ra lệnh, từ bỏ, và cố định cũng được áp dụng.
Aṭṭhakathāsu pana anāgatattā vīmaṃsitvā gahetabbā.
However, since they are not found in the Commentaries, they should be investigated and accepted.
Nhưng vì chúng không được đề cập trong các chú giải, nên cần phải xem xét và chấp nhận.
Pisatīti pisuṇā, samagge satte avayavabhūte vagge bhinne karotīti attho.
It breaks, thus slanderous (pisuṇā); meaning, it makes people who are united into separate factions or groups.
Pisuṇā là lời nói đâm thọc, có nghĩa là làm cho những người hòa hợp, những nhóm người như những bộ phận, trở nên chia rẽ.
Niruttinayena vā piyasuññakaraṇato pisuṇā.
Or, according to etymology, it is slanderous because it makes one devoid of love (piya-suñña-karaṇa).
Hoặc theo ngữ nguyên, pisuṇā là làm cho tình yêu thương trở nên trống rỗng (piyasuññakaraṇato).
Yāya hi vācāya yassa taṃ vācaṃ bhāsati, tassa hadaye attano piyabhāvaṃ, parassa ca piyasuññabhāvaṃ karoti, sā pisuṇavācā.
Indeed, the speech by which one makes oneself beloved in the heart of the person to whom one speaks, and makes the other person devoid of love, is slanderous speech (pisuṇavācā).
Lời nói nào mà khi nói với ai đó, làm cho người đó mất đi tình yêu thương với người khác và làm cho người khác trở nên không còn được yêu thương trong lòng người đó, thì đó là lời nói đâm thọc (pisuṇavācā).
Lakkhaṇato pana saṃkiliṭṭhacittassa paresaṃ vā bhedāya attano piyakamyatāya vā kāyavacīpayogasamuṭṭhāpikā cetanā pisuṇavācā pisuṇaṃ vadati etāyāti katvā.
By characteristic, it is the volition of one with a defiled mind, arising from bodily or verbal endeavor, with the intention to cause division among others or with the desire for one's own popularity, called slanderous speech because it speaks divisively by it.
Tuy nhiên, về mặt đặc tính, lời nói đâm thọc là ý muốn phát sinh hành động qua thân và lời nói, với tâm ô nhiễm, nhằm chia rẽ người khác hoặc vì muốn được người khác yêu mến, gọi là pisuṇavācā vì nó nói lời đâm thọc.
Sā yassa bhedaṃ karoti, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
It is of light offense when the one whose division it causes is of few virtues, and of heavy offense when of great virtues.
Lời nói đó, nếu người bị chia rẽ ít đức hạnh thì ít tội lỗi, nếu nhiều đức hạnh thì rất tội lỗi.
Tassā cattāro sambhārā – bhinditabbo paro, ‘‘iti ime nānā bhavissanti vinā bhavissantī’’ti bhedapurekkhāratā vā ‘‘iti ahaṃ piyo bhavissāmi vissāsiko’’ti piyakamyatā vā, tajjo vāyāmo, tassa tadatthavijānananti.
Its four requisites are: the other person who is to be divided; either the intention to divide, "Thus they will be separate, they will be apart," or the desire for popularity, "Thus I will be beloved and trusted"; the corresponding effort; and the other's understanding of that matter.
Bốn yếu tố của nó là: người cần bị chia rẽ, ý định muốn chia rẽ “để họ sẽ khác biệt, họ sẽ xa cách nhau” hoặc ý muốn được yêu mến “để tôi sẽ được yêu mến, được tin cậy”, nỗ lực tương ứng, và người đó biết được ý định đó.
Pare pana abhinne kammapathabhedo natthi, bhinne eva hoti.
However, there is no division of a kamma path among unseparated people; it only occurs among those who are divided.
Tuy nhiên, đối với những người chưa chia rẽ thì không có nghiệp đạo chia rẽ, chỉ khi đã chia rẽ mới có.
Pharusayatīti pharusā, vācā.
It is harsh, thus harsh (pharusā) speech.
Pharusā là lời nói thô tục, làm cho người khác trở nên thô tục.
Yāya hi vācāya attānampi parampi pharusaṃ sinehābhāvena lūkhaṃ karoti, sā pharusavācā.
Indeed, the speech by which one makes oneself and others harsh, rough, due to lack of affection, is harsh speech (pharusavācā).
Lời nói nào mà khi nói ra, làm cho cả mình và người khác trở nên thô tục, khô khan vì thiếu tình cảm, thì đó là lời nói thô tục (pharusavācā).
Atha vā sayampi pharusā domanassasamuṭṭhitattā sabhāvenapi kakkasā neva kaṇṇasukhā na hadayasukhāti pharusavācā.
Alternatively, it is harsh speech because it is inherently harsh, being arisen from ill will, and by nature disagreeable to the ear and displeasing to the heart.
Hoặc lời nói tự nó thô tục (pharusā) vì phát sinh từ sự ưu phiền, bản chất cũng thô ráp, không êm tai, không vui lòng, nên gọi là lời nói thô tục (pharusavācā).
Ettha pana paresaṃ mammacchedanavasena pavattiyā ekantaniṭṭhuratāya sabhāvena kāraṇavohārena ca vācāya pharusasaddappavatti daṭṭhabbā.
Here, the occurrence of the word "harsh" for speech should be understood as due to its utter cruelty, its inherent nature, and by way of attributing the effect to the cause, as it proceeds by cutting others to the quick.
Ở đây, sự phát sinh của từ thô tục (pharusasadda) trong lời nói cần được hiểu là do hành vi làm tổn thương người khác, do sự tàn nhẫn tuyệt đối và do bản chất là nguyên nhân.
Taṃ pharusaṃ vadati etāyāti pharusavācā, parassa mammacchedakakāyavacīpayogasamuṭṭhāpikā ekantapharusā cetanā.
It is harsh speech because one speaks harshly by it; it is an utterly harsh volition that initiates a bodily or verbal endeavor to cut another to the quick.
Lời nói thô tục (pharusavācā) là ý muốn thô tục tuyệt đối, phát sinh từ hành động thân và lời nói làm tổn thương người khác, vì nó nói những lời thô tục.
Tassā āvibhāvatthamidaṃ vatthu – eko kira dārako mātu vacanaṃ anādiyitvā araññaṃ gacchati, taṃ mātā nivattetuṃ asakkontī ‘‘caṇḍā taṃ mahiṃsī anubandhatū’’ti akkosi.
To illustrate this, there is this story: a certain boy, disregarding his mother's words, went into the forest. His mother, unable to make him return, cursed, "May a fierce buffalo pursue you!"
Để làm rõ điều đó, có một câu chuyện như sau: Có một cậu bé không nghe lời mẹ mà đi vào rừng. Người mẹ không thể ngăn cản được, bèn nguyền rủa: “Cầu mong con trâu cái hung dữ đuổi theo con!”
Athassa tatheva araññe mahiṃsī uṭṭhāsi.
Then, just as she had said, a buffalo appeared in the forest.
Và quả nhiên, một con trâu cái xuất hiện trong rừng.
Dārako ‘‘yaṃ mama mātā mukhena kathesi, taṃ mā hotu.
The boy made an act of truth, saying, "May what my mother spoke with her mouth not happen.
Cậu bé liền thực hiện lời thề chân thật: “Điều mẹ con nói bằng miệng, xin đừng xảy ra.
Yaṃ cittena cintesi, taṃ hotū’’ti saccakiriyamakāsi.
May what she thought in her heart happen."
Điều mẹ con nghĩ trong tâm, xin hãy xảy ra.”
Mahiṃsī tattheva baddhā viya aṭṭhāsi.
The buffalo stood there as if bound.
Con trâu cái liền đứng yên như bị trói buộc tại chỗ.
Evaṃ mammacchedakopi payogo cittasaṇhatāya pharusavācā na hoti.
Even such a heart-rending application is not harsh speech due to the kindness of the mind.
Ngay cả lời nói có thể cắt đứt ruột gan như vậy, nếu tâm thiện lành, cũng không phải là lời nói thô ác.
Mātāpitaro hi kadāci puttake evampi vadanti ‘‘corā vo khaṇḍākhaṇḍikaṃ karontū’’ti, uppalapattampi ca nesaṃ upari patantaṃ na icchanti.
For parents sometimes say to their children, "May thieves cut you into pieces!", yet they do not wish even a lotus leaf to fall upon them.
Cha mẹ, đôi khi nói với con cái rằng: “Cầu cho trộm cướp chặt các con ra từng mảnh!”, nhưng họ lại không muốn ngay cả một cánh sen rơi trên mình con.
Ācariyupajjhāyā ca kadāci nissitake evaṃ vadanti ‘‘kiṃ ime ahirikā anottappino caranti, niddhamatha ne’’ti.
And teachers and preceptors sometimes say to their pupils, "Why do these shameless, fearless ones behave like this? Drive them away!"
Các vị thầy và bổn sư đôi khi nói với các đệ tử của mình rằng: “Tại sao những kẻ vô tàm vô quý này lại hành xử như vậy? Hãy đuổi chúng đi!”
Atha ca nesaṃ āgamādhigamasampattiṃ icchanti, yathā cittasaṇhatāya pharusavācā na hoti, evaṃ vacanasaṇhatāya apharusavācāpi na hoti.
Yet they wish for their attainment of learning and realization. Just as harsh speech does not occur due to the kindness of the mind, so also non-harsh speech does not occur due to the kindness of the words.
Thế nhưng họ lại mong muốn sự thành tựu về học vấn và chứng đắc của các đệ tử. Cũng như lời nói thô ác không phải là thô ác nếu tâm thiện lành, thì lời nói không thô ác cũng không phải là không thô ác nếu lời nói được sắp đặt khéo léo.
Na hi mārāpetukāmassa ‘‘imaṃ sukhaṃ sayāpethā’’ti vacanaṃ apharusavācā hoti, cittapharusatāya pana esā pharusavācāva.
For the speech of one desiring to kill, "Let him sleep peacefully," is not non-harsh speech; it is harsh speech because of the harshness of the mind.
Lời nói của người muốn giết người rằng: “Hãy cho người này ngủ yên!” không phải là lời nói không thô ác, mà chính là lời nói thô ác do tâm thô ác.
Sā yaṃ sandhāya pavattitā, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.
That (speech), in dependence on what it is uttered, is of minor offense due to the insignificance of its object, and of major offense due to the great importance of its object.
Lời nói đó, tùy thuộc vào đối tượng mà nó hướng đến, nếu đối tượng có ít đức tính thì ít tội lỗi, nếu đối tượng có nhiều đức tính thì nhiều tội lỗi.
Tassā tayo sambhārā – akkositabbo paro, kupitacittaṃ, akkosanāti.
It has three constituents: the other person to be reviled, an angry mind, and the act of reviling.
Lời nói thô ác có ba yếu tố cấu thành: người bị mắng chửi, tâm sân hận, và hành động mắng chửi.
Saṃ sukhaṃ hitañca phalati visarati vināsetīti samphaṃ, attano paresañca anupakārakaṃ yaṃ kiñci, samphaṃ palapati etāyāti samphappalāpo, anatthaviññāpikakāyavacīpayogasamauṭṭhāpikā akusalacetanā.
That which bears fruit of happiness and welfare, spreads, and destroys is samphaṃ (fruitless); anything that is unhelpful to oneself and others is samphaṃ. Speaking samphaṃ by means of it is samphappalāpa (frivolous talk), which is unwholesome volition arising from a bodily or verbal application that announces meaninglessness.
Cái gì sinh ra, lan rộng và hủy hoại sự an lạc và lợi ích thì gọi là sampha (vô ích), tức là bất cứ điều gì không có lợi cho bản thân và người khác. Kẻ nào nói những điều vô ích như vậy thì gọi là samphappalāpo (nói lời vô ích), đó là tâm sở bất thiện phát sinh từ sự vận dụng thân và khẩu truyền đạt những điều vô nghĩa.
So āsevanamandatāya appasāvajjo, āsevanamahantatāya mahāsāvajjo.
That (frivolous talk) is of minor offense due to the slightness of practice, and of major offense due to the greatness of practice.
Lời nói vô ích đó, nếu thói quen ít thì ít tội lỗi, nếu thói quen nhiều thì nhiều tội lỗi.
Tassa dve sambhārā – bhāratayuddhasītāharaṇādiniratthakakathāpurekkhāratā, tathārūpīkathākathanañca.
It has two constituents: prior engagement in meaningless talks like the war of Bhārata and the abduction of Sītā, and the telling of such a story.
Nó có hai yếu tố cấu thành: sự bận tâm đến những câu chuyện vô ích như trận chiến Bharata, việc bắt cóc Sītā, v.v., và việc nói những câu chuyện như vậy.
Pare pana taṃ kathaṃ agaṇhante kammapathabhedo natthi, parena pana samphappalāpe gahiteyeva hoti.
However, if others do not accept that story, there is no breach of the path of action; it occurs only when frivolous talk is accepted by others.
Nếu người khác không chấp nhận lời nói đó thì không có sự vi phạm nghiệp đạo, nhưng nếu người khác chấp nhận lời nói vô ích thì có sự vi phạm.
Abhijjhābyāpādamicchādiṭṭhiyoti ettha parasampattiṃ abhimukhaṃ jhāyatīti abhijjhā, parasampattīsu lobho.
In abhijjhābyāpādamicchādiṭṭhiyo (covetousness, ill-will, wrong view), looking towards the prosperity of others is abhijjhā (covetousness), which is greed for the prosperity of others.
Trong tham lam, ác ý và tà kiến, tham lam là sự mong muốn tài sản của người khác, tức là lòng tham đối với tài sản của người khác.
Sā pana ‘‘aho vata idaṃ mamassā’’ti evaṃ parabhaṇḍābhijjhāyanalakkhaṇā.
This is characterized by coveting the belongings of others, saying, "Oh, if only this were mine!"
Tham lam đó có đặc điểm là mong muốn tài sản của người khác, chẳng hạn như: “Ôi, ước gì cái này là của mình!”
Adinnādānaṃ viya appasāvajjā mahāsāvajjā ca.
Like taking what is not given, it is of minor or major offense.
Nó có thể ít tội lỗi hoặc nhiều tội lỗi, giống như trộm cắp.
Tassā dve sambhārā – parabhaṇḍaṃ, attano pariṇāmanañca.
It has two constituents: the belongings of others, and one's own appropriation of them.
Nó có hai yếu tố cấu thành: tài sản của người khác, và sự chuyển đổi thành của mình.
Parabhaṇḍavatthuke hi lobhe uppannepi na tāva kammapathabhedo hoti, yāva ‘‘aho vata idaṃ mamassā’’ti attano na pariṇāmeti.
For even when greed arises concerning the belongings of others, there is no breach of the path of action until one appropriates it, saying, "Oh, if only this were mine!"
Thật vậy, ngay cả khi lòng tham phát sinh đối với tài sản của người khác, thì vẫn chưa có sự vi phạm nghiệp đạo cho đến khi người đó mong muốn: “Ôi, ước gì cái này là của mình!” và chuyển đổi nó thành của mình.
Yathābhuccagahaṇābhāvena micchā passatīti micchādiṭṭhi.
Seeing wrongly due to the absence of grasping things as they really are is micchādiṭṭhi (wrong view).
Do không nắm bắt được sự thật mà nhìn sai lệch nên gọi là tà kiến.
Sā ‘‘natthi dinna’’ntiādinā nayena viparītadassanalakkhaṇā.
This is characterized by perverted seeing in the manner of "there is no giving," and so on.
Nó có đặc điểm là sự nhìn nhận sai lệch, theo cách như: “Không có bố thí,” v.v.
Samphappalāpo viya appasāvajjā mahāsāvajjā ca.
Like frivolous talk, it is of minor or major offense.
Nó có thể ít tội lỗi hoặc nhiều tội lỗi, giống như lời nói vô ích.
Apica aniyatā appasāvajjā, niyatā mahāsāvajjā.
Moreover, indefinite (wrong view) is of minor offense, while definite (wrong view) is of major offense.
Hơn nữa, tà kiến bất định thì ít tội lỗi, tà kiến cố định thì nhiều tội lỗi.
Tassa dve sambhārā – vatthuno gahitākāraviparītatā, yathā ca taṃ gaṇhāti, tathābhāvena tassupaṭṭhānanti.
It has two constituents: the perversion of the grasped aspect of the object, and its presentation in the way one grasps it.
Nó có hai yếu tố cấu thành: sự sai lệch trong cách nắm bắt đối tượng, và sự xuất hiện của đối tượng theo cách mà người đó nắm bắt.
Tattha natthikāhetukaaariyadiṭṭhīhi eva kammapathabhedo hoti.
There, the breach of the path of action occurs only through annihilationist, non-causal, and nihilistic views.
Ở đây, chỉ có tà kiến hư vô, tà kiến vô nhân và tà kiến vô hành mới tạo thành nghiệp đạo.
6. Ayaṃ lokatantīti ayaṃ vuḍḍhānaṃ abhivādanādikiriyālakkhaṇā lokappaveṇī.
6. Ayaṃ lokatantī means this worldly custom characterized by acts like saluting elders.
6. Ayaṃ lokatantī (truyền thống thế gian này) là truyền thống thế gian có đặc điểm là các hành vi như chào hỏi người lớn tuổi.
Anāgāmibrahmānaṃ alaṅkārādīsu anāgāmibhikkhūnañca cīvarādīsu nikantivasena rāguppatti hotīti anāgāmimaggena pañcakāmaguṇikarāgasseva pahānaṃ veditabbanti āha ‘‘pañcakāmaguṇikarāgassā’’ti.
Desiring to show that attachment for the five sense pleasures is abandoned only by the Anāgāmi path because attachment arises in Anāgāmi brahmās for ornaments, etc., and in Anāgāmi bhikkhus for robes, etc., he says "pañcakāmaguṇikarāgassa" (attachment for the five sense pleasures).
Do sự phát sinh của tham ái dưới hình thức ham muốn đối với các vật trang sức, v.v., của các Phạm thiên Bất Hoàn, và đối với y phục, v.v., của các Tỳ-kheo Bất Hoàn, nên cần phải biết rằng con đường Bất Hoàn chỉ đoạn trừ tham ái liên quan đến năm dục trần, vì vậy Ngài nói ‘‘tham ái liên quan đến năm dục trần’’.
Rūpādīsu pañcasu kāmaguṇesu vatthukāmakoṭṭhāsesu uppajjamāno rāgo ‘‘pañcakāmaguṇikarāgo’’ti veditabbo.
The attachment arising in the five sense pleasure objects like sights, etc., should be understood as "pañcakāmaguṇikarāgo."
Tham ái phát sinh trong năm dục trần như sắc, v.v., tức là trong các phần của dục cảnh, cần được hiểu là ‘‘tham ái liên quan đến năm dục trần’’.
Koṭṭhāsavacano hettha guṇasaddo ‘‘vayoguṇā anupubbaṃ jahantī’’tiādīsu (saṃ. ni. 1.4) viya.
Here, the word guṇa means 'part', as in phrases like "vayoguṇā anupubbaṃ jahantī" (the parts of life gradually depart).
Ở đây, từ guṇa có nghĩa là ‘‘phần’’, giống như trong các câu ‘‘các phần của tuổi tác dần dần rời bỏ’’ v.v. (Saṃ. Ni. 1.4).
Dvīsu akusalacittesūti domanassasahagatesu dvīsu akusalacittesu.
Dvīsu akusalacittesu (in the two unwholesome minds) means in the two unwholesome minds accompanied by displeasure.
Dvīsu akusalacittesu (trong hai tâm bất thiện) là trong hai tâm bất thiện tương ưng với ưu.
Mohassa sabbākusalasādhāraṇattā āha ‘‘sabbākusalasambhavassā’’ti.
Since delusion is common to all unwholesome states, he says "sabbākusalasambhavassā" (of what arises from all unwholesome states).
Vì si mê là phổ biến cho tất cả các bất thiện, nên Ngài nói ‘‘phát sinh từ tất cả các bất thiện’’.
Avasesānanti sakkāyadiṭṭhiādīnaṃ.
Avasesāna (of the remaining) refers to views like sakkāyadiṭṭhi.
Avasesānaṃ (của những cái còn lại) là của những cái như tà kiến thân kiến, v.v.
7. Jigucchati maññeti ‘‘ahamabhijāto rūpavā paññavā, kathaṃ nāma aññesaṃ abhivādanādiṃ kareyya’’nti jigucchati viya jigucchatīti vā sallakkhemi.
7. Jigucchati maññe (I think he despises) means that he despises as if saying, "I am of noble birth, handsome, and wise; how can I perform acts like saluting others?" or so I observe.
7. Jigucchati maññe (tôi nghĩ là ghê tởm) hoặc tôi nhận thấy rằng người đó ghê tởm như thể người đó ghê tởm, nghĩ rằng: ‘‘Ta là người cao quý, có hình tướng đẹp đẽ, có trí tuệ, làm sao có thể chào hỏi người khác, v.v.!’’
Akosallasambhūtaṭṭhenāti aññāṇasambhūtaṭṭhena.
Akosallasambhūtaṭṭhenā (due to being born of unskillfulness) means due to being born of ignorance.
Akosallasambhūtaṭṭhenā (do phát sinh từ sự thiếu khéo léo) là do phát sinh từ sự vô minh.
Akusale dhamme jigucchamāno tesaṃ samaṅgībhāvampi jigucchatīti vuttaṃ ‘‘akusalānaṃ dhammānaṃ samāpattī’’ti.
It is stated "akusalānaṃ dhammānaṃ samāpattī" (entering into unwholesome states) because one who despises unwholesome states also despises being endowed with them.
Người nào ghê tởm các pháp bất thiện thì cũng ghê tởm sự đồng hành với chúng, vì vậy đã nói ‘‘sự đồng hành với các pháp bất thiện’’.
Samāpattīti etasseva vevacanaṃ samāpajjanā samaṅgibhāvoti.
Samāpattī has the same meaning as samāpajjanā and samaṅgibhāvo.
Samāpattī (sự đồng hành) là từ đồng nghĩa với samāpajjanā samaṅgibhāvo (sự nhập vào, sự đồng hành).
Maṇḍanakajātiyoti maṇḍanasabhāvo, maṇḍanasīloti attho.
Maṇḍanakajātiyo means having the nature of adorning, or being accustomed to adorning.
Maṇḍanakajātiyo (bản chất trang sức) có nghĩa là bản chất của sự trang sức, tức là có thói quen trang sức.
Jegucchitanti jigucchanasīlataṃ.
Jegucchitaṃ means the habit of despising.
Jegucchitaṃ (sự ghê tởm) là bản chất của sự ghê tởm.
8. Lokajeṭṭhakakammanti loke jeṭṭhakānaṃ kattabbakammaṃ, loke vā seṭṭhasammataṃ kammaṃ.
8. Lokajeṭṭhakakammaṃ (the foremost action in the world) means the action to be done by the foremost in the world, or the action considered supreme in the world.
8. Lokatṭhakakammaṃ (nghiệp của người lớn trong thế gian) là nghiệp mà những người lớn tuổi trong thế gian nên làm, hoặc là nghiệp được coi là cao quý nhất trong thế gian.
Tatrāti yathāvuttesu dvīsupi atthavikappesu.
Tatrā (there) means in both of the aforementioned interpretations of meaning.
Tatrā (trong đó) là trong cả hai cách giải thích ý nghĩa đã nói.
Padābhihito attho padattho, byañjanatthoti vuttaṃ hoti.
The meaning denoted by a word is padattho; it means the meaning of the expression.
Ý nghĩa được diễn đạt bằng từ ngữ là padattho (nghĩa của từ), tức là nghĩa của văn tự.
Vinayaṃ vā arahatīti ettha vinayanaṃ vinayo, niggaṇhananti attho.
In vinayaṃ vā arahatī (or deserves discipline), vinayana is vinayo, meaning suppression.
Trong Vinayaṃ vā arahatī (hoặc xứng đáng với Vinaya), vinayanaṃ là vinayo, nghĩa là sự chế ngự.
Tenāha ‘‘niggahaṃ arahatīti vuttaṃ hotī’’ti.
Therefore, he says "niggahaṃ arahatīti vuttaṃ hotī" (it means 'deserves suppression').
Vì vậy, Ngài nói ‘‘có nghĩa là xứng đáng với sự chế ngự’’.
Nanu ca paṭhamaṃ vuttesu dvīsupi atthavikappesu sakatthe arahatthe ca bhaddhitapaccayo saddalakkhaṇato dissati, na pana ‘‘vinayāya dhammaṃ desetī’’ti imasmiṃ atthe, tasmā kathamettha taddhitapaccayoti āha ‘‘vicitrā hi taddhitavuttī’’ti.
But in the two aforementioned interpretations of meaning (inherent meaning and 'deserves' meaning), the taddhita suffix is seen grammatically, but not in the meaning of "teaches Dhamma for discipline." Therefore, how is there a taddhita suffix here? He says "vicitrā hi taddhitavuttī" (for the function of taddhita is varied).
Chẳng phải trong cả hai cách giải thích ý nghĩa được nói đến trước đó, tức là nghĩa sở hữu và nghĩa xứng đáng, thì hậu tố taddhita được thấy theo đặc điểm ngữ pháp, nhưng không phải trong nghĩa ‘‘giảng pháp để chế ngự’’ này sao? Vậy thì làm thế nào có hậu tố taddhita ở đây? Ngài nói ‘‘thật vậy, cách dùng taddhita rất đa dạng’’.
Vicitratā cettha lokappamāṇato veditabbā.
Its varied nature here should be understood from common usage.
Sự đa dạng ở đây cần được hiểu theo chuẩn mực của thế gian.
Tathā hi yasmiṃ yasmiṃ atthe taddhitappayogo lokassa, tattha tattha taddhitavutti lokato siddhāti vicitrā taddhitavutti.
Thus, wherever the taddhita usage occurs in popular speech, there the function of taddhita is established by popular usage, hence the taddhita function is varied.
Thật vậy, trong bất kỳ nghĩa nào mà thế gian sử dụng hậu tố taddhita, thì cách dùng taddhita ở đó được xác lập từ thế gian, do đó cách dùng taddhita rất đa dạng.
Tasmā yathā ‘‘mā saddamakāsī’’ti vadanto ‘‘māsaddiko’’ti vuccati, evaṃ vinayāya dhammaṃ desetīti venayikoti vuccatīti adhippāyo.
Therefore, just as one who says "Do not make a sound" is called "māsaddiko" (one who makes no sound), so too, one who teaches Dhamma for discipline is called "venayiko" (disciplinarian) – this is the intention.
Vì vậy, giống như người nói ‘‘đừng tạo ra tiếng ồn’’ được gọi là ‘‘māsaddiko’’ (người tạo tiếng ồn), thì người giảng pháp để chế ngự cũng được gọi là venayiko, đó là ý nghĩa.
10. Devalokagabbhasampattiyāti vatvā ṭhapetvā bhummadeve sesesu devesu gabbhaggahaṇassa abhāvato paṭisandhiyevettha gabbhasampattīti veditabbāti vuttamevatthaṃ vivaritvā dassento āha ‘‘devalokapaṭisandhipaṭilābhāya saṃvattatī’’ti.
10. Having said "devalokagabbhasampattiyā" (by the attainment of rebirth in the divine realm), since rebirth (womb-taking) does not exist for devas other than earth-bound devas, it should be understood that here gabbhasampattī means paṭisandhi itself. Explaining the same point, he says "devalokapaṭisandhipaṭilābhāya saṃvattatī" (it leads to the attainment of rebirth in the divine realm).
10. Sau khi nói Devalokagabbhasampattiyā (sự thành tựu của việc tái sinh trong cõi trời), để làm rõ ý nghĩa đã nói rằng không có sự tái sinh trong thai bào đối với các vị trời còn lại ngoại trừ các vị trời sống trên đất, và sự tái sinh ở đây được hiểu là sự thành tựu của thai bào, Ngài nói ‘‘dẫn đến sự đạt được tái sinh trong cõi trời’’.
Assāti abhivādanādisāmīcikammassa.
Assā refers to the respectful actions such as salutation.
Assā (của điều này) là của các hành vi thích hợp như chào hỏi.
Mātukucchismiṃ paṭisandhiggahaṇe dosaṃ dassentoti mātito aparisuddhabhāvaṃ dassento, akkositukāmassa dāsiyā puttoti dāsikucchismiṃ nibbattabhāve dosaṃ dassetvā akkosanaṃ viya bhagavato mātukucchismiṃ paṭisandhiggahaṇe dosaṃ dassetvā akkosantopi evamāhāti adhippāyo.
The phrase " showing a fault in conceiving in the mother's womb" means showing an impure state from the mother, like reviling someone by saying "son of a slave girl," showing the fault of being born in a slave girl's womb. Thus, the intention is that even one reviling the Blessed One by showing a fault in his conception in the mother's womb speaks in this way.
Khi chỉ ra lỗi trong việc thọ sinh trong bụng mẹ là khi chỉ ra sự không thanh tịnh từ mẹ; ý nghĩa là, giống như việc một người muốn mắng chửi nói "con của tớ gái" để chỉ ra lỗi của việc sinh ra trong bụng tớ gái rồi mắng chửi, thì người mắng chửi Đức Thế Tôn bằng cách chỉ ra lỗi trong việc thọ sinh trong bụng mẹ của Ngài cũng nói như vậy.
Gabbhatoti devalokapaṭisandhito.
" From the womb" means from conception in the deva-world.
Gabbhato (từ thai) là từ sự thọ sinh ở cõi trời.
Tenevāha ‘‘abhabbo devalokūpapattiṃ pāpuṇitunti adhippāyo’’ti.
Therefore, he says, "The intention is that he is incapable of attaining rebirth in the deva-world."
Do đó,* nói: "Ý nghĩa là không thể đạt được sự tái sinh ở cõi trời."
Hīno vā gabbho assāti apagabbhoti imassa viggahassa ekena pariyāyena adhippāyaṃ dassento āha ‘‘devalokagabbhaparibāhirattā āyatiṃ hīnagabbhapaṭilābhabhāgītī’’ti.
Explaining the meaning of the analysis " or the womb is base, hence apagabbho" in one way, he says, "Being excluded from conception in the deva-world, he will in the future partake in acquiring a base conception."
Hīno vā gabbho assāti apagabbho (hoặc là thai kém cỏi, nên không có thai): Khi chỉ ra ý nghĩa của từ này theo một cách giải thích,* nói: "Vì bị loại trừ khỏi thai ở cõi trời, nên trong tương lai sẽ có phần nhận được thai kém cỏi."
Iti-saddā e hetuattho, yasmā āyatimpi hīnagabbhapaṭilābhabhāgī, tasmā hīno vā gabbho assāti apagabbhoti adhippāyo.
The word iti here means "because." Since he will in the future partake in acquiring a base conception, therefore "or the womb is base, hence apagabbho"—this is the intention.
Từ "iti" ở đây có nghĩa là nguyên nhân; bởi vì trong tương lai cũng có phần nhận được thai kém cỏi, nên ý nghĩa là, hoặc là thai kém cỏi, nên không có thai.
Puna tasseva viggahassa kodhavasena…pe… dassentoti heṭṭhā vuttanayassa anurūpaṃ katvā adhippāyaṃ dassento āha ‘‘hīno vāssa mātukucchismiṃ gabbhavāso ahosīti adhippāyo’’ti.
Again, explaining the meaning of the same analysis in accordance with the method stated earlier, with reference to " out of anger... etc. ...showing," he says, "The intention is that his dwelling in the mother's womb was base."
Lại nữa, khi chỉ ra ý nghĩa của cùng một từ đó theo cách tương ứng với cách đã nói ở trên, do sự tức giận…pe… chỉ ra,* nói: "Ý nghĩa là, hoặc là sự cư trú trong thai mẹ của người ấy là kém cỏi."
Gabbha-saddo atthi mātukucchipariyāyo ‘‘gabbhe vasati māṇavo’’tiādīsu (jā. 1.15.363) viya.
The word gabbha has the meaning of a mother's womb, as in "the child dwells in the womb" and so forth.
Từ gabbha (thai) có nghĩa là bụng mẹ, như trong các đoạn "gabbhe vasati māṇavo" (đứa trẻ cư trú trong thai) v.v.
Atthi mātukucchismiṃ nibbattasattapariyāyo ‘‘antamaso gabbhapātanaṃ upādāyā’’tiādīsu (mahāva. 129) viya.
It also has the meaning of a being born in the mother's womb, as in "down to procuring an abortion" and so forth.
Nó cũng có nghĩa là chúng sinh được sinh ra trong bụng mẹ, như trong các đoạn "antamaso gabbhapātanaṃ upādāyā" (thậm chí đến việc phá thai) v.v.
Tattha mātukucchipariyāyaṃ gahetvā atthaṃ dassento āha ‘‘anāgate gabbhaseyyā’’ti.
Here, taking the meaning of a mother's womb, he explains the meaning as " future womb-lying."
Ở đây, khi lấy nghĩa là bụng mẹ để chỉ ra ý nghĩa,* nói: "sự nằm trong thai trong tương lai."
Gabbhe seyyā gabbhaseyyā.
Lying in the womb is womb-lying (gabbhaseyyā).
Sự nằm trong thai là gabbhaseyyā.
Anuttarena maggenāti aggamaggena.
" By the unsurpassed path" means by the foremost path.
Anuttarena maggenā (bằng con đường vô thượng) là bằng con đường tối thượng.
Kammakilesānaṃ maggena vihatattā āha ‘‘vihatakāraṇattā’’ti.
Because it is destroyed by the path of kamma and defilements, he says, " due to being a cause of destruction."
Vì bị loại bỏ bởi con đường của nghiệp và phiền não,* nói: "do nhân loại bỏ."
Itarā tissopīti aṇḍajasaṃsedajaopapātikā.
" The other three" are egg-born, moisture-born, and spontaneously-arising.
Itarā tissopī (ba loại khác) là noãn sinh, thấp sinh, hóa sinh.
Ettha ca yadipi ‘‘apagabbho’’ti imassa anurūpato gabbhaseyyā eva vattabbā, pasaṅgato pana labbhamānaṃ sabbampi vattuṃ vaṭṭatīti punabbhavābhinibbattipi vuttāti veditabbā.
And here, although only gabbhaseyyā (womb-lying) should be stated in accordance with apagabbho (not womb-born), it should be understood that since everything obtainable by implication can be stated, rebirth has also been mentioned.
Ở đây, mặc dù theo sự tương ứng của "apagabbho" (không có thai) thì chỉ nên nói về sự nằm trong thai, nhưng vì có thể nói tất cả những gì có thể đạt được do sự liên quan, nên cũng nói về sự tái sinh trong các kiếp sau, cần phải hiểu như vậy.
Idāni sattapariyāyassa gabbhasaddassa vasena viggahanānattaṃ dassento āha ‘‘apicā’’tiādi.
Now, showing the variety of analysis based on the word gabbha in the sense of "being," he says, " Moreover," and so forth.
Bây giờ, khi chỉ ra sự đa dạng của cách giải thích theo nghĩa của từ "gabbha" (thai) với nghĩa là chúng sinh,* nói: "apicā" (hơn nữa) v.v.
Imasmiṃ pana vikappe gabbhaseyyā punabbhavābhinibbattīti ubhayampi gabbhaseyyavaseneva vuttantipi vadanti.
But in this alternative, some also say that both " womb-lying and rebirth" are stated only in the sense of womb-lying.
Tuy nhiên, trong cách giải thích này, một số người nói rằng cả gabbhaseyyā (sự nằm trong thai) và punabbhavābhinibbattī (sự tái sinh trong kiếp sau) đều được nói theo nghĩa của sự nằm trong thai.
Nanu ca ‘‘āyatiṃ gabbhaseyyā pahīnā’’ti (pārā. 10) vuttattā gabbhassa seyyā eva pahīnā, na pana gabbhoti āpajjatīti āha ‘‘yathā cā’’tiādi.
"But since it is stated 'future womb-lying is abandoned,' it follows that only the lying of the womb is abandoned, not the womb itself"—to this, he says, " And just as..." and so forth.
Chẳng phải vì đã nói "āyatiṃ gabbhaseyyā pahīnā" (sự nằm trong thai trong tương lai đã bị đoạn trừ) nên chỉ có sự nằm trong thai bị đoạn trừ, chứ không phải thai bị đoạn trừ sao? Do đó,* nói: "yathā cā" (cũng như) v.v.
Atha ‘‘abhinibbattī’’ti ettakameva avatvā punabbhavaggahaṇaṃ kimatthanti āha ‘‘abhinibbatti ca nāmā’’tiādi.
Then, without just saying "rebirth," why is the term "repeated existence" (punabbhava) used? To this, he says, " And rebirth" and so forth.
Vậy tại sao không chỉ nói "abhinibbatti" (sự tái sinh) mà lại thêm từ "punabbhava" (kiếp sau)? Do đó,* nói: "abhinibbatti ca nāmā" (và sự tái sinh) v.v.
Apunabbhavabhūtāti khaṇe khaṇe uppajjamānānaṃ dhammānaṃ abhinibbatti.
" Non-repeated existence" refers to the arising of phenomena moment by moment.
Apunabbhavabhūtā (không phải là sự tái sinh trong kiếp sau) là sự tái sinh của các pháp sinh khởi từng sát na.
11. Dhammadhātunti ettha dhamme anavasese dhāreti yāthāvato upadhāretīti dhammadhātu, dhammānaṃ yathāsabhāvato avabujjhanasabhāvo, sabbaññutaññāṇassetaṃ adhivacanaṃ.
In " dhammadhātu" (Dhamma-element), it is dhammadhātu because it upholds all dhammas completely and comprehends them truly, meaning the nature of comprehending dhammas as they are; this is a designation for the omniscience (sabbaññutaññāṇa).
11. Dhammadhātuṃ (pháp giới): Ở đây, "dhammadhātu" là nơi chứa đựng (dhāreti) tất cả các pháp một cách không sót, quán sát chúng một cách chân thực; đó là bản chất của sự hiểu biết các pháp theo đúng bản chất của chúng, đây là một tên gọi khác của Tuệ Toàn Tri (sabbaññutaññāṇa).
Paṭivijjhitvāti sacchikatvā, paṭilabhitvāti attho, paṭilābhahetūti vuttaṃ hoti.
" Having penetrated" means having realized, having attained; it is said to be the cause of attainment.
Paṭivijjhitvā (thâm nhập) là chứng ngộ, đạt được; ý nghĩa là, đã được nói là nguyên nhân của sự đạt được.
Desanāvilāsappatto hotīti rucivasena parivattetvā desetuṃ samatthatā desanāvilāso, taṃ patto adhigatoti attho.
" Attains eloquence in teaching" means the ability to teach by varying it according to one's wish is eloquence in teaching (desanāvilāsa); reaching that means having attained it.
Desanāvilāsappatto hotī (đạt được sự khéo léo trong thuyết pháp) là khả năng thuyết pháp bằng cách xoay chuyển theo ý muốn, đó là sự khéo léo trong thuyết pháp; ý nghĩa là đã đạt được điều đó.
Karuṇāvipphāranti sabbasattesu mahākaruṇāya pharaṇaṃ.
" Pervasion of compassion" means the pervading of great compassion towards all beings.
Karuṇāvipphāraṃ (sự lan tỏa của lòng bi mẫn) là sự lan tỏa của đại bi đối với tất cả chúng sinh.
Tādiguṇalakkhaṇameva puna upamāya vibhāvetvā dassento āha ‘‘pathavīsamacittata’’nti.
Again, illustrating that quality and characteristic with a simile, he says, " an attitude like the earth."
Khi làm rõ lại đặc điểm của phẩm chất đó bằng một ví dụ,* nói: "pathavīsamacittataṃ" (tâm bình đẳng như đất).
Yathā pathavī suciasucinikkhepachedanabhedanādīsu na vikampati, anurodhavirodhaṃ na pāpuṇāti, evaṃ iṭṭhāniṭṭhesu lābhālābhādīsu anurodhavirodhappahānato avikampitacittatāya pathavīsamacittatanti attho.
Just as the earth does not waver or incline towards favor or disfavor when pure or impure things are deposited, cut, or broken, similarly, " an attitude like the earth" means a mind unperturbed by the abandonment of favor and disfavor regarding agreeable and disagreeable things, gains and losses, and so forth.
Ý nghĩa là, giống như đất không rung động trước việc đổ những thứ sạch hay dơ, cắt hay đập v.v., không bị ảnh hưởng bởi sự thuận hay nghịch, thì việc tâm không rung động do loại bỏ sự thuận hay nghịch đối với những điều đáng ưa hay không đáng ưa, được và mất v.v., chính là tâm bình đẳng như đất.
Akuppadhammatanti ettha ‘‘akuppadhammo nāma phalasamāpattī’’ti tīsupi gaṇṭhipadesu vuttaṃ.
Here, in " akuppadhammatā" (immutability), it is stated in all three glossaries that "immutable is the attainment of fruition."
Akuppadhammataṃ (bản chất bất động): Ở đây, trong cả ba Gaṇṭhipada (chú giải từ khó) đều nói rằng "akuppadhammo" (pháp bất động) là phalasamāpatti (thành tựu quả vị).
‘‘Paresu pana akkosantesupi attano pathavīsamacittatālakkhaṇaṃ akujjhanasabhāvatanti evamettha attho gahetabbo’’ti amhākaṃ khanti.
However, our conviction is that "even when others revile, one's own nature of not becoming angry, characterized by an attitude like the earth"—this is the meaning to be taken here.
"Tuy nhiên, theo ý kiến của chúng tôi, ở đây cần hiểu ý nghĩa là bản chất không tức giận, đặc điểm của tâm bình đẳng như đất của mình ngay cả khi người khác mắng chửi."
Jarāya anusaṭanti jarāya paliveṭhitaṃ.
" Enveloped by old age" means surrounded by old age.
Jarāya anusaṭaṃ (bị già yếu bao phủ) là bị tuổi già quấn lấy.
Vaṭṭakhāṇubhūtanti anekesaṃ anayabyasanānaṃ nipātalakkhaṇatthambhabhūtatāya saṃsārakhāṇubhūtaṃ.
" Become a stump in the cycle of existence" means having become a stump of saṃsāra due to being a pillar characterized by the descent of many misfortunes and calamities.
Vaṭṭakhāṇubhūtaṃ (trở thành cọc trụ của vòng luân hồi) là trở thành cọc trụ của vòng luân hồi, vì là trụ cột mang đặc tính của sự rơi vào vô số tai họa và bất hạnh.
Brāhmaṇassa vuḍḍhatāya āsannavuttimaraṇanti sambhāvanavasena ‘‘ajja maritvā’’tiādi vuttaṃ.
Due to the brahmin's old age, impending death is likely, hence " dying today" and so forth are stated as a supposition.
"Ajja maritvā" (chết hôm nay) v.v. được nói theo nghĩa khả năng, do ông Bà-la-môn đã già nên cái chết đã cận kề.
Mahantena kho pana ussāhenāti ‘‘sādhu kho pana tathārūpānaṃ arahataṃ dassanaṃ hotī’’ti evaṃ sañjātamahussāhena.
" With great zeal" means with great zeal arisen, thinking, "Indeed, it is good to see such Arahants."
Mahantena kho pana ussāhenā (với sự nỗ lực lớn) là với sự nỗ lực lớn đã phát sinh như "thật tốt lành khi được thấy các vị A-la-hán như vậy."
Appaṭisamaṃ purejātabhāvanti anaññasādhāraṇaṃ purejātabhāvaṃ.
" Incomparable prior existence" means a prior existence not shared by others.
Appaṭisamaṃ purejātabhāvaṃ (bản chất sinh trước không ai sánh bằng) là bản chất sinh trước không ai khác có được.
Natthi etassa paṭisamoti appaṭisamo, purejātabhāvo.
There is no equal to this, hence " incomparable" refers to the prior existence.
Không có gì sánh bằng với điều này, đó là appaṭisamo (không ai sánh bằng), bản chất sinh trước.
‘‘Apī’’ti avatvā ‘‘pī’’ti vadanto pi-saddopi visuṃ atthi nipātoti dasseti.
By saying " pī" instead of " apī," he shows that the word pi also exists as a separate particle.
Khi nói "pī" mà không nói "apī",* chỉ ra rằng từ "pi" cũng là một tiểu từ riêng biệt.
Sambhāvanattheti ‘‘api nāmevaṃ siyā’’ti vikappanattho sambhāvanattho, tasmiṃ jotakatāya pisaddo vattati.
" In the sense of possibility" means the hypothetical meaning "might it be so?" is the meaning of possibility, and the word pi is used to indicate this.
Sambhāvanatthe (với nghĩa khả năng): "api nāmevaṃ siyā" (có thể là như vậy) là nghĩa của sự suy đoán, khả năng; từ "pi" được dùng để chỉ điều đó.
Vacanasiliṭṭhatāyāti vacanassa madhurabhāvatthaṃ, mudubhāvatthanti attho.
" For the smoothness of expression" means for the sweetness of expression, for the softness of expression.
Vacanasiliṭṭhatāya (vì sự mềm mại của lời nói) là vì sự ngọt ngào của lời nói, ý nghĩa là vì sự dịu dàng.
Evañhi loke siliṭṭhavacanaṃ hotīti evaṃ ekameva gaṇanaṃ avatvā aparāya gaṇanāya saddhiṃ vacanaṃ loke siliṭṭhavacanaṃ hoti yathā ‘‘dve vā tīṇi vā udakaphusitānī’’ti.
" For thus in the world, expression is smooth"—thus, without stating a single number, an expression combined with another number becomes smooth in the world, like "two or three drops of water."
Evañhi loke siliṭṭhavacanaṃ hotī (vì vậy, trong đời, lời nói trở nên mềm mại) là, khi không chỉ nói một số lượng mà nói cùng với một số lượng khác, lời nói trở nên mềm mại trong đời, như "dve vā tīṇi vā udakaphusitānī" (hai hoặc ba giọt nước).
Sammā adhisayitānīti pādādīhi attanā nesaṃ kiñci upaghātaṃ akarontiyā bahivātādiparissayaparihāratthaṃ sammadeva upari sayitāni.
" Duly brooded over" means properly sat upon from above, without causing any harm to them with feet and so forth, in order to guard them against dangers like external winds.
Sammā adhisayitānī (được ấp ủ một cách đúng đắn) là được ấp ủ một cách đúng đắn ở phía trên để tránh các nguy hiểm như gió bên ngoài v.v., mà không gây ra bất kỳ tổn hại nào cho chúng bằng chân v.v.
Upariattho hettha adhi-saddo.
Here, the prefix adhi means "above."
Ở đây, từ adhi có nghĩa là ở phía trên.
Utuṃ gaṇhāpentiyāti tesaṃ allasinehapariyādānatthaṃ attano kāyusmāvasena utuṃ gaṇhāpentiyā.
" Making them absorb heat" means making them absorb heat from her body, for the purpose of drying up their moisture and oil.
Utuṃ gaṇhāpentiyā (khi làm cho có hơi ấm) là khi làm cho có hơi ấm từ cơ thể của mình để làm khô chất ẩm và dầu của chúng.
Tenāha ‘‘usmīkatānī’’ti.
Therefore, he says, " warmed."
Do đó,* nói: "usmīkatānī" (được làm ấm).
Sammā paribhāvitānīti sammadeva sabbaso kukkuṭavāsanāya vāsitāni.
" Duly imbued" means thoroughly imbued all over with the smell of the hen.
Sammā paribhāvitānī (được làm thấm nhuần một cách đúng đắn) là được làm thấm nhuần hoàn toàn bằng mùi gà một cách đúng đắn.
Tenāha ‘‘kukkuṭagandhaṃ gāhāpitānī’’ti.
Therefore, he says, " made to acquire the smell of a hen."
Do đó,* nói: "kukkuṭagandhaṃ gāhāpitānī" (được làm cho có mùi gà).
Ettha ca sammā parisedanaṃ kukkuṭagandhaparibhāvanañca sammā adhisayananipphattiyā ānubhāvanipphāditanti daṭṭhabbaṃ.
And here, it should be understood that proper warming and imbuing with the hen's smell are brought about by the power of proper brooding.
Ở đây, cần phải thấy rằng việc ấp ủ đúng đắn và việc làm thấm nhuần mùi gà là do năng lực của việc ấp ủ đúng đắn mà thành tựu.
Sammā adhisayaneneva hi itaradvayaṃ ijjhati.
For it is by proper brooding that the other two are accomplished.
Thật vậy, chỉ bằng việc ấp ủ đúng đắn mà hai điều kia mới thành công.
Na hi sammā adhisayanato visuṃ sammā parisedanassa sammā paribhāvanassa ca karaṇaṃ atthi, tena pana saddhiṃyeva itaresaṃ dvinnampi ijjhanato vuttaṃ ‘‘evaṃ tīhi pakārehi tāni aṇḍāni paripāliyamānānī’’ti.
Indeed, there is no separate act of proper warming or proper imbuing apart from proper brooding; rather, since the other two are accomplished along with it, it is said, " Thus, those eggs being nurtured in three ways."
Không có việc ấp ủ đúng đắn riêng biệt nào khác ngoài việc ấp ủ đúng đắn và việc làm thấm nhuần đúng đắn; nhưng vì hai điều kia thành công cùng với điều đó, nên đã nói: "evaṃ tīhi pakārehi tāni aṇḍāni paripāliyamānānī" (như vậy, những quả trứng đó được chăm sóc bằng ba cách).
Nakhasikhāti nakhaggāni.
" Nakhasikhā" means claw-tips.
Nakhasikhā (móng nhọn) là đầu móng.
Mukhatuṇḍakanti mukhaggaṃ.
" Mukhatuṇḍaka" means beak-tip.
Mukhatuṇḍakaṃ (mỏ) là đầu mỏ.
Kapālassa tanukattāti ettha yathā kapālassa tanutā ālokassa anto paññāyamānassa kāraṇaṃ, tathā kapālassa tanutāya nakhasikhāmukhatuṇḍakānaṃ kharatāya ca allasinehapariyādānaṃ kāraṇavacananti daṭṭhabbaṃ.
Here, in " due to the thinness of the shell," just as the thinness of the shell is the cause for the light to be perceived inside, similarly, it should be understood that the thinness of the shell and the sharpness of the claw-tips and beak-tips are spoken of as the cause for the drying up of moisture and oil.
Kapālassa tanukattā (vì vỏ mỏng): Ở đây, cần phải thấy rằng cũng như sự mỏng manh của vỏ là nguyên nhân cho ánh sáng có thể nhìn thấy bên trong, thì sự mỏng manh của vỏ và sự sắc nhọn của móng và mỏ là nguyên nhân cho việc làm khô chất ẩm và dầu.
Saṅkuṭitahatthapādāti ettha hatthāti pakkhā.
Here, in " with contracted hands and feet," " hands" means wings.
Saṅkuṭitahatthapādā (tay chân co rút): Ở đây, hatthā (tay) là cánh.
Na hi kukkuṭānaṃ pakkhato añño hattho nāma atthi.
For chickens have no "hands" other than their wings.
Thật vậy, gà không có tay nào khác ngoài cánh.
Etthāti ālokaṭṭhāne.
" Here" means in the place of light.
Etthā (ở đây) là ở nơi có ánh sáng.
Pakkhe vidhunantāti pakkhe cālentā.
"Shaking their wings" means moving their wings.
Pakkhe vidhunantā có nghĩa là làm cho cánh chuyển động.
Nikkhamantānanti niddhāraṇe sāmivacanaṃ, nikkhamantesūti attho.
The word nikkhamantānaṃ is a genitive case used for determination; the meaning is 'among those coming out'.
Nikkhamantānaṃ là từ ở cách sở hữu trong ý nghĩa xác định, nghĩa là trong số những kẻ ra khỏi.
So jeṭṭho iti assa vacanīyoti yo paṭhamataraṃ aṇḍakosato nikkhanto kukkuṭapotako, soyeva jeṭṭhoti vacanīyo assa, bhaveyyāti attho.
"He is to be called the elder" means whichever chick came out of the eggshell first, he is to be called the elder, that is the meaning.
So jeṭṭho iti assa vacanīyo có nghĩa là con gà con nào nở ra khỏi vỏ trứng trước tiên, chính con đó là bậc trưởng thượng, nên được nói như vậy, tức là sẽ là như vậy.
Sampaṭipādentoti saṃsandento.
"Making consistent" means comparing.
Sampaṭipādento có nghĩa là làm cho hòa hợp.
Tibhūmakapariyāpannāpi sattā avijjākosassa anto paviṭṭhā tattha tattha appahīnāya avijjāya veṭhitattāti āha ‘‘avijjākosassa anto paviṭṭhesu sattesū’’ti.
Even beings included in the three realms have entered within the eggshell of ignorance because they are enveloped by ignorance that has not been abandoned here and there; therefore, it says "among beings who have entered within the eggshell of ignorance".
Ngay cả chúng sinh thuộc ba cõi cũng đã đi vào bên trong vỏ trứng của vô minh, do bị vô minh chưa đoạn trừ ở khắp nơi bao bọc, nên nói ‘‘avijjākosassa anto paviṭṭhesu sattesu’’ (trong số những chúng sinh đã đi vào bên trong vỏ trứng của vô minh).
Aṇḍakosanti bījakapālaṃ.
"Eggshell" means the seed-case.
Aṇḍakosa có nghĩa là vỏ hạt.
Lokasannivāseti loko eva lokasannivāso.
"In the world's dwelling place" means the world itself is the world's dwelling place.
Lokasannivāse có nghĩa là thế gian chính là nơi trú ngụ của thế gian.
Sammāsambodhinti ettha sammāti aviparītattho, saṃ-saddo sāmanti imamatthaṃ dīpeti, tasmā sammā aviparītenākārena sayameva cattāri saccāni bujjhati paṭivijjhatīti sammāsambodhīti maggo vuccati.
In "Perfect Self-Awakening," the word sammā means 'unperverted'; the prefix saṃ signifies 'by oneself'. Therefore, the path is called Sammāsambodhi because one awakens and penetrates the four noble truths perfectly by oneself in an unperverted manner.
Trong từ Sammāsambodhi, sammā có nghĩa là không sai lệch; từ saṃ- biểu thị ý nghĩa tự thân. Do đó, Sammāsambodhi là con đường mà thông qua đó người ta tự mình giác ngộ và thấu đạt Tứ Thánh Đế một cách không sai lệch, nên được gọi là Sammāsambodhi.
Tenāha ‘‘sammā sāmañca bodhi’’nti, sammā sayameva ca bujjhanakanti attho.
Hence, it says "perfectly and by oneself awakening," meaning awakening perfectly and by oneself.
Vì vậy, nói ‘‘sammā sāmañca bodhi’’, nghĩa là tự mình giác ngộ một cách chân chính.
Sammāti vā pasatthavacano, saṃ-saddo sundaravacanoti āha ‘‘atha vā pasatthaṃ sundarañca bodhi’’nti.
Alternatively, sammā is a word of praise, and the prefix saṃ is a word for 'excellent', as it says, "or excellent and beautiful awakening".
Hoặc sammā là từ chỉ sự tán thán, từ saṃ- là từ chỉ sự tốt đẹp, nên nói ‘‘atha vā pasatthaṃ sundarañca bodhi’’ (hoặc là sự giác ngộ đáng tán thán và tốt đẹp).
Bodhisaddassa anekatthataṃ dassetvā idhādhippetamatthaṃ niddhāretvā dassetukāmo āha ‘‘bodhīti rukkhopi maggopī’’tiādi.
After showing the manifold meanings of the word bodhi and wishing to determine the meaning intended here, it says, "Bodhi means a tree or a path," and so on.
Sau khi chỉ ra nhiều nghĩa của từ Bodhi, muốn xác định ý nghĩa được đề cập ở đây, nên nói ‘‘bodhīti rukkhopi maggopī’’ (Bodhi là cây, cũng là con đường) v.v.
Tattha abujjhi etthāti rukkho bodhi.
Among these, it is called a tree bodhi because one awakened there.
Trong đó, nơi đây đã giác ngộ, nên cây là Bodhi.
Sayaṃ bujjhati, bujjhanti vā tena ariyāti maggo bodhi.
It is called a path bodhi because one awakens by oneself, or because the noble ones awaken by means of it.
Tự mình giác ngộ, hoặc các bậc Thánh giác ngộ nhờ nó, nên con đường là Bodhi.
Sabbadhamme sabbākārato bujjhati paṭivijjhatīti sabbaññutaññāṇaṃ bodhi.
Omniscience is bodhi because one awakens to and penetrates all phenomena in all aspects.
Giác ngộ và thấu đạt tất cả các pháp dưới mọi khía cạnh, nên Tuệ Toàn Tri là Bodhi.
Bujjhīyati sacchikarīyatīti nibbānaṃ bodhi.
Nibbāna is bodhi because it is awakened to and realized.
Được giác ngộ, được chứng đắc, nên Nibbāna là Bodhi.
Antarā ca bodhinti dutiyamudāharaṇaṃ vināpi rukkhasaddena bodhisaddassa rukkhe pavattidassanatthaṃ vuttaṃ.
"And between the Bodhi" is stated as a second example to show that the word bodhi refers to the tree even without the word 'tree'.
Antarā ca bodhi là ví dụ thứ hai được nói ra để chỉ rằng từ Bodhi có thể được dùng để chỉ cây mà không cần từ rukkhā.
Varabhūrimedhasoti mahāpathavī viya patthaṭavarapaññoti attho.
"Of supreme vast wisdom" means one whose supreme wisdom is spread out like the great earth.
Varabhūrimedhaso có nghĩa là bậc có tuệ giác thù thắng rộng lớn như đại địa.
Asabbaguṇadāyakattāti sabbaguṇānaṃ adāyakattā.
"Because of not giving all good qualities" means because of not giving all good qualities.
Asabbaguṇadāyakattā có nghĩa là không ban cho tất cả các phẩm chất.
Sabbaguṇe na dadātīti hi asabbaguṇadāyako, ayuttasamāsoyaṃ gamakattā yathā ‘‘asūriyaṃpassāni mukhānī’’ti.
Indeed, one who does not give all good qualities is a "not-all-good-quality-giver"; this is an unsuited compound, but acceptable due to its expressiveness, like "faces that do not see the sun."
Không ban cho tất cả các phẩm chất, nên là asabbaguṇadāyako. Đây là một hợp từ không phù hợp nhưng được chấp nhận vì có ý nghĩa, giống như ‘‘asūriyaṃpassāni mukhānī’’ (những khuôn mặt không nhìn thấy mặt trời).
Tisso vijjāti upanissayavato saheva arahattaphalena tisso vijjā deti.
"The three knowledges": it grants the three knowledges, along with the fruit of arahantship, to one who has the prerequisite conditions.
Tisso vijjā (Ba minh) có nghĩa là ban ba minh cùng với quả A-la-hán cho người có nhân duyên.
Nanu cettha tīsu vijjāsu āsavakkhayañāṇassa maggapariyāpannattā kathametaṃ yujjati ‘‘maggo tisso vijjā detī’’ti?
But how is it suitable to say, "the path grants the three knowledges," when the knowledge of the destruction of the taints (āsavakkhayañāṇa) is included in the three knowledges, and itself is part of the path?
Há không phải trong ba minh này, tuệ tận lậu thuộc về con đường, vậy thì làm sao điều này lại phù hợp khi nói ‘‘con đường ban ba minh’’?
Nāyaṃ doso.
There is no fault here.
Đây không phải là lỗi.
Satipi āsavakkhayañāṇassa maggapariyāpannabhāve aṭṭhaṅgike magge sati maggañāṇena saddhiṃ tisso vijjā paripuṇṇā hontīti ‘‘maggo tisso vijjā detī’’ti vuccati.
Even though the knowledge of the destruction of the taints is included in the path, when there is the Noble Eightfold Path, the three knowledges become complete together with the knowledge of the path; thus, it is said, "the path grants the three knowledges."
Mặc dù tuệ tận lậu thuộc về con đường, nhưng khi có Bát Chánh Đạo, ba minh được viên mãn cùng với tuệ đạo, nên nói ‘‘con đường ban ba minh’’.
Cha abhiññāti etthāpi eseva nayo.
The same reasoning applies to "the six supernormal powers."
Trong Cha abhiññā (Sáu thắng trí) cũng theo cách này.
Sāvakapāramiñāṇanti aggasāvakehi paṭilabhitabbaṃ sabbameva lokiyalokuttarañāṇaṃ.
"Knowledge of a disciple's perfection" refers to all mundane and supramundane knowledge to be attained by the chief disciples.
Sāvakapāramiñāṇa có nghĩa là tất cả các loại tuệ thế gian và siêu thế mà các bậc Thượng Thủ Thanh Văn đạt được.
Paccekabodhiñāṇanti etthāpi imināva nayena attho veditabbo.
The meaning of "Paccekabodhi knowledge" should also be understood in the same way.
Trong Paccekabodhiñāṇa (Tuệ Độc Giác), ý nghĩa cũng phải được hiểu theo cách này.
Abbhaññāsinti jāniṃ.
"He knew" means he understood.
Abbhaññāsi có nghĩa là đã biết.
Jānanañca na anussavādivasenāti āha ‘‘paṭivijjhi’’nti, paccakkhamakāsinti attho.
And knowing is not through hearsay, etc.; therefore, it says "he penetrated," meaning he made it directly perceived.
Và sự biết không phải do nghe truyền khẩu v.v., nên nói ‘‘paṭivijjhi’’, nghĩa là đã chứng đắc trực tiếp.
Paṭivedhopi na dūre ṭhitassa lakkhaṇappaṭivedho viyāti āha ‘‘pattomhī’’ti, pāpuṇinti attho.
And penetration is not like the penetration of a characteristic from a distance; therefore, it says "I have reached," meaning I have arrived.
Sự chứng đắc cũng không phải là sự chứng đắc đặc tính của một vật ở xa, nên nói ‘‘pattomhī’’, nghĩa là đã đạt được.
Pāpuṇanañca na sayaṃ gantvāti āha ‘‘adhigatomhī’’ti, sakasantāne uppādanavasena paṭilabhinti attho.
And reaching is not by going oneself; therefore, it says "I have attained," meaning I have acquired it by generating it within one's own continuity.
Và sự đạt được không phải là tự mình đi đến, nên nói ‘‘adhigatomhī’’, nghĩa là đã đạt được bằng cách làm phát sinh trong tự thân.
Opammasampaṭipādananti opammatthassa upameyyena sammadeva paṭipādanaṃ.
"Making the simile consistent" means perfectly making the meaning of the simile consistent with what is being compared.
Opammasampaṭipādana có nghĩa là sự so sánh hoàn toàn phù hợp giữa ý nghĩa của ví dụ và điều được ví dụ.
Atthenāti upameyyatthena.
"By the meaning" means by the meaning of what is being compared.
Atthenā có nghĩa là với ý nghĩa của điều được ví dụ.
Yathā kukkuṭiyā aṇḍesu tividhakiriyākaraṇaṃ kukkuṭacchāpakānaṃ aṇḍakosato nikkhamanassa mūlakāraṇaṃ, evaṃ bodhisattabhūtassa bhagavato tividhānupassanākaraṇaṃ avijjaṇḍakosato nikkhamanassa mūlakāraṇanti āha ‘‘yathā hi tassā kukkuṭiyā…pe… tividhānupassanākaraṇa’’nti.
Just as the three kinds of activity performed by the hen on her eggs are the root cause for the chicks to emerge from the eggshell, so too the three kinds of contemplation performed by the Blessed One, while still a Bodhisatta, are the root cause for emerging from the eggshell of ignorance; hence it says "just as that hen... etc.... the three kinds of contemplation."
Giống như ba loại hành động của gà mái đối với trứng là nguyên nhân gốc rễ cho việc gà con nở ra khỏi vỏ trứng, thì ba loại quán chiếu của Đức Thế Tôn khi còn là Bồ-tát là nguyên nhân gốc rễ cho việc thoát ra khỏi vỏ trứng vô minh, nên nói ‘‘yathā hi tassā kukkuṭiyā…pe… tividhānupassanākaraṇa’’ (giống như gà mái ấy…v.v… ba loại quán chiếu).
‘‘Santāne’’ti vuttattā aṇḍasadisatā santānassa bahi nikkhantakukkuṭacchāpakasadisatā buddhaguṇānaṃ, buddhaguṇāti ca atthato buddhoyeva ‘‘tathāgatassa kho etaṃ, vāseṭṭha, adhivacanaṃ dhammakāyo itipī’’ti vacanato.
Since it is said "within one's own continuity," the similarity of the continuity to an egg, and the similarity of the Buddha's qualities to chicks that have come out externally, and "Buddha's qualities" by meaning refers to the Buddha himself, according to the saying, "This, Vāseṭṭha, is an appellation for the Tathāgata: 'Dhammakāya' as well."
Vì đã nói ‘‘santāne’’ (trong dòng tương tục), nên sự giống vỏ trứng là dòng tương tục, sự giống gà con đã nở ra là các phẩm chất của Đức Phật. Và các phẩm chất của Đức Phật, về mặt ý nghĩa, chính là Đức Phật, theo lời dạy ‘‘Này Vāseṭṭha, Pháp thân là một tên gọi khác của Như Lai’’.
Avijjaṇḍakosassa tanubhāvoti balavavipassanāvasena avijjaṇḍakosassa tanubhāvo, paṭicchādanasāmaññena ca avijjāya aṇḍakosasadisatā.
"Thinning of the eggshell of ignorance" means the thinning of the eggshell of ignorance by means of strong insight, and the similarity of ignorance to an eggshell due to its covering capacity.
Avijjaṇḍakosassa tanubhāvo có nghĩa là vỏ trứng vô minh trở nên mỏng manh nhờ vipassanā mạnh mẽ, và vô minh giống như vỏ trứng do có khả năng che đậy.
Mudubhūtassapi kharabhāvāpatti hotīti tannivattanatthaṃ ‘‘thaddhakharabhāvo’’ti vuttaṃ.
Even what is soft can become hard, and to prevent this, "strong and rough state" is stated.
Ngay cả vật mềm cũng có thể trở nên cứng, để loại bỏ điều đó, nên nói ‘‘thaddhakharabhāvo’’ (sự cứng chắc).
Tikkhakharavippasannasūrabhāvoti ettha pariggayhamānesu saṅkhāresu vipassanāñāṇassa samādhindriyavasena sukhānuppaveso tikkhatā, anupavisitvāpi satindriyavasena anatikkamanato akuṇṭhatā kharabhāvo.
In "sharp, rough, clear, and brave state," the easy entry of insight-knowledge into the mental formations being comprehended, by means of the faculty of concentration, is sharpness; not being dull, even after entering, by means of the faculty of mindfulness, is roughness.
Trong Tikkhakharavippasannasūrabhāvo, sự thâm nhập dễ dàng của tuệ vipassanā vào các hành được quán chiếu nhờ căn định là sự sắc bén; sau khi thâm nhập, không bị vượt qua hay cùn mòn nhờ căn niệm là sự cứng chắc.
Tikkhopi hi ekacco saro lakkhaṃ patvā kuṇṭho hoti, na tathā idaṃ.
Indeed, some arrows, though sharp, become blunt after hitting the target; this is not so.
Ngay cả một mũi tên sắc bén đôi khi cũng bị cùn khi trúng mục tiêu, nhưng điều này thì không như vậy.
Satipi kharabhāve sukhumappavattivasena kilesasamudācārasaṅkhobharahitatāya saddhindriyavasena pasannabhāvo, satipi ca pasannabhāve antarā anosakkitvā kilesapaccatthikānaṃ suṭṭhu abhibhavanato vīriyindriyavasena sūrabhāvo veditabbo.
Even with roughness, being free from the disturbance of the arising of defilements through subtle manifestation, by means of the faculty of faith, is clearness; and even with clearness, not retreating midway and thoroughly overcoming the enemies of defilements, by means of the faculty of energy, is to be understood as bravery.
Mặc dù có sự cứng chắc, nhưng nhờ sự vận hành vi tế, không bị xáo trộn bởi sự khởi lên của phiền não, nên nhờ căn tín là sự trong sáng; và mặc dù có sự trong sáng, nhưng không lùi bước giữa chừng, chiến thắng kẻ thù phiền não một cách xuất sắc, nên nhờ căn tinh tấn là sự dũng mãnh.
Evamimehi pakārehi saṅkhārupekkhāñāṇameva gahitanti daṭṭhabbaṃ.
Thus, it should be seen that only the knowledge of equanimity regarding mental formations is grasped by these aspects.
Như vậy, cần phải hiểu rằng chính tuệ xả hành đã được nắm bắt bằng những cách này.
Vipassanāñāṇassa pariṇāmakāloti vipassanāya vuṭṭhānagāminibhāvappatti, tadā ca sā maggañāṇagabbhaṃ dhārentī viya hotīti āha ‘‘gabbhaggahaṇakālo’’ti.
"Period of ripening of insight-knowledge" is the attainment of the exit-bound state of insight; and then it is as if it bears the embryo of path-knowledge; hence it says "period of conception."
Vipassanāñāṇassa pariṇāmakālo có nghĩa là thời điểm vipassanā đạt đến trạng thái hướng đến xuất ly. Vào lúc đó, nó giống như đang mang thai tuệ đạo, nên nói ‘‘gabbhaggahaṇakālo’’ (thời điểm thọ thai).
Gabbhaṃ gaṇhāpetvāti saṅkhārupekkhāya anantaraṃ sikhāppattaanulomavipassanāvasena maggavijāyanatthaṃ gabbhaṃ gaṇhāpetvā.
"Having conceived" means having conceived for giving birth to the path, through the culmination of insight leading to conformity (anuloma-vipassanā) immediately after equanimity regarding mental formations.
Gabbhaṃ gaṇhāpetvā có nghĩa là sau tuệ xả hành, nhờ vipassanā thuận thứ đạt đến đỉnh cao, đã thọ thai để sinh ra đạo.
Anupubbādhigatenāti paṭhamamaggapaṭipāṭiyā adhigatena.
"Attained progressively" means attained in the sequence of the first paths.
Anupubbādhigatenā có nghĩa là đã đạt được theo thứ tự của đạo đầu tiên.
Abhiññāpakkheti lokiyābhiññāpakkhe.
"In the aspect of supernormal powers" refers to the aspect of mundane supernormal powers.
Abhiññāpakkhe có nghĩa là trong khía cạnh các thắng trí thế gian.
Lokuttarābhiññā hi avijjaṇḍakosaṃ padālitā.
For supramundane supernormal powers have already split the eggshell of ignorance.
Vì các thắng trí siêu thế đã phá vỡ vỏ trứng vô minh.
Potthakesu pana katthaci ‘‘chaabhiññāpakkhe’’ti likhanti, so apāṭhoti veditabbo.
However, in some books, it is written "in the aspect of six supernormal powers"; this should be understood as an incorrect reading.
Tuy nhiên, ở một số bản kinh, người ta viết ‘‘chaabhiññāpakkhe’’ (trong khía cạnh sáu thắng trí), điều đó cần được hiểu là không phải là bản văn đúng.
Jeṭṭho seṭṭhoti vuddhatamattā jeṭṭho, sabbaguṇehi uttamattā pasatthatamoti seṭṭho.
"Elder, best": Elder due to being the oldest; best due to being supreme and most excellent in all good qualities.
Jeṭṭho seṭṭho: là Jeṭṭho (bậc trưởng thượng) vì là bậc cao tuổi nhất; là Seṭṭho (bậc tối thượng) vì là bậc đáng tán thán nhất, ưu việt nhất về mọi phẩm chất.
Idāni ‘‘āraddhaṃ kho pana me brāhmaṇa vīriya’’ntiādikāya desanāya anusandhiṃ dassento āha ‘‘evaṃ bhagavā’’tiādi.
Now, showing the connection to the teaching beginning with "My energy, O brahmin, was aroused," it says, "Thus, the Blessed One," and so on.
Bây giờ, muốn chỉ ra sự liên tục của bài thuyết pháp bắt đầu bằng ‘‘Này Bà-la-môn, tinh tấn của ta đã được khởi lên’’ v.v., nên nói ‘‘evaṃ bhagavā’’ (Đức Thế Tôn nói như vậy) v.v.
Tattha pubbabhāgato pabhutīti bhāvanāya pubbabhāgiyavīriyārambhādito paṭṭhāya.
Among these, "from the anterior part onwards" means from the beginning of the anterior part of exertion for development.
Trong đó, pubbabhāgato pabhutī có nghĩa là từ khi bắt đầu tinh tấn thuộc phần trước của sự tu tập.
Cittamevamuppannanti evaṃ upari vakkhamānaparivitakkavasena cittamuppannanti attho.
"Such a thought arose" means a thought arose in the manner of the reflections to be stated above.
Cittamevamuppanna có nghĩa là tâm đã khởi lên như vậy, theo sự suy xét sẽ được nói ở trên.
‘‘Cittameva uppanna’’ntipi pāṭho, tattha cittameva uppannaṃ, na tāva bhagavati pasādoti attho.
There is also the reading "Cittameva uppannaṃ," where the meaning is that only the thought arose, not yet faith in the Blessed One.
Cũng có bản đọc là ‘‘Cittameva uppanna’’, trong đó nghĩa là chỉ có tâm khởi lên, chưa phải là sự tịnh tín nơi Đức Thế Tôn.
Muṭṭhassatināti vinaṭṭhassatinā, sativirahitenāti attho.
"With forgotten mindfulness" means with lost mindfulness, meaning without mindfulness.
Muṭṭhassatinā có nghĩa là người đã mất niệm, tức là người không có niệm.
Sāraddhakāyenāti sadarathakāyena.
"With agitated body" means with a body full of distress.
Sāraddhakāyenā có nghĩa là với thân thể run rẩy.
Bodhimaṇḍeti bodhisaṅkhātassa ñāṇassa maṇḍabhāvappatte ṭhāne.
"At the Bodhi Maṇḍa" means at the place that attained the state of the essence (maṇḍa) of the knowledge called Bodhi.
Bodhimaṇḍe có nghĩa là nơi đạt đến trạng thái tinh túy của tuệ giác gọi là Bodhi.
Bodhīti hi paññā vuccati, sā ettha maṇḍā pasannā jātāti so padeso ‘‘bodhimaṇḍo’’ti paññāto.
Indeed, Bodhi is called wisdom; here, it has become bright and clear, so that place is known as "Bodhimaṇḍa."
"Bodhī" được gọi là tuệ (paññā), nơi đây tuệ ấy trở nên thanh tịnh và trong sáng, nên nơi đó được gọi là "bodhimaṇḍa".
Caturaṅgasamannāgatanti ‘‘kāmaṃ taco ca nhāru ca aṭṭhi ca avasissatu, sarīre upasussatu maṃsalohita’’nti (ma. ni. 2.184; saṃ. ni. 2.22; a. ni. 2.5; mahāni. 196) evaṃ vuttacaturaṅgasamannāgataṃ vīriyaṃ.
" Endowed with four factors" refers to the energy endowed with these four factors, as stated: "Let only skin, sinews, and bones remain; let the flesh and blood in the body dry up."
Caturaṅgasamannāgata (có đủ bốn chi) là tinh tấn được nói đến như vầy: "Dù da, gân, xương còn lại, thịt và máu trong thân thể khô cạn đi".
Tattha tacoti ekaṃ aṅgaṃ nhāru ekaṃ aṅgaṃ aṭṭhi ekaṃ aṅgaṃ maṃsalohitaṃ ekaṃ aṅganti veditabbaṃ.
In that regard, skin is one factor, sinews are one factor, bones are one factor, and flesh and blood are one factor, it should be understood.
Trong đó, da là một chi, gân là một chi, xương là một chi, thịt và máu là một chi, nên phải hiểu như vậy.
Taco ekaṃ aṅganti ca tace nirapekkhabhāvo ekaṃ aṅganti gahetabbaṃ.
And by " skin is one factor," it should be understood that indifference to the skin is one factor.
Và da là một chi phải hiểu là sự không bám víu vào da là một chi.
Padhānaṃ anuyuñjantassa hi tace palujjamānepi taṃnimittaṃ avosānāpajjanaṃ tassa vīriyassa ekaṃ aṅgaṃ ekaṃ kāraṇaṃ.
For one who strives diligently, not giving up due to the deterioration of the skin is one factor, one cause for their energy.
Thật vậy, đối với người đang thực hành tinh tấn, dù da có bị hủy hoại, việc không ngừng nghỉ vì lý do đó là một chi, một nguyên nhân của tinh tấn ấy.
Evaṃ sesesupi attho veditabbo.
Thus, the meaning should be understood for the remaining ones as well.
Tương tự, ý nghĩa cũng phải được hiểu đối với các phần còn lại.
Paggahitanti ārambhaṃ sithilaṃ akatvā daḷhaparakkamasaṅkhātussāhanabhāvena gahitaṃ.
" Paggahita" means held firmly, without slackening the effort, by means of strenuous exertion.
Paggahita (được nắm giữ) là được nắm giữ bởi sự nỗ lực kiên cường, không làm cho sự khởi đầu trở nên lỏng lẻo.
Tenāha ‘‘asithilappavattitanti vuttaṃ hotī’’ti.
Therefore, it is said, " it is said to be unslackening in its progress."
Do đó, đã nói "có nghĩa là sự tiếp diễn không lỏng lẻo".
Asallīnanti asaṅkucitaṃ kosajjavasena saṅkocaṃ anāpannaṃ.
" Asallīna" means uncontracted, not falling into contraction due to laziness.
Asallīna (không co rút) là không co rút, không rơi vào trạng thái co rút do lười biếng.
Upaṭṭhitāti ogāhanasaṅkhātena apilāpabhāvena ārammaṇaṃ upagantvā ṭhitā.
" Upaṭṭhitā" means having approached the object by means of non-forgetfulness, which is called penetration, and stands there.
Upaṭṭhitā (thiết lập) là đã đến gần đối tượng bằng cách thâm nhập, tức là không bị chìm đắm.
Tenāha ‘‘ārammaṇābhimukhībhāvenā’’ti.
Therefore, it is said, " by being directed towards the object."
Do đó, đã nói "bằng cách đối diện với đối tượng".
Sammosassa viddhaṃsanavasena pavattiyā na sammuṭṭhāti asammuṭṭhā.
It does not become forgotten due to the destruction of confusion, by its arising, hence " asammuṭṭhā" (unforgotten).
Do sự tiếp diễn của việc tiêu diệt sự lầm lạc, nên không lầm lạc, đó là asammuṭṭhā.
Kiñcāpi cittapassaddhivaseneva cittameva passaddhaṃ, kāyapassaddhivaseneva ca kāyo passaddho hoti, tathāpi yasmā kāyapassaddhi uppajjamānā cittapassaddhiyā saheva uppajjati, na vinā, tasmā vuttaṃ ‘‘kāyacittapassaddhivasenā’’ti.
Although the mind itself is tranquil by means of mental tranquility, and the body is tranquil by means of bodily tranquility, nevertheless, since bodily tranquility arises simultaneously with mental tranquility and not without it, it is said, " by means of bodily and mental tranquility."
Mặc dù tâm trở nên an tịnh do sự an tịnh của tâm, và thân trở nên an tịnh do sự an tịnh của thân, nhưng vì sự an tịnh của thân khi phát sinh thì phát sinh cùng với sự an tịnh của tâm, không phát sinh riêng lẻ, nên đã nói "do sự an tịnh của thân và tâm".
Kāyapassaddhiyā ubhayesampi kāyānaṃ passambhanāvahattā vuttaṃ ‘‘rūpakāyopi passaddhoyeva hotī’’ti.
Since bodily tranquility brings about the calming of both kinds of bodies, it is said, " the physical body also becomes tranquil."
Vì sự an tịnh của thân mang lại sự an tịnh cho cả hai loại thân, nên đã nói "thân sắc cũng trở nên an tịnh".
So ca khoti so ca kho kāyo.
" So ca kho" (And indeed) refers to that body.
So ca kho (và quả thật) là thân đó.
Vigatadarathoti vigatakilesadaratho.
" Vigatadaratho" means having the mental defilement and fever departed.
Vigatadaratho (không còn phiền não) là không còn phiền não.
Nāmakāye hi vigatadarathe rūpakāyopi vūpasantadarathapariḷāho hoti.
Indeed, when the mental body is free from fever, the physical body also becomes tranquil and free from burning defilements.
Khi thân danh (nāmakāya) không còn phiền não, thì thân sắc (rūpakāya) cũng trở nên an tịnh, không còn phiền não và nóng bức.
Sammā āhitanti nānārammaṇesu vidhāvanasaṅkhātaṃ vikkhepaṃ vicchinditvā ekasmiṃyeva ārammaṇe avikkhittabhāvāpādanena sammadeva āhitaṃ ṭhapitaṃ.
" Sammā āhita" means perfectly established, by cutting off distraction, which is wandering among various objects, and bringing about a state of non-distraction on a single object.
Sammā āhita (được đặt đúng đắn) là đã đặt đúng đắn bằng cách cắt đứt sự phân tán, tức là sự xao động do chạy theo nhiều đối tượng khác nhau, và đưa tâm vào trạng thái không bị phân tán trên một đối tượng duy nhất.
Tenāha ‘‘suṭṭhu ṭhapita’’ntiādi.
Therefore, it is said, " well-established," and so on.
Do đó, đã nói "được đặt rất tốt" v.v.
Cittassa anekaggabhāvo vikkhepavasena cañcalatā, sā sati ekaggatāya na hotīti āha ‘‘ekaggaṃ acalaṃ nipphandana’’nti.
The mind's lack of one-pointedness is restlessness due to distraction; it does not exist when there is one-pointedness, so it is said, " one-pointed, unmoving, unwavering."
Trạng thái không tập trung của tâm là sự xao động, bất định do phân tán, nhưng khi có sự nhất tâm thì điều đó không xảy ra, nên đã nói "nhất tâm, bất động, không dao động".
Ettāvatāti ‘‘āraddhaṃ kho panā’’tiādinā vīriyasatipassaddhisamādhīnaṃ kiccasiddhidassanena.
" Ettāvatā" (By this much) refers to demonstrating the accomplishment of energy, mindfulness, tranquility, and concentration, beginning with "indeed, exerted."
Ettāvatā (đến mức này) là bằng cách chỉ ra sự thành tựu của tinh tấn, niệm, an tịnh và định, bắt đầu từ "khởi sự tinh tấn".
Nanu ca saddhāpaññānampi kiccasiddhi jhānassa pubbapaṭipadāya icchitabbāti?
But is not the accomplishment of faith and wisdom also desirable as the preliminary practice for jhāna?
Chẳng phải sự thành tựu của tín (saddhā) và tuệ (paññā) cũng được mong muốn trong con đường tu tập sơ khởi của thiền sao?
Saccaṃ icchitabbā, sā pana nānantarikabhāvena avuttasiddhāti na gahitā.
It is true that it is desirable, but that is not explicitly stated because it is implicitly understood as not being immediate.
Đúng vậy, chúng được mong muốn, nhưng vì chúng được ngụ ý một cách gián tiếp, không được nói đến trực tiếp, nên chúng không được đề cập.
Asati hi saddhāya vīriyārambhādīnaṃ asambhavoyeva, paññāpariggahe ca nesaṃ asati ñāyārambhādibhāvo na siyā, tathā asallīnāsammosatādayo vīriyādīnanti asallīnatādiggahaṇenevettha paññākiccasiddhi gahitāti daṭṭhabbaṃ.
For, in the absence of faith, the commencement of energy and so on would be impossible; and in the absence of comprehension through wisdom, the commencement of method and so on would not be, just as non-contraction and unforgetfulness are for energy and so on. Thus, it should be seen that here, the accomplishment of wisdom is taken by the mention of non-contraction and so on.
Thật vậy, nếu không có tín, sự khởi đầu tinh tấn v.v. sẽ không thể xảy ra; và nếu không có sự nắm giữ bằng tuệ, thì sự khởi đầu đúng đắn v.v. sẽ không thể có. Tương tự, sự không co rút, không lầm lạc v.v. là của tinh tấn v.v., nên ở đây, sự thành tựu của tuệ được bao hàm trong việc đề cập đến sự không co rút v.v.
Jhānabhāvanāyaṃ vā samādhikiccaṃ adhikaṃ icchitabbanti dassetuṃ samādhipariyosānāva jhānassa pubbapaṭipadā kathitāti daṭṭhabbaṃ.
Or, it should be understood that the preliminary practice for jhāna is spoken of as culminating in concentration to show that the task of concentration is primarily desired in the cultivation of jhāna.
Hoặc phải hiểu rằng con đường tu tập sơ khởi của thiền được nói đến cho đến khi đạt được định là để chỉ ra rằng công năng của định được mong muốn nhiều hơn trong việc tu tập thiền.
Idāni ‘‘vivicceva kāmehī’’tiādinayappavattāya pāḷiyā jhānavibhaṅge (vibha. 508) vuttampi atthaṃ aṭṭhakathānayeneva saṃvaṇṇetukāmo vibhaṅgapāḷiyaṃ vuttanayena avacane kāraṇaṃ dassetuṃ ‘‘kiñcāpi tattha katame kāmā’’tiādimāha.
Now, desiring to explain the meaning stated in the Jhānavibhaṅga of the Pāḷi, which proceeds in the manner of "having become secluded from sensual pleasures," etc., by the method of the Aṭṭhakathā, and to show the reason for not stating it in the manner of the Vibhaṅgapāḷi, he says, " although there, what are sensual pleasures?" and so on.
Bây giờ, vì muốn giải thích ý nghĩa đã được nói đến trong phần phân tích thiền (Vibhaṅga 508) theo cách của chú giải, bằng đoạn Pāḷi bắt đầu bằng "vivicceva kāmehī" (ly dục), nên để chỉ ra lý do không nói theo cách đã được nói trong Pāḷi của Vibhaṅga, ngài đã nói đoạn bắt đầu bằng "kiñcāpi tattha katame kāmā" (mặc dù ở đó, những dục nào).
Tattha patthanākārena pavatto dubbalo lobho chandanaṭṭhena chando, tato balavā rañjanaṭṭhena rāgo, tatopi balavataro bahalarāgo chandarāgo.
In that context, the weak greed arising in the manner of wishing is chanda (desire), due to the meaning of wishing for and attachment to; then, a stronger greed, due to the meaning of delighting, is rāga (lust); and even stronger than that, intense rāga, is chandarāga (lustful desire).
Ở đó, lòng tham yếu ớt phát sinh dưới hình thức khao khát, do ý nghĩa của sự mong muốn, được gọi là chanda (dục). Lòng tham mạnh hơn từ đó, do ý nghĩa của sự say mê, được gọi là rāga (tham ái). Lòng tham mạnh mẽ hơn nữa từ đó, là tham ái mãnh liệt, được gọi là chandarāga (dục tham).
Nimittānubyañjanāni saṅkappeti etenāti saṅkappo, tathāpavatto lobho.
One conceptualizes signs and auxiliary characteristics by this, hence saṅkappa (conceptualization); such is the greed that arises.
Người ta suy tư về các tướng và các tướng phụ bằng điều này, nên đó là saṅkappa (tư duy), tức là lòng tham phát sinh theo cách đó.
Tattha nimittasaṅkappanā nāma avayave samodhānetvā ‘‘itthī puriso’’tiādinā ekajjhaṃ katvā uparūpari kilesuppattiyā nimittassa kappanā.
There, nimittasaṅkappanā (conceptualization of signs) means conceptualizing a sign, such as "woman, man," etc., by gathering the parts together and unifying them, causing the arising of defilements repeatedly.
Trong đó, nimittasaṅkappanā (suy tư về tướng) là sự suy tư về tướng bằng cách tổng hợp các bộ phận và xem chúng là một tổng thể, chẳng hạn như "phụ nữ, đàn ông", do sự phát sinh của các phiền não liên tiếp.
Anubyañjanasaṅkappanā pana ‘‘hatthā sobhanā, pādā sobhanā’’ti evaṃ anubyañjanavasena vibhajitvā kappanāti.
Anubyañjanasaṅkappanā (conceptualization of auxiliary characteristics), however, is conceptualizing by dividing them according to auxiliary characteristics, saying, "the hands are beautiful, the feet are beautiful," and so on.
Còn anubyañjanasaṅkappanā (suy tư về tướng phụ) là sự suy tư bằng cách phân tích theo các tướng phụ, chẳng hạn như "tay đẹp, chân đẹp".
Kilesānañhi anu anu byañjanato paribyañjanato paribyattivasena uppattiyā paccayabhāvato anubyañjanaṃ hatthapādādiavayavā vuccanti.
Indeed, the limbs such as hands and feet are called anubyañjana (auxiliary characteristics) because they are factors for the successive, repeated, and distinct arising of defilements.
Thật vậy, các bộ phận như tay, chân được gọi là anubyañjana (tướng phụ) vì chúng là nguyên nhân cho sự phát sinh của các phiền não một cách rõ ràng, từng bước, từng bước một.
Tato balavā rañjanaṭṭhena rāgo, saṅkappavaseneva pavatto tatopi balavataro saṅkapparāgo.
Then, a strong greed, due to the meaning of delighting, is rāga; and even stronger than that, arising solely by means of conceptualization, is saṅkapparāga (conceptual lust).
Từ đó, lòng tham mạnh hơn, do ý nghĩa của sự say mê, là rāga (tham ái). Lòng tham phát sinh chỉ do suy tư, mạnh hơn nữa từ đó, là saṅkapparāga (tư duy tham ái).
Svāyaṃ pabhedo ekasseva lobhassa pavattiākāravasena avatthābhedavasena ca veditabbo yathā ‘‘vaccho dammo balībaddo’’ti.
This classification should be understood as based on the manner of arising and the different stages of one and the same greed, just as "calf, tamed ox, bull."
Sự phân loại này phải được hiểu là sự khác biệt về trạng thái của cùng một lòng tham, tùy theo cách thức phát sinh, giống như "bê con, bò tơ, bò đực".
Kāmāti kilesakāmā, kāmentīti kāmā, kāmenti etehīti vā.
" Kāmā" are defilement-sensual pleasures (kilesakāmā). They desire, hence kāmā, or they are desired by these, hence kāmā.
Kāmā (dục) là các phiền não dục (kilesakāmā). Chúng mong muốn, nên là dục. Hoặc người ta mong muốn bằng chúng.
Seyyathidanti imassa taṃ katamaṃ, taṃ kathanti vā attho.
" Seyyathidaṃ" (namely) has the meaning of "which is that?" or "how is that?"
Seyyathida (nghĩa là) có nghĩa là cái nào, hoặc cái đó như thế nào.
Viviccitvāti visuṃ hutvā.
" Viviccitvā" means having become separate.
Viviccitvā (ly khai) là trở nên riêng biệt.
Tenāha ‘‘vinā hutvā apasakkitvā’’ti, pajahanavasena apakkamitvāti attho.
Therefore, it is said, " having become free, having moved away"; the meaning is, having departed by way of abandonment.
Do đó, đã nói "tách rời, tránh xa", có nghĩa là lìa bỏ bằng cách từ bỏ.
Vivicceva kāmehīti ettha viviccāti iminā vivecanaṃ jhānakkhaṇe kāmānaṃ abhāvamattaṃ vuttaṃ.
In "vivicceva kāmehi" (having become secluded from sensual pleasures), by " vivicca," only the absence of sensual pleasures at the moment of jhāna, their seclusion, is stated.
Trong câu vivicceva kāmehī (ly dục), với từ viviccā (ly khai) này, chỉ nói đến sự vắng mặt của các dục vào thời điểm thiền định.
Viviccevāti pana iminā ekaṃsato kāmānaṃ vivecetabbatādīpanena tappaṭipakkhatā jhānassa kāmavivekappahānassa ca jhānādhigamūpāyatā dassitā hotīti imamatthaṃ dassetuṃ ‘‘paṭhamajjhāna’’ntiādiṃ vatvā tamevatthaṃ pākaṭataraṃ kātuṃ ‘‘katha’’ntiādi vuttaṃ.
However, by " vivicceva," it is shown that jhāna is the opposite of sensual pleasures and that the abandonment of sensual seclusion is a means to attain jhāna, by emphasizing the absolute necessity of secluding sensual pleasures. To show this meaning, it is said, " the first jhāna," etc., and to make that meaning clearer, " how" etc. is said.
Tuy nhiên, với từ viviccevā (chắc chắn ly khai) này, bằng cách chỉ ra rằng các dục phải được ly khai một cách tuyệt đối, đã cho thấy rằng thiền định là đối lập với các dục và sự từ bỏ các dục là phương tiện để đạt được thiền định. Để chỉ ra ý nghĩa này, sau khi nói "paṭhamajjhāna" (thiền thứ nhất) v.v., để làm rõ hơn ý nghĩa đó, đã nói "katha" (như thế nào) v.v.
Andhakāre sati padīpo viyāti etena yathā padīpābhāvena rattiyaṃ andhakārābhibhavo, evaṃ jhānābhāvena cittasantatiyaṃ kāmābhibhavoti dasseti.
By "as a lamp in the presence of darkness," it shows that just as darkness overwhelms at night in the absence of a lamp, so too sensual pleasures overwhelm the mind-continuum in the absence of jhāna.
Với câu andhakāre sati padīpo viyā (như đèn khi có bóng tối), điều này chỉ ra rằng cũng như sự thiếu vắng đèn vào ban đêm dẫn đến sự bao trùm của bóng tối, thì sự thiếu vắng thiền định trong dòng tâm thức cũng dẫn đến sự bao trùm của các dục.
Etanti pubbapadeyeva avadhāraṇavacanaṃ, na kho pana evaṃ daṭṭhabbaṃ ‘‘kāmehi evā’’ti avadhāraṇassa akatattā.
" Etaṃ" (this) is a definitive word only in the preceding phrase, and it should not be understood as "only from sensual pleasures" because the definitive emphasis "eva" is not made.
Eta (này) là từ nhấn mạnh chỉ ở đoạn trước, không phải hiểu là "chỉ từ các dục", vì sự nhấn mạnh "chỉ" không được thực hiện.
Tannissaraṇatoti nissaranti niggacchanti etena, ettha vāti nissaraṇaṃ.
" Tannissaraṇato" (from the escape therefrom): by this, they escape, they emerge, hence nissaraṇa (escape). Or, in this, they escape, hence nissaraṇa.
Tannissaraṇato (từ sự xuất ly đó) là xuất ly (nissaraṇa) là cái mà nhờ đó các dục thoát ra, hoặc là nơi mà chúng thoát ra.
Ke niggacchanti?
Who escape?
Ai thoát ra?
Kāmā.
Sensual pleasures.
Các dục.
Tesaṃ kāmānaṃ nissaraṇaṃ pahānaṃ tannissaraṇaṃ, tato kāmanissaraṇatoti attho.
The escape of those sensual pleasures is tannissaraṇa (escape from them); the meaning is, from the escape of sensual pleasures.
Sự xuất ly của các dục đó là tannissaraṇaṃ (sự xuất ly đó), có nghĩa là từ sự xuất ly các dục.
Kathaṃ pana samāne vikkhambhane kāmānamevetaṃ nissaraṇaṃ, na byāpādādīnanti codanaṃ yuttito āgamato ca sādhetuṃ ‘‘kāmadhātū’’tiādi vuttaṃ.
To establish the question, "how is this jhāna the escape only from sensual pleasures, and not from ill-will and so on, when there is the same suppression?", by reasoning and tradition, it is said, " kāmadhātu" (sensual realm), etc.
Để chứng minh bằng lý lẽ và truyền thống rằng tại sao sự xuất ly này chỉ dành cho các dục, chứ không phải cho sân hận v.v., khi sự trấn áp là như nhau, đã nói "kāmadhātū" (dục giới) v.v.
Tattha kāmadhātusamatikkamanatoti sakalassapi kāmabhavassa samatikkamapaṭipadābhāvato.
There, " kāmadhātusamatikkamanato" (from the transcendence of the sensual realm) means because it is the path of transcending the entire sensual existence.
Trong đó, kāmadhātusamatikkamanato (do vượt qua dục giới) là do con đường tu tập vượt qua toàn bộ dục hữu.
Tena imassa jhānassa kāmapariññābhāvamāha.
By this, he states the non-comprehension of sensual pleasures by this jhāna.
Do đó, nó nói về sự không có sự liễu tri các dục của thiền định này.
Kāmarāgapaṭipakkhatoti ‘‘chando kāmo’’tiādinā (mahāni. 1) vuttavibhāgassa kilesakāmassa paccatthikabhāvato.
" Kāmarāgapaṭipakkhato" (from being an opponent of sensual lust) means because it is hostile to defilement-sensual pleasure as distinguished by "desire is sensual pleasure," etc.
Kāmarāgapaṭipakkhato (do đối lập với dục tham) là do đối lập với các phiền não dục đã được phân loại như "chanda là dục" v.v.
Tena yathā mettā byāpādassa, karuṇā vihiṃsāya, evamidaṃ jhānaṃ kāmarāgassa ujuvipaccanīkabhūtanti dasseti.
By this, he shows that just as loving-kindness is the direct opposite of ill-will, and compassion of cruelty, so too this jhāna is the direct opposite of sensual lust.
Do đó, điều này chỉ ra rằng thiền định này là đối nghịch trực tiếp với dục tham, giống như từ bi đối với sân hận, và hỷ đối với não hại.
Vipākena cettha kāmadhātusamatikkamo attano pavattikkhaṇe kāmarāgapaṭipakkhatā ca veditabbā.
And here, the transcendence of the sense-sphere realm by its result, and its opposing nature to sensual desire at the moment of its arising, should be understood.
Trong thiền này, sự vượt thoát khỏi Kāmadhātu do quả của nó, và sự đối lập với kāmarāga vào khoảnh khắc phát sinh của nó, cần phải được hiểu.
Evamattano pavattiyā vipākappavattiyā ca kāmarāgato kāmadhātuto ca vinivattasabhāvattā idaṃ jhānaṃ visesato kāmānameva nissaraṇaṃ, svāyamattho pāṭhāgato evāti āha ‘‘yathāhā’’tiādi.
Thus, due to its nature of turning away from sensual desire and from the sense-sphere realm, both through its own arising and through the arising of its result, this jhāna is pre-eminently the escape from sensual pleasures alone. This meaning is as stated in the text, and thus it is said: "as it is stated," and so forth.
Do đó, thiền này, bởi bản chất thoát ly khỏi kāmarāga và Kāmadhātu, cả trong sự phát sinh của tự thân và sự phát sinh của quả, đặc biệt là sự xuất ly khỏi các dục. Ý nghĩa này đã được nêu trong bản văn, nên mới nói “như đã nói” và tiếp theo.
Nekkhammanti paṭhamajjhānaṃ.
"Renunciation" means the first jhāna.
Nekkhamma (xuất ly) là sơ thiền.
Kāmañcettha tamatthaṃ dīpetuṃ purimapadeyeva avadhāraṇaṃ gahitaṃ, uttarapadepi pana taṃ gahetabbameva tathā atthasambhavatoti dassetuṃ ‘‘uttarapadepī’’tiādi vuttaṃ.
Although the emphatic particle (eva) is placed in the preceding word to clarify that meaning, it should also be understood in the subsequent word, and thus, to show that the meaning is thereby rendered possible, the phrase "even in the subsequent word" and so forth was stated.
Mặc dù ở đây, để làm rõ ý nghĩa đó, từ “eva” (chỉ, riêng) đã được dùng trong vế câu trước, nhưng để chỉ ra rằng nó cũng nên được dùng trong vế câu sau vì ý nghĩa có thể có như vậy, nên đã nói “cả trong vế câu sau” và tiếp theo.
Itoti kāmacchandato.
"From this" means from sensual craving.
Từ đây là từ kāmacchanda (dục tham).
Esa daṭṭhabboti esa niyamo daṭṭhabbo.
"This should be understood" means this rule should be understood.
Nên được thấy là quy tắc này nên được thấy.
Sādhāraṇavacanenāti sabbavivekasādhāraṇavacanena.
"By common designation" means by a designation common to all forms of seclusion.
Với lời nói chung là với lời nói chung cho tất cả các loại viễn ly.
Tadaṅgavikkhambhanasamucchedapaṭippassaddhinissaraṇavivekā tadaṅgavivekādayo.
The seclusions by suppression of individual constituents (tadaṅga), by temporary suppression (vikkhambhana), by eradication (samuccheda), by tranquilisation (paṭippassaddhi), and by escape (nissaraṇa) are seclusions by individual constituents and so forth.
Các loại viễn ly như tadaṅga (từng phần), vikkhambhana (đàn áp), samuccheda (đoạn trừ), paṭippassaddhi (tịnh chỉ), nissaraṇa (xuất ly) là tadaṅgavivekādayo (các loại viễn ly từng phần và tiếp theo).
Kāyacittaupadhivivekā kāyavivekādayo.
Seclusion of body (kāyaviveka), seclusion of mind (cittaviveka), and seclusion from requisites (upadhiviveka) are seclusion of body and so forth.
Các loại viễn ly thân, tâm, và upekkhā (xả) là kāyavivekādayo (các loại viễn ly thân và tiếp theo).
Tayo eva idha daṭṭhabbāti tayo eva idha jhānakathāyaṃ daṭṭhabbā samucchedavivekādīnaṃ asambhavato.
"Only three should be understood here" means only these three—seclusion of body, mind, and requisites—should be understood here in the discourse on jhāna, as seclusions by eradication and so forth are not possible.
Ba loại này chỉ nên được thấy ở đây nghĩa là chỉ ba loại này nên được thấy trong bài thuyết về thiền ở đây, vì các loại viễn ly đoạn trừ (samucchedaviveka) và tiếp theo không thể có được.
Niddeseti mahāniddese (mahāni. 1).
"In the Niddesa" refers to the Mahāniddesa.
Trong Niddesa là trong Mahāniddesa.
Tattha hi ‘‘uddānato dve kāmā vatthukāmā kilesakāmā cā’’ti uddisitvā tattha ‘‘katame vatthukāmā manāpiyā rūpā…pe… manāpiyā phoṭṭhabbā’’tiādinā vatthukāmā niddiṭṭhā.
For there, after summarising, "In brief, there are two kinds of sensual pleasures: object-sensual pleasures (vatthukāmā) and defilement-sensual pleasures (kilesakāmā)," the object-sensual pleasures are defined as "what are object-sensual pleasures? Agreeable forms... agreeable tangible objects," and so forth.
Ở đó, sau khi nêu ‘‘tóm tắt có hai loại dục: vatthukāma (dục cảnh) và kilesakāma (phiền não dục)”, thì các vatthukāma được trình bày chi tiết bằng cách nói ‘‘những gì là vatthukāma? Là các sắc pháp khả ái… các xúc pháp khả ái” và tiếp theo.
Te pana kāmīyantīti kāmāti veditabbā.
These are to be understood as sensual pleasures (kāmā) because they are desired.
Những dục cảnh này nên được hiểu là các dục vì chúng được mong muốn.
Tatthevāti niddeseyeva.
"Therein" means in the Niddesa itself.
Cũng ở đó là ngay trong Niddesa.
Vibhaṅgeti jhānavibhaṅge.
"In the Vibhaṅga" refers to the Jhānavibhaṅga.
Trong Vibhaṅga là trong Jhānavibhaṅga.
Evañhi satīti evaṃ ubhayesampi kāmānaṃ saṅgahe sati.
"For if this is so" means if both kinds of sensual pleasures are included thus.
Nếu có như vậy là nếu cả hai loại dục đều được bao gồm.
Vatthukāmehipīti vatthukāmehi viviccevātipi attho yujjatīti evaṃ yujjamānatthantarasamuccayattho pi-saddo, na kilesakāmasamuccayattho.
"Even from object-sensual pleasures" means even from object-sensual pleasures, one is separated; thus, the particle "pi" is for gathering additional suitable meanings, not for gathering defilement-sensual pleasures.
Cũng bởi các vatthukāma nghĩa là cũng bởi sự viễn ly khỏi các vatthukāma. Từ “pi” ở đây có ý nghĩa bao gồm một ý nghĩa khác phù hợp, chứ không phải ý nghĩa bao gồm các kilesakāma.
Imasmiṃ atthe kilesakāmehi vivekassa dutiyapadena vuttattā.
Because in this meaning, separation from defilement-sensual pleasures is stated by the second phrase.
Trong ý nghĩa này, sự viễn ly khỏi các kilesakāma đã được nói đến trong vế câu thứ hai.
Tenāti vatthukāmavivekena.
"Thereby" means by separation from object-sensual pleasures.
Do đó là do sự viễn ly khỏi các vatthukāma.
Kāyaviveko vutto hotīti puttadārādipariggahavivekadīpanato kāyaviveko vutto hoti.
"Seclusion of body is stated" means seclusion of body is stated by demonstrating separation from the attachment to children, wives, and so forth.
Sự viễn ly thân được nói đến nghĩa là sự viễn ly thân được nói đến bằng cách làm sáng tỏ sự viễn ly khỏi sự sở hữu vợ con và các thứ khác.
Purimenāti kāyavivekena.
"By the former" means by seclusion of body.
Bởi cái trước là bởi sự viễn ly thân.
Etthāti ‘‘vivicceva kāmehi vivicca akusalehi dhammehī’’ti etasmiṃ padadvaye.
"Herein" refers to these two phrases: "quite secluded from sensual pleasures, secluded from unwholesome states."
Ở đây là trong hai vế câu “vivicceva kāmehi vivicca akusalehi dhammehī” (ly dục, ly pháp bất thiện).
Ito vā niddhārite vivekadvaye, akusalasaddena yadi kilesakāmā, sabbākusalāpi vā gahitā, sabbathā kilesakāmehi viveko vuttoti āha ‘‘dutiyena kilesakāmehi vivekavacanato’’ti.
Or if defilement-sensual pleasures or all unwholesome states are taken by the word "unwholesome" in the two seclusions thus determined, then seclusion from defilement-sensual pleasures is stated in every way, and so it is said: "by the second designating seclusion from defilement-sensual pleasures."
Hoặc, trong hai loại viễn ly được xác định từ đây, nếu từ “akusala” (bất thiện) bao gồm các kilesakāma (phiền não dục) hoặc tất cả các pháp bất thiện, thì trong mọi trường hợp, sự viễn ly khỏi các kilesakāma đã được nói đến, nên mới nói “bởi vế câu thứ hai là lời nói về sự viễn ly khỏi các kilesakāma”.
Dutiyenāti ca cittavivekenāti attho.
And "by the second" means by seclusion of mind.
Bởi cái thứ hai cũng có nghĩa là bởi sự viễn ly tâm.
Etesanti yathāvuttānaṃ dvinnaṃ padānaṃ.
"Of these" means of the two phrases mentioned above.
Của những điều này là của hai vế câu đã nói.
Niddhāraṇe cetaṃ sāmivacanaṃ.
And this word is in the possessive case (sāmivacana) for determination.
Và đây là cách nói sở hữu cách trong ý nghĩa xác định.
Taṇhādisaṃkilesānaṃ vatthuno pahānaṃ saṃkilesavatthuppahānaṃ.
The abandonment of the cause of defilements like craving is the abandonment of the cause of defilements.
Sự đoạn trừ các căn bản ô nhiễm như tham ái là saṃkilesavatthuppahānaṃ (sự đoạn trừ các căn bản ô nhiễm).
Lolabhāvo nāma tattha tattha rūpādīsu taṇhuppādo, tassa hetū vatthukāmā eva veditabbā.
"Frivolity" refers to the arising of craving for forms and so forth here and there; its cause should be understood as object-sensual pleasures themselves.
Lolabhāva (tính ham muốn) là sự phát sinh tham ái đối với các sắc pháp và các thứ khác ở khắp mọi nơi. Căn nguyên của nó nên được hiểu là chính các vatthukāma.
Bālabhāvassa hetupariccāgoti sambandho.
The connection is: relinquishing the cause of folly.
Sự đoạn trừ căn nguyên của bālabhāva (tính ngu si) là mối liên hệ.
Bālabhāvo nāma avijjā, ducintitacintitādi vā, tassa ayonisomanasikāro, sabbepi vā akusalā dhammā hetū.
"Folly" is ignorance, or contemplating what should not be contemplated, etc., or wrong attention, or all unwholesome states are its causes.
Bālabhāva (tính ngu si) là vô minh, hoặc các ý nghĩ không đúng đắn, v.v., căn nguyên của nó là sự tác ý không đúng đắn (ayoniso manasikāra), hoặc tất cả các pháp bất thiện.
Kāmaguṇādhigamahetu pāṇātipātādiasuddhappayogo hotīti tabbivekena payogasuddhi vibhāvitā.
Impure application, such as taking life, arises due to the cause of acquiring sensual qualities; thus, purity of application is demonstrated by seclusion from such.
Do nguyên nhân đạt được các kāmaguṇa (dục lạc), sự thực hành bất tịnh như sát sinh xảy ra. Do đó, thông qua sự viễn ly khỏi điều đó, payogasuddhi (sự thanh tịnh trong thực hành) được làm rõ.
Taṇhāsaṃkilesasodhanena vivaṭṭūpanissayasaṃvaḍḍhanena ca ajjhāsayavisodhanaṃ āsayaposanaṃ.
Purification of intention (ajjhāsayavisodhana) is nourishment of intention (āsayaposana), by purifying the defilements of craving and by fostering the conditions for liberation.
Sự thanh lọc các ô nhiễm tham ái và sự tăng trưởng các điều kiện hỗ trợ cho sự thoát ly khỏi vòng luân hồi là āsayaposanaṃ (sự nuôi dưỡng ý chí).
Āsayaposananti ca jhānabhāvanāya paccayabhūtā pubbayogādivasena siddhā ajjhāsayasampadā, sā pana taṇhupatāpavigamena hoti.
"Nourishment of intention" also refers to the perfection of intention (ajjhāsayasampadā) achieved through previous practice (pubbayoga) and so forth, which serves as a condition for the development of jhāna; this comes about through the cessation of the fever of craving.
Và āsayaposana (sự nuôi dưỡng ý chí) là sự thành tựu của ý chí đã đạt được nhờ các sự thực hành trước đây, v.v., là điều kiện cho sự phát triển thiền, và điều đó xảy ra khi tham ái và sự phiền não chấm dứt.
Tena vuttaṃ ‘‘taṇhāsaṃkilesavisodhanenā’’ti.
Therefore, it is said, "by purifying the defilements of craving."
Do đó, đã nói “bằng sự thanh lọc các ô nhiễm tham ái”.
Kāmesūti niddhāraṇe bhummaṃ.
"Among sensual pleasures" is the locative case for determination.
Trong các dục là sở hữu cách trong ý nghĩa xác định.
Anekabhedoti kāmāsavakāmarāgasaṃyojanādivasena rūpataṇhādivasena ca anekappabhedo.
"Manifold" means manifold by way of sensual cankers (kāmāsava), sensual desire (kāmarāgasaṃyojana), and so forth, and by way of craving for forms (rūpataṇhā) and so forth.
Anekabhedo (nhiều loại) là nhiều loại khác nhau theo kāmasava (lậu hoặc dục), kāmarāgasaṃyojana (kiết sử dục tham), v.v., và theo rūpataṇhā (tham ái sắc), v.v.
Kāmacchandoyevāti kāmasabhāvoyeva chando, na kattukamyatāchando napi kusalacchandoti adhippāyo.
"Sensual craving alone" means craving which is merely of the nature of sensuality, not the desire to act, nor wholesome desire; this is the intention.
Chỉ là kāmacchanda có nghĩa là chỉ là kāmasabhāva (bản chất của dục), không phải là chando (ý muốn) để làm điều gì, cũng không phải là chando thiện (kusalacchando).
Akusalapariyāpannopīti ‘‘vivicca akusalehī’’ti ettha vuttaakusalesu antogadhopi.
"Even though included in the unwholesome" means even though included in the unwholesome states mentioned in "secluded from unwholesome states."
Cũng nằm trong các bất thiện là cũng nằm trong các pháp bất thiện được nói đến trong “vivicca akusalehi” (ly các pháp bất thiện).
Jhānapaṭipakkhatoti jhānassa paṭipakkhabhāvato taṃhetu taṃnimittaṃ visuṃ vutto, akusalabhāvasāmaññena aggahetvā visuṃ sarūpena gahito.
"As an opponent of jhāna" means it is separately stated due to its opposing nature to jhāna, and for that reason and for that purpose, it is taken in its own essence separately, not generally as an unwholesome state.
Do đối lập với thiền nghĩa là do bản chất đối lập với thiền, nên nó được nói riêng biệt như một nguyên nhân, một dấu hiệu cho điều đó, không được xem xét chung như một pháp bất thiện mà được xem xét riêng biệt theo bản chất của nó.
Yadi kilesakāmova purimapade vutto, taṃ kathaṃ bahuvacananti āha ‘‘anekabhedato’’tiādi.
If only defilement-sensual pleasures are mentioned in the first phrase, how can it be in the plural? Thus, it is stated: "due to its manifold nature," and so forth.
Nếu chỉ có kilesakāma (phiền não dục) được nói đến trong vế câu đầu tiên, thì làm sao nó lại là số nhiều? Do đó, đã nói “do có nhiều loại” và tiếp theo.
Aññesampīti diṭṭhimānaahirikānottappādīnaṃ taṃsahitaphassādīnañca.
"Of others also" refers to wrong views (diṭṭhi), conceit (māna), shamelessness (ahirikā), lack of moral dread (anottappa), and so forth, and contact (phassa), etc., associated with them.
Của những cái khác nữa là của tà kiến, ngã mạn, vô tàm, vô quý, v.v., và của các xúc, v.v., đi kèm với chúng.
Uparijhānaṅgapaccanīkapaṭipakkhabhāvadassanatoti ‘‘savitakkaṃ savicāra’’ntiādinā upari vuccamānāni jhānaṅgāni uparijhānaṅgāni, tesaṃ attano paccanīkānaṃ paṭipakkhabhāvadassanato tappaccanīkanīvaraṇavacanaṃ.
"Because the opposing nature of the hindrances to the higher jhāna factors is shown" means the jhāna factors mentioned above by "with initial application, with sustained application" and so forth, are the higher jhāna factors. The statement about the hindrances opposing them is because their opposing nature to these factors is shown.
Do thấy bản chất đối lập với các chi thiền cao hơn nghĩa là các chi thiền cao hơn là những chi thiền sẽ được nói đến ở trên bằng “savitakkaṃ savicāraṃ” (có tầm, có tứ), v.v. Lời nói về các chướng ngại đối lập với chúng là do thấy bản chất đối lập của chúng với các chi thiền đó.
‘‘Uparijhānaṅgānaṃ paccanīkapaṭipakkhabhāvadassanato’’tipi pāṭho.
Another reading is "because the opposing nature of the hindrances to the higher jhāna factors is shown."
Cũng có bản văn “Uparijhānaṅgānaṃ paccanīkapaṭipakkhabhāvadassanatopi” (cũng do thấy bản chất đối lập với các chi thiền cao hơn).
Tattha paccanīkapaṭipakkhabhāvadassanatoti upari vuccamānajhānaṅgānaṃ ujuvipaccanīkavasena paṭipakkhabhāvadassanatoti atthaṃ vadanti.
Therein, "because the opposing nature of the hindrances is shown" means they say the meaning is because the opposing nature to the jhāna factors mentioned above is shown as directly contrary.
Ở đó, do thấy bản chất đối lập có nghĩa là thấy bản chất đối lập của các chi thiền sẽ được nói đến ở trên theo cách đối lập trực tiếp.
Jhānaṅgapaccanīkānīti jhānaṅgānaṃ pavattinivāraṇato jhānaṅgapaccanīkāni.
"Opponents of the jhāna factors" means they are opponents of the jhāna factors because they prevent the arising of the jhāna factors.
Các chướng ngại của chi thiền là các chướng ngại của chi thiền vì chúng ngăn cản sự phát sinh của các chi thiền.
Viddhaṃsakānīti vighātakāni.
"Destroyers" means obstructors.
Các pháp hủy diệt là các pháp phá hoại.
Samādhi kāmacchandassa paṭipakkhoti rāgapaṇidhiyā ujuvipaccanīkabhāvato nānārammaṇehi palobhitassa paribbhamantassa cittassa samādhānato kāmacchandassa samādhi paṭipakkho.
"Concentration is the opponent of sensual craving" means concentration is the opponent of sensual craving because it directly opposes the aspiration for lust, and because it establishes the mind that is enticed and wandering among various objects.
Định là đối lập với kāmacchanda nghĩa là định là đối lập với kāmacchanda vì nó đối lập trực tiếp với sự khao khát tham ái, và vì nó làm cho tâm đang lang thang, bị quyến rũ bởi các đối tượng khác nhau, trở nên an định.
Pīti byāpādassāti pāmojjena samānayogakkhemattā byāpādassa pīti paṭipakkhā.
"Rapture is the opponent of ill will" means rapture is the opponent of ill will because it is equally secure with joy.
Hỷ là đối lập với byāpāda nghĩa là hỷ là đối lập với byāpāda vì nó có sự an toàn và hạnh phúc tương tự như sự hoan hỷ.
Vitakko thinamiddhassāti yoniso saṅkappanavasena savipphārappavattito vitakko thinamiddhassa paṭipakkho.
"Initial application is the opponent of sloth and torpor" means initial application is the opponent of sloth and torpor because of its expansive activity through proper intention.
Tầm là đối lập với thinamiddha nghĩa là tầm là đối lập với thinamiddha vì nó phát sinh với sự lay động thông qua sự tác ý đúng đắn.
Sukhaṃ uddhaccakukkuccassāti sukhaṃ vūpasantasītalasabhāvattā avūpasamānutāpasabhāvassa uddhaccakukkuccassa paṭipakkhaṃ.
"Happiness is the opponent of restlessness and remorse" means happiness is the opponent of restlessness and remorse, which are of the nature of unrest and regret, because it is of a calmed and cool nature.
Lạc là đối lập với uddhaccakukkucca nghĩa là lạc đối lập với uddhaccakukkucca, có bản chất không an tịnh và phiền não, vì lạc có bản chất an tịnh và mát mẻ.
Vicāro vicikicchāyāti vicāro ārammaṇe anumajjanavasena paññāpatirūpasabhāvattā vicikicchāya paṭipakkho.
"Sustained application is the opponent of doubt" means sustained application is the opponent of doubt because it is of the nature of a counterpart to wisdom, through the activity of examining the object.
Tứ là đối lập với vicikicchā nghĩa là tứ là đối lập với vicikicchā vì nó có bản chất giống như trí tuệ thông qua việc xem xét kỹ lưỡng đối tượng.
Mahākaccānattherena desitā piṭakānaṃ saṃvaṇṇanā peṭakaṃ, tasmiṃ peṭake.
The Peṭaka is the exposition of the Piṭakas taught by the Elder Mahākaccāyana.
Sự giải thích các tạng kinh được Đại Trưởng lão Mahākaccāyana thuyết giảng là Peṭaka, trong Peṭaka đó.
Pañcakāmaguṇabhedavisayassāti rūpādipañcakāmaguṇavisesavisayassa.
"Having as its domain the varieties of the five sense-objects" refers to forms and other sense objects, having as its domain the particular five sense-objects.
Của đối tượng được phân loại theo năm dục lạc là của đối tượng đặc biệt được phân loại theo năm dục lạc như sắc, v.v.
Āghātavatthubhedādivisayānanti byāpādavivekavacanena ‘‘anatthaṃ me acarī’’tiādiāghātavatthubhedavisayassa dosassa, mohādhikehi thinamiddhādīhi vivekavacanena paṭicchādanavasena dukkhādipubbantādibhedavisayassa mohassa vikkhambhanaviveko vutto.
"And having as their domains the varieties of grounds for indignation" means that by the statement of seclusion from ill will (byāpāda), anger (dosa) whose domain is the varieties of grounds for indignation such as "he harmed me," etc., is taught; and by the statement of seclusion from sloth and torpor (thinamiddha), etc., which are overcome by delusion (moha), delusion whose domain is the varieties of the past, etc., such as suffering (dukkha), etc., through the nature of covering, is taught as a seclusion by temporary suppression (vikkhambhanaviveka).
Của đối tượng được phân loại theo các căn bản sân hận, v.v. nghĩa là bởi lời nói về sự viễn ly khỏi byāpāda, sự đàn áp sân hận được nói đến, là sân hận có đối tượng được phân loại theo các căn bản sân hận như “ông ấy đã làm hại tôi” và tiếp theo. Bởi lời nói về sự viễn ly khỏi thinamiddha (hôn trầm, thụy miên) và các pháp khác có nhiều si mê, sự đàn áp si mê được nói đến, là si mê có đối tượng được phân loại theo các tiền kiếp đau khổ và các thứ khác, theo cách che giấu.
Kāmarāgabyāpādatadekaṭṭhathinamiddhādivikkhambhakañcetaṃ sabbākusalapaṭipakkhasabhāvattā sabbakusalānaṃ, tena sabhāvena sabbākusalappahāyakaṃ hontampi kāmarāgādivikkhambhanasabhāvameva hoti taṃsabhāvattāti avisesetvā nīvaraṇākusalamūlādīnaṃ vikkhambhanaviveko vutto hotīti āha.
And this jhāna, which effects temporary suppression of sensual desire, ill will, and the associated sloth and torpor, etc., being of the nature of opposing all unwholesome states, and thus being able to abandon all unwholesome states by that nature, is still primarily of the nature of temporarily suppressing sensual desire, etc., due to its inherent nature. Thus, without differentiating, the temporary suppression (vikkhambhanaviveka) of the hindrances, roots of unwholesome states, etc., is stated; so he said.
Và thiền này, có bản chất đàn áp kāmarāga (dục tham), byāpāda (sân hận), thinamiddha (hôn trầm, thụy miên) và các pháp khác cùng loại, mặc dù có bản chất đối lập với tất cả các pháp bất thiện và là pháp đoạn trừ tất cả các pháp bất thiện theo bản chất đó, nhưng nó chỉ có bản chất đàn áp kāmarāga, v.v., vì nó có bản chất đó. Do đó, đã nói rằng sự viễn ly đàn áp các triền cái, các căn bất thiện, v.v., được nói đến mà không phân biệt.
Yathāpaccayaṃ pavattamānānaṃ sabhāvadhammānaṃ natthi kāci vasavattitāti vasavattibhāvanivāraṇatthaṃ ‘‘vitakkanaṃ vitakko’’ti vuttaṃ.
To preclude the state of being subject to one's will—since there is no mastery whatsoever over natural phenomena that proceed according to their conditions—it is said, " thinking is vitakka".
Các pháp tự tánh vận hành theo duyên không có bất kỳ sự tùy thuộc ý muốn nào. Để ngăn chặn sự tùy thuộc ý muốn đó, nên đã nói ‘vitakkanaṃ vitakko’ (sự suy nghĩ là tầm).
Vitakkananti hi vitakkanakiriyā, sā ca vitakkassa attano paccayehi pavattimattamevāti bhāvaniddeso vasavattibhāvanivāraṇāya hoti.
Thinking is the act of thinking, and that is merely the proceeding of vitakka from its own conditions. Thus, the indication of its state is for the preclusion of the state of being subject to one's will.
Thật vậy, vitakkana (sự suy nghĩ) là hành động suy nghĩ, và hành động đó chỉ là sự vận hành của tầm (vitakka) theo các duyên của chính nó. Do đó, sự trình bày về bản chất này là để ngăn chặn sự tùy thuộc ý muốn.
Tayidaṃ vitakkanaṃ ‘‘īdisamida’’nti ārammaṇaparikappananti āha ‘‘ūhananti vuttaṃ hotī’’ti.
This vitakkana is the conceiving of an object as “this is such-and-such,” hence he said, “it means it is called ‘reasoning’” ( ūhana).
Sự suy nghĩ này là sự suy xét đối tượng theo kiểu "nó là thế này", nên đã nói "ūhananti vuttaṃ hotī" (được gọi là sự suy xét).
Yasmā cittaṃ vitakkabalena ārammaṇaṃ abhiniruḷhaṃ viya hoti, tasmā so ārammaṇābhiniropanalakkhaṇo vutto.
Because the mind, by the power of vitakka, seems to have ascended onto the object, it is therefore said to have the characteristic of applying* onto an object.
Vì tâm nhờ sức của tầm mà như thể tiến nhập vào đối tượng, nên tầm được nói là có đặc tính đưa tâm đến đối tượng.
Yathā hi koci rājavallabhaṃ ñātiṃ vā mittaṃ vā nissāya rājagehaṃ ārohati anupavisati, evaṃ vitakkaṃ nissāya cittaṃ ārammaṇaṃ ārohati.
Just as someone, relying on a relative or a friend who is a royal favorite, ascends and enters the king's palace, so too the mind, relying on vitakka, ascends onto the object.
Ví như một người nào đó dựa vào một người thân cận hoặc bạn bè của vua mà đi vào cung vua, thì cũng vậy, tâm nương vào tầm mà tiến nhập vào đối tượng.
Yadi evaṃ kathaṃ avitakkaṃ cittaṃ ārammaṇaṃ ārohatīti?
If so, how does a mind without vitakka ascend onto an object?
Nếu vậy, làm sao tâm không có tầm (avitakka) lại có thể tiến nhập vào đối tượng?
Vitakkabaleneva.
By the power of vitakka itself.
Chính là nhờ sức của tầm.
Yathā hi so puriso paricayena tena vināpi nirāsaṅko rājagehaṃ pavisati, evaṃ paricayena vitakkena vināpi avitakkaṃ cittaṃ ārammaṇaṃ ārohati.
Just as that person, through familiarity, enters the king's palace without hesitation even without that*, so too the mind without vitakka, through familiarity, ascends onto the object even without vitakka.
Ví như người ấy nhờ quen biết mà không chút e dè đi vào cung vua dù không có người kia đi cùng, thì cũng vậy, tâm không có tầm nhờ quen biết mà vẫn tiến nhập vào đối tượng.
Paricayenāti ca santāne pavattavitakkabhāvanāsaṅkhātena paricayena.
And by “through familiarity” is meant through the familiarity known as the development of vitakka that has occurred in the mental continuum.
Và "paricayena" (nhờ quen biết) là nhờ sự quen thuộc được gọi là sự tu tập tầm đã vận hành trong dòng tương tục.
Vitakkassa hi santāne abhiṇhaṃ pavattassa vasena cittassa ārammaṇābhiruhanaṃ ciraparicitaṃ, tena taṃ kadāci vitakkena vināpi tattha pavattateva.
For, by means of the frequent arising of vitakka in the mental continuum, the mind's ascending onto the object becomes long-practiced; therefore, it sometimes arises there even without vitakka.
Thật vậy, sự tiến nhập vào đối tượng của tâm nhờ tầm vận hành liên tục trong dòng tương tục là một sự quen thuộc lâu dài, nên đôi khi tâm vận hành trên đối tượng đó ngay cả khi không có tầm.
Yathā taṃ ñāṇasahitaṃ hutvā sammasanavasena ciraparicitaṃ kadāci ñāṇarahitampi sammasanavasena pavattati, yathā vā kilesasahitaṃ hutvā pavattaṃ sabbaso kilesarahitampi paricayena kilesavāsanāvasena pavattati, evaṃsampadamidaṃ daṭṭhabbaṃ.
Just as a mind, having been long-practiced in association with knowledge by way of comprehension, sometimes proceeds by way of comprehension even when devoid of knowledge; or just as a mind that has arisen associated with defilements, even when completely free of defilements, proceeds through familiarity by the power of the latent tendencies of defilements—so should this be understood as an analogy.
Ví như một người có trí tuệ đã quen thuộc lâu ngày với sự suy xét, đôi khi vẫn suy xét ngay cả khi không có trí tuệ; hoặc ví như một tâm đã vận hành cùng với phiền não, đôi khi vẫn vận hành theo thói quen phiền não ngay cả khi hoàn toàn không có phiền não. Điều này nên được hiểu theo cách tương tự.
Āhananapariyāhananarasoti ādito, abhimukhaṃ vā hananaṃ āhananaṃ.
With the function of striking and striking all around: From the beginning or directly facing, the striking is āhanana.
Āhananapariyāhananaraso (vị chạm vào và chạm xung quanh) là: sự chạm từ ban đầu, hoặc sự chạm đối diện là āhanana (sự chạm vào).
Parito, parivattitvā vā āhananaṃ pariyāhananaṃ.
From all around, or striking repeatedly, is pariyāhanana.
Sự chạm xung quanh, hoặc sự chạm xoay vòng là pariyāhanana (sự chạm xung quanh).
‘‘Rūpaṃ rūpaṃ, pathavī pathavī’’ti ākoṭentassa viya pavatti āhananaṃ pariyāhanananti ca veditabbaṃ.
The occurrence like one striking with "form, form," or "earth, earth," should be understood as striking and striking all around.
Sự vận hành như đang gõ "sắc là sắc, đất là đất" nên được hiểu là āhanana và pariyāhanana.
Yasmiñhi ārammaṇe cittaṃ abhiniropeti, taṃ tassa gahaṇayogyaṃ karonto vitakko ākoṭento viya hoti.
For, on whatever object it applies the mind, vitakka, while making it suitable for grasping, is like one striking it.
Thật vậy, tầm như thể đang gõ vào đối tượng mà tâm đang đưa vào, khiến đối tượng đó trở nên thích hợp để nắm giữ.
Yadi evaṃ nāgasenattherena ‘‘ākoṭanalakkhaṇo vitakko.
If so, by the Elder Nāgasena,* " vitakka has the characteristic of striking.
Nếu vậy, tại sao Trưởng lão Nāgasena lại nói tầm có đặc tính gõ vào (ākoṭanalakkhaṇo vitakko)?
Yathā, mahārāja, bherī ākoṭitā atha pacchā anuravati anusaddāyati, evameva kho, mahārāja, yathā ākoṭanā, evaṃ vitakko daṭṭhabbo.
Just as, Your Majesty, when a drum is struck, it afterwards resonates and reverberates, even so, Your Majesty, vitakka should be seen as the striking.
"Thưa Đại vương, ví như khi trống được gõ, sau đó nó vang vọng, thì cũng vậy, thưa Đại vương, tầm nên được xem như sự gõ.
Atha pacchā anuravanā anusaddanā, evaṃ vicāro daṭṭhabbo’’ti ākoṭanalakkhaṇatā vitakkassa kasmā vuttā?
And the subsequent resonating and reverberating should be seen as vicāra." Why was the characteristic of striking stated for vitakka?
Và sau đó, sự vang vọng là sự suy xét (vicāra) nên được xem như vậy." Tại sao đặc tính gõ vào của tầm lại được nói như vậy?
Nāyaṃ virodho.
This is not a contradiction.
Không có sự mâu thuẫn này.
Therena hi kiccasannissitaṃ katvā lakkhaṇaṃ vuttaṃ.
For the Elder stated the characteristic in connection with its function.
Thật vậy, Trưởng lão đã nói đặc tính dựa trên chức năng.
Dhammānañhi sabhāvavinimuttā kāci kiriyā nāma natthi tathā gahetabbākāro ca.
Indeed, for dhammas, there is no activity whatsoever separate from their intrinsic nature, nor is there a mode in which they can be so grasped.
Vì không có hành động nào tách rời khỏi bản chất của các pháp, cũng không có cách nắm giữ nào như vậy.
Bodhaneyyajanānurodhena pana paramatthato ekībhāvopi sabhāvadhammo pariyāyavacanehi viya samāropitarūpehi bahūhi pakārehi pakāsīyati.
However, out of consideration for those to be taught, an intrinsic dhamma, which is in the ultimate sense a single entity, is explained in many ways with superimposed forms, as if with synonyms.
Tuy nhiên, tùy theo những người có thể giác ngộ, một pháp tự tánh có cùng bản chất tối hậu cũng được trình bày theo nhiều cách khác nhau, như thể bằng các từ ngữ gián tiếp và các hình thái được gán ghép.
Evañhi so suṭṭhu pakāsito hoti.
For in this way, it is well explained.
Thật vậy, bằng cách này, pháp đó được trình bày một cách rõ ràng.
Ānayanapaccupaṭṭhānoti ettha ānayanaṃ citte ārammaṇassa upanayanaṃ, ākaḍḍhanaṃ vā.
Manifesting as bringing forward: Here, ānayana is the bringing of the object to the mind, or the drawing of it.
Trong câu "ānayanapaccupaṭṭhāno" (có sự biểu hiện là đưa đến), ānayana (sự đưa đến) là sự đưa đối tượng đến tâm, hoặc sự kéo đến.
Anusañcaraṇaṃ anuparibbhamanaṃ.
Anusañcaraṇa is moving about continuously, wandering around.
Anusañcaraṇaṃ (sự đi theo sau) là sự đi vòng quanh theo sau.
Svāyaṃ viseso santānamhi labbhamāno eva santāne pākaṭo hotīti daṭṭhabbo.
This distinction, being found in the mental continuum, should be understood as becoming manifest in the continuum.
Đặc tính này, khi được tìm thấy trong dòng tương tục, sẽ trở nên rõ ràng trong dòng tương tục, nên cần phải hiểu như vậy.
Sesesupi eseva nayo.
This same method applies to the remaining cases as well.
Đối với các từ còn lại cũng theo cách tương tự.
Anumajjananti ārammaṇe cittassa anumasanaṃ, parimajjananti attho.
Anumajjana is the rubbing of the mind on the object; the meaning is polishing.
Anumajjanaṃ (sự xoa xát) là sự xoa xát tâm trên đối tượng, nghĩa là sự suy xét kỹ lưỡng.
Tathā hi ‘‘vicāro parimajjanahattho viya sañcaraṇahattho viyā’’ti ca vutto.
Thus, it is said that "vicāra is like a hand that polishes and like a hand that moves around."
Thật vậy, nó được nói là "sự suy xét (vicāra) như bàn tay xoa xát, như bàn tay di chuyển".
Tatthāti ārammaṇe.
Therein means on the object.
Tattha (ở đó) là trên đối tượng.
Sahajātānaṃ anuyojanaṃ ārammaṇe anuvicaraṇasaṅkhātaanumajjanavaseneva veditabbaṃ.
The application of co-nascent states should be understood by means of that very anumajjana, which is called scrutinizing the object.
Sự kết hợp của các pháp đồng sinh nên được hiểu chính là sự xoa xát (anumajjana) được gọi là sự suy xét kỹ lưỡng trên đối tượng.
Anuppabandhanaṃ ārammaṇe cittassa avicchinnassa viya pavatti.
Sustaining is the mind's proceeding on the object as if uninterruptedly.
Anuppabandhanaṃ (sự liên tục) là sự vận hành của tâm trên đối tượng như không bị gián đoạn.
Tathā hi so ‘‘anuppabandhanatā’’ti niddiṭṭho.
For it is described as "the state of being sustained."
Thật vậy, nó được định nghĩa là "anuppabandhanatā" (tính liên tục).
Teneva ca ‘‘ghaṇṭānuravo viya, paribbhamanaṃ viyā’’ti ca vutto.
And for that very reason, it is also said to be "like the resonance of a bell" and "like circling around."
Và vì thế, nó được nói là "như tiếng chuông ngân, như sự đi vòng quanh".
Katthacīti paṭhamajjhāne parittacittuppādesu ca.
In some cases means in the first jhāna and in minor mind-moments.
Katthaci (ở một số nơi) là trong thiền thứ nhất và trong các tâm sinh khởi nhỏ (parittacittuppādesu).
Oḷārikaṭṭhenāti vicārato oḷārikaṭṭhena.
Due to its grossness means due to its being grosser than vicāra.
Oḷārikaṭṭhenāti (vì thô thiển) là vì thô thiển hơn sự suy xét (vicāra).
Yathā ghaṇṭābhighātasaddo paṭhamābhinipāto hoti, evaṃ ārammaṇābhimukhaniropanaṭṭhena vitakko cetaso paṭhamābhinipāto viya hotīti āha ‘‘ghaṇṭābhighātasaddo viyā’’tiādi.
Just as the sound of a bell being struck is the first impact, so too, due to its nature of applying* towards the object, vitakka is like the first impact on the mind. Therefore, he said, "like the sound of a bell being struck," and so on.
Ví như tiếng chuông đập là sự va chạm ban đầu, thì cũng vậy, tầm như là sự va chạm ban đầu của tâm vì nó có đặc tính đưa tâm đến đối tượng. Nên đã nói "ghaṇṭābhighātasaddo viyā" (như tiếng chuông đập) v.v.
Vipphāravāti ettha vipphāro nāma vitakkassa thinamiddhapaṭipakkho ārammaṇe anolīnatā asaṅkoco, so pana abhiniropanabhāvena calanaṃ viya hotīti adhippāyenāha ‘‘paripphandanabhāvo cittassā’’ti.
Expansive: Here, vipphāra is vitakka's non-sluggishness, its lack of contraction on the object, which is the opposite of sloth and torpor. But since this occurs through the state of application, it is like a movement. With this intention, he said, "it is the movement of the mind."
Trong câu "vipphāravā" (có sự lan tỏa), vipphāro (sự lan tỏa) là sự không dính mắc, không co rút trên đối tượng, đối nghịch với hôn trầm và thụy miên của tầm. Và điều đó như là sự rung động vì có đặc tính đưa tâm đến đối tượng, nên đã nói "paripphandanabhāvo cittassā" (sự rung động của tâm).
Paribbhamanaṃ viyāti ettha parissayābhāvavīmaṃsanatthaṃ paribbhamananti veditabbaṃ.
Like circling around: Here, it should be understood as circling around to investigate the absence of danger.
Trong câu "paribbhamanaṃ viyā" (như sự đi vòng quanh), sự đi vòng quanh nên được hiểu là để tìm hiểu về sự không có nguy hiểm.
Dukanipātaṭṭhakathāyaṃ pana –
However, in the Commentary to the Dukanipāta:
Tuy nhiên, trong chú giải Dukanipāta thì nói:
Vuttaṃ, taṃ anuppabandhanena pavattiyaṃ yujjati.
This statement is appropriate for its arising with continuity.
Lời đó phù hợp với sự vận hành liên tục.
Tathā hi upacāre vā appanāyaṃ vā santānena pavattiyaṃ vitakko niccalo hutvā ārammaṇaṃ anupavisitvā viya pavattati, na paṭhamābhinipāte pākaṭo hoti.
Indeed, for that very reason, when arising in a continuum in access or appanā concentration, vitakka becomes steady and proceeds as if it has entered the object; it is not manifest as an initial impact.
Thật vậy, trong cận định (upacāra) hoặc nhập định (appanā), khi tầm vận hành liên tục, nó trở nên bất động và như thể đi sâu vào đối tượng, không còn rõ ràng như sự va chạm ban đầu.
Yathā hi apubbārammaṇe paṭhamābhinipātabhūto vitakko vipphāravā hoti, na tathā ekasmiṃyeva ārammaṇe nirantaraṃ anuppabandhavasena pavattiyaṃ, nātivipphāravā pana tattha hoti sannisinnabhāvato.
Just as vitakka, being the initial impact on a new object, is expansive, it is not so when arising uninterruptedly in a continuous manner on one and the same object; rather, it is not very expansive there, due to its settled nature.
Ví như tầm là sự va chạm ban đầu trên một đối tượng mới mẻ thì có sự lan tỏa, nhưng không phải như vậy khi nó vận hành liên tục trên cùng một đối tượng, mà ở đó nó không quá lan tỏa vì đã ổn định.
Paṭhamadutiyajjhānesu pākaṭo hotīti vitakkassa viseso abhiniropanākāro oḷārikattā paṭhamajjhāne pākaṭo hoti, tadabhāvato pañcakanaye dutiyajjhāne vicārassa viseso anumajjanākāro pākaṭo hoti.
Is manifest in the first and second jhānas: The specific characteristic of vitakka, its mode of application, is manifest in the first jhāna due to its grossness. Due to its absence, in the second jhāna of the five-fold system, the specific characteristic of vicāra, its mode of scrutiny, is manifest.
"Paṭhamadutiyajjhānesu pākaṭo hotī" (rõ ràng trong thiền thứ nhất và thứ hai) là: đặc tính riêng biệt của tầm, tức là sự đưa tâm đến đối tượng, rõ ràng trong thiền thứ nhất vì tính thô thiển của nó; do không có tầm, đặc tính riêng biệt của sự suy xét (vicāra), tức là sự xoa xát đối tượng, rõ ràng trong thiền thứ hai theo cách năm bậc.
Ayaṃ panettha aparo nayo – malaggahitaṃ kaṃsabhājanaṃ ekena hatthena daḷhaṃ gahetvā itarena hatthena cuṇṇatelaeḷakalomādikatacumbaṭakena parimajjantassa daḷhaṃ gahaṇahattho viya vitakko, parimajjanahattho viya vicāro.
Here, however, is another method: For one who, holding a soiled bronze bowl firmly with one hand, scrubs it with the other hand using a cloth with powder, oil, goat's hair, and so on, vitakka is like the hand that holds firmly, and vicāra is like the hand that scrubs.
Đây là một cách khác: tầm như bàn tay nắm chặt của người đang dùng một tay giữ chặt một cái bát đồng dơ bẩn và dùng tay kia xoa xát bằng một miếng giẻ có bột, dầu, lông cừu, v.v.; sự suy xét (vicāra) như bàn tay xoa xát.
Tathā kumbhakārassa daṇḍappahārena cakkaṃ bhamayitvā bhājanaṃ karontassa piṇḍassa uppīḷanahattho viya vitakko, tasseva ito cito ca sañcaraṇahattho viya vicāro.
Similarly, for a potter making a vessel after spinning the wheel by striking it with a stick, vitakka is like the hand pressing down on the lump of clay, and vicāra is like the hand moving over that same lump from side to side.
Cũng vậy, tầm như bàn tay nén cục đất sét của người thợ gốm đang làm bát bằng cách quay bánh xe bằng dùi; sự suy xét (vicāra) như bàn tay di chuyển qua lại trên cục đất sét đó.
Tathā kaṃsabhājanādīsu kiñci maṇḍalaṃ vaṭṭalekhaṃ karontassa majjhe sannirumbhitvā ṭhitakaṇṭako viya abhiniropano vitakko, bahi paribbhamanakaṇṭako viya anumajjano vicāroti veditabbaṃ.
Similarly, for one making a circular mark or a round line on a bronze bowl or the like, the application, vitakka, is to be understood as being like the compass point held steady in the center, while the scrutiny, vicāra, is like the compass point circling on the outside.
Cũng vậy, tầm là sự đưa tâm đến đối tượng như cái chốt đứng yên ở giữa của người đang vẽ một vòng tròn hoặc đường tròn trên bát đồng, v.v.; sự suy xét (vicāra) là sự xoa xát như cái chốt quay vòng bên ngoài, nên cần phải hiểu như vậy.
Yathā pupphaphalasākhādiavayavavinimutto avijjamānopi rukkho ‘‘sapuppho saphalo’’ti voharīyati, evaṃ vitakkādiaṅgavinimuttaṃ avijjamānampi jhānaṃ ‘‘savitakkaṃ savicāra’’nti voharīyatīti dassetuṃ ‘‘rukkho viyā’’tiādi vuttaṃ.
Just as a tree, though devoid of flowers, fruits, branches, and other parts, and even if not actually existing, is spoken of as "having flowers, having fruits," so too, to show that jhāna, though devoid of vitakka and other factors, and even if not actually existing, is spoken of as "accompanied by vitakka, accompanied by vicāra," the phrase " like a tree" and so forth was stated.
Để chỉ ra ý nghĩa rằng, giống như một cái cây, mặc dù không hiện hữu rõ ràng khi thoát khỏi các bộ phận như hoa, quả, cành, v.v., vẫn được gọi là "có hoa, có quả", thì tương tự như vậy, thiền, mặc dù không hiện hữu khi thoát khỏi các chi thiền như vitakka (tầm) và các chi khác, vẫn được gọi là "có vitakka, có vicāra", nên cụm từ "rukkho viyā" (như cây) và các từ khác đã được nói đến.
Vibhaṅge panātiādīsu jhānabhāvanāya puggalavasena desetabbattā ‘‘idha bhikkhu vivicceva kāmehī’’tiādinā (vibha. 508) puggalādhiṭṭhānena jhānāni uddiṭṭhānīti.
In the Vibhanga and other texts, because jhāna-bhāvanā is to be taught in terms of persons, the jhānas are indicated by means of a teaching based on persons, as in "here a bhikkhu, quite secluded from sensual pleasures," and so forth.
Trong các phần như "Vibhaṅge panā" (trong Vibhaṅga), vì thiền định cần được giảng dạy theo cá nhân, nên các thiền được nêu ra theo cách đặt nặng về cá nhân với câu "Ở đây, một tỳ khưu tách biệt khỏi các dục lạc..." (Vibha. 508).
Yadipi vibhaṅge puggalādhiṭṭhānā desanā katā, attho pana tatrāpi vibhaṅgepi yathā idha ‘‘iminā ca vitakkenā’’tiādinā dhammavasena vutto, evameva daṭṭhabbo, paramatthato puggalasseva abhāvatoti adhippāyo.
Even if the teaching in the Vibhanga is based on persons, the meaning there, even in the Vibhanga, should be understood as stated here in terms of phenomena by "with this vitakka" and so forth, because in the ultimate sense, there is no person; this is the intention.
Mặc dù trong Vibhaṅga, giáo pháp được trình bày theo cá nhân, nhưng ý nghĩa ở đó, cũng như ở đây, được nói đến theo pháp, ví dụ như "với vitakka này...", thì cũng phải được hiểu như vậy, vì xét về chân đế, cá nhân không tồn tại. Đó là ý nghĩa.
Atha vā jhānasamaṅgino vitakkavicārasamaṅgitādassanena jhānasseva savitakkasavicāratā vuttāti āha ‘‘attho pana tatrāpi evameva daṭṭhabbo’’ti.
Alternatively, the jhāna's quality of being savitakka and savicāra is stated by showing the jhāna-practitioner's possession of vitakka and vicāra; thus, it is said, " the meaning there too should be understood in the same way."
Hoặc, bằng cách chỉ ra sự đầy đủ của vitakka và vicāra ở người thành tựu thiền, trạng thái có vitakka và có vicāra của chính thiền đã được nói đến, nên đã nói "ý nghĩa ở đó cũng phải được hiểu như vậy".
Vivekasaddassa bhāvasādhanataṃ sandhāyāha ‘‘tasmā vivekā’’ti.
Referring to the bhāvasādhana (abstract noun formation) of the word viveka, it is stated, " therefore from seclusion."
Để chỉ ý nghĩa của từ "viveka" (viễn ly) là một danh từ hành động (bhāvasādhana), nên đã nói "tasmā vivekā" (do viễn ly đó).
Hetuatthe cetaṃ nissakkavacanaṃ, tasmā vivekā hetubhūtāti attho.
And this is an ablative case in the sense of cause; therefore, the meaning is: because of seclusion as the cause.
Đây là một từ ở cách ly cách với ý nghĩa nguyên nhân, vậy ý nghĩa là do viễn ly đó làm nhân.
Vivekasaddassa kattusādhanataṃ kammasādhanataṃ vā sandhāyāha ‘‘tasmiṃ vā viveke’’ti.
Referring to the kattusādhana (agent noun formation) or kammasādhana (object noun formation) of the word viveka, it is stated, " or in that seclusion."
Để chỉ ý nghĩa của từ "viveka" là một danh từ chủ động (kattusādhana) hoặc danh từ bị động (kammasādhana), nên đã nói "tasmiṃ vā viveke" (trong viễn ly đó).
‘‘Vivitto’’ti hi iminā nīvaraṇehi vinābhūto tehi vivecitoti ca sādhanadvayampi saṅgahitamevāti.
Indeed, by this "vivitto," both formations are included: "separated from hindrances" and "separated from them by others."
Thật vậy, với từ "vivitto" (đã viễn ly), cả hai cách thành lập danh từ (thoát khỏi các chướng ngại và được các chướng ngại làm cho viễn ly) đều được bao hàm.
Pinayatīti tappeti vaḍḍheti vā.
Pinayatī means "delights" or "increases."
Pinayatī có nghĩa là làm thỏa mãn hoặc làm tăng trưởng.
Sampiyāyanalakkhaṇāti paritussanalakkhaṇā.
Sampiyāyanalakkhaṇā means "having the characteristic of delighting greatly."
Sampiyāyanalakkhaṇā (đặc tính của sự vui thích) có nghĩa là đặc tính của sự hoan hỷ.
Pīnanarasāti paribrūhanarasā.
Pīnanarasā means "having the function of fortifying" (body and mind).
Pīnanarasā (chức năng làm sung mãn) có nghĩa là chức năng làm tăng trưởng thân và tâm.
Pharaṇarasāti paṇītarūpehi kāyassa byāpanarasā.
Pharaṇarasā means "having the function of pervading the body with delightful forms."
Pharaṇarasā (chức năng lan tỏa) có nghĩa là chức năng làm lan tỏa thân thể với những sắc pháp vi diệu.
Udaggabhāvo odagyaṃ.
The state of elation is odagyaṃ.
Trạng thái hân hoan là odagyaṃ (hân hoan).
Sukhayatīti sukhaṃ, attanā sampayuttadhamme laddhassāde karotīti attho.
Sukhaṃ means "it makes happy"; that is, it makes the conjoined phenomena experience delight in oneself.
Làm cho hạnh phúc là sukhaṃ (lạc), nghĩa là làm cho các pháp tương ưng với nó có được sự thỏa mãn.
Svāyaṃ kattuniddeso pariyāyaladdho dhammato aññassa kattunivattanattho, nippariyāyena pana bhāvasādhanameva labbhatīti ‘‘sukhanaṃ sukha’’nti vuttaṃ.
This nominative in the agent sense is obtained indirectly, for the purpose of excluding an agent other than the phenomenon itself; directly, however, only the bhāvasādhana is obtained, hence it is stated, " sukhanaṃ sukhaṃ" (making happy is happiness).
Sự chỉ định chủ thể này được đạt được theo nghĩa gián tiếp, với mục đích loại bỏ một chủ thể khác ngoài pháp. Tuy nhiên, theo nghĩa trực tiếp, chỉ có thể là danh từ hành động, nên đã nói "sukhanaṃ sukha" (sự làm cho hạnh phúc là lạc).
Sātalakkhaṇanti iṭṭhasabhāvattā taṃsamaṅgīpuggalaṃ, sampayuttadhamme vā attani sādayatīti sātaṃ da-kārassa ta-kāraṃ katvā.
Sātalakkhaṇaṃ (having the characteristic of pleasantness) means that, due to its agreeable nature, it delights the person endowed with it or the conjoined phenomena in oneself, by changing the 'da' to 'ta' (i.e., sādayati to sāta).
Sātalakkhaṇaṃ (đặc tính của sự thỏa mãn) là vì có bản chất đáng mong muốn, nên làm cho người thành tựu nó hoặc các pháp tương ưng thỏa mãn trong chính mình, bằng cách đổi chữ 'da' thành 'ta' để thành 'sātaṃ'.
Sātaṃ madhuranti vadanti, sātaṃ lakkhaṇaṃ etassāti sātalakkhaṇaṃ.
They say sāta is pleasant. Sātalakkhaṇaṃ means 'whose characteristic is pleasantness'.
Họ nói 'sātaṃ' là ngọt ngào. Có đặc tính là sự thỏa mãn, nên nó là sātalakkhaṇaṃ.
Upabrūhanarasantiādīsu upabrūhanaṃ sampayuttadhammānaṃ saṃvaddhanaṃ, dukkhaṃ viya avissajjetvā adukkhamasukhā viya anajjhupekkhitvā anu anu gaṇhanaṃ upakāritā vā anuggaho.
In upabrūhanarasaṃ and so forth, upabrūhanaṃ is the increase of conjoined phenomena, or support, a form of assistance, like holding on continually without discarding like suffering or neglecting like neither-painful-nor-pleasant.
Trong các từ như upabrūhanarasaṃ (chức năng tăng trưởng), upabrūhanaṃ là sự tăng trưởng các pháp tương ưng, hoặc sự hỗ trợ, sự giúp đỡ bằng cách nắm giữ liên tục, không từ bỏ như khổ, và không thờ ơ như vô khổ vô lạc.
Katthacīti paṭhamajjhānādike.
Katthaci means "in the first jhāna and so forth."
Katthacī (đôi khi) là trong sơ thiền và các thiền khác.
Paṭilābhatuṭṭhīti paṭilābhavasena uppajjanakatuṭṭhi.
Paṭilābhatuṭṭhī means "delight arising through attainment."
Paṭilābhatuṭṭhī (sự hoan hỷ do thành tựu) là sự hoan hỷ phát sinh do sự thành tựu.
Paṭiladdharasānubhavananti paṭiladdhassa ārammaṇarasassa anubhavanaṃ.
Paṭiladdharasānubhavanaṃ means "the experience of the attained flavor of the object."
Paṭiladdharasānubhavanaṃ (trải nghiệm hương vị của đối tượng đã đạt được) là sự trải nghiệm hương vị của đối tượng đã đạt được.
Etena pītisukhāni sabhāvato vibhajitvā dassitāni.
By this, pīti and sukha are shown as distinct in nature.
Qua đó, pīti và sukha được phân biệt theo bản chất.
Yattha pīti, tattha sukhanti vitakkassa viya vicārena pītiyā sukhena accantasaṃyogamāha.
Where there is pīti, there is sukha speaks of the absolute concomitance of pīti with sukha, just as with vitakka and vicāra.
Yattha pīti, tattha sukhaṃ (ở đâu có pīti, ở đó có sukha) nói về sự kết hợp tuyệt đối của pīti với sukha, giống như vitakka với vicāra.
Yattha sukhaṃ, tattha na niyamato pītīti vicārassa viya vitakkena, sukhassa pītiyā anaccantasaṃyogaṃ.
Where there is sukha, pīti is not necessarily present refers to the non-absolute concomitance of sukha with pīti, just as with vicāra and vitakka.
Yattha sukhaṃ, tattha na niyamato pītī (ở đâu có sukha, ở đó không nhất thiết có pīti) nói về sự không kết hợp tuyệt đối của sukha với pīti, giống như vicāra với vitakka.
Tena accantānaccantasaṃyogitāya pītisukhānaṃ visesaṃ dasseti.
Thereby, it shows the distinction between pīti and sukha through their absolute and non-absolute concomitance.
Qua đó, chỉ ra sự khác biệt của pīti và sukha qua sự kết hợp tuyệt đối và không tuyệt đối.
Kaṃ udakaṃ tārenti etthāti kantāraṃ, nirudakamaruṭṭhānaṃ.
Where they can cross (tārenti) water (kaṃ), that is kantāraṃ, a waterless desert region.
Nơi mà người ta có thể vượt qua nước đó là kantāraṃ (sa mạc), một vùng đất hoang vắng không có nước.
Vanameva vanantaṃ.
A forest itself is vanantaṃ.
Chính khu rừng là vanantaṃ (rìa rừng).
Vanacchāyappavesanaudakaparibhogesu viya sukhanti yathā hi puriso mahākantāramaggaṃ paṭipanno ghammapareto tasito pipāsito paṭipathe purisaṃ disvā ‘‘kattha pānīyaṃ atthī’’ti puccheyya, so ‘‘aṭaviṃ uttaritvāva jātassaravanasaṇḍo atthi, tattha gantvā labhissasī’’ti vadeyya, so tassa kathaṃ sutvāva haṭṭhapahaṭṭho bhaveyya, tato gacchanto bhūmiyaṃ patitāni uppaladalanāḷapattādīni disvā suṭṭhutaraṃ haṭṭhapahaṭṭho hutvā gacchanto allavatthe allakese purise passeyya, vanakukkuṭavanamorādīnaṃ saddaṃ suṇeyya, jātassarapariyante jātamaṇijālasadisaṃ nīlavanasaṇḍaṃ passeyya, sare jātāni uppalapadumakumudāni passeyya, acchaṃ vippasannaṃ udakampi passeyya, so bhiyyo bhiyyo haṭṭhapahaṭṭho hutvā jātassaraṃ otaritvā yathāruci nhatvā ca pivitvā ca passaddhadaratho bhisamuḷālapokkharādīni khāditvā nīluppalādīni piḷandhitvā mandālavamūlāni khandhe khipitvā uttaritvā sāṭakaṃ nivāsetvā udakasāṭakaṃ ātape katvā sītacchāyāya mandamande vāte paharante nipannova ‘‘aho sukhaṃ aho sukha’’nti vadeyya, evaṃsampadamidaṃ daṭṭhabbaṃ.
Happiness like entering the shade of a forest and consuming water: Just as a man traveling a great desert path, oppressed by heat, thirsty and craving water, might see a man on the path and ask, "Where is water?" and that man would say, "Having crossed the jungle, there is a forest grove with a natural lake; go there and you will get it." Hearing his words, the first man would become joyful and elated. Then, as he proceeds, seeing fallen lotus petals, stems, and leaves on the ground, he would become even more joyful and elated. As he continues, he would see men with wet clothes and wet hair, hear the calls of jungle fowl and peacocks, see a blue forest grove at the edge of the natural lake resembling a net of jewels, and see lotuses, water lilies, and kumuda flowers growing in the lake, and also see clear, purified water. That man, becoming more and more joyful and elated, would descend into the natural lake, bathe and drink as he wished, and with his distress calmed, he would eat lotus roots and stalks, adorn himself with blue lotuses and the like, throw mandālava roots onto his shoulder, emerge from the lake, put on his outer robe, dry his water-robe in the sun, and lying in the cool shade with gentle breezes blowing, he would exclaim, "Oh, what happiness! Oh, what happiness!" In the same way, this example should be understood.
Vanacchāyappavesanaudakaparibhogesu viya sukhaṃ (hạnh phúc như khi vào bóng cây rừng và dùng nước) có nghĩa là: Giống như một người đàn ông, bị nóng bức, khát nước, đang đi trên một con đường sa mạc lớn, khi thấy một người trên đường, có thể hỏi: "Nước ở đâu?". Người kia có thể trả lời: "Hãy vượt qua khu rừng, có một khu rừng có hồ tự nhiên, đến đó anh sẽ tìm thấy nước." Nghe lời đó, người đàn ông sẽ rất vui mừng. Sau đó, khi đi, anh ta thấy những cánh sen, lá sen, v.v. rơi trên mặt đất, anh ta sẽ càng vui mừng hơn. Khi đi tiếp, anh ta thấy những người đàn ông với quần áo ướt, tóc ướt. Anh ta nghe tiếng gà rừng, công rừng, v.v. Anh ta thấy một khu rừng xanh biếc giống như mạng lưới ngọc quý mọc quanh hồ tự nhiên. Anh ta thấy những bông sen xanh, sen hồng, súng mọc trong hồ, và thấy nước trong sạch, tinh khiết. Người đàn ông đó sẽ càng vui mừng hơn nữa, xuống hồ tự nhiên, tắm và uống tùy thích, với sự lo lắng đã lắng xuống, anh ta ăn củ sen, ngó sen, v.v., đeo những bông sen xanh, v.v., vắt rễ cây mandālava lên vai, lên khỏi hồ, mặc lại y phục, phơi y phục tắm nắng, rồi nằm xuống trong bóng mát lạnh, gió nhẹ thổi qua, và nói: "Ôi hạnh phúc! Ôi hạnh phúc!" Tương tự như vậy, điều này phải được hiểu.
Tassa hi purisassa jātassaravanasaṇḍasavanato paṭṭhāya yāva udakadassanā haṭṭhapahaṭṭhakālo viya pubbabhāgārammaṇe haṭṭhapahaṭṭhākārā pīti, nhāyitvā ca pivitvā ca sītacchāyāya mandamande vāte paharante ‘‘aho sukhaṃ aho sukha’’nti vadanto nipannakālo viya balappattaṃ ārammaṇarasānubhavanākārasaṇṭhitaṃ sukhaṃ.
For that man, the state of being joyful and elated from hearing about the forest grove with the natural lake until seeing the water, is like pīti, the feeling of exhilaration regarding the preliminary object. And the time when he lies down, saying, "Oh, what happiness! Oh, what happiness!" after bathing, drinking, and being fanned by gentle breezes in the cool shade, is like sukha, which is established in the mode of experiencing the strong flavor of the object.
Đối với người đàn ông đó, từ khi nghe về khu rừng có hồ tự nhiên cho đến khi nhìn thấy nước, khoảng thời gian vui mừng hân hoan đó giống như pīti (hỷ) dưới dạng hân hoan trước đối tượng ở giai đoạn đầu. Còn sau khi tắm và uống, nằm xuống trong bóng mát lạnh, gió nhẹ thổi qua, nói "Ôi hạnh phúc! Ôi hạnh phúc!", khoảng thời gian đó giống như sukha (lạc), được hình thành dưới dạng trải nghiệm hương vị đối tượng đã đạt đến sức mạnh.
Tasmiṃ tasmiṃ samayeti iṭṭhārammaṇassa paṭilābhasamaye paṭiladdhassa rasānubhavanasamaye vanacchāyādīnaṃ savanadassanasamaye paribhogasamaye ca.
In that very moment means at the moment of attaining the desired object, and at the moment of experiencing the flavor of the attained object, and at the moment of hearing and seeing the forest shade and so forth, and at the moment of consuming.
Tasmiṃ tasmiṃ samaye (vào từng thời điểm đó) là vào thời điểm đạt được đối tượng mong muốn, vào thời điểm trải nghiệm hương vị đã đạt được, vào thời điểm nghe và thấy bóng cây rừng và các thứ khác, và vào thời điểm sử dụng.
Pākaṭabhāvatoti yathākkamaṃ pītisukhānaṃ vibhūtabhāvato.
Pākaṭabhāvato means due to the manifestation of pīti and sukha in due order.
Pākaṭabhāvato (do sự rõ ràng) là do sự hiển lộ rõ ràng của pīti và sukha theo thứ tự.
Vivekajaṃ pītisukhanti ettha purimasmiṃ atthe vivekajanti jhānaṃ vuttaṃ.
In the phrase vivekajaṃ pītisukhaṃ, in the former sense, jhāna is called vivekajaṃ.
Trong cụm từ vivekajaṃ pītisukhaṃ (hỷ lạc do viễn ly sinh), trong ý nghĩa đầu tiên, thiền được gọi là vivekajaṃ (do viễn ly sinh).
Pītisukhasaddato ca atthiatthavisesavato assa jhānassa, asmiṃ vā jhāneti ettha akāro daṭṭhabbo yathā arisasoti.
And from the word pītisukha and from the specific meaning of atthi (there is), the letter 'a' in " assa jhānassa, asmiṃ vā jhāne" should be understood as in "ariso aso" (a faultless one).
Và từ pītisukha (hỷ lạc), và từ sự đặc biệt về ý nghĩa, chữ 'a' trong assa jhānassa, asmiṃ vā jhāne (của thiền này, hoặc trong thiền này) phải được hiểu, giống như trong 'arisaso'.
Dutiye pītisukhameva vivekajaṃ, vivekajaṃpītisukhanti ca aññapadatthasamāso paccattaniddesassa ca alopo kato, lope vā sati ‘‘vivekajapītisukha’’nti pāṭhoti ayaṃ viseso.
In the second sense, pītisukha itself is vivekajaṃ; vivekajaṃ pītisukhaṃ is a compound referring to another meaning, and the elision of the nominative indicator is made. Alternatively, if there is elision, the reading is "vivekaja pītisukhaṃ"; this is the distinction.
Trong ý nghĩa thứ hai, chính pītisukha là vivekajaṃ. Và vivekajaṃ pītisukhaṃ là một hợp chất aññapadatthasamāso (hợp chất chỉ một ý nghĩa khác), và sự bỏ đi của cách thứ nhất đã được thực hiện. Hoặc, nếu có sự bỏ đi, thì cách đọc là "vivekajapītisukhaṃ" (hỷ lạc do viễn ly sinh). Đó là sự khác biệt.
Gaṇanānupubbato paṭhamanti iminā desanākkamaṃ ulliṅgeti.
By " first in the order of enumeration," the sequence of instruction is indicated.
Với cụm từ gaṇanānupubbato paṭhamaṃ (đầu tiên theo thứ tự đếm), chỉ ra thứ tự giảng dạy.
‘‘Gaṇanānupubbatā paṭhama’’ntipi pāṭho, tatthāpi gaṇanānupubbatāyāti attho, gaṇanānupubbatāmattaṃ vā paṭhamanti idaṃ vacananti attho.
The reading is also "gaṇanānupubbatā paṭhamaṃ"; there too, the meaning is "by the sequential order of enumeration," or "first is merely the sequential order of enumeration," this is the saying.
Cũng có cách đọc là "gaṇanānupubbatā paṭhamaṃ" (đầu tiên theo thứ tự đếm). Ở đó, ý nghĩa là theo thứ tự đếm, hoặc ý nghĩa là chỉ riêng thứ tự đếm là "đầu tiên", đây là lời nói.
Paṭhamaṃ samāpajjatīti paṭhamanti idaṃ pana na ekantalakkhaṇaṃ.
However, this statement, " first, because one attains it first," is not an absolute characteristic.
Tuy nhiên, câu paṭhamaṃ samāpajjatīti paṭhamaṃ (đạt được đầu tiên là đầu tiên) này không phải là một đặc tính tuyệt đối.
Ciṇṇavasībhāvo hi aṭṭhasamāpattilābhī ādito paṭṭhāya matthakaṃ pāpentopi samāpajjituṃ sakkoti, matthakato paṭṭhāya ādiṃ pāpentopi samāpajjituṃ sakkoti, antarantarā okkamantopi sakkoti.
Indeed, a person who has attained the eight attainments and has mastered them can enter them starting from the beginning and reaching the highest, or starting from the highest and reaching the beginning, or even entering them intermittently.
Thật vậy, một người đã thuần thục và đạt được tám thiền định có thể nhập thiền từ ban đầu cho đến đỉnh, hoặc từ đỉnh cho đến ban đầu, hoặc có thể nhập thiền xen kẽ.
Evaṃ pubbuppattiyaṭṭhena pana paṭhamaṃ uppannantipi paṭhamaṃ.
Thus, "first" also means "that which arose first" in the sense of prior occurrence.
Tương tự như vậy, theo nghĩa là sự phát sinh đầu tiên, cái gì phát sinh đầu tiên cũng là đầu tiên.
Teneva visuddhimagge (visuddhi. 1.75) ‘‘gaṇanānupubbatā paṭhamaṃ, paṭhamaṃ uppannantipi paṭhama’’nti ettakameva vuttaṃ.
For this very reason, in the Visuddhimagga, only this much is stated: "first by the order of enumeration, and first also means that which arose first."
Chính vì thế, trong Visuddhimagga (Visuddhi. 1.75) chỉ nói rằng: "Đầu tiên theo thứ tự đếm, và cái gì phát sinh đầu tiên cũng là đầu tiên."
Paccanīkadhamme jhāpetīti nīvaraṇādipaccanīkadhamme dahati, vikkhambhanavasena pajahatīti attho.
Paccanīkadhamme jhāpetī means that it burns up opposing phenomena such as the hindrances, that is, it abandons them by way of suppression.
Paccanīkadhamme jhāpetī có nghĩa là đốt cháy các pháp đối nghịch như các triền cái (nīvaraṇa), tức là từ bỏ chúng bằng cách trấn áp.
Gocaranti kasiṇādiālambanaṃ.
Gocara means the meditation object (ālambana) such as a kasiṇa.
Gocara là đối tượng như kasiṇa (biến xứ) và các loại khác.
Tanti taṃ gocaraṃ.
Taṃ means that gocara.
Taṃ (nó) là đối tượng (gocara) đó.
Upanijjhāyatīti passati.
Upanijjhāyati means sees.
Upanijjhāyatī có nghĩa là quan sát.
Saha upacārenāti saddhiṃ upacārajjhānena.
Saha upacārena means together with access jhāna.
Saha upacārena (cùng với cận định) có nghĩa là cùng với cận định jhāna.
Kasiṇārammaṇūpanijjhāyanatoti pathavīkasiṇādino attano ārammaṇassa rūpaṃ viya cakkhunā upanijjhāyanato.
Kasiṇārammaṇūpanijjhāyanato means from closely contemplating one's own meditation object, such as the earth kasiṇa, as if it were a visible form seen with the eye.
Kasiṇārammaṇūpanijjhāyanato có nghĩa là do quán sát đối tượng của mình như biến xứ đất (pathavīkasiṇa) và các loại khác, giống như nhìn một sắc tướng bằng mắt.
Lakkhaṇūpanijjhāyanatoti yathāsambhavaṃ aniccādilakkhaṇattayassa nibbānadhātuyā tathalakkhaṇassa ca upanijjhāyanato.
Lakkhaṇūpanijjhāyanato means from closely contemplating, as appropriate, the three characteristics of impermanence (anicca) and so forth, and also the true characteristic (tathalakkhaṇa) of the nibbāna-dhātu.
Lakkhaṇūpanijjhāyanato có nghĩa là do quán sát ba tướng vô thường (anicca) và các loại khác tùy theo khả năng, và quán sát tướng chân thật (tathalakkhaṇa) của Niết Bàn giới.
Tenevāha ‘‘ettha hī’’tiādi.
Therefore, he said, "Here, indeed," and so on.
Vì lẽ đó, Ngài đã nói “ettha hi” (ở đây) v.v.
Niccādivipallāsappahānena maggo asammohato aniccādilakkhaṇāni upanijjhāyatīti lakkhaṇūpanijjhānanti āha ‘‘vipassanāya upanijjhāyanakicca’’ntiādi.
The Path, being free from delusion through the abandoning of perversions such as permanence, closely contemplates the characteristics of impermanence (anicca) and so forth; thus, it is contemplation of characteristics (lakkhaṇūpanijjhāna). Therefore, he stated, "the function of contemplating with vipassanā," and so on.
Con đường (magga), do không mê lầm nhờ đoạn trừ các sự đảo lộn về thường (nicca) và các loại khác, quán sát các tướng vô thường (anicca) và các loại khác, nên được gọi là quán sát tướng (lakkhaṇūpanijjhāna). Do đó, Ngài nói “vipassanāya upanijjhāyanakicca” (công việc quán sát của tuệ quán) v.v.
Tathalakkhaṇanti avināsadhammassa nibbānassa anaññathābhāvato aviparītasabhāvo tathalakkhaṇaṃ, maggassapi vā nibbānārammaṇato tathalakkhaṇūpanijjhānatā yojetabbā.
Tathalakkhaṇa means the unperverted nature of Nibbāna, which is imperishable, due to its unchangeable state. Or, it should be connected with the Path's contemplation of the true characteristic due to Nibbāna being its object.
Tathalakkhaṇa là bản chất không thay đổi, không sai khác của Niết Bàn, một pháp không hoại diệt. Hoặc, cũng có thể hiểu rằng con đường (magga) quán sát tướng chân thật (tathalakkhaṇa) là do Niết Bàn là đối tượng của nó.
Visadisodāharaṇaṃ tāva dassento āha ‘‘yathā sadhano’’tiādi.
Then, showing an inappropriate example, he said, "Just as a wealthy person," and so on.
Trước hết, để đưa ra một ví dụ không tương đồng, Ngài nói “yathā sadhano” (ví như người có tài sản) v.v.
Añño apadesāraho hotīti dhanato parijanato ca añño dhanavā parijanavā ca puriso saha dhanena vattati parijanena cāti sadhano saparijanoti apadesaṃ arahatīti apadesāraho hoti, apadisitabbo hotīti vuttaṃ hoti.
Añño apadesāraho hoti means that a wealthy man, or a man with attendants, who is distinct from his wealth and attendants, is called "wealthy" or "with attendants" because he exists with his wealth and attendants. This means he is worthy of being designated, he should be designated.
Añño apadesāraho hoti có nghĩa là một người đàn ông giàu có và có người hầu, khác với tài sản và người hầu, sống cùng với tài sản và người hầu, nên được gọi là người có tài sản, có người hầu. Điều này có nghĩa là anh ta xứng đáng được gọi tên như vậy.
Senaṅgesu eva senāsammutīti rathādisenaṅgavinimuttāya senāya abhāvepi rathehi pattīhi ca saha vattanato sarathā sapatti senāti rathādisenaṅgesuyeva senāvohāroti attho.
Senaṅgesu eva senāsammutī means that the designation "army" (senā) applies only to the army's components, such as chariots, because even in the absence of an army separate from these components, it exists with chariots and infantry; thus, it is called an army with chariots and infantry.
Senaṅgesu eva senāsammutī có nghĩa là ngay cả khi không có quân đội tách rời khỏi các bộ phận quân sự như xe ngựa, thì việc gọi là quân đội có xe ngựa, có bộ binh vẫn chỉ là cách gọi quân đội trong các bộ phận quân sự như xe ngựa, bộ binh mà thôi.
Kasmā panettha jhānapāṭhe aggahitā cittekaggatā gahitāti anuyogaṃ sandhāyāha ‘‘avuttattā’’tiādi.
Addressing the question of why one-pointedness of mind (cittekaggatā), though not mentioned in the jhāna passage, is nevertheless included, he said, "due to its not being stated," and so on.
Để giải đáp câu hỏi tại sao tâm định nhất (cittekaggatā) không được đề cập trong phần jhāna này, Ngài nói “avuttattā” (vì không được nói đến) v.v.
Evaṃ vuttāyevāti evaṃ sarūpato vibhaṅge vuttāyeva.
Evaṃ vuttāyeva means it is already stated in this form in the Vibhaṅga.
Evaṃ vuttāyevā có nghĩa là chỉ những gì đã được nói đến như vậy trong Vibhaṅga.
Sacittekaggatanti idha avuttepīti ‘‘sacittekaggata’’nti evaṃ sarūpato imasmiṃ jhānapāṭhe avuttepīti attho, sāmaññato pana jhānaggahaṇena gahitā eva.
Sacittekaggatanti idha avuttepi means that even though "sacittekaggataṃ" is not explicitly stated in this jhāna passage, it is implicitly included by the general term "jhāna."
Sacittekaggatanti idha avuttepī có nghĩa là mặc dù tâm định nhất (cittekaggatā) không được nói đến một cách rõ ràng trong phần jhāna này, nhưng nó vẫn được bao hàm một cách tổng quát trong khái niệm jhāna.
Tenevāha ‘‘yena hī’’tiādi.
Therefore, he stated, "Because indeed," and so on.
Vì lẽ đó, Ngài đã nói “yena hī” (vì lẽ đó) v.v.
Idaṃ vuttaṃ hoti – yena vitakkādīhi saha vattabbaṃ, taṃ dhammaṃ dīpetuṃ tassa pakāsanādhippāyena ‘‘savitakkaṃ savicāra’’ntiādinā uddeso kato, so eva adhippāyo tena bhagavatā vibhaṅge (vibha. 569) ‘‘cittassekaggatā’’ti niddisantena pakāsito, tasmā sā jhānapāṭhe aggahitāti na cintetabbanti.
This is what is meant: the enumeration beginning with "savitakkaṃ savicāraṃ" was made with the intention of revealing that phenomenon which should be associated with vitakka and so forth; that very intention was clarified by the Blessed One in the Vibhaṅga by designating it as "cittassekaggatā" (one-pointedness of mind). Therefore, one should not think that it is not included in the jhāna passage.
Điều này có nghĩa là: Để làm sáng tỏ pháp cần được nói đến cùng với tầm (vitakka) và tứ (vicāra) v.v., Đức Thế Tôn đã đưa ra phần tóm tắt bắt đầu bằng “có tầm, có tứ” (savitakkaṃ savicāraṃ) v.v. với ý định làm rõ điều đó. Ý định ấy đã được Đức Thế Tôn làm sáng tỏ trong Vibhaṅga (Vibha. 569) khi Ngài chỉ rõ “tâm định nhất” (cittassekaggatā). Do đó, không nên nghĩ rằng nó không được bao gồm trong phần jhāna này.
Vūpasamāti vūpasamahetu.
Vūpasamā means due to cessation.
Vūpasamā có nghĩa là do sự lắng dịu.
Vūpasamoti cettha pahānaṃ adhippetaṃ, tañca vitakkavicārānaṃ atikkamo atthato dutiyajjhānakkhaṇe anuppādoti āha ‘‘samatikkamā’’tiādi.
Here, by vūpasama, abandonment is intended, which is the transcending of vitakka and vicāra, and in essence, their non-arising at the moment of the second jhāna. Thus, he said, "by transcending," and so on.
Ở đây, lắng dịu (vūpasama) được hiểu là sự đoạn trừ, và sự đoạn trừ đó là sự vượt qua tầm (vitakka) và tứ (vicāra), theo nghĩa là chúng không khởi lên trong khoảnh khắc của nhị thiền. Vì vậy, Ngài nói “samatikkamā” (do vượt qua) v.v.
Katamesaṃ panettha vitakkavicārānaṃ vūpasamo adhippeto, kiṃ paṭhamajjhānikānaṃ, udāhu dutiyajjhānikānanti, kiñcettha – yadi paṭhamajjhānikānaṃ, natthi tesaṃ vūpasamo.
Which vitakka and vicāra are here intended by cessation? Is it those of the first jhāna, or those of the second jhāna? And what if it is those of the first jhāna, their cessation does not exist.
Ở đây, sự lắng dịu của tầm và tứ nào được đề cập? Là của tầm và tứ thuộc sơ thiền, hay của tầm và tứ thuộc nhị thiền? Và ở đây, nếu là của tầm và tứ thuộc sơ thiền, thì chúng không có sự lắng dịu.
Na hi kadāci paṭhamajjhānaṃ vitakkavicārarahitaṃ atthi.
Indeed, the first jhāna is never without vitakka and vicāra.
Thật vậy, sơ thiền không bao giờ vắng bóng tầm và tứ.
Atha dutiyajjhānikānaṃ, evampi nattheva vūpasamo sabbena sabbaṃ tesaṃ tattha abhāvatoti imaṃ anuyogaṃ sandhāyāha ‘‘tattha kiñcāpī’’tiādi.
If it is those of the second jhāna, then too cessation does not exist at all, since they are totally absent there. Addressing this query, he said, "There, although," and so on.
Nếu là của tầm và tứ thuộc nhị thiền, thì cũng không có sự lắng dịu, vì chúng hoàn toàn không tồn tại ở đó. Để giải đáp câu hỏi này, Ngài nói “tattha kiñcāpī” (mặc dù ở đó) v.v.
Yasmā diṭṭhādīnavassa taṃtaṃjhānakkhaṇe anuppattidhammatāpādanaṃ vūpasamanaṃ adhippetaṃ, vitakkādayo eva ca jhānaṅgabhūtā tathā karīyanti, na taṃsampayuttā phassādayo, tasmā vitakkādīnaṃyeva vūpasamādhivacanaṃ jhāne āgataṃ.
Since the cessation intended is the non-occurrence of the seen danger (ādīnava) at each jhāna moment, and it is vitakka and so forth, which are factors of jhāna, that are made thus, not the co-arising phenomena like contact (phassa) and so forth, therefore the designation of cessation of vitakka and so forth alone is found in jhāna.
Vì sự lắng dịu được hiểu là việc khiến các pháp có khuyết điểm đã được nhận thấy không khởi lên trong khoảnh khắc của từng jhāna, và chỉ tầm và các pháp tương tự, vốn là các chi thiền, được xử lý như vậy, chứ không phải xúc (phassa) và các pháp tương tự đi kèm với chúng, nên chỉ có từ “vūpasama” (lắng dịu) cho tầm và các pháp tương tự được dùng trong jhāna.
Yasmā pana vitakkādīnaṃ viya taṃsampayuttadhammānampi ‘‘etena etaṃ oḷārika’’nti ādīnavadassanaṃ sutte āgataṃ, tasmā avisesena vitakkādīnaṃ taṃsahagatānañca vūpasamādike vattabbe vitakkādīnaṃyeva vūpasamo vuccamāno adhikavacanaṃ aññamatthaṃ bodhetīti katvā kañci visesaṃ dīpetīti dassento ‘‘oḷārikassa panā’’tiādimāha.
However, since the showing of danger, such as "by this, this is coarse," is found in the Sutta for the co-arising phenomena as well as for vitakka and so forth, when speaking of the cessation and so on of vitakka and so forth and their co-arising phenomena without distinction, the mention of cessation of vitakka and so forth alone signifies something additional and points to a certain distinction. Thus, he said, "but of the coarse," and so on.
Tuy nhiên, vì trong kinh cũng có sự chỉ ra khuyết điểm như “do điều này, điều này là thô thiển” đối với các pháp đi kèm với tầm và các pháp tương tự, giống như đối với tầm và các pháp tương tự, nên khi nói về sự lắng dịu v.v. của tầm và các pháp tương tự cùng với các pháp đi kèm với chúng một cách không phân biệt, việc chỉ nói về sự lắng dịu của riêng tầm và các pháp tương tự ngụ ý một ý nghĩa khác biệt. Do đó, để chỉ ra một số điểm đặc biệt, Ngài nói “oḷārikassa panā” (nhưng của cái thô thiển) v.v.
Ayañhettha adhippāyo – yehi vitakkavicārehi paṭhamajjhānassa oḷārikatā, tesaṃ samatikkamā dutiyajjhānassa samadhigamo, na sabhāvato anoḷārikānaṃ phassādīnaṃ samatikkamāti ayamattho ‘‘vitakkavicārānaṃ vūpasamā’’ti etena dīpito, tasmā ‘‘kiṃ paṭhamajjhānikānaṃ vitakkavicārānaṃ vūpasamo idhādhippeto, udāhu dutiyajjhānikāna’’nti edisī codanā anokāsāva.
This, indeed, is the intention here: the attainment of the second jhāna is due to the transcending of those vitakka and vicāra by which the first jhāna is coarse, and not due to the transcending of phenomena like contact, which are inherently not coarse. This meaning is indicated by "due to the cessation of vitakka and vicāra." Therefore, such a question as "Is the cessation of vitakka and vicāra of the first jhāna intended here, or of the second jhāna?" is indeed out of place.
Ý nghĩa ở đây là: Nhờ sự vượt qua tầm và tứ mà sơ thiền trở nên thô thiển, nhị thiền được thành tựu, chứ không phải do sự vượt qua xúc và các pháp tương tự mà tự bản chất không thô thiển. Ý nghĩa này được làm rõ bởi câu “vitakkavicārānaṃ vūpasamā” (do sự lắng dịu của tầm và tứ). Do đó, những câu hỏi như “sự lắng dịu của tầm và tứ thuộc sơ thiền được đề cập ở đây, hay của tầm và tứ thuộc nhị thiền?” là không có cơ sở.
‘‘Pītiyā ca virāgā’’tiādīsupi eseva nayo.
The same method applies to "due to the fading away of joy" and so on.
Trong các câu như “pītiyā ca virāgā” (và do ly hỷ) v.v. cũng theo cách tương tự.
Tasmā vitakkavicārapītisukhasamatikkamavacanāni oḷārikoḷārikaṅgasamatikkamā dutiyādiadhigamadīpakānīti tesaṃ ekadesabhūtaṃ vitakkavicārasamatikkamavacanaṃ avayavena samudāyopalakkhaṇanayena taṃ dīpakaṃ vuttaṃ.
Therefore, the statements about transcending vitakka, vicāra, joy, and happiness indicate the attainment of the second and subsequent jhānas by transcending the coarse and coarser factors. The statement about transcending vitakka and vicāra, being a partial aspect of these, is thus stated to indicate the whole by way of indicating a part by the whole.
Do đó, các lời nói về sự vượt qua tầm, tứ, hỷ, lạc được dùng để chỉ sự thành tựu nhị thiền và các thiền cao hơn nhờ sự vượt qua các chi thiền thô thiển. Lời nói về sự vượt qua tầm và tứ, vốn là một phần của chúng, được nói đến theo cách biểu thị toàn bộ bằng một phần.
Visuṃ visuṃ ṭhitepi hi vitakkavicārasamatikkamavacanādike paheyyaṅganiddesatāsāmaññena cittena samūhato gahite vitakkavicāravūpasamavacanassa tadekadesatā hotīti.
For even when statements about transcending vitakka and vicāra and so on are present separately, if they are understood collectively through a mind that generally designates factors to be abandoned, then the statement about the cessation of vitakka and vicāra becomes an integral part of that whole.
Thật vậy, ngay cả khi các lời nói về sự vượt qua tầm và tứ v.v. tồn tại riêng biệt, khi chúng được nắm bắt một cách tổng thể bằng tâm ý chung về việc chỉ định các chi cần đoạn trừ, thì lời nói về sự lắng dịu của tầm và tứ trở thành một phần của toàn bộ đó.
Atha vā vitakkavicāravūpasamavacaneneva taṃsamatikkamā dutiyādiadhigamadīpakena pītivirāgādivacanānaṃ pītiādisamatikkamā tatiyādiadhigamadīpakatā dīpitā hotīti tassa taṃdīpakatā vuttā.
Or alternatively, by the statement about the cessation of vitakka and vicāra, which indicates the attainment of the second and subsequent jhānas through transcending them, the similar function of the statements about the fading away of joy and so on, in their respective domains, indicating the attainment of the third and subsequent jhānas through transcending joy and so on, is also shown.
Hoặc, do lời nói về sự lắng dịu của tầm và tứ, vốn chỉ sự thành tựu nhị thiền và các thiền cao hơn nhờ sự vượt qua chúng, đã làm sáng tỏ khả năng của các lời nói về sự ly hỷ v.v. để chỉ sự thành tựu tam thiền và các thiền cao hơn nhờ sự vượt qua hỷ v.v., nên khả năng chỉ ra điều đó của nó đã được nói đến.
Evañhi avayavena samudāyopalakkhaṇaṃ vinā vitakkavicāravūpasamavacanena pītivirāgādivacanānaṃ savisaye samānabyāpāratā dassitā hoti.
In this way, the similar function of the statements about the fading away of joy and so on, in their respective domains, is demonstrated without resorting to the indication of the whole by a part, but directly by the statement about the cessation of vitakka and vicāra.
Bằng cách này, sự hoạt động tương tự của các lời nói về ly hỷ v.v. trong phạm vi riêng của chúng, mà không cần biểu thị toàn bộ bằng một phần, đã được chỉ ra.
Nīlavaṇṇayogato nīlavatthaṃ viyāti nīlayogato vatthaṃ nīlaṃ viyāti adhippāyo.
Nīlavaṇṇayogato nīlavatthaṃ viyā means, the intention is, just as a cloth is blue due to its association with blue.
Nīlavaṇṇayogato nīlavatthaṃ viyā có nghĩa là, ý muốn nói, giống như một tấm vải trở nên xanh do có màu xanh.
Imasmiñca atthavikappeti ‘‘ceto sampasādayatī’’ti etasmiṃ pakkhe.
Imasmiñca atthavikappe means, in this interpretation of the meaning, "ceto sampasādayati."
Imasmiñca atthavikappe có nghĩa là trong khía cạnh ý nghĩa này của “ceto sampasādayatī” (làm cho tâm thanh tịnh).
Cetasoti ca upayogatthe sāmivacanaṃ.
And cetaso is a genitive case word in the sense of the accusative.
Cetaso là một từ sở hữu cách (sāmivacana) ở nghĩa công dụng (upayogattha).
Purimasminti ‘‘sampasādanayogato jhānampi sampasādana’’nti vuttapakkhe.
Purimasmiṃ means, in the context stated: "Jhāna is also sampasādana because of its quality of sampasādana."
Purimasminti: Trong trường hợp đã nói rằng “Do sự phối hợp của sự thanh tịnh, thiền cũng là sự thanh tịnh”.
Cetasoti sambandhe sāmivacanaṃ.
Cetaso is a genitive case word indicating relation.
Cetasoti: Đây là từ sở hữu cách (sāmivacanaṃ) trong ý nghĩa liên hệ (sambandhe).
‘‘Yāva na pare ekagate karomī’’tiādīsu seṭṭhavacanopi ekasaddo loke dissatīti āha ‘‘seṭṭhopi hi loke ekoti vuccatī’’ti.
Since the word eka is seen in the world, even in the sense of 'best', in phrases like "as long as I do not make others one-pointed", it is said: "Even the best is called 'eka' in the world."
Trong các câu như “Yāva na pare ekagate karomī” (Chừng nào ta chưa làm cho người khác đạt đến nhất tâm), từ “eka” cũng được thấy dùng với nghĩa tối thượng trong thế gian, nên nói: “Thật vậy, trong thế gian, ‘eka’ cũng được gọi là tối thượng”.
‘‘Ekākīhi khuddakehi jita’’ntiādīsu asahāyatthopi ekasaddo diṭṭhoti āha ‘‘eko asahāyo hutvā’’ti.
Since the word eka is seen in the sense of 'alone' or 'unaccompanied' in phrases like "won by the isolated little ones", it is said: "being alone, unaccompanied."
Trong các câu như “Ekākīhi khuddakehi jita” (Đã chiến thắng bởi những người nhỏ bé một mình), từ “eka” cũng được thấy dùng với nghĩa không có bạn đồng hành, nên nói: “Eko asahāyo hutvā” (một mình, không có bạn đồng hành).
Saddhādayopi kāmaṃ sampayuttadhammānaṃ sādhāraṇato ca asādhāraṇato ca paccayā hontiyeva, samādhi pana jhānakkhaṇe sampayuttadhammānaṃ avikkhepalakkhaṇe indaṭṭhakaraṇena sātisayaṃ paccayo hotīti dassento ‘‘sampayuttadhamme…pe… adhivacana’’nti āha.
Faith (saddhā) and the like certainly become conditions for co-arisen phenomena, both in common and uncommonly; but samādhi, at the moment of jhāna, becomes a superior condition by acting as a master (indaṭṭhakaraṇena) in the characteristic of non-distraction for co-arisen phenomena. To show this, it is said: "sampayuttadhamme...pe... adhivacana."
Mặc dù tín (saddhā) và các pháp khác cũng là nhân duyên chung và không chung cho các pháp đồng sanh, nhưng định (samādhi) vào lúc nhập thiền là nhân duyên đặc biệt cho các pháp đồng sanh bằng cách thực hiện vai trò chủ yếu trong đặc tính không tán loạn. Để chỉ ra điều này, nên nói: “sampayuttadhamme…pe… adhivacana” (các pháp đồng sanh... v.v... là tên gọi).
‘‘Sampasādanaṃ cetaso ekodibhāva’’nti visesanadvayaṃ jhānassa atisayavacanicchāvasena gahitaṃ.
The two epithets "purification of mind (sampasādanaṃ cetaso) and one-pointedness (ekodibhāva)" are used to express the excellence of jhāna.
Hai đặc tính “sampasādanaṃ cetaso ekodibhāvaṃ” (sự thanh tịnh của tâm, sự nhất tâm) được dùng để nhấn mạnh sự siêu việt của thiền.
Svāyamatisayo yathā imasmiṃ jhāne labbhati, na tathā paṭhamajjhāneti imaṃ visesaṃ dassetuṃ ‘‘nanu cā’’tiādi vuttaṃ.
To show that such excellence is attained in this jhāna (the second jhāna), but not in the first jhāna, the phrase "nanu cā" (But isn't it so?) and so on is stated.
Để chỉ ra rằng sự siêu việt này đạt được trong thiền này chứ không phải trong thiền thứ nhất, nên nói: “Nanu cā” (Há chẳng phải…?).
Ārammaṇe āhananapariyāhananavasena anumajjanaanuyujjanavasena ca pavattamānā dhammā satipi nīvaraṇappahānena kilesakālussiyāpagame sampayuttānaṃ kiñci khobhaṃ karontā viya tehi ca te na sannisinnā hontīti vuttaṃ ‘‘vitakkavicārakkhobhena…pe… na suppasanna’’nti.
It is said: "due to the agitation of vitakka and vicāra...pe... not well-purified" because the phenomena (vitakka and vicāra), occurring through striking and repeatedly striking the object, and through analyzing and scrutinizing, appear to cause some disturbance to the co-arisen phenomena even though the defilement-impurity has ceased with the abandonment of hindrances, and the co-arisen phenomena are not fully settled by them.
Các pháp khởi lên do sự tác động và phản tác động vào đối tượng, do sự phân tích và tập trung, mặc dù đã loại bỏ các triền cái và sự xáo trộn của phiền não, dường như vẫn gây ra một chút xáo động cho các pháp đồng sanh, và chúng không hoàn toàn lắng đọng với các pháp đó. Vì vậy, nên nói: “vitakkavicārakkhobhena…pe… na suppasanna” (do sự xáo động của tầm và tứ… v.v… không hoàn toàn thanh tịnh).
Tattha khuddikā ūmiyo vīciyo, mahatiyo taraṅgā.
In that context, small waves are vīciyo, and large ones are taraṅgā.
Trong đó, những làn sóng nhỏ là vīciyo (gợn sóng), những làn sóng lớn là taraṅgā (sóng lớn).
Samādhipi na suṭṭhu pākaṭoti satipi indriyasamatte vīriyasamatāya ca teneva khotena sampasādābhāvena ca bahale viya jale maccho samādhipi na suṭṭhu pākaṭo.
Samādhi is also not very clear because even with equal faculties and equal effort, due to that very agitation and lack of purification, samādhi is not very clear, just like a fish in turbid water.
Samādhipi na suṭṭhu pākaṭoti (Định cũng không rõ ràng lắm): Mặc dù có sự quân bình của các căn và sự quân bình của tinh tấn, nhưng do sự xáo động đó và sự thiếu thanh tịnh, định cũng không rõ ràng lắm, giống như một con cá trong nước đục.
Vitakkavicārapalibodhābhāvenāti ettha yathāvuttakhobho eva palibodho.
In the phrase vitakkavicārapalibodhābhāvenā (due to the absence of the hindrance of vitakka and vicāra), the aforementioned agitation is itself the hindrance (palibodha).
Trong câu Vitakkavicārapalibodhābhāvenāti (do không có chướng ngại của tầm và tứ), sự xáo động đã nói trên chính là chướng ngại (palibodha).
Evaṃ vuttenāti yassā saddhāya vasena sampasādanaṃ, yassā ca cittekaggatāya vasena ekodibhāvanti ca jhānaṃ vuttaṃ, tāsaṃ eva ‘‘saddahanā’’tiādinā (vibha. 574) pavattiākāravisesavibhāvanavasena vuttena tena vibhaṅgapāṭhena.
Evaṃ vuttena refers to that Vibhaṅga passage which, by illustrating the specific modes of occurrence through "faith, believing" (yā saddhā saddahanā) and so on, elaborates on the jhāna described as "purification (sampasādana)" by means of faith, and "one-pointedness (ekodibhāva)" by means of one-pointedness of mind.
Evaṃ vuttenāti: Bằng đoạn kinh Vibhaṅga đã nói đó, theo cách diễn giải chi tiết về sự khởi lên của chúng, tức là sự tin tưởng (saddahanā) v.v., nhờ vào đó thiền được gọi là sự thanh tịnh (sampasādana) do tín (saddhā), và sự nhất tâm (ekodibhāva) do tâm nhất cảnh (cittekaggatā).
Ayaṃ atthavaṇṇanāti ‘‘sampasādanayogato, sampasādanato vā sampasādanaṃ.
Ayaṃ atthavaṇṇanā (this explanation of meaning) refers to this explanation of meaning that proceeds as "jhāna is called 'sampasādana' because of its quality of purification, or because it purifies; and it is called 'ekodibhāva' because it makes one-pointed (ekodiṃ bhāvetīti)."
Ayaṃ atthavaṇṇanāti (Đây là sự giải thích ý nghĩa): Sự giải thích ý nghĩa này khởi lên như vậy, rằng thiền được gọi là “sampasādana” (thanh tịnh) do sự phối hợp với sự thanh tịnh, hoặc do bản chất thanh tịnh.
Ekodiṃ bhāvetīti ekodibhāvanti jhānaṃ vutta’’nti evaṃ pavattā ayaṃ atthavaṇṇanā.
This is how this explanation of meaning operates.
Và thiền được gọi là “ekodibhāva” (nhất tâm) vì nó làm cho tâm trở nên nhất tâm (ekodi).
Aññadatthu saṃsandati ceva sameti ca, evaṃ veditabbāti kathaṃ panāyaṃ atthavaṇṇanā tena vibhaṅgapāṭhena saddhiṃ saṃsandati sameti, nanu jhānavibhaṅge ‘‘sampasādana’’nti padaṃ uddharitvā ‘‘yā saddhā saddahanā’’tiādinā (vibha. 574) saddhāyeva vuttā, ‘‘cetaso ekodibhāva’’nti ca padaṃ uddharitvā ‘‘yā cittassa ṭhiti saṇṭhiti avaṭṭhitī’’tiādinā samādhisseva niddeso kato, aṭṭhakathāyaṃ pana ‘‘sampasādanaṃ ekodibhāva’’nti jhānameva vuttanti aṭṭhakathāya vibhaṅgapāṭhena saddhiṃ virodho āpajjatīti?
Aññadatthu saṃsandati ceva sameti ca, evaṃ veditabbā (It aligns and accords, thus it should be understood): How does this explanation of meaning align and accord with that Vibhaṅga passage? For in the Jhānavibhaṅga, the word "sampasādana" is taken and faith (saddhā) alone is spoken of as "that faith, believing" (yā saddhā saddahanā), and the word "cetaso ekodibhāva" is taken and concentration (samādhi) alone is designated as "that steadfastness, firmness, unwaveringness of mind" (yā cittassa ṭhiti saṇṭhiti avaṭṭhiti); but in the Aṭṭhakathā, jhāna itself is spoken of as "sampasādana, ekodibhāva." Does this not create a contradiction between the Aṭṭhakathā and the Vibhaṅga passage?
Aññadatthu saṃsandati ceva sameti ca, evaṃ veditabbāti (Hơn nữa, nó phù hợp và hài hòa, nên được hiểu như vậy): Làm thế nào sự giải thích ý nghĩa này lại phù hợp và hài hòa với đoạn kinh Vibhaṅga đó? Chẳng phải trong Jhana-vibhaṅga, từ “sampasādana” được trích dẫn và chỉ đề cập đến tín (saddhā) qua “yā saddhā saddahanā” v.v., và từ “cetaso ekodibhāva” được trích dẫn và chỉ đề cập đến định (samādhi) qua “yā cittassa ṭhiti saṇṭhiti avaṭṭhitī” v.v., trong khi trong Chú Giải lại nói thiền chính là “sampasādanaṃ ekodibhāva”? Vậy có mâu thuẫn giữa Chú Giải và đoạn kinh Vibhaṅga chăng?
Nāpajjati vibhaṅgepi imināva adhippāyena niddesassa katattā.
No, it does not create a contradiction, because the designation in the Vibhaṅga is made with this very intention.
Không có mâu thuẫn, vì trong Vibhaṅga cũng đã được giải thích với cùng ý nghĩa này.
Tathā hi yena sampasādanena yogā jhānaṃ ‘‘sampasādana’’nti vuccati, tasmiṃ ‘‘yā saddhā saddahanā’’tiādinā dassite sampasādanaṃ jhānanti samānādhikaraṇaniddeseneva taṃyogā jhāne taṃsaddappavatti dassitā hoti.
Thus, by directly correlating (samānādhikaraṇaniddesena) "purification (sampasādana) is jhāna" in the jhāna that is called "sampasādana" due to its association with that purification which is shown as "that faith, believing" (yā saddhā saddahanā), the occurrence of that word (sampasādana) in jhāna due to its association with it is indicated.
Thật vậy, thiền được gọi là “sampasādana” do sự phối hợp với sự thanh tịnh đó. Khi sự thanh tịnh được chỉ ra qua “yā saddhā saddahanā” v.v., thì sự khởi lên của từ đó trong thiền do sự phối hợp với nó đã được chỉ ra bằng cách giải thích đồng nhất (samānādhikaraṇaniddesa) rằng sự thanh tịnh là thiền.
‘‘Ekodibhāva’’nti ca padaṃ uddharitvā ekodimhi dassite ekodibhāvaṃ jhānanti samānādhikaraṇaniddeseneva jhānassa ekodivaḍḍhanatā vuttāva hotīti iminā adhippāyena byañjanavicāraṃ akatvā dhammamattameva niddiṭṭhanti avirodho yutto.
And by directly correlating "one-pointedness (ekodibhāva) is jhāna" in the 'one-pointed' (ekodimhi) that is shown by extracting the word "ekodibhāva", the increase of one-pointedness (ekodivaḍḍhanatā) in jhāna is certainly stated. Thus, by not considering the grammatical analysis (byañjanavicāraṃ akatvā) but only the mere phenomena, a non-contradiction is proper.
Và khi từ “ekodibhāva” được trích dẫn và sự nhất tâm (ekodi) được chỉ ra, thì sự tăng trưởng nhất tâm của thiền đã được nói bằng cách giải thích đồng nhất rằng nhất tâm là thiền. Với ý nghĩa này, không phân tích từ ngữ mà chỉ giải thích ý nghĩa, nên sự không mâu thuẫn là hợp lý.
Yaṃ pana vuttaṃ ṭīkākārehi ācariyadhammapālattherādīhi ‘‘yadi ekodīti samādhissa gahaṇaṃ adhippetaṃ, tadā ‘ekodibhāva’nti padaṃ uddharitvā samādhissa niddeso na kattabbo siyā.
However, what the ṭīkā commentators, such as Ācariya Dhammapālatthera, said, "If the meaning of 'ekodi' is intended as 'samādhi', then the word 'ekodibhāva' should not have been extracted to designate samādhi. Therefore, it is proper that the word 'ekodibhāva' occurs in relation to samādhi, just as the word 'sampasādana' occurs in relation to jhāna,"—
Tuy nhiên, điều mà các bậc thầy chú giải (ṭīkākāra) như Tôn giả Dhammapāla và các vị khác đã nói rằng: “Nếu ý định là lấy ‘ekodi’ làm định, thì không nên giải thích định bằng cách trích dẫn từ ‘ekodibhāva’.
Tasmā ekodibhāvasaddo eva samādhimhi pavatto sampasādanasaddo viya jhāne pavattatīti yutta’’nti, taṃ aṭṭhakathāya virujjhati.
—this contradicts the Aṭṭhakathā.
Vì vậy, hợp lý khi nói rằng từ ‘ekodibhāva’ cũng được dùng cho định, giống như từ ‘sampasādana’ được dùng cho thiền”, thì điều đó mâu thuẫn với Chú Giải.
Tasmā so aṭṭhakathānirapekkho visuṃyeveko atthavikappoti gahetabbaṃ.
Therefore, that interpretation, being independent of the Aṭṭhakathā, should be taken as a separate conceptualization of meaning (atthavikappa).
Do đó, điều đó phải được hiểu là một cách giải thích ý nghĩa riêng biệt, không phụ thuộc vào Chú Giải.
Ayañhi nesaṃ adhippāyo – vitakkavicārehi anajjhāruḷhattā ekaṃ udetīti ekodīti tathāvidhasamādhiyuttaṃ jhānacittameva gahetvā ekodissa bhāvo ekodibhāvoti samādhissa gahaṇaṃ sakkā vattunti.
Indeed, their intention is this: since (the mind) is not overwhelmed by vitakka and vicāra, it arises as one (ekaṃ udetīti ekodi), thus, taking jhānacitta itself as endowed with such samādhi, it is possible to say that the state of one-pointedness (ekodibhāva) is the grasping of samādhi.
Ý định của các vị ấy là: “Vì không bị tầm và tứ chi phối, tâm trở nên duy nhất (ekaṃ udeti), nên gọi là ekodi. Bằng cách lấy tâm thiền đã đạt được định như vậy, có thể nói rằng sự nhất tâm (ekodibhāva) là định”.
Yo panāyaṃ tesamabhiniveso ‘‘ekodīti samādhissa gahaṇe sati ‘ekodibhāva’nti padaṃ uddharitvā samādhissa niddeso na kattabbo siyā’’ti, so anekantikattā ayutto.
However, their insistence that "if 'ekodi' means grasping samādhi, then the word 'ekodibhāva' should not have been extracted to designate samādhi" is unsuitable because it is not universally applicable (anekantikattā).
Tuy nhiên, sự cố chấp của các vị ấy rằng “nếu ‘ekodi’ được lấy làm định, thì không nên giải thích định bằng cách trích dẫn từ ‘ekodibhāva’” là không hợp lý vì nó không nhất quán (anekantikatā).
Aññatthapi hi byañjanavicāraṃ akatvā atthamattasseva bāhullena vibhaṅge niddeso dissati.
For in other places too, the designation in the Vibhaṅga is frequently seen to state only the meaning, without grammatical analysis.
Thật vậy, ở những chỗ khác trong Vibhaṅga, cũng thường thấy việc giải thích ý nghĩa mà không phân tích từ ngữ.
Santāti samaṃ nirodhaṃ gatā.
Santā means, reached cessation completely.
Santāti (đã lắng dịu): Đã đạt đến sự chấm dứt hoàn toàn.
Samitāti bhāvanāya samaṃ gamitā nirodhitā.
Samitā means, brought to cessation, annihilated by development.
Samitāti (đã được làm lắng dịu): Đã được đưa đến sự chấm dứt, đã được diệt trừ bằng sự tu tập.
Vūpasantāti tato eva suṭṭhu upasantā.
Vūpasantā means, from that very state, they are thoroughly calmed.
Vūpasantāti (đã hoàn toàn lắng dịu): Do đó, đã hoàn toàn lắng dịu.
Atthaṅgatāti atthaṃ vināsaṃ gatā.
Atthaṅgatā means, gone to destruction, vanished.
Atthaṅgatāti (đã biến mất): Đã đi đến sự hủy diệt.
Abbhatthaṅgatāti upasaggena padaṃ vaḍḍhetvā vuttaṃ.
Abbhatthaṅgatā is said by increasing the word with a prefix.
Abbhatthaṅgatāti (đã hoàn toàn biến mất): Được nói bằng cách thêm tiền tố vào từ.
Appitāti gamitā vināsaṃ gatā.
Appitā means, gone to destruction, vanished.
Appitāti (đã được đưa vào): Đã đi đến sự hủy diệt.
Sositāti pavattisaṅkhātassa santānassa abhāvena sosaṃ sukkhabhāvaṃ gatā.
Sositā means, gone to dryness due to the non-existence of the continuum, which is termed 'occurrence'.
Sositāti (đã khô cạn): Đã đi đến trạng thái khô cạn do không còn sự tiếp nối của sự vận hành.
Byantīkatāti vigatantā katā.
Byantīkatā means, made to have an end removed (made to cease).
Byantīkatāti (đã được chấm dứt): Đã được làm cho không còn giới hạn.
Ayamatthoti bhāvanāya pahīnattā vitakkavicārānaṃ abhāvasaṅkhāto attho.
Ayamattho means the meaning of the non-existence of vitakka and vicāra, due to their abandonment through development.
Ayamatthoti: Ý nghĩa là sự không tồn tại của tầm và tứ do đã được đoạn trừ bằng sự tu tập.
Codakena vuttamatthaṃ sampaṭicchitvā pariharituṃ ‘‘evametaṃ siddhovāyamattho’’ti vatvā ‘‘na paneta’’ntiādi vuttaṃ.
To accept the meaning stated by the interrogator and then to resolve it, it is said: "evametaṃ siddhovāyamattho" (This meaning is thus established), and then "na paneta" and so on is stated.
Để chấp nhận và giải thích ý nghĩa mà người chất vấn đã nói, sau khi nói “evametaṃ siddhovāyamattho” (ý nghĩa này đã được chứng minh như vậy), nên nói “na paneta” v.v.
Tattha etanti ‘‘vitakkavicārānaṃ vūpasamā’’ti etaṃ vacanaṃ.
Here, etaṃ refers to the statement "vitakkavicārānaṃ vūpasamā" (from the subsiding of vitakka and vicāra).
Trong đó, etanti (câu này) là câu “vitakkavicārānaṃ vūpasamā” (do sự lắng dịu của tầm và tứ).
Tadatthadīpakanti tassa vitakkavicārābhāvamattasaṅkhātassa atthassa dīpakaṃ.
Tadatthadīpakaṃ means, indicating the mere absence of vitakka and vicāra.
Tadatthadīpakanti (chỉ ra ý nghĩa đó) là chỉ ra ý nghĩa chỉ là sự không tồn tại của tầm và tứ.
Na kilesakālussiyassāti upacārakkhaṇe viya nīvaraṇasaṅkhātassa kilesasaṅkhobhassa vūpasamā na sampasādananti attho.
Na kilesakālussiyassā means, it is not that purification comes from the subsidence of the defilement's agitation, called hindrances, as in the moment of access concentration.
Na kilesakālussiyassāti: Ý nghĩa là sự lắng dịu của sự xáo trộn phiền não được gọi là các triền cái không phải là sự thanh tịnh, giống như trong giai đoạn cận định (upacāra-khaṇa).
Nanu ca ‘‘purimaṃ vatvāpi vattabbamevā’’ti idaṃ kasmā vuttaṃ.
"Why is it said: "purimaṃ vatvāpi vattabbamevā" (though stated earlier, it must still be said)?"
Há chẳng phải câu “purimaṃ vatvāpi vattabbamevā” (dù đã nói trước, vẫn phải nói thêm) này được nói vì lý do gì?
Tathā hi dutiyajjhānādiadhigamūpāyadīpakena ajjhattaṃ sampasādanatāya cetaso ekodibhāvatāya ca hetudīpakena avitakkaavicārabhāvahetudīpakena ca vitakkavicāravūpasamavacaneneva vitakkavicārābhāvo dīpitoti, kiṃ puna avitakkaavicāravacanena katenāti?
No, because it is not indicated. For, the absence of vitakka and vicāra is indicated by the statement of the subsidence of vitakka and vicāra, which points to the means of attaining the second jhāna and so on, points to the cause in the form of internal purification and one-pointedness of mind, and points to the cause of being without vitakka and vicāra. So, what more is achieved by the statement "without vitakka, without vicāra"?
Thật vậy, lẽ ra sự không tồn tại của tầm và tứ đã được chỉ ra chỉ bằng câu “vitakkavicāravūpasama” (sự lắng dịu của tầm và tứ), bằng cách chỉ ra nguyên nhân của sự thanh tịnh nội tâm và sự nhất tâm của tâm, là nguyên nhân của sự đạt được thiền thứ hai v.v., và bằng cách chỉ ra nguyên nhân của trạng thái vô tầm vô tứ. Vậy tại sao lại cần thêm câu “avitakka avicāra” (không tầm không tứ) nữa?
Na, adīpitattā.
No, because it is not indicated.
Không phải vậy, vì nó chưa được chỉ ra.
Na hi vitakkavicāravūpasamavacanena vitakkavicārānaṃ appavatti vuttā hoti.
For the statement of the subsidence of vitakka and vicāra does not mean the non-occurrence of vitakka and vicāra.
Thật vậy, câu “vitakkavicāravūpasama” không nói đến sự không khởi lên của tầm và tứ.
Vitakkavicāresu hi taṇhāppahānaṃ etesaṃ vūpasamanaṃ.
For the cessation of vitakka and vicāra is the abandonment of craving for them.
Sự đoạn trừ tham ái đối với tầm và tứ chính là sự lắng dịu của chúng.
Oḷārikaṅgamukhena hi taṃtaṃjhānanikantiyā vikkhambhanaṃ vitakkavicāravūpasamavacanādīhi pakāsitaṃ.
Indeed, the suppression of craving for each jhāna, primarily through the gross factors, is made manifest by phrases such as "subsiding of vitakka and vicāra."
Thật vậy, sự trấn áp (vikkhambhana) sự tham đắm vào các thiền tương ứng, thông qua các chi phần thô thiển, đã được làm rõ bằng các từ như “vitakkavicāravūpasama” (sự lắng dịu của tầm và tứ).
Yato vitakkavicāresu virattabhāvadīpakaṃ vitakkavicāravūpasamavacanaṃ, ye ca saṅkhāresu taṇhāppahānaṃ karonti, tesu maggesu pahīnataṇhesu ca phalesu saṅkhārappavatti hoti, evamidhāpi vikkhambhitavitakkavicārataṇhassa dutiyajjhānassa vitakkavicārasampayogo purimena na nivārito siyāti tannivāraṇatthaṃ āvajjitukāmatādiatikkamo ca tesaṃ vūpasamoti dassanatthañca ‘‘avitakkaṃ avicāra’’nti vuttaṃ.
Since the statement of the appeasement of vitakka and vicāra indicates the state of being dispassionate towards vitakka and vicāra, and because formations arise in those paths that abandon craving for formations and in those fruits where craving has been abandoned, so too here, in the second jhāna, where the craving for vitakka and vicāra has been suppressed, the association of vitakka and vicāra might not be prevented by the preceding statement. Therefore, to prevent that, and to show that the transcendence of the desire to reflect, etc., is their appeasement, it is said: "without vitakka, without vicāra."
Bởi vì lời nói về sự an tịnh của tầm và tứ biểu thị trạng thái không còn tham ái đối với tầm và tứ, và bởi vì sự vận hành của các hành (saṅkhāra) xảy ra trong các thiền định mà người ta đoạn trừ tham ái đối với các hành, trong các đạo (magga) mà tham ái đã được đoạn trừ, và trong các quả (phala) mà tham ái đã được đoạn trừ, nên ở đây, sự không tương ưng với tầm và tứ của thiền thứ hai, mà tham ái đối với tầm và tứ đã được trấn áp, sẽ không bị lời nói trước đó ngăn cản. Vì vậy, để ngăn cản điều đó, và để chỉ ra rằng sự vượt qua ý muốn quán sát v.v. chính là sự an tịnh của chúng, nên đã nói “không tầm, không tứ”.
Paṭhamajjhānaṃ dutiyajjhānassa upanissayapaccayena paccayo hotīti āha ‘‘paṭhamajjhānasamādhito’’ti.
"The first jhāna is a condition for the second jhāna by way of proximate support condition (upanissaya-paccaya)," thus it is said: "from the concentration of the first jhāna."
Thiền thứ nhất là duyên cho thiền thứ hai bằng duyên y chỉ (upanissaya-paccaya). Do đó, đã nói “từ định của thiền thứ nhất”.
Paṭhamampīti paṭhamajjhānampi.
Paṭhamampī (also the first) means paṭhamajjhānampi (also the first jhāna).
Paṭhamampī có nghĩa là thiền thứ nhất.
Gaṇanānupubbatotiādi heṭṭhā vuttanayeneva veditabbaṃ.
Gaṇanānupubbato and so on should be understood in the manner stated below.
Gaṇanānupubbato v.v. nên được hiểu theo cách đã nói ở dưới.
Etthāpi ‘‘dutiyaṃ uppannantipi dutiya’’nti vattuṃ vaṭṭatiyeva.
Even here, it is proper to say "the second" even if it means "the second having arisen."
Ở đây cũng có thể nói: “Thứ hai đã sanh, cũng là thứ hai.”
Vuttamevatthaṃ vibhaṅgapāṭhena sādhento āha ‘‘yathāhā’’tiādi.
To establish the same meaning stated previously with the text from the Vibhaṅga, it is said: "as it is said..." and so on.
Để chứng minh ý nghĩa đã nói bằng văn bản của Vibhaṅga, đã nói “như đã nói” v.v.
Yaṃ pana vibhaṅge (vibha. 580) ‘‘jhānanti sampasādo pīti sukhaṃ cittassekaggatā’’ti vuttaṃ, taṃ saparikkhāraṃ jhānaṃ dassetuṃ pariyāyena vuttaṃ.
However, what is said in the Vibhaṅga: "Jhāna means placidity, joy, happiness, one-pointedness of mind" is said indirectly to show jhāna with its accessories.
Tuy nhiên, điều đã nói trong Vibhaṅga rằng “thiền là sự thanh tịnh, hỷ, lạc, nhất tâm của tâm” (Vibh. 580) là được nói theo phương tiện, để chỉ ra thiền với các yếu tố phụ trợ của nó.
Rathassa paṇḍukambalaṃ viya hi sampasādo jhānassa parikkhāro, na jhānaṅganti āha ‘‘pariyāyoyeva ceso’’ti.
For placidity is an accessory of jhāna, like a white blanket for a carriage, not a jhāna-factor. Thus, it is said: "and this is merely an indirect statement."
Sự thanh tịnh (sampasāda) giống như tấm thảm trắng của cỗ xe, là yếu tố phụ trợ của thiền, chứ không phải là chi phần của thiền. Do đó, đã nói “đây chỉ là một phương tiện”.
Nippariyāyato pana upanijjhānalakkhaṇappattānaṃ aṅgānaṃ vasena tivaṅgikamevetaṃ hotīti āha ‘‘sampasādanaṃ pana ṭhapetvā’’tiādi.
But directly, it is only three-factored, by means of the factors that have attained the characteristic of close contemplation. Thus, it is said: "excluding placidity" and so on.
Tuy nhiên, theo nghĩa trực tiếp, thiền này chỉ có ba chi phần theo các chi phần đạt đến đặc tính quán sát. Do đó, đã nói “ngoại trừ sự thanh tịnh” v.v.
Virajjanaṃ virāgo.
Virajjanaṃ (dispassion) is virāgo (detachment).
Virajjana là sự ly tham (virāga).
Taṃ pana virajjanaṃ nibbindanamukhena hīḷanaṃ vā tappaṭibaddharāgappahānaṃ vāti dassetuṃ ‘‘tassā pītiyā jigucchanaṃ vā samatikkamo vā’’ti vuttaṃ.
To show that this virajjana (dispassion) is either disgust or the abandonment of the craving connected to it, by way of revulsion, it is said: "disgust with that joy, or its transcendence."
Để chỉ ra rằng sự ly tham đó là sự chán ghét (jigucchana) hoặc sự vượt qua (samatikkama) hỷ đó thông qua sự nhàm chán (nibbindana), hoặc là sự đoạn trừ tham ái gắn liền với hỷ đó, nên đã nói “sự chán ghét hỷ đó hoặc sự vượt qua hỷ đó”.
Ubhinnamantarāti pītiyā virāgāti imesaṃ dvinnaṃ padānaṃ antarā, majjheti attho.
Ubhinnamantarā means between these two words, i.e., between "joy" and "dispassion" — it means in the middle.
Ubhinnamantarā có nghĩa là giữa hai từ này, tức là giữa từ “pītiyā” (của hỷ) và “virāgā” (sự ly tham).
Sampiṇḍanaṃ samuccayo.
Sampiṇḍanaṃ (collection) is samuccayo (accumulation).
Sampiṇḍana là sự tập hợp.
Maggoti upāyo.
Maggo means the means (upāya).
Maggo là phương tiện.
Dutiyajjhānassa hi paṭilābhaṃ vinā tatiyajjhānassa adhigamo na hotīti vitakkavicārānaṃ vūpasamo tatiyajjhānādhigamassa upāyo.
Indeed, without the attainment of the second jhāna, the third jhāna cannot be realized. Therefore, the appeasement of vitakka and vicāra is the means to realizing the third jhāna.
Vì không thể đạt được thiền thứ ba nếu không đạt được thiền thứ hai, nên sự an tịnh của tầm và tứ là phương tiện để đạt được thiền thứ ba.
Tadadhigamāyāti tatiyamaggādhigamāya.
Tadadhigamāyā means for the attainment of the third path.
Tadadhigamāya có nghĩa là để đạt được đạo thứ ba (A-na-hàm đạo).
Upapattitoti samavāhitabhāvena patirūpato jhānupekkhāpi samavāhitameva antonītaṃ katvā pavattatīti āha ‘‘samaṃ passatī’’ti.
Upapattito means by way of fittingness due to being equally borne. Jhāna-equanimity also proceeds by making the equally borne intrinsic. Thus, it is said: "he sees impartially."
Upapattito có nghĩa là do sự thích hợp của trạng thái được phối hợp, tức là trạng thái xả thiền cũng được bao hàm bên trong và vận hành một cách phối hợp. Do đó, đã nói “thấy bình đẳng”.
Visadāyāti saṃkilesavigamena paribyattāya.
Visadāyā means clear, distinct, due to the cessation of defilements.
Visadāyā có nghĩa là do sự rõ ràng nhờ thoát khỏi các phiền não.
Vipulāyāti sātisayaṃ mahaggatabhāvappattito mahatiyā.
Vipulāyā means great, due to having attained a very exalted state.
Vipulāyā có nghĩa là do sự rộng lớn đạt đến trạng thái siêu việt.
Thāmagatāyāti pītivigamena thirabhāvappattāya.
Thāmagatāyā means firm, due to having attained stability through the cessation of joy.
Thāmagatāyā có nghĩa là do sự vững chắc đạt được nhờ thoát khỏi hỷ.
Nanu cettha upekkhāvedanāva na sambhavati, tasmā kathamayaṃ tatiyajjhānasamaṅgī upekkhāya samannāgatattā ‘‘upekkhako’’ti vuccatīti ce?
"But is it not the case that feeling of equanimity (upekkhāvedanā) does not arise here? So how is this person, endowed with the third jhāna, called 'upekkhaka' (one who is equanimous) due to being endowed with equanimity?" If this is asked,
Nếu nói rằng ở đây không thể có xả thọ (upekkhāvedanā), vậy thì tại sao người chứng thiền thứ ba này lại được gọi là “upekkhako” (người có xả) vì đã đầy đủ xả?
Na kevalaṃ vedanupekkhāva upekkhāti vuccati, atha kho aññāpi upekkhā vijjantīti dassento āha ‘‘upekkhā pana dasavidhā hotī’’tiādi.
It is not only the feeling of equanimity (vedanupekkhā) that is called equanimity. Rather, there are other types of equanimity as well. Thus, to show this, it is said: "Now, equanimity is of ten kinds," and so on.
Để chỉ ra rằng không chỉ có xả thọ được gọi là xả, mà còn có những loại xả khác, nên đã nói “xả có mười loại” v.v.
Tattha (dha. sa. aṭṭha. 163; visuddhi. 1.84) ‘‘idha, bhikkhave, bhikkhu cakkhunā rūpaṃ disvā neva sumano hoti na dummano, upekkhako viharati sato sampajāno’’ti (a. ni. 6.1) evamāgatā khīṇāsavassa chasu dvāresu iṭṭhāniṭṭhachaḷārammaṇāpāthe parisuddhapakatibhāvāvijahanākārabhūtā upekkhā chaḷaṅgupekkhā nāma.
Therein, the equanimity of an Arahant (khīṇāsava), which appears in the six doors, upon seeing pleasant and unpleasant six sense objects (chaḷārammaṇā), characterized by not abandoning the state of pure normalcy, is called chaḷaṅgupekkhā (six-factored equanimity), as stated: "Here, bhikkhus, a bhikkhu, having seen a form with the eye, is neither pleased nor displeased; he dwells in equanimity, mindful and fully aware."
Trong đó, xả được gọi là chaḷaṅgupekkhā (lục chi xả) là trạng thái không từ bỏ bản chất thanh tịnh của vị A-la-hán khi các đối tượng đáng ưa và không đáng ưa xuất hiện ở sáu căn môn, như đã nói: “Ở đây, này các Tỳ-khưu, một Tỳ-khưu thấy sắc bằng mắt, không vui cũng không buồn, sống với tâm xả, chánh niệm và tỉnh giác.”
‘‘Katamā aṭṭha saṅkhārupekkhā samathavasena uppajjanti?
"Which are the eight saṅkhārupekkhā that arise by way of samatha?
Tám hành xả nào sanh khởi theo cách chỉ tịnh?
Paṭhamajjhānapaṭilābhatthāya nīvaraṇe paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, dutiyajjhānapaṭilābhatthāya vitakkavicāre paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, tatiyajjhānapaṭilābhatthāya pītiṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, catutthajjhānapaṭilābhatthāya sukhadukkhe paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, ākāsānañcāyatanasamāpattipaṭilābhatthāya rūpasaññaṃ paṭighasaññaṃ nānattasaññaṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, viññāṇañcāyatanasamāpattipaṭilābhatthāya ākāsānañcāyatanasaññaṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, ākiñcaññāyatanasamāpattipaṭilābhatthāya viññāṇañcāyatanasaññaṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, nevasaññānāsaññāyatanasamāpattipaṭilābhatthāya ākiñcaññāyatanasaññaṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, imā aṭṭha saṅkhārupekkhā samathavasena uppajjanti.
For the attainment of the first jhāna, the wisdom of discerning the hindrances, reflecting upon them, settling down in equanimity regarding formations, is knowledge. For the attainment of the second jhāna, the wisdom of discerning vitakka and vicāra, reflecting upon them, settling down in equanimity regarding formations, is knowledge. For the attainment of the third jhāna, the wisdom of discerning joy, reflecting upon it, settling down in equanimity regarding formations, is knowledge. For the attainment of the fourth jhāna, the wisdom of discerning happiness and suffering, reflecting upon them, settling down in equanimity regarding formations, is knowledge. For the attainment of the base of infinite space attainment, the wisdom of discerning the perception of form, the perception of resistance, and the perception of diversity, reflecting upon them, settling down in equanimity regarding formations, is knowledge. For the attainment of the base of infinite consciousness attainment, the wisdom of discerning the perception of infinite space, reflecting upon it, settling down in equanimity regarding formations, is knowledge. For the attainment of the base of nothingness attainment, the wisdom of discerning the perception of infinite consciousness, reflecting upon it, settling down in equanimity regarding formations, is knowledge. For the attainment of the base of neither perception nor non-perception attainment, the wisdom of discerning the perception of nothingness, reflecting upon it, settling down in equanimity regarding formations, is knowledge. These eight saṅkhārupekkhā arise by way of samatha.
Để đạt được thiền thứ nhất, trí tuệ là sự quán xét các triền cái, sự an trú, sự hiểu biết về các hành xả. Để đạt được thiền thứ hai, trí tuệ là sự quán xét tầm và tứ, sự an trú, sự hiểu biết về các hành xả. Để đạt được thiền thứ ba, trí tuệ là sự quán xét hỷ, sự an trú, sự hiểu biết về các hành xả. Để đạt được thiền thứ tư, trí tuệ là sự quán xét lạc và khổ, sự an trú, sự hiểu biết về các hành xả. Để đạt được định Không Vô Biên Xứ, trí tuệ là sự quán xét tưởng sắc, tưởng chướng ngại, tưởng dị biệt, sự an trú, sự hiểu biết về các hành xả. Để đạt được định Thức Vô Biên Xứ, trí tuệ là sự quán xét tưởng Không Vô Biên Xứ, sự an trú, sự hiểu biết về các hành xả. Để đạt được định Vô Sở Hữu Xứ, trí tuệ là sự quán xét tưởng Thức Vô Biên Xứ, sự an trú, sự hiểu biết về các hành xả. Để đạt được định Phi Tưởng Phi Phi Tưởng Xứ, trí tuệ là sự quán xét tưởng Vô Sở Hữu Xứ, sự an trú, sự hiểu biết về các hành xả. Tám hành xả này sanh khởi theo cách chỉ tịnh.
‘‘Katamā dasa saṅkhārupekkhā vipassanāvasena uppajjanti?
"Which are the ten saṅkhārupekkhā that arise by way of vipassanā?
Mười hành xả nào sanh khởi theo cách quán?
Sotāpattimaggapaṭilābhatthāya uppādaṃ pavattaṃ nimittaṃ āyūhanaṃ paṭisandhiṃ gatiṃ nibbattiṃ upapattiṃ jātiṃ jaraṃ byādhiṃ maraṇaṃ sokaṃ paridevaṃ upāyāsaṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, sotāpattiphalasamāpattatthāya uppādaṃ pavattaṃ nimittaṃ āyūhanaṃ paṭisandhiṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, sakadāgāmimaggapaalābhatthāya…pe… sakadāgāmiphalasamāpattatthāya…pe… anāgāmimaggapaṭilābhatthāya…pe… anāgāmiphalasamāpattatthāya…pe… arahattamaggapaṭilābhatthāya uppādaṃ pavattaṃ nimittaṃ āyūhanaṃ paṭisandhiṃ gatiṃ nibbattiṃ upapattiṃ jātiṃ jaraṃ byādhiṃ maraṇaṃ sokaṃ paridevaṃ upāyāsaṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, arahattaphalasamāpattatthāya…pe… suññatavihārasamāpattatthāya…pe… animittavihārasamaāpattatthāya uppādaṃ pavattaṃ nimittaṃ āyūhanaṃ paṭisandhiṃ paṭisaṅkhā santiṭṭhanā paññā saṅkhārupekkhāsu ñāṇaṃ, imā dasa saṅkhārupekkhā vipassanāvasena uppajjantī’’ti (paṭi. ma. 1.57) –
Which are these ten equanimity regarding formations, arising by way of insight? Knowledge in discerning and settling upon equanimity regarding formations, concerning the arising, continuation, sign, accumulation, rebirth, destination, manifestation, re-existence, birth, aging, sickness, death, sorrow, lamentation, and despair for the attainment of the stream-entry path; knowledge in discerning and settling upon equanimity regarding formations, concerning the arising, continuation, sign, accumulation, and rebirth for the attainment of the fruition of stream-entry; ...likewise... for the attainment of the once-returner path; ...likewise... for the attainment of the fruition of once-returner; ...likewise... for the attainment of the non-returner path; ...likewise... for the attainment of the fruition of non-returner; ...likewise... for the attainment of the Arahant path, concerning the arising, continuation, sign, accumulation, rebirth, destination, manifestation, re-existence, birth, aging, sickness, death, sorrow, lamentation, and despair; knowledge in discerning and settling upon equanimity regarding formations, concerning the arising, continuation, sign, accumulation, and rebirth for the attainment of the fruition of Arahantship; ...likewise... for the attainment of the void dwelling attainment; ...likewise... for the attainment of the signless dwelling attainment, concerning the arising, continuation, sign, accumulation, and rebirth, these ten equanimity regarding formations arise by way of insight.
Vì mục đích chứng đắc đạo Tu-đà-hoàn (Sotāpattimagga): sự sinh khởi (uppāda), sự tiếp diễn (pavatta), dấu hiệu (nimitta), sự nỗ lực (āyūhana), sự tái sinh (paṭisandhi), cảnh giới (gati), sự xuất hiện (nibbatti), sự tái tục (upapatti), sự sinh (jāti), sự già (jarā), bệnh tật (byādhi), cái chết (maraṇa), sầu muộn (soka), than vãn (parideva), khổ não (upāyāsa) – trí tuệ quán xét (paṭisaṅkhā), an trú (santiṭṭhanā) và xả ly các hành (saṅkhārupekkhā) là trí tuệ (ñāṇa). Vì mục đích chứng đắc quả Tu-đà-hoàn (Sotāpattiphala): sự sinh khởi, sự tiếp diễn, dấu hiệu, sự nỗ lực, sự tái sinh – trí tuệ quán xét, an trú và xả ly các hành là trí tuệ. Vì mục đích chứng đắc đạo Tư-đà-hàm (Sakadāgāmimagga)…v.v… vì mục đích chứng đắc quả Tư-đà-hàm (Sakadāgāmiphalasamāpatti)…v.v… vì mục đích chứng đắc đạo A-na-hàm (Anāgāmimaggapaṭilābhatthāya)…v.v… vì mục đích chứng đắc quả A-na-hàm (Anāgāmiphalasamāpattatthāya)…v.v… vì mục đích chứng đắc đạo A-la-hán (Arahattamaggapaṭilābhatthāya): sự sinh khởi, sự tiếp diễn, dấu hiệu, sự nỗ lực, sự tái sinh, cảnh giới, sự xuất hiện, sự tái tục, sự sinh, sự già, bệnh tật, cái chết, sầu muộn, than vãn, khổ não – trí tuệ quán xét, an trú và xả ly các hành là trí tuệ. Vì mục đích chứng đắc quả A-la-hán (Arahattaphalasamāpattatthāya)…v.v… vì mục đích chứng đắc Vô tướng trú (Suññatavihārasamāpattatthāya)…v.v… vì mục đích chứng đắc Vô nguyện trú (Animittavihārasamāpattatthāya): sự sinh khởi, sự tiếp diễn, dấu hiệu, sự nỗ lực, sự tái sinh – trí tuệ quán xét, an trú và xả ly các hành là trí tuệ. Mười loại xả ly các hành này sinh khởi theo phương cách quán minh. (Paṭi. Ma. 1.57) –
Tattha nīvaraṇe paṭisaṅkhāti pañca nīvaraṇāni pahātabbabhāvena paṭisaṅkhāya, pariggahetvāti attho.
Among these, "discerning the hindrances" means discerning, or understanding, the five hindrances as needing to be abandoned.
Trong đó, quán xét các triền cái có nghĩa là quán xét năm triền cái như là những thứ cần phải đoạn trừ, tức là nắm giữ chúng.
Santiṭṭhanāti nīvaraṇānaṃ pahānābhimukhībhūtattā tesaṃ pahānepi abyāpārabhāvūpagamanena majjhattatāya santiṭṭhanā.
"Settling upon" means settling with neutrality (equanimity), due to being intent on abandoning the hindrances and having come to a state of non-involvement in their abandonment.
An trú có nghĩa là an trú trong sự trung lập, không bận tâm đến việc đoạn trừ các triền cái vì chúng đã hướng đến sự đoạn trừ.
Saṅkhārupekkhāsūti nīvaraṇappahāne byāpārākaraṇena nīvaraṇasaṅkhātānaṃ saṅkhārānaṃ upekkhanāsūti attho.
"In equanimity regarding formations" means in maintaining equanimity towards formations, referred to as hindrances, by not being involved in their abandonment.
Trong sự xả ly các hành có nghĩa là xả ly các hành được gọi là triền cái bằng cách không bận tâm đến việc đoạn trừ các triền cái.
Esa nayo vitakkavicārādīsu uppādādīsu ca.
The same method applies to "initial application and sustained application" (vitakkavicārā) and so forth, and to "arising" (uppāda) and so forth.
Cũng theo cách này đối với vitakka, vicāra v.v. và sự sinh khởi v.v.
Tattha uppādanti purimakammapaccayā khandhānaṃ idha uppattimāha.
Among these, "arising" refers to the origination of the aggregates here due to past karma.
Trong đó, sự sinh khởi nói về sự sinh khởi của các uẩn trong kiếp này do nghiệp quá khứ làm nhân.
Pavattanti tathāuppannassa pavattiṃ.
"Continuation" refers to the continuity of what has thus arisen.
Sự tiếp diễn nói về sự tiếp diễn của những gì đã sinh khởi như vậy.
Nimittanti sabbampi tebhūmakaṃ saṅkhāragataṃ nimittabhāvena upaṭṭhānato.
"Sign" refers to all formations of the three planes, as they appear as a sign.
Dấu hiệu là vì tất cả các hành thuộc ba cõi đều xuất hiện như một dấu hiệu.
Āyūhananti āyatiṃ paṭisandhihetubhūtaṃ kammaṃ.
"Accumulation" refers to karma that is a cause for rebirth in the future.
Sự nỗ lực là nghiệp tạo nhân tái sinh trong tương lai.
Paṭisandhinti āyatiṃ upapattiṃ.
"Rebirth" refers to re-existence in the future.
Sự tái sinh là sự tái tục trong tương lai.
Gatinti yāya gatiyā sā paṭisandhi hoti.
"Destination" refers to the destination in which that rebirth occurs.
Cảnh giới là cảnh giới mà sự tái sinh đó diễn ra.
Nibbattinti khandhānaṃ nibbattanaṃ.
"Manifestation" refers to the manifestation of the aggregates.
Sự xuất hiện là sự xuất hiện của các uẩn.
Upapattinti vipākappavattiṃ.
"Re-existence" refers to the continuation of results.
Sự tái tục là sự tiếp diễn của quả dị thục.
Jātinti jarādīnaṃ paccayabhūtaṃ bhavapaccayā jātiṃ.
"Birth" refers to birth caused by existence, which is a condition for aging and so forth.
Sự sinh là sự sinh do hữu làm duyên, là nhân của sự già v.v.
Jarāmaraṇādayo pākaṭā eva.
"Aging and death" and so forth are obvious.
Sự già và sự chết v.v. là rõ ràng.
Ettha ca uppādādayo pañceva saṅkhārupekkhāñāṇassa visayavasena vuttā, sesā tesaṃ vevacanavasena.
Here, the five terms such as "arising" (uppāda) are stated as the scope of knowledge of equanimity regarding formations, while the remaining terms are synonyms for these. Indeed, these two, "manifestation" (nibbatti) and "birth" (jāti), are synonyms for "arising" (uppāda) and "rebirth" (paṭisandhi).
Ở đây, năm từ chính "sự sinh khởi" v.v. được nói đến theo đối tượng của trí tuệ xả ly các hành, còn lại là các từ đồng nghĩa của chúng.
Nibbatti jātīti idañhi dvayaṃ uppādassa ceva paṭisandhiyā ca vevacanaṃ.
And these two, "destination" (gati) and "re-existence" (upapatti), are synonyms for "continuation" (pavatta); "aging" (jarā) and so forth are synonyms for "sign" (nimitta): this should be understood.
Thật vậy, hai từ "sự xuất hiện" và "sự sinh" là đồng nghĩa với "sự sinh khởi" và "sự tái sinh".
Gati upapatti cāti idaṃ dvayaṃ pavattassa, jarādayo nimittassāti veditabbaṃ.
It might be asked: in the four instances of the paths (magga), five root terms such as "arising" (uppāda) and ten synonymous terms such as "destination" (gati), making fifteen terms, are mentioned; but in the six instances of fruition attainments (phala-samāpatti), only the five root terms are mentioned. Why is this so?
Hai từ "cảnh giới" và "sự tái tục" là đồng nghĩa với "sự tiếp diễn", và "sự già" v.v. là đồng nghĩa với "dấu hiệu", nên cần phải hiểu như vậy.
Nanu cettha catūsu maggavāresu ‘‘uppāda’’ntiādīni pañca mūlapadāni, ‘‘gatī’’tiādīni dasa vevacanapadānīti pannarasa padāni vuttāni, chasu pana phalasamāpattivāresu pañca mūlapadāneva vuttāni, taṃ kasmāti ce?
Now, in the four path-sections, fifteen terms are mentioned: five root-terms, "arising" and so on, and ten synonyms, "course" and so on. But in the six fruit-attainment sections, only the five root-terms are mentioned. If it is asked why this is so:
Nếu hỏi: "Trong bốn giai đoạn Đạo, năm từ gốc 'sự sinh khởi' v.v. và mười từ đồng nghĩa 'cảnh giới' v.v. – tổng cộng mười lăm từ – đã được nói đến, nhưng trong sáu giai đoạn Quả-định thì chỉ có năm từ gốc được nói đến, tại sao vậy?"
Saṅkhārupekkhāya tikkhabhāve sati kilesappahānasamatthassa maggassa sabbhāvato tassā tikkhabhāvadassanatthaṃ vevacanapadehi saha daḷhaṃ katvā mūlapadāni vuttāni, phalassa nirussāhabhāvena santasabhāvattā maggāyattattā ca mandabhūtāpi saṅkhārupekkhā phalassa paccayo hotīti dassanatthaṃ mūlapadāneva vuttānīti veditabbāni.
When equanimity regarding formations is keen, there is the existence of a path capable of abandoning defilements; to show its keenness, the root terms are stated with the synonymous terms to strengthen the teaching. For the fruition, being free from effort and having a tranquil nature, and being dependent on the path, even a gentle equanimity regarding formations can be a condition for the fruition; to show this, only the root terms are stated. This should be understood.
Khi trí tuệ xả ly các hành sắc bén, có khả năng đoạn trừ các phiền não và có Đạo, thì để chỉ ra sự sắc bén của nó, các từ gốc được nói đến một cách kiên cố cùng với các từ đồng nghĩa. Còn đối với Quả, vì nó ở trạng thái không cần nỗ lực, an tịnh, và phụ thuộc vào Đạo, nên để chỉ ra rằng ngay cả một trí tuệ xả ly các hành yếu kém cũng có thể là nhân của Quả, thì chỉ có các từ gốc được nói đến. Cần phải hiểu như vậy.
Tattha ‘‘sotāpattimaggapaṭilābhatthāyā’’tiādīsu catūsu maggavāresu suññatānimittappaṇihitamaggānaṃ aññataro vutto.
Among these, in the four instances of the paths, such as "for the attainment of the stream-entry path" and so forth, one of the paths—the void, the signless, or the undefiled path—is mentioned.
Trong đó, ở bốn giai đoạn Đạo như "vì mục đích chứng đắc đạo Tu-đà-hoàn" v.v., một trong các đạo Vô không, Vô tướng, Vô nguyện được nói đến.
‘‘Sotāpattiphalasamāpattatthāyā’’tiādīsu catūsu phalavāresu pana appaṇihitaphalasamāpatti veditabbā.
In the four instances of the fruits, such as "for the attainment of the fruition of stream-entry" and so forth, the undefiled fruition attainment (appaṇihita-phala-samāpatti) should be understood.
Còn ở bốn giai đoạn Quả như "vì mục đích chứng đắc Quả Tu-đà-hoàn" v.v., cần phải hiểu là Quả-định Vô nguyện.
Suññatavihārasamāpattatthāya animittavihārasamāpattatthāyāti itarāsaṃ dvinnaṃ phalasamāpattīnaṃ visuṃ vuttattā.
Because the other two fruition attainments—for the attainment of the void dwelling attainment and for the attainment of the signless dwelling attainment—are mentioned separately.
Vì hai Quả-định còn lại là Vô không trú và Vô tướng trú đã được nói riêng, như "vì mục đích chứng đắc Vô không trú" và "vì mục đích chứng đắc Vô tướng trú".
Aniccānupassanāvuṭṭhānavasena hi animittamaggo, tatheva phalasamāpattikāle animittaphalasamāpatti, dukkhānupassanāvuṭṭhānavasena appaṇihitamaggaphalasamāpattiyo, anattānupassanāvuṭṭhānavasaena suññatamaggaphalasamāpattiyo suttantanayena veditabbā.
Indeed, the signless path arises by way of insight into impermanence, and similarly, the signless fruition attainment arises at the time of fruition attainment; the undefiled path and fruition attainments arise by way of insight into suffering; and the void path and fruition attainments arise by way of insight into non-self. This should be understood according to the Sutta method.
Thật vậy, theo phương pháp của kinh tạng, đạo Vô tướng là do sự xuất khởi của quán vô thường (anicca), và quả-định Vô tướng cũng vậy khi nhập quả-định. Đạo và quả-định Vô nguyện là do sự xuất khởi của quán khổ (dukkha), và đạo và quả-định Vô không là do sự xuất khởi của quán vô ngã (anattā). Cần phải hiểu như vậy.
Evañca katvā suññatādivimokkhavasena magguppattihetubhūtā catasso, tathā appaṇihitaphalasamāpattiyā catasso, suññatavihāraanimittavihāravasena dveti dasa saṅkhārupekkhāvipassanāpaññā vuttā, samathasaṅkhārupekkhā pana appanāvīthiyā āsannapubbabhāge balappattaṃ bhāvanāmayañāṇaṃ.
And having done so, four types of wisdom of equanimity regarding formations for insight are taught, which are causes for the arising of the path by way of the void and other liberations; similarly, four for the undefiled fruition attainment; and two by way of the void dwelling and signless dwelling, totaling ten. However, the equanimity regarding formations for tranquility is the developed knowledge that has gained strength in the proximate prior stage of the absorption path.
Và như vậy, bốn trí tuệ quán minh xả ly các hành là nhân sinh khởi Đạo theo phương cách giải thoát Vô không v.v., bốn trí tuệ khác là theo phương cách Quả-định Vô nguyện, và hai trí tuệ là theo phương cách Vô không trú và Vô tướng trú, tổng cộng là mười trí tuệ quán minh xả ly các hành đã được nói đến. Còn trí tuệ xả ly các hành thuộc tịnh chỉ (samatha saṅkhārupekkhā) là trí tuệ do tu tập đã đạt được sức mạnh ở giai đoạn tiền cận của con đường an chỉ (appanā vīthi).
Tattha chaḷaṅgupekkhā ca brahmavihārupekkhā ca bojjhaṅgupekkhā ca tatramajjhattupekkhā ca jhānupekkhā ca pārisuddhupekkhā ca atthato ekā tatramajjhattupekkhāva hoti.
Among these, the six-limbed equanimity (chaḷaṅgupekkhā), the divine abiding equanimity (brahmavihārupekkhā), the awakening factor equanimity (bojjhaṅgupekkhā), the equanimity of impartiality (tatramajjhattupekkhā), the jhāna equanimity (jhānupekkhā), and the purification equanimity (pārisuddhupekkhā) are, in essence, one and the same impartiality equanimity.
Trong đó, xả ly lục chi (chaḷaṅgupekkhā), xả ly phạm trú (brahmavihārupekkhā), xả ly giác chi (bojjhaṅgupekkhā), xả ly bình đẳng sở hữu (tatramajjhattupekkhā), xả ly thiền định (jhānupekkhā), và xả ly thanh tịnh (pārisuddhupekkhā) về mặt ý nghĩa thì chỉ là một loại tatramajjhattupekkhā.
Tena tena avatthābhedena panassā ayaṃ bhedo ekassapi sato sattassa kumārayuvatherasenāpatirājādivasena bhedo viya.
This distinction of it, despite its unity, is like the distinctions of a single being as child, youth, elder, general, king, and so forth, according to different situations.
Tuy nhiên, sự phân biệt này là do sự khác biệt về trạng thái, giống như sự phân biệt một chúng sinh thành trẻ con, thanh niên, trưởng lão, tướng quân, vua v.v.
Tasmā tāsu yattha chaḷaṅgupekkhā, na tattha bojjhaṅgupekkhādayo.
Therefore, among these, where there is six-limbed equanimity, there are no awakening factor equanimity and so forth.
Do đó, nơi nào có xả ly lục chi, nơi đó không có xả ly giác chi v.v.
Yattha vā pana bojjhaṅgupekkhā, na tattha chaḷaṅgupekkhādayo hontīti veditabbā.
And where there is awakening factor equanimity, there are no six-limbed equanimity and so forth. This should be understood.
Hoặc nơi nào có xả ly giác chi, nơi đó không có xả ly lục chi v.v. Cần phải hiểu như vậy.
Yathā cetāsaṃ atthato ekībhāvo, evaṃ saṅkhārupekkhāvipassanupekkhānampi.
Just as these* are one in meaning, so too are saṅkhārupekkhā and vipassanupekkhā.
Cũng như các pháp xả này là một về phương diện ý nghĩa, cũng vậy, xả đối với các hành (saṅkhārupekkhā) và xả trong minh sát (vipassanupekkhā) cũng là một.
Paññā eva hi sā kiccavasena dvidhā bhinnā.
Indeed, that is wisdom itself, divided into two according to its function.
Thật vậy, đó chính là trí tuệ (paññā), được phân chia làm hai theo chức năng.
Yathā hi purisassa sāyaṃ gehaṃ paviṭṭhaṃ sappaṃ ajapadadaṇḍaṃ gahetvā pariyesamānassa taṃ thusakoṭṭhake nipannaṃ disvā ‘‘sappo nu kho, no’’ti avalokentassa sovattikattayaṃ disvā nibbematikassa ‘‘sappo, na sappo’’ti vicinane majjhattatā hoti, evameva yā āraddhavipassakassa vipassanāñāṇena lakkhaṇattaye diṭṭhe saṅkhārānaṃ aniccabhāvādivicinane majjhattatā uppajjati, ayaṃ vipassanupekkhā.
Just as, for a man searching with a curved stick like a goat's leg for a snake that has entered his house in the evening, when he sees it lying in a pile of husks and examines it, saying, ‘‘Is it a snake, or not?’’ and then, seeing its three coils, becomes certain, there arises in him an equanimity in discerning ‘‘it is a snake, it is not a snake’’; in the same way, when a diligent meditator sees the three characteristics with vipassanā knowledge, the equanimity that arises in discerning the impermanent nature of formations is vipassanupekkhā.
Ví như một người đàn ông, vào buổi chiều, cầm gậy có đầu cong như chân dê đi tìm con rắn đã vào nhà, khi thấy nó nằm trong đống trấu, người ấy nhìn xem "có phải rắn không, hay không phải" và khi thấy ba ngấn ở cổ thì hết nghi ngờ, sự trung lập trong việc xem xét "là rắn, không phải rắn" khởi lên; cũng vậy, đối với vị hành giả đã bắt đầu tu tập minh sát, khi ba tướng đã được thấy bằng trí tuệ minh sát, sự trung lập khởi lên trong việc xem xét tính vô thường của các hành, đây là xả trong minh sát (vipassanupekkhā).
Yathā pana tassa purisassa ajapadena daṇḍena gāḷhaṃ sappaṃ gahetvā ‘‘kintāhaṃ imaṃ sappaṃ aviheṭhento attānañca iminā aḍaṃsāpento muñceyya’’nti muñcanākārameva pariyesato gahaṇe majjhattatā hoti, evameva yā lakkhaṇattayassa diṭṭhattā āditte viya tayo bhave passato saṅkhāraggahaṇe majjhattatā, ayaṃ saṅkhārupekkhā.
But just as that man, having firmly caught the snake with the curved stick, seeks only the way to release it, thinking, ‘‘How can I release this snake without harming it and without being bitten by it myself?’’ and there is an equanimity in holding it; in the same way, the equanimity in grasping formations, seeing the three existences as if they were ablaze due to having seen the three characteristics, is saṅkhārupekkhā.
Lại nữa, ví như người đàn ông ấy, sau khi dùng gậy chân dê bắt chặt con rắn, chỉ tìm cách thả nó ra sao cho "làm thế nào ta có thể thả con rắn này mà không làm nó bị thương và cũng không để mình bị nó cắn", sự trung lập trong việc bắt giữ khởi lên; cũng vậy, do đã thấy được ba tướng, vị ấy thấy ba cõi như đang bốc cháy, sự trung lập trong việc nắm bắt các hành khởi lên, đây là xả đối với các hành (saṅkhārupekkhā).
Iti vipassanupekkhāya siddhāya saṅkhārupekkhāpi siddhāva hoti.
Thus, when vipassanupekkhā is perfected, saṅkhārupekkhā is also perfected.
Như vậy, khi xả trong minh sát (vipassanupekkhā) đã thành tựu, xả đối với các hành (saṅkhārupekkhā) cũng được xem là đã thành tựu.
Iminā panesā vicinanagahaṇesu majjhattasaṅkhātena kiccena dvidhā bhinnā.
However, these are divided into two by the function of equanimity in discerning and grasping.
Tuy nhiên, nó được phân chia làm hai bởi chức năng này, được gọi là sự trung lập trong việc xem xét và nắm bắt.
Vīriyupekkhā pana vedanupekkhā ca aññamaññañca avasesāhi ca atthato bhinnā evāti.
Vīriyupekkhā and vedanupekkhā, on the other hand, are different from each other and from the remaining* in meaning.
Còn xả trong tinh tấn (vīriyupekkhā) và xả trong thọ (vedanupekkhā) thì khác nhau về ý nghĩa, cả với nhau và với các loại xả còn lại.
Imāsaṃ pana dasannampi upekkhānaṃ bhūmipuggalādivasena vibhāgo tattha tattha vuttanayeneva veditabboti dassento āha ‘‘evamayaṃ dasavidhāpī’’tiādi.
Now, in order to show that the classification of these ten types of equanimity, according to plane, person, and so forth, is to be understood in the manner stated in each context, he states, ‘‘Thus, this is also tenfold’’, and so on.
Bây giờ, để chỉ ra rằng sự phân loại mười loại xả này theo địa, cá nhân, v.v. cần được hiểu theo phương pháp đã được trình bày ở các nơi khác, ngài nói "evamayaṃ dasavidhāpī" v.v.
Tattha bhūmipuggalacittārammaṇatoti ‘‘chaḷaṅgupekkhā kāmāvacarā, brahmavihārupekkhā rūpāvacarā’’ti evamādinā bhūmito.
Regarding that, according to plane, person, consciousness, and object,* according to plane by expressions such as ‘‘the six-limbed equanimity is kāmāvacara, brahmavihārupekkhā is rūpāvacara.’’
Trong đó, bhūmipuggalacittārammaṇato (theo địa, cá nhân, tâm và đối tượng) có nghĩa là: theo địa (bhūmi), qua các câu như "lục chi xả (chaḷaṅgupekkhā) thuộc cõi dục, xả trong phạm trú (brahmavihārupekkhā) thuộc cõi sắc".
‘‘Chaḷaṅgupekkhā khīṇāsavasseva, brahmavihārupekkhā tiṇṇampi puthujjanasekkhāsekkhāna’’nti evamādinā puggalato.
According to person by expressions such as ‘‘the six-limbed equanimity belongs only to an Arahant, brahmavihārupekkhā to all three: ordinary people, trainees, and perfected ones.’’
Theo cá nhân (puggala), qua các câu như "lục chi xả chỉ có ở bậc lậu tận, xả trong phạm trú có ở cả ba hạng phàm phu, hữu học và vô học".
‘‘Chaḷaṅgupekkhā somanassupekkhāsahagatacittasampayuttā’’tiādinā cittato.
According to consciousness by expressions such as ‘‘the six-limbed equanimity is associated with consciousness accompanied by joy-equanimity,’’ and so on.
Theo tâm (citta), qua các câu như "lục chi xả tương ưng với tâm câu hành thọ hỷ hoặc thọ xả".
‘‘Chaḷaṅgupekkhā chaḷārammaṇā, brahmavihārupekkhā dhammārammaṇā’’tiādinā ārammaṇato.
According to object by expressions such as ‘‘the six-limbed equanimity has six objects, brahmavihārupekkhā has dhamma as its object,’’ and so on.
Theo đối tượng (ārammaṇa), qua các câu như "lục chi xả có sáu đối tượng, xả trong phạm trú có đối tượng là pháp".
Khandhasaṅgahaekakkhaṇakusalattikasaṅkhepavasenāti ‘‘vedanupekkhā vedanākkhandhena saṅgahitā, itarā nava saṅkhārakkhandhenā’’ti khandhasaṅgahavasena.
According to inclusion in aggregates, occurrence at one moment, and analysis into the triple classification of kamma means, according to inclusion in aggregates, that ‘‘vedanupekkhā is included in the feeling aggregate, the other nine in the formation aggregate.’’
Khandhasaṅgahaekakkhaṇakusalattikasaṅkhepavasenā (theo sự phân loại uẩn, cùng một sát-na, tam đề thiện và tóm lược) có nghĩa là: theo sự phân loại uẩn (khandhasaṅgaha), "xả trong thọ (vedanupekkhā) được bao gồm trong thọ uẩn, chín loại còn lại được bao gồm trong hành uẩn".
Chaḷaṅgupekkhā brahmavihārabojjhaṅgajhānapārisuddhitatramajjhattupekkhā ca atthato ekā, tasmā ekakkhaṇe tāsu ekāya sati na itarā, tathā saṅkhārupekkhāvipassanupekkhāpi veditabbā, vedanāvīriyupekkhānaṃ ekakkhaṇe siyā uppattīti evaṃ ekakkhaṇavasena.
Chaḷaṅgupekkhā, brahmavihārupekkhā, bojjhaṅgupekkhā, jhānupekkhā, pārisuddhupekkhā, and tatramajjhattatā-upekkhā are one in meaning; therefore, if one of them exists at a single moment, the others do not. Saṅkhārupekkhā and vipassanupekkhā should be understood similarly. Vedanupekkhā and vīriyupekkhā may arise at a single moment. Thus, this is according to occurrence at one moment.
Lục chi xả, xả trong phạm trú, xả trong giác chi, xả trong thiền, xả trong thanh tịnh và xả trung bình (tatramajjhattupekkhā) về bản chất là một; do đó, trong một sát-na, khi một trong số chúng có mặt thì các loại khác không có. Tương tự, cần hiểu về xả đối với các hành và xả trong minh sát. Xả trong thọ và xả trong tinh tấn có thể sinh khởi trong cùng một sát-na. Như vậy là theo cùng một sát-na (ekakkhaṇa).
Chaḷaṅgupekkhā abyākatā, brahmavihārupekkhā kusalābyākatā, tathā sesā, vedanupekkhā pana siyā akusalāpīti evaṃ kusalattikavasena.
Chaḷaṅgupekkhā is indeterminate (abyākatā); brahmavihārupekkhā is wholesome (kusalā) or indeterminate (abyākatā); the remaining ones are likewise. Vedanupekkhā, however, may also be unwholesome (akusalā). Thus, this is according to the triple classification of kamma.
Lục chi xả là vô ký; xả trong phạm trú là thiện và vô ký; các loại còn lại cũng vậy. Riêng xả trong thọ có thể là bất thiện. Như vậy là theo tam đề thiện (kusalattika).
Dasapetā saṅkhepato cattārova dhammā vīriyavedanātatramajjhattatāñāṇavasenāti evaṃ saṅkhepavasena.
These ten, in brief, are only four dhammas in terms of energy, feeling, impartiality, and knowledge. Thus, this is according to brevity.
Mười loại này, tóm lại, chỉ là bốn pháp theo phương diện tinh tấn, thọ, xả trung bình và trí tuệ. Như vậy là theo sự tóm lược (saṅkhepa).
Idāni idhādhippetāya jhānupekkhāya lakkhaṇādiṃ niddhāretvā dassento āha ‘‘lakkhaṇādito panā’’tiādi.
Now, determining and showing the characteristics of jhānupekkhā, which is intended here, he states, ‘‘From the standpoint of characteristics, moreover’’, and so on.
Bây giờ, để xác định và chỉ ra đặc tính v.v. của xả trong thiền được đề cập ở đây, ngài nói "lakkhaṇādito panā" v.v.
Tattha anābhogarasāti paṇītasukhepi tasmiṃ avanatipaṭipakkhakiccāti attho.
Here, anābhogarasā means that its function is to oppose inclination even towards supreme pleasure.
Trong đó, anābhogarasā (có phận sự là không chú ý) có nghĩa là: có phận sự đối nghịch với việc hướng đến lạc thọ cao tột đó.
Abyāpārapaccupaṭṭhānāti satipi sukhapāramippattiyaṃ tasmiṃ sukhe abyāvaṭā hutvā paccupatiṭṭhati, sampayuttānaṃ vā tattha abyāpāraṃ paccupaṭṭhapetīti attho.
Abyāpārapaccupaṭṭhānā means that, even when the culmination of pleasure is attained, it appears as being unconcerned with that pleasure, or it causes the associated mental factors to appear unconcerned with it.
Abyāpārapaccupaṭṭhānā (có sự biểu hiện là không bận tâm) có nghĩa là: mặc dù đã đạt đến đỉnh cao của lạc, nó biểu hiện như là không bận tâm đến lạc đó, hoặc nó làm cho các pháp tương ưng không bận tâm đến lạc đó.
Sampayuttadhammānaṃ khobhaṃ uppilavañca āvahantehi vitakkādīhi abhibhūtattā aparibyattaṃ tattha tatramajjhattatāya kiccaṃ, tadabhāvato idha paribyattanti āha ‘‘aparibyattakiccato’’ti.
The function of tatramajjhattatā in those* is not distinct, because it is overwhelmed by vitakka and other coarse factors that cause agitation and wavering among the associated mental factors. Here, it is distinct due to the absence of those*. Thus, he says, ‘‘because its function is not indistinct’’.
Do bị các pháp như tầm v.v. vốn mang lại sự xáo trộn và trôi nổi cho các pháp tương ưng áp đảo, nên phận sự của xả trung bình (tatramajjhattatā) ở các tầng thiền đó không rõ ràng. Do không có chúng ở đây, nên nó rõ ràng. Vì vậy, ngài nói "aparibyattakiccato" (do phận sự không rõ ràng).
Tenevāha ‘‘aparibyattaṃ hī’’tiādi.
For that very reason, he says, ‘‘Indeed, indistinct,’’ and so on.
Chính vì thế ngài nói "aparibyattaṃ hī" v.v.
Idāni sato ca sampajānoti ettha ‘‘vuccatī’’ti ajjhāharitabbaṃ.
Now, in the phrase sato ca sampajāno (mindful and clearly comprehending), the word ‘‘is said’’ should be supplied.
Bây giờ, ở đây, trong câu sato ca sampajāno, cần phải thêm vào từ "vuccati" (được gọi là).
Saratīti iminā ‘‘sato’’ti padassa kattusādhanatamāha.
By saratī (remembers), he states the agentive derivation of the word ‘‘sato’’ (mindful).
Với từ saratī (nhớ), ngài chỉ ra rằng từ "sato" được hình thành theo nghĩa chủ động.
Sampajānātīti sammadeva pajānāti.
Sampajānātī (clearly comprehends) means understands thoroughly.
Sampajānāti có nghĩa là biết một cách đúng đắn.
Puggalenāti puggalādhiṭṭhānena.
Puggalenā means by the teaching based on a person.
Puggalenā có nghĩa là theo cách thuyết giảng quy về cá nhân.
Saraṇaṃ cintanaṃ upaṭṭhānaṃ lakkhaṇametissāti saraṇalakkhaṇā.
That which has remembrance, reflection, and presence as its characteristic is saraṇalakkhaṇā (having remembrance as its characteristic).
Sự nhớ, sự suy niệm, sự an trú là đặc tính của nó, nên gọi là saraṇalakkhaṇā (có đặc tính là nhớ).
Sammussanapaṭipakkho asammussanaṃ kiccaṃ etissāti asammussanarasā.
That which has non-forgetfulness, the opposite of forgetfulness, as its function is asammussanarasā (having non-forgetfulness as its essence).
Sự không quên, đối nghịch với sự lãng quên, là phận sự của nó, nên gọi là asammussanarasā (có phận sự là không quên).
Kilesehi ārakkhā hutvā paccupatiṭṭhati, tato vā ārakkhaṃ paccupaṭṭhapetīti ārakkhapaccupaṭṭhānā.
It stands present as a guard against defilements, or it causes protection from them to appear. Thus, it is ārakkhapaccupaṭṭhānā (having protection as its proximate cause).
Nó biểu hiện như là sự bảo vệ khỏi các phiền não, hoặc nó làm cho sự bảo vệ khỏi các phiền não hiện khởi, nên gọi là ārakkhapaccupaṭṭhānā (có sự biểu hiện là sự bảo vệ).
Asammuyhanaṃ sammadeva pajānanaṃ, sammohapaṭipakkho vā asammoho lakkhaṇametassāti asammohalakkhaṇaṃ.
Non-delusion is clear comprehension; or, that which has non-delusion, the opposite of delusion, as its characteristic is asammohalakkhaṇaṃ (having non-delusion as its characteristic).
Sự không mê mờ, tức là biết một cách đúng đắn, hoặc sự không mê mờ, đối nghịch với si mê, là đặc tính của nó, nên gọi là asammohalakkhaṇaṃ (có đặc tính là không mê mờ).
Tīraṇaṃ kiccassa pāragamanaṃ.
Tīraṇaṃ is reaching the conclusion of a task.
Tīraṇaṃ là sự hoàn thành phận sự.
Pavicayo vīmaṃsā.
Pavicayo is investigation.
Pavicayo là sự thẩm sát.
Kāmaṃ upacārajjhānādiṃ upādāya paṭhamadutiyajjhānānipi sukhumāneva, imaṃ pana uparimajjhānaṃ upādāya ‘‘oḷārikattā pana tesaṃ jhānāna’’nti vuttaṃ, sā ca oḷārikatā vitakkādithūlaṅgatāya veditabbā.
Although the first and second jhānas are subtle by virtue of being proximate jhānas, etc., the statement ‘‘because those jhānas are coarse’’ is made with reference to this higher jhāna. And that coarseness should be understood as having gross factors such as vitakka.
Mặc dù so với cận hành thiền v.v., thiền thứ nhất và thứ hai cũng đã là vi tế, nhưng so với tầng thiền cao hơn này, câu "oḷārikattā pana tesaṃ jhānānaṃ" (do sự thô thiển của các tầng thiền đó) đã được nói đến, và sự thô thiển đó cần được hiểu là do các chi thiền thô như tầm v.v.
Keci ‘‘bahucetasikatāyā’’ti ca vadanti.
Some also say, ‘‘because of having many mental factors.’’
Một số vị lại nói "do có nhiều tâm sở".
Bhūmiyaṃ viya purisassāti purisassa bhūmiyaṃ gati viyāti vuttaṃ hoti.
As a man’s movement on the ground means as a man's going on the ground.
Bhūmiyaṃ viya purisassā (như sự đi của người trên mặt đất) có nghĩa là như sự đi của người trên mặt đất.
Gati sukhā hotīti tesu jhānesu gati sukhā hoti.
The movement is comfortable means the movement in those jhānas is comfortable.
Gati sukhā hoti (sự đi lại dễ dàng) có nghĩa là sự đi lại trong các tầng thiền đó dễ dàng.
Abyattaṃ tattha satisampajaññakiccanti ‘‘idaṃ nāma dukkaraṃ karīyatī’’ti vattabbassa abhāvato vuttaṃ.
The function of mindfulness and clear comprehension there is indistinct is said because there is no saying ‘‘this is difficult to do.’’
Abyattaṃ tattha satisampajaññakicca (phận sự của niệm và tỉnh giác ở đó không rõ ràng) được nói đến do không có gì để phải nói rằng "việc khó làm này đang được thực hiện".
Oḷārikaṅgappahānena pana sukhumattāti ayamattho kāmaṃ dutiyajjhānepi sambhavati, tathāpi yebhuyyena avippayogībhāvena vattamānesu pītisukhesu pītisaṅkhātassa oḷārikaṅgassa pahānena sukhumatāya idha sātisayo satipaññābyāpāroti vuttaṃ ‘‘purisassā’’tiādi.
But due to its subtlety through the abandoning of coarse factors – although this meaning is possible even in the second jhāna, it is said that here, in the third jhāna, the activity of mindfulness and wisdom is especially pronounced due to subtlety resulting from the abandoning of the coarse factor called joy among joy and pleasure which mostly occur in an inseparable state. Thus, he states, ‘‘for the man,’’ and so on.
Oḷārikaṅgappahānena pana sukhumattā (nhưng do sự vi tế nhờ từ bỏ các chi thiền thô), ý này tuy có thể có ở thiền thứ hai, nhưng ở đây, do sự từ bỏ chi thiền thô là hỷ trong số hỷ và lạc vốn thường không tách rời nhau, nên sự vi tế làm cho hoạt động của niệm và trí tuệ trở nên vượt trội, do đó đã nói "purisassā" v.v.
Dhenuṃ pivatīti dhenupago, dhenuyā khīraṃ pivantoti vuttaṃ hoti.
He drinks from the cow, thus dhenupago; it means he drinks milk from the cow.
Uống sữa bò mẹ nên gọi là dhenupago, có nghĩa là kẻ đang uống sữa của bò mẹ.
Punadeva pītiṃ upagaccheyyāti hānabhāgiyaṃ jhānaṃ siyā, dutiyajjhānameva sampajjeyyāti attho.
He might again attain joy means the jhāna might be disadvantageous, meaning it might revert to the second jhāna.
Punadeva pītiṃ upagaccheyyā (lại có thể đạt đến hỷ) có nghĩa là thiền có thể trở thành phần thoái thất, tức là chỉ đạt được thiền thứ hai.
Tenāha ‘‘pītisampayuttameva siyā’’ti.
Thus, he says, ‘‘It might be associated with joy.’’
Do đó, ngài nói "pītisampayuttameva siyā" (chỉ có thể tương ưng với hỷ).
Idañca atimadhuraṃ sukhanti tatiyajjhāne sukhaṃ sandhāyāha, atimadhuratā cassa pahāsodagyasabhāvāya pītiyā abhāveneva veditabbā.
And this pleasure is exceedingly sweet – this refers to the pleasure in the third jhāna. Its exceeding sweetness should be understood by the absence of joy, which is of the nature of exuberance and elation.
Idañca atimadhuraṃ sukhaṃ (và lạc này rất ngọt ngào) là nói đến lạc trong thiền thứ ba, và sự rất ngọt ngào của nó cần được hiểu là do không có hỷ, vốn có bản chất là hân hoan và phấn khởi.
Idanti ‘‘sato sampajāno’’ti padadvayaṃ.
Idaṃ refers to the two words ‘‘sato sampajāno’’.
Idaṃ (điều này) là chỉ hai từ "sato sampajāno".
Sukhañca kāyena paṭisaṃvedesinti ettha kathamābhogena vinā sukhapaṭisaṃvedanāti āha ‘‘kiñcāpī’’tiādi.
In the phrase sukhañca kāyena paṭisaṃvedesi (and he felt pleasure with his body), the question arises how pleasure can be felt without advertence. Therefore, he states, ‘‘Although’’, and so on.
Trong câu sukhañca kāyena paṭisaṃvedesi (và cảm nhận lạc bằng thân), làm thế nào có thể cảm nhận lạc mà không có sự chú ý? Để trả lời, ngài nói "kiñcāpī" v.v.
Yasmā tassa nāmakāyena sampayuttaṃ sukhaṃ, tasmā etamatthaṃ dassento ‘‘sukhañca kāyena paṭisaṃvedesi’’nti āhāti yojetabbaṃ.
Since pleasure associated with the mental body belongs to him, it should be connected thus: in order to show this meaning, he said, ‘‘sukhañca kāyena paṭisaṃvedesi.’’
Bởi vì vị ấy có lạc tương ưng với danh thân, nên để chỉ ra ý nghĩa này, ngài nói "sukhañca kāyena paṭisaṃvedesi". Cần phải liên kết như vậy.
Ayaṃ panettha saṅkhepattho – ‘‘sukhaṃ vedayāmī’’ti evamābhoge asatipi nāmakāyena cetasikasukhaṃ, kāyikasukhaheturūpasamuṭṭhāpanena kāyikasukhañca jhānasamaṅgī paṭisaṃvedetīti vuccatīti.
Here is the brief meaning: even without advertence like ‘‘I feel pleasure,’’ a person endowed with jhāna feels mental pleasure through the mental body, and also physical pleasure by giving rise to physical pleasure-causing formations. Thus it is said.
Đây là ý nghĩa tóm tắt ở đây – mặc dù không có sự chú ý rằng "tôi cảm nhận lạc", nhưng người chứng thiền được cho là cảm nhận lạc tâm sở bằng danh thân, và lạc thân bằng cách làm sinh khởi sắc pháp là nhân của lạc thân.
Tassāti jhānasamaṅgino.
Tassā refers to the one endowed with jhāna.
Tassā (của vị ấy) có nghĩa là của người chứng thiền.
Yaṃ vā tanti yaṃ vā taṃ yathāvuttaṃ nāmakāyasampayuttaṃ sukhaṃ.
That which is the happiness conjoined with the mental body, as described.
Yaṃ vā tanti có nghĩa là, bất cứ lạc nào đã được nói đến, tương ưng với danh thân.
Taṃsamuṭṭhānenāti tato samuṭṭhitena atipaṇītena rūpena assa jhānasamaṅgino rūpakāyo yasmā phuṭo, tasmā etamatthaṃ dassentoti sambandhitabbaṃ.
By that arising means: because the physical body of that meditator, endowed with jhāna, is pervaded by the exceedingly refined matter arisen from that (happiness), therefore this meaning should be connected as being shown.
Taṃsamuṭṭhānenāti bởi vì sắc thân của vị thành tựu thiền này được thấm nhuần bởi sắc cực kỳ vi tế khởi sinh từ đó, nên cần được liên kết rằng, ngài trình bày ý nghĩa này.
Yassāti rūpakāyassa.
Whose refers to the physical body.
Yassāti là của sắc thân.
Phuṭattāti byāpitattāti attho.
Being pervaded means being spread throughout.
Phuṭattāti có nghĩa là do đã được lan khắp.
Yathā hi udakena phuṭṭhasarīrassa tādise phoṭṭhabbe phuṭṭhe sukhaṃ uppajjati, evaṃ etehi jhānacittasamuṭṭhitehi rūpehi phuṭṭhasarīrassa.
Just as happiness arises for a body pervaded by water when such a tangible object is touched, so too for a body pervaded by these kinds of matter arisen from the jhāna-consciousness.
Ví như khi thân thể được thấm nhuần bởi nước, lạc khởi sinh khi xúc chạm với đối tượng xúc tương tự; cũng vậy, đối với thân thể được thấm nhuần bởi những sắc do tâm thiền này sanh khởi.
Jhānā vuṭṭhitopīti jhānamhā vuṭṭhitopi.
Even having risen from jhāna means even having risen from the jhāna.
Jhānā vuṭṭhitopīti là ngay cả khi đã xuất thiền.
Sukhaṃ paṭisaṃvedeyyāti cittasamuṭṭhitarūpehi avasesatisamuṭṭhitarūpasaṅghaṭṭanena uppannakāyaviññāṇena kāyikaṃ sukhaṃ paṭisaṃvedeyya.
He would experience happiness means he would experience physical happiness by a body-consciousness arisen from the impingement of matter arisen from consciousness with matter arisen from the remaining three causes.
Sukhaṃ paṭisaṃvedeyyāti là vị ấy có thể cảm thọ thân lạc bằng thân thức sanh khởi do sự va chạm của các sắc do tâm sanh với các sắc do ba nhân sanh còn lại.
Etamatthanti vuttanayena cetasikakāyikasukhapaṭisaṃvedanasaṅkhātaṃ atthaṃ.
This meaning is the meaning referred to as the experiencing of mental and physical happiness in the manner described.
Etamatthanti là ý nghĩa được gọi là sự cảm thọ lạc thuộc tâm và lạc thuộc thân theo phương pháp đã nói.
Yanti hetuatthe nipāto, yasmāti attho.
Yaṃ (what) is a particle in the sense of cause; it means "because".
Yanti là một tiểu từ chỉ nguyên nhân, có nghĩa là bởi vì.
Tenāha ‘‘yaṃjhānahetū’’ti.
Therefore, it says "whatever is the cause of jhāna."
Do đó, ngài nói ‘‘yaṃjhānahetū’’ti.
Ācikkhantītiādīni padāni kittanatthānīti adhippāyenāha ‘‘pasaṃsantīti adhippāyo’’ti.
Ācikkhantī and other words are in the sense of extolling, with the intention of "they praise."
Với ý rằng các từ ācikkhantīti, v.v. có nghĩa là tán thán, ngài nói ‘‘pasaṃsantīti adhippāyo’’ti.
Kintīti pasaṃsanākārapucchā.
Kinti is a question about the manner of praise.
Kintīti là câu hỏi về cách thức tán thán.
Sukhapāramippatteti sukhassa paramaṃ pariyantaṃ patte.
Attained to the extreme of happiness means attained to the supreme limit of happiness.
Sukhapāramippatteti là đã đạt đến giới hạn tối thượng của lạc.
Sukhābhisaṅgenāti sukhasmiṃ ālayena.
By attachment to happiness means by craving for happiness.
Sukhābhisaṅgenāti là do luyến ái trong lạc.
Edisesu ṭhānesu satiggahaṇeneva sampajaññampi gahitaṃ hotīti idha pāḷiyaṃ satiyā eva gahitattā evaṃ upaṭṭhitassatitāya satimā icceva vuttaṃ, sampajānoti heṭṭhā vuttattā vā.
In such instances, by the mere apprehension of mindfulness, clear comprehension is also included, hence, in the Pāḷi here, only mindfulness is mentioned as one who is mindful because of such established mindfulness, or because clear comprehension was mentioned previously.
Trong những trường hợp như vậy, việc nắm bắt niệm cũng bao hàm cả tỉnh giác. Do đó, ở đây trong Chánh tạng, vì chỉ đề cập đến niệm, nên chỉ nói là satimā (có niệm) do niệm đã được an trú. Hoặc là vì sampajāno (tỉnh giác) đã được nói ở dưới.
Asaṃkiliṭṭhanti kilesehi asammissattā asaṃkiliṭṭhaṃ.
Unblemished means unblemished due to not being mixed with defilements.
Asaṃkiliṭṭhanti là không ô nhiễm, vì không bị pha trộn với các phiền não.
Jhānakkhaṇe nippariyāyato cetasikasukhameva labbhatīti ‘‘sukhaṃ nāmakāyena paṭisaṃvedetī’’ti vuttaṃ.
Since mental happiness is obtained directly at the moment of jhāna, it is said, "he experiences happiness with the mental body."
Trong khoảnh khắc thiền, chỉ có lạc thuộc tâm được chứng đắc một cách không qua trung gian, do đó đã nói ‘‘sukhaṃ nāmakāyena paṭisaṃvedetī’’ti.
Tatiyanti gaṇanānupubbato tatiyantiādi heṭṭhā vuttanayānusārena veditabbaṃ.
Third, in the order of enumeration, third, and so forth, should be understood in accordance with the method explained previously.
Tatiyanti gaṇanānupubbato tatiyanti, v.v. cần được hiểu theo phương pháp đã được trình bày ở dưới.
‘‘Pubbevā’’ti vuttattā ‘‘kadā pana nesaṃ pahānaṃ hotī’’ti codanaṃ samuṭṭhāpetvā āha ‘‘catunnaṃ jhānānaṃ upacārakkhaṇe’’ti.
Since it was said "previously," raising the question "when, then, does their abandonment occur?" it is stated, "at the moment of access concentration of the four jhānas."
Vì đã nói ‘‘pubbevā’’ti, ngài nêu lên câu hỏi ‘‘kadā pana nesaṃ pahānaṃ hotī’’ti (khi nào chúng được đoạn trừ?) và trả lời ‘‘catunnaṃ jhānānaṃ upacārakkhaṇe’’ti (trong khoảnh khắc cận định của bốn thiền).
Evaṃ veditabbanti sambandho.
This is the connection to be understood.
Cần được liên kết rằng, nên hiểu như vậy.
Pahānakkamena avuttānanti ettha pahānakkamo nāma pahāyakadhammānaṃ uppattipaṭipāṭi.
In "not spoken in the order of abandonment," the order of abandonment refers to the sequence of the arising of the qualities to be abandoned.
Pahānakkamena avuttānanti ở đây, pahānakamo là thứ tự sanh khởi của các pháp đoạn trừ.
Tena pana vuccamāne ‘‘dukkhaṃ domanassaṃ sukhaṃ somanassa’’nti vattabbaṃ siyā, kasmā ito aññathā vacananti āha ‘‘indriyavibhaṅge’’tiādi.
If it were spoken according to that, it should be said "pain, displeasure, happiness, pleasure." Why is it spoken differently from this? Thus it says "in the analysis of faculties" and so forth.
Tuy nhiên, nếu nói theo thứ tự đó, đáng lẽ phải nói là “khổ, ưu, lạc, hỷ”. Tại sao lại nói khác đi? Ngài trả lời ‘‘indriyavibhaṅge’’ti, v.v.
Uddesakkamenāti ‘‘sukhindriyaṃ dukkhindriyaṃ somanassindriyaṃ domanassindriya’’nti evaṃ pavattauddesakkamena.
In the order of enumeration means in the established order of enumeration, such as "faculty of pleasure, faculty of pain, faculty of mental pleasure, faculty of mental displeasure."
Uddesakkamenāti là theo thứ tự đề mục đã được trình bày là “lạc quyền, khổ quyền, hỷ quyền, ưu quyền”.
Atha kasmā jhānesveva nirodho vuttoti sambandho.
Why, then, is the cessation mentioned only in the jhānas? This is the connection.
Vậy tại sao sự đoạn diệt chỉ được nói đến trong các thiền? Cần được liên kết như vậy.
Kattha cuppannaṃ dukkhindriyanti attano paccayehi uppannaṃ avikkhambhitaṃ dukkhindriyaṃ.
Where does the faculty of pain arise refers to the faculty of pain that has arisen unsuppressed by its own conditions.
Kattha cuppannaṃ dukkhindriyanti là khổ quyền chưa bị chế ngự, đã sanh khởi do các duyên của nó.
Kattha ca aparisesaṃ nirujjhatīti nirodhaṭṭhānaṃ nirodhakāraṇaṃ pucchati.
And where does it cease utterly asks about the place of cessation and the cause of cessation.
Kattha ca aparisesaṃ nirujjhatīti là hỏi về nơi đoạn diệt và nguyên nhân đoạn diệt.
Tena katthāti pucchāya etthāti vissajjanepi hetumhi bhummavacanaṃ daṭṭhabbaṃ.
Therefore, in the question "where?" and in the answer "there," the locative case should be understood as referring to the cause.
Do đó, trong câu hỏi katthāti và câu trả lời etthāti, cần hiểu cách dùng biến cách thứ bảy (bhumma) theo nghĩa nguyên nhân.
Jhānānubhāvanimittañhi anuppajjantaṃ dukkhindriyaṃ aparisesaṃ nirujjhatīti vuttaṃ.
Indeed, the faculty of pain that does not arise due to the power of jhāna is said to cease utterly.
Vì đã nói rằng khổ quyền không sanh khởi, được đoạn diệt không còn dư sót, là nhờ vào năng lực của thiền.
Atisayanirodho suṭṭhu pahānaṃ ujupaṭipakkhena vūpasamo.
Supreme cessation is excellent abandonment, calming by direct opposition.
Atisayanirodho là sự đoạn trừ hoàn toàn, sự lắng dịu bằng pháp đối trị trực tiếp.
Nirodho pahānamattaṃ.
Cessation is mere abandonment.
Nirodho chỉ là sự đoạn trừ.
Nānāvajjaneti yena āvajjanena appanāvīthi, tato bhinnāvajjane anekāvajjane vā.
In diverse advertising means by that advertising attention which leads to the absorption path, or in different advertising attention, or in multiple advertising attentions.
Nānāvajjaneti là trong sự hướng tâm khác với sự hướng tâm dẫn đến lộ trình an chỉ, hoặc trong nhiều sự hướng tâm.
Appanāvīthiyañhi upacāro ekāvajjano, itaro anekāvajjano anekakkhattuṃ pavattanato.
In the absorption path, access is one advertising attention, while the other is multiple advertising attentions, as it occurs many times.
Trong lộ trình an chỉ, cận định có một sự hướng tâm duy nhất, còn các lộ trình khác có nhiều sự hướng tâm vì chúng diễn ra nhiều lần.
Visamanisajjāya uppannakilamatho visamāsanupatāpo.
Weariness arisen from an uncomfortable posture is the suffering of uncomfortable sitting.
Sự mệt mỏi phát sinh do ngồi không đúng tư thế là visamāsanupatāpo.
Pītipharaṇenāti pītiyā pharaṇarasattā pītisamuṭṭhānānaṃ vā paṇītarūpānaṃ kāyassa byāpanato vuttaṃ.
By the suffusion of joy is said because of the nature of joy to pervade, or because of the pervading of the body by refined matter arisen from joy.
Pītipharaṇenāti được nói do hỷ có tính chất lan tỏa, hoặc do sự lan khắp thân của các sắc vi tế do hỷ sanh khởi.
Tenāha ‘‘sabbo kāyo sukhokkanto hotī’’ti.
Therefore, it says "the entire body is suffused with happiness."
Do đó, ngài nói ‘‘sabbo kāyo sukhokkanto hotī’’ti.
Paṇītarūpaphuṭṭhasarīrassa sukhokkantakāyattā kuto dukkhuppatti visamāsanupatāpādināti āha ‘‘paṭipakkhena avihatattā’’ti.
Since the body pervaded by refined matter is a body suffused with happiness, how can pain, uncomfortable sitting, and so forth arise? It says "because it is not harmed by its opponents."
Đối với người có thân thể được thấm nhuần bởi sắc vi tế, vì thân đã thấm nhuần lạc, làm sao khổ có thể phát sinh do ngồi không đúng tư thế, v.v.? Ngài nói ‘‘paṭipakkhena avihatattā’’ti (vì không bị pháp đối trị ngăn cản).
Vitakkavicārapaccayepīti pi-saddo aṭṭhānappayutto, so ‘‘pahīnassā’’ti ettha ānetvā sambandhitabbo.
Even with vitakka and vicāra as conditions: the word "pi" (even) is used out of place; it should be brought and connected with "of the abandoned" here.
Vitakkavicārapaccayepīti, từ pi ở đây được dùng không đúng chỗ, nên được mang đến và liên kết với từ ‘‘pahīnassā’’ti.
Pahīnassapi domanassindriyassāti idañca ‘‘siyā uppattī’’ti iminā sambandhitabbaṃ.
And the faculty of mental displeasure, even though abandoned—this should be connected with "there might be an arising."
Pahīnassapi domanassindriyassāti, câu này cần được liên kết với ‘‘siyā uppattī’’ti.
Etanti domanassindriyaṃ.
This refers to the faculty of mental displeasure.
Etanti là ưu quyền.
‘‘Uppajjatī’’ti iminā sambandho.
It is connected with "arises."
Cần liên kết với từ ‘‘uppajjatī’’ti.
‘‘Tassa mayhaṃ aticiraṃ vitakkayato vicārayato kāyopi kilami, cittampi ūhaññī’’ti vacanato kāyacittakhedānaṃ vitakkavicārapaccayatā veditabbā.
The weariness of body and mind as a condition for vitakka and vicāra should be understood from the saying: "As I pondered and investigated for a long time, my body became weary, and my mind became agitated."
Nên hiểu rằng sự mệt mỏi của thân và tâm có tầm và tứ làm duyên, dựa vào câu nói: “Đối với ta, người đã tầm và tứ quá lâu, thân cũng mệt mỏi, tâm cũng bị tổn hại”.
Vitakkavicārabhāveti ettha ‘‘uppajjati domanassindriya’’nti ānetvā sambandhitabbaṃ.
In vitakka and vicāra state, "the faculty of mental displeasure arises" should be brought and connected.
Vitakkavicārabhāveti, ở đây cần mang đến và liên kết với câu ‘‘uppajjati domanassindriya’’nti.
Tatthassa siyā uppattīti tattha dutiyajjhānūpacāre assa pahīnassapi domanassindriyassa uppatti bhaveyya.
There might be its arising there means that in the access concentration of the second jhāna, there might be an arising of the faculty of mental displeasure, even though it was abandoned.
Tatthassa siyā uppattīti là ở đó, trong cận định của thiền thứ hai, ưu quyền, dù đã được đoạn trừ, vẫn có thể khởi sinh.
Ettha ca yadeke vadanti ‘‘tatthassa siyā uppattīti vadantena jhānalābhīnampi domanassuppatti atthīti dassitaṃ hoti, tena ca anīvaraṇasabhāvo lobho viya dosopi atthīti dīpeti.
Here, some teachers say: "By stating 'there might be its arising there,' it is shown that even for those who have attained jhāna, mental displeasure can arise, and this indicates that aversion (dosa) exists, similar to greed (lobha), which is not a hindrance. Indeed, mental displeasure does not occur without aversion, and here there should be no thought of a contradiction with the Paṭṭhāna Pāḷi. This is because, in that Pāḷi, mental displeasure occurring with the abandoned jhāna as its object is shown; since mental displeasure cannot arise with unabandoned jhāna as its object, it cannot be said that mental displeasure never arises for those who have attained jhāna, because it has arisen even for those who have attained the eight attainments, and he was certainly not one whose jhāna had declined." This is not proper because there is no mental displeasure that is not a hindrance.
Ở đây, một số vị luận rằng: “Khi nói ‘tatthassa siyā uppattī’ti (ở đó, nó có thể khởi sinh), điều đó cho thấy rằng ngay cả những người đắc thiền cũng có thể khởi sinh ưu. Và điều này chỉ ra rằng, giống như tham có bản chất không phải là triền cái, sân cũng có thể có bản chất không phải là triền cái.
Na hi dosena vinā domanassaṃ pavattati, na cettha paṭṭhānapāḷiyā virodho cintetabbo.
If there were, it would arise even for beings in the rūpāvacara and arūpāvacara realms, but it does not.
Vì ưu không thể tồn tại nếu không có sân, và ở đây không nên nghĩ đến sự mâu thuẫn với Chánh tạng Paṭṭhāna.
Yasmā tattha parihīnajjhānaṃ ārammaṇaṃ katvā pavattamānaṃ domanassaṃ dassitaṃ, aparihīnajjhānaṃ ārammaṇaṃ katvā uppajjamānassa domanassassa asambhavato jhānalābhīnaṃ sabbaso domanassaṃ nuppajjatīti ca na sakkā vattuṃ aṭṭhasamāpattilābhino api tassa uppannattā, na heva kho so parihīnajjhāno ahosī’’ti, taṃ ayuttaṃ anīvaraṇasabhāvassa domanassassa abhāvato.
Thus, in the arūpa realm, the hindrances of sensual desire, sloth and torpor, restlessness and remorse, and ignorance are not lifted, but the state of non-hindrance here is not just a mere term, as even sensual desire and other non-hindrances are said to be hindrances in the sense of being similar to hindrances.
Bởi vì ở đó, ưu được trình bày là khởi sinh khi lấy thiền đã bị suy thoái làm đối tượng, do ưu không thể khởi sinh khi lấy thiền chưa bị suy thoái làm đối tượng, và cũng không thể nói rằng ưu hoàn toàn không khởi sinh đối với người đắc thiền, vì nó đã khởi sinh ngay cả với người đắc tám thiền chứng, nhưng vị ấy không phải là người đã bị suy thoái thiền.” – Lập luận đó là không hợp lý, vì không có ưu nào có bản chất không phải là triền cái.
Yadi siyā, rūpārūpāvacarasattānampi uppajjeyya, na ca uppajjati.
If it were, it would arise even for beings in the rūpāvacara and arūpāvacara realms, but it does not.
Nếu có, nó cũng sẽ khởi sinh cho các chúng sanh ở cõi Sắc và Vô Sắc, nhưng nó không khởi sinh.
Tathā hi āruppe kāmacchandanīvaraṇaṃ paṭicca thinamiddhanīvaraṇaṃ uddhaccanīvaraṇaṃ avijjānīvaraṇantiādīsu byāpādakukkuccanīvaraṇāni anuddhaṭāni, na cettha anīvaraṇatāpariyāyo kāmacchandādīnampi anīvaraṇānaṃyeva nīvaraṇasadisatāya nīvaraṇapariyāyassa vuttattā.
Thus, in the case of the formless attainments, references to the hindrances of sensual desire, sloth and torpor, restlessness, and ignorance are not omitted, but anger and remorse are not included. There is no implication of non-hindrance here, as even sensual desire, etc., though not hindrances themselves, are spoken of in terms of hindrances due to their similarity to hindrances.
Thật vậy, trong các cõi Vô Sắc, khi đề cập đến dục tham triền cái, hôn trầm thụy miên triền cái, trạo cử triền cái, vô minh triền cái, v.v., thì sân triền cái và hối quá triền cái không được nêu ra. Và ở đây không có trường hợp được gọi là không phải triền cái, vì ngay cả dục tham, v.v., vốn không phải là triền cái, cũng được gọi là triền cái theo nghĩa ẩn dụ do chúng tương tự như triền cái.
Yaṃ pana vuttaṃ ‘‘aṭṭhasamāpattilābhino api tassa uppannattā’’ti, tampi akāraṇaṃ uppajjamānena ca domanassena jhānato parihāyanato.
What was said, "because it arose even for those who attained the eight attainments," is also incorrect, because by the arising mental displeasure, one falls away from jhāna.
Còn điều đã nói: “vì nó đã khởi sinh ngay cả với người đắc tám thiền chứng”, điều đó cũng không phải là lý do, vì khi ưu khởi sinh thì thiền đã bị suy thoái.
Lahukena pana paccayena parihīnaṃ tādisā naṃ appakasireneva paṭipākatikaṃ karontīti daṭṭhabbaṃ.
However, it should be understood that those who have fallen away due to a slight condition easily restore it to its original state.
Tuy nhiên, cần hiểu rằng những vị như vậy có thể phục hồi thiền đã bị suy thoái do một duyên nhỏ một cách không khó khăn.
‘‘Tatthassa siyā uppattī’’ti idaṃ pana parikappanavacanaṃ upacārakkhaṇe domanassassa appahīnabhāvadassanatthaṃ.
But this statement, "there might be its arising there," is a speculative statement meant to show the unabandoned nature of mental displeasure in the access moment.
Còn câu ‘‘tatthassa siyā uppattī’’ti là một câu giả định, nhằm mục đích cho thấy rằng ưu chưa được đoạn trừ trong khoảnh khắc cận định.
Tathā hi vuttaṃ ‘‘na tveva antoappanāya’’nti.
Thus, it is said, "but not within absorption."
Thật vậy, đã được nói rằng ‘‘na tveva antoappanāya’’nti (nhưng không phải bên trong an chỉ).
Yadi pana tadā domanassaṃ uppajjeyya, paṭhamajjhānampissa parihīnamevāti daṭṭhabbaṃ.
If mental displeasure were to arise at that time, his first jhāna would certainly have declined, so it should be understood.
Tuy nhiên, nếu ưu khởi sinh vào lúc đó, cần hiểu rằng ngay cả thiền thứ nhất của vị ấy cũng đã bị suy thoái.
Pahīnampi somanassindriyaṃ pīti viya na dūreti katvā ‘‘āsannattā’’ti vuttaṃ.
Even the faculty of mental pleasure, though abandoned, does not remain far off like joy; thus, it is said "due to proximity."
Cho rằng hỷ quyền, dù đã được đoạn trừ, cũng không ở xa như hỷ, nên đã nói ‘‘āsannattā’’ti (vì gần).
Nānāvajjanūpacāre pahīnampi pahānaṅgaṃ paṭipakkhena avihatattā antarantarā uppajjeyya vāti imamatthaṃ dassento ‘‘appanāppattāyā’’tiādimāha.
While the factor of abandonment, even if eliminated in various approach-attentions, might arise intermittently because it is not suppressed by the opponent, he showed this meaning by stating “for attaining appanā” and so on.
Để chỉ rõ ý này, rằng dù chi phần đoạn trừ đã được đoạn trừ trong sự chú ý đa dạng, nó vẫn có thể phát sinh xen kẽ do đối thủ (trí tuệ) chưa hoàn toàn chế ngự, nên Ngài đã nói v.v… “đạt đến appanā”.
Tādisāya āsevanāya icchitabbattā yathā maggavīthito pubbe dve tayo javanavārā sadisānupassanāva pavattanti, evamidhāpi appanāvārato pubbe dve tayo javanavārā upekkhāsahagatāva pavattantīti vadanti.
Because it is desired through such cultivation, just as before the path-sequence, two or three javana moments occur as similar anupassanā, so too here, before the appanā moment, two or three javana moments occur accompanied by upekkhā, so they say.
Các vị thầy nói rằng, do mong muốn sự thực hành như vậy, giống như trước lộ trình đạo, hai hoặc ba sát-na tốc hành chỉ là sự quán chiếu tương tự, thì ở đây cũng vậy, trước sát-na appanā, hai hoặc ba sát-na tốc hành chỉ là sự tốc hành đồng sanh với xả.
Samāharīti samānesi, saṅgahetvā abhāsīti attho.
Samāharī means he gathered, he spoke having collected; that is the meaning.
Samāharī có nghĩa là đã gom lại, đã thu thập và thuyết giảng.
Sukhumāti sukhadukkhāni viya anoḷārikattā avibhūtatāya sukhumā, tato eva anuminitabbasabhāvattā dubbiññeyyā.
Sukhumā means subtle, due to not being coarse like pleasant and painful, and due to not being obvious; for that very reason, dubbiññeyyā (hard to discern) because it is of a nature that must be inferred.
Sukhumā (vi tế) là vi tế do không thô thiển như khổ và lạc, không hiển lộ. Chính vì vậy mà dubbiññeyyā (khó hiểu), do bản chất của nó chỉ có thể được suy ra.
Duṭṭhassāti duṭṭhapayogassa, duddamassāti attho.
Duṭṭhassā means of a bad practice, of one hard to tame; that is the meaning.
Duṭṭhassā (của kẻ xấu) có nghĩa là của kẻ có sự nỗ lực tồi tệ, của kẻ khó điều phục.
Sakkā hoti esā gāhayitunti aññāpohananayena sakkā gāhayitunti adhippāyo.
Sakkā hoti esā gāhayituṃ means it is possible to be grasped by means of taming, like catching a wild ox with a tame one; that is the intention.
Sakkā hoti esā gāhayituṃ: Ý muốn nói rằng có thể nắm bắt được nó bằng cách loại trừ những cái khác.
Adukkhamasukhāya cetovimuttiyāti idameva catutthaṃ jhānaṃ daṭṭhabbaṃ.
Adukkhamasukhāya cetovimuttiyā—this very refers to the fourth jhāna.
Adukkhamasukhāya cetovimuttiyā (với sự giải thoát tâm không khổ không lạc) đây chính là thiền thứ tư.
Paccayadassanatthanti adhigamassa upāyabhūtapaccayadassanatthaṃ.
Paccayadassanatthaṃ means for showing the condition that is the means to attainment.
Paccayadassanatthaṃ (để chỉ ra các duyên) là để chỉ ra các duyên là phương tiện để đạt được.
Tenāha ‘‘dukkhappahānādayo hi tassā paccayā’’ti.
Therefore he said, “for indeed, the abandonment of suffering and so on are its conditions.”
Vì vậy, Ngài nói: “Sự đoạn trừ khổ v.v… là duyên của nó”.
Dukkhappahānādayoti ca sopacārā paṭhamajjhānādayovettha adhippetā.
And by “abandonment of suffering and so on,” the first jhāna and so on, with metaphorical meaning, are intended here.
Và dukkhappahānādayo (sự đoạn trừ khổ v.v…) ở đây có nghĩa là sơ thiền v.v… có ẩn dụ.
Pahīnāti vuttāti ‘‘pañcannaṃ orambhāgiyānaṃ saṃyojanānaṃ parikkhayā’’ti (ma. ni. 3.147; saṃ. ni. 5.1021) vuttattā.
Pahīnāti vuttā means “it is said to be abandoned” because it is stated, “due to the complete eradication of the five lower fetters.”
Pahīnāti vuttā (được nói là đã đoạn trừ) là do được nói rằng “do sự đoạn trừ năm hạ phần kiết sử”.
Etāti sukhādayo vedanā.
Etā means feelings such as pleasure.
Etā (những điều này) là các thọ như lạc v.v…
Sukhaṃ somanassassa paccayoti vasanagandhālepanapupphābharaṇasamālepanādinibbattaṃ kāyikasukhaṃ somanassassa paccayo.
Sukhaṃ somanassassa paccayo means bodily pleasure arising from dwelling, perfumes, ointments, flowers, adornments, and equal application is a condition for mental pleasure.
Sukhaṃ somanassassa paccayo (lạc là duyên của hỷ) là lạc thân do y phục, hương, phấn, hoa, trang sức, xoa bóp v.v… sinh ra là duyên của hỷ.
‘‘Sukhāya kho, āvuso visākha vedanāya, rāgānusayo anusetī’’ti (ma. ni. 1.465) vacanato āha ‘‘somanassaṃ rāgassa paccayo’’ti.
Based on the saying, “Friend Visākha, the latent tendency of lust lies dormant in pleasant feeling,” he said, “mental pleasure is a condition for lust.”
Do lời dạy “Này hiền giả Visākha, tùy miên tham ái tùy miên trên thọ lạc”, nên Ngài nói “hỷ là duyên của tham”.
‘‘Dukkhāya kho, āvuso visākha, vedanāya paṭighānusayo anusetī’’ti vacanato vuttaṃ ‘‘domanassaṃ dosassa paccayo’’ti.
Based on the saying, “Friend Visākha, the latent tendency of aversion lies dormant in painful feeling,” he said, “displeasure is a condition for hatred.”
Do lời dạy “Này hiền giả Visākha, tùy miên sân hận tùy miên trên thọ khổ”, nên đã nói “ưu là duyên của sân”.
Sukhādighātenāti sukhādīnaṃ pahānena.
Sukhādighātenā means by the removal of pleasure and so on.
Sukhādighātenā (do sự đoạn trừ lạc v.v…) là do sự đoạn trừ lạc v.v…
Adukkhamasukhanti ettha na dukkhanti adukkhaṃ, dukkhavidūraṃ.
In adukkhamasukhaṃ (neither painful nor pleasant), adukkhaṃ means not painful, far from pain.
Trong từ adukkhamasukhaṃ (không khổ không lạc), adukkhaṃ (không khổ) là không khổ, xa lìa khổ.
Yasmā tattha dukkhaṃ natthi, tasmā vuttaṃ ‘‘dukkhābhāvenā’’ti.
Since there is no pain there, it is said “due to the absence of pain.”
Vì không có khổ ở đó, nên đã nói “do không có khổ”.
Asukhanti etthāpi eseva nayo.
The same reasoning applies to asukhaṃ (not pleasant).
Trong từ asukhaṃ (không lạc) cũng theo cách tương tự.
Etenāti dukkhasukhapaṭikkhepavacanena.
Etenā means by this statement of rejecting pain and pleasure.
Etenā (bằng điều này) là bằng lời phủ nhận khổ lạc.
Paṭipakkhabhūtanti idaṃ idha tatiyavedanāya dukkhādīnaṃ samatikkamavasena pattabbattā vuttaṃ, na kusalākusalānaṃ viya ujuvipaccanīkatāya.
Paṭipakkhabhūtaṃ is stated here because it is to be attained by transcending pain and so on by means of the third feeling, not by direct opposition as in the case of wholesome and unwholesome actions.
Paṭipakkhabhūtaṃ (đối nghịch) ở đây được nói là do sự đạt được bằng cách vượt qua khổ v.v… đối với thọ thứ ba, chứ không phải do sự đối nghịch trực tiếp như thiện và bất thiện.
Iṭṭhāniṭṭhaviparītānubhavanalakkhaṇāti iṭṭhāniṭṭhaviparītassa majjhattārammaṇassa, iṭṭhāniṭṭhaviparītaṃ vā majjhattākārena anubhavanalakkhaṇā.
Iṭṭhāniṭṭhaviparītānubhavanalakkhaṇā means characterized by experiencing the opposite of desirable and undesirable, i.e., an indifferent object, or by experiencing the opposite of desirable and undesirable in an indifferent manner.
Iṭṭhāniṭṭhaviparītānubhavanalakkhaṇā (có đặc tính kinh nghiệm đối lập với điều đáng thích và không đáng thích) có nghĩa là có đặc tính kinh nghiệm đối tượng trung tính đối lập với điều đáng thích và không đáng thích, hoặc kinh nghiệm đối lập với điều đáng thích và không đáng thích dưới dạng trung tính.
Tato eva majjhattarasā.
Therefore, it is majjhattarasā (of indifferent taste).
Chính vì vậy mà majjhattarasā (có vị trung tính).
Avibhūtapaccupaṭṭhānāti sukhadukkhāni viya na vibhūtākārā piṭṭhipāsāṇe migagatamaggo viya tehi anumātabbāvibhūtākāropaṭṭhānā.
Avibhūtapaccupaṭṭhānā means its manifestation is not obvious like pleasure and pain, but subtle, to be inferred like the path of a deer on a rock surface.
Avibhūtapaccupaṭṭhānā (sự hiện hữu không hiển lộ) có nghĩa là sự hiện hữu không hiển lộ cần được suy ra từ chúng, giống như dấu chân hươu trên tảng đá phẳng, không hiển lộ như khổ và lạc.
Sukhanirodho nāma idha catutthajjhānūpacāro, so padaṭṭhānaṃ etissāti sukhanirodhapadaṭṭhānā.
The cessation of pleasure here is the approach-concentration of the fourth jhāna, and since that is its proximate cause, it is sukhanirodhapadaṭṭhānā.
Sự diệt lạc ở đây là cận định của thiền thứ tư, và đó là cận duyên của nó, nên gọi là sukhanirodhapadaṭṭhānā (có sự diệt lạc làm cận duyên).
Upekkhāsatipārisuddhi nti purimapade uttarapadalopenetaṃ samāsapadanti āha ‘‘upekkhāya janitasatipārisuddhi’’nti.
Upekkhāsatipārisuddhiṃ is a compound word with the elision of the latter part in the former word, so he says, “the purity of mindfulness generated by upekkhā.”
Upekkhāsatipārisuddhiṃ (sự thanh tịnh của niệm xả) đây là một từ ghép do sự lược bỏ hậu tố trong từ trước, nên Ngài nói “sự thanh tịnh của niệm do xả sinh ra”.
Sabbapaccanīkadhammaparisuddhāya paccanīkasamanepi abyāvaṭāya pārisuddhupekkhāya vattamānāya catutthajjhāne sati sampahaṃsanapaññā viya suparisuddhā suvisadā ca hotīti āha ‘‘satiyā pārisuddhi, sā upekkhāya katā na aññenā’’ti.
He said, “the purity is of mindfulness, it is made by upekkhā, not by anything else,” meaning that when mindfulness in the fourth jhāna is present, purified by all opposing qualities and undisturbed even by the appeasement of opposing qualities, it becomes supremely pure and clear, like perfectly cheerful wisdom.
Ngài nói: “Sự thanh tịnh của niệm, do xả tạo ra chứ không phải do cái khác”, bởi vì khi niệm hiện hữu trong thiền thứ tư, với sự xả thanh tịnh, không bị xáo trộn ngay cả khi có kẻ thù, thanh tịnh khỏi tất cả các pháp đối nghịch, thì niệm trở nên rất thanh tịnh và rất rõ ràng, giống như tuệ hoan hỷ.
Yadi tatramajjhattatā idha ‘‘upekkhā’’ti adhippetā, kathaṃ satiyeva pārisuddhāti vuttāti āha ‘‘na kevala’’ntiādi.
If Tatramajjhattatā (equanimity) is intended here as "upekkhā," then how is it said that only mindfulness is pure? To this, he said, “not only,” and so on.
Nếu tatramajjhattatā (sự trung tính ở đó) được hiểu là “upekkhā” (xả) ở đây, thì tại sao chỉ có niệm được nói là thanh tịnh? Ngài nói “na kevalaṃ” (không chỉ) v.v…
Satisīsenāti satiṃ uttamaṅgaṃ katvā, padhānaṃ katvāti vuttaṃ hoti.
Satisīsenā means by making mindfulness the highest limb, that is, making it paramount.
Satisīsenā (do niệm là chính) có nghĩa là lấy niệm làm phần chính, làm điều chủ yếu.
Evamapi kasmā idheva sati ‘‘upekkhāsatipārisuddhī’’ti vuttāti anuyogaṃ sandhāya ‘‘tattha kiñcāpī’’tiādi vuttaṃ.
Even so, why is mindfulness here alone called “purity of mindfulness due to upekkhā”? In response to this question, it is said, “tattha kiñcāpī” and so on.
Tuy nhiên, tại sao chỉ ở đây niệm mới được gọi là “upekkhāsatipārisuddhi” (sự thanh tịnh của niệm xả)? Để trả lời câu hỏi này, Ngài đã nói “tattha kiñcāpī” (mặc dù ở đó) v.v…
Tattha heṭṭhā tīsu jhānesu vijjamānāyapi tatramajjhattatāya paccanīkābhibhavanato sahāyapaccayavekallato ca apārisuddhi, tathā taṃsampayuttānaṃ tadabhāvato idha pārisuddhīti imamatthaṃ upamāvasena dassetuṃ ‘‘yathā panā’’tiādi vuttaṃ.
In that statement, although tatramajjhattatā is present in the three lower jhānas, there is impurity due to the overwhelming presence of opposing factors and the lack of supportive conditions. Similarly, because those qualities are absent in the associated phenomena, purity is present here. To illustrate this meaning by way of an analogy, “yathā panā” and so on is stated.
Ở đó, trong ba thiền thấp hơn, mặc dù có tatramajjhattatā (sự trung tính ở đó), nhưng nó không thanh tịnh do bị các pháp đối nghịch lấn át và thiếu các duyên hỗ trợ. Tương tự, do sự vắng mặt của chúng trong các pháp đồng sanh với nó, nên ở đây có sự thanh tịnh của niệm. Để chỉ rõ ý này bằng cách ví dụ, Ngài đã nói “yathā panā” (như là) v.v…
Sūriyappabhābhibhavāti sūriyappabhāya abhibhuyyamānattā.
Sūriyappabhābhibhavā means being overpowered by the sun's radiance.
Sūriyappabhābhibhavā (do bị ánh sáng mặt trời lấn át) là do bị ánh sáng mặt trời lấn át.
Atikkhatāya candalekhā viya rattipi sommasabhāvā sabhāgāya rattiyameva ca candalekhā samujjalatīti sā tassā saṅgayhatīti dassento ‘‘sommabhāvena ca attano upakārakattena vā sabhāgāya rattiyā’’ti āha.
He said, “due to its tranquil nature, or due to its helpfulness to the kindred night,” indicating that just as the moonlight, due to its coolness, is tranquil like the night and shines brightest only during the kindred night, so it is encompassed by it.
Để chỉ ra rằng đêm cũng có bản chất dịu mát như ánh trăng không quá chói chang, và ánh trăng chỉ chiếu sáng rực rỡ trong đêm có cùng bản chất, nên ánh trăng được bao gồm trong đêm, Ngài nói “do bản chất dịu mát hoặc do có lợi cho chính nó, trong đêm có cùng bản chất”.
Sesamettha uttānatthameva.
The rest of this is clear in meaning.
Phần còn lại ở đây chỉ là ý nghĩa rõ ràng.
12. Rūpavirāgabhāvanāvasena pavattaṃ catubbidhampi arūpajjhānaṃ catutthajjhānasaṅgahamevāti āha ‘‘cattāri jhānānī’’ti.
He said, “the four jhānas,” because all four types of immaterial jhānas, which arise through the development of dispassion towards form, are included in the fourth jhāna.
12. Bốn thiền vô sắc, phát sinh do sự tu tập ly tham sắc, cũng được bao gồm trong thiền thứ tư, nên Ngài nói “bốn thiền”.
Yuttaṃ tāva cittekaggatā bhavokkamanatthatā viya vipassanāpādakatāpi catunnaṃ jhānānaṃ sādhāraṇāti tesaṃ vasena ‘‘cattāri jhānānī’’ti vacanaṃ, abhiññāpādakatā pana nirodhapādakatā ca catutthasseva jhānassa āveṇikā, sā kathaṃ catunnaṃ jhānānaṃ sādhāraṇā vuttāti?
It is indeed appropriate to speak of "the four jhānas" when citta-ekaggatā (one-pointedness of mind) and vipassanā-pādakatā (the basis for insight) are common to all four jhānas, just as bhavokkamanatthatā (entry into existence) is. But abhiññā-pādakatā (the basis for supernormal powers) and nirodha-pādakatā (the basis for cessation) are unique to the fourth jhāna. How then are they said to be common to all four jhānas?
Sự tập trung tâm (cittekaggatā) là lợi ích của sự nhập các cõi và cũng là nền tảng của tuệ quán (vipassanā), điều này là chung cho bốn thiền, nên việc nói “bốn thiền” là phù hợp. Nhưng khả năng tạo ra thần thông (abhiññā) và khả năng tạo ra diệt thọ tưởng định (nirodhasamāpatti) là đặc thù của thiền thứ tư, vậy làm sao nó có thể là chung cho bốn thiền?
Paramparādhiṭṭhānabhāvato.
Because of their successive conditionality.
Do là điều kiện hỗ trợ liên tục.
Padaṭṭhānapadaṭṭhānampi hi padaṭṭhānantveva vuccati, kāraṇakāraṇampi kāraṇanti yathā ‘‘tiṇehi bhattaṃ siddha’’nti.
For even a proximate cause of a proximate cause is called a proximate cause, and a cause of a cause is called a cause, just as it is said, "rice is cooked with grass."
Ngay cả một cận duyên của cận duyên cũng được gọi là cận duyên, và một nguyên nhân của nguyên nhân cũng được gọi là nguyên nhân, ví dụ như “cơm được nấu bằng cỏ” (tiṇehi bhattaṃ siddhaṃ).
Evañca katvā payojananiddese aṭṭhasamāpattiggahaṇaṃ samatthitaṃ hoti.
And having done so, the inclusion of the eight attainments in the statement of purpose becomes substantiated.
Và khi làm như vậy, sự bao gồm tám định trong phần chỉ rõ mục đích được chứng minh là hợp lý.
Cittekaggatatthānīti ittasamādhatthāni, diṭṭhadhammasukhavihāratthānīti attho.
Cittekaggatatthānī means having the benefit of mental one-pointedness, or having the benefit of a pleasant dwelling in this very life; that is the meaning.
Cittekaggatatthānī (có mục đích là sự tập trung tâm) có nghĩa là có mục đích là sự định tâm, có mục đích là sự an trú lạc ngay trong hiện tại.
Cittekaggatāsīsena hi diṭṭhadhammasukhavihāro vutto, sukkhavipassakakhīṇāsavavasena cetaṃ vuttaṃ.
For a pleasant dwelling in this very life is spoken of primarily in terms of one-pointedness of mind, and this is said in reference to dry-insight Arahants.
Sự an trú lạc ngay trong hiện tại được nói đến với sự tập trung tâm là chính, và điều này được nói đến theo cách của vị A-la-hán tuệ quán khô khan.
Tenāha ‘‘ekaggacittā sukhaṃ divasaṃ viharissāmā’’ti.
Therefore he said, “With one-pointed mind, we will dwell pleasantly throughout the day.”
Vì vậy, Ngài nói: “Chúng ta sẽ an trú lạc suốt ngày với tâm nhất điểm”.
Bhavokkamanatthānīti bhavesu nibbattiatthāni.
Bhavokkamanatthānī means having the benefit of arising in existences.
Bhavokkamanatthānī (có mục đích là sự nhập các cõi) có nghĩa là có mục đích là sự tái sinh vào các cõi.
Sattāhaṃ nirodhasamāpattiyā samāpajjanato āha ‘‘sattāhaṃ acittakā hutvā’’ti.
Since one enters into the attainment of cessation for seven days, he said, “having been without consciousness for seven days.”
Do nhập diệt thọ tưởng định trong bảy ngày, Ngài nói “trở thành vô tâm trong bảy ngày”.
Kasmā pana sattāhameva nirodhaṃ samāpajjantīti?
But why do they enter into cessation for only seven days?
Tại sao lại nhập diệt thọ tưởng định chỉ trong bảy ngày?
Tathākālaparicchedakaraṇato, tañca yebhuyyena āhārūpajīvīnaṃ sattānaṃ upādinnakappavattassa ekadivasaṃ bhuttāhārassa sattāhameva yāpanato.
Because a time limit is set in that way, and that is mostly because for beings who subsist on food, the food consumed in one day sustains them for seven days.
Do sự quy định thời gian như vậy, và điều đó chủ yếu là do thức ăn đã ăn trong một ngày của chúng sinh sống bằng thức ăn, được duy trì trong bảy ngày.
Kā (visuddhi. 2.867-868) panāyaṃ nirodhasamāpatti nāma, ke taṃ samāpajjanti, ke na samāpajjanti, kattha samāpajjanti, kasmā samāpajjanti, kathañcassā samāpajjanaṃ hotīti?
What is this attainment of cessation, who attains it, who does not attain it, where do they attain it, why do they attain it, and how is it attained? I will explain. In answer to “what is this attainment of cessation?” it is the non-occurrence of mental and psychological phenomena by way of gradual cessation.
Vậy diệt thọ tưởng định là gì? Ai nhập nó? Ai không nhập nó? Nhập ở đâu? Tại sao nhập? Và sự nhập của nó diễn ra như thế nào?
Vuccate – tattha kā panāyaṃ nirodhasamāpatti nāmāti yā anupubbanirodhavasena cittacetasikānaṃ dhammānaṃ appavatti.
It is stated thus: in this regard, what is this attainment of cessation? It is the non-occurrence of citta and cetasikas by way of gradual cessation.
Được trả lời – Ở đó, “diệt thọ tưởng định là gì?” là sự không phát sinh của các pháp tâm và tâm sở theo thứ tự diệt.
Ke taṃ samāpajjanti, ke na samāpajjantīti sabbepi puthujjanasotāpannasakadāgāmino sukkhavipassakā ca anāgāmiarahanto na samāpajjanti, aṭṭhasamāpattilābhino pana anāgāmino khīṇāsavā ca samāpajjanti.
Who attain it? Who do not attain it? All ordinary persons, Stream-winners, and Once-returners, as well as dry-insight non-returners and Arahants, do not attain it. But non-returners and Arahants who have attained the eight attainments do attain it.
Ai nhập định ấy, ai không nhập định ấy? Tất cả phàm phu, Tu-đà-hoàn, Tư-đà-hàm, và các bậc Bất-lai, A-la-hán thuộc hạng thuần quán (sukkhavipassakā) thì không nhập định ấy; còn các bậc Bất-lai và lậu tận A-la-hán đã chứng đắc tám thiền chứng (aṭṭhasamāpatti) thì nhập định ấy.
Kattha samāpajjantīti pañcavokārabhave.
Where do they attain it? In the five-constituent existence.
Nhập định ở đâu? Ở cõi năm uẩn (pañcavokārabhava).
Anupubbasamāpattisabbhāvato.
Because of the existence of the sequential attainments.
Vì có sự tồn tại của các thiền chứng tuần tự.
Catuvokārabhave pana paṭhamajjhānādīnaṃ uppattiyeva natthi, tasmā na sakkā tattha samāpajjituṃ.
But in the four-constituent existence, there is no arising of the first jhāna and so forth. Therefore, it is not possible to attain it there.
Còn ở cõi bốn uẩn (catuvokārabhava), sự sanh khởi của sơ thiền v.v... vốn không có, do đó không thể nhập định ở đó.
Kasmā samāpajjantīti saṅkhārānaṃ pavattibhede ukkaṇṭhitvā ‘‘diṭṭhadhamme acittakā hutvā nirodhaṃ nibbānaṃ patvā sukhaṃ viharissāmā’’ti.
Why do they attain it? Becoming wearied of the various processes of saṅkhāras, thinking: “Having become non-mental in this very life, attaining Nirodha (cessation), Nibbāna, we will dwell in happiness.”
Vì sao nhập định? Vì nhàm chán sự sai khác trong diễn biến của các pháp hữu vi, (vị ấy nghĩ rằng) “trong hiện tại, chúng ta sẽ trở thành người không có tâm, đạt đến diệt tận là Niết-bàn, và an trú trong an lạc”.
Kathañcassā samāpajjanaṃ hotīti samathavipassanāvasena ussakkitvā katapubbakiccassa nevasaññānāsaññāyatanaṃ nirodhayato evamassā samāpajjanaṃ hoti.
How does their attainment occur? After striving with samatha and vipassanā, and having performed the preliminary duties, when one ceases the sphere of neither-perception-nor-non-perception, their attainment occurs in this way.
Sự nhập định ấy diễn ra như thế nào? Đối với vị đã làm xong các tiền sự, sau khi nỗ lực đi lên bằng con đường chỉ và quán, khi diệt trừ phi tưởng phi phi tưởng xứ, sự nhập định ấy diễn ra như vậy.
Yo hi samathavaseneva ussakkati, so nevasaññānāsaññāyatanasamāpattiṃ patvā tiṭṭhati.
For indeed, one who strives solely through samatha attains and dwells in the attainment of the sphere of neither-perception-nor-non-perception.
Vị nào nỗ lực đi lên chỉ bằng con đường chỉ (samatha), vị ấy đạt đến phi tưởng phi phi tưởng xứ định rồi dừng lại ở đó.
Yopi vipassanāvaseneva ussakkati, so phalasamāpattiṃ patvā tiṭṭhati.
And one who strives solely through vipassanā attains and dwells in the attainment of Fruition.
Vị nào nỗ lực đi lên chỉ bằng con đường quán (vipassanā), vị ấy đạt đến quả định (phalasamāpatti) rồi dừng lại ở đó.
Yo pana ubhayavaseneva ussakkitvā nevasaññānāsaññāyatanaṃ nirodheti, so taṃ samāpajjatīti ayamettha saṅkhepo.
But one who strives by means of both and ceases the sphere of neither-perception-nor-non-perception, that one attains it—this is the summary here.
Còn vị nào sau khi nỗ lực đi lên bằng cả hai con đường, diệt trừ phi tưởng phi phi tưởng xứ, vị ấy nhập vào định ấy. Đây là phần tóm tắt ở đây.
Ayaṃ pana vitthāro – idha bhikkhu nirodhaṃ samāpajjitukāmo paṭhamajjhānaṃ samāpajjitvā vuṭṭhāya tattha saṅkhāre aniccato dukkhato anattato vipassati.
This, however, is the detailed explanation: Here, a monk who wishes to attain Nirodhasamāpatti attains the first jhāna, emerges from it, and then discerns the saṅkhāras therein as impermanent, suffering, and non-self.
Còn đây là phần chi tiết – Ở đây, vị tỳ khưu muốn nhập diệt định, sau khi nhập sơ thiền, xuất thiền, vị ấy quán các pháp hành trong đó là vô thường, khổ, vô ngã.
Vipassanā ca panesā tividhā saṅkhārapariggaṇhanakavipassanā phalasamāpattivipassanā nirodhasamāpattivipassanāti.
This vipassanā is threefold: saṅkhārapariggaṇhanakavipassanā (discerning saṅkhāras), phalasamāpattivipassanā (fruition-attainment vipassanā), and nirodhasamāpattivipassanā (cessation-attainment vipassanā).
Và pháp quán này có ba loại: quán để nắm bắt các pháp hành (saṅkhārapariggaṇhanakavipassanā), quán để nhập quả định (phalasamāpattivipassanā), và quán để nhập diệt định (nirodhasamāpattivipassanā).
Tattha saṅkhārapariggaṇhanakavipassanā mandā vā tikkhā vā maggassa padaṭṭhānaṃ hotiyeva.
Among these, saṅkhārapariggaṇhanakavipassanā, whether dull or sharp, is certainly the proximate cause for the path.
Trong đó, quán để nắm bắt các pháp hành dù chậm hay nhanh, đều là nền tảng của đạo.
Phalasamāpattivipassanā tikkhāva vaṭṭati maggabhāvanāsadisā.
Phalasamāpattivipassanā must be sharp, being similar to the development of the path.
Quán để nhập quả định phải thật nhanh, tương tự như việc tu tập đạo.
Nirodhasamāpattivipassanā pana nātimandanātitikkhā vaṭṭati, tasmā esa nātimandāya nātitikkhāya vipassanāya te saṅkhāre vipassati.
But nirodhasamāpattivipassanā should be neither too dull nor too sharp. Therefore, with vipassanā that is neither too dull nor too sharp, one discerns those saṅkhāras.
Còn quán để nhập diệt định thì phải không quá chậm, không quá nhanh. Do đó, vị ấy quán các pháp hành ấy bằng pháp quán không quá chậm, không quá nhanh.
Tato dutiyajjhānaṃ…pe… tato viññāṇañcāyatanaṃ samāpajjitvā vuṭṭhāya tattha saṅkhāre tatheva vipassati.
Then the second jhāna... (and so on) ... then, having attained the sphere of infinite consciousness and emerged from it, one discerns the saṅkhāras there in the same way.
Từ đó, sau khi nhập nhị thiền... cho đến... từ đó, sau khi nhập thức vô biên xứ, xuất thiền, vị ấy quán các pháp hành trong đó cũng như vậy.
Atha ākiñcaññāyatanaṃ samāpajjitvā vuṭṭhāya catubbidhaṃ pubbakiccaṃ karoti nānābaddhaavikopanaṃ saṅghapatimānanaṃ satthupakkosanaṃ addhānaparicchedanti.
Then, having attained the sphere of nothingness and emerged from it, one performs the four preliminary duties: non-disturbance of unrelated possessions, paying respect to the Saṅgha, calling upon the Teacher, and determining the lifespan.
Sau đó, sau khi nhập vô sở hữu xứ, xuất thiền, vị ấy làm bốn loại tiền sự: sự không hư hoại của các vật dụng không gắn liền, sự chờ đợi của Tăng chúng, sự triệu tập của Bậc Đạo Sư, và sự xác định thời hạn.
Tattha nānābaddhaavikopananti yaṃ iminā bhikkhunā saddhiṃ ekābaddhaṃ na hoti, nānābaddhaṃ hutvā ṭhitaṃ pattacīvaraṃ vā mañcapīṭhaṃ vā nivāsagehaṃ vā aññaṃ vā pana yaṃ kiñci parikkhārajātaṃ, taṃ yathā na vikuppati, aggiudakavātacoraundūrādīnaṃ vasena na vinassati, evaṃ adhiṭṭhātabbaṃ.
Among these, non-disturbance of unrelated possessions means that any bowl, robe, dwelling, or any other requisites that are not attached to this monk, that stand as separate possessions, should be determined so that they are not disturbed—that they are not destroyed by fire, water, wind, thieves, mice, or other such things.
Trong đó, sự không hư hoại của các vật dụng không gắn liền là y bát, giường ghế, nhà ở, hay bất kỳ vật dụng nào khác không gắn liền với vị tỳ khưu này mà ở riêng rẽ, phải được chú nguyện sao cho chúng không bị hư hoại, không bị hủy hoại bởi lửa, nước, gió, trộm cắp, chuột bọ v.v...
Tatridaṃ adhiṭṭhānavidhānaṃ ‘‘idañcidañca imasmiṃ sattāhabbhantare mā agginā jhāyatu, mā udakena vuyhatu, mā vātena viddhaṃsatu, mā corehi harīyatu, mā undūrādīhi khajjatū’’ti.
Here is the method of determination: "May this and that not be burned by fire, not be carried away by water, not be scattered by wind, not be stolen by thieves, not be gnawed by mice or other animals, within these seven days."
Đây là phương pháp chú nguyện: “Cầu mong vật này và vật này trong vòng bảy ngày không bị lửa thiêu, không bị nước cuốn, không bị gió thổi bay, không bị trộm lấy, không bị chuột bọ gặm nhấm”.
Evaṃ adhiṭṭhite taṃ sattāhaṃ tassa na koci parissayo hoti, anadhiṭṭhahato pana aggiādīhi nassati, idaṃ nānābaddhaavikopanaṃ nāma.
When thus determined, no danger whatsoever befalls them for seven days. But if not determined, they are destroyed by fire and so forth. This is called non-disturbance of unrelated possessions.
Khi đã chú nguyện như vậy, trong bảy ngày ấy không có hiểm nguy nào xảy đến với vật đó; còn nếu không chú nguyện, nó sẽ bị hủy hoại bởi lửa v.v... Đây gọi là sự không hư hoại của các vật dụng không gắn liền.
Yaṃ pana ekābaddhaṃ hoti nivāsanapārupanaṃ vā nisinnāsanaṃ vā, tattha visuṃ adhiṭṭhānakiccaṃ natthi, samāpattiyeva naṃ rakkhati.
However, for things that are attached to one, such as the lower robe or upper robe, or the sitting mat, there is no need for a separate act of determination; the attainment itself protects them.
Còn đối với những gì gắn liền như y nội và y vai trái, hoặc chỗ ngồi, thì không cần phải chú nguyện riêng, chính thiền định sẽ bảo vệ chúng.
Saṅghapatimānananti bhikkhusaṅghassa patimānanaṃ udikkhanaṃ, yāva so bhikkhu āgacchati, tāva saṅghakammassa akaraṇanti attho.
Paying respect to the Saṅgha means to respect and wait upon the community of monks, that is, not to perform any Saṅgha-kamma until that monk arrives.
Sự chờ đợi của Tăng chúng là sự trông đợi, sự mong chờ của Tăng chúng. Nghĩa là, Tăng sự sẽ không được tiến hành cho đến khi vị tỳ khưu ấy trở về.
Ettha ca patimānanaṃ etassa na pubbakiccaṃ, patimānanāvajjanaṃ pana pubbakiccaṃ.
And here, paying respect itself is not his preliminary duty, but the mindfulness of the expectation of being respected is the preliminary duty.
Ở đây, sự chờ đợi không phải là tiền sự của vị ấy, mà việc quán niệm về sự chờ đợi mới là tiền sự.
Tasmā evaṃ āvajjitabbaṃ ‘‘sace mayi sattāhaṃ nirodhaṃ samāpajjitvā nisinne saṅgho apalokanakammādīsu kiñcideva kammaṃ kattukāmo hoti, yāva maṃ koci bhikkhu āgantvā na pakkosati, tāvadeva vuṭṭhahissāmī’’ti.
Therefore, one should reflect thus: "If, while I am seated in Nirodhasamāpatti for seven days, the Saṅgha wishes to perform any act, such as an apalokana-kamma (declaration), I will emerge only when some monk comes and calls me."
Do đó, cần phải quán niệm như sau: “Nếu trong khi tôi đang ngồi nhập diệt định trong bảy ngày, Tăng chúng có ý muốn thực hiện bất kỳ Tăng sự nào như yết ma biểu quyết v.v..., tôi sẽ xuất định ngay khi có một vị tỳ khưu nào đó đến gọi tôi”.
Evaṃ katvā samāpanno hi tasmiṃ samaye vuṭṭhahatiyeva.
One who attains samāpatti after reflecting thus will indeed emerge at that time.
Vị nhập định sau khi làm như vậy, chắc chắn sẽ xuất định vào thời điểm đó.
Yo pana evaṃ na karoti, saṅgho ce sannipatitvā taṃ apassanto ‘‘asuko bhikkhu kuhi’’nti pucchitvā ‘‘nirodhaṃ samāpanno’’ti vutte kañci bhikkhuṃ peseti ‘‘taṃ pakkosāhī’’ti, athassa tena bhikkhunā savanūpacāre ṭhatvā ‘‘saṅgho taṃ āvuso patimānetī’’ti vuttamatteyeva vuṭṭhānaṃ hoti.
But if one does not do so, and the Saṅgha convenes and, not seeing him, asks, "Where is so-and-so, the monk?" and when told, "He is in Nirodhasamāpatti," they send a monk saying, "Call him," then upon that monk standing within earshot and saying, "Venerable sir, the Saṅgha expects you," he will immediately emerge.
Còn vị nào không làm như vậy, nếu Tăng chúng tụ họp lại, không thấy vị ấy, hỏi: “Vị tỳ khưu kia ở đâu?”, và khi được trả lời: “Đang nhập diệt định”, Tăng chúng sai một vị tỳ khưu đi: “Hãy đi gọi vị ấy”. Khi đó, ngay khi vị tỳ khưu kia đứng trong tầm nghe và nói: “Thưa hiền giả, Tăng chúng đang chờ đợi ngài”, vị ấy liền xuất định.
Evaṃ garukā hi saṅghassa āṇā nāma, tasmā taṃ āvajjitvā yathā paṭhamameva vuṭṭhāti, evaṃ samāpajjitabbaṃ.
So weighty is the authority of the Saṅgha. Therefore, one should reflect upon this and attain samāpatti in such a way that one emerges immediately.
Mệnh lệnh của Tăng chúng thật trọng đại như vậy, do đó, cần phải quán niệm về điều đó và nhập định sao cho có thể xuất định ngay từ đầu.
Addhānaparicchedoti jīvitaddhānassa paricchedo.
Determining the lifespan means determining the duration of life.
Sự xác định thời hạn là sự xác định thời hạn của mạng sống.
Iminā bhikkhunā addhānaparicchedesu kusalena bhavitabbaṃ, ‘‘attano āyusaṅkhārā sattāhaṃ pavattissanti na pavattissantī’’ti āvajjitvāva samāpajjitabbaṃ.
This monk must be skilled in determining the lifespan; he should attain samāpatti only after reflecting, "Will my life-span continue for seven days or not?"
Vị tỳ khưu này phải thiện xảo trong việc xác định thời hạn, phải nhập định sau khi đã quán niệm: “Mạng hành của ta sẽ tồn tại trong bảy ngày hay không tồn tại?”.
Sace hi sattāhabbhantare nirujjhanake āyusaṅkhāre anāvajjitvāva samāpajjati, tassa nirodhasamāpatti maraṇaṃ paṭibāhituṃ na sakkoti, antonirodhe maraṇassa natthitāya antarāva samāpattito vuṭṭhāti, tasmā etaṃ āvajjitvāva samāpajjitabbaṃ.
For if he attains samāpatti without reflecting on a life-span that will cease within seven days, his Nirodhasamāpatti cannot prevent death, and because there is no death within Nirodhasamāpatti, he emerges from the attainment prematurely. Therefore, one must reflect on this before attaining samāpatti.
Bởi vì nếu vị ấy nhập định mà không quán niệm về mạng hành sẽ chấm dứt trong vòng bảy ngày, thì diệt định không thể ngăn cản cái chết. Do không có cái chết trong lúc nhập diệt định, vị ấy sẽ xuất định giữa chừng. Do đó, phải nhập định sau khi đã quán niệm điều này.
Avasesañhi anāvajjitumpi vaṭṭati, idaṃ pana āvajjitabbamevāti vuttaṃ.
It is permissible not to reflect on the other (preliminary duties), but this one must certainly be reflected upon, so it is said.
Các việc còn lại không quán niệm cũng được, nhưng điều này thì nhất định phải quán niệm, đã được nói như vậy.
So evaṃ ākiñcaññāyatanaṃ samāpajjitvā vuṭṭhāya idaṃ pubbakiccaṃ katvā nevasaññānāsaññāyatanaṃ samāpajjati, athekaṃ vā dve vā cittavāre atikkamitvā acittako hoti, nirodhaṃ phusati.
Having thus attained the sphere of nothingness and emerged, and having performed these preliminary duties, he attains the sphere of neither-perception-nor-non-perception; then, after passing one or two thought-moments, he becomes non-mental and contacts Nirodha.
Vị ấy sau khi nhập vô sở hữu xứ, xuất thiền, làm xong tiền sự này, rồi nhập phi tưởng phi phi tưởng xứ. Sau đó, trải qua một hoặc hai sát-na tâm, vị ấy trở thành vô tâm, chạm đến sự diệt tận.
Kasmā panassa dvinnaṃ cittānaṃ upari cittāni na pavattantīti?
Why do thoughts not continue beyond two thought-moments?
Nhưng tại sao các tâm không khởi lên sau hai tâm ấy?
Nirodhassa payogattā.
Because it is the effort for Nirodha.
Vì đó là sự nỗ lực của diệt định.
Idañhi imassa bhikkhuno dve samathavipassanādhamme yuganaddhe katvā aṭṭhasamāpattiārohanaṃ anupubbanirodhassa payogo, na nevasaññānāsaññāyatanasamāpattiyāti nirodhassa payogattā dvinnaṃ cittānaṃ upari cittāni na pavattantīti.
The simultaneous progression through the eight attainments by this monk, combining samatha and vipassanā, is the effort for anupubbanirodha (sequential cessation), not for the attainment of the sphere of neither-perception-nor-non-perception. Thus, because it is the effort for Nirodha, thoughts do not continue beyond two thought-moments.
Đối với vị tỳ khưu này, việc đi lên qua tám thiền chứng bằng cách kết hợp hai pháp chỉ và quán là sự nỗ lực cho sự diệt tận tuần tự, chứ không phải cho phi tưởng phi phi tưởng xứ định. Do đó, vì sự nỗ lực của diệt định, các tâm không khởi lên sau hai tâm ấy.
Yasmā bodhisattena bodhimaṇḍupasaṅkamanato pubbepi carimabhave catutthajjhānaṃ nibbattitapubbaṃ, tadā pana taṃ nibbattitamattameva ahosi, na vipassanādipādakaṃ.
Because the Bodhisatta, in his last existence, had developed the fourth jhāna even before approaching the Bodhi-maṇḍa, but at that time it was merely developed, not serving as a basis for vipassanā and so forth.
Bởi vì Bồ-tát, ngay cả trước khi đến cội Bồ-đề trong kiếp chót, cũng đã từng chứng đắc đệ tứ thiền. Nhưng lúc đó, thiền ấy chỉ đơn thuần là được chứng đắc, chứ không phải là nền tảng cho minh sát v.v...
Tasmā ‘‘bodhirukkhamūle nibbattita’’nti tato visesetvā vuttaṃ.
Therefore, it is said "developed at the root of the Bodhi-tree" to distinguish it from that.
Do đó, để nêu bật sự khác biệt, đã nói rằng "được chứng đắc dưới cội Bồ-đề".
Vipassanāpādakanti vipassanārambhe vipassanāya pādakaṃ.
Basis for insight means the basis for vipassanā at the commencement of vipassanā.
Nền tảng cho minh sát là nền tảng cho minh sát khi bắt đầu tu tập minh sát.
Abhiññāpādakanti etthāpi eseva nayo.
The same method applies to basis for supernormal powers.
Nền tảng cho thắng trí ở đây cũng theo cách tương tự.
Buddhānañhi paṭhamārambhe eva pādakajjhānena payojanaṃ ahosi, na tato paraṃ uparimaggādhigamaphalasamāpattiabhiññāvaḷañjanādiatthaṃ.
For the Buddhas, only the foundational jhāna was necessary at the very beginning; thereafter, it was not for the sake of higher path-attainment, fruition-attainment, or the practice of supernormal powers.
Đối với các vị Phật, thiền nền tảng chỉ cần thiết lúc bắt đầu tu tập, chứ không cần cho mục đích chứng đắc các đạo cao hơn, nhập quả định, và sử dụng các thắng trí sau đó.
Abhisambodhisamadhigamato paṭṭhāya hi sabbaṃ ñāṇasamādhikiccaṃ ākaṅkhāmattapaṭibaddhamevāti.
For from the attainment of full enlightenment, all tasks of knowledge and concentration are dependent solely on their mere wish.
Bởi vì kể từ khi chứng đắc Chánh Đẳng Giác, tất cả các công việc liên quan đến trí tuệ và thiền định đều chỉ phụ thuộc vào ý muốn của Ngài.
Sabbakiccasādhakanti anupubbavihārādisabbakiccasādhakaṃ.
Sabbakiccasādhaka means accomplishing all tasks such as dwelling in gradual stages.
Sabbakiccasādhaka (hoàn thành mọi việc) nghĩa là hoàn thành mọi việc như an trú tuần tự, v.v.
Sabbalokiyalokuttaraguṇadāyakanti ettha vipassanābhiññāpādakattā eva catutthassa jhānassa bhagavato sabbalokiyalokuttaraguṇadāyakatā veditabbā.
Here, concerning Sabbalokiyalokuttaraguṇadāyaka (the giver of all mundane and supramundane qualities), it should be understood that the fourth jhāna is the giver of all mundane and supramundane qualities for the Bhagavā solely because it is the basis for insight (vipassanā) and supernormal powers (abhiññā).
Ở đây, cụm từ sabbalokiyalokuttaraguṇadāyaka (ban cho tất cả các phẩm chất thế gian và siêu thế) có nghĩa là thiền thứ tư của Đức Thế Tôn được biết đến là ban cho tất cả các phẩm chất thế gian và siêu thế chỉ vì nó là nền tảng cho vipassanā và các thắng trí (abhiññā).
Sabbaññutaññāṇapadaṭṭhānañhi maggañāṇaṃ taṃpadaṭṭhānañca sabbaññutaññāṇaṃ abhisambodhi, tadadhigamasamakālameva ca bhagavato sabbe buddhaguṇā hatthagatā ahesuṃ, catutthajjhānasannissayo ca maggādhigamoti.
Indeed, the path-knowledge (maggañāṇa) has omniscience (sabbaññutaññāṇa) as its proximate cause, and omniscience, which has path-knowledge as its proximate cause, is perfect enlightenment (abhisambodhi). At the very moment of attaining it, all the Buddha's qualities became close at hand for the Bhagavā, and the attainment of the path has the fourth jhāna as its support.
Thật vậy, Tuệ Đạo (maggañāṇa) là nền tảng cho Tuệ Toàn Tri (sabbaññutañāṇa), và Tuệ Toàn Tri là nền tảng cho Tuệ Đạo, đó là sự giác ngộ viên mãn (abhisambodhi). Ngay khi đạt được điều đó, tất cả các phẩm chất của chư Phật đã nằm trong tay Đức Thế Tôn, và sự chứng đắc Tuệ Đạo nương tựa vào thiền thứ tư.
‘‘Catutthaṃ jhānaṃ upasampajja vihāsi’’nti vatvā ‘‘so’’ti vuttattā āha ‘‘so aha’’nti.
Having said, "he dwelt having entered the fourth jhāna," because "he" was stated, it says, "that 'I'."
Sau khi nói: “Ngài an trú, chứng đắc thiền thứ tư”, vì đã nói “so” (ngài), nên Ngài nói: “ so ahaṃ (ta)”.
Evaṃ samāhiteti ettha evaṃ-saddo heṭṭhā jhānattayādhigamapaṭipāṭisiddhassa catutthajjhānasamādhānassa nidassanatthoti āha ‘‘evanti catutthajjhānakkamanidassanameta’’nti.
Here, in evaṃ samāhite (thus composed), the word evaṃ (thus) signifies the attainment of the fourth jhāna, which was accomplished in the sequence of attaining the three previous jhānas. Hence it says, "this 'thus' is an indication of the sequence of the fourth jhāna."
Ở đây, từ evaṃ (như vậy) trong evaṃ samāhite (như vậy đã định tâm) là để chỉ ra sự định tâm trong thiền thứ tư, vốn được thành tựu theo trình tự chứng đắc ba thiền trước. Do đó, Ngài nói: “ evanti catutthajjhānakkamanidassanametaṃ (như vậy là sự chỉ dẫn về trình tự thiền thứ tư)”.
Catutthajjhānassa tassa ca adhigamamaggassa nidassanaṃ, yena samādhānānukkamena catutthajjhānasamādhi laddho, tadubhayanidassananti attho.
It is an indication of the fourth jhāna and the path to its attainment, by means of which sequence of concentration the samādhi of the fourth jhāna was attained; it is an indication of both of these, is the meaning.
Nghĩa là, đó là sự chỉ dẫn về thiền thứ tư và con đường chứng đắc thiền đó, tức là sự chỉ dẫn về cả hai điều đó, là trình tự định tâm mà nhờ đó sự định tâm trong thiền thứ tư đã được đạt đến.
Tenāha ‘‘iminā…pe… vuttaṃ hotī’’ti.
Therefore, it says, "by this… (pe)… it is said."
Do đó, Ngài nói: “ iminā…pe… vuttaṃ hotī (bằng cách này…v.v… đã được nói)”.
Tattha iminā kamenāti iminā paṭhamajjhānādhigamādinā kamena.
There, iminā kamenā (by this sequence) means by this sequence beginning with the attainment of the first jhāna.
Ở đó, iminā kamena (bằng trình tự này) nghĩa là bằng trình tự bắt đầu từ sự chứng đắc thiền thứ nhất.
Yadipi ‘‘eva’’nti idaṃ āgamanasamādhinā saddhiṃ catutthajjhānasamādhānaṃ dīpeti, satipārisuddhisamādhi eva pana iddhiyā adhiṭṭhānabhāvato padhānanti āha ‘‘catutthajjhānasamādhinā samāhite’’ti.
Although this word "evaṃ" (thus) indicates the concentration of the fourth jhāna together with the acquired concentration, the concentration of purity of mindfulness (satipārisuddhisamādhi) is primary due to its being the basis for supernormal power (iddhi). Hence it says, "composed with the concentration of the fourth jhāna."
Mặc dù từ “evaṃ” này chỉ ra sự định tâm trong thiền thứ tư cùng với sự định tâm đạt được, nhưng sự định tâm trong sự thanh tịnh của niệm (satipārisuddhisamādhi) là chính yếu vì nó là nền tảng cho thần thông (iddhi). Do đó, Ngài nói: “ catutthajjhānasamādhinā samāhite (đã định tâm bằng định thiền thứ tư)”.
Sabbapaccanīkadhammupakkilesaparisuddhāya paccanīkasamanepi abyāvaṭāya pārisuddhupekkhāya vattamānāya catutthajjhānaṃ taṃsampayuttā ca dhammā suparisuddhā suvisadā ca honti, satisīsena pana tattha desanā katāti āha ‘‘upekkhāsatipārisuddhibhāvena parisuddhe’’ti, upekkhāya janitasatipārisuddhisambhavenāti attho.
When the fourth jhāna and its associated phenomena are exceedingly purified and clear, it is due to equanimity purified from all opposing defilements and impurities, and which is not engaged even with the opposing elements. But the teaching there is given with mindfulness as the primary factor. Hence it says, "purified by the state of purity of equanimity and mindfulness," which means, born of the purity of mindfulness generated by equanimity.
Khi thiền thứ tư và các pháp tương ưng với nó được thanh tịnh tuyệt đối và trong sáng hoàn toàn, nhờ sự xả thanh tịnh (pārisuddhupekkhā) không bị xáo trộn bởi các cấu uế (upakkilesa) đối nghịch và các pháp đối nghịch khác, nhưng vì lời dạy ở đây được đặt trọng tâm vào niệm (sati), nên Ngài nói: “ upekkhāsatipārisuddhibhāvena parisuddhe (thanh tịnh nhờ trạng thái thanh tịnh của xả và niệm)”, nghĩa là nhờ sự phát sinh của niệm thanh tịnh được tạo ra bởi xả.
Parisuddhiyā eva paccayavisesena pavattiviseso pariyodātatā sudhantasuvaṇṇassa nighaṃsanena pabhassaratā viyāti āha ‘‘parisuddhattāyeva pariyodāte, pabhassareti vuttaṃ hotī’’ti.
The special nature of its occurrence, its extreme purity (pariyodātatā), is due to its purity itself, like the luminosity of well-refined gold by polishing. Hence it says, "due to its purity itself, it is extremely pure, it is said to be effulgent."
Chỉ vì sự thanh tịnh mà có một trạng thái đặc biệt của sự vận hành, đó là sự trong sáng (pariyodātatā), giống như sự sáng chói của vàng đã được tinh luyện khi được mài giũa. Do đó, Ngài nói: “ parisuddhattāyeva pariyodāte, pabhassareti vuttaṃ hotī (chỉ vì thanh tịnh mà trong sáng, nghĩa là chói sáng)”.
Sukhādīnaṃ paccayānaṃ ghātenāti sukhasomanassānaṃ dukkhadomanassānañca yathākkamaṃ rāgadosapaccayānaṃ vikkhambhanena.
By the destruction of factors such as sukha means by successively suppressing the factors of joy and happiness (sukha-somanassa), which are causes of greed (rāga), and suffering and displeasure (dukkha-domanassa), which are causes of aversion (dosa).
Sukhādīnaṃ paccayānaṃ ghātenā (do diệt trừ các duyên của lạc, v.v.) nghĩa là do trấn áp các duyên của tham và sân, tương ứng là lạc và hỷ, khổ và ưu.
‘‘Sukhaṃ somanassassa paccayo, somanassaṃ rāgassa, dukkhaṃ domanassassa paccayo, domanassaṃ dosassā’’ti vuttaṃ.
It is said: "Joy is a factor for happiness, happiness for greed; suffering is a factor for displeasure, displeasure for aversion."
Đã được nói rằng: “Lạc là duyên của hỷ, hỷ là duyên của tham; khổ là duyên của ưu, ưu là duyên của sân”.
Yathā rāgādayo cetaso malāsucibhāvena ‘‘aṅgaṇānī’’ti vuccanti, evaṃ upagantvā kilesanaṭṭhena upakkilesāti āha ‘‘anaṅgaṇattā eva ca vigatupakkilese’’ti.
Just as greed and the like are called "stains" (aṅgaṇāni) due to the mind's defiled and impure state, so too, they are called "defilements" (upakkilesā) because they approach and afflict. Hence it says, "and undefiled, truly free from defilements."
Cũng như tham, v.v., được gọi là “aṅgaṇa” (nhơ bẩn) vì trạng thái ô uế của tâm, thì cũng vậy, chúng được gọi là cấu uế (upakkilesa) vì chúng bám víu và làm ô nhiễm. Do đó, Ngài nói: “ anaṅgaṇattā eva ca vigatupakkilese (không nhơ bẩn và đã đoạn trừ các cấu uế)”.
Tenāha ‘‘aṅgaṇena hi cittaṃ upakkilissatī’’ti, vibādhīyati upatāpīyatīti attho.
Therefore, it says, "for the mind is defiled by stain." This means it is afflicted and tormented.
Do đó, Ngài nói: “ aṅgaṇena hi cittaṃ upakkilissatī (tâm bị ô nhiễm bởi sự nhơ bẩn)”, nghĩa là bị quấy nhiễu, bị phiền não.
Subhāvitattāti paguṇabhāvāpādanena suṭṭhu bhāvitattā.
Subhāvitattā means thoroughly cultivated by bringing it to a state of proficiency.
Subhāvitattā (được tu tập tốt) nghĩa là được tu tập tốt đẹp bằng cách đạt đến trạng thái thuần thục.
Tenāha ‘‘vasībhāvappatte’’ti, āvajjanādinā pañcadhā cuddasavidhena vā paridamanena vasaṃ vattituṃ upagateti attho.
Therefore, it says, "attained to mastery." This means it has come to be subservient through the fivefold or fourteenfold training, beginning with adverting (āvajjanā), is the meaning.
Do đó, Ngài nói: “ vasībhāvappatte (đã đạt đến sự thuần thục)”, nghĩa là đã đạt đến trạng thái có thể điều khiển được bằng cách rèn luyện theo năm cách hoặc mười bốn cách, bắt đầu từ sự chú ý (āvajjanā).
Vase vattamānañhi cittaṃ mudūti vuccatīti vase vattamānaṃ cittaṃ paguṇabhāvāpattiyā suparimadditaṃ viya cammaṃ suparikammakatā viya ca lākhā mudūti vuccati.
For a mind that is subject to control is called pliant means a mind that is subject to control, having attained proficiency, is called pliant, like leather that has been well-kneaded or lacquer that has been well-processed.
Vase vattamānañhi cittaṃ mudūti vuccatī (tâm đã được điều khiển được gọi là mềm mại), nghĩa là tâm đã được điều khiển, nhờ đạt đến trạng thái thuần thục, được gọi là mềm mại, giống như da đã được nhào nặn kỹ hoặc sơn mài đã được chế biến tốt.
Kammakkhameti vikubbanādiiddhikammakkhame.
Kammakkhame means capable of acts of supernormal power, such as transformations (vikubbana).
Kammakkhame (có khả năng làm việc) nghĩa là có khả năng thực hiện các phép thần thông như biến hóa.
Tadubhayanti mudutākammaniyadvayaṃ.
Tadubhayaṃ means both pliability and serviceability.
Tadubhayaṃ (cả hai điều đó) nghĩa là cả hai điều mềm mại (mudutā) và có khả năng làm việc (kammaniya).
Nāhantiādīsu (a. ni. aṭṭha. 1.1.1) na-kāro paṭisedhattho.
In nāhaṃ and so on, the particle na has the meaning of negation.
Trong các từ như Nāhaṃ (ta không), v.v., từ na (không) mang nghĩa phủ định.
Ahanti satthā attānaṃ niddisati.
Ahaṃ (I) refers to the Teacher, the Buddha, speaking of himself.
Ahaṃ (ta) là Đức Đạo Sư chỉ chính mình.
Bhikkhaveti bhikkhū ālapati.
Bhikkhave (O monks) addresses the bhikkhus.
Bhikkhave (này các Tỳ-khưu) là lời gọi các Tỳ-khưu.
Aññanti idāni vuccamānacittato aññaṃ.
Aññaṃ (another) means another mind different from the one now being described.
Aññaṃ (khác) nghĩa là một tâm khác với tâm đang được nói đến bây giờ.
Ekadhammampīti ekampi sabhāvadhammaṃ.
Ekadhammampi (even one phenomenon) means even one natural phenomenon.
Ekadhammampī (dù chỉ một pháp) nghĩa là dù chỉ một pháp tự tính.
Na samanupassāmīti sambandho.
The connection is "na samanupassāmi" (I do not perceive).
Sự liên kết là “na samanupassāmi” (ta không thấy).
Ayañhettha attho – ahaṃ, bhikkhave, sabbaññutaññāṇena olokentopi aññaṃ ekadhammampi na samanupassāmi, yaṃ vasībhāvāpādanena bhāvitaṃ tathā punappunaṃ karaṇena bahulīkataṃ evaṃ savisesamudubhāvappattiyā mudu kammakkhamatāya kammaniyañca hoti yathā idaṃ cittanti.
Here is the meaning: "O monks, even while perceiving with omniscience, I do not perceive any other single phenomenon that has been cultivated through bringing it to mastery, and similarly made abundant by repeated practice, so that it becomes pliable due to attaining a specially pliant state and serviceable due to its serviceability, like this mind."
Ở đây, ý nghĩa là: “Này các Tỳ-khưu, dù ta quán sát bằng Tuệ Toàn Tri (sabbaññutañāṇa), ta cũng không thấy một pháp nào khác, mà đã được tu tập bằng cách đạt đến sự thuần thục (vasībhāva), và như vậy, đã được thực hành nhiều lần, đạt đến trạng thái mềm mại đặc biệt, mềm mại và có khả năng làm việc như tâm này”.
Idaṃ cittanti ca attano tesañca paccakkhatāya evamāha.
And idaṃ cittaṃ (this mind) is spoken thus because it is directly perceivable by himself and by them.
Và Ngài nói: “ Idaṃ cittaṃ (tâm này)” như vậy vì nó là trực tiếp đối với Ngài và các vị ấy.
Yathā yathāvuttā parisuddhatādayo na vigacchanti, evaṃ subhāvitaṃ cittaṃ tattha avaṭṭhitaṃ idha ‘‘ṭhitaṃ āneñjappatta’’nti ca vuttanti āha ‘‘etesu parisuddhabhāvādīsu ṭhitattā ṭhite, ṭhitattāyeva āneñjappatte’’ti.
It says, "established in these states of purity and so on, therefore steady; and due to being steady, therefore attained to imperturbability (āneñjappatta)" meaning that the well-cultivated mind, being established in the aforementioned purity and so on, does not disappear, and is here called "steady" (ṭhitaṃ) and "attained to imperturbability" (āneñjappattaṃ).
Để sự thanh tịnh, v.v., đã được nói đến không mất đi, tâm đã được tu tập tốt đẹp, an trú ở đó, được gọi ở đây là “ṭhitaṃ āneñjappattaṃ” (đứng vững, đã đạt đến sự bất động). Do đó, Ngài nói: “ etesu parisuddhabhāvādīsu ṭhitattā ṭhite, ṭhitattāyeva āneñjappatte (đứng vững trong các trạng thái thanh tịnh, v.v., và do đứng vững mà đạt đến sự bất động)”.
Yathā mudukammaññatā vasībhāvappattiyā lakkhīyati, evaṃ vasībhāvappattipi mudukammaññatāhi lakkhīyatīti ‘‘mudukammaññabhāvena vā attano vase ṭhitattā ṭhite’’ti vuttaṃ.
Just as pliability and serviceability are recognized by attaining mastery, so too, attaining mastery is recognized by pliability and serviceability. Hence it is said, "or steady due to its being subject to one's own control through the state of pliability and serviceability."
Cũng như sự mềm mại và khả năng làm việc được nhận biết qua sự đạt đến thuần thục, thì sự đạt đến thuần thục cũng được nhận biết qua sự mềm mại và khả năng làm việc. Do đó, đã được nói: “ mudukammaññabhāvena vā attano vase ṭhitattā ṭhite (hoặc đứng vững vì đã được điều khiển bởi trạng thái mềm mại và khả năng làm việc)”.
Yathā hi kāraṇena phalaṃ niddhārīyati, evaṃ phalenapi kāraṇaṃ niddhārīyatīti niccalabhāvena avaṭṭhānaṃ āneñjappattiyā ca sampayuttadhammesu thirabhāvena paṭipakkhehi akammaniyatāya ca sambhavataṃ saddhādibalānaṃ ānubhāvena hotīti āha ‘‘saddhādīhi pariggahitattā āneñjappatte’’ti.
Just as a result is determined by its cause, so too, a cause is determined by its result. Thus, steadfastness through immobility, and the attainment of imperturbability, and the firmness of associated phenomena, and the unserviceability by opponents, arise due to the power of such faculties as faith. Hence it says, "attained to imperturbability, being encompassed by faith and so on."
Thật vậy, cũng như kết quả được xác định bởi nguyên nhân, thì nguyên nhân cũng được xác định bởi kết quả. Do đó, sự an trú vững chắc (niccalabhāvena avaṭṭhānaṃ), sự đạt đến bất động (āneñjappattiyā), sự kiên cố trong các pháp tương ưng (sampayuttadhammesu thirabhāvena), và sự không thể bị quấy nhiễu bởi các đối nghịch (paṭipakkhehi akammaniyatāya) đều xảy ra nhờ sức mạnh của tín, v.v., đã phát sinh. Do đó, Ngài nói: “ saddhādīhi pariggahitattā āneñjappatte (đã đạt đến bất động vì được tín, v.v., bao bọc)”.
Idāni saṅkhepato vuttamevatthaṃ vivarituṃ ‘‘saddhāpariggahitaṃ hī’’tiādi vuttaṃ.
Now, to elaborate on the meaning stated concisely, "saddhāpariggahitaṃ hī" (for it is encompassed by faith) and so on, is spoken.
Bây giờ, để giải thích ý nghĩa đã được trình bày tóm tắt, Ngài đã nói: “ saddhāpariggahitaṃ hī (thật vậy, được tín bao bọc)”, v.v.
Tattha saddhāpariggahitanti evaṃ subhāvitaṃ vasībhāvappattaṃ cittaṃ ekaṃsena abhiññāsacchikaraṇīyānaṃ dhammānaṃ abhiññāsacchikiriyāya saṃvattatīti evaṃ pavattāya saddhāya pariggahitaṃ yathāvuttasaddhābalena upatthambhitaṃ.
There, saddhāpariggahitaṃ (encompassed by faith) means this well-cultivated mind, having attained mastery, conducive to directly realizing phenomena to be directly realized, is encompassed by such faith, supported by the power of faith as described.
Ở đó, saddhāpariggahitaṃ (được tín bao bọc) nghĩa là tâm đã được tu tập tốt đẹp, đã đạt đến sự thuần thục, được bao bọc bởi tín, tức là được nâng đỡ bởi sức mạnh của tín đã nói trên, để hoàn toàn thực hiện các pháp cần được chứng ngộ bằng thắng trí (abhiññā).
Assaddhiyenāti tappaṭipakkhena assaddhiyena hetunā.
Assaddhiyenā (by lack of faith) means by its opposite, by the cause of lack of faith.
Assaddhiyenā (bởi sự vô tín) nghĩa là bởi sự vô tín, là đối nghịch của tín, làm nguyên nhân.
Na iñjatīti na calati na kampati, aññadatthu uparivisesāvahabhāveneva tiṭṭhati.
Na iñjatī (does not waver) means it does not stir, it does not tremble; it stands firm, bringing forth further distinction.
Na iñjatī (không rung động) nghĩa là không lay động, không rung chuyển, mà chỉ an trú trong trạng thái mang lại những đặc tính siêu việt hơn.
Vīriyapariggahitantiādīsupi imināva nayena attho veditabbo.
Similarly, in vīriyapariggahitaṃ (encompassed by energy) and so on, the meaning should be understood in the same way.
Trong các từ như vīriyapariggahitaṃ (được tinh tấn bao bọc), v.v., ý nghĩa cũng nên được hiểu theo cách này.
Ayaṃ pana viseso – vīriyapariggahitanti vasībhāvāpādanaparidamanasādhanena vīriyena upatthambhitaṃ.
This is the distinction: vīriyapariggahitaṃ means supported by energy, by the means of discipline that leads to the attainment of mastery.
Tuy nhiên, đây là sự khác biệt: vīriyapariggahitaṃ (được tinh tấn bao bọc) nghĩa là được nâng đỡ bởi tinh tấn, vốn là phương tiện để rèn luyện và đạt đến sự thuần thục.
Satipariggahitanti yathāvutte bhāvanābahulīkāre asammosādikāya kusalānañca dhammānaṃ gatiyo samanvesamānāya satiyā upatthambhitaṃ.
Satipariggahitaṃ (encompassed by mindfulness) means supported by mindfulness that is free from confusion and so on, and that investigates the courses of wholesome phenomena, in the aforementioned frequent cultivation.
Satipariggahitaṃ (được niệm bao bọc) nghĩa là được nâng đỡ bởi niệm, vốn không lầm lẫn, v.v., trong sự tu tập và thực hành nhiều lần đã nói trên, và tìm kiếm các con đường của các pháp thiện.
Samādhipariggahitanti tattheva avikkhepasādhanena samādhānena upatthambhitaṃ.
Samādhipariggahitaṃ (encompassed by concentration) means supported by concentration that leads to undistractedness in that very object.
Samādhipariggahitaṃ (được định bao bọc) nghĩa là được nâng đỡ bởi định, vốn là phương tiện để không xao nhãng ở chính đối tượng đó.
Paññāpariggahitanti tassā eva bhāvanāya upakārānupakāradhammānaṃ pajānanalakkhaṇāya paññāya upatthambhitaṃ.
Paññāpariggahitaṃ (encompassed by wisdom) means supported by wisdom, which is characterized by knowing beneficial and non-beneficial phenomena concerning that very cultivation.
Paññāpariggahitaṃ (được tuệ bao bọc) nghĩa là được nâng đỡ bởi tuệ, vốn có đặc tính nhận biết các pháp có ích và không có ích trong sự tu tập đó.
Obhāsagatanti ñāṇobhāsasahagataṃ.
Obhāsagataṃ (gone to light) means accompanied by the light of knowledge.
Obhāsagataṃ (đã đạt đến ánh sáng) nghĩa là đi kèm với ánh sáng của tuệ (ñāṇobhāsa).
Obhāsabhūtena hi yathāvuttasamādhānasaṃvaddhitena ñāṇena saṃkilesapakkhaṃ yāthāvato passanto tato utrāsanto ottappanto taṃ abhibhavati, na tena abhibhuyyati.
Indeed, with knowledge that has become light, enhanced by the aforementioned concentration, one truly sees the defilement-side, and being terrified and ashamed of it, one overcomes it, and is not overcome by it.
Thật vậy, với tuệ đã được phát triển bởi sự định tâm đã nói trên, vốn là ánh sáng, khi thấy rõ ràng phe cấu uế (saṃkilesapakkha), Ngài kinh sợ và hổ thẹn về nó, Ngài vượt qua nó, chứ không bị nó vượt qua.
Tenāha ‘‘kilesandhakārena na iñjatī’’ti.
Therefore, it says, "it does not waver due to the darkness of defilements."
Do đó, Ngài nói: “ kilesandhakārena na iñjatī (không rung động bởi bóng tối của cấu uế)”.
Etena ñāṇapariggahitaṃ hirottappabalaṃ dasseti.
By this, it shows the power of shame and fear of wrongdoing (hirī-ottappa) encompassed by knowledge.
Bằng điều này, Ngài chỉ ra sức mạnh của hổ thẹn và ghê sợ (hirottappabala) được tuệ bao bọc.
Aṭṭhaṅgasamannāgatanti catutthajjhānasamādhinā samāhitatā parisuddhatā pariyodātatā anaṅgaṇatā vigatupakkilesatā mudubhāvo kammaniyatā āneñjappattiyā ṭhitatāti imehi aṭṭhahi aṅgehi samannāgataṃ.
Endowed with Eight Factors means being endowed with these eight factors: collectedness, purity, utter purity, freedom from defilements, freedom from corruptions, malleability, wroughtness (for performing superhuman powers), and steadfastness by attaining imperturbability, due to the samādhi of the fourth jhāna.
Tám chi phần đầy đủ (Aṭṭhaṅgasamannāgata) là sự định tĩnh, sự thanh tịnh, sự trong sạch, sự không ô uế, sự thoát khỏi phiền não, sự mềm mại, sự dễ uốn nắn, và sự an trú trong trạng thái bất động (āneñjappatti) — đầy đủ tám chi phần này nhờ định của Tứ thiền.
Atha vā samāhitassa cittassa imāni aṅgānīti ‘‘samāhite’’ti imaṃ aṅgabhāvena aggahetvā ṭhitiāneñjappattiyo visuṃ gahetvā yathāvuttehi aṭṭhahi aṅgehi samannāgatanti attho daṭṭhabbo.
Alternatively, these are the factors of a concentrated mind, so the meaning should be understood as being endowed with the aforementioned eight factors, without taking "collectedness" as a factor, but taking steadfastness and attainment of imperturbability separately.
Hoặc, những chi phần này là của tâm đã định tĩnh, nhưng không lấy từ "định tĩnh" (samāhite) làm một chi phần, mà lấy sự an trú (ṭhiti) và sự đạt đến bất động (āneñjappatti) một cách riêng biệt, thì ý nghĩa là đầy đủ tám chi phần như đã nói.
Abhinīhārakkhamanti iddhividhādiatthaṃ abhinīhārakkhamaṃ tadabhimukhakaraṇayoggaṃ.
Capable of Directing means capable of directing for the purpose of such as psychic powers, fit for directing towards that.
Có khả năng hướng đến (Abhinīhārakkhama) là có khả năng hướng đến các ý nghĩa như thần thông (iddhividhā), xứng đáng để đạt được chúng.
Tenāha ‘‘abhiññāsacchikaraṇīyānaṃ dhammānaṃ abhiññāsacchikiriyāyā’’ti.
Therefore, it is said: "for the direct knowledge and realization of things to be directly known and realized."
Vì thế, Ngài nói "để chứng ngộ các pháp cần phải chứng ngộ bằng thắng trí".
‘‘Jhānapaṭilābhapaccayānanti jhānapaṭilābhahetukānaṃ jhānapaṭilābhaṃ nissāya uppajjanakānaṃ.
"Jhānapaṭilābhapaccayānaṃ" means born due to the attainment of jhāna, dependent on the attainment of jhāna.
"Các điều kiện cho sự chứng đắc thiền (Jhānapaṭilābhapaccayānaṃ)" là những pháp có nguyên nhân là sự chứng đắc thiền, những pháp sinh khởi nhờ nương vào sự chứng đắc thiền.
Pāpakānanti lāmakānaṃ.
"Pāpakānaṃ" means evil.
"Các pháp ác (pāpakānaṃ)" là những pháp xấu xa.
Icchāvacarānanti icchāya avacarānaṃ icchāvasena otiṇṇānaṃ ‘aho vata mameva satthā paṭipucchitvā bhikkhūnaṃ dhammaṃ deseyyā’tiādinayappavattānaṃ mānamāyāsāṭheyyādīnaṃ.
"Icchāvacarānaṃ" means those that roam about according to desire, those that have descended by way of desire, such as "Oh, if only the Teacher would question me and teach the Dhamma to the bhikkhus!"—and so forth, like conceit, hypocrisy, and cunning.
"Các pháp do dục vọng (icchāvacarānaṃ)" là những pháp hoạt động theo dục vọng, những pháp phát sinh theo ý muốn như "Ôi, ước gì Đức Thế Tôn chỉ hỏi riêng tôi và thuyết pháp cho các Tỳ-khưu", và các pháp như mạn, dối trá, xảo quyệt v.v.
Abhijjhādīnanti ādi-saddenapi tesaṃyeva saṅgaho.
"Abhijjhādīnaṃ"—the ādi (etc.) term here refers to these same things.
Trong từ "tham lam v.v. (abhijjhādīnaṃ)", từ "v.v. (ādi)" cũng bao gồm các pháp đó.
Abhijjhā cettha paṭhamajjhānena avikkhambhaneyyā mānādayo ca tadekaṭṭhā daṭṭhabbā jhānapaṭilābhapaccayānanti anuvattamānattā.
Here, covetousness (abhijjhā) and pride (māna) etc., which are not suppressed by the first jhāna, should be understood as being of the same nature as the hindrances, because they are continuously occurring as conditions for the attainment of jhāna.
Ở đây, tham lam (abhijjhā) là những pháp không bị Sơ thiền trấn áp, và mạn v.v. là những pháp cùng tồn tại với nó, cần được hiểu như vậy vì chúng tiếp nối theo "các điều kiện cho sự chứng đắc thiền".
Vikkhambhaneyyā pana nīvaraṇaggahaṇena gahitā.
But those that are suppressible are included by the term "hindrances."
Còn những pháp có thể bị trấn áp thì đã được bao gồm trong việc đề cập đến các triền cái (nīvaraṇa).
Kathaṃ pana paṭhamajjhānena avikkhambhaneyyā idha vigacchantīti?
How, then, do those that are not suppressible by the first jhāna cease here?
Nhưng làm thế nào mà những pháp không bị Sơ thiền trấn áp lại biến mất ở đây?
‘Sabbe kusalā dhammā sabbākusalānaṃ paṭipakkhā’ti sallekhapaṭipattivasena evaṃ vuttaṃ jhānassa aparāmaṭṭhabhāvadassanato.
"All wholesome states are opposed to all unwholesome states"—this is stated in the sense of the practice of self-effacement (sallekha paṭipattī), to show that the jhāna is not adhered to.
Điều này được nói theo phương pháp thực hành thanh lọc (sallekhapaṭipatti), rằng "tất cả các pháp thiện đều là đối nghịch của tất cả các pháp bất thiện", để chỉ ra rằng thiền không bị chấp thủ.
Ye panettha ‘icchāvacarānaṃ abhijjhādīna’nti imehi padehi kopaappaccayakāmarāgabyāpādādayo gahitāti adhippāyena ‘jhānapaṭilābhapaccayāna’nti pāṭhaṃ paṭikkhipitvā ‘jhānapaṭilābhapaccanīkāna’nti pāṭhoti vadanti, taṃ tesaṃ matimattaṃ tathā pāṭhasseva abhāvato, jhānapaṭilābhapaccanīkā ca nīvaraṇā ceva tadekaṭṭhā ca, tesaṃ dūrībhāvaṃ vatvā puna tesaṃyeva abhāvavigamacodanāya ayujjamānattā.
As for those who say that by these terms "icchāvacarānaṃ abhijjhādīnaṃ" (covetousness etc. that roam about according to desire) are meant states like anger, displeasure, sensual passion, ill-will, etc., and thus reject the reading "jhānapaṭilābhapaccayānaṃ" (conditions for the attainment of jhāna) and propose the reading "jhānapaṭilābhapaccanīkānaṃ" (inimical to the attainment of jhāna)—that is merely their opinion, as such a reading does not exist, and also because having stated the farness of the hindrances and those of a similar nature, it would be improper to again urge their non-existence and cessation.
Những ai nói rằng các pháp ác thô thiển như sân hận, bất mãn, tham ái dục, sân độc v.v. được bao gồm trong các từ "các pháp do dục vọng và tham lam v.v.", và do đó bác bỏ cách đọc "jhānapaṭilābhapaccayānaṃ" mà thay bằng "jhānapaṭilābhapaccanīkānaṃ", thì đó chỉ là quan điểm riêng của họ, vì cách đọc đó không tồn tại. Nếu đã nói về sự xa lìa của các triền cái và những pháp cùng tồn tại với chúng, thì việc thúc giục loại bỏ chúng một lần nữa là không hợp lý.
Nanu ca anaṅgaṇasuttavatthasuttesu ayamattho labbhati oḷārikānaṃyeva pāpadhammānaṃ tattha adhippetattāti.
Isn't this meaning found in the Anaṅgaṇa Sutta and Vatthu Sutta, since only gross evil states are intended there?
Chẳng phải ý nghĩa này được tìm thấy trong các kinh Anaṅgaṇa Sutta và Vatthūpama Sutta sao, vì ở đó chỉ đề cập đến các pháp ác thô thiển?
Saccametaṃ, idha pana adhigatacatutthajjhānassa vasena vuttattā sukhumāyeva te gahitā, aṅgaṇupakkilesatāsāmaññena panettha suttānaṃ apadisanaṃ.
This is true, but here, because it is stated in the context of one who has attained the fourth jhāna, subtle states are intended; here, the suttas are referred to by way of the common characteristic of defilement and corruption.
Điều này là đúng. Tuy nhiên, ở đây, vì được nói trong bối cảnh của người đã chứng đắc Tứ thiền, nên các pháp đó được hiểu là vi tế. Việc đề cập đến các kinh ở đây là dựa trên sự tương đồng về sự ô uế và phiền não.
Tathā hi ‘suttānusārenā’ti vuttaṃ, na pana suttavasenā’’ti.
Thus, it is said "according to the suttas," not "by way of the suttas."
Vì vậy, Ngài nói "theo các kinh", chứ không phải "theo quyền uy của các kinh".
Avassañcetamevaṃ sampaṭicchitabbaṃ adhigatajjhānānampi kesañci icchāvacarānaṃ pavattisabbhāvatoti.
This must certainly be accepted in this way, because even in some who have attained jhāna, there is a possibility of the occurrence of mental states that roam according to desire.
Điều này nhất định phải được chấp nhận như vậy, vì ngay cả đối với những người đã chứng đắc thiền, đôi khi vẫn có sự phát sinh của các pháp do dục vọng.
Teneva ācariyadhammapālattherena ‘‘jhānapaṭilābhapaccayāna’’nti pāṭhaṃ gahetvā ‘‘jhānapaṭilābhapaccanīkāna’’nti ayaṃ pāṭho paṭikkhitto.
For this very reason, the venerable Ācariya Dhammapāla Thera adopted the reading "jhānapaṭilābhapaccayānaṃ" and rejected the reading "jhānapaṭilābhapaccanīkānaṃ."
Chính vì thế, Trưởng lão Ācariya Dhammapāla đã chấp nhận cách đọc "jhānapaṭilābhapaccayānaṃ" và bác bỏ cách đọc "jhānapaṭilābhapaccanīkānaṃ".
Mahāgaṇṭhipade visuddhimaggassa sīhaḷagaṇṭhipadepi ca ‘‘jhānapaṭilābhapaccayāna’’nti imasseva pāṭhassa attho vutto, tasmā ayameva pāṭho gahetabbo, atthopi cettha yathāvuttanayeneva veditabbo.
In the Mahāgaṇṭhipada and also in the Sīhaḷagaṇṭhipada of the Visuddhimagga, the meaning of this very reading "jhānapaṭilābhapaccayānaṃ" is explained. Therefore, this reading alone should be adopted, and its meaning here should also be understood according to the aforementioned method.
Trong Mahāgaṇṭhipada và Sīhaḷagaṇṭhipada của Visuddhimagga, ý nghĩa của cách đọc "jhānapaṭilābhapaccayānaṃ" đã được giải thích. Do đó, chỉ nên chấp nhận cách đọc này, và ý nghĩa ở đây cũng phải được hiểu theo cách đã nói.
Tena ‘‘icchāvacarānanti icchāya avacarānaṃ icchāvasena otiṇṇānaṃ pavattānaṃ nānappakārānaṃ kopaappaccayānanti attho’’ti ayampi pāṭho ayuttoyevāti gahetabbaṃ, tatoyeva ca visuddhimagge ayaṃ pāṭho sabbena sabbaṃ na dassitoti.
Therefore, the reading "icchāvacarānanti icchāya avacarānaṃ icchāvasena otiṇṇānaṃ pavattānaṃ nānappakārānaṃ kopaappaccayānanti attho" (meaning: "icchāvacarānaṃ" means those that roam about according to desire, those that have descended by way of desire, various kinds of anger, displeasure, etc.) should also be taken as incorrect, and for that very reason, this reading is not found at all in the Visuddhimagga.
Vì vậy, cách đọc "ý nghĩa của icchāvacarānaṃ là các loại sân hận và bất mãn khác nhau phát sinh do dục vọng" cũng không hợp lý, và chính vì thế, cách đọc này hoàn toàn không được trình bày trong Visuddhimagga.
Iddhipādakabhāvūpagamanenāti iddhiyā pādakabhāvassa padaṭṭhānabhāvassa upagamanena.
By reaching the state of being the base for psychic power means by reaching the state of being the base or the proximate cause of psychic power.
Bằng cách trở thành nền tảng của thần thông (Iddhipādakabhāvūpagamanena) là bằng cách đạt đến trạng thái làm nền tảng, làm chỗ đứng cho thần thông.
Bhāvanāpāripūriyāti ito paraṃ kattabbassa abhāvavasena abhinīhārakkhamabhāvanāya paripuṇṇattā.
By the perfection of development means by the completeness of the development that is capable of directing the mind towards psychic powers, due to there being nothing further to be done after this.
Do sự hoàn hảo của sự tu tập (Bhāvanāpāripūriyā) là do sự tu tập có khả năng hướng đến thắng trí đã hoàn mãn, không còn gì phải làm thêm nữa.
Paṇītabhāvūpagamanenāti tato eva padhānabhāvaṃ nītatāya uttamaṭṭhena atittikaraṭṭhena ca paṇītabhāvassa upagamanena.
By reaching the state of excellent quality means by reaching the state of excellent quality due to having been brought to the state of prominence from that very reason, and by the meaning of supreme and insatiable.
Bằng cách đạt đến trạng thái vi diệu (Paṇītabhāvūpagamanena) là bằng cách đạt đến trạng thái vi diệu với ý nghĩa là tối thượng và không bao giờ đủ, do đã đạt đến trạng thái chủ yếu.
Ubhayañcetaṃ bhāvanāya ṭhitiyā kāraṇavacanaṃ, paripuṇṇāya bhāvanāya paṇītabhāvappattiyā ṭhiteti.
Both of these are causal statements for the stability of development: when development is perfected, it stands in the attainment of excellent quality.
Cả hai điều này là lời giải thích về nguyên nhân của sự an trú trong tu tập, rằng nó an trú do sự tu tập đã hoàn mãn và đạt đến trạng thái vi diệu.
Āneñjappatteti idaṃ ṭhitiyā visesanaṃ.
Āneñjappatte (in a state of imperturbability)—this qualifies ṭhitiyā (steadfastness).
Đạt đến bất động (Āneñjappatte) là một tính từ bổ nghĩa cho sự an trú (ṭhiti).
Tenāha ‘‘yathā āneñjappattaṃ hoti, evaṃ ṭhite’’ti.
Therefore, it is said: "steadfast, so that it becomes imperturbable."
Vì thế, Ngài nói "an trú như thể đã đạt đến bất động".
Imasmiṃ pakkhe ‘‘ṭhite āneñjappatte’’ti ubhayamekaṃ aṅgaṃ, ‘‘samāhite’’ti pana idampi ekamaṅgaṃ.
In this interpretation, "ṭhite āneñjappatte" (steadfast, in a state of imperturbability) both together form one factor, while "samāhite" (collected) is also one factor.
Trong trường hợp này, "an trú, đạt đến bất động" (ṭhite āneñjappatte) là một chi phần, và "định tĩnh" (samāhite) cũng là một chi phần.
Tenevassa paṭhamavikappato visesaṃ sandhāyāha ‘‘evampi aṭṭhaṅgasamannāgata’’nti.
For this very reason, referring to a distinction from the first alternative, it is said: "thus also endowed with eight factors."
Chính vì thế, để chỉ sự khác biệt so với cách giải thích đầu tiên, Ngài nói "cũng vậy, đầy đủ tám chi phần".
Pubbenivāsaṃ anussarati, tassa vā anussaraṇaṃ pubbenivāsānussati taṃnissayādipaccayabhūtaṃ paṭicca uppajjanato.
Recalling previous existences, or the recollection of previous existences, is called pubbenivāsānussati because it arises dependent on that previous existence as its basis and other conditions.
Vị ấy hồi tưởng lại các đời sống quá khứ, hoặc sự hồi tưởng đó là túc mạng niệm (pubbenivāsānussati), vì nó sinh khởi nương vào các duyên như chỗ nương tựa đó.
Pubbenivāsānussatimhi yaṃ ñāṇaṃ tadatthāyāti saṅkhepena vuttamatthaṃ vivaranto pubbenivāsaṃ tāva dassetvā tattha satiñāṇāni dassetuṃ ‘‘pubbenivāso’’tiādimāha.
Expounding the meaning stated briefly as " the knowledge that is in the recollection of previous existences, for that purpose," first showing previous existences, then to show mindfulness and knowledge therein, he says " pubbenivāso" and so forth.
Để giải thích ý nghĩa đã được nói tóm tắt là "trí tuệ trong túc mạng niệm đó", Ngài trước hết trình bày về túc mạng (pubbenivāsa), sau đó nói "túc mạng là..." v.v. để trình bày về niệm và trí trong đó.
Tattha ‘‘pubbe’’ti idaṃ padaṃ ‘‘ekampi jāti’’ntiādivacanato atītabhavavisayaṃ idhādhippetanti āha ‘‘atītajātīsū’’ti.
Among those, the word "pubbe" (previously) is intended here to refer to past existences, as in statements like "even one birth," and so forth; thus he says: "in past births."
Trong đó, từ "pubbe" (trước đây) ở đây có ý nghĩa là liên quan đến các kiếp quá khứ, theo lời dạy như "một kiếp" v.v., nên Ngài nói "trong các kiếp quá khứ (atītajātīsu)".
Nivāsasaddo kammasādhano, khandhavinimutto ca nivasitadhammo natthīti āha ‘‘nivutthakkhandhā’’ti.
The word nivāsa (dwelling) is formed by the object case (kamma-sādhana); and there is no dwelled-upon phenomenon separate from the aggregates, thus he says: "the aggregates that were dwelt in."
Từ "nivāsa" (nơi ở) là một danh từ động từ (kammasādhana). Không có pháp nào tồn tại tách rời khỏi các uẩn (khandha) mà lại là pháp đã ở, nên Ngài nói "các uẩn đã ở (nivutthakkhandhā)".
Nivutthatā cettha santāne pavattatā, tathābhūtā ca te anu anu bhūtā jātā pavattā, tattha uppajjitvā vigatā ca hontīti āha ‘‘nivutthāti ajjhāvutthā anubhūtā attano santāne uppajjitvā niruddhā’’ti.
Here, having dwelt in means having occurred in one's own continuum; and being such, they occurred, arose, and after arising in that continuum, they ceased. Thus he says: "Nivutthāti (having dwelt in) means having stayed, having experienced, having arisen in one's own continuum and ceased."
Ở đây, "nivutthatā" là sự tồn tại trong dòng tương tục. Và các uẩn đó đã sinh khởi và tồn tại như vậy, đã sinh khởi và biến mất trong dòng tương tục của chính mình, nên Ngài nói "nivutthā (đã ở) là đã trú ngụ, đã trải nghiệm, đã sinh khởi trong dòng tương tục của chính mình và đã diệt".
Evaṃ sasantatipariyāpannadhammavasena nivāsasaddassa atthaṃ vatvā idāni avisesena vattuṃ ‘‘nivutthadhammā vā nivutthā’’ti vatvā taṃ vivarituṃ ‘‘gocaranivāsenā’’tiādi vuttaṃ.
Having thus stated the meaning of the word nivāsa in terms of phenomena pertaining to one's own continuum, now, to state it without distinction, having said " nivutthadhammā vā nivutthā" (or phenomena that were dwelt in, or dwelt in), to explain that, it is said " gocaranivāsenā" and so forth.
Sau khi giải thích ý nghĩa của từ "nivāsa" theo các pháp thuộc dòng tương tục của chính mình, bây giờ để nói một cách tổng quát, Ngài nói "hoặc các pháp đã ở (nivutthadhammā vā nivutthā)", và để giải thích điều đó, Ngài nói "bằng cách trú ngụ trong đối tượng (gocaranivāsena)" v.v.
Gocarabhūtāpi hi gocarāsevanāya āsevitā ārammaṇakaraṇavasena anubhūtā nivutthā nāma honti.
Indeed, phenomena that become objects (gocara) are also called "nivutthā" (dwelt in) when they are experienced by way of their being attended to as objects, by attending to them as objects.
Các pháp đã trở thành đối tượng, đã được thực hành bằng cách thực hành đối tượng, đã được trải nghiệm bằng cách biến thành đối tượng, cũng được gọi là "nivutthā" (đã ở).
Te pana duvidhā saparaviññāṇagocaratāyāti ubhayepi te dassetuṃ ‘‘attano’’tiādi vuttaṃ.
These are of two kinds: being objects of one's own consciousness and objects of others' consciousness. To show both of these, it is said: "attano" and so forth.
Các pháp đó có hai loại: đối tượng của thức của chính mình và đối tượng của thức của người khác. Để trình bày cả hai, Ngài nói "của chính mình (attano)" v.v.
Tattha ‘‘attano viññāṇena viññātā’’ti vatvā ‘‘paricchinnā’’ti vacanaṃ ye te gocaranivāsena nivutthadhammā, na te kevalaṃ viññāṇena viññātamattā, atha kho yathā pubbe nāmagottavaṇṇaliṅgāhārādīhi visesehi paricchedakārikāya paññāya paricchijja gahitā, tathevetaṃ ñāṇaṃ paricchijja gaṇhātīti imassa atthassa dīpanatthaṃ vuttaṃ.
There, having said, “known by one’s own consciousness,” the word “discerned” is spoken to illustrate the meaning that those states of existence experienced as objects of consciousness are not merely known by consciousness, but rather, just as in the past they were taken (or grasped) after being discerned by wisdom that makes distinctions through specific qualities like name, clan, appearance, marks, and sustenance, so too does this knowledge discern and grasp them.
Trong đó, việc nói “được biết bằng thức của chính mình” rồi nói “được phân biệt” là để làm sáng tỏ ý nghĩa rằng những pháp đã được an trú bằng sự an trú đối tượng (gocaranivāsa) thì không chỉ đơn thuần là được biết bằng thức, mà còn được nắm giữ bằng trí tuệ phân biệt, qua sự phân biệt bằng những đặc điểm như tên, dòng họ, màu sắc, hình tướng, thức ăn, v.v., như đã nói trước đây; và trí tuệ này cũng nắm giữ bằng cách phân biệt như vậy.
Paraviññāṇaviññātāpi vā nivutthāti sambandho.
Alternatively, the connection is that they were lived (experienced) even when known by others’ consciousness.
Hoặc có sự liên hệ rằng những gì đã được an trú cũng được biết bởi thức của người khác.
Na kevalaṃ attanova viññāṇena, atha kho paresaṃ viññāṇena viññātāpīti attho.
The meaning is that they are known not only by one’s own consciousness, but also by the consciousness of others.
Điều đó có nghĩa là không chỉ được biết bằng thức của chính mình, mà còn được biết bằng thức của người khác.
Idhāpi ‘‘paricchinnā’’ti padaṃ ānetvā sambandhitabbaṃ, paresampi vā viññāṇena viññātā paricchinnāti.
Here too, the word “discerned” should be brought in and connected, meaning that they are known and discerned even by the consciousness of others.
Ở đây cũng cần đưa từ “được phân biệt” (paricchinnā) vào để liên hệ, tức là “được biết và được phân biệt bằng thức của người khác”.
Tassa ca gahaṇe payojanaṃ vuttanayeneva vattabbaṃ.
The purpose of grasping that (knowledge) should be stated in the manner already explained.
Mục đích của việc nắm giữ điều đó phải được nói theo cách đã trình bày.
Te ca kho yasmā atītāsu eva jātīsu aññehi viññātā paricchinnā, te ca parinibbutāpi honti, yehi te viññātā, tesaṃ tadā vattamānasantānānusārena tesampi atīte pavatti viññāyatīti sikhāppattaṃ pubbenivāsānussatiñāṇassa visayabhūtaṃ pubbenivāsaṃ dassetuṃ ‘‘chinnavaṭumakānussaraṇādīsū’’ti vuttaṃ.
And because those beings were known and discerned by others in past existences, and those who knew them have attained final Nibbāna, and their past existence is understood in accordance with the continuity of those who knew them at that time, therefore, to show the past existence which is the domain of the highest recollection of past lives, it is said: “in the recollection of those whose path is cut off, etc.”
Và bởi vì những điều đó đã được người khác biết và phân biệt trong những kiếp quá khứ, và những vị đã biết đó cũng đã nhập Niết Bàn (parinibbuta), nên để chỉ ra kiếp sống quá khứ (pubbenivāsa) là đối tượng của tuệ Túc Mạng Minh (pubbenivāsānussatiñāṇa) đã đạt đến đỉnh cao, qua sự hiểu biết về sự tiếp nối hiện tại của những vị đã biết đó trong quá khứ, nên đã nói “trong sự hồi tưởng các vị đã cắt đứt con đường sinh tử, v.v.”.
Chinnavaṭumakā sammāsambuddhā, tesaṃ anussaraṇaṃ chinnavaṭumakānussaraṇaṃ.
The Sammāsambuddhas are those whose path is cut off; their recollection is the recollection of those whose path is cut off.
Chinnavaṭumakānussaraṇaṃ là sự hồi tưởng các vị Chánh Đẳng Giác (sammāsambuddha) đã cắt đứt con đường sinh tử.
‘‘Ādisaddena paccekabuddhabuddhasāvakānussaraṇāni gayhantī’’ti keci vadanti.
Some say that “the recollection of Paccekabuddhas and disciples of the Buddha are included by the word ‘etc.’”
Một số người nói rằng “từ ‘v.v.’ bao gồm sự hồi tưởng các vị Phật Độc Giác (paccekabuddha) và các vị Thanh Văn (buddhasāvaka)”.
Chinnavaṭumakā pana sabbeva anupādisesāya nibbānadhātuyā parinibbutā chinnasaṃsāramaggattā, tesaṃ anussaraṇaṃ nāma tesaṃ paṭipattiyā anussaraṇaṃ.
But all of those whose path is cut off are those Buddhas who have attained final Nibbāna with the element of Nibbāna without any remainder (anupādisesa), due to having cut off the path of saṃsāra; their recollection is the recollection of their practice.
Tuy nhiên, tất cả các vị Chinnavaṭumaka đều đã nhập Niết Bàn (parinibbuta) vào Niết Bàn Giới (nibbānadhātu) vô dư y (anupādisesa), vì đã cắt đứt con đường luân hồi. Sự hồi tưởng các vị ấy là sự hồi tưởng về con đường tu tập của các vị ấy.
Sā pana paṭipatti saṅkhepato chaḷārammaṇaggahaṇalakkhaṇāti tāni idha paraviññāṇaviññātaggahaṇena gahitāni.
And that practice, in brief, is characterized by grasping the six sense objects; those are grasped here by the grasping of what is known by others’ consciousness.
Con đường tu tập đó, tóm lại, có đặc tính là nắm giữ sáu đối tượng (chaḷārammaṇa), và những điều đó ở đây được nắm giữ bằng cách nắm giữ những gì được biết bởi thức của người khác.
Tasmā purimāsu jātīsu attano viññāṇena aviññātānaṃ parinibbutānaṃ sabbesampi buddhapaccekabuddhasāvakānaṃ anussaraṇaṃ chinnavaṭumakānussaraṇanti veditabbaṃ.
Therefore, it should be understood that the recollection of all Buddhas, Paccekabuddhas, and disciples who have attained final Nibbāna, and who were not known by one's own consciousness in past lives, is the recollection of those whose path is cut off.
Vì vậy, cần hiểu rằng sự hồi tưởng tất cả các vị Phật, Độc Giác Phật và Thanh Văn đã nhập Niết Bàn, những vị mà thức của chính mình chưa từng biết đến trong các kiếp trước, là Chinnavaṭumakānussaraṇaṃ.
Ādi-saddena panettha purimāsu jātīsu attano viññāṇena aviññātānaṃ aparinibbutānampi vattamānakkhandhapaṭipāṭiyā agantvā sīhokkantikavasena anussaraṇaṃ gahitaṃ, ime pana yathāvuttachinnavaṭumakānussaraṇādayo buddhānaṃyeva labbhanti.
And here, by the word ādi (etc.), is grasped the recollection of those who have not attained final Nibbāna but were unknown by one’s own consciousness in past lives, approaching it in the manner of a lion's pounce, without following the continuity of their present aggregates; however, these recollections of those whose path is cut off, etc., are only attainable by Buddhas.
Ở đây, từ “v.v.” cũng bao gồm sự hồi tưởng về những vị chưa nhập Niết Bàn, mà thức của chính mình chưa từng biết đến trong các kiếp trước, bằng cách đi ngược dòng chảy của các uẩn hiện tại, theo cách thức của sư tử nhảy (sīhokkantika). Tuy nhiên, những điều như Chinnavaṭumakānussaraṇaṃ đã nói trên chỉ có thể đạt được bởi chư Phật.
Na hi atīte buddhā bhagavanto evaṃ vipassiṃsu, evaṃ maggaṃ bhāvesuṃ, phalanibbānāni sacchākaṃsu, evaṃ veneyye vinesunti ettha sabbathā aññesaṃ ñāṇassa gati atthīti.
For, in the past, no other knowledge has the capacity to comprehend how the Buddhas, the Bhagavā, thus saw, thus developed the path, thus realized the fruits and Nibbāna, and thus disciplined those who were to be trained.
Thật vậy, không có trí tuệ nào khác có thể đạt đến việc biết rằng “trong quá khứ, chư Phật Thế Tôn đã quán chiếu như thế này, đã tu tập con đường như thế này, đã chứng đắc quả và Niết Bàn, đã giáo hóa những người đáng giáo hóa như thế này”.
Ye pana purimāsu jātīsu attanova viññāṇena viññātā, te parinibbutepi khandhapaṭibaddhattā sāvakā anussarantiyeva.
But those who were known by their own consciousness in past lives, even if they have attained final Nibbāna, their disciples still recollect them because they are connected to their aggregates.
Tuy nhiên, những vị đã được thức của chính mình biết đến trong các kiếp trước, thì dù đã nhập Niết Bàn, các vị Thanh Văn vẫn hồi tưởng được vì có sự liên hệ với các uẩn.
Yāya satiyā pubbenivāsaṃ anussarati, sā pubbenivāsānussatīti ānetvā sambandhitabbaṃ.
The memory by which one recollects past existences, that is called pubbenivāsānussati (recollection of past lives); this should be brought in and connected.
Cần liên hệ rằng “niệm mà nhờ đó người ta hồi tưởng kiếp sống quá khứ (pubbenivāsa) là Túc Mạng Niệm (pubbenivāsānussati)”.
Abhinīharinti cittaṃ jhānārammaṇato apanetvā pubbenivāsābhimukhaṃ pesesiṃ, pubbenivāsaninnaṃ pubbenivāsapoṇaṃ pubbenivāsapabbhāraṃ akāsinti attho.
Abhinīhariṃ means “I directed my mind away from the jhānic object towards past existences; I made it inclined towards past existences, tending towards past existences, leaning towards past existences.”
Abhinīhariṃ có nghĩa là “ta đã chuyển tâm khỏi đối tượng thiền định và hướng về kiếp sống quá khứ; ta đã làm cho tâm nghiêng về, hướng về, và tập trung vào kiếp sống quá khứ”.
Pāḷiyaṃ ‘‘abhininnāmesi’’nti uttamapurisappayogattā ‘‘so’’ti ettha ahaṃsaddo ānetvā vuccamāno tadattho pākaṭo hotīti ‘‘so aha’’nti vuttaṃ.
In the Pāḷi, since “abhininnāmesi” is used in the first person singular, the word “ahaṃ” (I) is brought in here to clarify its meaning, thus it is said “so ahaṃ” (that I).
Trong Pāli, vì từ “abhininnāmesi” là cách dùng ở ngôi thứ nhất, nên khi thêm từ “ahaṃ” vào sau “so” để nói, ý nghĩa đó sẽ rõ ràng hơn. Vì vậy, đã nói “so ahaṃ”.
Anekavidhanti nānābhavayonigativiññāṇaṭṭhitisattāvāsādivasena bahuvidhaṃ.
Anekavidhaṃ means "of many kinds" in terms of diverse existences, wombs, destinies, stations of consciousness, abodes of beings, and so on.
Anekavidhaṃ có nghĩa là “đa dạng, nhiều loại” theo các khía cạnh như các cõi, chủng loại, cảnh giới, trú xứ của thức, trú xứ của chúng sinh, v.v.
Pakārehīti nāmagottādiākārehi saddhiṃ.
Pakārehi means "together with" aspects such as name, clan, etc.
Pakārehi là “cùng với các hình thức như tên gọi, dòng họ, v.v.”.
Sahayoge cetaṃ karaṇavacanaṃ.
And this is an instrumental case of association.
Đây là cách dùng ở thể công cụ (karaṇavacana) trong ý nghĩa liên kết (sahayoga).
Pavattitanti desanāvasena pavattitaṃ.
Pavattitaṃ means "caused to occur" in the sense of a teaching.
Pavattitaṃ có nghĩa là “được trình bày” theo cách giảng dạy.
Tenāha ‘‘saṃvaṇṇita’’nti, vitthāritanti attho.
Therefore, it is said “saṃvaṇṇitaṃ” which means "elaborated upon, explained in detail."
Vì thế, đã nói “saṃvaṇṇitaṃ”, có nghĩa là “được giải thích chi tiết”.
Nivāsanti antogadhabhedasāmaññavacanametanti te bhede byāpanicchāvasena saṅgahetvā dassento ‘‘tattha tattha nivutthasantāna’’nti āha.
Nivāsaṃ is a generic term encompassing various distinctions; therefore, desiring to broadly include those distinctions, he says “tattha tattha nivutthasantānaṃ” (the continuity of lives lived here and there).
Nivāsaṃ là một từ chung chỉ sự khác biệt bao hàm bên trong. Để bao gồm và chỉ ra những khác biệt đó theo ý muốn mở rộng, đã nói “tattha tattha nivutthasantānaṃ”.
Anugantvā anugantvāti ñāṇagatiyā anugantvā anugantvā.
Anugantvā anugantvā means "following again and again" with the movement of knowledge.
Anugantvā anugantvā có nghĩa là “đi theo, đi theo” bằng sự vận hành của trí tuệ.
Anudevāti anu eva, da-kāro padasandhivasena āgato.
Anudevā is anu eva; the letter da has come for euphonic conjunction of words.
Anudevā là anu eva, âm ‘da’ xuất hiện do sự nối từ.
‘‘Abhininnāmesi’’nti vatvā ‘‘anussarāmī’’ti vuttattā cittassa abhinīhārasamanantarabhāvasaraṇaṃ anusaddo dīpetīti āha ‘‘citte abhininnāmitamatte eva sarāmīti dassetī’’ti.
Since "anussarāmī" is said after "abhininnāmesi," the prefix anu indicates the immediacy of recollection after the mind has been directed; thus, he says “it shows that I recollect immediately upon the mind being directed.”
Việc nói “abhininnāmesi” rồi nói “anussarāmī” cho thấy từ anu chỉ ra sự hồi tưởng ngay sau khi tâm được hướng đến. Vì vậy, đã nói “citte abhininnāmitamatte eva sarāmīti dasseti”.
Parikammaṃ vattabbaṃ siyāti ‘‘pubbenivāsaṃ anussaritukāmena ādikammikena bhikkhunā pacchābhattaṃ piṇḍapātapaṭikkantena rahogatena paṭisallīnena paṭipāṭiyā cattāri jhānāni samāpajjitvā abhiññāpādakacatutthajjhānato vuṭṭhāya sabbapacchimā nisajjā āvajjitabbā’’ti evamādinā pubbenivāsañāṇassa parikammabhūtaṃ pubbakaraṇaṃ vattabbaṃ bhaveyya.
Parikammaṃ vattabbaṃ siyā means that the preparatory action, which is the preliminary for pubbenivāsañāṇa, should be stated, such as: “A monk, a beginner, desiring to recollect past lives, after returning from his alms round in the afternoon, having gone to a secluded place and engaged in meditation, should enter the four jhānas in sequence, then emerge from the fourth jhāna which is the basis for higher knowledges (abhiññā), and contemplate his very last sitting.”
Parikammaṃ vattabbaṃ siyā có nghĩa là “một tỳ khưu mới tu (ādikammika) muốn hồi tưởng kiếp sống quá khứ (pubbenivāsa), sau khi thọ trai và trở về từ khất thực, nên ở nơi thanh vắng, độc cư, tuần tự nhập bốn thiền, rồi xuất khỏi thiền thứ tư là thiền cơ sở cho thắng trí (abhiññāpādakacatutthajjhāna), và quán xét tư thế ngồi cuối cùng”. Theo cách này, cần nói về sự chuẩn bị (pubbakaraṇa) là công việc sơ khởi (parikamma) của Túc Mạng Minh (pubbenivāsañāṇa).
Āraddhappakāradassanattheti anussarituṃ āraddhassa pubbenivāsassa pabhedadassanatthe.
Āraddhappakāradassanatthe means "for showing the distinctions of past lives that one has begun to recollect."
Āraddhappakāradassanatthe là để chỉ ra các loại của kiếp sống quá khứ (pubbenivāsa) đã bắt đầu được hồi tưởng.
Ekampi jātinti ekampi bhavaṃ.
Ekampi jātiṃ means "even one existence."
Ekampi jātiṃ có nghĩa là “một kiếp sống” (bhava).
So hi ekakammanibbatto ādānanikkhepaparicchinno antogadhadhammappabhedo khandhappabandho idha ‘‘jātī’’ti adhippeto jāyatīti jātīti katvā.
For that existence, being produced by a single kamma, delimited by grasping and discarding, and having internal distinctions of phenomena as a continuous series of aggregates, is here intended as “existence” (jāti) because it is that which comes into being.
Kiếp sống đó, được tạo ra bởi một nghiệp, được phân định bởi sự nắm giữ và buông bỏ, bao gồm các loại pháp bên trong, và là sự tiếp nối của các uẩn, ở đây được hiểu là “jāti” (sự sinh) vì nó là cái sinh ra.
Tenāha ‘‘ekampi…pe… khandhasantāna’’nti.
Therefore, he says “even one... (etc.)... continuity of aggregates.”
Vì thế, đã nói “ekampi…pe… khandhasantānaṃ”.
Parihāyamānoti khīyamāno vinassamāno.
Parihāyamāno means "being consumed, being destroyed."
Parihāyamāno có nghĩa là “đang tiêu hoại, đang hủy diệt”.
Kappoti asaṅkhyeyyakappo.
Kappo means "an immeasurable aeon (asaṅkhyeyyakappa)."
Kappo là “đại kiếp vô số” (asaṅkhyeyyakappa).
So pana atthato kālo, tadā pavattamānasaṅkhāravasenassa parihāni veditabbā.
And that kappo is, in essence, time, and its decline should be understood in terms of the conditioned phenomena existing at that time.
Đại kiếp đó, về ý nghĩa, là thời gian (kāla), và sự suy tàn của nó phải được hiểu theo sự vận hành của các hành (saṅkhāra) vào thời điểm đó.
Vaḍḍhamāno vivaṭṭakappoti etthāpi eseva nayo.
The same method applies here to vaḍḍhamāno vivaṭṭakappo (the expanding (developing) aeon).
Trong vaḍḍhamāno vivaṭṭakappo (đại kiếp đang tăng trưởng), cũng áp dụng nguyên tắc tương tự.
Yo pana ‘‘kālaṃ khepeti, kālo ghasati bhūtāni, sabbāneva sahattanā’’ti (jā. 1.2.190) ādīsu kālassapi khayo vuccati, so idha nādhippeto aniṭṭhappasaṅgato.
However, the destruction of time, which is spoken of in passages like “Time expends, time devours beings, all by itself,” is not intended here, due to the undesirable implication.
Tuy nhiên, sự tiêu hoại của thời gian được nói đến trong các câu như “Thời gian tiêu diệt, thời gian nuốt chửng chúng sinh, tất cả đều cùng với tự ngã” (Jā. 1.2.190), thì không được đề cập ở đây, vì điều đó sẽ dẫn đến một kết luận không mong muốn.
Saṃvaṭṭanaṃ vinassanaṃ saṃvaṭṭo, saṃvaṭṭato uddhaṃ tathāṭhāyī saṃvaṭṭaṭṭhāyī.
Saṃvaṭṭaṭṭhāyī means "staying as such" (in existence) after the contraction, which is destruction and perishing, i.e., staying after the period of contraction.
Sự hoại diệt, sự hủy diệt là saṃvaṭṭo; saṃvaṭṭaṭṭhāyī là sự tồn tại sau khi hoại diệt.
Tammūlakattāti taṃpubbakattā.
Tammūlakattā means "because it has that (contraction) as its origin" (i.e., as its precondition).
Tammūlakattā có nghĩa là “có điều đó làm tiền đề”.
Vivaṭṭanaṃ nibbattanaṃ, vaḍḍhanaṃ vā vivaṭṭo.
Vivaṭṭo means "evolution" or "development," or "increase."
Sự sinh khởi, sự phát sinh là vivaṭṭanaṃ; hoặc sự tăng trưởng là vivaṭṭo.
Tejena saṃvaṭṭo tejosaṃvaṭṭo.
Tejosaṃvaṭṭo means "contraction by fire."
Sự hoại diệt do lửa là tejosaṃvaṭṭo.
Saṃvaṭṭasīmāti saṃvaṭṭanamariyādā.
Saṃvaṭṭasīmā means "the boundary of contraction."
Saṃvaṭṭasīmā là “giới hạn của sự hoại diệt”.
Saṃvaṭṭatīti vinassati.
Saṃvaṭṭati means "it perishes."
Saṃvaṭṭatī có nghĩa là “hủy diệt”.
Sadāti sabbakālaṃ, tīsupi saṃvaṭṭakālesūti attho.
Sadā means "always," i.e., in all three periods of contraction.
Sadā có nghĩa là “luôn luôn”, tức là “trong cả ba thời kỳ hoại diệt”.
Ekaṃ buddhakkhettanti idha yaṃ sandhāya vuttaṃ, taṃ niyametvā dassetuṃ ‘‘buddhakkhettaṃ nāma tividha’’ntiādi vuttaṃ.
Ekaṃ buddhakkhettaṃ is stated here to specify what is intended; thus, “Buddhakkhettaṃ nāma tividhaṃ” (The Buddha-field is of three kinds), etc., is said.
Ekaṃ buddhakkhettaṃ (một Phật độ) – Để xác định và chỉ ra điều được nói đến ở đây, đã nói “buddhakkhettaṃ nāma tividhaṃ” (Phật độ có ba loại), v.v.
Yattake ṭhāne tathāgatassa paṭisandhiñāṇādiñāṇānubhāvo puññaphalasamuttejito saraseneva parijambhati, taṃ sabbampi buddhaṅkurassa nibbattanakkhettaṃ nāmāti āha ‘‘jātikkhettaṃ dasasahassacakkavāḷapariyanta’’nti.
In any place where the power of the Tathāgata’s knowledge, such as the knowledge of rebirth-linking, manifests spontaneously, stimulated by the fruit of merit, all of that is called the field of arising for the Buddha-seedling; therefore, it is said, “jātikkhettaṃ dasasahassacakkavāḷapariyantaṃ” (the birth-field extends to ten thousand world-systems).
Tất cả những nơi mà uy lực của trí tuệ như trí tuệ tái sinh của Đức Như Lai, được thúc đẩy bởi quả phúc, tự nhiên lan tỏa, tất cả những nơi đó được gọi là cõi sinh của vị Phật tương lai (buddhaṅkura). Vì vậy, đã nói “jātikkhettaṃ dasasahassacakkavāḷapariyantaṃ” (cõi sinh giới hạn trong mười ngàn thế giới).
Ānubhāvo pavattatīti idha iddhimā cetovasippatto āṇākkhettapariyāpanne yattha katthaci cakkavāḷe ṭhatvā attano atthāya parittaṃ katvā tattheva aññaṃ cakkavāḷaṃ gatopi kataparitto eva hotīti katvā vuttaṃ.
Ānubhāvo pavattatī (the power operates) is said here because one who is endowed with psychic power (iddhimā) and has attained mastery of mind (cetovasippatto), having performed protective chanting (paritta) for their own benefit while standing in any world-system within the sphere of influence (āṇākkhetta), even if they go to another world-system, their protective chanting still remains effective.
Ānubhāvo pavattatī (uy lực vận hành) – Ở đây, điều này được nói đến vì một vị có thần thông, đã đạt đến sự làm chủ tâm (cetovasippatta), dù ở bất cứ thế giới nào thuộc cõi quyền năng (āṇākkhetta) và đã trì tụng kinh Paritta cho lợi ích của mình, thì dù có đến một thế giới khác, kinh Paritta đã trì tụng vẫn có hiệu lực.
Atha vā tattha ekasmiṃ cakkavāḷe ṭhatvā sabbasattānaṃ atthāya paritte kate āṇākkhette sabbasattānaṃ abhisambhuṇātveva parittānubhāvo tattha devatāhi parittānaṃ sampaṭicchitabbatoti vuttaṃ ‘‘ānubhāvo pavattatī’’ti.
Or alternatively, having stayed in one world-system and made a paritta for the benefit of all beings, the power of the paritta reaches all beings within that range of influence, because the devas in that place receive the parittas. Thus it is said, "the power functions."
Hoặc giả, khi đã an trú trong một luân vũ trụ và làm lễ Paritta vì lợi ích của tất cả chúng sinh, năng lực của Paritta chắc chắn sẽ đến với tất cả chúng sinh trong vùng quyền năng (āṇākkhetta) đó, vì các vị chư thiên ở đó phải tiếp nhận các bài Paritta. Do đó đã nói ‘năng lực được vận hành’.
Yaṃ yāvatā vā pana ākaṅkheyyāti vuttanti yaṃ visayakkhettaṃ sandhāya ekasmiṃyeva khaṇe sarena abhiviññāpanaṃ attano rūpadassanañca paṭijānantena bhagavatā ‘‘yāvatā vā pana ākaṅkheyyā’’ti vuttaṃ.
What is meant by ‘as far as one may wish’ is what the Blessed One said, "as far as one may wish," referring to the range of vision where, in a single moment, He is able to make Himself known by voice and seen in His form.
Cái gì đã được nói là ‘nếu muốn đến mức nào’ là cái mà Đức Thế Tôn đã nói ‘nếu muốn đến mức nào’, khi Ngài tuyên bố có thể làm cho tiếng nói được nghe thấy và hình sắc của mình được nhìn thấy trong cùng một khoảnh khắc, nhắm đến phạm vi đối tượng nào.
Yatthāti yasmiṃ padese anantāparimāṇe visayakkhette.
‘Where’ means in which region, in the infinite and boundless realm.
Ở đâu là ở nơi nào, trong phạm vi đối tượng vô biên, vô lượng.
Yaṃ yaṃ ākaṅkhati, taṃ taṃ anussaratīti ākaṅkhamattapaṭibaddhavuttitāya buddhañāṇassa yaṃ yaṃ anussarituṃ icchati, taṃ taṃ anussarati.
‘Whatever one wishes, that one recollects’ means that due to the Buddha-knowledge's function being dependent solely on His wish, whatever He desires to recollect, that He recollects.
Muốn cái gì thì nhớ cái đó là vì trí tuệ của Đức Phật có cách vận hành ràng buộc với ý muốn, nên Ngài muốn nhớ cái gì thì nhớ cái đó.
Ekaṃ āṇākkhettaṃ vinassatīti iminā tiriyato saṃvaṭṭamānaparicchedo vutto.
By ‘one range of influence is destroyed’ is stated the limit of contraction across.
Một vùng quyền năng bị hoại diệt – với điều này, sự phân định về sự biến hoại theo chiều ngang đã được nói đến.
Saṇṭhahantanti vivaṭṭamānaṃ jāyamānaṃ.
‘While existing’ means while expanding, while arising.
Đang hình thành là đang biến chuyển, đang sinh khởi.
Tassa vināso ca saṇṭhahanañca visuddhimagge vuttanti amhehipi heṭṭhā ‘‘lokavidū’’ti imassa atthasaṃvaṇṇanādhikāre pasaṅgato vuttattā idha na vuccati.
That its destruction and its existence are stated in the Visuddhimagga is not mentioned here, as we have already stated it in passing below in the explanation of the meaning of "lokavidū".
Sự hoại diệt và sự hình thành của nó đã được nói trong Thanh Tịnh Đạo – vì chúng tôi cũng đã nói về điều này một cách ngẫu nhiên trong phần giải thích ý nghĩa của từ ‘‘lokavidū’’ (bậc thấu hiểu thế gian) ở dưới, nên không nói lại ở đây.
Evaṃ pasaṅgena saṃvaṭṭādike pakāsetvā idāni yathādhigataṃ tesaṃ anussaraṇākāraṃ dassetuṃ ‘‘ye panete saṃvaṭṭavivaṭṭā vuttā’’tiādimāha.
Having thus explained the saṃvaṭṭa and so on by way of digression, now to show the manner of their recollection as it was attained, he says: ‘‘Those saṃvaṭṭa and vivaṭṭa that have been stated’’ and so on.
Sau khi giải thích về sự biến hoại (saṃvaṭṭa) và sự hình thành (vivaṭṭa) v.v. một cách ngẫu nhiên như vậy, bây giờ để chỉ ra cách thức ghi nhớ của chúng theo những gì đã được chứng đắc, Ngài nói ‘‘Những gì đã được nói về sự biến hoại và sự hình thành này’’ v.v.
Tattha etesūti niddhāraṇe bhummaṃ saṃvaṭṭavivaṭṭakappasamudāyato anekesaṃ saṃvaṭṭakappādīnaṃ niddhāriyamānattā.
Therein, ‘in these’ is the locative case of designation, because many saṃvaṭṭa-kappas etc. are being designated from the aggregate of saṃvaṭṭa-kappas and vivaṭṭa-kappas.
Trong đó, ‘‘etesu’’ (trong những điều này) là từ chỉ định cách sở tại, vì nhiều kiếp biến hoại (saṃvaṭṭakappa) v.v. được chọn ra từ tổng thể các kiếp biến hoại và hình thành.
Amumhi saṃvaṭṭakappeti ettha vā-saddo luttaniddiṭṭho daṭṭhabbo.
In ‘in that saṃvaṭṭa-kappa’, the word vā should be understood as omitted.
Trong câu ‘‘amumhi saṃvaṭṭakappe’’ (trong kiếp biến hoại kia), từ vā phải được hiểu là bị lược bỏ.
Tena ca aniyamatthena itarāsaṃ asaṅkhyeyyānampi saṅgaho siddhoti.
And by that indeterminate meaning, the inclusion of other immeasurable kappas is also established.
Và với ý nghĩa không cố định đó, sự bao gồm cả vô số kiếp khác cũng được thành tựu.
Atha vā amumhi saṃvaṭṭakappeti idaṃ saṃvaṭṭakappassa ādito pāḷiyaṃ gahitattā vuttaṃ.
Or alternatively, ‘in that saṃvaṭṭa-kappa’ is stated because the saṃvaṭṭa-kappa is taken from the beginning in the Pāḷi.
Hoặc giả, câu ‘‘amumhi saṃvaṭṭakappe’’ này được nói vì kiếp biến hoại đã được nêu ở đầu trong bản Pāḷi.
Tatthāpi hi imassa katipayakālaṃ bhavādīsu saṃsaraṇaṃ upalabbhatīti.
Even in that, his wandering in existences and so on for a certain period of time is found.
Vì ngay cả trong đó, sự luân hồi của vị ấy trong các cõi tồn tại (bhava) v.v. trong một khoảng thời gian nhất định cũng được tìm thấy.
Saṃvaṭṭakappe vā vattamāne yesu bhavādīsu imassa upapatti ahosi, taṃdassanametaṃ daṭṭhabbaṃ.
Or it should be understood that this is a vision of the existences in which he was reborn when the saṃvaṭṭa-kappa was current.
Hoặc giả, điều này phải được hiểu là sự thấy biết về những cõi tồn tại (bhava) v.v. mà vị ấy đã tái sinh trong kiếp biến hoại đang diễn ra.
Bhave vātiādīsu kāmādibhave vā aṇḍajādiyoniyā vā devādigatiyā vā nānattakāyanānattasaññīādiviññāṇaṭṭhitiyā vā sattāvāse vā khattiyādisattanikāye vā.
In ‘or in an existence’ and so on means: or in existences such as sense-sphere existences, or in wombs such as egg-born, or in destinies such as devas, or in stations of consciousness such as diverse body and diverse perception, or in abodes of beings, or in classes of beings such as khattiyas.
Trong các câu ‘‘bhave vā’’ (hoặc trong cõi tồn tại) v.v., có nghĩa là hoặc trong các cõi dục (kāma) v.v., hoặc trong các loại sinh (yoni) như noãn sinh (aṇḍaja) v.v., hoặc trong các cảnh giới (gati) như chư thiên (deva) v.v., hoặc trong các trú xứ của thức (viññāṇaṭṭhiti) như thân khác nhau, tưởng khác nhau v.v., hoặc trong các trú xứ của chúng sinh (sattāvāsa), hoặc trong các nhóm chúng sinh như Sát-đế-lợi (khattiya) v.v.
Yasmā idaṃ bhagavato vasena pubbenivāsānussatiñāṇaṃ āgataṃ, tasmā tasseva nāmādivasena atthaṃ yojetvā dassento āha ‘‘evaṃnāmoti vessantaro vā jotipālo vā’’tiādi.
Since this knowledge of recollection of past lives came by way of the Blessed One, he explains its meaning by way of name and clan and so on, saying: ‘‘with such a name, or Vessantara, or Jotipaḷa’’ and so on.
Vì trí tuệ nhớ các đời quá khứ (pubbenivāsānussatiñāṇa) này được nói đến theo Đức Thế Tôn, nên để chỉ ra ý nghĩa bằng cách kết hợp với tên gọi v.v. của Ngài, Ngài nói ‘‘có tên như vậy, là Vessantara hoặc Jotipāla’’ v.v.
Sālimaṃsodanāhāro vāti gihikālaṃ sandhāya vuttaṃ.
‘Or one who eats rice, meat, and broth’ is said with reference to the time as a householder.
Hoặc là người ăn cơm gạo và thịt được nói đến để chỉ thời kỳ tại gia.
Pavattaphalabhojano vāti tāpasādikālaṃ sandhāya.
‘Or one who eats fallen fruits’ refers to the time as an ascetic and so on.
Hoặc là người ăn trái cây tự rụng được nói đến để chỉ thời kỳ tu sĩ khổ hạnh v.v.
Pavattaphalabhojanoti sayampatitaphalāhāro.
‘One who eats fallen fruits’ means one whose food is fruits that have fallen by themselves.
Người ăn trái cây tự rụng là người ăn những trái cây tự rơi xuống.
Sāmisanirāmisādippabhedānanti ettha sāmisā gehassitasomanassādayo, nirāmisā nekkhammassitasomanassādayo.
In ‘of the divisions such as material and immaterial’, sāmisa means pleasures associated with household life and so on, nirāmisa means pleasures associated with renunciation and so on.
Trong câu ‘‘sāmisanirāmisādippabhedānaṃ’’ (các loại có vị dục và không vị dục v.v.), sāmisa là những sự hoan hỷ (somanassa) gắn liền với gia đình v.v., nirāmisa là những sự hoan hỷ gắn liền với sự xuất ly (nekkhamma) v.v.
Ādi-saddena vivekajasamādhijasukhādīnaṃ saṅgaho.
By the word ‘ādi’ (and so on) is included happiness arising from seclusion, happiness arising from concentration, and so on.
Với từ ādi, sự bao gồm các loại hạnh phúc (sukha) phát sinh từ sự viễn ly (viveka), phát sinh từ thiền định (samādhi) v.v. được thực hiện.
Heṭṭhā sāmaññato vuttamevatthaṃ vibhajitvā dassetukāmo ‘‘atha vā’’tiādimāha.
Wishing to explain in detail the meaning already stated in general below, he says ‘‘Or alternatively’’ and so on.
Muốn giải thích ý nghĩa đã được nói chung ở dưới bằng cách phân loại, Ngài nói ‘‘Hoặc giả’’ v.v.
Tattha amutrāsinti sāmaññaniddesoyaṃ, byāpanicchālopo vā, amutra amutra āsinti vuttaṃ hoti.
Therein, ‘I was there’ is a general designation, or it is an elision of spreading; it means, ‘I was in this place and that place’.
Trong đó, ‘‘amutrāsiṃ’’ là một sự chỉ định chung, hoặc là sự lược bỏ của ‘‘byāpanicchālopo’’, có nghĩa là đã từng ở nơi này, nơi kia.
Anupubbena ārohantassa yāvadicchakaṃ anussaraṇanti ettha ārohantassāti paṭilomato ñāṇena pubbenivāsaṃ ārohantassa.
In ‘recollection as much as desired, ascending in sequence’, ‘ascending’ means ascending to past existences with knowledge, in reverse order.
Trong câu ‘‘anupubbena ārohantassa yāvadicchakaṃ anussaraṇaṃ’’ (sự ghi nhớ tùy ý của người đang tiến lên theo thứ tự), ‘‘ārohantassa’’ là của người đang tiến lên các đời quá khứ (pubbenivāsa) bằng trí tuệ theo chiều ngược lại.
Paṭinivattantassāti pubbenivāsaṃ anussaraṇavasena yāvadicchakaṃ gantvā paccāgacchantassa.
‘Returning’ means having gone as far as desired by way of recollecting past lives, and then returning.
Của người đang quay trở lại là của người đã đi xa tùy ý theo cách ghi nhớ các đời quá khứ và đang quay trở lại.
Paccavekkhaṇanti anussaritānussaritassa paccavekkhaṇaṃ.
‘Review’ means the review of what has been recollected again and again.
Sự quán xét là sự quán xét những gì đã được ghi nhớ và ghi nhớ lại.
Tasmāti vuttassevatthassa kāraṇabhāvena paccāmasanaṃ, paṭinivattantassa paccavekkhaṇabhāvatoti vuttaṃ hoti.
‘Therefore’ refers back to the meaning already stated as the cause; it means that it is because it is the review of one who is returning.
Do đó là sự xem xét lại ý nghĩa đã được nói như là nguyên nhân, có nghĩa là vì là sự quán xét của người đang quay trở lại.
Idhūpapattiyāti idha carimabhave upapattiyā.
‘By rebirth here’ means by rebirth in this last existence.
Sự tái sinh ở đây là sự tái sinh trong kiếp cuối cùng này.
Anantaranti atītānantaramāha.
‘Immediately’ refers to the immediate past.
Ngay sau đó là nói về quá khứ liền kề.
Amutrāti amukasmiṃ bhaveti attho.
‘There’ means in that existence.
Ở kia có nghĩa là ở kiếp đó.
Udapādinti uppajjiṃ.
‘Arose’ means I was born.
Đã sinh khởi là đã sinh ra.
Tāhi devatāhīti tusitadevatāhi.
‘By those devas’ means by the Tusita devas.
Bởi các vị chư thiên đó là bởi các vị chư thiên Tusita.
Ekagottoti tusitagottena ekagotto.
‘Of the same clan’ means of the same clan as the Tusita devas.
Cùng dòng họ là cùng dòng họ với dòng họ Tusita.
Mahābodhisattānaṃ santānassa pariyosānāvatthāyaṃ devalokūpapattijanakaṃ nāma akusalena kammunā anupaddutameva hotīti adhippāyena ‘‘dukkhaṃ pana saṅkhāradukkhamattamevā’’ti vuttaṃ.
It is said ‘‘but suffering is merely the suffering of conditioned phenomena’’ with the intention that for great Bodhisattas, the rebirth-generating kamma in the deva realm at the final stage of their lineage is not afflicted by unwholesome kamma.
Với ý nghĩa rằng sự tái sinh vào cõi trời trong giai đoạn cuối cùng của dòng tâm thức của các vị Đại Bồ-tát không bao giờ bị nghiệp bất thiện quấy nhiễu, nên đã nói ‘‘nhưng khổ chỉ là khổ hành (saṅkhāradukkha) mà thôi’’.
Mahāpuññānampi pana devaputtānaṃ pubbanimittuppattikālādīsu aniṭṭhārammaṇasamāyogo hotiyevāti ‘‘kadāci dukkhadukkhassapi sambhavo natthī’’ti na sakkā vattuṃ, dhammānaṃ uppādanirodhasaṅkhāradukkhanti veditabbaṃ.
However, even for devaputtas of great merit, an encounter with unpleasant objects occurs at the time of the arising of पूर्व-निमित्तs and so on, so it cannot be said, "there is no possibility of even duḥkhadukkha (painful suffering) at times"; it should be understood that the suffering of conditioned phenomena refers to the arising and cessation of phenomena.
Tuy nhiên, ngay cả các vị thiên tử có phước báu lớn cũng có sự kết hợp với những đối tượng không mong muốn trong thời điểm xuất hiện các điềm báo trước v.v., nên không thể nói rằng ‘‘đôi khi không có cả khổ khổ (dukkhadukkha)’’, mà phải hiểu là sự sinh diệt của các pháp là khổ hành.
Sattapaññāsa…pe… pariyantoti idaṃ manussavassagaṇanāvasena vuttaṃ.
‘Fifty-seven… and so on… limit’ is stated according to the reckoning of human years.
Năm mươi bảy… v.v… là giới hạn – điều này được nói theo số năm của loài người.
Tattha devānaṃ vassagaṇanāya pana catusahassameva.
However, according to the reckoning of deva years, it is only four thousand.
Trong đó, theo số năm của chư thiên thì chỉ có bốn ngàn năm.
Itīti vuttatthanidassanametaṃ, tañca kho yathārahato, na yathānupubbatoti dassento ‘‘nāmagottavasenā’’tiādimāha.
‘Thus’ is an indication of the meaning stated, and to show that it is according to what is fitting, not in sequential order, he says ‘‘by way of name and clan’’ and so on.
Như vậy là sự chỉ rõ ý nghĩa đã được nói, và để chỉ ra rằng điều đó phù hợp chứ không phải theo thứ tự, Ngài nói ‘‘theo tên gọi và dòng họ’’ v.v.
Uddisīyatīti disvāva aviññeyyattā ‘‘ayaṃ ko nāmo’’ti pucchite ‘‘tisso gotamo’’ti nāmagottena uddisīyati.
‘Is pointed out’ means, since it cannot be known merely by seeing, when asked, "What is his name?", he is pointed out by name and clan, saying, "This is Tissa Gotama."
Được chỉ ra là vì không thể biết được chỉ bằng cách nhìn, nên khi được hỏi ‘‘Người này tên gì?’’, thì được chỉ ra bằng tên gọi và dòng họ là ‘‘người này tên Tissa, người này dòng Gotama’’.
Vaṇṇādīhīti vaṇṇāhāravedayitāyuparicchedehi.
‘By appearance and so on’ means by color, food, feeling, and limit of life-span.
Bằng sắc thái v.v. là bằng sắc thái, thức ăn, cảm thọ và giới hạn tuổi thọ.
Sāmotīti ettha iti-saddo ādiattho, pakārattho vā.
In ‘such’, the word ‘iti’ means ‘beginning’ or ‘kind’.
Trong câu ‘‘sāmoti’’, từ iti có ý nghĩa là ‘‘v.v.’’ hoặc là ‘‘loại’’.
Tena evamādievaṃpakāranānattatoti dassitaṃ hoti.
Thereby it is shown that there are such and such kinds of diversity.
Với điều đó, đã chỉ ra rằng có sự khác biệt về loại và kiểu như vậy.
Nāmagottaṃ uddesoti uddisīyati satto etenāti uddeso nāmagottaṃ.
‘Name and clan are a designation’ means that by which a being is pointed out is a designation, namely name and clan.
Tên gọi và dòng họ là sự chỉ định là tên gọi và dòng họ là sự chỉ định, vì chúng sinh được chỉ ra bằng chúng.
Itare ākārāti ākarīyati disvāva satto viññāyati etehīti itare vaṇṇādayo ākārā.
‘The other characteristics’ means that by which a being is known merely by seeing are the other characteristics such as appearance and so on.
Các đặc điểm khác là các đặc điểm khác như sắc thái v.v., vì chúng sinh được nhận biết chỉ bằng cách nhìn thấy chúng.
‘‘No ca kho avisesenā’’ti saṅkhepato vuttamevatthaṃ vitthārena dassento āha ‘‘titthiyā hī’’tiādi.
To explain in detail the meaning briefly stated in ‘‘but not indiscriminately’’, he says ‘‘for the sectarians’’ and so on.
Để giải thích chi tiết ý nghĩa đã được nói tóm tắt là ‘‘nhưng không phải một cách không phân biệt’’, Ngài nói ‘‘Vì các ngoại đạo’’ v.v.
Tattha titthiyāti aññatitthiyā.
Therein, ‘sectarians’ means other sectarians.
Trong đó, các ngoại đạo là các ngoại đạo khác.
Te pana kammavādino kiriyavādino tāpasādayo.
These are the Kamma-vādins, Kiriya-vādins, ascetics, and so on.
Những người đó là các đạo sĩ khổ hạnh v.v. tin vào nghiệp (kammavādī) và hành động (kiriyavādī).
Yasmā titthiyānaṃ brahmajālādīsu cattālīsāya eva saṃvaṭṭavivaṭṭānaṃ anussaraṇaṃ āgataṃ, tasmā ‘‘na tato para’’nti vatvā tattha kāraṇaṃ vadanto ‘‘dubbalapaññattā’’tiādimāha.
Since in the Brahmajāla Sutta and so on, the sectarians' recollection of saṃvaṭṭa and vivaṭṭa extends only to forty kappas, having said ‘‘not beyond that’’, he states the reason for it, saying ‘‘due to weak wisdom’’ and so on.
Vì trong các kinh như Brahmajāla v.v., sự ghi nhớ về bốn mươi kiếp biến hoại và hình thành của các ngoại đạo đã được nói đến, nên sau khi nói ‘‘không hơn thế nữa’’, để nói về nguyên nhân của điều đó, Ngài nói ‘‘vì trí tuệ yếu kém’’ v.v.
Tena vipassanābhiyogo pubbenivāsānussatiñāṇassa visesakāraṇanti dasseti.
Thereby he shows that the application of vipassanā is a special cause for the knowledge of recollection of past lives.
Với điều đó, Ngài chỉ ra rằng sự tinh tấn tu tập thiền quán (vipassanābhiyogo) là nguyên nhân đặc biệt của trí tuệ nhớ các đời quá khứ (pubbenivāsānussatiñāṇa).
Tatoyeva ca balavapaññattā ṭhapetvā aggasāvakamahāsāvake itare pakatisāvakā kappasatampi kappasahassampi anussarantiyevāti daṭṭhabbaṃ.
And for that very reason, it should be understood that ordinary disciples, excluding the chief disciples and great disciples, recollect for even a hundred kappas or a thousand kappas, due to their strong wisdom.
Và cũng từ đó, phải hiểu rằng vì trí tuệ mạnh mẽ, các vị Thanh văn thông thường (pakatisāvaka) – trừ các vị Đại Thanh văn và Thượng thủ Thanh văn – cũng ghi nhớ được một trăm kiếp hoặc một ngàn kiếp.
Teneva vuttaṃ visuddhimagge (visuddhi. 2.402) ‘‘pakatisāvakā kappasatampi kappasahassampi anussarantiyeva balavapaññattā’’ti.
Thus it is said in the Visuddhimagga: ‘‘Ordinary disciples recollect for even a hundred kappas or a thousand kappas due to their strong wisdom.’’
Chính vì vậy, trong Thanh Tịnh Đạo đã nói (Thanh Tịnh Đạo 2.402) ‘‘Các vị Thanh văn thông thường ghi nhớ được một trăm kiếp hoặc một ngàn kiếp vì trí tuệ mạnh mẽ’’.
Ettako hi tesaṃ abhinīhāroti kappānaṃ satasahassampi tadadhikaṃ ekaṃ dve ca asaṅkhyeyyānīti kālavasena evaṃparimāṇo yathākkamaṃ tesaṃ mahāsāvakaaggasāvakapaccekabuddhānaṃ puññañāṇābhinīhāro, sāvakapaccekabodhipāramitā siddhā.
‘For such is their aspiration’ means that by way of time, their aspiration for merit and knowledge for great disciples, chief disciples, and Paccekabuddhas, respectively, is thus limited: a hundred thousand kappas, or one or two asaṅkheyyas more than that; the perfections for a disciple-bodhi and Paccekabodhi are thus accomplished.
Sự phát nguyện của họ là như vậy là sự tích lũy phước báu và trí tuệ của các vị Đại Thanh văn, Thượng thủ Thanh văn và Độc Giác Phật theo thứ tự là một trăm ngàn kiếp, hoặc hơn thế nữa là một hoặc hai A-tăng-kỳ (asaṅkhyeyya) kiếp, theo thời gian, như vậy là giới hạn; các Ba-la-mật (pāramitā) của Thanh văn và Độc Giác Phật đã được thành tựu.
Yadi bodhisambhārasambharaṇakālaparicchinno tesaṃ tesaṃ ariyānaṃ abhiññāñāṇavibhavo, evaṃ sante buddhānampissa paricchedatā āpannāti āha ‘‘buddhānaṃ pana paricchedo natthī’’ti.
If the potency of the supernormal knowledge of those various noble ones is limited by the period of accumulating the requisites for awakening, then in that case, a limitation would be incurred for the Buddhas as well. Therefore, he said, “But for the Buddhas, there is no limitation.”
Nếu sự phát triển của các thắng trí (abhiññā-ñāṇa) của các bậc Thánh đó bị giới hạn bởi thời gian tích lũy các Ba-la-mật của Bồ-tát, thì khi đó, ngay cả trí tuệ toàn tri của chư Phật cũng sẽ bị giới hạn. Do đó, lời dạy là: “Nhưng chư Phật thì không có sự giới hạn.”
‘‘Yāvatakaṃ ñeyyaṃ, tāvatakaṃ ñāṇa’’nti (paṭi. ma. 3.5) vacanato sabbaññutaññāṇassa viya buddhānaṃ abhiññāñāṇānampi savisaye paricchedo nāma natthīti tattha yaṃ yaṃ ñātuṃ icchanti, taṃ taṃ jānanti eva.
Because of the saying, “As much as is knowable, so much is the knowledge,” just like for the All-Knowing Knowledge, for the abhiññā-knowledges of the Buddhas too there is no limitation in their respective domains; therefore, whatever they wish to know, that they certainly know.
Theo câu nói: “Trí tuệ bao nhiêu thì đối tượng biết được cũng bấy nhiêu” (Paṭisambhidāmagga 3.5), cũng như trí Tuệ Toàn Tri (sabbaññutaññāṇa), các thắng trí (abhiññā-ñāṇa) của chư Phật cũng không có sự giới hạn trong phạm vi đối tượng của chúng. Do đó, bất cứ điều gì chư Phật muốn biết, chư Phật đều biết.
Atha vā satipi kālaparicchede kāraṇūpāyakosallapariggahādinā sātisayattā mahābodhisambhārānaṃ paññāpāramitāya pavattiānubhāvassa paricchedo nāma natthi, kuto taṃnibbattānaṃ abhiññāñāṇānanti āha ‘‘buddhānaṃ pana paricchedo natthī’’ti.
Alternatively, even if there is a limitation of time, because the great requisites for Awakening are exceptional due to skill in causes and means, acquisition, and so on, there is no limitation to the power of the perfection of wisdom in its operation; how could there be a limitation for the abhiññā-knowledges produced from it? Thus, it is said: “But for the Buddhas, there is no limitation.”
Hoặc, dù có sự giới hạn về thời gian, nhưng do sự siêu việt về thiện xảo trong phương tiện và các yếu tố khác của sự tích lũy Ba-la-mật lớn lao, nên không có sự giới hạn nào đối với uy lực phát sinh từ Ba-la-mật Trí tuệ (paññāpāramitā). Huống hồ gì các thắng trí (abhiññā-ñāṇa) được sinh ra từ đó. Do đó, lời dạy là: “Nhưng chư Phật thì không có sự giới hạn.”
Atīte ‘‘ettakānaṃ kappānaṃ asaṅkhyeyyānī’’ti evaṃ kālaparicchedo natthi anāgate anāgataṃsañāṇassa viya.
In the past, there is no time limitation such as “so many incalculable periods of eons,” just as for the knowledge of the future in the future.
Trong quá khứ, không có sự giới hạn thời gian như “vô số kiếp như thế này”. Trong tương lai cũng không có sự giới hạn như trí tuệ về tương lai (anāgataṃsañāṇa).
Tenāha ‘‘yāva icchanti tāva sarantī’’ti.
Therefore, he said, “For as long as they wish, so long do they recollect.”
Do đó, lời dạy là: “Họ nhớ lại bao nhiêu tùy ý muốn.”
Evaṃ pañcannaṃ janānaṃ pubbenivāsānussaraṇaṃ kālavibhāgato dassetvā idāni ārammaṇaggahaṇavasenassa pavattivisesaṃ dassento ‘‘titthiyā cā’’tiādimāha.
Having thus shown the recollection of former existences of the five kinds of persons according to the division of time, he now says “Heretics also…” and so on, to show the specific way it occurs by way of grasping the object.
Sau khi trình bày sự hồi tưởng các đời quá khứ của năm hạng người theo sự phân chia thời gian như vậy, bây giờ, để trình bày sự đặc biệt trong cách thức hoạt động của trí tuệ đó theo sự nắm bắt đối tượng, lời dạy bắt đầu bằng “Và các ngoại đạo”.
Khandhapaṭipāṭimeva sarantīti ettha khandhapaṭipāṭi khandhānaṃ anukkamo, sā ca kho cutito paṭṭhāya uppaṭipāṭivasena.
Here in “they recollect only the sequence of the aggregates,” the sequence of the aggregates is the order of the aggregates, and that is by way of reverse order, starting from the death-moment.
Trong câu “Họ chỉ nhớ theo thứ tự các uẩn”, thứ tự các uẩn (khandhapaṭipāṭi) là sự tuần tự của các uẩn, và sự tuần tự đó là theo chiều ngược lại, bắt đầu từ sự chết (cuti).
Keci panettha ‘‘iriyāpathapaṭipāṭi khandhapaṭipāṭī’’ti vadanti.
Some here say, “The sequence of postures is the sequence of aggregates.”
Một số người ở đây nói rằng: “Thứ tự các oai nghi là thứ tự các uẩn.”
Vuttamevatthaṃ byatirekato vibhāvento āha ‘‘paṭipāṭiṃ muñcitvā’’tiādi.
Clarifying this same point from a negative perspective, he says “Having let go of the sequence…” and so on.
Để làm rõ nghĩa đã nói bằng cách phủ định, lời dạy nói: “buông bỏ thứ tự” và tiếp theo.
Tattha cutipaṭisandhivasenāti attano parassa vā tasmiṃ tasmiṃ attabhāve cutiṃ disvā antarā kiñci anāmasitvā paṭisandhiyā eva gahaṇavasena.
Therein, by way of the death-moment and the linking-consciousness means: by way of seeing one’s own or another’s death-moment in a particular existence, and without considering anything in between, grasping only the linking-consciousness.
Trong đó, “theo cách thức chết và tái sanh” có nghĩa là theo cách thức nắm bắt sự tái sanh sau khi thấy sự chết trong kiếp sống này của chính mình hoặc của người khác, mà không chạm vào bất cứ điều gì ở giữa.
Yathā pana andhā yaṭṭhiṃ amuñcitvā gacchanti, evaṃ te khandhapaṭipāṭiṃ amuñcitvāva sarantīti āha ‘‘tesañhi andhānaṃ viya icchitappadesokkamanaṃ natthī’’ti.
Just as the blind walk without letting go of their staff, so too they recollect without letting go of the sequence of the aggregates. Thus, he says, “For them, like for the blind, there is no leaping to a desired place.”
Và cũng như những người mù đi mà không buông gậy, họ nhớ lại mà không buông bỏ thứ tự các uẩn. Do đó, lời dạy là: “Vì những người đó, giống như người mù, không thể đi đến nơi mình muốn.”
Sāvakāti pakatisāvakāpi mahāsāvakāpi aggasāvakāpi sāmaññato vuttā.
Disciples is said generally for ordinary disciples, great disciples, and chief disciples.
Các đệ tử (sāvakā) được nói chung bao gồm các đệ tử thông thường (pakatisāvaka), các đại đệ tử (mahāsāvaka) và các đệ tử tối thượng (aggasāvaka).
Pakatisāvakāpi hi khandhapaṭipāṭiyāpi anussaranti, cutipaṭisandhivasenapi saṅkamanti balavapaññattā, tathā asītimahāsāvakā.
For even ordinary disciples recollect both by the sequence of the aggregates and move on by way of the death-moment and the linking-consciousness, because their wisdom is strong; so too the eighty great disciples.
Các đệ tử thông thường cũng nhớ theo thứ tự các uẩn, và họ cũng chuyển dịch theo cách thức chết và tái sanh vì có trí tuệ mạnh mẽ. Tám mươi vị đại đệ tử cũng vậy.
Dvinnaṃ pana aggasāvakānaṃ khandhapaṭipāṭikiccaṃ natthi.
But for the two chief disciples, there is no need for the sequence of the aggregates.
Nhưng đối với hai vị đệ tử tối thượng thì không có việc nhớ theo thứ tự các uẩn.
Ekassa attabhāvassa cutiṃ disvā paṭisandhiṃ passanti, puna aparassa cutiṃ disvā paṭisandhinti evaṃ cutipaṭisandhivasenapi saṅkamantā gacchanti.
Seeing the death-moment of one existence, they see the linking-consciousness; again, seeing the death-moment of another, they see the linking-consciousness. Thus, they proceed, moving on by way of the death-moment and the linking-consciousness.
Họ thấy sự chết của một kiếp sống, rồi thấy sự tái sanh; rồi lại thấy sự chết của một kiếp sống khác, rồi thấy sự tái sanh. Cứ như vậy, họ chuyển dịch và đi theo cách thức chết và tái sanh.
Yathā nāma saradasamaye ṭhitamajjhanhikavelāyaṃ caturatanike gehe cakkhumato purisassa rūpagataṃ supākaṭameva hotīti lokasiddhametaṃ.
It is well-established in the world that just as, in the autumn season at midday, a visible form in a four-cornered house is exceedingly clear to a person with sight.
Ví dụ, điều này nổi tiếng trong thế gian rằng vào mùa thu, giữa buổi trưa, trong một ngôi nhà bốn góc, một người có mắt nhìn thấy mọi vật rất rõ ràng.
Siyā pana tassa sukhumataratirokuṭṭādibhedassa rūpagatassa agocaratā, na tveva buddhānaṃ ñātuṃ icchitassa ñeyyassa agocaratā, atha kho taṃ ñāṇālokena obhāsitaṃ hatthatale āmalakaṃ viya supākaṭaṃ suvibhūtameva hoti, tathā ñeyyāvaraṇassa suppahīnattāti āha ‘‘buddhā panā’’tiādi.
However, for that person, a visible form that is very subtle, behind a wall, and so on, may be out of range, but for the Buddhas, a knowable thing they wish to know is never out of range. Rather, illuminated by the light of knowledge, it becomes as exceedingly clear and distinct as a myrobalan fruit on the palm of the hand, because the obstruction to the knowable has been completely abandoned. Thus, he says “But the Buddhas…” and so on.
Có thể có những hình sắc vi tế hơn bị che khuất bởi tường vách, v.v., mà người đó không thể thấy được. Nhưng đối với chư Phật, không có đối tượng nào mà chư Phật muốn biết lại không thấy được. Ngược lại, đối tượng đó được trí tuệ chiếu sáng, trở nên rất rõ ràng và hiển lộ, giống như quả xoài trên lòng bàn tay. Tương tự, vì sự che chướng của đối tượng biết được đã được loại bỏ hoàn toàn, do đó lời dạy là: “Nhưng chư Phật thì…” và tiếp theo.
Tattha sīhokkantavasenāti sīhagatipatanavasena.
Therein, by way of the lion’s leap means by way of the lion’s gait and pounce.
Trong đó, “theo cách thức của sư tử nhảy vọt” có nghĩa là theo cách thức của bước chân sư tử.
Yaṃ yaṃ ṭhānaṃ ākaṅkhantīti yasmiṃ kappe yasmiṃ bhave yaṃ yaṃ ṭhānaṃ jānituṃ icchanti.
Whatever place they desire means whichever eon, whichever existence, whichever place they wish to know.
“Bất cứ nơi nào họ muốn” có nghĩa là bất cứ nơi nào, trong kiếp nào, trong đời nào, họ muốn biết.
Taṃ sabbaṃ sarantiyevāti ñātuṃ icchitaṃ taṃ sabbaṃ sarantiyeva, na na saranti.
They recollect all of that means they recollect all that they wish to know; it is not that they do not recollect.
“Họ nhớ lại tất cả những điều đó” có nghĩa là họ nhớ lại tất cả những điều họ muốn biết, chứ không phải là không nhớ.
Buddhānañhi neva khandhapaṭipāṭikiccaṃ, na ca cutipaṭisandhivasena saṅkamanakiccaṃ atthi.
For the Buddhas, there is neither the need for the sequence of the aggregates nor the need to move on by way of the death-moment and the linking-consciousness.
Đối với chư Phật, không có việc nhớ theo thứ tự các uẩn, cũng không có việc chuyển dịch theo cách thức chết và tái sanh.
Tesañhi anekāsu kappakoṭīsu heṭṭhā vā upari vā yaṃ yaṃ ṭhānaṃ icchanti, taṃ taṃ pākaṭameva hoti.
For them, whatever place they wish, whether below or above, across many crores of eons, becomes manifest.
Đối với chư Phật, bất cứ nơi nào họ muốn trong vô số kiếp, dù ở dưới hay ở trên, nơi đó đều hiển lộ rõ ràng.
Tasmā yathā peyyālapāḷiṃ paṭhantā ‘‘paṭhamaṃ jhānaṃ…pe… pañcamaṃ jhāna’’ntiādipariyosānameva gaṇhantā saṅkhipitvā sajjhāyanti, na anupadaṃ, evaṃ anekāpi kappakoṭiyo peyyālapāḷiṃ viya saṅkhipitvā yaṃ yaṃ icchanti, tattha tattheva ñāṇena okkamantā sīhokkantavasena gacchanti.
Therefore, just as those who recite a text with omissions take only the beginning and the end, such as “the first jhāna…pe…the fifth jhāna,” and recite it in brief, not word by word, so too, abbreviating even many crores of eons like a text with omissions, they proceed by way of the lion’s leap, their knowledge descending upon whatever place they wish.
Do đó, cũng như những người đọc bài kệ peyyāla (rút gọn) chỉ nắm bắt phần đầu và phần cuối như “thiền thứ nhất…pe…thiền thứ năm”, họ đọc rút gọn chứ không đọc từng từ. Tương tự, chư Phật cũng rút gọn vô số kiếp như bài kệ peyyāla, và bất cứ nơi nào họ muốn, họ đều nhập vào đó bằng trí tuệ, đi theo cách thức của sư tử nhảy vọt.
Evaṃ gacchantānañca tesaṃ ñāṇaṃ yathā nāma katavālavedhiparicayassa sarabhaṅgasadisassa dhanuggahassa khitto saro antarantarā rukkhalatādīsu asajjamāno lakkheyeva patati na sajjati na virajjhati, evaṃ antarantarāsu jātīsu na sajjati na virajjhati, asajjamānaṃ avirajjhamānaṃ icchiticchitaṭṭhānaṃyeva gaṇhāti.
And as they proceed thus, their knowledge, just as an arrow shot by an archer like Sarabhaṅga, who is practiced in piercing a hair, does not get stuck on trees, vines, and so on in between, but falls only on the target—it does not get stuck, it does not miss—so too, it does not get stuck, it does not miss among the intervening births; not getting stuck, not missing, it grasps only the very place that is desired.
Và trí tuệ của những vị đi như vậy, giống như mũi tên của một cung thủ thiện xạ, thành thạo việc bắn xuyên qua sợi lông, giống như Sarabhaṅga, mũi tên đã bắn không bị vướng vào cây cối, dây leo, v.v., ở giữa, mà chỉ rơi trúng mục tiêu, không bị mắc kẹt, không bị lệch. Tương tự, trong các kiếp sống ở giữa, trí tuệ không bị mắc kẹt, không bị lệch, mà chỉ nắm bắt được nơi mong muốn.
Atītabhave khandhā tappaṭibaddhanāmagottāni ca sabbaṃ pubbenivāsantveva saṅgahitānīti āha ‘‘kiṃ viditaṃ karoti?
In past existences, the aggregates and the names and clans connected with them are all included under “former existences.” Therefore, he said, “What does it make known? Former existences.”
Trong các kiếp quá khứ, các uẩn và danh tánh liên quan đến chúng đều được bao gồm trong sự hồi tưởng các đời quá khứ (pubbenivāsa).
Pubbenivāsa’’nti.
is 'recollection of past lives'.
Do đó, lời dạy là: “Nó làm cho điều gì được biết? Sự hồi tưởng các đời quá khứ.”
Moho paṭicchādakaṭṭhena tamo viya tamoti āha ‘‘sveva moho’’tiādi.
Ignorance, in the sense of concealing, is like darkness; thus, he said, “That itself is darkness…” and so on.
Sự si mê (moha) giống như bóng tối (tamo) vì nó có tính chất che đậy. Do đó, lời dạy là: “Chính sự si mê đó” và tiếp theo.
Obhāsakaraṇaṭṭhenāti kātabbato karaṇaṃ, obhāsova karaṇaṃ obhāsakaraṇaṃ, attano paccayehi obhāsabhāvena nibbattetabbaṭṭhenāti attho.
In the sense of making light means: making is the action to be done; the making of light is making light. The meaning is: in the sense of having to be produced in the state of light by its own conditions.
“Vì tính chất tạo ra ánh sáng” có nghĩa là sự tạo ra là việc làm, ánh sáng chính là việc làm, việc tạo ra ánh sáng, nghĩa là vì tính chất được tạo ra dưới dạng ánh sáng bởi các điều kiện của chính nó.
Sesaṃ pasaṃsāvacananti paṭipakkhavidhamanapavattivisesānaṃ bodhanato vuttaṃ.
The rest is a statement of praise, spoken because it signifies the particular ways of acting that destroy the opposite.
“Phần còn lại là lời khen ngợi” được nói để chỉ ra các đặc điểm hoạt động đặc biệt của việc tiêu diệt đối thủ.
Avijjā vihatāti etena vijānanaṭṭhena vijjāti ayampi attho dīpitoti daṭṭhabbaṃ.
By “ignorance is dispelled,” it should be understood that this meaning is also shown: that which knows is knowledge, in the sense of knowing.
“Vô minh đã bị diệt trừ” – qua điều này, ý nghĩa rằng “minh (vijjā) là sự hiểu biết” cũng được làm rõ. Điều này nên được hiểu như vậy.
Yasmā vijjā uppannāti etena vijjāpaṭipakkhā avijjā, paṭipakkhatā cassā pahātabbabhāvena vijjāya ca pahāyakabhāvenāti dasseti.
Because knowledge has arisen.” By this, he shows that ignorance is the opposite of knowledge, and its opposition is in the sense that it is to be abandoned, and knowledge is in the sense of that which abandons.
Vì minh đã sanh khởi – qua điều này, lời dạy chỉ ra rằng vô minh là đối nghịch của minh, và sự đối nghịch này là do vô minh cần phải được đoạn trừ và minh có tính chất đoạn trừ.
Esa nayo itarasmimpi padadvayeti iminā tamo vihato vinaṭṭho.
This is the method in the other pair of words as well. By this, he indicates the meaning: darkness is dispelled, destroyed.
“Nguyên tắc này cũng áp dụng cho hai từ còn lại” – qua điều này, lời dạy mở rộng ý nghĩa rằng bóng tối đã bị diệt trừ, đã bị phá hủy.
Yasmā āloko uppannoti imamatthaṃ atidisati.
Because light has arisen.
Vì ánh sáng đã sanh khởi. Lời dạy này mở rộng ý nghĩa đó.
Kilesānaṃ ātāpanaparitāpanaṭṭhena vīriyaṃ ātāpoti āha ‘‘vīriyātāpena ātāpino’’ti, vīriyavatoti attho.
Energy, in the sense of heating and scorching the defilements, is ardor; thus, he said, “ardent with the ardor of energy,” meaning, endowed with energy.
Sự tinh tấn (vīriya) là sự nhiệt tâm (ātāpa) vì nó có tính chất đốt cháy và làm khổ các phiền não (kilesa). Do đó, lời dạy là: “nhiệt tâm với sự tinh tấn”, nghĩa là có sự tinh tấn.
Pesitacittassāti yathādhippetatthasiddhiṃ pativissaṭṭhacittassa.
Of one with a dispatched mind means of one whose mind is released towards the accomplishment of the desired goal.
“Với tâm đã được hướng đến” có nghĩa là với tâm đã được giải thoát để đạt được mục đích mong muốn.
Yathā appamattassa ātāpino pahitattassa viharatoti aññassapi kassaci mādisassāti adhippāyo.
As he dwells diligent, ardent, with a resolved self, means for any other person like myself; that is the intention.
“Như một người không phóng dật, nhiệt tâm, với tâm đã được hướng đến, đang an trú” – ý nghĩa là đối với bất kỳ ai khác giống như tôi.
Padhānānuyogassāti sammappadhānamanuyuttassa.
Of one devoted to the endeavor means of one engaged in the right endeavors.
“Của người chuyên cần tinh tấn” có nghĩa là của người chuyên cần thực hành chánh tinh tấn (sammappadhāna).
Sesamettha uttānattā vuttanayattā ca suviññeyyameva.
The rest here is easily understood because it is plain and follows the method already explained.
Phần còn lại ở đây rất dễ hiểu vì nó rõ ràng và đã được trình bày theo cách tương tự.
13. Cutiyāti cavane.
13. Of the passing away means at the moment of ceasing.
13. “Cái chết” (Cutiyā) có nghĩa là trong lúc chết.
Upapāteti upapajjane.
In the reappearing means at the moment of being reborn.
“Sự tái sanh” (Upapāte) có nghĩa là trong lúc tái sanh.
Samīpatthe cetaṃ bhummavacanaṃ, cutikkhaṇasāmantā upapattikkhaṇasāmantā cāti vuttaṃ hoti.
And this is a locative expression in the sense of proximity; it means near the moment of death and near the moment of rebirth.
Và đây là một từ ở cách sở thuộc (bhummavacana) với ý nghĩa gần kề, nghĩa là gần thời điểm chết và gần thời điểm tái sanh.
Tathā hi vakkhati ‘‘ye pana āsannacutikā’’tiādi.
Indeed, he will say, “But those who are near death…” and so on.
Thật vậy, lời dạy sẽ nói: “Những người sắp chết” và tiếp theo.
Yena ñāṇenāti yena dibbacakkhuñāṇena.
By which knowledge means by which knowledge of the divine eye.
“Bằng trí tuệ nào” có nghĩa là bằng trí tuệ thiên nhãn (dibbacakkhuñāṇa) nào.
Dibbacakkhuñāṇeneva hi sattānaṃ cuti ca upapatti ca ñāyati.
For it is only with the knowledge of the divine eye that the passing away and reappearance of beings is known.
Thật vậy, chỉ bằng trí tuệ thiên nhãn mà sự chết và sự tái sanh của chúng sanh mới được biết đến.
Parikammaṃ vattabbaṃ siyāti ‘‘dibbacakkhuñāṇaṃ uppādetukāmena ādikammikena kulaputtena kasiṇārammaṇaṃ abhiññāpādakajjhānaṃ sabbākārena abhinīhārakkhamaṃ katvā tejokasiṇaṃ odātakasiṇaṃ ālokakasiṇanti imesu tīsu kasiṇesu aññataraṃ āsannaṃ kātabbaṃ, upacārajjhānagocaraṃ katvā vaḍḍhetvā ṭhapetabba’’ntiādinā dibbacakkhuñāṇassa parikammaṃ vattabbaṃ bhaveyya.
Preparation should be spoken of means that the preparation for the divine eye knowledge should be spoken of, beginning with "by a virtuous young man, a beginner who desires to generate the divine eye knowledge, having made the foundation-jhana for higher knowledge with a kasiṇa as its object capable of drawing forth (the higher knowledge) in all respects, one of these three kasiṇas—the fire kasiṇa, the white kasiṇa, or the light kasiṇa—should be made near, and having made it the object of access concentration, it should be developed and established."
Cần phải nói về sự chuẩn bị (Parikammaṃ vattabbaṃ siyā) nghĩa là, cần phải nói về sự chuẩn bị cho thiên nhãn thông (dibbacakkhuñāṇa) theo cách như sau: “Người thiện nam tử mới bắt đầu tu tập, muốn phát sinh thiên nhãn thông, cần phải làm cho thiền nền tảng của thắng trí (abhiññāpādakajjhāna) với đề mục kasiṇa trở nên khả dĩ đưa đến thắng trí bằng mọi phương cách, rồi làm cho một trong ba loại kasiṇa này—hỏa kasiṇa, bạch kasiṇa, quang kasiṇa—trở nên rõ ràng, và phát triển nó để trở thành đối tượng của cận định (upacārajjhāna).”
So ahanti so katacittābhinīhāro ahaṃ.
That I means "that I who have accomplished the aspiration of mind."
So ahaṃ nghĩa là, tôi, người đã hướng tâm đến thắng trí như vậy.
Dibbasadisattāti divi bhavanti dibbaṃ, devānaṃ pasādacakkhu, tena dibbena cakkhunā sadisattāti attho.
Due to being similar to the divine means that which exists in the heavens is divine, the delightful eye of the devas; due to being similar to that divine eye, that is the meaning.
Dibbasadisattā nghĩa là, vì tương tự với thiên nhãn. “Dibba” là cái gì thuộc về chư thiên, là tịnh nhãn của chư thiên. Do đó, nghĩa là vì tương tự với thiên nhãn đó.
Dibbasadisattāti ca hīnūpamādassanaṃ devatānaṃ dibbacakkhutopi imassa mahānubhāvattā.
And due to being similar to the divine is a showing of an inferior simile, because this (divine eye of the Buddha) is more potent than even the divine eye of the devas.
Và Dibbasadisattā cũng là sự trình bày một ví dụ thấp kém, vì năng lực của nhãn này vĩ đại hơn cả thiên nhãn của chư thiên.
Idāni taṃ dibbasadisattaṃ vibhāvetuṃ ‘‘devatānañhī’’tiādi vuttaṃ.
Now, to illustrate that similarity to the divine, the statement "for of devas" and so on was made.
Bây giờ, để làm rõ sự tương tự với thiên nhãn đó, lời “devatānañhī” và tiếp theo đã được nói.
Tattha sucaritakammanibbattanti saddhābahulatāvisuddhadiṭṭhitāānisaṃsadassāvitādisampattiyā suṭṭhu caritattā sucaritena devūpapattijanakena puññakammena nibbattaṃ.
There, produced by wholesome kamma means produced by wholesome kamma that generates rebirth as a deva, due to being well-practiced with the accomplishment of abundant faith, purified view, and the showing of benefits, and so on.
Trong đó, sucaritakammanibbattaṃ nghĩa là, được tạo ra bởi nghiệp thiện (puññakamma) đã được thực hành tốt đẹp, là nghiệp dẫn đến tái sinh cõi trời, nhờ vào sự thành tựu như có nhiều đức tin (saddhābahulatā), có chánh kiến thanh tịnh (visuddhadiṭṭhitā), và thấy rõ các lợi ích.
Pittasemharuhirādīhīti ādi-saddena vātarogādīnaṃ saṅgaho.
By the word "etc." in "by bile, phlegm, blood, etc.", diseases such as wind disorders are included.
Trong pittasemharuhirādīhi, từ ādi bao gồm các bệnh như phong bệnh (vātaroga).
Apalibuddhanti anupaddutaṃ.
Unobstructed means unimpeded.
Apalibuddhaṃ nghĩa là, không bị chướng ngại.
Pittādīhi anupaddutattā kammassa ca uḷāratāya upakkilesavimutti veditabbā.
Liberation from defilement should be understood as being unimpeded by bile, etc., and due to the exalted nature of kamma.
Vì không bị chướng ngại bởi mật (pitta) và các yếu tố khác, và vì nghiệp là cao thượng, nên cần hiểu rằng nó được giải thoát khỏi các cấu uế (upakkilesa).
Upakkilesadosarahitañhi kammaṃ tiṇādidosarahitaṃ viya sassaṃ uḷāraphalaṃ anupakkiliṭṭhaṃ hoti.
For kamma that is free from defilement is like a crop free from defects such as weeds, possessing excellent fruits and being undefiled.
Thật vậy, nghiệp không bị ô nhiễm bởi các cấu uế sẽ có quả báo cao thượng và không bị ô nhiễm, giống như cây lúa không bị sâu bệnh.
Kāraṇūpacārena cassa phalaṃ tathā voharīyati yathā ‘‘sukkaṃ sukkavipāka’’nti.
And its result is spoken of in that way by figurative use of the cause, as in "white, of white result."
Và quả của nó được gọi như vậy theo cách ẩn dụ về nguyên nhân, giống như câu “trắng có quả trắng”.
Dūrepīti pi-saddena sukhumassapi ārammaṇassa sampaṭicchanasamatthataṃ saṅgaṇhāti.
Even far away, by the word "even", it includes the ability to apprehend even a subtle object.
Trong dūrepi, từ pi bao gồm khả năng tiếp nhận đối tượng dù ở xa hay vi tế.
Pasādacakkhūti catunnaṃ mahābhūtānaṃ pasādalakkhaṇaṃ cakkhu.
The sensitive eye means the eye with the characteristic of sensitivity of the four great elements.
Pasādacakkhu là nhãn có đặc tính trong sáng của bốn đại.
Vīriyabhāvanābalanibbattanti vīriyārambhavaseneva ijjhanato sabbāpi kusalabhāvanā vīriyabhāvanā, padhānasaṅkhārasamannāgatā vā iddhipādabhāvanā visesato vīriyabhāvanā, tassā ānubhāvena nibbattaṃ vīriyabhāvanābalanibbattaṃ.
Produced by the power of exertion-development means all wholesome development is exertion-development, because it is perfected solely through the application of energy; or, the development of the bases of psychic power, endowed with strong effort, is specifically exertion-development. That which is produced by the influence of that (exertion-development) is produced by the power of exertion-development.
Vīriyabhāvanābalanibbattaṃ nghĩa là, được tạo ra bởi sức mạnh của sự tu tập tinh tấn. Tất cả mọi sự tu tập thiện (kusalabhāvanā) đều là sự tu tập tinh tấn (vīriyabhāvanā) vì nó thành tựu chỉ nhờ vào sự khởi xướng tinh tấn (vīriyārambha). Hoặc, sự tu tập các thần túc (iddhipāda bhāvanā) đi kèm với các hành chính (padhānasaṅkhāra) đặc biệt là sự tu tập tinh tấn. Được tạo ra bởi năng lực của sự tu tập đó là vīriyabhāvanābalanibbattaṃ.
Ñāṇamayaṃ cakkhu ñāṇacakkhu.
The eye made of knowledge is the knowledge-eye.
Nhãn được tạo thành từ trí tuệ là ñāṇacakkhu (trí nhãn).
Tādisamevāti upakkilesavimuttatāya dūrepi sukhumassapi ārammaṇassa sampaṭicchanasamatthatāya ca taṃsadisameva.
Exactly similar means exactly similar to that (deva's eye) due to being free from defilements and capable of apprehending even subtle objects even from afar.
Tādisamevā nghĩa là, tương tự như vậy, vì nó được giải thoát khỏi các cấu uế và có khả năng tiếp nhận đối tượng dù ở xa hay vi tế.
Dibbavihāravasena paṭiladdhattāti dibbavihārasaṅkhātānaṃ catunnaṃ jhānānaṃ vasena paṭiladdhattā.
Due to being attained through divine abidings means due to being attained through the four jhānas known as divine abidings.
Dibbavihāravasena paṭiladdhattā nghĩa là, được thành tựu nhờ vào bốn thiền định được gọi là thiên trú (dibbavihāra).
Iminā kāraṇavasenassa dibbabhāvamāha.
By this, he states its divine nature based on the cause.
Qua điều này, Ngài nói về tính chất thiên thượng của nó dựa trên nguyên nhân.
Dibbavihārasannissitattāti aṭṭhaṅgasamannāgamena ukkaṃsagataṃ pādakajjhānasaṅkhātaṃ dibbavihāraṃ sannissāya pavattattā, dibbavihārapariyāpannaṃ vā attanā sampayuttaṃ rūpāvacaracatutthajjhānaṃ nissāya paccayabhūtaṃ sannissitattāti evamettha attho daṭṭhabbo.
Due to relying on a divine abiding means due to operating by relying on the divine abiding, which is the foundational jhāna that has reached its peak, endowed with eight factors; or, the meaning here should be seen as "due to relying on the rūpāvacara fourth jhāna, which is included in the divine abiding and is associated with oneself, and which is a proximate condition."
Dibbavihārasannissitattā nghĩa là, vì nó hoạt động dựa vào thiên trú, tức là thiền nền tảng (pādakajjhāna) đã đạt đến mức tối thượng với tám chi phần; hoặc nghĩa là, nó hoạt động dựa vào thiền thứ tư của sắc giới (rūpāvacaracatutthajjhāna) liên hệ với chính nó và thuộc về thiên trú, làm nhân duyên.
Ālokapariggahena mahājutikattāpi dibbanti kasiṇālokānuggahena pattabbattā sayaṃ ñāṇālokapharaṇabhāvena ca mahājutikabhāvatopi dibbanti attho.
And divine due to being greatly luminous through the apprehension of light means divine due to being attained through the aid of kasiṇa light, and also due to being greatly luminous through the radiation of the light of knowledge itself.
Ālokapariggahena mahājutikattāpi dibbaṃ nghĩa là, nó cũng là “thiên” (dibba) vì được thành tựu nhờ sự hỗ trợ của ánh sáng kasiṇa và vì tự thân nó có ánh sáng trí tuệ lan tỏa, nên có hào quang lớn.
Mahājutikampi hi dibbanti vuccati ‘‘dibbamidaṃ byamha’’ntiādīsu.
For something greatly luminous is also called divine, as in "this divine firmament" and so on.
Thật vậy, cái gì có hào quang lớn cũng được gọi là “dibba” trong các câu như “dibbamidaṃ byamhaṃ” (Đây là cõi trời).
Mahāgatikattāti mahanīyagamanattā, vimhayanīyappavattikattāti attho.
Due to having great movement means having noble movement, or having astonishing activity.
Mahāgatikattā nghĩa là, có sự đi lại cao quý, tức là có sự hoạt động đáng kinh ngạc.
Vimhayanīyā hissa pavatti tirokuṭṭādigatarūpadassanato.
For its activity is astonishing due to seeing forms beyond walls and so on.
Thật vậy, sự hoạt động của nó đáng kinh ngạc vì thấy được các sắc tướng xuyên qua tường vách, v.v.
Taṃ sabbanti ‘‘heṭṭhā vuttaṃ atthapañcakamapekkhitvā vutta’’nti vadanti.
All that – some say that this was stated referring to the five meanings mentioned earlier.
Taṃ sabbaṃ (tất cả điều đó) – một số người nói rằng điều này được nói đến khi xem xét năm ý nghĩa đã được đề cập ở trên.
Keci pana ‘‘jutigatiatthesupi saddavidū divusaddaṃ icchantīti mahājutikattā mahāgatikattāti idameva dvayaṃ sandhāya vuttaṃ, tasmā ‘saddasatthānusārena veditabba’nti idaṃ dibbati jotayatīti dibbaṃ, dibbati gacchati asajjamānaṃ pavattatīti dibbanti imamatthaṃ dassetuṃ vutta’’nti vadanti.
But some say, "Even experts in grammar desire the word 'divu' in the meanings of brilliance and movement, and this refers only to these two (greatly luminous and having great movement). Therefore, 'it should be understood according to grammar' was said to show this meaning: 'divva' means it shines, it glitters; 'divva' means it moves, it proceeds unimpeded."
Tuy nhiên, một số khác nói rằng “ngay cả trong các ý nghĩa về ánh sáng và sự đi lại, các nhà ngữ pháp cũng chấp nhận từ ‘divu’. Do đó, điều này chỉ đề cập đến hai điều này: ‘vì có hào quang lớn’ và ‘vì có sự đi lại lớn’. Vì vậy, câu ‘cần phải hiểu theo ngữ pháp’ được nói ra để chỉ rõ ý nghĩa ‘dibba’ là tỏa sáng (dibbati jotayati) và ‘dibba’ là đi lại không vướng mắc (dibbati gacchati asajjamānaṃ pavattati).”
Ācariyadhammapālatthero pana –
But Acariya Dhammapāla Thera said –
Nhưng Trưởng lão Ācariya Dhammapāla thì –
Dassanaṭṭhenāti rūpadassanabhāvena.
In the sense of seeing means in the sense of seeing forms.
Dassanaṭṭhenā nghĩa là, theo nghĩa thấy sắc.
Cakkhunā hi sattā rūpaṃ passanti.
For beings see forms with the eye.
Thật vậy, chúng sinh thấy sắc bằng mắt.
Yathā maṃsacakkhu viññāṇādhiṭṭhitaṃ samavisamaṃ ācikkhantaṃ viya pavattati, na tathā idaṃ.
Just as the flesh-eye, supported by consciousness, appears as if pointing out what is even or uneven, this is not so.
Giống như nhục nhãn (maṃsacakkhu) được yểm trợ bởi thức (viññāṇa) hoạt động như thể chỉ ra cái bằng phẳng và cái không bằng phẳng, thiên nhãn này không phải như vậy.
Idaṃ pana sayameva tato sātisayaṃ cakkhukiccakārīti āha ‘‘cakkhukiccakaraṇena cakkhumivātipi cakkhū’’ti.
However, this (divine eye) itself performs the function of an eye with excellence, surpassing that (flesh-eye). Thus, he says, "It is also an eye due to performing the function of an eye, as if it were an eye."
Nhưng nhãn này tự thân thực hiện chức năng của mắt một cách vượt trội hơn, nên Ngài nói “cakkhukiccakaraṇena cakkhumivātipi cakkhū” (nó cũng là mắt vì thực hiện chức năng của mắt).
Diṭṭhivisuddhihetuttāti saṅkhepato vuttamatthaṃ vivarituṃ ‘‘yo hī’’tiādi vuttaṃ.
Due to being the cause of purification of view, to explain the meaning stated concisely, "for whoever" and so on was said.
Diṭṭhivisuddhihetuttā nghĩa là, để làm rõ ý nghĩa đã được nói tóm tắt, câu “yo hī” và tiếp theo đã được nói.
Ucchedadiṭṭhiṃ gaṇhātīti parato uppattiyā adassanato ‘‘etthe vāyaṃ satto ucchinno, evamitarepī’’ti ucchedadiṭṭhiṃ gaṇhāti.
He adopts the annihilation view means that by not seeing rebirth thereafter, one adopts the annihilation view, thinking, "This being is annihilated right here; similarly, others too."
Ucchedadiṭṭhiṃ gaṇhāti nghĩa là, vì không thấy sự tái sinh sau đó, người ta ôm giữ đoạn kiến (ucchedadiṭṭhi) rằng “chúng sinh này bị đoạn diệt tại đây, và những chúng sinh khác cũng vậy”.
Navasattapātubhāvadiṭṭhiṃ gaṇhātīti jhānalābhī adhiccasamuppanniko viya gaṇhāti.
He adopts the view of the emergence of a new being means that one who has attained jhāna adopts it as if having arisen without cause.
Navasattapātubhāvadiṭṭhiṃ gaṇhāti nghĩa là, người đạt được thiền định ôm giữ tà kiến về sự xuất hiện mới của chúng sinh, như thể nó là sự phát sinh ngẫu nhiên.
Yathā hi so asaññasattā cavitvā idhūpapanno pabbajito samāno abhiññālābhī hutvā pubbenivāsaṃ anussaranto idhūpapattimeva disvā tato paraṃ asaññabhave uppattiṃ anussaritumasakkonto ‘‘ahaṃ adhiccasamuppanno pubbe nāhosiṃ, somhi etarahi ahutvā sattatāya pariṇato, sesāpi sattā tādisāyevā’’ti abhinavasattapātubhāvadiṭṭhiṃ gaṇhāti, evamayampi upapātamattameva disvā cutiṃ apassanto navasattapātubhāvadiṭṭhiṃ gaṇhāti.
Just as such a person, having passed away from the non-percipient realm and being reborn here, becomes a monastic and attains higher knowledge, and recalling past lives, sees only this rebirth and is unable to recall rebirth in the non-percipient realm beyond that, thinks, "I arose without cause; I did not exist before, but now, having not existed, I have become a being; other beings are also like that," and adopts the view of the emergence of a new being. Similarly, this person, seeing only spontaneous rebirth but not seeing death, adopts the view of the emergence of a new being.
Thật vậy, giống như một người có tà kiến về sự phát sinh ngẫu nhiên, sau khi chết từ cõi vô tưởng chúng sinh (asaññasatta), tái sinh ở đây, trở thành tỳ khưu, đạt được thắng trí, và khi hồi tưởng về các đời quá khứ, chỉ thấy sự tái sinh ở đây, không thể hồi tưởng về sự tái sinh ở cõi vô tưởng sau đó, nên ôm giữ tà kiến về sự xuất hiện mới của chúng sinh rằng “ta phát sinh ngẫu nhiên, trước đây ta không tồn tại, bây giờ ta không tồn tại mà trở thành chúng sinh, và các chúng sinh khác cũng vậy”; tương tự như vậy, người này cũng chỉ thấy sự tái sinh tức thời, không thấy sự chết, nên ôm giữ tà kiến về sự xuất hiện mới của chúng sinh.
‘‘Ahampi sudaṃ anuruddhā pubbeva sambodhā anabhisambuddho bodhisattova samāno obhāsañceva sañjānāmi dassanañca rūpānaṃ, so kho pana me obhāso na cirasseva antaradhāyati dassanañca rūpānaṃ.
"I, too, Anuruddha, before my Enlightenment, while still a Bodhisatta, perceived light and saw forms. But that light and the seeing of forms quickly disappeared.
“Này Anuruddha, trước khi giác ngộ, khi ta vẫn còn là Bồ Tát chưa giác ngộ hoàn toàn, ta đã nhận biết ánh sáng và thấy các sắc tướng, nhưng ánh sáng đó và sự thấy các sắc tướng đó không lâu sau đã biến mất.
Tassa mayhaṃ anuruddhā etadahosi ‘ko nu kho hetu, ko paccayo, yena me obhāso antaradhāyati dassanañca rūpāna’nti.
Then, Anuruddha, this thought occurred to me: 'What is the reason, what is the cause, that the light and the seeing of forms quickly disappear from me?'"
Này Anuruddha, khi đó ta nghĩ: ‘Nguyên nhân nào, duyên nào khiến cho ánh sáng của ta biến mất và sự thấy các sắc tướng cũng biến mất?’”
Tassa mayhaṃ anuruddhā etadahosi ‘vicikicchā kho me udapādi, vicikicchādhikaraṇañca me samādhi cavi, samādhimhi cute obhāso antaradhāyati dassanañca rūpānaṃ, sohaṃ tathā karissāmi, yathā me puna na vicikicchā uppajjissatī’ti.
Then, Anuruddha, it occurred to me: ‘Doubt has arisen in me, and because of doubt, my concentration has wavered. When concentration wavers, the light vanishes, and the vision of forms disappears. So I will act in such a way that doubt will not arise in me again.’
Này Anuruddha, tôi đã nghĩ thế này: ‘Nghi ngờ đã khởi lên trong tôi, và do nghi ngờ ấy, định của tôi bị suy giảm. Khi định suy giảm, ánh sáng biến mất và sự thấy các sắc cũng biến mất. Tôi sẽ làm sao để nghi ngờ không còn khởi lên nữa.’
‘‘So kho ahaṃ anuruddhā appamatto ātāpī pahitatto viharanto obhāsañceva sañjānāmi dassanañca rūpānaṃ, so kho pana me obhāso na cirasseva antaradhāyati dassanañca rūpānaṃ.
“So, Anuruddha, dwelling heedful, ardent, and resolute, I perceived the light and the vision of forms, but that light and the vision of forms soon vanished from me.
“Này Anuruddha, khi tôi sống không phóng dật, tinh cần, chuyên tâm, tôi nhận biết ánh sáng và sự thấy các sắc, nhưng ánh sáng ấy và sự thấy các sắc ấy của tôi không lâu sau lại biến mất.
Tassa mayhaṃ anuruddhā etadahosi ‘ko nu kho hetu, ko paccayo, yena me obhāso antaradhāyati dassanañca rūpāna’nti.
Then, Anuruddha, it occurred to me: ‘What now is the cause, what the condition, by which the light vanishes from me and the vision of forms disappears?’
Này Anuruddha, tôi đã nghĩ thế này: ‘Nguyên nhân nào, duyên cớ nào khiến ánh sáng của tôi biến mất và sự thấy các sắc cũng biến mất?’
Tassa mayhaṃ anuruddhā etadahosi ‘amanasikāro kho me udapādi, amanasikārādhikaraṇañca pana me samādhi cavi, samādhimhi cute obhāso antaradhāyati dassanañca rūpānaṃ, sohaṃ tathā karissāmi, yathā me puna na vicikicchā uppajjissati na amanasikāro’’’ti –
Then, Anuruddha, it occurred to me: ‘Lack of attention has arisen in me, and because of lack of attention, my concentration has wavered. When concentration wavers, the light vanishes, and the vision of forms disappears. So I will act in such a way that neither doubt nor lack of attention will arise in me again.’ –
Này Anuruddha, tôi đã nghĩ thế này: ‘Sự không tác ý đã khởi lên trong tôi, và do sự không tác ý ấy, định của tôi bị suy giảm. Khi định suy giảm, ánh sáng biến mất và sự thấy các sắc cũng biến mất. Tôi sẽ làm sao để nghi ngờ không còn khởi lên nữa, và sự không tác ý cũng không còn nữa.’”
Tattha (ma. ni. aṭṭha. 3.241) vicikicchāti mahāsattassa ālokaṃ vaḍḍhetvā dibbacakkhunā nānāvidhāni rūpāni passantassa ‘‘idaṃ nu kho ki’’nti uppannā vicikicchā.
Therein, doubt refers to the doubt that arose in the Great Being, who, by developing light and seeing various forms with the divine eye, wondered, “What is this (object)?”
Ở đó, vicikicchā (nghi ngờ) là nghi ngờ khởi lên trong Bồ Tát khi Ngài đã tăng cường ánh sáng và dùng thiên nhãn thấy các sắc khác nhau, tự hỏi: “Đây là gì vậy?”
Manasikāravasena pana me rūpāni upaṭṭhahiṃsu, rūpāni passato vicikicchā uppajjati, tasmā idāni kiñci na manasi karissāmīti tuṇhī bhavati, taṃ tuṇhībhāvappattiṃ sandhāyāha ‘‘amanasikāro’’ti.
But for me, forms appeared through attention, and when seeing forms, doubt arises. Therefore, I will not attend to anything now, and I became silent. Referring to that state of silence, it is said “lack of attention.”
Còn amanasikāro (không tác ý) được nói để chỉ trạng thái im lặng, khi Ngài nghĩ: “Các sắc đã hiện ra với ta do tác ý, và nghi ngờ khởi lên khi ta thấy các sắc; vì vậy bây giờ ta sẽ không tác ý bất cứ điều gì.”
Thinamiddhanti kiñci amanasikarontassa uppannaṃ thinamiddhaṃ.
Sloth and torpor refers to the sloth and torpor that arose in one who attends to nothing.
Thinamiddhaṃ (hôn trầm, thụy miên) là hôn trầm, thụy miên khởi lên ở người không tác ý bất cứ điều gì.
Tathābhūtassa hi savipphārikamanasikārassa abhāvato thinamiddhaṃ uppajjati.
Indeed, for such a person, due to the absence of expansive attention, sloth and torpor arise.
Thật vậy, do không có tác ý phân tích, hôn trầm, thụy miên khởi lên ở người như vậy.
Chambhitattanti thinamiddhaṃ vinodetvā yathāraddhamanasikāravasena himavantābhimukhaṃ ālokaṃ vaḍḍhetvā dānavarakkhasaajagarādayo passantassa uppannaṃ chambhitattaṃ.
Fright refers to the fright that arose in one who, having dispelled sloth and torpor, developed light towards the Himalayas according to the attention that had been aroused, and saw ogres, demons, pythons, and so on.
Chambhitattaṃ (sự hoảng sợ) là sự hoảng sợ khởi lên ở người đã loại bỏ hôn trầm, thụy miên, và theo tác ý đã bắt đầu, tăng cường ánh sáng hướng về dãy Himalaya, thấy những loài như quỷ Dạ Xoa, quỷ La Sát, rắn hổ mang khổng lồ, v.v.
Uppilanti ‘‘mayā diṭṭhabhayaṃ pakatiyā cakkhuviññāṇena olokiyamānaṃ na passati, adiṭṭhe parikappitasadise kiṃnāma bhaya’’nti bhayassa vinodanavasena cintentassa attano paccavekkhaṇākosallaṃ nissāya uppannaṃ uppilāvitattaṃ.
Exaltation refers to the state of elation, known as joy, that arose in one who, by considering “The danger that I saw is not seen when viewed with the natural eye; what kind of danger is it that is unseen, merely imagined?”, thus dispelling fear, relying on one’s skill in introspection.
Uppilaṃ (sự phô trương, sự tự mãn) là sự tự mãn khởi lên do sự khéo léo tự quán xét của chính mình, khi Ngài nghĩ để loại bỏ nỗi sợ hãi: “Sự kinh hãi mà ta đã thấy (như quỷ Dạ Xoa, La Sát, v.v.) không được thấy khi được nhìn bằng nhãn thức thông thường. Sợ hãi nào có thể có trong một đối tượng không thấy, chỉ được tưởng tượng ra?”
Duṭṭhullanti kāyālasiyaṃ.
Grossness refers to bodily laziness.
Duṭṭhullaṃ (sự thô tháo) là sự lười biếng của thân.
‘‘Mayā thinamiddhaṃ chambhitattānaṃ vūpasamanatthaṃ gāḷhaṃ vīriyaṃ paggahitaṃ, tena me uppilasaṅkhātā cittasamādhidūsitā gehassitā balavapīti uppannā’’ti vīriyaṃ sithilaṃ karontassa hi kāyaduṭṭhullaṃ kāyadaratho kāyālasiyaṃ udapādi.
Indeed, for one who slackens effort, thinking, “I exerted strong effort to suppress sloth, torpor, and fright, and because of that, a powerful joy, called exaltation, which is corrupted concentration of mind and rooted in household life, has arisen in me,” there arose bodily grossness, bodily fatigue, bodily laziness.
Thật vậy, khi Ngài nới lỏng tinh tấn, nghĩ: “Ta đã nỗ lực mạnh mẽ để làm lắng dịu hôn trầm và hoảng sợ, do đó một hỷ mạnh mẽ, ô nhiễm định tâm, liên quan đến gia đình, được gọi là ‘uppila’ (sự phô trương), đã khởi lên trong ta,” thì sự thô tháo của thân, sự khó chịu của thân, sự lười biếng của thân đã khởi lên.
Accāraddhavīriyanti ‘‘mama vīriyaṃ sithilaṃ karoto duṭṭhullaṃ uppanna’’nti puna vīriyaṃ paggaṇhato uppannaṃ accāraddhavīriyaṃ.
Over-exertion of effort refers to the over-exertion of effort that arose in one who, again exerting effort, thinking, “Grossness arose in me when I slackened my effort.”
Accāraddhavīriyaṃ (tinh tấn quá mức) là tinh tấn quá mức khởi lên khi Ngài lại nỗ lực tinh tấn, nghĩ: “Sự thô tháo đã khởi lên khi ta nới lỏng tinh tấn của mình.”
Atilīnavīriyanti ‘‘mama vīriyaṃ paggaṇhato evaṃ jāta’’nti puna vīriyaṃ sithilayato uppannaṃ atilīnavīriyaṃ.
Under-exertion of effort refers to the under-exertion of effort that arose in one who, again relaxing effort, thinking, “This is what happened to me when I exerted effort.”
Atilīnavīriyaṃ (tinh tấn quá yếu) là tinh tấn quá yếu khởi lên khi Ngài lại nới lỏng tinh tấn, nghĩ: “Điều này đã xảy ra khi ta nỗ lực tinh tấn.”
Abhijappāti devalokābhimukhaṃ ālokaṃ vaḍḍhetvā devasaṅghaṃ passato uppannā taṇhā.
Desire for gain refers to the craving that arose in one who, developing light towards the divine realm, saw the assembly of devas.
Abhijappā (sự khao khát) là tham ái khởi lên khi Ngài tăng cường ánh sáng hướng về cõi trời và thấy chư thiên.
‘‘Evaṃ me hotū’’ti hi abhinivisanavasena jappatīti abhijappā, taṇhā.
Indeed, one yearns, saying, “May it be so for me,” and so it is called abhijappā, craving.
Thật vậy, đó là abhijappā (tham ái) vì nó khao khát theo cách “mong điều này xảy ra với tôi.”
Nānattasaññāti ‘‘mayhaṃ ekajātikaṃ rūpaṃ manasikarontassa abhijappā uppannā, nānāvidhaṃ rūpaṃ manasikāraṃ karissāmī’’ti kālena devalokābhimukhaṃ kālena manussalokābhimukhaṃ vaḍḍhetvā nānāvidhāni rūpāni manasikaroto uppannā nānattasaññā, nānatte nānāsabhāve saññāti nānattasaññā.
Perception of diversity refers to the perception of diversity that arose in one who, thinking, “Desire for gain arose in me when I attended to a single type of form; I will attend to various types of forms,” at times developing light towards the divine realm, at times towards the human realm, attended to various forms. Perception of diversity refers to the perception of diversity in diverse phenomena.
Nānattasaññā (tưởng về các loại khác nhau) là tưởng về các loại khác nhau khởi lên khi Ngài tác ý các sắc khác nhau, lúc hướng về cõi trời, lúc hướng về cõi người, nghĩ: “Tham ái đã khởi lên khi ta tác ý một loại sắc; ta sẽ tác ý nhiều loại sắc khác nhau.” Nānattasaññā là tưởng về các loại khác nhau, các bản chất khác nhau.
Atinijjhāyitattanti ‘‘mayhaṃ nānāvidhāni rūpāni manasikarontassa nānattasaññā udapādi, iṭṭhaṃ vā aniṭṭhaṃ vā ekajātikameva rūpaṃ manasi karissāmī’’ti tathā manasikaroto uppannaṃ rūpānaṃ atinijjhāyitattaṃ, ativiya uttari katvā nijjhānaṃ pekkhanaṃ atinijjhāyitattaṃ.
Excessive scrutiny refers to the excessive scrutiny of forms that arose in one who, thinking, “Perception of diversity arose in me when I attended to various forms; I will attend to only one type of form, whether agreeable or disagreeable,” attended in that way. Excessive scrutiny is looking extremely and excessively.
Atinijjhāyitattaṃ (sự quán sát quá mức) là sự quán sát quá mức các sắc khởi lên khi Ngài tác ý như vậy, nghĩ: “Tưởng về các loại khác nhau đã khởi lên khi ta tác ý các sắc khác nhau; ta sẽ tác ý chỉ một loại sắc, dù là đáng ưa hay không đáng ưa.” Atinijjhāyitattaṃ là sự nhìn, sự quán sát quá mức, vượt trội.
Obhāsanti parikammasamuṭṭhitaṃ obhāsaṃ.
Light refers to the light arisen from preliminary effort.
Obhāsaṃ (ánh sáng) là ánh sáng khởi lên do sự chuẩn bị (parikamma).
Na ca rūpāni passāmīti parikammobhāsamanasikārappasutatāya dibbacakkhunā rūpāni na passāmi.
And I do not see forms means that due to being absorbed in the attention to the light of preliminary effort, I do not see forms with the divine eye.
Na ca rūpāni passāmi (và tôi không thấy các sắc) có nghĩa là tôi không thấy các sắc bằng thiên nhãn do chuyên tâm vào tác ý ánh sáng chuẩn bị.
Rūpāni hi kho passāmīti tena parikammobhāsena pharitvā ṭhitaṭṭhāne dibbacakkhuno visayabhūtāni rūpagatāni passāmi.
But I do see forms means that in the place pervaded by that light of preliminary effort, I see the forms that are objects of the divine eye.
Rūpāni hi kho passāmi (thật vậy, tôi thấy các sắc) có nghĩa là tôi thấy các đối tượng sắc nằm trong phạm vi của thiên nhãn ở nơi được bao phủ bởi ánh sáng chuẩn bị đó.
‘‘Kevalampi rattiṃ kevalampi divaṃ kevalampi rattindivaṃ tassa mayhaṃ anuruddhā etadahosi ‘ko nu kho hetu, ko paccayo, yvāhaṃ obhāsañhi kho sañjānāmi, na ca rūpāni passāmi, rūpāni kho passāmi, na ca obhāsaṃ sañjānāmi kevalampi rattiṃ kevalampi divaṃ kevalampi rattindiva’nti.
“Anuruddha, for me, for a whole night, for a whole day, for a whole night and day, it occurred to me: ‘What now is the cause, what the condition, by which I perceive the light but do not see forms, or I see forms but do not perceive the light, for a whole night, for a whole day, for a whole night and day?’
“Này Anuruddha, suốt đêm, suốt ngày, suốt ngày đêm, tôi đã nghĩ thế này: ‘Nguyên nhân nào, duyên cớ nào khiến tôi nhận biết ánh sáng nhưng không thấy các sắc, hoặc tôi thấy các sắc nhưng không nhận biết ánh sáng, suốt đêm, suốt ngày, suốt ngày đêm?’”
Tassa mayhaṃ anuruddhā etadahosi ‘yasmiñhi kho ahaṃ samaye rūpanimittaṃ amanasikaritvā obhāsanimittaṃ manasi karomi.
Then, Anuruddha, it occurred to me: ‘Indeed, at the time when I do not attend to the form-sign but attend to the light-sign,
Này Anuruddha, tôi đã nghĩ thế này: ‘Khi tôi không tác ý tướng sắc mà tác ý tướng ánh sáng,
Obhāsañhi kho tasmiṃ samaye sañjānāmi, na ca rūpāni passāmi.
at that time I perceive the light but do not see forms.
thì vào lúc đó tôi nhận biết ánh sáng nhưng không thấy các sắc.
Yasmiṃ panāhaṃ samaye obhāsanimittaṃ amanasikaritvā rūpanimittaṃ manasi karomi.
But at the time when I do not attend to the light-sign but attend to the form-sign,
Còn khi tôi không tác ý tướng ánh sáng mà tác ý tướng sắc,
Rūpāni hi kho tasmiṃ samaye passāmi, na ca obhāsaṃ sañjānāmi kevalampi rattiṃ kevalampi divaṃ kevalampi rattindiva’’nti (ma. ni. 3.243) –
at that time I see forms but do not perceive the light, for a whole night, for a whole day, for a whole night and day.’”
thì vào lúc đó tôi thấy các sắc nhưng không nhận biết ánh sáng, suốt đêm, suốt ngày, suốt ngày đêm.’” (Ma. Ni. 3.243)
Manussānaṃ idanti mānusakaṃ, manussānaṃ gocarabhūtaṃ rūpārammaṇaṃ.
That which belongs to humans is human, meaning a visual object that is within the range of humans.
Manussānaṃ idaṃ (của loài người) là đối tượng sắc thuộc về phạm vi của loài người.
Tadaññassa pana dibbatirokuṭṭasukhumādibhedassa rūpassa dassanato atikkantamānusakaṃ.
But the seeing of another form, which is divine, beyond walls, subtle, and so on, is beyond human.
Còn việc thấy các sắc khác, như sắc cõi trời, sắc xuyên tường, sắc vi tế, v.v., thì là atikkantamānusakaṃ (vượt khỏi loài người).
Evarūpaṃ tañca manussūpacāraṃ atikkantaṃ nāma hotīti āha ‘‘manussūpacāraṃ atikkamitvā rūpadassanenā’’ti.
Such a form is said to transcend human reach, thus it is said “by seeing forms that transcend human reach.”
Sắc như vậy được gọi là vượt qua phạm vi của loài người, nên Ngài nói “manussūpacāraṃ atikkamitvā rūpadassanenā” (bằng cách thấy các sắc vượt qua phạm vi của loài người).
Tattha manussūpacāranti manussehi upacaritabbaṭṭhānaṃ, pakatiyā cakkhudvārena gahetabbaṃ visayanti adhippāyo.
Therein, human reach means the place to be perceived by humans, the meaning being an object to be apprehended by the natural eye.
Ở đó, manussūpacāraṃ (phạm vi của loài người) có nghĩa là nơi mà con người có thể tiếp cận, tức là đối tượng mà nhãn căn thông thường có thể nắm bắt.
Evaṃ visayamukhena dassetvā idāni visayimukhena dassetuṃ ‘‘mānusakaṃ vā’’tiādi vuttaṃ.
Having thus explained through the object, now, to explain through the subject, it is said “or human,” and so on.
Sau khi trình bày theo khía cạnh đối tượng như vậy, bây giờ để trình bày theo khía cạnh chủ thể, “mānusakaṃ vā” (hoặc thuộc về loài người) v.v. đã được nói.
Tatthāpi maṃsacakkhātikkamo tassa kiccātikkameneva daṭṭhabbo.
Even there, the transcendence of the flesh-eye should be understood as the transcendence of its function.
Ở đó, sự vượt qua nhục nhãn cũng nên được hiểu là sự vượt qua chức năng của nó.
Dibbena cakkhunāti dibbacakkhuñāṇenapi daṭṭhuṃ na sakkā khaṇassa atiittaratāya atisukhumatāya kesañci rūpassa, apica dibbacakkhussa paccuppannaṃ rūpārammaṇaṃ, tañca purejātapaccayabhūtaṃ, na ca āvajjanaparikammehi vinā mahaggatassa pavatti atthi, nāpi uppajjamānameva rūpaṃ ārammaṇapaccayo bhavituṃ sakkoti, bhijjamānaṃ vā, tasmā cutūpapātakkhaṇe rūpaṃ dibbacakkhunā daṭṭhuṃ na sakkāti suvuttametaṃ.
With the divine eye means that some forms cannot be seen even with the divine eye knowledge due to their extreme brevity and extreme subtlety. Furthermore, the object of the divine eye is present, and it is a pre-arisen condition. The development of a noble mind does not occur without advertence and preliminary effort, nor can a form that is just arising be a condition for an object, nor one that is ceasing. Therefore, it is well said that a form at the moment of death and rebirth cannot be seen by the divine eye.
Dibbena cakkhunā (bằng thiên nhãn) có nghĩa là ngay cả với thiên nhãn tuệ cũng không thể thấy một số sắc do chúng quá ngắn ngủi và quá vi tế. Hơn nữa, đối tượng sắc của thiên nhãn là hiện tại, và nó là duyên sinh trước. Không có sự tồn tại của pháp đại hành (mahaggata) mà không có sự chú ý và chuẩn bị (āvajjanaparikamma), và sắc đang sinh cũng không thể là duyên đối tượng, hay sắc đang diệt cũng không thể là duyên đối tượng. Do đó, không thể thấy sắc bằng thiên nhãn vào khoảnh khắc chết và tái sinh. Điều này đã được nói rất đúng.
Yadi dibbacakkhuñāṇaṃ rūpārammaṇameva, atha kasmā ‘‘satte passāmī’’ti vuttanti?
If divine eye knowledge is only an object of form, then why is it said, “I see beings”?
Nếu thiên nhãn tuệ chỉ là đối tượng sắc, vậy tại sao lại nói “tôi thấy các chúng sinh”?
Yebhuyyena sattasantānagatarūpadassanato evaṃ vuttaṃ.
Mostly, it is said thus due to seeing the form existing in the mental continuum of beings.
Chủ yếu là do nhìn thấy sắc pháp tồn tại trong dòng tương tục của chúng sinh mà được nói như vậy.
Sattagahaṇassa vā kāraṇabhāvato vohāravasena vuttantipi vadanti.
Or, some also say that it is stated conventionally, due to the reason for referring to 'beings'.
Hoặc cũng có người nói rằng được nói theo cách thông thường vì sự nắm giữ chúng sinh là nguyên nhân.
Te cavamānāti adhippetāti sambandho.
The connection is that 'they are passing away' is intended.
Có nghĩa là “những chúng sinh đang chết” – đó là sự liên kết.
Evarūpeti na cutūpapātakkhaṇasamaṅginoti adhippāyo.
Of such forms means that they are not endowed with the moment of death and rebirth.
Ý nghĩa của từ evarūpe (như vậy) là không phải những chúng sinh đang ở khoảnh khắc chết và tái sinh.
Mohūpanissayaṃ nāma kammaṃ nihīnaṃ nihīnaphalaṃ hotīti āha ‘‘mohanissandayuttattā’’ti.
That kamma which has delusion as its root is inferior and brings inferior results, thus it is stated: "due to being associated with the outflow of delusion".
Nói rằng nghiệp có sự nương tựa vào si mê (mohūpanissayaṃ) là nghiệp thấp kém và cho quả thấp kém, vì vậy Ngài nói “mohanissandayuttattā” (do có sự liên kết với quả tương ứng của si mê).
Mohūpanissayatā ca kusalakammassa pubbabhāge mohappavattibahulatāya veditabbā.
And the condition of having delusion as its root for a wholesome kamma should be understood by the abundance of the arising of delusion in its earlier stage.
Và sự nương tựa vào si mê của nghiệp thiện cần được hiểu là do sự phổ biến của si mê trong giai đoạn trước.
Tāya pana mohappavattiyā saṃkiliṭṭhaṃ kusalakammaṃ nihīnameva jātiādiṃ nipphādetīti nihīnajātiādayo mohassa nissandaphalānīti āha ‘‘hīnānaṃ jātikulabhogādīna’’ntiādi.
Because of that arising of delusion, the wholesome kamma, being defiled, produces only inferior birth and so on; thus, inferior birth and so on are the resultant fruits of delusion, as stated: "of inferior birth, family, possessions, and so on".
Và nghiệp thiện bị ô nhiễm bởi sự phổ biến của si mê đó chỉ tạo ra những sự tái sinh thấp kém, v.v., vì vậy Ngài nói “hīnānaṃ jātikulabhogādīna” (những sự tái sinh, dòng tộc, tài sản thấp kém, v.v.) rằng những sự tái sinh thấp kém, v.v., là quả tương ứng của si mê.
Hīḷiteti garahite.
Hīḷite means reproached.
Hīḷite (bị khinh bỉ) có nghĩa là bị chê bai.
Ohīḷiteti visesato garahite.
Ohīḷite means specially reproached.
Ohīḷite (bị đặc biệt khinh bỉ) có nghĩa là bị đặc biệt chê bai.
Uññāteti lāmakabhāvena ñāte.
Uññāte means known as base.
Uññāte (bị coi thường) có nghĩa là được biết đến với tính chất thấp kém.
Avaññāteti visesato lāmakabhāvena vidite.
Avaññāte means specially known as base.
Avaññāte (bị đặc biệt coi thường) có nghĩa là được biết đến với tính chất đặc biệt thấp kém.
Amohanissandayuttattāti ettha amoho sampayuttavasena pubbabhāgavasena ca pavatto kathito, tena ca tihetukapaṭisandhike dasseti.
In the phrase amohanissandayuttattā, non-delusion is spoken of as arisen through being conjoined and through its earlier stage, and by that, it indicates those with a three-rooted rebirth-linking consciousness (tihetukapaṭisandhika).
Ở đây, từ amohanissandayuttattā (do có sự liên kết với quả tương ứng của vô si) đã nói về vô si xuất hiện do tương ưng và do giai đoạn trước, và nhờ đó nó chỉ ra những chúng sinh tái sinh với ba nhân (tihetukapaṭisandhika).
Tabbiparīteti tassa hīḷitādibhāvassa viparīte, ahīḷite anohīḷite anuññāte anavaññāte cittīkateti attho.
Tabbiparīte means the opposite of that state of being reproached and so on, i.e., not reproached, not specially reproached, not despised, not specially despised, but honored.
Tabbiparīte (ngược lại với điều đó) có nghĩa là ngược lại với trạng thái bị khinh bỉ, v.v., tức là không bị khinh bỉ, không bị đặc biệt khinh bỉ, không bị coi thường, không bị đặc biệt coi thường, được tôn kính.
Suvaṇṇeti sundaravaṇṇe.
Suvaṇṇe means of beautiful complexion.
Suvaṇṇe (có sắc đẹp) có nghĩa là có màu sắc đẹp.
Dubbaṇṇeti asundaravaṇṇe.
Dubbaṇṇe means of ugly complexion.
Dubbaṇṇe (có sắc xấu) có nghĩa là có màu sắc không đẹp.
Sā panāyaṃ suvaṇṇadubbaṇṇatā yathākkamaṃ kammassa adosadosūpanissayatāya hotīti āha ‘‘adosanissandayuttattā’’tiādi.
That state of being of beautiful or ugly complexion arises, respectively, from kamma rooted in non-hatred or hatred, as stated: "due to being associated with the outflow of non-hatred" and so on.
Và trạng thái có sắc đẹp và sắc xấu này lần lượt xảy ra do nghiệp có sự nương tựa vào vô sân và sân, vì vậy Ngài nói “adosanissandayuttattā” (do có sự liên kết với quả tương ứng của vô sân), v.v.
Adosūpanissayatā ca kammassa mettādīhi paribhāvitasantānappavattiyā veditabbā.
The state of kamma being rooted in non-hatred should be understood by the continuity of mind cultivated with loving-kindness and so on.
Và sự nương tựa vào vô sân của nghiệp cần được hiểu là do sự tiếp nối của dòng tâm thức được tu tập bằng lòng từ, v.v.
Abhirūpe virūpeti idaṃ saṇṭhānavasena vuttaṃ.
Abhirūpe virūpe is spoken with reference to bodily shape.
Abhirūpe virūpe (có hình dáng đẹp, có hình dáng xấu) điều này được nói theo khía cạnh hình dáng.
Saṇṭhānavacanopi hi vaṇṇasaddo hoti ‘‘mahantaṃ hatthivaṇṇaṃ abhinimminitvā’’tiādīsu (saṃ. ni. 1.138) viya.
Indeed, the word vaṇṇa (complexion/form) can also refer to shape, as in "having created a huge elephant's form" and so on.
Thật vậy, từ vaṇṇa (sắc) cũng có nghĩa là hình dáng, như trong “tạo ra hình dáng voi to lớn”, v.v.
Paṭhamaṃ vutto pana attho vaṇṇavaseneva vutto.
However, the meaning mentioned first was expressed only with reference to complexion.
Nhưng ý nghĩa được nói trước đó chỉ được nói theo khía cạnh màu sắc.
Sundaraṃ gatiṃ gatā sugatāti āha ‘‘sugatigate’’ti, sugatiṃ upapanneti attho.
They who have gone to a good destiny are well-gone (sugata), as stated: "gone to a good destiny" (sugatigate), meaning they have been reborn in a good realm.
Đi đến cõi tốt đẹp là sugata (thiện thú), vì vậy Ngài nói “sugatigate” (đã đi đến thiện thú), có nghĩa là đã tái sinh vào thiện thú.
Alobhajjhāsayā sattā vadaññū vigatamaccherā alobhūpanissayena kammunā sugatā samiddhā hontīti āha ‘‘alobhanissandayuttattā vā aḍḍhe mahaddhane’’ti.
Beings with non-greedy intentions, who are generous and free from avarice, become well-destined and prosperous through kamma rooted in non-greed, as stated: "or rich, wealthy, due to being associated with the outflow of non-greed".
Những chúng sinh có khuynh hướng vô tham, biết lắng nghe lời khuyên, không có sự keo kiệt, nhờ nghiệp có sự nương tựa vào vô tham mà trở thành những người có thiện thú, giàu có, đại phú, vì vậy Ngài nói “alobhanissandayuttattā vā aḍḍhe mahaddhane” (hoặc do có sự liên kết với quả tương ứng của vô tham mà trở nên giàu có, đại phú).
Dukkhaṃ gatiṃ gatā duggatāti āha ‘‘duggatigate’’ti.
They who have gone to a miserable destiny are ill-gone (duggata), as stated: "gone to a miserable destiny" (duggatigate).
Đi đến cõi khổ là duggata (ác thú), vì vậy Ngài nói “duggatigate” (đã đi đến ác thú).
Lobhajjhāsayā sattā luddhā maccharino lobhūpanissayena kammunā duggatā durūpā hontīti āha ‘‘lobhanissandayuttattā vā dalidde appannapāne’’ti.
Beings with greedy intentions, who are greedy and avaricious, become ill-destined and unsightly through kamma rooted in greed, as stated: "or poor, with little food and drink, due to being associated with the outflow of greed".
Những chúng sinh có khuynh hướng tham lam, tham lam, keo kiệt, nhờ nghiệp có sự nương tựa vào tham mà trở thành những người có ác thú, xấu xí, vì vậy Ngài nói “lobhanissandayuttattā vā dalidde appannapāne” (hoặc do có sự liên kết với quả tương ứng của tham mà trở nên nghèo khổ, thiếu ăn thiếu uống).
Upacitanti phalāvahabhāvena kataṃ.
Accumulated (upacita) means performed in such a way as to bear fruit.
Upacita (đã tích lũy) có nghĩa là đã làm cho có khả năng mang lại quả.
Yathā katañhi kammaṃ phaladānasamatthaṃ hoti, tathā kataṃ upacitaṃ.
Kamma that is performed in such a way as to be capable of yielding results is said to be accumulated.
Nghiệp đã làm như thế nào để có khả năng mang lại quả, nghiệp đã làm như thế đó là upacita.
Cavamānetiādīhi dibbacakkhukiccaṃ vuttanti visayamukhena visayibyāpāramāha.
Through 'passing away' and so on, the function of the divine eye is stated refers to the activity of the subject through the object.
Cavamānetiādīhi dibbacakkhukiccaṃ vuttaṃ (chức năng của thiên nhãn được nói qua “đang chết”, v.v.) nói về hoạt động của chủ thể thông qua đối tượng.
Purimehīti ‘‘dibbena cakkhunā’’tiādīni padāni sandhāya vuttaṃ.
By the former is said with reference to phrases like "with the divine eye" and so on.
Purimehī (bởi những điều trước) được nói đến để chỉ các từ “bằng thiên nhãn”, v.v.
Ādīhīti ettha ca-saddo luttaniddiṭṭho, tasmā ‘‘dibbena…pe… passāmī’’ti imehi ‘‘cavamāne’’tiādīhi ca dibbacakkhukiccaṃ vuttanti attho.
In the word ādīhi, the word ca is elided; therefore, the meaning is that the function of the divine eye is stated by "with the divine... I see" and by "passing away" and so on.
Ở đây, từ ca (và) trong ādīhi (v.v.) bị lược bỏ, vì vậy ý nghĩa là chức năng của thiên nhãn được nói đến bởi các từ “bằng thiên nhãn...pe... ta thấy” này và bởi các từ “đang chết”, v.v.
Iminā pana padenāti ‘‘yathākammūpage satte pajānāmī’’ti iminā vākyena.
But by this phrase means by this sentence: "I discern beings according to their kamma."
Iminā pana padenā (nhưng bằng từ này) có nghĩa là bằng câu “tôi biết các chúng sinh tùy theo nghiệp của họ” này.
Pajjati ñāyati attho imināti hi padaṃ vākyaṃ.
Indeed, the word pada here means a sentence, as the meaning is understood by it.
Thật vậy, từ (pada) là câu (vākya) mà ý nghĩa được biết (pajjati ñāyati) bởi nó.
Mahantaṃ dukkhamanubhavamāneti ettha dibbacakkhuñāṇena rūpaṃ disvā tesaṃ dukkhānubhavanaṃ kāmāvacaracitteneva jānātīti veditabbaṃ.
In experiencing great suffering, it should be understood that, having seen the forms with the divine eye, one comprehends their suffering with a mind belonging to the sensuous sphere (kāmāvacara).
Ở đây, mahantaṃ dukkhamanubhavamāne (đang trải qua sự khổ lớn) cần được hiểu là sau khi nhìn thấy sắc pháp bằng thiên nhãn, người đó biết sự trải qua khổ của họ chỉ bằng tâm giới dục.
Soti nerayikasatte paccakkhato disvā ṭhito dibbacakkhuñāṇalābhī.
He refers to the one who has attained the divine eye, who stands having seen the beings in hell directly.
So (người đó) là người có được thiên nhãn, đang đứng nhìn trực tiếp các chúng sinh địa ngục.
Evaṃ manasi karotīti tesaṃ nerayikānaṃ nirayasaṃvattanikassa kammassa ñātukāmatāvasena pādakajjhānaṃ samāpajjitvā vuṭṭhāya parikammavasena manasi karoti.
He attends thus means that, desiring to know the kamma leading to the hellish realm of those hell-beings, he enters the basic jhāna, rises from it, and attends by way of preliminary preparation.
Evaṃ manasi karoti (người đó tác ý như vậy) có nghĩa là vì muốn biết nghiệp dẫn đến địa ngục của những chúng sinh địa ngục đó, người đó nhập thiền nền tảng, rồi xuất thiền và tác ý theo cách chuẩn bị.
Kiṃ nu khotiādi manasikāravidhidassanaṃ.
What then...? and so on shows the method of attention.
Kiṃ nu kho (phải chăng) v.v. là sự trình bày phương pháp tác ý.
Evaṃ pana parikammaṃ katvā pādakajjhānaṃ samāpajjitvā vuṭṭhitassa taṃ kammaṃ ārammaṇaṃ katvā āvajjanaṃ uppajjati, tasmiṃ niruddhe cattāri pañca vā javanāni javanti.
Having performed such preliminary work, having entered the basic jhāna and risen from it, an adverting consciousness arises, taking that kamma as its object. When that ceases, four or five javana-moments flash by.
Sau khi đã chuẩn bị như vậy, người đã nhập thiền nền tảng và xuất thiền, sự chú ý (āvajjana) khởi lên lấy nghiệp đó làm đối tượng. Khi sự chú ý đó diệt, bốn hoặc năm sát na tâm (javana) chạy.
Yesaṃ purimāni tīṇi cattāri vā parikammaupacārānulomagotrabhunāmakāni kāmāvacarāni, catutthaṃ pañcamaṃ vā appanācittaṃ rūpāvacaraṃ catutthajjhānikaṃ, tattha yaṃ tena appanācittena saddhiṃ uppannaṃ ñāṇaṃ, taṃ yathākammūpagañāṇanti veditabbaṃ.
Of these, the first three or four are sensuous sphere (kāmāvacara) moments of preliminary work (parikamma), access (upacāra), adaptation (anuloma), and change of lineage (gotrabhū); the fourth or fifth is the jhāna-absorption consciousness (appanācitta), which is a fourth jhāna consciousness of the fine-material sphere (rūpāvacara). The knowledge that arises with that jhāna-absorption consciousness is to be understood as the knowledge of beings according to their kamma (yathākammūpage ñāṇa).
Trong đó, ba hoặc bốn sát na tâm đầu tiên là các tâm giới dục mang tên parikamma, upacāra, anuloma, gotrabhū. Sát na tâm thứ tư hoặc thứ năm là tâm nhập định (appanācitta) thuộc giới sắc, tương ứng với thiền thứ tư. Trí tuệ khởi lên cùng với tâm nhập định đó cần được hiểu là trí tuệ tùy nghiệp (yathākammūpagañāṇa).
‘‘Visuṃ parikammaṃ natthī’’ti idaṃ pana dibbacakkhuñāṇena vinā yathākammūpagañāṇassa visuṃ parikammaṃ natthīti adhippāyena vuttaṃ.
But the statement "there is no separate preliminary work" is said with the intention that there is no separate preliminary work for the knowledge of beings according to their kamma without the divine eye.
Nhưng điều ‘‘Visuṃ parikammaṃ natthī’’ (không có sự chuẩn bị riêng biệt) này được nói với ý nghĩa rằng không có sự chuẩn bị riêng biệt cho trí tuệ tùy nghiệp nếu không có thiên nhãn.
Evañcetaṃ icchitabbaṃ, aññathā yathākammūpagañāṇassa mahaggatabhāvo eva na siyā.
And this should be desired thus; otherwise, the supramundane nature of the knowledge of beings according to their kamma would not exist.
Và điều này nên được chấp nhận như vậy, nếu không thì trí tuệ tùy nghiệp sẽ không có tính chất siêu thế (mahaggata).
Devānaṃ dassanepi eseva nayo.
The same method applies to seeing devas.
Đối với việc nhìn thấy các vị trời cũng theo cách tương tự.
Nerayikadevaggahaṇañcettha nidassanamattaṃ daṭṭhabbaṃ.
The inclusion of hell-beings and devas here should be understood as merely an example.
Và việc nắm giữ chúng sinh địa ngục và chư thiên ở đây cần được xem là chỉ là một ví dụ.
Ākaṅkhamāno hi dibbacakkhulābhī aññagatikesupi evaṃ paṭipajjatiyeva.
Indeed, a person who has attained the divine eye, if he wishes, can similarly proceed with regard to beings in other destinies as well.
Thật vậy, người có được thiên nhãn, nếu muốn, cũng thực hành như vậy đối với các cõi khác.
Tathā hi vakkhati ‘‘apāyaggahaṇena tiracchānayoniṃ dīpetī’’tiādi, ‘‘sugatiggahaṇena manussagatipi saṅgayhatī’’ti ca.
Thus, it will be said, "by the inclusion of woeful states, the animal realm is indicated" and so on, and "by the inclusion of good destinies, the human destiny is also encompassed."
Như Ngài sẽ nói “bằng cách nắm giữ các ác đạo, Ngài chỉ ra loài súc sinh”, v.v., và “bằng cách nắm giữ các thiện thú, cõi người cũng được bao gồm”.
Taṃ nirayasaṃvattaniyakammaṃ ārammaṇametassāti taṃkammārammaṇaṃ.
That kamma leading to the hellish realm is its object; hence, that kamma is its object (taṃkammārammaṇaṃ).
Nghiệp dẫn đến địa ngục đó là đối tượng của trí tuệ này, vì vậy gọi là taṃkammārammaṇaṃ (có nghiệp đó làm đối tượng).
Phārusakavanādīsū ti ādi-saddena cittalatāvanādīnaṃ saṅgaho.
In Phārusakavana and so on, the word ādi (and so on) includes Cittalatāvana and other forests.
Trong phārusakavanādīsu (trong các khu rừng gai góc, v.v.), từ ādi (v.v.) bao gồm các khu vườn Cittalatā, v.v.
Yathā cimassāti yathā ca imassa yathākammūpagañāṇassa visuṃ parikammaṃ natthi, evaṃ anāgataṃsañāṇassapīti visuṃ parikammābhāvañca nidasseti.
Just as for this, it also indicates the absence of separate preliminary work for the knowledge of future events (anāgataṃsañāṇa), similar to how there is no separate preliminary work for this knowledge of beings according to their kamma.
Yathā cimassā (cũng như của cái này) cũng như trí tuệ tùy nghiệp này không có sự chuẩn bị riêng biệt, trí tuệ biết tương lai cũng vậy, Ngài cũng chỉ ra sự không có sự chuẩn bị riêng biệt.
Tattha kāraṇamāha ‘‘dibbacakkhupādakāneva hi imānī’’ti.
The reason for that is stated: "for these are indeed based on the divine eye".
Ở đó, Ngài nói lý do ‘‘dibbacakkhupādakāneva hi imānī’’ (thật vậy, những điều này chỉ có thiên nhãn làm nền tảng).
Tatrāyamadhippāyo – yathā dibbacakkhulābhī nirayādiabhimukhaṃ ālokaṃ vaḍḍhetvā nerayikādike satte disvā tehi pubbe āyūhitaṃ nirayasaṃvattaniyādikaṃ kammaṃ tādisena samādānena tajjena ca manasikārena parikkhate citte yāthāvato jānāti, evaṃ yassa yassa sattassa samanantaraṃ anāgataṃ attabhāvaṃ ñātukāmo, taṃ taṃ odissa ālokaṃ vaḍḍhetvā tena tena atīte etarahi vā āyūhitaṃ tassa nibbattakaṃ kammaṃ yathākammūpagañāṇena disvā tena tena nibbattetabbaṃ anāgataṃ attabhāvaṃ ñātukāmo tādisena samādānena tajjena ca manasikārena parikkhate citte yāthāvato jānāti.
The intention here is this: just as one who has attained the divine eye, by increasing the light directed towards hell and so on, sees the beings in hell and so forth, and accurately knows the kamma leading to the hellish realm, and so on, previously accumulated by them, in a mind purified by such resolve and corresponding attention; similarly, whoever desires to know the immediate next existence of any being, directs the light towards that being, increases it, and having seen the kamma accumulated by that being in the past or present, which produces that existence, through the knowledge of beings according to their kamma, that person, desiring to know the future existence to be produced by that kamma, accurately knows it in a mind purified by such resolve and corresponding attention.
Ý nghĩa ở đây là: cũng như người có được thiên nhãn, sau khi tăng cường ánh sáng hướng về địa ngục, v.v., và nhìn thấy các chúng sinh địa ngục, v.v., biết rõ nghiệp dẫn đến địa ngục, v.v., mà họ đã tạo ra trước đó, trong tâm đã được thanh lọc bằng sự định tâm như vậy và sự tác ý tương ứng; cũng vậy, người muốn biết kiếp sống kế tiếp của bất kỳ chúng sinh nào, sau khi hướng tâm đến chúng sinh đó và tăng cường ánh sáng, và sau khi nhìn thấy nghiệp tạo ra kiếp sống đó mà chúng sinh đó đã tạo ra trong quá khứ hoặc hiện tại bằng trí tuệ tùy nghiệp, người muốn biết kiếp sống tương lai mà nghiệp đó sẽ tạo ra, biết rõ điều đó trong tâm đã được thanh lọc bằng sự định tâm như vậy và sự tác ý tương ứng.
Esa nayo tato paresupi attabhāvesu.
The same method applies to subsequent existences.
Cách này cũng tương tự đối với các kiếp sống sau đó.
Etaṃ anāgataṃsañāṇaṃ nāma.
This is called the knowledge of future events.
Đây được gọi là trí tuệ biết tương lai (anāgataṃsañāṇa).
Yasmā etaṃ dvayaṃ dibbacakkhuñāṇe sati eva sijjhati, nāsati.
Because these two are perfected only when the divine eye knowledge is present, and not when it is absent.
Vì hai điều này chỉ thành tựu khi có thiên nhãn, chứ không phải khi không có.
Tena vuttaṃ ‘‘imāni dibbacakkhunā saheva ijjhantī’’ti.
Therefore, it is said: "these are perfected together with the divine eye".
Vì vậy, Ngài nói ‘‘imāni dibbacakkhunā saheva ijjhantī’’ (những điều này thành tựu cùng với thiên nhãn).
Kāyena duccaritaṃ, kāyato vā uppannaṃ duccaritanti kāyena duṭṭhu caritaṃ, kāyato vā uppannaṃ kilesapūtikattā duṭṭhu caritaṃ kāyaduccaritanti evaṃ yathākkamaṃ yojetabbaṃ.
Bodily misconduct, or misconduct arisen from the body (kāyena duccaritaṃ, kāyato vā uppannaṃ duccaritaṃ), should be construed respectively as evil conduct by the body, or evil conduct arisen from the body due to its defiled and rotten nature, thus it is bodily misconduct.
Kāyena duccaritaṃ, kāyato vā uppannaṃ duccarita (ác hạnh bằng thân, hoặc ác hạnh khởi lên từ thân) cần được kết nối theo thứ tự như sau: ác hạnh được thực hiện bằng thân, hoặc ác hạnh khởi lên từ thân do bị ô nhiễm bởi các phiền não, được gọi là kāyaduccarita (thân ác hạnh).
Kāyoti cettha copanakāyo adhippeto.
Here, body (kāyo) refers to the inciting body (copenakāya).
Ở đây, kāyo (thân) có nghĩa là thân hành động (copenakāya).
Kāyaviññattivasena pavattaṃ akusalaṃ kāyakammaṃ kāyaduccaritaṃ.
Unwholesome bodily kamma that arises by way of bodily intimation is bodily misconduct.
Nghiệp bất thiện biểu hiện qua thân biểu tri (kāyaviññatti) là thân ác hạnh (kāyaduccarita).
Yasmiṃ santāne kammaṃ katupacitaṃ, asati āhārupacchede vipākārahasabhāvassa avigacchanato so tena sahitoyevāti vattabboti āha ‘‘samannāgatāti samaṅgībhūtā’’ti.
He says: “are endowed with, that is, possessed of” (samannāgatāti samaṅgībhūtā), because in the continuum of existence where kamma has been accumulated, if the condition for its fruit is not suppressed, it does not cease to be capable of producing results; thus, one is said to be accompanied by it.
Trong dòng tâm thức nào mà nghiệp đã được tạo và tích lũy, khi không có sự cắt đứt nhân duyên, thì trạng thái xứng đáng cho quả báo không mất đi. Do đó, nên nói rằng người ấy 'có đầy đủ' (samannāgata) nghiệp đó, tức là 'hòa nhập' (samaṅgībhūta) với nó.
Anatthakāmā hutvāti etena mātāpitaro viya puttānaṃ, ācariyupajjhāyā viya ca nissitakānaṃ atthakāmā hutvā garahakā upavādakā na hontīti dasseti.
With the phrase “not being desirous of their harm”, it shows that parents are not censurers or blamers of their children, nor are teachers and preceptors of their dependants, out of a desire for their good.
Với lời 'không mong muốn điều bất lợi' (anatthakāmā hutvā), điều này cho thấy rằng, giống như cha mẹ mong muốn điều lợi ích cho con cái, và các vị thầy tổ (ācariyupajjhāyā) mong muốn điều lợi ích cho đệ tử (nissitakāna), họ không trở thành những người quở trách hay chỉ trích.
Guṇaparidhaṃsanenāti vijjamānānaṃ guṇānaṃ viddhaṃsanena, vināsanenāti attho.
“By disparaging qualities” means by destroying existing qualities, or by ruining them.
Với lời 'do làm suy giảm phẩm hạnh' (guṇaparidhaṃsanena), nghĩa là do hủy hoại, làm mất đi những phẩm hạnh đang hiện hữu.
Nanu ca antimavatthunāpi upavādo guṇaparidhaṃsanamevāti?
Is it not the case that even with a parajika offense, the disparagement of qualities is still considered such?
Há chẳng phải sự chỉ trích bằng một hành động cuối cùng (antimavatthu) cũng là sự làm suy giảm phẩm hạnh sao?
Saccametaṃ, guṇāti panettha jhānādivisesā uttarimanussadhammā adhippetāti sīlaparidhaṃsanaṃ visuṃ gahitaṃ.
That is true, but here, by “qualities” are intended the special attainments like jhanas, i.e., states superior to human; therefore, disparagement of sīla is taken separately.
Điều này đúng vậy, nhưng ở đây, 'phẩm hạnh' (guṇa) được hiểu là các đặc tính siêu phàm của bậc Thánh (uttarimanussadhamma) như thiền định, v.v. Do đó, sự làm suy giảm giới hạnh (sīlaparidhaṃsana) được đề cập riêng.
Tenāha ‘‘natthi imesaṃ samaṇadhammo’’tiādi.
Hence it is said, “these have no recluse’s conduct”, etc.
Vì thế, có lời nói 'những người này không có pháp Sa-môn' (natthi imesaṃ samaṇadhammo) v.v.
Samaṇadhammoti ca sīlasaṃyamaṃ sandhāya vadati.
And “recluse’s conduct” here refers to sīla and restraint.
Và 'pháp Sa-môn' (samaṇadhammo) ở đây ám chỉ giới luật và sự tự chế (sīlasaṃyama).
Jānaṃ vāti yaṃ upavadati, tassa ariyabhāvaṃ jānanto vā.
“Knowing” means knowing that the person he is reviling is an Arahant.
'Biết rõ' (jānaṃ vā) nghĩa là biết rõ người mà mình chỉ trích là bậc Thánh.
Ajānaṃ vāti ajānanto vā.
“Or not knowing” means not knowing.
'Không biết rõ' (ajānaṃ vā) nghĩa là không biết rõ.
Jānanājānanañcettha appamāṇaṃ, ariyabhāvo eva pamāṇaṃ.
In this case, knowing or not knowing is not the criterion; the Arahant’s state itself is the criterion.
Ở đây, việc biết hay không biết không phải là thước đo, mà trạng thái bậc Thánh mới là thước đo.
Tenāha ‘‘ubhayathāpi ariyūpavādova hotī’’ti.
Hence he said, “in both ways, it is a reviling of a Noble One”.
Vì thế, có lời nói 'dù thế nào thì đó cũng là sự chỉ trích bậc Thánh' (ariyūpavādova hotī).
‘‘Ariyoti pana ajānato aduṭṭhacittasseva tattha ariyaguṇabhāvaṃ pavedentassa guṇaparidhaṃsanaṃ na hotīti tassa ariyūpavādo natthī’’ti vadanti.
However, some say that if one reviles a Noble One unknowingly and with an uncorrupted mind, while making known that the Noble One possesses Noble qualities, then it is not a disparagement of qualities, and thus there is no "reviling of a Noble One" for that person.
Tuy nhiên, một số người nói rằng: "Nếu một người không biết người kia là bậc Thánh và tâm không ác ý, chỉ muốn cho người kia biết về phẩm hạnh của bậc Thánh thì đó không phải là sự làm suy giảm phẩm hạnh, và do đó, người ấy không phạm tội chỉ trích bậc Thánh (ariyūpavāda)."
Bhāriyaṃ kammanti ānantariyasadisattā bhāriyaṃ kammaṃ, satekicchaṃ pana hoti khamāpanena, na ānantariyaṃ viya atekicchaṃ.
“A grave action” is a grave action because it is similar to an anantarika kamma, but it is remediable through asking for forgiveness, unlike an anantarika kamma which is irremediable.
'Nghiệp nặng' (bhāriyaṃ kammaṃ) là nghiệp nặng vì tương tự như nghiệp vô gián (ānantariya). Tuy nhiên, nó có thể được khắc phục bằng cách xin lỗi (khamāpana), không phải là nghiệp không thể khắc phục như nghiệp vô gián.
Tassa ca āvibhāvatthanti bhāriyādisabhāvassa pakāsanatthaṃ.
“And for making that clear” is for making clear its grave nature and so on.
'Để làm rõ điều đó' (tassa ca āvibhāvatthaṃ) nghĩa là để làm rõ bản chất nặng nề của nó.
Taṃ jigucchīti taṃ theraṃ, taṃ vā kiriyaṃ jigucchi.
“He abhorred that” means he abhorred that elder, or that action.
'Ông ta ghê tởm điều đó' (taṃ jigucchī) nghĩa là ông ta ghê tởm vị Trưởng lão đó, hoặc ghê tởm hành động đó.
Aticchātoti ativiya khudābhibhūto.
“Extremely hungry” means severely afflicted by hunger.
'Rất đói' (aticchāto) nghĩa là bị đói khát hành hạ quá mức.
Mahallakoti samaṇānaṃ sāruppamasāruppaṃ, lokasamudācāramattaṃ vā na jānātīti adhippāyena vuttattā guṇaparidhaṃsanena garahatīti veditabbaṃ.
“An old man”: This should be understood as disparaging qualities, as it implies that he does not know what is proper and improper for monastics, or merely worldly customs.
Nên hiểu rằng 'vị già cả' (mahallako) được nói với ý rằng ông ta không biết điều gì phù hợp hay không phù hợp đối với các Sa-môn, hoặc chỉ là phong tục thế gian, và ông ta chỉ trích bằng cách làm suy giảm phẩm hạnh.
Amhākaṃ lajjitabbakaṃ akāsīti ‘‘samaṇena nāma evaṃ kata’’nti vutte mayaṃ sīsaṃ ukkhipituṃ na sakkomāti adhippāyo.
“He made us ashamed”: The meaning is that if it is said, “A monastic did such a thing,” we cannot lift our heads.
'Đã làm chúng tôi phải xấu hổ' (amhākaṃ lajjitabbakaṃ akāsī) có nghĩa là: "Khi người ta nói 'một Sa-môn đã làm điều như vậy', chúng tôi không thể ngẩng đầu lên được."
Jānanto eva thero ‘‘atthi te āvuso imasmiṃ sāsane patiṭṭhā’’ti pucchi.
Knowing this, the elder asked, “Friend, do you have any foundation in this Dispensation?”
Vị Trưởng lão biết rõ điều đó, đã hỏi: 'Này Hiền giả, ông có chỗ đứng vững chắc nào trong giáo pháp này không?' (atthi te āvuso imasmiṃ sāsane patiṭṭhā).
Itaropi saccābhisamayo sāsane patiṭṭhāti āha ‘‘sotāpanno aha’’nti.
The other replied, understanding that the realization of the truth is the foundation in the Dispensation: “I am a Stream-Enterer.”
Vị kia cũng nói rằng sự chứng ngộ chân lý là chỗ đứng vững chắc trong giáo pháp: 'Tôi là bậc Dự Lưu' (sotāpanno ahaṃ).
Thero taṃ karuṇāyamāno ‘‘khīṇāsavo tayā upavadito’’ti attānaṃ āvi akāsi.
The elder, feeling compassion for him, revealed himself, saying, “You have reviled an Arahant.”
Vị Trưởng lão, vì lòng từ bi đối với người đó, đã tự tiết lộ mình: 'Ông đã chỉ trích một vị A-la-hán' (khīṇāsavo tayā upavadito).
Tenassa taṃ pākatikaṃ ahosīti tena assa taṃ kammaṃ maggāvaraṇaṃ nāhosīti adhippāyo.
“Then that became normal for him”: The meaning is that by that act, his kamma did not become an obstruction to the Path.
'Vì thế, điều đó trở nên bình thường đối với ông ta' (tenassa taṃ pākatikaṃ ahosī) có nghĩa là nghiệp đó không còn là chướng ngại cho đạo lộ (maggāvaraṇa) đối với người ấy.
Pubbeva pana sotāpannattā apāyagāmīnaṃ suppahīnabhāvato saggāvaraṇamassa kātumasamatthameva taṃ kammaṃ.
However, since he was already a Stream-Enterer, and states leading to the lower realms are completely eradicated, that kamma was unable to obstruct his path to heaven.
Tuy nhiên, vì người ấy đã là bậc Dự Lưu từ trước, và các nghiệp dẫn đến khổ cảnh đã được đoạn trừ hoàn toàn, nên nghiệp đó không có khả năng tạo thành chướng ngại cho thiên giới (saggāvaraṇa) đối với người ấy.
Attanā vuḍḍhataro hotīti ettha ‘‘ukkuṭikaṃ nisīditvā khamāpetabbo’’ti visuddhimagge vuttaṃ.
Here, in “he is older than oneself”, it is said in the Visuddhimagga that one should ask for forgiveness while squatting.
Ở đây, với lời 'người lớn tuổi hơn mình' (attanā vuḍḍhataro hoti), trong Thanh Tịnh Đạo (Visuddhimagga) có nói rằng 'phải quỳ gối xin lỗi' (ukkuṭikaṃ nisīditvā khamāpetabbo).
Sotāpannasakadāgāmino dosenapi nakkhamanti, sesaariyā vā tassa atthakāmā hutvā āyatiṃ saṃvaraṇatthāya na khamāpeyyunti āha ‘‘sace so nakkhamatī’’ti.
If Stream-Enterers and Once-Returners do not forgive due to anger, or if other Noble Ones, desiring the good of that person, do not forgive for the sake of future restraint, then it is said, “if he does not forgive.”
Các bậc Dự Lưu (Sotāpanna) và Nhất Lai (Sakadāgāmi) không tha thứ ngay cả khi có lỗi lầm, hoặc các bậc Thánh khác, vì mong muốn điều lợi ích cho người đó, sẽ không tha thứ để người ấy có thể tự kiềm chế trong tương lai. Vì thế, có lời nói 'nếu người đó không tha thứ' (sace so nakkhamati).
Attanā vuḍḍhataro hoti, ṭhitakenevāti etthāpi ‘‘ukkuṭikaṃ nisīditvā’’ti visuddhimagge (visuddhi. 2.411) vuttaṃ.
Here too, in “he is older than oneself, while standing”, it is said in the Visuddhimagga (Visuddhi. 2.411):
Ở đây, với lời 'người lớn tuổi hơn mình, đứng yên' (attanā vuḍḍhataro hoti, ṭhitakenevā), trong Thanh Tịnh Đạo (Visuddhi. 2.411) cũng có nói 'phải quỳ gối' (ukkuṭikaṃ nisīditvā).
Evañhi tattha vuttaṃ –
For it is stated there:
Trong đó, điều này được nói như sau:
Viparītaṃ dassanametesanti viparītadassanā.
“Those with perverted views” (viparītadassanā) means those whose views are contrary.
'Những người có tà kiến' (viparītadassanā) là những người có cái thấy sai lệch.
Samādātabbaṭṭhena samādānāni, kammāni samādānāni yesaṃ te kammasamādānā, micchādiṭṭhivasena kammasamādānā micchādiṭṭhikammasamādānā, hetuatthaṃ vā antogadhaṃ katvā micchādiṭṭhivasena pare kammesu samādāpakā micchādiṭṭhikammasamādānā.
"Samādānā" refers to actions because they are to be undertaken. Those whose actions are samādāna are "kammasamādānā". "Micchādiṭṭhikammasamādānā" are those whose actions are samādāna due to wrong view, or, including the meaning of cause, "Micchādiṭṭhikammasamādānā" are those who cause others to undertake actions due to wrong view.
Các hành động được gọi là 'samādāna' vì chúng được thực hiện một cách kiên quyết. Những người có các hành động được thực hiện một cách kiên quyết (kammāni samādānāni) được gọi là 'kammasamādānā'. Hoặc, những người 'kammasamādānā' do tà kiến (micchādiṭṭhivasena) là những người có các hành động được thực hiện một cách kiên quyết do tà kiến. Hoặc, bao gồm ý nghĩa nhân quả, 'micchādiṭṭhikammasamādānā' là những người khiến người khác thực hiện các hành động do tà kiến (micchādiṭṭhivasena pare kammesu samādāpakā).
Tayimaṃ atthaṃ dassento ‘‘micchādiṭṭhivasenā’’tiādimāha.
To show this meaning, he says, “due to wrong view,” and so on.
Để chỉ rõ ý nghĩa này, Ngài đã nói 'do tà kiến' (micchādiṭṭhivasenā) v.v.
Ye ca…pe… samādapenti, tepi micchādiṭṭhikammasamādānāti yojetabbaṃ.
And those who… also cause them to undertake, they too are to be connected as those who undertake actions due to wrong view.
Và những người... v.v... khiến người khác thực hiện (samādapenti), họ cũng được gọi là những người có hành động do tà kiến (micchādiṭṭhikammasamādānā).
Sīlasampannotiādi paripakkindriyassa maggasamaṅgino vasena vuttaṃ, aggamaggaṭṭhe pana vattabbameva natthi.
“Endowed with sīla” and so on, are said in reference to a person whose faculties are fully developed and who is endowed with the Path; there is nothing to be said about one who has attained the highest Path.
Lời 'giới hạnh viên mãn' (sīlasampanno) v.v. được nói theo nghĩa của một người có căn lành đã chín muồi, đã chứng đắc đạo lộ. Đối với người đã chứng đắc A-la-hán đạo, thì không cần phải nói nữa.
Atha vā aggamaggapariyāpannā eva sīlādayo veditabbā.
Alternatively, sīla and other qualities should be understood as being included in the highest Path.
Hoặc, giới hạnh, v.v. cần được hiểu là đã bao gồm trong A-la-hán đạo (aggamagga).
Aggamaggaṭṭhassa hi diṭṭheva dhamme ekaṃsikā aññārādhanā, itaresaṃ anekaṃsikā.
Indeed, for one who has attained the highest Path, the attainment of Nibbāna in this very life is certain, while for others it is uncertain.
Vì đối với người đã chứng đắc A-la-hán đạo, sự chứng ngộ (aññārādhanā) là chắc chắn (ekaṃsikā) ngay trong hiện tại (diṭṭheva dhamme), còn đối với những người khác thì không chắc chắn (anekaṃsikā).
Aññanti arahattaṃ.
“Other” means Arahantship.
'Sự chứng ngộ' (aññaṃ) là A-la-hán quả (arahattaṃ).
Evaṃsampadamidanti ettha sampajjanaṃ sampadā, nipphatti, evaṃ avirajjhanakanipphattikanti attho, yathā taṃ avassambhāvī, evamidampīti vuttaṃ hoti.
In Evaṃsampadamidaṃ, sampadā means accomplishment, completion; the meaning is unfailing completion, just as that (fruit) is certain to be, so is this (stated).
Trong từ Evaṃsampadamida (Thành tựu như vậy), sampajjanaṃ (sự thành tựu) là sampadā (sự thành tựu), nipphatti (sự hoàn thành), nghĩa là sự hoàn thành không sai lệch như vậy. Điều đó có nghĩa là, giống như quả Thánh chắc chắn sẽ sinh khởi ngay sau con đường (Đạo), thì điều này (sự tái sinh vào địa ngục) cũng chắc chắn sẽ xảy ra ngay sau khi người này chết.
Yathā hi maggānantaraṃ avirajjhitvāva phalaṃ nibbattaṃ, evametaṃ imassapi puggalassa cutianantaraṃ avirajjhitvāva niraye paṭisandhi hotīti dasseti.
It shows that just as the fruit arises immediately after the path without fail, so too does rebirth in hell occur immediately after this person's passing away, without fail.
Thật vậy, giống như quả (Thánh) sinh khởi ngay sau con đường (Đạo) mà không sai lệch, thì nghiệp này (tức là lời phỉ báng bậc Thánh) cũng khiến cho sự tái sinh vào địa ngục của người này chắc chắn xảy ra ngay sau khi chết, điều này cho thấy.
Sakalasmiñhi buddhavacane na imāya upamāya gāḷhataraṃ katvā vuttaupamā atthi.
Indeed, in the entire Buddha's teaching, there is no simile more forceful than this one.
Trong toàn bộ lời dạy của Đức Phật, không có ví dụ nào được nêu ra mạnh mẽ hơn ví dụ này.
Taṃ vācaṃ appahāyātiādīsu (ma. ni. aṭṭha. 1.149) ariyūpavādaṃ sandhāya ‘‘puna evarūpiṃ vācaṃ na vakkhāmī’’ti vadanto vācaṃ pajahati nāma, ‘‘puna evarūpaṃ cittaṃ na uppādessāmī’’ti cintento cittaṃ pajahati nāma, ‘‘puna evarūpiṃ diṭṭhiṃ na gaṇhissāmī’’ti pajahanto diṭṭhiṃ pajahati nāma.
In Taṃ vācaṃ appahāyā and so on, referring to slandering Noble Ones: one who says "I will not utter such a speech again" abandons speech; one who thinks "I will not generate such a thought again" abandons thought; one who abandons saying "I will not grasp such a view again" abandons view.
Trong các câu như Taṃ vācaṃ appahāyā (không từ bỏ lời nói đó), v.v., ý muốn nói đến sự phỉ báng bậc Thánh: người nói "Tôi sẽ không nói lời như vậy nữa" là từ bỏ lời nói; người suy nghĩ "Tôi sẽ không khởi tâm như vậy nữa" là từ bỏ tâm; người từ bỏ "Tôi sẽ không chấp thủ tà kiến như vậy nữa" là từ bỏ tà kiến.
Tathā akaronto neva pajahati na paṭinissajjati.
One who does not act thus neither abandons nor relinquishes.
Nếu không làm như vậy, người đó không từ bỏ cũng không xả bỏ.
Yathābhataṃ nikkhitto evaṃ nirayeti yathā nirayapālehi āharitvā niraye ṭhapito, evaṃ niraye ṭhapitoyeva, nāssa nirayūpapattiyā koci vibandho.
Yathābhataṃ nikkhitto evaṃ niraye means just as one is carried by the guardians of hell and placed in hell, so too is one placed in hell; there is no hindrance to their rebirth in hell.
Yathābhataṃ nikkhitto evaṃ niraye (như bị quăng vào địa ngục) nghĩa là như bị các ngục tốt địa ngục mang đến và đặt vào địa ngục; người đó đã bị đặt vào địa ngục, không có gì ngăn cản việc người đó tái sinh vào địa ngục.
Tatrāyaṃ yutti – nirayūpago ariyūpavādī tadādāyakassa avijahanato seyyathāpi micchādiṭṭhīti.
Here is the reason: a slanderer of Noble Ones is destined for hell due to not abandoning that (wrong view), just like one with wrong view.
Trong trường hợp này, lý lẽ là: kẻ phỉ báng bậc Thánh chắc chắn sẽ đi đến địa ngục, bởi vì người đó không từ bỏ sự chấp thủ đó, giống như một kẻ tà kiến.
Ettha ca ‘‘taṃ vācaṃ appahāyā’’ti evamādivacanena tadādāyakassa appahāneneva ariyūpavādo antarāyiko anatthāvahova, pahānena pana accayaṃ desetvā khamāpanena na antarāyiko anatthāvaho yathā taṃ vuṭṭhitā desitā ca āpattīti dasseti.
And here, by phrases such as "without abandoning that speech," it is shown that slandering Noble Ones, through not abandoning that (wrong view), is indeed an obstruction and leads to harm, but by abandoning (the wrong view), confessing the transgression, and seeking forgiveness, it is not an obstruction nor leads to harm, just as an offense that has arisen and been confessed.
Ở đây, với câu nói “taṃ vācaṃ appahāyā” (không từ bỏ lời nói đó) và những câu tương tự, cho thấy rằng sự phỉ báng bậc Thánh sẽ gây chướng ngại và mang lại tai họa nếu không từ bỏ sự chấp thủ đó; nhưng nếu từ bỏ, tức là sám hối và xin tha thứ, thì nó sẽ không gây chướng ngại và không mang lại tai họa, giống như một lỗi đã phát sinh và đã được sám hối.
Micchādiṭṭhivasena akattabbaṃ nāma pāpaṃ natthi, yato saṃsārakhāṇubhāvopi nāma hotīti āha ‘‘micchādiṭṭhiparamāni, bhikkhave, vajjānī’’ti.
There is no evil deed that should not be done by one with wrong view, because it can even lead to being a stump in saṃsāra, thus it is said: "Wrong views, bhikkhus, are the worst transgressions."
Không có điều ác nào không thể làm bởi tà kiến, vì nó có thể trở thành gốc rễ của luân hồi, do đó Đức Phật nói: “Này các Tỳ-kheo, các tội lỗi tột cùng là tà kiến.”
‘‘Ucchinnabhavanettiko, bhikkhave, tathāgatassa kāyo tiṭṭhati (dī. ni. 1. 147), ayañceva kāyo bahiddhā ca nāmarūpa’’nti ca evamādīsu viya idha kāya-saddo khandhapañcakavisayoti āha ‘‘kāyassa bhedāti upādinnakkhandhapariccāgā’’ti.
Here, like in phrases such as "Bhikkhus, the Tathāgata's body remains, with the net of existence cut off, and this body and name-and-form outside," the word kāya refers to the five aggregates, thus it is said: "By the breaking of the body" means the relinquishing of the aggregates sustained by clinging.
Giống như trong các câu như “Này các Tỳ-kheo, thân của Như Lai vẫn còn tồn tại với dòng tái sinh đã bị cắt đứt; chỉ có thân này và danh sắc bên ngoài” và những câu tương tự, ở đây từ kāya (thân) có nghĩa là năm uẩn. Do đó, Đức Phật nói: “kāyassa bhedāti upādinnakkhandhapariccāgā” (sự tan rã của thân là sự từ bỏ các uẩn bị chấp thủ).
Avītarāgassa maraṇato paraṃ nāma bhavantarūpādānamevāti āha ‘‘paraṃ maraṇāti tadanantaraṃ abhinibbattakkhandhaggahaṇe’’ti.
For one without eradicated defilements, after death means only grasping aggregates in another existence, thus it is said: "After death" means the seizing of the aggregates that arise immediately thereafter.
Sau khi chết, đối với người chưa ly tham, chỉ có sự chấp thủ vào một kiếp sống khác. Do đó, Đức Phật nói: “paraṃ maraṇāti tadanantaraṃ abhinibbattakkhandhaggahaṇe” (sau khi chết là sự chấp thủ vào các uẩn mới sinh khởi ngay sau đó).
Yena tiṭṭhati, tassa upacchedeneva kāyo bhijjatīti āha ‘‘kāyassa bhedāti jīvitindriyassa upacchedā’’ti.
The body breaks through the cessation of that by which it endures, thus it is said: "By the breaking of the body" means the cessation of the life-faculty.
Thân thể tồn tại nhờ vào sinh mạng (jīvitindriya), và sự tan rã của thân thể xảy ra khi sinh mạng bị cắt đứt. Do đó, Đức Phật nói: “kāyassa bhedāti jīvitindriyassa upacchedā” (sự tan rã của thân là sự cắt đứt sinh mạng).
Eti imasmā sukhanti ayo, puññanti āha ‘‘puññasammatā ayā’’ti.
That which comes from this as happiness is aya, merit, thus it is said: "Aya," reckoned as merit.
Từ thiện nghiệp này mà hạnh phúc sinh khởi, đó là phước. Do đó, Đức Phật nói: “puññasammatā ayā” (phước được xem là sự đến).
Āyanti etasmā sukhānīti āyo, puññakammādīnaṃ sukhasādhanaṃ.
That from which happiness comes is āya, the means of happiness for meritorious deeds and so on.
Từ đó mà hạnh phúc sinh khởi, đó là āyo, tức là phương tiện mang lại hạnh phúc của các thiện nghiệp, v.v.
Tenāha ‘‘sukhānaṃ vā āyassa abhāvā’’ti.
Therefore, it is said: "Or from the absence of the source of happiness."
Vì thế, Đức Phật nói: “sukhānaṃ vā āyassa abhāvā” (hoặc do không có sự đến của hạnh phúc).
Vivasāti kammassa vase vattanato attano vase vattituṃ na sakkontīti vigato vaso etesanti vivasā, avasavattinoti attho.
Vivasā means that, being subject to kamma, they cannot act according to their own will, thus vigato vaso etesaṃ means those whose will has departed; the meaning is 'not masters of themselves.'
Vivasā (không tự chủ) nghĩa là không thể tự chủ do bị nghiệp chi phối, tức là những người không có sự tự chủ.
Iyati assādīyatīti ayo, assādoti āha ‘‘assādasaññito ayo’’ti.
That which is enjoyed is aya, enjoyment, thus it is said: "Aya," designated as enjoyment.
Iyati assādīyati (được hưởng thụ) là āyo (sự hưởng thụ), tức là assādo (sự thích thú). Do đó, Đức Phật nói: “assādasaññito ayo” (āyo được gọi là sự thích thú).
Nāgarājādīnanti ādi-saddena supaṇṇādīnaṃ saṅgaho.
In Nāgarājādīnaṃ, the word ādi includes supaṇṇas and so on.
Trong từ Nāgarājādīna (của các vua Nāga, v.v.), từ ādi (v.v.) bao gồm các loài như Supaṇṇa (Kim Sí Điểu), v.v.
Asurasadisanti petāsurasadisaṃ.
Asurasadisaṃ means similar to peta-asuras.
Asurasadisa (giống như Asura) nghĩa là giống như các loài ngạ quỷ Asura.
So hīti so asurakāyo.
So hi means that asura body.
So hī (thật vậy, thân đó) nghĩa là thân Asura đó.
Sabbasamussayehīti sabbehi sampattisamussayehi, sabbasampattirāsitoti vuttaṃ hoti.
Sabbasamussayehi means from all heaps of prosperity, that is, from all accumulations of success.
Sabbasamussayehī (từ tất cả các sự tích lũy) nghĩa là từ tất cả các sự tích lũy của cải, tức là từ tất cả các khối tài sản.
Vuttavipariyāyenāti ‘‘suṭṭhu caritaṃ, sobhanaṃ vā caritaṃ anavajjattāti sucarita’’ntiādinā kāyaduccaritenātiādīnaṃ padānaṃ vuttassa atthassa vipariyāyena.
Vuttavipariyāyena means by the opposite of the meaning stated for terms like "evil conduct of body" and so on, which begin with "well-conducted, or beautiful conduct, being blameless, is sucarita."
Vuttavipariyāyenā (bằng cách ngược lại với những gì đã nói) nghĩa là bằng cách ngược lại với ý nghĩa đã được nói của các từ như kāyaduccarita (ác hạnh thân), v.v., bắt đầu bằng "sucarita (thiện hạnh) là hành động tốt, hoặc hành động đẹp, không có lỗi lầm".
‘‘Ito bho sugatiṃ gacchā’’ti (itivu. 83) vacanato manussagatipi sugatiyevāti āha ‘‘sugatiggahaṇena manussagatipi saṅgayhatī’’ti.
Since human existence is also a good destination according to the saying "Go, sirs, to a good destination from here," it is said: "By the term 'good destination,' human existence is also included."
Theo câu “Này các bạn, từ đây các bạn đi đến thiện thú” (Itivu. 83), cõi người cũng là một thiện thú. Do đó, Đức Phật nói: “sugatiggahaṇena manussagatipi saṅgayhatī” (cõi người cũng được bao gồm trong từ thiện thú).
Sesamettha vuttanayattā uttānatthato ca suviññeyyameva.
The rest here is easily understood, being explained according to the method already stated and having a clear meaning.
Phần còn lại ở đây dễ hiểu vì đã được giải thích theo cách đã nói và ý nghĩa rõ ràng.
14. Vipassanāpādakanti vipassanāya padaṭṭhānabhūtaṃ.
14. Vipassanāpādakaṃ means that which serves as the proximate cause for insight (vipassanā).
14. Vipassanāpādaka (nền tảng của Vipassanā) nghĩa là nền tảng cho Vipassanā.
Vipassanā ca tividhā vipassakapuggalabhedena.
Insight, furthermore, is threefold according to the distinction of the practitioners of insight.
Vipassanā có ba loại tùy theo sự khác biệt của người hành Vipassanā.
Mahābodhisattānañhi paccekabodhisattānañca cintāmayañāṇasaṃvaddhitattā sayambhūñāṇabhūtā, itaresaṃ sutamayañāṇasaṃvaddhitattā paropadesasambhūtā.
For Great Bodhisattas and Paccekabuddha Bodhisattas, it is self-arisen knowledge, cultivated by intellectual knowledge; for others (disciples), it is born of others' instruction, cultivated by knowledge gained through listening.
Đối với các vị Đại Bồ-tát và Độc Giác Bồ-tát, đó là trí tự sinh (sayambhūñāṇa) được phát triển bởi tư duy trí tuệ (cintāmayañāṇa); đối với những người khác, đó là trí tuân theo lời dạy của người khác (paropadesasambhūtā) được phát triển bởi nghe pháp trí tuệ (sutamayañāṇa).
Sā ‘‘ṭhapetvā nevasaññānāsaññāyatanaṃ avasesarūpārūpajjhānānaṃ aññatarato vuṭṭhāyā’’tiādinā anekadhā arūpamukhavasena catudhātuvavatthāne vuttānaṃ tesaṃ tesaṃ dhātupariggahamukhānaṃ aññataramukhavasena anekadhāva visuddhimagge nānānayato vibhāvitā.
This (insight), in its many varieties, as stated in the analysis of the four elements in the Visuddhimagga in various ways by means of formless states, beginning with "having emerged from one of the rūpa- and arūpa-jhānas, except the sphere of neither-perception-nor-non-perception," and by means of one or another of the aforementioned ways of apprehending the elements, is expounded in manifold ways.
Vipassanā này được giải thích theo nhiều cách khác nhau trong Thanh Tịnh Đạo (Visuddhimagga), thông qua một trong những phương pháp phân tích các yếu tố (dhātupariggahamukha) đã được đề cập trong phần phân loại bốn yếu tố (catudhātuvavatthāna) bằng cách lấy vô sắc làm cửa ngõ, bắt đầu từ “trừ phi từ tầng thiền phi tưởng phi phi tưởng xứ, còn lại là từ một trong các tầng thiền sắc giới hoặc vô sắc giới mà xuất ra”.
Mahābodhisattānaṃ pana catuvīsatikoṭisatasahassamukhena pabhedagamanato nānānayaṃ sabbaññutaññāṇasannissayassa ariyamaggañāṇassa adhiṭṭhānabhūtaṃ pubbabhāgañāṇagabbhaṃ gaṇhāpentaṃ paripākaṃ gacchantaṃ paramagambhīraṃ saṇhasukhumataraṃ anaññasādhāraṇaṃ vipassanāñāṇaṃ hoti.
For Great Bodhisattas, however, there arises a vipassanā-ñāṇa that is extremely profound, subtly refined, and unique to them, developing through 240,000,000 modes of differentiation, forming the basis for the knowledge of the Noble Path, which is dependent on Omniscience, and containing the preliminary knowledge, reaching maturity.
Tuy nhiên, đối với các vị Đại Bồ-tát, có một trí tuệ Vipassanā vô cùng sâu sắc, tinh tế và vi diệu, không thể chia sẻ với người khác, được phát triển đến mức viên mãn, bao gồm trí tuệ tiền phần (pubbabhāgañāṇa) làm nền tảng cho trí tuệ Thánh Đạo (ariyamaggañāṇa), vốn là chỗ nương tựa của trí tuệ Toàn Tri (sabbaññutaññāṇa), thông qua hai trăm bốn mươi triệu một trăm ngàn phương pháp phân loại.
Yaṃ aṭṭhakathāsu mahāvajiraññāṇanti vuccati.
This is called the Great Vajira-ñāṇa in the commentaries.
Trí tuệ này được gọi là Mahāvajiraññāṇa (Đại Kim Cang Trí) trong các bộ chú giải.
Yassa ca pavattivibhāgena catuvīsatikoṭisatasahassapabhedassa pādakabhāvena samāpajjiyamānā catuvīsatikoṭisatasahassasaṅkhyā devasikaṃ satthu vaḷañjanakasamāpattiyo vuccanti, svāyaṃ buddhānaṃ vipassanācāro paramatthamañjusāyaṃ visuddhimaggavaṇṇanāyaṃ uddesato dassito, atthikehi tato gahetabbo.
And the 240,000,000 meditations that the Teacher enters daily, which are called vaḷañjanaka-samāpattiyo, are said to be based on the differentiation of this vipassanā-ñāṇa into 240,000,000 varieties. This practice of insight for the Buddhas is briefly indicated in the Paramatthamañjusā, the commentary to the Visuddhimagga; those who desire it should obtain it from there.
Sự thực hành Vipassanā của chư Phật, mà theo sự phân loại của nó, có hai trăm bốn mươi triệu một trăm ngàn loại, và các loại thiền định mà Đức Phật nhập vào hàng ngày, cũng có số lượng tương ứng là hai trăm bốn mươi triệu một trăm ngàn, được gọi là những thiền định được Đức Phật sử dụng làm nền tảng. Sự thực hành Vipassanā này của chư Phật đã được trình bày tóm tắt trong phần chú giải Thanh Tịnh Đạo của Paramatthamañjusā; những ai có nhu cầu có thể tìm hiểu từ đó.
Āsavānaṃ khepanato samucchindanato āsavakkhayo ariyamaggo, ukkaṭṭhaniddesavasena arahattamaggaggahaṇaṃ.
The destruction of taints (āsavakkhaya) is the Noble Path, by completely eradicating the taints. This is a reference to the Arahantship Path, given by way of supreme designation.
Āsavakkhaya (lậu tận) là Thánh Đạo (ariyamagga), do sự đoạn trừ và diệt tận các lậu hoặc (āsava); theo cách giải thích tối thượng, đó là sự nắm giữ A-la-hán Đạo.
Āsavānaṃ khaye ñāṇaṃ āsavakkhayañāṇanti dassento ‘‘tatra cetaṃ ñāṇa’’nti vatvā khayeti ca ādhāre bhummaṃ, na visayeti dassento ‘‘tappariyāpannattā’’ti āha.
To show that knowledge concerning the destruction of taints is āsavakkhaya-ñāṇa, having said "And that knowledge therein", it is also said "tappariyāpannattā" to show that khaye is in the locative case indicating basis, not object.
Để chỉ ra rằng trí tuệ về sự diệt tận các lậu hoặc là āsavakkhayañāṇa (lậu tận trí), Đức Phật nói “tatra cetaṃ ñāṇa” (và trí tuệ này ở đó), và để chỉ ra rằng khaye (trong sự diệt tận) là một trường hợp định sở (ādhāra bhūmi), chứ không phải đối tượng (visaya), Đức Phật nói “tappariyāpannattā” (vì nó nằm trong đó).
Idaṃ dukkhanti dukkhassa ariyasaccassa tadā paccakkhato gahitabhāvadassanaṃ.
Idaṃ dukkhaṃ indicates that the Noble Truth of Suffering was directly apprehended at that time.
Idaṃ dukkha (đây là khổ) là sự trình bày rằng Thánh đế Khổ đã được nhận thức trực tiếp vào thời điểm đó.
Ettakaṃ dukkhanti tassa paricchijja gahitabhāvadassanaṃ.
Ettakaṃ dukkhaṃ indicates that it was apprehended by defining it.
Ettakaṃ dukkha (khổ chừng này) là sự trình bày rằng khổ đã được nhận thức một cách giới hạn.
Na ito bhiyyoti anavasesetvā gahitabhāvadassanaṃ.
Na ito bhiyyo indicates that it was apprehended completely, without remainder.
Na ito bhiyyo (không hơn thế nữa) là sự trình bày rằng khổ đã được nhận thức mà không còn sót lại gì.
Tenāha ‘‘sabbampi dukkhasacca’’ntiādi.
Therefore, it is said: "All the Truth of Suffering" and so on.
Do đó, Đức Phật nói: “sabbampi dukkhasacca” (toàn bộ Khổ đế), v.v.
Sarasalakkhaṇapaṭivedhenāti sabhāvasaṅkhātassa lakkhaṇassa asammohato paṭivijjhanena.
Sarasalakkhaṇapaṭivedhena means by realizing the inherent characteristic without confusion.
Sarasalakkhaṇapaṭivedhenā (bằng sự thấu hiểu đặc tính tự thân) nghĩa là bằng sự xuyên thấu không lầm lẫn đặc tính được gọi là bản chất.
Asammohapaṭivedhoti ca yathā tasmiṃ ñāṇe pavatte pacchā dukkhassa sarūpādiparicchede sammoho na hoti, tathā pavatti.
And this realization without confusion occurs in such a way that when that knowledge has arisen, there is no subsequent confusion in distinguishing the nature and so forth of suffering.
Sự thấu hiểu không lầm lẫn (asammohapaṭivedha) là sự phát sinh của trí tuệ đó theo cách mà sau khi trí tuệ đó phát sinh, không còn sự lầm lẫn nào trong việc phân biệt bản chất của khổ, v.v.
Tenāha ‘‘yathābhūtaṃ abbhaññāsi’’nti.
Therefore, it is said: "He truly understood."
Do đó, Đức Phật nói: “yathābhūtaṃ abbhaññāsi” (đã hiểu rõ như thật).
Nibbattikanti nipphādentaṃ.
Nibbattikaṃ means producing.
Nibbattika (sinh khởi) nghĩa là làm cho sinh khởi.
Yaṃ ṭhānaṃ patvāti yaṃ nibbānaṃ maggassa ārammaṇapaccayaṭṭhena kāraṇabhūtaṃ āgamma.
Yaṃ ṭhānaṃ patvā means having attained that Nibbāna, which serves as a cause for the path by being an object condition.
Yaṃ ṭhānaṃ patvā (đã đạt đến trạng thái nào) nghĩa là đã đạt đến Niết Bàn nào, vốn là nguyên nhân theo nghĩa là điều kiện đối tượng của Đạo.
Tadubhayavato hi puggalassa patti tadubhayassa pattīti vuttaṃ.
It is said that the attainment by a person possessing both (path and fruit) is the attainment of both.
Thật vậy, sự đạt được của người có cả hai điều đó được gọi là sự đạt được của cả hai điều đó.
Patvāti vā pāpuṇanahetu.
Or patvā (means) due to attaining.
Hoặc Patvā (đã đạt đến) là nguyên nhân của sự đạt được.
Appavattinti appavattinimittaṃ.
Appavattiṃ means the sign of non-arising.
Appavatti (không sinh khởi) nghĩa là dấu hiệu của sự không sinh khởi.
Te vā na pavattanti etthāti appavatti, nibbānaṃ.
Or in this (Nibbāna) those (suffering and its origin) do not arise, thus it is appavatti, Nibbāna.
Hoặc các điều đó không sinh khởi ở đây, do đó là appavatti (không sinh khởi), tức là Niết Bàn.
Tassāti dukkhanirodhassa.
Tassā means of the cessation of suffering.
Tassā (của sự diệt khổ đó) nghĩa là của sự diệt khổ.
Sampāpakanti sacchikiriyāvasena sammadeva pāpakaṃ.
Sampāpakaṃ means that which leads to (Nibbāna) properly by way of direct realization.
Sampāpaka (đưa đến đúng đắn) nghĩa là đưa đến một cách đúng đắn theo cách chứng ngộ.
Kilesavasenāti āsavasaṅkhātakilesavasena.
Kilesavasenā means by the power of defilements known as āsavas.
Do Kilesavasenā có nghĩa là do quyền năng của các phiền não được gọi là āsava.
Yasmā āsavānaṃ dukkhasaccapariyāyo, tappariyāpannattā, sesasaccānañca taṃsamudayādipariyāyo atthi, tasmā vuttaṃ ‘‘pariyāyato’’ti.
Because the āsavas are an aspect of the Noble Truth of Suffering, being comprised within it, and because for the other Noble Truths there are also aspects such as its origin, therefore it is said "by way of aspect."
Bởi vì các āsava là một phương diện của Khổ đế, do thuộc về Khổ đế, và các đế còn lại cũng là phương diện của tập đế đó, v.v., nên đã nói “pariyāyato” (một cách gián tiếp).
Dassento saccānīti yojanā.
"Showing the Noble Truths" is the construction.
Ý nghĩa là “chỉ ra các sự thật”.
Āsavānaṃyeva cettha gahaṇaṃ ‘‘āsavānaṃ khayañāṇāyā’’ti āraddhattā.
Here, only the āsavas are taken because it was begun with "for the knowledge of the destruction of the āsavas."
Ở đây, chỉ có sự nắm giữ các āsava được đề cập, vì đã bắt đầu với câu “để diệt trừ các āsava”.
Tathā hi āsavavimuttisīseneva sabbasaṃkilesavimutti vuttā.
Thus, liberation from all defilements is spoken of only by way of the head of liberation from āsavas.
Thật vậy, sự giải thoát khỏi mọi phiền não được nói đến chỉ bằng cách lấy sự giải thoát khỏi các āsava làm đầu.
Idaṃ dukkhanti yathābhūtaṃ abbhaññāsintiādinā missakamaggo idha kathitoti ‘‘saha vipassanāya koṭippattaṃ maggaṃ kathetī’’ti vuttaṃ.
Since a mixed path, beginning with "He truly understood 'This is suffering'," is taught here, it is said, "He teaches the path that has reached its culmination with vipassanā."
Vì con đường hỗn hợp được giảng ở đây với câu “Idaṃ dukkhaṃ yathābhūtaṃ abbhaññāsi” (Ta đã như thật biết đây là khổ), v.v., nên đã nói “nói về con đường đã đạt đến đỉnh cao cùng với vipassanā”.
Ettha ca saccappaṭivedhassa tadā atītakālikattā ‘‘yathābhūtaṃ abbhaññāsi’’nti vatvāpi abhisamayakāle tassa paccuppannataṃ upādāya ‘‘evaṃ jānato evaṃ passato’’ti vattamānakālena niddeso kato.
And here, although the comprehension of the Noble Truths was past-tense at that time, by taking its present nature at the time of realization, it is expressed in the present tense as "one who knows thus, one who sees thus."
Ở đây, mặc dù sự thấu hiểu các sự thật lúc đó là thuộc quá khứ, nên đã nói “yathābhūtaṃ abbhaññāsi” (đã như thật biết), nhưng vào thời điểm abhisamaya (thấu hiểu), do tính chất hiện tại của nó, nên đã được trình bày bằng thì hiện tại với câu “evaṃ jānato evaṃ passato” (khi biết như vậy, khi thấy như vậy).
So ca kāmaṃ maggakkhaṇato paraṃ yāvajjatanā atītakāliko eva, sabbapaṭhamaṃ panassa atītakālikattaṃ phalakkhaṇeneva veditabbanti āha ‘‘vimuccitthāti iminā phalakkhaṇaṃ dassetī’’ti.
And that, indeed, is past-tense from the moment of the path up to the present day, but its being initially past-tense should be understood as occurring at the moment of fruition. Therefore, it is said, "By 'was liberated,' he shows the moment of fruition."
Và điều đó, dù cho từ sát-na đạo cho đến ngày nay đều thuộc quá khứ, nhưng trước hết, tính chất quá khứ của nó phải được hiểu bằng sát-na quả, nên đã nói “bằng câu ‘vimuccittha’ (đã giải thoát) chỉ ra sát-na quả”.
Jānato passatoti vā hetuniddesoyaṃ.
Or, "one who knows, one who sees" is an indication of cause.
Hoặc, jānato passato (biết và thấy) là sự chỉ rõ nguyên nhân.
Jānanahetu dassanahetu kāmāsavāpi cittaṃ vimuccitthāti yojanā.
The construction is: "By the cause of knowing, by the cause of seeing, the mind was liberated even from the kāmāsava."
Ý nghĩa là: Do nguyên nhân biết, do nguyên nhân thấy, tâm cũng đã giải thoát khỏi dục āsava.
Bhavāsavaggahaṇeneva cettha bhavarāgassa viya bhavadiṭṭhiyāpi samavarodhoti diṭṭhāsavassapi saṅgaho daṭṭhabbo.
Here, by the inclusion of bhavāsava, the diṭṭhāsava should also be understood as included, just as the bhavarāga is fully encompassed, so is bhavadiṭṭhi.
Ở đây, cần phải hiểu rằng việc nắm giữ bhavāsava (āsava tái sinh) bao gồm cả bhavadiṭṭhi (tà kiến về tái sinh) cũng như bhavarāga (tham ái tái sinh), do đó cũng bao gồm cả diṭṭhāsava (āsava tà kiến).
Yasmā pahīnakilesapaccavekkhaṇena vijjamānassapi kammassa āyatiṃ appaṭisandhikabhāvato ‘‘khīṇā jātī’’ti jānāti, yasmā ca maggapaccavekkhaṇādīhi vusitaṃ brahmacariyantiādiṃ pajānāti, tasmā vuttaṃ ‘‘khīṇā jātīti ādīhi tassa bhūmi’’nti.
Because, by reflecting on the abandoned defilements, one knows "birth is destroyed" due to the non-relinking nature of existing kamma in the future; and because, by reflecting on the path, one understands "the holy life has been lived," etc., therefore it is said, "This is the basis (bhūmi) for 'birth is destroyed,' and so on."
Bởi vì, bằng cách quán xét các phiền não đã được đoạn trừ, biết rằng “sự sinh đã tận diệt” do nghiệp hiện hữu cũng không còn khả năng tái sinh trong tương lai; và bởi vì, bằng cách quán xét đạo lộ, v.v., biết rằng “phạm hạnh đã hoàn mãn”, v.v., nên đã nói “bằng câu ‘khīṇā jāti’ (sự sinh đã tận diệt), v.v., đó là nền tảng của nó”.
Tattha tassāti paccavekkhaṇañāṇassa.
Therein, "tassā" refers to the knowledge of reflection.
Trong đó, tassā là của paccavekkhaṇañāṇa (tuệ quán xét).
Bhūminti pavattiṭṭhānaṃ.
"Bhūmi" means the place of occurrence.
Bhūmi (nền tảng) là nơi phát sinh.
Yenādhippāyena ‘‘katamā panā’’tiādinā codanā katā, taṃ pakāsetvā parihāraṃ vattukāmo āha ‘‘na tāvassā’’tiādi.
Intending to clarify the intent behind the question asked, beginning with "But what is that…?", and to provide a refutation, he says, "It is not yet for him…" and so on.
Muốn làm sáng tỏ ý định đã đặt ra câu hỏi “katamā panā” (vậy thì cái nào), v.v., và muốn đưa ra câu trả lời, đã nói “na tāvassā” (chưa phải là của nó), v.v.
Na tāvassa atītā jāti khīṇāti maggabhāvanāya na khīṇāti adhippāyo.
"His past birth is not yet destroyed" means it is not destroyed by the cultivation of the path.
“Na tāvassa atītā jāti khīṇā” (sự sinh trong quá khứ của vị ấy chưa tận diệt) có ý nghĩa là chưa tận diệt bằng sự tu tập đạo lộ.
Tattha kāraṇamāha ‘‘pubbeva khīṇattā’’ti.
He states the reason for that: "because it was already destroyed previously."
Trong đó, lý do được nói là “pubbeva khīṇattā” (vì đã tận diệt từ trước).
Na anāgatā assa jāti khīṇāti yojanā.
The construction is: "His future birth is not destroyed."
Ý nghĩa là: Sự sinh trong tương lai của vị ấy chưa tận diệt.
Na anāgatāti ca anāgatattasāmaññaṃ gahetvā lesena vadati.
And "not future" is spoken concisely, taking the general meaning of "future."
Và “na anāgatā” (không phải là tương lai) được nói một cách gián tiếp, nắm giữ ý nghĩa chung của tương lai.
Tenāha ‘‘anāgate vāyāmābhāvato’’ti.
Therefore, it is said, "due to the absence of effort in the future."
Vì vậy, đã nói “anāgate vāyāmābhāvato” (vì không có sự nỗ lực trong tương lai).
Vijjamāneyeva hi payogo sambhavati, nāvijjamāneti adhippāyo.
Indeed, effort is possible only in what exists, not in what does not exist—this is the intention.
Ý nghĩa là: Sự cố gắng chỉ có thể xảy ra với những gì đang hiện hữu, không thể xảy ra với những gì không hiện hữu.
Anāgataviseso panettha adhippeto, tassa ca khepane vāyāmopi labbhateva.
Here, a specific future is intended, and effort in destroying it can indeed be attained.
Ở đây, ý định là một loại tương lai đặc biệt, và sự nỗ lực để tiêu diệt nó cũng có thể đạt được.
Tenāha ‘‘yā pana maggassā’’tiādi.
Therefore, it is said, "But that which belongs to the path…" and so on.
Vì vậy, đã nói “yā pana maggassā” (cái nào của đạo lộ), v.v.
‘‘Yā panā’’ti hi ādinā maggabhāvanāya anāgatajātiyā eva hetuvināsanadvārena khīṇabhāvo pakāsīyati.
For by "But that which…" and so on, the destruction of future birth itself, through the elimination of its causes by the cultivation of the path, is revealed.
Thật vậy, bằng cách bắt đầu với “yā panā”, v.v., sự tận diệt của sự sinh trong tương lai được làm sáng tỏ thông qua việc tiêu diệt nguyên nhân của nó bằng sự tu tập đạo lộ.
Ekacatupañcavokārabhavesūti bhavattayaggahaṇaṃ vuttanayena anavasesato jātiyā khīṇabhāvadassanatthaṃ.
"In the single, four-constituent, and five-constituent existences"—the inclusion of the three realms of existence is to show the complete destruction of birth, as explained.
Ekacatupañcavokārabhavesu (trong các cõi một, bốn, năm uẩn) là sự nắm giữ ba cõi tồn tại, theo cách đã nói, để chỉ ra sự tận diệt hoàn toàn của sự sinh.
Tanti yathāvuttajātiṃ.
"That" refers to birth as previously described.
Taṃ (điều đó) là sự sinh đã được nói đến.
Soti bhagavā.
"He" refers to the Blessed One.
So (vị ấy) là Thế Tôn.
Brahmacariyavāso nāma idha maggabrahmacariyassa nibbattanamevāti āha ‘‘niṭṭhita’’nti.
"Living the holy life" here means the bringing about of the noble holy life. Therefore, he says, "completed."
Sự sống phạm hạnh ở đây có nghĩa là sự thành tựu phạm hạnh đạo lộ, nên đã nói “niṭṭhita” (đã hoàn thành).
Sammādiṭṭhiyā catūsu saccesu pariññādikiccasādhanavasena pavattamānāya sammāsaṅkappādīnampi dukkhasacce pariññābhisamayānuguṇā pavatti, itarasaccesu ca nesaṃ pahānābhisamayādivasena pavatti pākaṭā eva.
When right view is present, engaged in accomplishing tasks such as comprehending the four Noble Truths, it is evident that right thought and so on also function in accordance with the comprehension of the Truth of Suffering, and in the other Noble Truths, they function by way of the comprehension of abandonment, and so on.
Khi chánh kiến vận hành bằng cách thực hiện các chức năng như liễu tri trong Tứ Diệu Đế, thì sự vận hành của chánh tư duy, v.v., phù hợp với sự liễu tri và thấu hiểu Khổ đế, và sự vận hành của chúng trong các đế khác bằng cách đoạn trừ và thấu hiểu, v.v., là điều hiển nhiên.
Tena vuttaṃ ‘‘catūhi maggehi pariññāpahānasacchikiriyābhāvanābhisamayavasenā’’ti.
Therefore, it is said, "by way of comprehension, abandonment, realization, and cultivation through the four paths."
Vì vậy, đã nói “bằng bốn đạo lộ, theo cách liễu tri, đoạn trừ, chứng ngộ và tu tập”.
Nāparaṃ itthattāyāti ime pakārā itthaṃ, tabbhāvo itthattaṃ, tadatthanti vuttaṃ hoti.
"No further for this state": these types are ittham, and the state of being such is itthattaṃ. This means "for the sake of that."
“Nāparaṃ itthattāyā” (không có trạng thái này nữa) có nghĩa là các loại này là “itthaṃ” (như vậy), trạng thái của chúng là “itthattaṃ” (trạng thái như vậy), đó là ý nghĩa của “tadatthanti” (vì mục đích đó).
Te pana pakārā ariyamaggabyāpārabhūtā pariññādayo idhādhippetāti āha ‘‘evaṃsoḷasakiccabhāvāyā’’ti.
These types, however, are here intended to be the sixteen functions that are the operations of the Noble Path, such as full comprehension. Therefore, he says, "for the state of these sixteen functions."
Và các loại đó, tức là các chức năng như liễu tri thuộc về hoạt động của Thánh đạo, được hiểu ở đây, nên đã nói “evaṃ soḷasakiccabhāvāyā” (vì sự hiện hữu của mười sáu chức năng như vậy).
Te hi maggaṃ paccavekkhato maggānubhāvena pākaṭā hutvā upaṭṭhahanti, pariññādīsu ca pahānameva padhānaṃ, tadatthattāya itaresanti āha ‘‘kilesakkhayāya vā’’ti.
For indeed, when one reflects on the path, they become evident and appear through the power of the path. And among full comprehension and the others, abandonment is primary, and the others are for its sake. Therefore, he says, "or for the destruction of defilements."
Thật vậy, khi quán xét đạo lộ, chúng hiện ra rõ ràng nhờ uy lực của đạo lộ; và trong các chức năng như liễu tri, sự đoạn trừ là chính yếu, vì các chức năng khác là vì mục đích đó, nên đã nói “kilesakkhayāya vā” (hoặc để diệt trừ các phiền não).
Pahīnakilesapaccavekkhaṇavasena vā etaṃ vuttaṃ.
Or, this is said by way of reflecting on the abandoned defilements.
Hoặc, điều này được nói theo cách quán xét các phiền não đã được đoạn trừ.
‘‘Nāparaṃ itthattāyāti abbhaññāsi’’nti etthāyamaparo nayo – itthattāyāti nissakke sampadānavacanaṃ.
Regarding "Nāparaṃ itthattāyāti abbhaññāsi" (He understood there is no more for this state), there is another explanation here: itthattāya is a dative case in the sense of separation.
Trong câu “Nāparaṃ itthattāyāti abbhaññāsi” (Vị ấy đã biết rằng không còn trạng thái này nữa), đây là một cách giải thích khác: itthattāyā là một từ chỉ định cách cấp cho ý nghĩa không có sở hữu.
Tenāyamattho – itthattāya itthambhāvato imasmā evaṃpakārā idāni vattamānakkhandhasantānā aparaṃ anāgatakkhandhasantānaṃ mayhaṃ natthi, ime pana carimattabhāvasaṅkhātā pañcakkhandhā pariññātā appatiṭṭhā tiṭṭhanti chinnamūlakā rukkhā viya.
Therefore, the meaning is: "For this state, for this mode of being, there is no further future continuum of aggregates for me from this present continuum of aggregates; but these five aggregates, which constitute the final existence, being fully understood, stand without support, like trees with severed roots."
Do đó, ý nghĩa là: Đối với tôi, không còn sự tiếp nối uẩn trong tương lai nào khác ngoài sự tiếp nối uẩn hiện tại theo cách này, từ trạng thái hiện hữu như vậy. Năm uẩn này, được gọi là thân cuối cùng, đã được liễu tri, chúng đứng vững không còn nền tảng, giống như những cây đã bị cắt gốc.
Apariññātamūlakā hi patiṭṭhā.
For, roots not fully understood are a support.
Thật vậy, những gì có gốc rễ chưa được liễu tri mới là nền tảng.
Yathāha ‘‘kabaḷīkāre ce, bhikkhave, āhāre atthi rāgo atthi nandī atthi taṇhā, patiṭṭhitaṃ tattha viññāṇaṃ viruḷha’’ntiādi (saṃ. ni. 2.64; kathā. 296; mahāni. 7).
As it is said, "If, bhikkhus, there is lust, delight, or craving for edible food, then consciousness is established there, grown there," and so on.
Như đã nói: “Này các tỳ-khưu, nếu có tham, có hỷ, có ái trong thức ăn vật thực, thì thức ấy sẽ an trú và tăng trưởng ở đó,” v.v.
Te pana pañcakkhandhā carimakaviññāṇanirodhena anupādāno viya jātavedo nibbāyissantīti abbhaññāsinti.
And he understood that those five aggregates would be extinguished like a fire without fuel, by the cessation of the final consciousness.
Và vị ấy đã biết rằng năm uẩn đó sẽ tịch diệt như ngọn lửa không còn nhiên liệu khi thức cuối cùng diệt đi.
Tikkhattuṃ jātoti iminā pana idaṃ dasseti ‘‘ahaṃ, brāhmaṇa, paṭhamavijjāya jātoyeva purejātassa sahajātassa vā abhāvato sabbesaṃ vuḍḍho mahallako, kimaṅgaṃ pana tīhi vijjāhi tikkhattuṃ jātoti.
"Born three times" — with this he indicates, "Brahmin, by the first knowledge alone, I am already old and venerable, because there is no elder or co-born; how much more so with three knowledges, being born three times!"
Bằng câu “Tikkhattuṃ jāto” (đã sinh ba lần), điều này được chỉ ra: “Này Bà-la-môn, ta đã sinh ra chỉ với tuệ thứ nhất, do không có sự sinh trước hay đồng sinh, ta là người lớn tuổi nhất, trưởng lão của tất cả, huống chi là đã sinh ba lần với ba tuệ.”
Pubbenivāsañāṇena atītaṃsañāṇanti atītārammaṇasabhāgatāya tabbhāvībhāvato ca pubbenivāsañāṇena atītaṃsañāṇaṃ pakāsetvāti yojetabbaṃ.
"Knowledge of the past through the knowledge of previous existences": this should be construed as "having revealed knowledge of the past through the knowledge of previous existences, due to its having the nature of a past object and its being the knowledge of previous existences."
“Pubbenivāsañāṇena atītaṃsañāṇaṃ” (tuệ về phần quá khứ bằng tuệ túc mạng) nên được kết nối như sau: bằng tuệ túc mạng, làm sáng tỏ tuệ về phần quá khứ, do tính chất tương tự của đối tượng quá khứ và do sự hiện hữu của nó như tuệ túc mạng.
Tattha atītaṃsañāṇanti atītakkhandhāyatanadhātusaṅkhāte atītakoṭṭhāse appaṭihatañāṇaṃ.
Therein, "knowledge of the past" means unobstructed knowledge regarding the past aggregates, sense bases, and elements.
Trong đó, atītaṃsañāṇaṃ (tuệ về phần quá khứ) là tuệ không bị cản trở trong phần quá khứ, tức là các uẩn, xứ, giới trong quá khứ.
Dibbacakkhuñāṇassa paccuppannārammaṇattā yathākammūpagañāṇassa anāgataṃsañāṇassa ca dibbacakkhuvaseneva ijjhanato dibbacakkhuno paribhaṇḍañāṇattā dibbacakkhumhiyeva ca ṭhitassa cetopariyañāṇasiddhito vuttaṃ ‘‘dibbacakkhunā paccuppannānāgataṃsañāṇa’’nti.
Because the divine eye knowledge has present objects, and because the knowledge of the destination of beings according to their kamma and the knowledge of the future are perfected only through the divine eye, and because the divine eye is ancillary knowledge, and the knowledge of penetrating the minds of others is perfected only when resting in the divine eye, it is said, "knowledge of the present and future through the divine eye."
Bởi vì tuệ thiên nhãn có đối tượng là hiện tại, và tuệ yathākammūpaga (tuệ biết nghiệp và quả) và tuệ anāgataṃsa (tuệ về phần vị lai) chỉ thành tựu thông qua thiên nhãn, và tuệ cetopariya (tuệ biết tâm người khác) cũng thành tựu ở người có thiên nhãn, nên đã nói “dibbacakkhunā paccuppannānāgataṃsañāṇaṃ” (tuệ về phần hiện tại và vị lai bằng thiên nhãn).
Tattha dibbacakkhunāti saparibhaṇḍena dibbacakkhuñāṇena.
Therein, "through the divine eye" means through the divine eye knowledge together with its ancillary faculties.
Trong đó, dibbacakkhunā (bằng thiên nhãn) là bằng tuệ thiên nhãn cùng với các phẩm chất phụ trợ của nó.
Paccuppannaṃso ca anāgataṃso ca paccuppannānāgataṃsaṃ, tattha ñāṇaṃ paccuppannānāgataṃsañāṇaṃ.
The present aspect and the future aspect are the present and future aspects; knowledge concerning them is knowledge of the present and future aspects.
Paccuppannaṃsa (phần hiện tại) và anāgataṃsa (phần vị lai) là paccuppannānāgataṃsaṃ (phần hiện tại và vị lai), tuệ trong đó là paccuppannānāgataṃsañāṇaṃ (tuệ về phần hiện tại và vị lai).
Āsavakkhayañāṇādhigameneva sabbaññutaññāṇassa viya sesāsādhāraṇañāṇadasabalañāṇaāveṇikabuddhadhammādīnampi anaññasādhāraṇānaṃ buddhaguṇānaṃ ijjhanato vuttaṃ ‘‘āsavakkhayena sakalalokiyalokuttaraguṇa’’nti.
Just as omniscience is perfected only through the attainment of the knowledge of the destruction of āsavas, so too are other unique qualities of the Buddha, such as the ten powers of knowledge and the eighteen unique Buddha-qualities. Therefore, it is said, "all worldly and supramundane qualities by the destruction of āsavas."
Bởi vì, chỉ bằng sự thành tựu tuệ diệt trừ các āsava, các phẩm chất của Phật như sabbaññutaññāṇa (tuệ toàn tri), các ñāṇadasabala (mười lực của Phật) không chung với ai khác, và các aveṇikabuddhadhamma (các pháp đặc biệt của Phật) cũng được thành tựu như sabbaññutaññāṇa, nên đã nói “āsavakkhayena sakalalokiyalokuttaraguṇa” (bằng sự diệt trừ các āsava, các phẩm chất thế gian và siêu thế).
Tenāha ‘‘sabbepi sabbaññuguṇe pakāsetvā’’ti.
Therefore, he says, "having revealed all the qualities of an Omniscient One."
Vì vậy, đã nói “sabbepi sabbaññuguṇe pakāsetvā” (làm sáng tỏ tất cả các phẩm chất của bậc Toàn Tri).
15. Pītivipphāraparipuṇṇagattacittoti pītipharaṇena paripuṇṇakāyacitto.
15. Pītivipphāraparipuṇṇagattacitto means one whose body and mind are completely suffused with joy (pīti).
15. Pītivipphāraparipuṇṇagattacitto có nghĩa là thân và tâm tràn đầy hỷ lạc.
Aññāṇanti aññāṇassāti attho.
To the ignorant means of the ignorant; that is the meaning.
Aññāṇa (vô minh) có nghĩa là sự không biết.
Dhīsaddassa yogato hi sāmiatthe etaṃ upayogavacanaṃ.
For, due to its connection with the word dhī, this is an objective case in the sense of possession.
Quả thật, do sự kết hợp với từ dhī (trí tuệ), đây là một từ ngữ được dùng trong ý nghĩa sở hữu.
Abhikkantāti ettha atikkantā, vigatāti atthoti āha ‘‘khaye dissatī’’ti.
Here in abhikkantā, the meaning is passed, gone; therefore he says, “it appears in the sense of destruction.”
Ở đây, từ abhikkantā (đã qua) có nghĩa là đã vượt qua, đã ra đi, như đã nói “hiện rõ sự chấm dứt.”
Teneva hi ‘‘nikkhanto paṭhamo yāmo’’ti vuttaṃ.
Indeed, for that very reason it is said, “The first watch has passed.”
Do đó, đã nói “canh đầu đã qua.”
Abhikkantataro cāti ativiya kantataro manoramo, tādiso ca sundaro bhaddako nāma hotīti āha ‘‘sundare dissatī’’ti.
And more excellent means exceedingly pleasing, delightful; and such a thing is called beautiful, good. Therefore, he says “it appears in the sense of beautiful.”
Từ abhikkantataro ca (và đẹp đẽ hơn) có nghĩa là rất đáng yêu, rất đẹp lòng; một người như vậy được gọi là tốt đẹp, thanh nhã, như đã nói “hiện rõ sự tốt đẹp.”
Koti devanāgayakkhagandhabbādīsu ko katamo.
Who? means among devas, nāgas, yakkhas, gandhabbas, and so on, which one?
Ko (ai) có nghĩa là ai trong số các vị trời, nāga, yakkha, gandhabba, v.v.
Meti mama.
My means of me.
Me (của tôi) có nghĩa là của tôi.
Pādānīti pāde.
Pādāni means the feet.
Pādāni (bàn chân) có nghĩa là các bàn chân.
Iddhiyāti imāya evarūpāya deviddhiyā.
Iddhiyā means by this kind of divine power.
Iddhiyā (với thần thông) có nghĩa là với thần thông của chư thiên như vậy.
Yasasāti iminā edisena parivārena paricchedena.
Yasasā means by this kind of retinue and domain.
Yasasā (với danh tiếng) có nghĩa là với sự tùy tùng và sự phân biệt như vậy.
Jalanti vijjotamāno.
Jalaṃ means shining.
Jala (tỏa sáng) có nghĩa là đang chiếu sáng.
Abhikkantenāti ativiya kantena kamanīyena abhirūpena.
Abhikkantena means with an exceedingly lovely, pleasing, and very beautiful appearance.
Abhikkantena (với vẻ đẹp) có nghĩa là với vẻ đẹp rất đáng yêu, quyến rũ.
Vaṇṇenāti chavivaṇṇena sarīravaṇṇanibhāya.
Vaṇṇena means with a radiant complexion, by the glow of the body's complexion.
Vaṇṇena (với màu da) có nghĩa là với màu da, vẻ rạng rỡ của thân thể.
Sabbā obhāsayaṃ disāti dasapi disā pabhāsento cando viya sūriyo viya ca ekobhāsaṃ ekālokaṃ karontoti gāthāya attho.
Sabbā obhāsayaṃ disā means illuminating all ten directions, making a single radiance, a single light, like the moon and like the sun; this is the meaning of the verse.
Sabbā obhāsayaṃ disā (chiếu sáng khắp các phương) có nghĩa là chiếu sáng mười phương, tạo ra một ánh sáng, một sự rạng rỡ duy nhất, như mặt trăng hay mặt trời, đó là ý nghĩa của bài kệ.
Abhirūpeti uḷārarūpe sampannarūpe.
Abhirūpe means in a sublime form, in a perfect form.
Abhirūpe (trong vẻ đẹp) có nghĩa là trong vẻ đẹp cao quý, vẻ đẹp hoàn hảo.
Abhikkantaṃ bho gotama, abhikkantaṃ bho gotamāti vacanadvayassa ‘‘sādhu sādhu bho gotamā’’ti āmeḍitavasena atthaṃ dassetvā tassa visayaṃ niddhārento āha ‘‘bhaye kodhe’’tiādi.
After showing the meaning of the two phrases Abhikkantaṃ bho gotama, abhikkantaṃ bho gotama by way of repetition as "Excellent, excellent, Master Gotama," determining its scope, he said, "In fear, in anger," etc.
Giải thích ý nghĩa của hai lời nói “Abhikkantaṃ bho Gotama, abhikkantaṃ bho Gotama” (Tuyệt vời thay, thưa Tôn giả Gotama! Tuyệt vời thay, thưa Tôn giả Gotama!) theo cách lặp lại như “Sādhu sādhu bho Gotama” (Lành thay, lành thay, thưa Tôn giả Gotama!), rồi xác định phạm vi của chúng, ông nói “trong sợ hãi, giận dữ,” v.v.
Tattha ‘‘coro coro, sappo sappo’’tiādīsu bhaye āmeḍitaṃ.
Therein, repetition occurs in fear, as in "Thief, thief! Snake, snake!" and so on.
Trong đó, sự lặp lại được dùng trong sợ hãi trong các trường hợp như “Kẻ cướp! Kẻ cướp!”, “Rắn! Rắn!”
‘‘Vijjha vijjha, pahara paharā’’tiādīsu kodhe.
In anger, as in "Strike, strike! Hit, hit!" and so on.
Trong giận dữ trong các trường hợp như “Đâm! Đâm!”, “Đánh! Đánh!”
‘‘Sādhu sādhū’’tiādīsu pasaṃsāyaṃ.
In praise, as in "Excellent, excellent!" and so on.
Trong tán thán trong các trường hợp như “Lành thay! Lành thay!”
‘‘Gaccha gaccha, lunāhi lunāhī’’tiādīsu turite.
In urgency, as in "Go, go! Cut, cut!" and so on.
Trong vội vã trong các trường hợp như “Đi đi! Đi đi!”, “Cắt đi! Cắt đi!”
‘‘Āgaccha āgacchā’’tiādīsu kotūhale.
In excitement, as in "Come, come!" and so on.
Trong tò mò trong các trường hợp như “Đến đây! Đến đây!”
‘‘Buddho buddhoti cintento’’tiādīsu (bu. vaṃ. 2.44) acchare.
In wonder, as in "The Buddha, the Buddha, reflecting thus," and so on.
Trong ngạc nhiên trong các trường hợp như “Suy nghĩ ‘Phật! Phật!’”
‘‘Abhikkamathāyasmanto, abhikkamathāyasmanto’’tiādīsu (dī. ni. 3.20; a. ni. 9.11) hāse.
In joy, as in "Go forward, venerable ones, go forward, venerable ones," and so on.
Trong vui vẻ trong các trường hợp như “Thưa các Tôn giả, hãy tiến lên! Thưa các Tôn giả, hãy tiến lên!”
‘‘Kahaṃ ekaputtaka, kahaṃ ekaputtakā’’tiādīsu soke.
In sorrow, as in "Where, my only son, where, my only son?" and so on.
Trong đau khổ trong các trường hợp như “Con trai duy nhất của ta ở đâu? Con trai duy nhất của ta ở đâu?”
‘‘Aho sukhaṃ, aho sukha’’ntiādīsu (udā. 20; cūḷava. 332) pasāde.
In serene confidence, as in "Oh, what happiness! Oh, what happiness!" and so on.
Trong thanh tịnh trong các trường hợp như “Ôi hạnh phúc! Ôi hạnh phúc!”
Ca-saddo avuttasamuccayattho.
The particle ca has the meaning of including what has not been said.
Từ ca (và) có nghĩa là bao gồm những điều chưa được nói đến.
Tena garahaasammānādīnaṃ saṅgaho daṭṭhabbo.
By it, the inclusion of censure, disrespect, and so on should be understood.
Do đó, cần hiểu rằng nó bao gồm sự khiển trách, sự thiếu tôn trọng, v.v.
Tattha ‘‘pāpo pāpo’’tiādīsu garahāyaṃ.
Therein, in censure, as in "Wicked, wicked!" and so on.
Trong đó, trong sự khiển trách cần được hiểu trong các trường hợp như “Ác! Ác!”
‘‘Abhirūpaka abhirūpakā’’tiādīsu asammāne daṭṭhabbaṃ.
In disrespect, as in "O handsome one, O handsome one," and so on should be understood.
Trong sự thiếu tôn trọng cần được hiểu trong các trường hợp như “Đẹp trai! Đẹp trai!”
Nayidaṃ āmeḍitavasena dvikkhattuṃ vuttaṃ, atha kho atthadvayavasenāti dassento ‘‘atha vā’’tiādimāha.
To show that this was not said twice by way of repetition, but rather with two different meanings, he said "Or alternatively," etc.
Để chỉ ra rằng điều này không được nói hai lần theo cách lặp lại, mà là theo hai ý nghĩa, ông nói “hoặc là,” v.v.
Abhikkantanti vacanaṃ apekkhitvā napuṃsakaliṅgavasena vuttaṃ.
The word abhikkantaṃ is stated in the neuter gender with reference to the utterance.
Lời nói abhikkanta (tuyệt vời) được nói theo giống trung tính, dựa vào từ đó.
Taṃ pana bhagavato vacanaṃ dhammassa desanāti katvā vuttaṃ ‘‘yadidaṃ bhoto gotamassa dhammadesanā’’ti.
But that utterance of the Blessed One is a teaching of the Dhamma, and so it is said, "namely, this Dhamma teaching of Master Gotama."
Nhưng lời nói đó của Đức Thế Tôn là sự thuyết giảng giáo pháp, nên đã nói “đó là sự thuyết giảng giáo pháp của Tôn giả Gotama.”
Atthamattadassanaṃ vā etaṃ, tasmā atthavasena liṅgavibhattivipariṇāmo veditabbo.
Or this is just an indication of the meaning; therefore, a change of gender and case according to the meaning should be understood.
Hoặc đây chỉ là sự trình bày ý nghĩa, do đó, sự thay đổi giống và biến cách cần được hiểu theo ý nghĩa.
Dutiyapadepi eseva nayo.
The same method applies to the second term as well.
Tương tự đối với từ thứ hai.
Dosanāsanatoti rāgādikilesaviddhaṃsanato.
Because of dispelling faults means because of destroying defilements such as greed.
Dosanāsanato (do diệt trừ lỗi lầm) có nghĩa là do diệt trừ các phiền não như tham ái.
Guṇādhigamanatoti sīlādiguṇānaṃ sampāpanato.
Because of attaining virtues means because of bringing about virtues such as moral conduct.
Guṇādhigamanato (do đạt được các đức tính) có nghĩa là do đạt được các đức tính như giới hạnh.
Ye guṇe desanā adhigameti, tesu padhānabhūtā guṇā dassetabbāti te padhānabhūte guṇe tāva dassetuṃ ‘‘saddhājananato paññājananato’’ti vuttaṃ.
Among the virtues that the teaching helps one attain, the primary virtues should be shown. Therefore, to show those primary virtues first, it is said, "because it generates faith, because it generates wisdom."
Các đức tính mà sự thuyết giảng đạt được, trong số đó, các đức tính chủ yếu cần được trình bày, nên đã nói “do sinh ra đức tin, do sinh ra trí tuệ” để trình bày các đức tính chủ yếu đó.
Saddhāpamukhā hi lokiyā guṇā, paññāpamukhā lokuttarā.
For worldly virtues are headed by faith, and supramundane virtues are headed by wisdom.
Quả thật, các đức tính thế gian lấy đức tin làm đầu, các đức tính siêu thế lấy trí tuệ làm đầu.
Sātthatotiādīsu sīlādiatthasampattiyā sātthato, sabhāvaniruttisampattiyā sabyañjanato.
In "because it has meaning," etc., it is because it has meaning through the accomplishment of meaning such as moral conduct, and because it has phrasing through the accomplishment of phrasing and grammar.
Trong các trường hợp như sātthato (có ý nghĩa), sātthato (có ý nghĩa) là do sự đầy đủ ý nghĩa như giới hạnh, sabyañjanato (có văn tự) là do sự đầy đủ văn tự tự nhiên.
Suviññeyyasaddappayogatāya uttānapadato, saṇhasukhumabhāvena duviññeyyatthatāya gambhīratthato.
Because it has clear terms due to the use of easily understandable words; because it has profound meaning due to having meaning that is difficult to understand because of its subtle and fine nature.
Uttānapadato (có lời lẽ rõ ràng) là do việc sử dụng từ ngữ dễ hiểu; gambhīratthato (có ý nghĩa sâu xa) là do ý nghĩa khó hiểu vì sự tinh tế, vi diệu.
Siniddhamudumadhurasaddappayogatāya kaṇṇasukhato, vipulavisuddhapemanīyatthatāya hadayaṅgamato.
Because it is pleasant to the ear due to the use of smooth, soft, and sweet words; because it is endearing to the heart due to having meaning that is extensive, pure, and lovely.
Kaṇṇasukhato (dễ chịu tai) là do việc sử dụng từ ngữ dịu dàng, mềm mại, ngọt ngào; hadayaṅgamato (thấm vào lòng) là do ý nghĩa rộng lớn, thanh tịnh, đáng yêu.
Mānātimānavidhamanena anattukkaṃsanato, thambhasārambhanimmaddanena aparavambhanato.
Because it does not exalt oneself by destroying conceit and excessive conceit; because it does not disparage others by crushing stubbornness and contention.
Anattukkaṃsanato (không tự đề cao) là do diệt trừ kiêu mạn, ngã mạn; aparavambhanato (không khinh thường người khác) là do nghiền nát sự cứng nhắc, thô bạo.
Hitādhippāyappavattiyā paresaṃ rāgapariḷāhādivūpasamanena karuṇāsītalato, kilesandhakāravidhamanena paññāvadātato.
Because it is cooled by compassion by calming the fever of greed and so on in others through its proceeding with a beneficial intention; because it is bright with wisdom by dispelling the darkness of defilements.
Karuṇāsītalato (mát mẻ bởi lòng bi mẫn) là do sự khởi lên ý định lợi ích, làm dịu đi sự nung đốt của tham ái, v.v., cho người khác; paññāvadātato (thanh tịnh bởi trí tuệ) là do diệt trừ bóng tối phiền não.
Karavīkarutamañjutāya āpātharamaṇīyato, pubbāparāviruddhasuvisuddhatthatāya vimaddakkhamato.
Because it is delightful on the surface due to its sweetness like the voice of the karavīka bird; because it withstands scrutiny due to having a very pure meaning that is not contradictory between the beginning and the end.
Āpātharamaṇīyato (đẹp đẽ ngay từ đầu) là do sự ngọt ngào, du dương như tiếng chim Karavīka; vimaddakkhamato (chịu đựng được sự phân tích) là do ý nghĩa rất thanh tịnh, không mâu thuẫn trước sau.
Āpātharamaṇīyatāya eva suyyamānasukhato, vimaddakkhamatāya hitajjhāsayappavattitāya ca vīmaṃsiyamānahitatoti evamattho veditabbo.
Because it is pleasant to hear due to its delightfulness on the surface; because it is beneficial when investigated because it withstands scrutiny and proceeds from a beneficial intention. Thus the meaning should be understood.
Cần hiểu ý nghĩa như sau: suyyamānasukhato (dễ chịu khi nghe) là do sự đẹp đẽ ngay từ đầu; và vīmaṃsiyamānahitato (có lợi ích khi suy xét) là do chịu đựng được sự phân tích và khởi lên ý định lợi ích.
Evamādīhīti ādi-saddena saṃsāracakkanivattanato, saddhammacakkappavattanato, micchāvādavidhamanato, sammāvādapatiṭṭhāpanato, akusalamūlasamuddharaṇato, kusalamūlasaṃropanato, apāyadvārapidhānato, saggamaggadvāravivaraṇato, pariyuṭṭhānavūpasamanato, anusayasamugghātanatoti evamādīnaṃ saṅgaho daṭṭhabbo.
By and so on, the inclusion of the following should be understood: because it stops the wheel of saṃsāra, because it sets in motion the wheel of the true Dhamma, because it destroys wrong views, because it establishes right view, because it uproots unwholesome roots, because it plants wholesome roots, because it closes the door to the lower realms, because it opens the door to heaven and the path, because it pacifies obsessions, because it eradicates the underlying tendencies, and so on.
Evamādīhi (và những điều tương tự) – với từ ādi (v.v.), cần hiểu rằng nó bao gồm các điều như: do làm dừng bánh xe luân hồi, do làm chuyển bánh xe Chánh pháp, do diệt trừ tà kiến, do thiết lập chánh kiến, do nhổ tận gốc rễ bất thiện, do gieo trồng gốc rễ thiện, do đóng cửa các cõi khổ, do mở cửa con đường thiên giới và đạo lộ, do làm dịu các tùy miên, do nhổ tận gốc các phiền não tiềm ẩn, v.v.
Adhomukhaṭhapitanti kenaci adhomukhaṃ ṭhapitaṃ.
Placed upside down means placed face down by someone.
Adhomukhaṭhapitaṃ (đặt úp xuống) có nghĩa là bị ai đó đặt úp xuống.
Heṭṭhāmukhajātanti sabhāveneva heṭṭhāmukhaṃ jātaṃ.
Born facing downwards means born naturally facing downwards.
Heṭṭhāmukhajātaṃ (tự nhiên úp xuống) có nghĩa là tự nhiên có mặt úp xuống.
Ugghāṭeyyāti vivaṭaṃ kareyya.
Would uncover means would make open.
Ugghāṭeyyā (sẽ mở ra) có nghĩa là sẽ làm cho mở ra.
Hatthe gahetvāti ‘‘puratthābhimukho uttarābhimukho vā gacchā’’tiādīni avatvā hatthe gahetvā ‘‘nissandehaṃ esa maggo, evaṃ gacchā’’ti dasseyya.
Taking by the hand means that, without saying things like "Go facing east or facing north," he would take him by the hand and show him, saying, "Without a doubt, this is the path; go this way."
Hatthe gahetvā (nắm tay dẫn đi) có nghĩa là không nói “hãy đi về phía đông” hay “hãy đi về phía bắc,” mà nắm tay dẫn đi và chỉ đường “chắc chắn đây là con đường, hãy đi như vậy.”
Kāḷapakkhacātuddasīti kāḷapakkhe cātuddasī kāḷapakkhacātuddasī.
The fourteenth day of the dark fortnight means the fourteenth day in the dark fortnight is the fourteenth day of the dark fortnight.
Kāḷapakkhacātuddasī (ngày mười bốn của kỳ trăng khuyết) là ngày mười bốn của kỳ trăng khuyết.
Nikkujjitaṃ ukkujjeyyāti ādheyyassa anādhārabhūtaṃ bhājanaṃ ādhārabhāvāpādanavasena ukkujjeyya.
Would turn upright what was overturned means he would turn upright a vessel that was not a receptacle for its contents, thus making it a receptacle.
Nikkujjitaṃ ukkujjeyyā (sẽ lật ngửa cái bị úp) có nghĩa là sẽ lật ngửa cái bình không phải là vật chứa cho vật được chứa, để biến nó thành vật chứa.
Heṭṭhāmukhajātatāya saddhammavimukhaṃ adhomukhaṭhapitatāya asaddhamme patiṭṭhitanti evaṃ padadvayaṃ yathārahaṃ yojetabbaṃ, na yathāsaṅkhyaṃ.
The two terms, turned away from the true Dhamma due to being born facing downwards, and established in the false Dhamma due to being placed upside down, should be connected appropriately, not in sequential order.
Vì tự nhiên úp xuống nên saddhammavimukhaṃ (quay lưng lại với Chánh pháp), và vì bị đặt úp xuống nên asaddhamme patiṭṭhitaṃ (an trú trong phi Chánh pháp). Cần kết hợp hai từ này một cách thích hợp, không theo thứ tự số học.
Kāmaṃ kāmacchandādayopi paṭicchādakā nīvaraṇabhāvato, micchādiṭṭhi pana savisesaṃ paṭicchādikā satte micchābhinivesanenāti āha ‘‘micchādiṭṭhigahanapaṭicchanna’’nti.
Although sensual desire and so on are also concealers because they are hindrances, wrong view is a special concealer because it causes beings to adhere wrongly. Thus he said, "concealed by the thicket of wrong view."
Mặc dù tham ái, v.v., cũng là những chướng ngại che lấp, nhưng tà kiến đặc biệt che lấp chúng sinh bằng cách khiến họ bám chấp sai lầm, nên đã nói “micchādiṭṭhigahanapaṭicchannaṃ” (bị che lấp bởi rừng rậm tà kiến).
Tenāha bhagavā – ‘‘micchādiṭṭhiparamāhaṃ, bhikkhave, vajjaṃ vadāmī’’ti.
Therefore, the Blessed One said: "Monks, I declare wrong view to be the greatest fault."
Vì thế, Đức Thế Tôn đã nói: “Này các Tỳ-kheo, Ta nói tà kiến là tội lỗi tối thượng.”
Sabbo apāyagāmimaggo kummaggo kucchito maggoti katvā, sammādiṭṭhiādīnaṃ ujupaṭipakkhatāya micchādiṭṭhiādayo aṭṭha micchattadhammā micchāmaggo.
The entire path leading to the lower realms is the wrong path because it is a despicable path. The eight states of wrongness, such as wrong view, are the mistaken path because they are the direct opposite of right view and so on.
Tất cả con đường dẫn đến cõi khổ là kummaggo (con đường xấu) vì đó là con đường đáng chê trách; tám pháp tà kiến như tà kiến, v.v., là micchāmaggo (con đường sai lầm) vì chúng đối nghịch trực tiếp với chánh kiến, v.v.
Teneva hi tadubhayapaṭipakkhataṃ sandhāya ‘‘saggamokkhamaggaṃ ācikkhantenā’’ti vuttaṃ.
Indeed, for that very reason, referring to the opposition to both, it was said "by one who explains the path to heaven and liberation."
Do đó, để chỉ sự đối nghịch với cả hai, đã nói “saggamokkhamaggaṃ ācikkhantena” (bằng cách chỉ ra con đường đến thiên giới và giải thoát).
Sappiādisannissayo padīpo na tathā, ujjalo yathā telasannissayoti telapajjotaggahaṇaṃ.
A lamp fueled by ghee and so on is not as bright as one fueled by oil; thus, an oil lamp is mentioned.
Ngọn đèn dựa vào bơ, v.v., không sáng rực như ngọn đèn dựa vào dầu, do đó, đã dùng từ “ngọn đèn dầu.”
Etehi pariyāyehīti etehi nikkujjitukkujjanapaṭicchannavivaraṇādiupamopamitabbappakārehi, etehi vā yathāvuttehi arasarūpatādīnaṃ attani aññathā paṭipādanapariyāyehi attano dibbavihāravibhāvanapariyāyehi vijjattayavibhāvanāpadesena attano sabbaññuguṇavibhāvanapariyāyehi ca.
By these methods means by these various similes and subjects of similes, such as overturning and righting, concealing and revealing; or by these aforementioned methods of presenting the tasteless and so on in oneself in a different way, by the methods of revealing his own divine abiding, by the indication of revealing the three knowledges, and by the methods of revealing his quality of omniscience.
Etehi pariyāyehi (bằng những cách này) có nghĩa là bằng những cách ví dụ và được ví dụ như lật úp, lật ngửa, che đậy, mở ra, v.v.; hoặc bằng những cách đã nói ở trên về việc thể hiện các yếu tố như hương vị, hình sắc, v.v., một cách khác trong bản thân; bằng những cách thể hiện sự an trú thiêng liêng của mình; bằng cách thể hiện ba minh; và bằng những cách thể hiện các đức tính toàn tri của mình.
Tenāha ‘‘anekapariyāyena dhammo pakāsito’’ti.
Therefore he said, "the Dhamma has been clarified in many ways."
Do đó, đã nói “anekapariyāyena dhammo pakāsito” (giáo pháp đã được tuyên bố bằng nhiều cách).
Pasannākāranti pasannehi kātabbaṃ sakkāraṃ.
The mode of devotion means the veneration to be done by the devoted.
Pasannākāraṃ (sự tôn kính của người có niềm tin) có nghĩa là sự tôn kính được thực hiện bởi những người có niềm tin.
Saraṇaṃ gacchāmīti ettha iti-saddo luttaniddiṭṭhoti āha ‘‘saraṇanti gacchāmī’’ti.
In " Saraṇaṃ gacchāmī" (I go for refuge), the word iti is implicitly indicated, and thus it says " saraṇaṃ ti gacchāmī".
Trong cụm từ Saraṇaṃ gacchāmī, từ "iti" được chỉ ra là bị lược bỏ, do đó người ta nói ‘‘saraṇanti gacchāmī’’.
Ettha hi nāyaṃ gamisaddo nīsaddādayo viya dvikammako, tasmā yathā ajaṃ gāmaṃ netīti vuccati, evaṃ ‘‘gotamaṃ saraṇaṃ gacchāmī’’ti vattuṃ na sakkā, ‘‘saraṇanti gacchāmī’’ti pana vattabbaṃ, tasmā ettha iti-saddo luttaniddiṭṭhoti veditabbaṃ.
For here, this verb gami (to go) is not ditransitive like nī (to lead) and others. Therefore, just as it is said, "He leads the goat to the village," so too, it is not possible to say "Gotamaṃ saraṇaṃ gacchāmī" (I go to Gotama for refuge). Rather, it should be said, "Saraṇaṃ ti gacchāmī" (I go as refuge). Thus, it should be understood that here the word iti is implicitly indicated.
Thật vậy, ở đây, động từ gami này không phải là động từ hai tân ngữ như nī và các từ khác. Do đó, không thể nói ‘‘gotamaṃ saraṇaṃ gacchāmī’’ như cách nói ‘‘ajaṃ gāmaṃ netī’’ (dẫn dê đến làng). Mà phải nói ‘‘saraṇanti gacchāmī’’. Vì vậy, ở đây, từ "iti" được hiểu là bị lược bỏ.
Saraṇanti paṭisaraṇaṃ.
Saraṇa means refuge.
Saraṇaṃ nghĩa là nơi nương tựa.
Tenāha ‘‘parāyaṇa’’nti.
Therefore, it says " parāyaṇa" (supreme resort).
Vì thế, người ta nói ‘‘parāyaṇa’’ (chỗ nương tựa tối thượng).
Parāyaṇabhāvo ca anatthanisedhanena atthasampaṭipādanena ca hotīti āha ‘‘aghassa tātā hitassa ca vidhātā’’ti.
And the state of being a supreme resort comes about through preventing harm and bringing about welfare, so it says " aghassa tātā hitassa ca vidhātā" (rescuer from evil and dispenser of welfare).
Và trạng thái là chỗ nương tựa tối thượng có được nhờ ngăn chặn điều bất lợi và thành tựu điều lợi ích, vì vậy người ta nói ‘‘aghassa tātā hitassa ca vidhātā’’ (Đấng bảo hộ khỏi tai ương và ban phước lành).
Aghassāti dukkhatoti vadanti, pāpatoti pana attho yutto, nissakke cetaṃ sāmivacanaṃ.
Regarding " Aghassā," some say it means 'from suffering,' but 'from evil' is a more suitable meaning. And this is a possessive case in the sense of the ablative.
Aghassā một số người nói là từ khổ, nhưng nghĩa là từ ác nghiệp thì hợp lý hơn. Và đây là cách dùng sở thuộc cách (sāmivacana) trong nghĩa ly cách (nissakke).
Saraṇanti gamanañcettha tadadhippāyena bhajanaṃ tathā jānanaṃ vāti dassento ‘‘iti iminā adhippāyenā’’tiādimāha.
To show that 'going for refuge' here means resort with that intention, or knowing in that way, he says, " iti iminā adhippāyenā" (Thus, with this intention, etc.).
Để chỉ ra rằng việc đi đến nương tựa (saraṇaṃ gamanaṃ) ở đây là sự phụng sự với ý định đó, hoặc sự hiểu biết theo cách đó, người ta nói ‘‘iti iminā adhippāyenā’’ (với ý định này), v.v.
Tattha gacchāmītiādīsu purimassa purimassa pacchimaṃ pacchimaṃ atthavacanaṃ.
Among these, gacchāmī (I go) and so forth, the later term is the semantic explanation of the former term.
Trong đó, đối với các từ như gacchāmī, v.v., từ sau là nghĩa của từ trước.
Bhajanaṃ vā saraṇādhippāyena upasaṅkamanaṃ, sevanā santikāvacaratā, payirupāsanaṃ vattappaṭivattakaraṇena upaṭṭhānanti evaṃ sabbathāpi anaññasaraṇataṃyeva dīpeti.
Or bhajana (resorting) is approaching with the intention of refuge, sevanā (serving) is being close by, payirupāsanaṃ (attending) is attending by performing duties and counter-duties, thus in every way, it indicates only non-reliance on others.
Hoặc bhajanaṃ (phụng sự) là sự đến gần với ý định nương tựa, sevanā (thân cận) là sự ở gần, payirupāsanaṃ (cung kính phụng sự) là sự phục vụ bằng cách làm các bổn phận lớn nhỏ. Như vậy, trong mọi trường hợp, nó đều chỉ ra sự không nương tựa vào bất cứ ai khác.
Gacchāmīti padassa kathaṃ bujjhāmīti ayamattho labbhatīti āha ‘‘yesaṃ hī’’tiādi.
To the question of how the meaning 'I understand' is obtained for the word gacchāmī, he says, " yesaṃ hī" (for those who...), etc.
Để giải thích làm thế nào mà từ Gacchāmī lại có nghĩa là bujjāmī (tôi hiểu), người ta nói ‘‘yesaṃ hī’’ (Thật vậy, những ai), v.v.
Adhigatamagge sacchikatanirodheti padadvayenapi phalaṭṭhā eva dassitā, na maggaṭṭhāti te dassento ‘‘yathānusiṭṭhaṃ paṭipajjamāne cā’’ti āha.
By the two terms " adhigatamagge sacchikatanirodhe" (who have attained the Path and realized Nibbāna), only those established in the Fruit are indicated, not those established in the Path. To show them, he says, " yathānusiṭṭhaṃ paṭipajjamāne cā" (and those practicing according to the instructions).
Với hai từ adhigatamagge sacchikatanirodhe (đã đạt Đạo, đã chứng Niết Bàn), chỉ có những người đã chứng quả được chỉ ra, chứ không phải những người đang ở trên Đạo. Để chỉ ra những người đang ở trên Đạo, người ta nói ‘‘yathānusiṭṭhaṃ paṭipajjamāne cā’’ (và những ai thực hành theo lời giáo huấn).
Nanu ca kalyāṇaputhujjanopi yathānusiṭṭhaṃ paṭipajjatīti vuccatīti?
But is it not said that even an ordinary virtuous person practices according to the instructions?
Há không phải người phàm thiện cũng được gọi là thực hành theo lời giáo huấn sao?
Kiñcāpi vuccati, nippariyāyena pana maggaṭṭhā eva tathā vattabbā, na itare niyāmokkamanābhāvato.
Although it is said, properly speaking, only those established in the Path should be spoken of in that way, not others, due to the absence of their entry into the definite course (niyāma).
Mặc dù có thể nói như vậy, nhưng một cách trực tiếp, chỉ những người đang ở trên Đạo mới được gọi như vậy, chứ không phải những người khác, vì họ chưa bước vào sự chắc chắn (niyāma).
Tathā hi te eva ‘‘apāyesu apatamāne dhāretī’’ti vuttā.
Thus, only they are spoken of as " apāyesu apatamāne dhāretī" (sustaining those who do not fall into the lower realms).
Thật vậy, chỉ những người đó mới được nói là ‘‘apāyesu apatamāne dhāretī’’ (giữ cho không rơi vào các cõi khổ).
Sammattaniyāmokkamanena hi apāyavinimuttasambhavo.
For liberation from the lower realms is possible through entry into the definite course of rightness (sammattaniyāma).
Vì sự giải thoát khỏi các cõi khổ chỉ có thể xảy ra khi bước vào sự chắc chắn của Chánh Đạo (sammattaniyāma).
Akkhāyatīti ettha iti-saddo ādiattho, pakārattho vā.
In " akkhāyatī" (is declared), the word iti signifies 'and so on' or 'type'.
Trong từ Akkhāyatīti, từ iti có nghĩa là "v.v." hoặc "cách thức".
Tena ‘‘yāvatā, bhikkhave, dhammā saṅkhatā vā asaṅkhatā vā, virāgo tesaṃ aggamakkhāyatī’’ti (itivu. 90; a. ni. 4.34) suttapadaṃ saṅgaṇhāti, ‘‘vitthāro’’ti vā iminā.
By this, it includes the phrase, "Whatever dhammas there are, monks, whether conditioned or unconditioned, dispassion is declared to be the best of them," or it is included by the word " vitthāro" (elaboration).
Do đó, nó bao gồm suttapadaṃ (câu kinh) ‘‘Này các Tỳ-kheo, trong số tất cả các pháp hữu vi hay vô vi, sự ly tham (virāga) được tuyên bố là tối thượng’’ (Itivu. 90; A.IV.34), hoặc với từ ‘‘vitthāro’’ (sự mở rộng).
Ettha ca ariyamaggo niyyānikatāya, nibbānaṃ tassa tadatthasiddhihetutāyāti ubhayameva nippariyāyena dhammoti vutto.
Here, the Noble Path is called Dhamma in an ultimate sense due to its emancipating nature, and Nibbāna, due to its being the cause for the accomplishment of that goal.
Ở đây, Bát Chánh Đạo được gọi là Pháp một cách trực tiếp vì nó dẫn đến sự giải thoát (niyyānikatā), và Niết Bàn cũng vậy vì nó là nguyên nhân thành tựu mục đích của Bát Chánh Đạo.
Nibbānañhi ārammaṇapaccayabhūtaṃ labhitvā ariyamaggassa tadatthasiddhi, tathāpi ariyaphalānaṃ ‘‘yasmā tāya saddhāya avūpasantāyā’’tiādivacanato maggena samucchinnānaṃ kilesānaṃ paṭippassaddhippahānakiccatāya niyyānānuguṇatāya niyyānapariyosānatāya ca.
For the Noble Path achieves its goal by taking Nibbāna as its object-condition. And also for the Noble Fruits, because of expressions like "since that faith is not subsided," and because of the task of tranquillizing and abandoning defilements utterly eradicated by the path, and because of its suitability for emancipation, and because its culmination is emancipation.
Thật vậy, sau khi đạt được Niết Bàn là đối tượng duyên, mục đích của Bát Chánh Đạo được thành tựu. Hơn nữa, các quả Thánh (ariyaphala) cũng có liên quan đến sự giải thoát, vì chúng có chức năng làm lắng dịu và đoạn trừ các phiền não đã bị Đạo đoạn diệt, phù hợp với sự giải thoát và kết thúc bằng sự giải thoát, như lời dạy ‘‘yasmā tāya saddhāya avūpasantāyā’’ti (vì niềm tin đó chưa được an tịnh), v.v.
Pariyattidhammassa pana niyyānadhammasamadhigamahetutāyāti iminā pariyāyena vuttanayena dhammabhāvo labbhati eva, svāyamattho pāṭhāruḷho evāti dassento ‘‘na kevala’’ntiādimāha.
The Dhamma of learning, however, is attained by this method as Dhamma by way of being the cause for the realization of the Dhamma of emancipation. To show that this meaning is clearly stated in the text, he says, " na kevala" (not only), etc.
Còn đối với Pháp học (pariyattidhamma), nó có thể được xem là Pháp một cách gián tiếp, theo cách đã nói, vì nó là nguyên nhân để đạt được Pháp giải thoát (niyyānadhamma). Để chỉ ra rằng ý nghĩa này đã có sẵn trong kinh điển, người ta nói ‘‘na kevala’’ (không chỉ), v.v.
Rāgavirāgoti maggo kathitoti kāmarāgo bhavarāgoti evamādibhedo sabbopi rāgo virajjati pahīyati etenāti rāgavirāgoti maggo kathito.
" Rāgavirāgo ti maggo kathito" means that the Path is called Rāgavirāga because all craving, such as sensual craving and craving for existence, is abandoned and eliminated by it.
Rāgavirāgoti maggo kathito (Đạo được gọi là Rāgavirāga - sự ly tham): Tất cả mọi tham ái, như dục tham (kāmarāga), hữu tham (bhavarāga), v.v., đều được đoạn trừ bởi Đạo này. Vì vậy, Đạo được gọi là Rāgavirāga.
Anejamasokanti phalanti ejāsaṅkhātāya taṇhāya antonijjhānalakkhaṇassa sokassa ca taduppattiyaṃ sabbaso parikkhīṇattā anejamasokanti phalaṃ kathitaṃ.
" Anejamasokaṃ ti phalaṃ" means that the Fruit is called Anejamasokaṃ (free from agitation and sorrow) because agitation, which is craving, and sorrow, which is characterized by internal burning, are completely eradicated when they arise.
Anejamasokanti phala (Quả được gọi là Anejamasoka - không dao động, không sầu muộn): Quả được gọi là Anejamasoka vì tham ái (ejā) và sầu muộn (soka), vốn có đặc tính là sự thiêu đốt bên trong, đã hoàn toàn bị diệt tận khi chúng sinh khởi.
Appaṭikūlanti avirodhadīpanato kenaci aviruddhaṃ, iṭṭhaṃ paṇītanti vā attho.
" Appaṭikūlaṃ" (not repulsive) means not in conflict with anything, showing non-opposition, or it means desirable and excellent.
Appaṭikūlaṃ (không đối nghịch) nghĩa là không mâu thuẫn với bất kỳ điều gì, vì nó chỉ ra sự không đối kháng, hoặc nghĩa là điều mong muốn và cao quý.
Paguṇarūpena pavattitattā, pakaṭṭhaguṇavibhāvanato vā paguṇaṃ.
" Paguṇaṃ" (familiar, well-versed) means being well-practiced, or due to revealing excellent qualities.
Paguṇaṃ (tinh thông) là vì nó được thực hành một cách thuần thục, hoặc vì nó biểu lộ những phẩm chất ưu việt.
Yathāha ‘‘vihiṃsasaññī paguṇaṃ nabhāsiṃ, dhammaṃ paṇītaṃ manujesu brahme’’ti (ma. ni. 1.283; mahāva. 9).
As it is said: "I, who am inclined to non-harming, spoke well, O Brahmin, of the excellent Dhamma among humans."
Như đã nói: ‘‘Vihiṃsasaññī paguṇaṃ nabhāsiṃ, dhammaṃ paṇītaṃ manujesu brahme’’ (Với tâm không hại, tôi đã tuyên bố Pháp cao quý giữa loài người, hỡi Bà-la-môn) (M.I.283; Mahāva. 9).
Sabbadhammakkhandhā kathitāti yojanā.
The connection is: "all the Dhammakkhandhas are described."
Tất cả các pháp uẩn đã được nói đến là sự kết nối.
Diṭṭhisīlasaṅghātenāti ‘‘yāyaṃ diṭṭhi ariyā niyyānikā niyyāti takkarassa sammā dukkhakkhayāya, tathārūpāya diṭṭhiyā diṭṭhisāmaññagato viharatī’’ti (dī. ni. 3.324, 356; ma. ni. 1.492; 3.54) evaṃ vuttāya diṭṭhiyā ‘‘yāni tāni sīlāni akhaṇḍāni acchiddāni asabalāni akammāsāni bhujissāni viññuppasatthāni aparāmaṭṭhāni samādhisaṃvattanikāni, tathārūpehi sīlehi sīlasāmaññagato viharatī’’ti (dī. ni. 3.324, 356; ma. ni. 1.492; 3.54; a. ni. 6.12) evaṃ vuttānaṃ sīlānañca saṃhatabhāvena, diṭṭhisīlasāmaññenāti attho.
" Diṭṭhisīlasaṅghātena" (by the combination of view and virtue) means by the unified state of such view as, "This Noble View leads out, leading to the utter destruction of suffering for one who practices it rightly," and such virtues as, "these virtues are unbroken, untorn, unblemished, unblotted, liberating, praised by the wise, ungrasped, conducive to concentration," or it means by the sameness of view and virtue.
Diṭṭhisīlasaṅghātenā (bằng sự kết hợp của chánh kiến và giới hạnh): Nghĩa là bằng sự hợp nhất của chánh kiến (diṭṭhi) được nói đến như ‘‘yāyaṃ diṭṭhi ariyā niyyānikā niyyāti takkarassa sammā dukkhakkhayāya, tathārūpāya diṭṭhiyā diṭṭhisāmaññagato viharatī’’ (chánh kiến này là Thánh, đưa đến giải thoát, dẫn người thực hành nó đến sự diệt khổ hoàn toàn; người sống với chánh kiến như vậy sẽ có sự đồng nhất về chánh kiến), và giới hạnh (sīla) được nói đến như ‘‘yāni tāni sīlāni akhaṇḍāni acchiddāni asabalāni akammāsāni bhujissāni viññuppasatthāni aparāmaṭṭhāni samādhisaṃvattanikāni, tathārūpehi sīlehi sīlasāmaññagato viharatī’’ (những giới hạnh không bị phá vỡ, không bị lỗi lầm, không bị vết nhơ, không bị ô uế, tự do, được người trí khen ngợi, không bị chấp thủ, đưa đến định; người sống với giới hạnh như vậy sẽ có sự đồng nhất về giới hạnh); nghĩa là bằng sự đồng nhất về chánh kiến và giới hạnh.
Saṃhatoti ghaṭito, sametoti attho.
" Saṃhato" means united, joined together.
Saṃhato (hợp nhất) nghĩa là được kết hợp, được hòa hợp.
Ariyapuggalā hi yattha katthaci dūre ṭhitāpi attano guṇasāmaggiyā saṃhatā eva.
For Noble Persons, even if they are far apart, they are united by the totality of their qualities.
Thật vậy, các bậc Thánh nhân, dù ở xa cách nhau, vẫn luôn hợp nhất nhờ sự toàn vẹn của phẩm hạnh của mình.
Aṭṭha ca puggalā dhammadasā teti purisayugaḷavasena cattāropi puggalavasena aṭṭheva ariyadhammassa paccakkhadassāvitāya dhammadasā.
" Aṭṭha ca puggalā dhammadasā te" (and these eight persons see the Dhamma) refers to the four pairs of individuals, or eight individuals in terms of persons, who are dhammadasā because they directly see the Noble Dhamma.
Aṭṭha ca puggalā dhammadasā te (và tám hạng người đó là những người thấy Pháp): Tám hạng người, tức là bốn cặp người hoặc tám cá nhân, là những người thấy Pháp (dhammadasā) vì họ trực tiếp thấy được Thánh Pháp (ariyadhamma).
Tīṇi vatthūni saraṇanti gamanena tikkhattuṃ gamanena ca tīṇi saraṇagamanāni.
Tīṇi saraṇagamanāni are the three acts of going for refuge, by going for refuge to the three objects, and by going three times.
Ba đối tượng nương tựa và việc đi đến nương tựa ba lần được gọi là tīṇi saraṇagamanāni (ba lần quy y).
Paṭivedesīti attano hadayaṅgataṃ vācāya pavedesi.
Paṭivedesī means he declared by word what was in his heart.
Paṭivedesī (tuyên bố) nghĩa là tuyên bố bằng lời nói điều đã thấm sâu vào lòng mình.
Saraṇagamanassa visayappabhedaphalasaṃkilesabhedānaṃ viya kattu ca vibhāvanā tattha kosallāya hotīti ‘‘saraṇagamanesu kosallatthaṃ saraṇaṃ…pe… veditabbo’’ti vuttaṃ tena vinā saraṇagamanasseva asambhavato.
The exposition of the agent of going for refuge, similar to the distinctions of its object, divisions, fruits, and defilements, is for skill in it. Thus, it is said " saraṇagamanesu kosallatthaṃ saraṇaṃ…pe… veditabbo" (for skill in going for refuge, refuge…to be understood), because without it, the very act of going for refuge is impossible.
Việc làm rõ người hành trì (kattu) cũng như đối tượng, sự phân loại, quả và sự nhiễm ô của sự quy y (saraṇagamana) là hữu ích cho sự tinh thông về nó, vì vậy người ta nói ‘‘saraṇagamanesu kosallatthaṃ saraṇaṃ…pe… veditabbo’’ (để tinh thông về sự quy y, sự quy y…v.v… cần được hiểu), vì nếu không có người hành trì thì sự quy y không thể tồn tại.
Tattha saraṇanti padatthato tāva hiṃsatīti saraṇaṃ.
Here, saraṇaṃ, from the meaning of the word itself, is that which harms.
Trong đó, saraṇaṃ theo nghĩa từ nguyên, trước hết là "làm hại" (hiṃsati), nên được gọi là saraṇaṃ.
Hiṃsatthassa hi sarasaddassa vasenetaṃ padaṃ daṭṭhabbaṃ, tasmā saraṇagatānaṃ teneva saraṇagamanena vaṭṭabhayaṃ cittutrāsaṃ kāyikaṃ dukkhaṃ duggatipariyāpannaṃ sabbampi dukkhaṃ hanati, vināsetīti attho.
Indeed, this word should be seen in the sense of the root sar (to harm). Therefore, it means that for those who have gone for refuge, by that very act of going for refuge, it destroys and eliminates all suffering, such as the fear of Saṃsāra, mental terror, bodily pain, and all suffering included in the lower realms.
Thật vậy, từ này phải được hiểu theo gốc từ sar có nghĩa là làm hại. Do đó, đối với những người đã quy y, chính sự quy y đó sẽ tiêu diệt, làm chấm dứt mọi khổ đau như nỗi sợ hãi luân hồi (vaṭṭabhayaṃ), sự lo âu trong tâm (cittutrāsaṃ), khổ đau thể chất (kāyikaṃ dukkhaṃ), và tất cả những khổ đau thuộc về các cõi xấu (duggatipariyāpannaṃ).
Ratanattayassevetaṃ adhivacanaṃ.
This is an appellation for the Triple Gem.
Đây là một tên gọi khác của Tam Bảo (Ratanattaya).
Atha vā hite pavattanena ‘‘sampannasīlā, bhikkhave, viharathā’’tiādinā (ma. ni. 1.64) atthe niyojanena ahitā ca nivattanena ‘‘pāṇātipātassa kho pana pāpako vipāko, pāpakaṃ abhisamparāya’’ntiādinā ādīnavadassanādimukhena anatthato nivattanena sattānaṃ bhayaṃ hiṃsati, hitāhitesu appavattipavattihetukaṃ byasanaṃ apavattikaraṇena vināseti buddho.
Alternatively, the Buddha harms (destroys) the fear of beings by guiding them towards welfare, by applying them to benefits as in "Monks, dwell with accomplished virtue," and by deterring them from harm, by causing them to desist from what is not beneficial through showing danger, as in "Indeed, the result of the destruction of life is evil, an evil future existence." He removes the calamity caused by acting or not acting with respect to welfare and harm, by causing non-occurrence.
Hoặc, Đức Phật tiêu diệt nỗi sợ hãi của chúng sinh bằng cách hướng họ đến điều lợi ích qua lời dạy ‘‘Này các Tỳ-kheo, hãy sống với giới hạnh đầy đủ’’ (M.I.64), v.v., và ngăn cản họ khỏi điều bất lợi bằng cách chỉ ra những nguy hại qua lời dạy ‘‘Quả báo của việc sát sinh là ác, hậu quả sau khi chết là ác’’, v.v., tức là ngăn chặn chúng sinh khỏi điều bất lợi bằng cách chỉ ra những nguy hại; Ngài tiêu diệt sự hủy hoại do sự không hành động hoặc hành động trong điều lợi ích và bất lợi bằng cách làm cho chúng không xảy ra.
Bhavakantārauttaraṇena maggasaṅkhāto dhammo sattānaṃ bhayaṃ hiṃsati, itaro assāsadānena.
The Dhamma, called the Path, harms the fear of beings by crossing the wilderness of existence; the other Dhamma (of learning) by giving solace.
Pháp, tức là Đạo (magga), tiêu diệt nỗi sợ hãi của chúng sinh bằng cách giúp họ vượt qua sa mạc sinh tử (bhavakantāra); Pháp khác (tức Pháp học) thì bằng cách ban sự an ủi.
Appakānampi dānavasena pūjāvasena ca upanītānaṃ sakkārānaṃ vipulaphalapaṭilābhakaraṇena sattānaṃ bhayaṃ hiṃsati saṅgho anuttaradakkhiṇeyyabhāvato, tasmā imināpi vibhajitvā vuttapariyāyena ratanattayaṃ saraṇaṃ.
The Saṅgha harms the fear of beings by causing the attainment of abundant fruits from even small offerings brought as gifts and homage, because of being the unsurpassed field of merit. Therefore, by this method of distinction, the Triple Gem is saraṇa (refuge).
Tăng đoàn tiêu diệt nỗi sợ hãi của chúng sinh bằng cách làm cho những sự cúng dường nhỏ bé, dù là dâng cúng hay tôn kính, đều mang lại quả báo lớn lao, vì Tăng đoàn là ruộng phước vô thượng (anuttaradakkhiṇeyyabhāva). Do đó, theo cách phân loại và giải thích này, Tam Bảo cũng là nơi nương tựa.
‘‘Sammāsambuddho bhagavā, svākkhāto dhammo, suppaṭipanno saṅgho’’ti evaṃ pavattaratanattayapasaādataggarukatāhi vidhutadiṭṭhivicikicchāsammohaassaddhiyāditāya vihatakileso tadeva ratanattayaṃ saraṇaṃ parāyaṇaṃ gati tāṇaṃ leṇanti evaṃ pavattiyā tapparāyaṇatākārappavatto cittuppādo saraṇagamanaṃ saraṇanti gacchati etenāti katvā.
The mind-moment that arises in the manner of having the Triple Gem as one's resort, by which one has destroyed defilements due to the elimination of wrong view, doubt, delusion, lack of faith, etc., through veneration and high esteem for the Triple Gem — saying, "The Blessed One is perfectly enlightened, the Dhamma is well-expounded, the Saṅgha is well-practiced" — and takes that very Triple Gem as refuge, as resort, as destination, as protection, as shelter; this is called saraṇagamana because one goes to refuge with it.
Với sự thanh tịnh và lòng tôn kính Tam Bảo đã phát sinh như vậy: “Đức Thế Tôn là bậc Chánh Đẳng Giác, Pháp đã được thuyết giảng khéo léo, Tăng chúng là những bậc tu hành chân chánh”, nhờ đó mà các tà kiến, hoài nghi, si mê, vô tín, v.v., đã được loại bỏ, phiền não đã được tiêu diệt; chính Tam Bảo ấy là nơi nương tựa (saraṇa), là nơi quy hướng (parāyaṇa), là nơi đến (gati), là nơi che chở (tāṇa), là nơi ẩn náu (leṇa). Tâm sở phát sinh với hình thái quy hướng về Tam Bảo ấy, được gọi là quy y (saraṇagamana), vì nhờ đó mà người ta đi đến chỗ nương tựa.
Tena yathāvuttacittuppādena samannāgato satto saraṇanti gacchati, vuttappakārena cittuppādena ‘‘etāni me tīṇi ratanāni saraṇaṃ, etāni parāyaṇa’’nti evaṃ upeti bhajati sevati payirupāsati, evaṃ vā jānāti, bujjhatīti attho.
A being endowed with that aforementioned mind-moment goes to refuge, or, by means of the mind-moment described, approaches, resorts to, attends upon, or reveres, saying, "These three jewels are my refuge, these are my resort." This is the meaning, or one understands or comprehends thus.
Chúng sinh nào đầy đủ tâm sở vừa nêu, thì đi đến chỗ nương tựa. Với tâm sở đã nói, người ấy đến gần, phụng sự, thân cận, cung kính, hoặc hiểu biết như vậy: “Ba ngôi báu này là nơi nương tựa của tôi, ba ngôi báu này là nơi quy hướng của tôi”, đó là ý nghĩa.
Evaṃ tāva saraṇaṃ, saraṇagamanaṃ, yo ca saraṇaṃ gacchati, idaṃ tayaṃ veditabbaṃ.
Thus, refuge (saraṇa), going for refuge (saraṇagamana), and the one who goes for refuge—these three should be understood.
Như vậy, cần phải biết ba điều này: nơi nương tựa (saraṇa), sự quy y (saraṇagamana), và người quy y.
Saraṇagamanappabhede pana duvidhaṃ saraṇagamanaṃ lokuttaraṃ lokiyañca.
In the classification of going for refuge, there are two kinds of going for refuge: supramundane (lokuttara) and mundane (lokiya).
Tuy nhiên, trong các loại quy y (saraṇagamanappabhede), quy y có hai loại: siêu thế và thế gian.
Tattha lokuttaraṃ diṭṭhasaccānaṃ maggakkhaṇe saraṇagamanupakkilesasamucchedanena ārammaṇato nibbānārammaṇaṃ hutvā kiccato sakalepi ratanattaye ijjhati.
Among these, the supramundane going for refuge, for those who have seen the truths, at the moment of the path, by the complete eradication of defilements that corrupt going for refuge, becomes nibbāna as its object and is accomplished in the entire Triple Gem in terms of its function.
Trong đó, quy y siêu thế của các bậc đã chứng ngộ chân lý, vào sát-na đạo, thành tựu do sự đoạn trừ hoàn toàn các cấu uế của quy y, và về mặt đối tượng, là lấy Nibbāna làm đối tượng, về mặt công năng, nó thành tựu trong toàn bộ Tam Bảo.
Atthato catusaccādhigamo eva hi lokuttarasaraṇagamanaṃ.
For, in essence, the attainment of the Four Noble Truths is indeed supramundane going for refuge.
Thật vậy, về mặt ý nghĩa, sự chứng đắc Tứ Diệu Đế chính là quy y siêu thế.
Tattha hi nibbānadhammo sacchikiriyābhisamayavasena, maggadhammo bhāvanābhisamayavasena paṭivijjhiyamānoyeva saraṇagamanatthaṃ sādheti, buddhaguṇā pana sāvakagocarabhūtā pariññābhisamayavasena, tathā ariyasaṅghaguṇā.
For here, the Dhamma of Nibbāna, when penetrated by way of realization-abhisamaya, and the Dhamma of the path, when penetrated by way of development-abhisamaya, accomplish the meaning of going for refuge; and the qualities of the Buddha, which are within the range of disciples, and likewise the qualities of the Noble Saṅgha, are penetrated by way of full-understanding-abhisamaya.
Ở đó, Pháp Nibbāna được chứng đắc thông qua sự chứng ngộ bằng cách thực chứng, Pháp đạo được chứng đắc thông qua sự chứng ngộ bằng cách tu tập, thì mới thành tựu ý nghĩa của quy y. Còn các đức Phật, là đối tượng của chư vị Thanh văn, được chứng đắc thông qua sự chứng ngộ bằng cách liễu tri; và các đức của Tăng đoàn Thánh cũng vậy.
Tena vuttaṃ ‘‘kiccato sakalepi ratanattaye ijjhatī’’ti.
Therefore it is said, "it is accomplished in the entire Triple Gem in terms of its function."
Do đó, có lời dạy: “về mặt công năng, nó thành tựu trong toàn bộ Tam Bảo”.
Ijjhantañca saheva ijjhati, na lokiyaṃ viya paṭipāṭiyā asammohapaṭivedhena paṭividdhattā.
And when it is accomplished, it is accomplished simultaneously, not in succession like the mundane, because it is penetrated through undeluded penetration.
Và khi thành tựu, nó thành tựu đồng thời, không như quy y thế gian, thành tựu theo thứ tự, vì nó được thấu triệt bằng sự thấu triệt không lầm lẫn.
Ye pana vadanti ‘‘na saraṇagamanaṃ nibbānārammaṇaṃ hutvā pavattati, maggassa adhigatattā pana adhigatameva hoti ekaccānaṃ tevijjādīnaṃ lokiyavijjādayo viyā’’ti, tesaṃ lokiyameva saraṇagamanaṃ siyā, na lokuttaraṃ.
But those who say, "Going for refuge does not arise with Nibbāna as its object; rather, because the path has been attained, it is already attained for some, such as those with the three knowledges, like mundane knowledges, etc.," for them, going for refuge would be merely mundane, not supramundane.
Nhưng những ai nói rằng: “Sự quy y không phát sinh lấy Nibbāna làm đối tượng, mà do đã chứng đắc đạo, nên nó đã được chứng đắc đối với một số người có Tam Minh, v.v., giống như các loại minh thế gian”, thì đối với họ, quy y ấy chỉ là quy y thế gian, không phải siêu thế.
Tañca ayuttaṃ duvidhassapi icchitabbattā.
And that is improper, because both types are desired.
Và điều đó không hợp lý, vì cả hai loại đều được mong muốn.
Lokiyaṃ pana saraṇagamanaṃ puthujjanānaṃ saraṇagamanupakkilesavikkhambhanena ārammaṇato buddhādiguṇārammaṇaṃ hutvā ijjhati.
Mundane going for refuge, however, for ordinary people, is accomplished by overcoming the defilements that corrupt going for refuge, having the qualities of the Buddha and so forth as its object.
Còn quy y thế gian của phàm phu, thành tựu do sự trấn áp các cấu uế của quy y, và về mặt đối tượng, là lấy các đức của Phật, v.v., làm đối tượng.
Taṃ atthato buddhādīsu vatthūsu ‘‘sammāsambuddho bhagavā’’tiādinā saddhāpaṭilābho yathāvuttasaddhāpubbaṅgamā ca sammādiṭṭhi, dasasu puññakiriyavatthūsu diṭṭhijukammanti vuccati.
This, in essence, is called the attainment of faith in the objects of the Buddha and so forth, saying "The Blessed One is the Perfectly Enlightened One" and so on, and the right view preceded by such faith, and the rectification of views among the ten bases of meritorious action.
Về mặt ý nghĩa, đó là sự chứng đắc niềm tin vào các đối tượng như Phật, v.v., qua lời nói “Đức Thế Tôn là bậc Chánh Đẳng Giác”, v.v., và Chánh kiến có niềm tin như đã nói làm tiền đề, được gọi là sự làm cho kiến chấp ngay thẳng trong mười nghiệp thiện xứ.
Ettha ca ‘‘saddhāpaṭilābho’’ti iminā mātādīhi ussāhitadārakādīnaṃ viya ñāṇavippayuttasaraṇagamanaṃ dassitanti veditabbaṃ.
Here, by "attainment of faith," going for refuge dissociated from knowledge, like that of children exhorted by mothers and so forth, should be understood as shown.
Và ở đây, qua từ “saddhāpaṭilābho” (chứng đắc niềm tin), cần phải hiểu rằng quy y không kèm trí tuệ được chỉ ra, giống như đối với trẻ em được cha mẹ, v.v., khuyến khích.
‘‘Sammādiṭṭhī’’ti iminā pana ñāṇasampayuttaṃ saraṇagamanaṃ dassitaṃ buddhasubuddhataṃ dhammasudhammataṃ saṅghasuppaṭipattiñca lokiyāvabodhavaseneva sammā ñāyena dassanato.
By "right view," however, going for refuge associated with knowledge is shown, because the perfect enlightenment of the Buddha, the perfect exposition of the Dhamma, and the perfect practice of the Saṅgha are rightly understood only by way of mundane comprehension.
Còn qua từ “sammādiṭṭhī” (chánh kiến), quy y kèm trí tuệ được chỉ ra, vì sự toàn giác của Đức Phật, sự diệu pháp của Giáo Pháp, và sự tu hành chân chánh của Tăng đoàn được hiểu một cách đúng đắn chỉ thông qua sự giác ngộ thế gian.
Tayidaṃ lokiyasaraṇagamanaṃ catudhā pavattati attasanniyyātanena tapparāyaṇatāya sissabhāvūpagamanena paṇipātenāti.
This mundane going for refuge manifests in four ways: by self-surrender, by taking them as one's resort, by assuming the state of a disciple, and by prostration.
Sự quy y thế gian này phát sinh theo bốn cách: dâng hiến tự thân, quy hướng, trở thành đệ tử, và đảnh lễ.
Tattha attasanniyyātanaṃ nāma ‘‘ajja ādiṃ katvā ahaṃ attānaṃ buddhassa niyyātemi, dhammassa, saṅghassā’’ti evaṃ buddhādīnaṃyeva saṃsāradukkhanittharaṇatthaṃ attano attabhāvassa pariccajanaṃ.
Among these, self-surrender means offering one's existence to the Buddha, the Dhamma, and the Saṅgha for the purpose of escaping the suffering of saṃsāra, as in "Beginning from today, I surrender myself to the Buddha, to the Dhamma, to the Saṅgha."
Trong đó, dâng hiến tự thân (attasanniyyātanaṃ) có nghĩa là từ nay trở đi, tôi dâng hiến thân mình cho Đức Phật, cho Giáo Pháp, cho Tăng đoàn; tức là sự từ bỏ thân mạng của mình vì mục đích thoát khỏi khổ đau luân hồi, chỉ dành riêng cho Đức Phật, v.v.
Tapparāyaṇatā nāma ‘‘ajja ādiṃ katvā ahaṃ buddhaparāyaṇo dhammaparāyaṇo saṅghaparāyaṇoti maṃ dhārethā’’ti evaṃ tapparāyaṇabhāvo.
Taking them as one's resort means having the Triple Gem as one's resort, as in, "Beginning from today, may you remember me as one whose resort is the Buddha, whose resort is the Dhamma, whose resort is the Saṅgha."
Quy hướng (tapparāyaṇatā) có nghĩa là từ nay trở đi, hãy ghi nhận tôi là người quy hướng về Đức Phật, quy hướng về Giáo Pháp, quy hướng về Tăng đoàn; tức là trạng thái quy hướng về các bậc đó.
Sissabhāvūpagamanaṃ nāma ‘‘ajja ādiṃ katvā ‘ahaṃ buddhassa antevāsiko, dhammassa, saṅghassā’ti maṃ dhārethā’’ti evaṃ sissabhāvūpagamo.
Assuming the state of a disciple means becoming a disciple, as in, "Beginning from today, may you remember me as a resident-disciple of the Buddha, of the Dhamma, of the Saṅgha."
Trở thành đệ tử (sissabhāvūpagamanaṃ) có nghĩa là từ nay trở đi, hãy ghi nhận tôi là đệ tử của Đức Phật, của Giáo Pháp, của Tăng đoàn; tức là sự trở thành đệ tử.
Paṇipāto nāma ‘‘ajja ādiṃ katvā ‘ahaṃ abhivādanaṃ paccuṭṭhānaṃ añjalikammaṃ sāmīcikammaṃ buddhādīnaṃyeva tiṇṇaṃ vatthūnaṃ karomī’ti maṃ dhārethā’’ti evaṃ buddhādīsu paramanipaccakāro.
Prostration means showing the utmost reverence to the Buddha and so forth, as in, "Beginning from today, may you remember me as one who performs salutation, rising to meet, anjali, and proper conduct only to the three objects, the Buddha and so forth."
Đảnh lễ (paṇipāto) có nghĩa là từ nay trở đi, hãy ghi nhận tôi sẽ thực hiện sự đảnh lễ, đứng dậy chào đón, chắp tay, và những hành động cung kính chỉ dành cho ba ngôi báu là Đức Phật, v.v.; tức là sự tôn kính tối thượng đối với Đức Phật, v.v.
Imesañhi catunnaṃ ākārānaṃ aññatarampi karontena gahitaṃyeva hoti saraṇagamanaṃ.
Indeed, by performing any one of these four modes, going for refuge is considered to have been taken.
Thật vậy, khi thực hiện bất kỳ một trong bốn hình thái này, sự quy y đã được thọ trì.
Apica ‘‘bhagavato attānaṃ pariccajāmi, dhammassa saṅghassa attānaṃ pariccajāmi, jīvitaṃ pariccajāmi, pariccattoyeva me attā, pariccattaṃyeva me jīvitaṃ, jīvitapariyantikaṃ buddhaṃ saraṇaṃ gacchāmi, buddho me saraṇaṃ leṇaṃ tāṇa’’nti evampi attasanniyyātanaṃ veditabbaṃ.
Furthermore, self-surrender should be understood thus: "I offer myself to the Blessed One, I offer myself to the Dhamma, to the Saṅgha, I offer my life, my self is indeed offered, my life is indeed offered, I go for refuge to the Buddha for as long as life lasts, the Buddha is my refuge, my shelter, my protection."
Hơn nữa, dâng hiến tự thân (attasanniyyātanaṃ) cũng cần được hiểu như sau: “Tôi dâng hiến thân mình cho Đức Thế Tôn, tôi dâng hiến thân mình cho Giáo Pháp, cho Tăng đoàn, tôi dâng hiến mạng sống của mình, thân tôi đã được dâng hiến, mạng sống tôi đã được dâng hiến, tôi quy y Đức Phật cho đến trọn đời, Đức Phật là nơi nương tựa, nơi ẩn náu, nơi che chở của tôi”.
‘‘Satthārañca vatāhaṃ passāmi, bhagavantameva passāmi, sugatañca vatāhaṃ passāmi, bhagavantameva passāmi, sammāsambuddhañca vatāhaṃ passāmi, bhagavantameva passāmī’’ti (saṃ. ni. 2.154) evaṃ mahākassapattherassa saraṇagamanaṃ viya sissabhāvūpagamanaṃ daṭṭhabbaṃ.
Assuming the state of a disciple should be seen like the going for refuge of Mahākassapa Thera, as in, "Indeed I see the Teacher, indeed I see the Blessed One, indeed I see the Sugata, indeed I see the Blessed One, indeed I see the Perfectly Enlightened One, indeed I see the Blessed One."
Sự quy y của Tôn giả Mahākassapa, như: “Thật vậy, tôi thấy Đức Đạo Sư, tôi thấy Đức Thế Tôn. Thật vậy, tôi thấy Đức Thiện Thệ, tôi thấy Đức Thế Tôn. Thật vậy, tôi thấy Đức Chánh Đẳng Giác, tôi thấy Đức Thế Tôn” cần được xem là trở thành đệ tử (sissabhāvūpagamanaṃ).
Evampi āḷavakasātāgirahemavatādīnaṃ saraṇagamanaṃ viya tapparāyaṇatā veditabbā.
Taking them as one's resort should be understood like the going for refuge of Āḷavaka, Sātāgira, Hemavata, and others in this way.
Sự quy y của Āḷavaka, Sātāgira, Hemavata, v.v., như vậy, cần được hiểu là quy hướng (tapparāyaṇatā).
Nanu cete āḷavakādayo maggeneva āgatasaraṇagamanā, kathaṃ tesaṃ tapparāyaṇatāsaraṇagamanaṃ vuttanti?
But are not these Āḷavaka and others those whose going for refuge came by way of the path? How then is their going for refuge described as taking them as their resort?
Há chẳng phải Āḷavaka, v.v., là những người đã quy y bằng đạo sao? Tại sao lại nói sự quy y quy hướng của họ?
Maggenāgatasaraṇagamanehipi ‘‘sohaṃ vicarissāmi gāmā gāma’’ntiādinā (saṃ. ni. 1.246; su. ni. 194) tehi tapparāyaṇatākārassa paveditattā tathā vuttaṃ.
It is stated thus because even though their going for refuge came by way of the path, they expressed the mode of taking them as their resort with phrases such as "So I shall wander from village to village," etc.
Mặc dù họ đã quy y bằng đạo, nhưng vì họ đã tuyên bố hình thái quy hướng qua câu “Vậy tôi sẽ du hành từ làng này đến làng khác”, v.v., nên đã được nói như vậy.
Atha kho brahmāyu brāhmaṇo uṭṭhāyāsanā ekaṃsaṃ uttarāsaṅgaṃ karitvā bhagavato pādesu sirasā nipatitvā bhagavato pādāni mukhena ca paricumbati, pāṇīhi ca parisambāhati, nāmañca sāveti ‘‘brahmāyu ahaṃ, bho gotama, brāhmaṇo, brahmāyu ahaṃ, bho gotama, brāhmaṇo’’ti (ma. ni. 2.394) evampi paṇipāto daṭṭhabbo.
And furthermore, when the brahmin Brahmāyu rose from his seat, arranged his upper robe over one shoulder, prostrated his head at the Blessed One's feet, kissed the Blessed One's feet with his mouth, stroked them with his hands, and announced his name, saying, "I am Brahmāyu, good Gotama, I am the brahmin Brahmāyu, good Gotama" – this should be seen as prostration.
Hơn nữa, Bà-la-môn Brahmāyu đã đứng dậy khỏi chỗ ngồi, vắt y vai trái, cúi đầu đảnh lễ dưới chân Đức Thế Tôn, dùng miệng hôn chân Ngài, dùng tay xoa bóp chân Ngài, và xướng tên mình: “Bạch Đức Gotama, tôi là Bà-la-môn Brahmāyu, bạch Đức Gotama, tôi là Bà-la-môn Brahmāyu”. Đây cũng cần được xem là đảnh lễ (paṇipāto).
So panesa ñātibhayācariyadakkhiṇeyyatāvasena catubbidho hoti.
This prostration is of four kinds: by reason of kinship, fear, respect for a teacher, and worthiness of offerings (dakkhiṇeyyatā).
Sự đảnh lễ này có bốn loại tùy theo thân quyến, sợ hãi, thầy giáo, và đáng cúng dường.
Tattha dakkhiṇeyyatāhetukena paṇipātena saraṇagamanaṃ hoti, na itarehi ñātibhayādivasappavattehi tīhi paṇipātehi.
Among these, going for refuge arises from prostration that is due to worthiness of offerings, not from the other three prostrations that arise due to kinship, fear, etc.
Trong đó, quy y chỉ thành tựu bằng sự đảnh lễ do lý do đáng cúng dường, chứ không phải bằng ba loại đảnh lễ kia phát sinh do thân quyến, sợ hãi, v.v.
Seṭṭhavaseneva hi saraṇaṃ gayhati, seṭṭhavasena bhijjati, tasmā yo sākiyo vā koliyo vā ‘‘buddho amhākaṃ ñātako’’ti vandati, aggahitameva hoti saraṇaṃ.
For refuge is taken by way of superiority, and it is broken by way of superiority. Therefore, if a Sakya or a Koliya bows, thinking, "The Buddha is our relative," refuge is not considered to have been taken.
Thật vậy, quy y được thọ trì bằng cách tối thượng, và bị phá vỡ bằng cách tối thượng. Do đó, nếu một người Sākiya hay Koliya đảnh lễ vì nghĩ “Đức Phật là thân quyến của chúng ta”, thì sự quy y vẫn chưa được thọ trì.
Yo vā ‘‘samaṇo gotamo rājapūjito mahānubhāvo avandiyamāno anatthampi kareyyā’’ti bhayena vandati, aggahitameva hoti saraṇaṃ.
Or if one bows out of fear, thinking, "The ascetic Gotama is honored by kings, possesses great power, and if not honored, might cause harm," refuge is not considered to have been taken.
Nếu một người đảnh lễ vì sợ hãi rằng “Sa-môn Gotama được các vị vua tôn kính, có uy lực lớn, nếu không đảnh lễ có thể gây ra tai họa”, thì sự quy y vẫn chưa được thọ trì.
Yopi bodhisattakāle bhagavato santike kiñci uggahitaṃ saramāno buddhakāle vā –
And if someone, remembering something he had learned from the Blessed One during the time of the Bodhisatta, or during the time of the Buddha –
Và nếu một người, nhớ lại điều gì đã học được từ Đức Thế Tôn vào thời Bồ-tát, hoặc vào thời Đức Phật –
Evaṃ gahitasaraṇassa ca upāsakassa vā upāsikāya vā aññatitthiyesu pabbajitampi ñātiṃ ‘‘ñātako me aya’’nti vandatopi saraṇagamanaṃ na bhijjati, pageva apabbajitaṃ.
For a male or female lay follower who has thus taken refuge, if they bow down to a relative who has gone forth among other sects, thinking, "'This is my relative'," their taking of refuge is not broken, much less if they bow down to an unordained relative.
Đối với một nam cư sĩ hoặc nữ cư sĩ đã thọ trì quy y như vậy, ngay cả khi người ấy lạy một người thân đã xuất gia theo ngoại đạo với ý nghĩ ‘vị này là người thân của tôi’, thì sự quy y vẫn không bị phá vỡ, huống hồ là lạy một người chưa xuất gia.
Tathā rājānaṃ bhayavasena vandato.
Similarly, if one bows down to a king out of fear.
Cũng vậy, khi lạy một vị vua vì sợ hãi.
So hi raṭṭhapūjitattā avandiyamāno anatthampi kareyyāti.
For if he, being honored by the state, is not bowed to, he might cause harm.
Vì nếu không lạy vị vua được quốc dân tôn kính, vị ấy có thể gây ra tai họa.
Tathā yaṃ kiñci sippasikkhāpakaṃ titthiyampi ‘‘ācariyo me aya’’nti vandatopi na bhijjati.
Similarly, if one bows down to any non-Buddhist teacher of a craft, thinking, "'This is my teacher'," it is not broken.
Cũng vậy, khi lạy một người ngoại đạo dạy bất kỳ nghề thủ công nào với ý nghĩ ‘vị này là thầy của tôi’, thì sự quy y cũng không bị phá vỡ.
Evaṃ saraṇagamanassa pabhedo veditabbo.
Thus, the distinctions of taking refuge should be understood.
Như vậy, cần phải hiểu sự phân loại của quy y.
‘‘Atha kho sakko devānamindo asītiyā devatāsahassehi saddhiṃ yenāyasmā mahāmoggallāno tenupasaṅkami…pe… ekamantaṃ ṭhitaṃ kho sakkaṃ devānamindaṃ āyasmā mahāmoggallāno etadavoca ‘sādhu kho, devānaminda, buddhasaraṇagamanaṃ hoti, buddhasaraṇagamanahetu kho, devānaminda, evamidhekacce sattā kāyassa bhedā paraṃ maraṇā sugatiṃ saggaṃ lokaṃ upapajjanti.
“Then Sakka, king of the devas, together with eighty thousand devas, approached the Venerable Mahāmoggallāna… and standing to one side, Sakka, king of the devas, was addressed by the Venerable Mahāmoggallāna thus: ‘Good indeed, king of the devas, is going for refuge to the Buddha; because of going for refuge to the Buddha, king of the devas, some beings here, at the breaking up of the body, after death, are reborn in a good destination, a heavenly world. They surpass other devas in ten ways: in divine lifespan, divine beauty, divine happiness, divine glory, divine supremacy, and in divine sights, sounds, smells, tastes, and tactile objects.’”
“Rồi Sakka, Thiên chủ, cùng tám vạn thiên nhân, đến gần Tôn giả Mahāmoggallāna… (lược)… Tôn giả Mahāmoggallāna nói với Sakka, Thiên chủ, đang đứng một bên: ‘Lành thay, Thiên chủ, sự quy y Phật là tốt đẹp. Này Thiên chủ, chính vì lý do quy y Phật mà một số chúng sanh, sau khi thân hoại mạng chung, được tái sanh vào cõi thiện, cõi trời. Họ vượt trội hơn các vị trời khác ở mười phương diện: tuổi thọ, sắc đẹp, an lạc, danh tiếng, quyền uy, các cảnh sắc, âm thanh, hương vị, xúc chạm của chư thiên.’”
Te aññe deve dasahi ṭhānehi adhigaṇhanti dibbena āyunā dibbena vaṇṇena sukhena yasena ādhipateyyena dibbehi rūpehi saddehi gandhehi rasehi phoṭṭhabbehī’’’ti (saṃ. ni. 4.341).
This method applies to the Dhamma and the Saṅgha as well.
“Họ vượt trội hơn các vị trời khác ở mười phương diện: tuổi thọ, sắc đẹp, an lạc, danh tiếng, quyền uy, các cảnh sắc, âm thanh, hương vị, xúc chạm của chư thiên.’”
Tattha ca lokiyasaraṇagamanaṃ tīsu vatthūsu aññāṇasaṃsayamicchāñāṇādīhi saṃkilissati, na mahājutikaṃ, na ujjalaṃ aparisuddhaṃ apariyodātaṃ hoti, na mahāvipphāraṃ anuḷāraṃ.
Here, mundane refuge (lokiya saraṇagamana) becomes defiled in the three objects (Buddha, Dhamma, Saṅgha) by ignorance (aññāṇa), doubt (saṃsaya), wrong knowledge (micchāñāṇa), and so forth; it is not greatly radiant, not brilliant, impure, unclear, not greatly pervasive, and not noble.
Trong đó, quy y thế gian bị ô nhiễm bởi sự vô minh, nghi ngờ, tà kiến, v.v., đối với ba đối tượng (Phật, Pháp, Tăng), nên nó không có hào quang lớn, không rực rỡ, không thanh tịnh, không trong sáng, không lan tỏa rộng lớn, không cao thượng.
Ettha ca aññāṇaṃ nāma vatthuttayassa guṇānaṃ ajānanaṃ tattha sammoho.
Here, ignorance (aññāṇa) means not knowing the qualities of the Triple Gem (vatthuttaya), or confusion regarding them.
Ở đây, vô minh (aññāṇa) là không biết các phẩm chất của ba đối tượng, là sự si mê đối với chúng.
‘‘Buddho nu kho, na nu kho’’tiādinā vicikicchā saṃsayo.
Doubt (saṃsaya) is perplexity, thinking, "Is he a Buddha, or not?" and so on.
Nghi ngờ (saṃsayo) là sự hoài nghi như ‘có phải là Phật không, hay không phải là Phật?’
Micchāñāṇaṃ nāma tassa guṇānaṃ aguṇabhāvaparikappanena viparītaggāhoti veditabbaṃ.
Wrong knowledge (micchāñāṇa) should be understood as a perverse grasping, imagining that their qualities are not qualities.
Tà kiến (micchāñāṇaṃ) cần được hiểu là sự chấp thủ sai lầm bằng cách suy nghĩ rằng các phẩm chất của chúng không phải là phẩm chất.
Lokuttarassa pana saraṇagamanassa natthi saṃkileso.
However, there is no defilement (saṃkilesa) for supramundane refuge (lokuttara saraṇagamana).
Tuy nhiên, quy y siêu thế thì không có sự ô nhiễm.
Lokiyassa ca saraṇagamanassa duvidho bhedo sāvajjo anavajjo ca.
And for mundane refuge (lokiya saraṇagamana), there are two kinds of breaking: blameworthy (sāvajja) and blameless (anavajja).
Còn quy y thế gian có hai loại bị phá vỡ: có tội và không có tội.
Tattha sāvajjo aññasatthārādīsu attaniyyātanādīhi hoti, so aniṭṭhaphalo.
Among these, blameworthy (sāvajja) occurs through surrendering oneself to other teachers, and so forth; that results in undesirable fruit.
Trong đó, có tội (sāvajjo) là do việc tự hiến mình cho các vị đạo sư khác, v.v., và điều đó mang lại quả báo không mong muốn.
Anavajjo pana kālakiriyāya hoti.
Blameless (anavajja), however, occurs through death.
Còn không có tội (anavajjo) là do sự chết.
Lokiyañhi saraṇagamanaṃ sikkhāpadasamādānaṃ viya aggahitakālaparicchedakaṃ jīvitapariyantameva hoti, tasmā tassa khandhabhedena bhedo, so avipākattā aphalo.
For mundane refuge, like the undertaking of training rules (sikkhāpada), is limited in time (aggahitakālaparicchedaka) and lasts only until the end of life; therefore, its breaking occurs with the breaking of the aggregates (khandhabhedena), and it is fruitless because it does not yield any result (avipākattā).
Vì quy y thế gian, giống như việc thọ trì giới luật, có thời hạn không được thọ trì và chỉ kéo dài đến cuối đời. Do đó, nó bị phá vỡ khi các uẩn tan rã, và vì không có quả báo (trực tiếp), nên nó là vô hiệu.
Lokuttarassa pana nevatthi bhedo.
However, there is no breaking of supramundane refuge.
Tuy nhiên, quy y siêu thế thì không có sự phá vỡ.
Bhavantarepi hi ariyasāvako aññaṃ satthāraṃ na uddisatīti.
For even in other existences, a Noble Disciple (ariyasāvaka) does not declare another as teacher.
Vì ngay cả trong các kiếp sống khác, một Thánh đệ tử cũng không chỉ định một vị đạo sư khác.
Evaṃ saraṇagamanassa saṃkileso ca bhedo ca veditabbo.
Thus, the defilement (saṃkilesa) and breaking (bheda) of taking refuge should be understood.
Như vậy, cần phải hiểu sự ô nhiễm và sự phá vỡ của quy y.
Kasmā panettha vodānaṃ na gahitaṃ, nanu vodānavibhāvanāpi tattha kosallāya hotīti?
Why is purification (vodāna) not included here? Is not the explanation of purification also helpful for proficiency in it?
Tại sao ở đây không đề cập đến sự thanh tịnh? Chẳng lẽ việc làm rõ sự thanh tịnh không giúp ích cho sự khéo léo trong đó sao?
Saccametaṃ, taṃ pana saṃkilesaggahaṇena atthato dīpitaṃ hotīti na gahitaṃ.
This is true, but it is implied by the inclusion of defilement, so it has not been specifically mentioned.
Điều đó là đúng, nhưng sự thanh tịnh đã được ngụ ý về mặt ý nghĩa thông qua việc đề cập đến sự ô nhiễm, nên nó không được đề cập (riêng).
Yāni hi tesaṃ saṃkilesakāraṇāni aññāṇādīni, tesaṃ sabbena sabbaṃ anuppādanena uppannānañca pahānena vodānaṃ hotīti.
For purification comes about by the complete non-arising of those causes of defilement, such as ignorance, and by the abandonment of those that have arisen.
Vì sự thanh tịnh là do hoàn toàn không phát sinh các nguyên nhân ô nhiễm như vô minh, v.v., và do sự đoạn trừ những gì đã phát sinh.
Evamettha ‘‘saraṇaṃ saraṇagamana’’ntiādīnaṃ papañco veditabbo.
Thus, here the elaboration of "refuge, taking refuge," and so forth, should be understood.
Như vậy, ở đây cần phải hiểu sự phân loại chi tiết của “nơi nương tựa, sự quy y”, v.v.
Imassa pana yathāvuttapapañcassa idha avacane kāraṇaṃ dassento āha ‘‘so pana idha vuccamāno’’tiādi.
Showing the reason for not stating the aforementioned elaboration here, he said: “If it were to be stated here…” and so on.
Để chỉ ra lý do không nói rộng về sự diễn giải đã nêu ở đây,* nói: "Nếu điều đó được nói ở đây..." và tiếp theo.
Tattha saraṇavaṇṇanatoti sāmaññaphalasutte vuttasaraṇavaṇṇanato.
Therein, saraṇavaṇṇanato means from the exposition of the refuge (saraṇa) stated in the Sāmaññaphala Sutta.
Trong đó, "saraṇavaṇṇanato" có nghĩa là từ sự giải thích về nơi nương tựa đã được nói trong kinh Sāmaññaphala.
Evaṃ dhāretūti evaṃ jānātūti attho.
“Evaṃ dhāretū” means “let him know thus.”
"Evaṃ dhāretū" có nghĩa là "hãy biết như vậy".
Ettha ko upāsakoti sarūpapucchā, tasmā kiṃlakkhaṇo upāsakoti vuttaṃ hoti.
Here, “Who is an upāsaka?” is a question about the nature; therefore, it means “what are the characteristics of an upāsaka?”
Ở đây, "ko upāsako" là câu hỏi về bản chất, do đó có nghĩa là "upāsaka có đặc điểm gì?".
Kasmāti hetupucchā.
“Why?” is a question about the cause.
"Kasmā" là câu hỏi về nguyên nhân.
Tena kena pavattinimittena upāsakasaddo tasmiṃ puggale niruḷhoti dasseti.
Thereby, it shows by what cause or condition the term upāsaka is applied to that person.
Nó chỉ ra bởi dấu hiệu phát sinh nào mà từ "upāsaka" được áp dụng cho người đó.
Tenāha ‘‘kasmā upāsakoti vuccatī’’ti.
That is why he said: “Why is he called an upāsaka?”
Vì vậy,* nói: "Tại sao được gọi là upāsaka?".
Saddassa hi abhidheyyapavattinimittaṃ tadatthassa tabbhāvakāraṇaṃ.
Indeed, the condition for the arising of the meaning of a word is the cause of that meaning’s existence.
Thật vậy, dấu hiệu phát sinh của ý nghĩa được chỉ định của một từ là nguyên nhân cho sự hiện hữu của ý nghĩa đó.
Kimassa sīlanti kīdisaṃ assa upāsakassa sīlaṃ, kittakena sīlenāyaṃ sīlasampanno nāma hotīti attho.
“What is his sīla?” means “what kind of sīla does this upāsaka have, and by how much sīla is he said to be accomplished in sīla?”
"Kimassa sīlaṃ" có nghĩa là "Giới của upāsaka này là gì? Với bao nhiêu giới thì người này được gọi là người đầy đủ giới?".
Ko ājīvoti ko assa sammāājīvo.
“What is his livelihood?” means “what is his right livelihood (sammā-ājīva)?”
"Ko ājīvo" có nghĩa là "Sanh kế chân chánh của người này là gì?".
So pana micchājīvassa parivajjanena hotīti sopi vibhajīyati.
That, moreover, comes about by avoiding wrong livelihood (micchā-ājīva); therefore, it too is explained.
Điều đó được phân loại bằng cách tránh tà mạng.
Kā vipattīti kassa sīlassa ājīvassa vā vipatti.
“What is his failure?” means “what is the failure (vipatti) of his sīla or livelihood?”
"Kā vipattī" có nghĩa là "Sự thất bại của giới hay sanh kế nào?".
Anantarassa hi vidhi vā paṭisedho vā.
For indeed, the instruction or prohibition pertains to the immediate subject.
Thật vậy, điều được quy định hoặc bị cấm là của điều liền trước.
Sampattīti etthāpi eseva nayo.
“Accomplishment” – here too, the same method applies.
Về "sampattī" cũng vậy.
Idaṃ pakiṇṇakaṃ veditabbanti kathaṃ veditabbaṃ?
“This miscellaneous matter should be known.” How should it be known?
"Idaṃ pakiṇṇakaṃ veditabbaṃ" (Điều lặt vặt này cần được biết) – cần được biết như thế nào?
Vuccate – ko upāsakoti khattiyādīsu yo koci tisaraṇaṃ gato gahaṭṭho.
It is said: “Who is an upāsaka?” Any householder (gahaṭṭha) from among Khattiyas and so on, who has gone for the Three Refuges (tisaraṇa).
Được nói rằng – "ko upāsako" (ai là upāsaka?) là bất kỳ cư sĩ nào thuộc dòng Sát-đế-lợi hoặc các dòng khác đã quy y Tam Bảo.
Saraṇagamanameva hettha kāraṇaṃ, na jātiādiviseso.
Here, taking refuge (saraṇagamana) itself is the cause, not any distinction of caste or other factors.
Ở đây, chỉ có sự quy y là nguyên nhân, không phải sự khác biệt về giai cấp, v.v.
Vuttañhetaṃ ‘‘yato kho, mahānāma, buddhaṃ saraṇaṃ gato hoti, dhammaṃ, saṅghaṃ saraṇaṃ gato hoti.
For this was said: “When, Mahānāma, one has gone for refuge to the Buddha, to the Dhamma, to the Saṅgha.
Điều này đã được nói: "Này Mahānāma, khi một upāsaka đã quy y Phật, quy y Pháp, quy y Tăng.
Ettāvatā kho, mahānāma, upāsako hotī’’ti (saṃ. ni. 5.1033).
To this extent, Mahānāma, one is an upāsaka.”
Chừng đó, này Mahānāma, người ấy là một upāsaka."
Kimassa sīlanti pañca veramaṇiyo.
“What is his sīla?” The five abstinences (veramaṇiyo).
"Kimassa sīlaṃ" (Giới của người ấy là gì?) là năm điều kiêng cữ.
Veramaṇiyoti cettha veraṃ vuccati pāṇātipātādīsu dussīlyaṃ, tassa mananato hananato vināsanato veramaṇiyo pañca viratiyo viratippadhānattā tassa sīlassa.
And here, veramaṇiyo refers to the vice of killing living beings and so forth (pāṇātipātādīsu dussīlyaṃ); the five abstinences (viratiyo) are called veramaṇiyo because they repress (mananato), eliminate (hananato), and destroy (vināsanato) that vice, due to the predominance of abstinence in that sīla.
Ở đây, "veramaṇiyo" (các điều kiêng cữ) có nghĩa là sự bất thiện như sát sanh, v.v., được gọi là "vera" (ác nghiệp), và năm sự kiêng cữ là "veramaṇiyo" vì chúng ngăn chặn, tiêu diệt ác nghiệp đó, do sự kiêng cữ là chính yếu trong giới đó.
Vuttañhetaṃ ‘‘yato kho, mahānāma, upāsako pāṇātipātā paṭivirato hoti, adinnādānā, kāmesumicchācārā, musāvādā, surāmerayamajjapamādaṭṭhānā paṭivirato hoti.
For this was said: “When, Mahānāma, an upāsaka abstains from killing living beings, from taking what is not given, from sexual misconduct, from false speech, from indulging in fermented and distilled intoxicants that lead to heedlessness.
Điều này đã được nói: "Này Mahānāma, khi một upāsaka đã tránh xa sự sát sanh, tránh xa sự trộm cắp, tránh xa tà hạnh trong các dục, tránh xa sự nói dối, tránh xa sự say sưa do rượu và các chất men say.
Ettāvatā kho, mahānāma, upāsako sīlavā hotī’’ti (saṃ. ni. 5.1033).
To this extent, Mahānāma, an upāsaka is virtuous (sīlavā).”
Chừng đó, này Mahānāma, upāsaka đó là người có giới."
Ettha ca satthavaṇijjāti āvudhabhaṇḍaṃ katvā vā kāretvā vā yathākataṃ vā paṭilabhitvā tassa vikkayo.
Here, satthavaṇijjā means selling weapons, whether one has made them oneself, had them made, or acquired ready-made ones.
Ở đây, "satthavaṇijjā" là việc chế tạo, hoặc thuê chế tạo, hoặc nhận vũ khí đã chế tạo rồi đem bán.
Sattavaṇijjāti manussavikkayo.
Sattavaṇijjā means selling human beings.
"Sattavaṇijjā" là việc buôn bán người.
Maṃsavaṇijjāti sūnakārādayo viya migasūkarādike posetvā maṃsaṃ sampādetvā vikkayo.
Maṃsavaṇijjā means, like butchers and others, raising deer, pigs, and so forth, preparing their meat, and selling it.
"Maṃsavaṇijjā" là việc nuôi dưỡng thú rừng, heo, v.v., như những người bán thịt, rồi chuẩn bị thịt và bán.
Majjavaṇijjāti yaṃ kiñci majjaṃ yojetvā tassa vikkayo.
Majjavaṇijjā means preparing any kind of intoxicant and selling it.
"Majjavaṇijjā" là việc pha chế bất kỳ loại rượu nào rồi đem bán.
Visavaṇijjāti visaṃ yojetvā saṅgahetvā vā tassa vikkayo.
Visavaṇijjā means preparing poison or collecting it and selling it.
"Visavaṇijjā" là việc pha chế hoặc thu thập chất độc rồi đem bán.
Tattha satthavaṇijjā paroparodhanimittatāya akaraṇīyā vuttā, sattavaṇijjā abhujissabhāvakaraṇato, maṃsavisavaṇijjā vadhahetuto, majjavaṇijjā pamādaṭṭhānatoti veditabbā.
Among these, trade in weapons is said to be prohibited because it causes harm to others; trade in living beings because it leads to lack of freedom; trade in meat and poison because it is a cause of killing; and trade in intoxicants because it is a cause of heedlessness. This should be understood.
Trong đó, buôn bán vũ khí được nói là không nên làm vì nó là nguyên nhân gây hại cho người khác; buôn bán chúng sanh vì nó biến người khác thành nô lệ; buôn bán thịt và chất độc vì chúng là nguyên nhân của sự giết chóc; buôn bán rượu vì nó là nguyên nhân của sự phóng dật.
Ettha ca upāsakapaṭikuṭṭhoti upāsakanihīno.
Here, upāsakapaṭikuṭṭho means an inferior upāsaka.
Ở đây, "upāsakapaṭikuṭṭho" có nghĩa là upāsaka thấp kém.
Buddhādīsu kammakammaphalesu ca saddhāvipariyāyo assaddhiyaṃ micchādhimokkho, yathāvuttena assaddhiyena samannāgato assaddho.
Assaddho is one who is endowed with the aforementioned lack of faith (assaddhiyaṃ), which is a perversion of faith (saddhāvipariyāyo) and wrong inclination (micchādhimokkho) concerning the Buddha and other noble ones, and kamma and its results.
Sự vô tín là sự sai lệch về niềm tin vào Đức Phật, v.v., và vào nghiệp cùng quả của nghiệp; người đầy đủ sự vô tín như đã nói thì là "assaddho" (vô tín).
Yathāvuttasīlavipattiājīvavipattivasena dussīlo.
Dussīlo is one who is immoral due to the aforementioned failure of sīla and failure of livelihood.
"Dussīlo" (phá giới) là do sự thất bại về giới và sự thất bại về sanh kế như đã nói.
‘‘Iminā diṭṭhādinā idaṃ nāma maṅgalaṃ hotī’’ti evaṃ bālajanaparikappitakotūhalasaṅkhātena diṭṭhasutamutamaṅgalena samannāgato kotūhalamaṅgaliko.
Kotūhalamaṅgaliko is one who is given to superstitious rites and ceremonies (kotūhalasaṅkhātena diṭṭhasutamutamaṅgalena), such as those seen, heard, or perceived, which are conceived by fools, believing “by this sight or other observation, such and such a blessing will occur.”
Người đầy đủ những điềm lành được thấy, được nghe, được biết, được tưởng tượng bởi những người ngu si như "do thấy điều này, điềm lành này sẽ xảy ra", thì là "kotūhalamaṅgaliko" (tin vào điềm lành một cách tò mò).
Maṅgalaṃ paccetīti diṭṭhamaṅgalādibhedaṃ maṅgalameva pattiyāyati.
Maṅgalaṃ paccetī means he believes only in rites and ceremonies (maṅgalaṃ), such as those based on seeing a good omen (diṭṭhamaṅgalādibhedaṃ).
"Maṅgalaṃ paccetī" có nghĩa là người ấy chỉ tin vào điềm lành, bao gồm điềm lành được thấy, v.v.
No kammanti kammassakataṃ no pattiyāyati.
No kamma means he does not believe that kamma is one's own possession (kammassakataṃ).
"No kammaṃ" có nghĩa là người ấy không tin vào sự sở hữu nghiệp.
Itobahiddhāti ito sabbaññubuddhasāsanato bahiddhā bāhirakasamaye.
Itobahiddhā means outside this Dispensation of the All-Enlightened Buddha, in external systems (bāhirakasamaye).
"Itobahiddhā" có nghĩa là bên ngoài giáo pháp của Đức Phật Toàn Giác này, trong các giáo phái ngoại đạo.
Dakkhiṇeyyaṃ pariyesatīti duppaṭipannaṃ dakkhiṇārahasaññī gavesati.
Dakkhiṇeyyaṃ pariyesatī means he seeks out those of wrong conduct (duppaṭipannaṃ), considering them worthy of offerings (dakkhiṇārahasaññī).
"Dakkhiṇeyyaṃ pariyesatī" có nghĩa là người ấy tìm kiếm những người có hành vi sai trái mà người ấy cho là xứng đáng được cúng dường.
Pubbakāraṃ karotīti dānamānanādikaṃ kusalakiriyaṃ paṭhamataraṃ karoti.
Pubbakāraṃ karotī means he performs acts of merit (kusalakiriyaṃ), such as giving and honoring, as the primary deed.
"Pubbakāraṃ karotī" có nghĩa là người ấy thực hiện các hành động thiện lành như bố thí, tôn kính, v.v., trước tiên.
Ettha ca dakkhiṇeyyapaayesanapubbakāre ekaṃ katvā pañca dhammā veditabbā.
Here, seeking worthy recipients and performing the primary offering should be taken as one, making five qualities to be understood.
Ở đây, năm pháp cần được hiểu bằng cách gộp việc tìm kiếm người đáng cúng dường và việc thực hiện sự cúng dường đầu tiên thành một.
Ādimhīti ādiatthe.
Ādimhī means “in the beginning.”
"Ādimhī" có nghĩa là ở phần đầu.
Koṭiyanti pariyantakoṭiyaṃ.
Koṭiya means “at the very end.”
"Koṭiyaṃ" có nghĩa là ở điểm cuối cùng.
Vihāraggenāti ovarakakoṭṭhāsena, ‘‘imasmiṃ gabbhe vasantānaṃ idaṃ panasaphalaṃ pāpuṇātī’’tiādinā taṃtaṃvasanaṭṭhānakoṭṭhāsenāti attho.
Vihāraggenā means “by a section of the dwelling,” meaning “by the portion of the dwelling where one lives, such as ‘this jackfruit belongs to those dwelling in this chamber,’ and so forth.”
"Vihāraggenā" có nghĩa là bằng phần của phòng, tức là bằng phần của nơi ở cụ thể như "quả mít này thuộc về những người sống trong căn phòng này", v.v.
Ajjatanti ajja icceva attho.
The meaning of ajjata is simply "today".
Ajjata có nghĩa là hôm nay.
Pāṇehi upetanti iminā tassa saraṇagamanassa āpāṇakoṭikataṃ dassento ‘‘yāva me jīvitaṃ pavattatī’’tiādīni vatvā puna jīvitenapahaṃ vatthuttayaṃ paṭipūjento saraṇagamanañca rakkhāmīti uppannaṃ tassa brāhmaṇassa adhippāyaṃ vibhāvento ‘‘ahañhī’’tiādimāha.
By this phrase, "pāṇehi upetaṃ", showing that his going for refuge is life-long, he (the commentator) says, "having said 'as long as my life continues', and then again intending to revere the Triple Gem with his life and protect the going for refuge," thereby revealing the intention that arose in that brahmin, he (the text) says, " ahañhi" and so on.
Với câu Pāṇehi upeta (cùng với sinh mạng), để chỉ ra rằng sự quy y của người ấy là cho đến cuối đời, sau khi nói "chừng nào mạng sống của tôi còn tiếp diễn", v.v., và để làm rõ ý định của vị Bà-la-môn ấy rằng "Tôi sẽ cúng dường Tam Bảo bằng mạng sống và giữ gìn sự quy y", ông ấy đã nói "ahañhi" (quả thật tôi) v.v.
Pāṇehi upetanti hi yāva me pāṇā dharanti, tāva saraṇaṃ upetaṃ, upento na vācāmattena na ekavāraṃ cittuppādanamattena, atha kho pāṇānaṃ pariccajanavasena yāvajīvaṃ upetanti evamettha attho veditabbo.
Indeed, the meaning of "pāṇehi upetaṃ" here should be understood as: "As long as my life persists, I have gone for refuge; and when going for refuge, it is not merely by words, nor by a single arising of thought, but rather by way of sacrificing life, one goes for refuge for as long as life lasts."
Quả thật, Pāṇehi upeta (cùng với sinh mạng) có nghĩa là: chừng nào mạng sống của tôi còn duy trì, chừng đó tôi quy y. Sự quy y không phải chỉ bằng lời nói suông, không phải chỉ bằng một lần khởi tâm, mà là quy y suốt đời bằng cách hiến dâng sinh mạng. Ý nghĩa ở đây cần được hiểu như vậy.
Adhivāsetūti sādiyatu, taṃ pana sādiyanaṃ manasā sampaṭiggaho hotīti āha ‘‘sampaṭicchatū’’ti.
Adhivāsetū means "may he consent". Since that consent is an acceptance in mind, he says, " sampaṭicchatū" (may he receive it).
Adhivāsetū có nghĩa là hãy chấp thuận. Sự chấp thuận đó là sự chấp nhận trong tâm, nên ông ấy nói "sampaṭicchatū" (hãy chấp nhận).
Kāyaṅganti kāyameva aṅganti vadanti, kāyassa vā aṅgaṃ sīsādi kāyaṅgaṃ, sīsādi sarīrāvayavanti vuttaṃ hoti.
Kāyaṅga means "the body itself is an limb," or "an limb of the body, such as the head, is aāyaṅga"; that is to say, parts of the body such as the head.
Kāyaṅga nghĩa là họ nói chính thân là một chi phần, hoặc đầu, v.v., là chi phần của thân, tức là các bộ phận của cơ thể như đầu, v.v.
Vācaṅganti ‘‘hotu sādhū’’ti evamādivācāya aṅgaṃ avayavaṃ.
Vācaṅga means "a limb or part of speech," such as "may it be good, excellent."
Vācaṅga là một chi phần của lời nói như "hotu sādhu" (tốt lành thay), v.v.
Vācaṅgassa copanaṃ vācāya pavattanamevāti veditabbaṃ.
The operation of the vocal limb should be understood as the mere utterance of speech.
Sự khởi động của chi phần lời nói cần được hiểu là sự phát ra lời nói.
Abbhantareyevāti attano cittasantāneyeva.
Abbhantareyevā means "within one's own mental continuum."
Abbhantareyevā có nghĩa là chỉ trong dòng tâm thức của mình.
Khantiṃ cāretvāti khantiṃ pavattetvā, ruciṃ uppādetvāti vuttaṃ hoti.
Khantiṃ cāretvā means "having exercised patience," which is to say, "having generated a liking."
Khantiṃ cāretvā có nghĩa là thực hành sự nhẫn nại, tức là làm phát sinh sự ưa thích.
‘‘Khantiṃ dhāretvā’’tipi pāṭho, uppannaṃ ruciṃ abbhantareyeva dhāretvā vacībhedena apakāsetvāti vuttaṃ hoti.
"Khantiṃ dhāretvā" is also a reading, meaning "having maintained the arisen liking within oneself and not disclosed it through verbal expression."
Cũng có bản đọc là khantiṃ dhāretvā (duy trì sự nhẫn nại), có nghĩa là giữ gìn sự ưa thích đã phát sinh chỉ trong nội tâm, không biểu lộ ra bằng lời nói.
Kathaṃ pana verañjo brāhmaṇo bhagavato adhivāsanaṃ aññāsi.
How did the brahmin Verañja know of the Buddha’s acceptance?
Nhưng làm sao Bà-la-môn Verañja biết được sự chấp thuận của Đức Thế Tôn?
Na hi tena sakkā bhagavato cittappavatti paccakkhato viññātuṃ, tasmā ‘‘bhagavato adhivāsanaṃ viditvā’’ti kasmā vuttanti ce?
For he could not directly discern the Buddha’s mental process. So, if one asks, "Why is it said, 'having known the Buddha’s acceptance'?"
Quả thật, ông ta không thể trực tiếp nhận biết sự vận hành của tâm Đức Thế Tôn. Vậy tại sao lại nói "biết được sự chấp thuận của Đức Thế Tôn"?
Kiñcāpi tena na sakkā cittappavatti paccakkhato viññātuṃ, tathāpi ākārasallakkhaṇakusalatāya anvayabyatirekavasena anumānato aññāsīti dassento āha ‘‘sace me samaṇo gotamo’’tiādi.
Although he could not directly discern the mental process, yet, showing that he knew it by inference, through agreement and disagreement, due to his skill in observing signs, he (the text) says, " sace me samaṇo gotamo" and so on.
Mặc dù ông ta không thể trực tiếp nhận biết sự vận hành của tâm, nhưng để chỉ ra rằng ông ta đã biết bằng cách suy luận theo phương pháp thuận nghịch, nhờ sự khéo léo trong việc nhận biết các dấu hiệu, ông ấy đã nói "sace me samaṇo gotamo" (nếu Sa-môn Gotama của tôi), v.v.
Ākārasallakkhaṇakusalatāyāti cittappavattiākāravijānane chekatāya, adhippāyavijānane kusalatāyāti vuttaṃ hoti.
Ākārasallakkhaṇakusalatāya means "due to skill in discerning the indications of mental processes," that is to say, "skill in discerning intentions."
Ākārasallakkhaṇakusalatāyā có nghĩa là nhờ sự khéo léo trong việc nhận biết các dấu hiệu của sự vận hành của tâm, tức là sự khéo léo trong việc nhận biết ý định.
Dasanakhasamodhānasamujjalanti dvīsu hatthesu dasannaṃ nakhānaṃ samodhānena ekībhāvena samujjalantaṃ.
Dasanakhasamodhānasamujjala means "shining brightly with the joining of the ten fingernails of both hands into one."
Dasanakhasamodhānasamujjala có nghĩa là chắp mười móng tay của hai bàn tay lại với nhau, tỏa sáng rực rỡ.
Añjalinti hatthapuṭaṃ.
Añjali means "palms joined in reverence."
Añjali có nghĩa là chắp tay.
Paṭimukhoyevāti abhimukhoyeva, na bhagavato piṭṭhiṃ dassetvāti attho.
Paṭimukhoyevā means "facing directly," that is to say, "not showing one’s back to the Blessed One."
Paṭimukhoyevā có nghĩa là chỉ đối mặt, không quay lưng lại với Đức Thế Tôn.
Vanditvāti pañcapatiṭṭhitena vanditvā.
Vanditvā means "having paid homage with the five-point prostration."
Vanditvā có nghĩa là đảnh lễ bằng năm chi chạm đất.
16. Susassakālepīti sampannasassakālepi.
16. Susassakālepī means "even during a time of abundant harvest."
16. Susassakālepī có nghĩa là ngay cả trong thời kỳ mùa màng bội thu.
Atisamagghepīti atisayena appagghepi, yadā kiñcideva datvā bahuṃ pubbaṇṇāparaṇṇaṃ gaṇhanti, tādise kālepīti attho.
Atisamagghepī means "even when prices are extremely low," that is to say, "during a time when one can give only a little and receive much grain and pulses."
Atisamagghepī có nghĩa là ngay cả khi giá cả cực kỳ rẻ mạt, tức là trong thời kỳ mà người ta có thể đổi một chút gì đó để lấy nhiều ngũ cốc và đậu.
Sāliādi dhaññaṃ pubbaṇṇaṃ, muggamāsādi aparaṇṇaṃ.
Grain like rice is pubbaṇṇaṃ (early harvest), and mung beans, black lentils, etc., are aparaṇṇaṃ (late harvest).
Lúa gạo, v.v., là pubbaññaṃ (ngũ cốc chính); đậu xanh, đậu đen, v.v., là aparaññaṃ (ngũ cốc phụ).
Dvidhā pavattaṃ īhitaṃ etthāti dvīhitikāti majjhapadalopībāhiratthasamāsoyamīti dassento āha ‘‘dvidhā pavattaīhitikā’’ti.
"There is activity in two ways here," thus it is dvīhitikā. This is an external compound (bahiratthasamāsa) with the elision of the middle term (majjhapadalopa). Thus, he says, " dvidhā pavattaīhitikā" (activity proceeding in two ways).
Ở đây, sự cố gắng diễn ra theo hai cách, nên gọi là dvīhitikā. Để chỉ ra rằng đây là một hợp chất bahiratthasamāsa với sự lược bỏ trung từ, ông ấy nói "dvidhā pavattaīhitikā" (sự cố gắng diễn ra theo hai cách).
Īhanaṃ īhitanti īhitasaddoyaṃ bhāvasādhanoti āha ‘‘īhitaṃ nāma iriyā’’ti.
" Īhanaṃ īhitanti" (the act of striving is striving); this word īhita is an agent noun (bhāvasādhana). Thus, he says, " īhitaṃ nāma iriyā" (striving is indeed an action).
Īhanaṃ là īhitaṃ, nên từ īhita này là một bhāvasādhana (danh từ chỉ hành động), nên ông ấy nói "īhitaṃ nāma iriyā" (īhita là hành động).
Tattha iriyāti kiriyā.
Therein, iriyā means "action."
Ở đó, iriyā có nghĩa là hành động.
Kassa panesā kiriyāti āha ‘‘cittairiyā’’ti, cittakiriyā cittappayogoti attho.
And whose action is this? He says, " cittairiyā," meaning "mental action," that is, "mental effort."
Vậy hành động này là của ai? Ông ấy nói "cittairiyā" (hành động của tâm), tức là sự hoạt động của tâm, sự cố gắng của tâm.
Tenevāha ‘‘cittaīhā’’ti.
Therefore, he says, " cittaīhā" (mental striving).
Chính vì vậy, ông ấy nói "cittaīhā" (sự cố gắng của tâm).
Kathaṃ panettha īhitassa dvidhā pavattīti āha ‘‘lacchāma nu kho’’tiādi.
How does striving proceed in two ways here? He says, " lacchāma nu kho" and so on.
Vậy sự cố gắng ở đây diễn ra theo hai cách như thế nào? Ông ấy nói "lacchāma nu kho" (chúng ta có nhận được không), v.v.
Tattha lacchāma nu khoti idaṃ duggatānaṃ vasena vuttaṃ.
Therein, lacchāma nu kho (shall we obtain it?) is said with reference to the poor.
Ở đó, câu lacchāma nu kho này được nói theo cách của những người nghèo khổ.
Jīvituṃ vā sakkhissāma nu kho, noti idaṃ pana issarānaṃ vasena vuttanti veditabbaṃ.
Jīvituṃ vā sakkhissāma nu kho, no (shall we be able to live, or not?) should be understood as having been said with reference to the wealthy.
Còn câu Jīvituṃ vā sakkhissāma nu kho, no (chúng ta có thể sống sót không, không) này cần được hiểu là được nói theo cách của những người quyền quý.
Bhikkhamānāti yācamānā.
Bhikkhamānā means "begging."
Bhikkhamānā có nghĩa là đang xin ăn.
‘‘Duhitikā’’tipi pāṭho.
"Duhitikā" is also a reading.
Cũng có bản đọc là duhitikā.
Tatthāpi vuttanayenevattho veditabbo.
In that case too, the meaning should be understood in the manner already explained.
Ở đó, ý nghĩa cũng cần được hiểu theo cách đã nói.
Dvi-saddassa hi du-saddādesenāyaṃ niddeso hoti.
For this designation arises from the substitution of du- for the word dvi-.
Thật vậy, sự diễn giải này là do sự thay thế từ dvi bằng từ du.
Dukkhaṃ vā īhitaṃ ettha na sakkā koci payogo sukhena kātunti duhitikā, dukkarajīvitappayogāti attho.
Or, striving is difficult here; no effort can be made with ease, thus duhitikā, meaning "effort for a difficult livelihood."
Hoặc, ở đây có sự cố gắng đau khổ, không ai có thể thực hiện bất kỳ sự cố gắng nào một cách dễ dàng, nên gọi là duhitikā, tức là sự cố gắng sống sót khó khăn.
Du-sadde vā ukārassa vakāraṃ katvā dvīhitikāti ayaṃ niddesoti āha ‘‘atha vā’’tiādi.
Or, having changed the u of du- to v, this designation is dvīhitikā. Thus, he says, " atha vā" and so on.
Hoặc, sau khi biến âm u của từ du thành v, đây là sự diễn giải dvīhitikā, nên ông ấy nói "atha vā" (hoặc là), v.v.
Byādhi rogoti etāni ‘‘āturatā’’ti imassa vevacanāni.
Byādhi rogo these are synonyms for "āturatā" (affliction).
Byādhi rogo (bệnh tật, bệnh hoạn) là những từ đồng nghĩa của āturatā (ốm yếu).
Tena setaṭṭikā nāma ekā rogajātīti dasseti.
Thereby, he shows that setaṭṭikā is a type of disease.
Qua đó, ông ấy chỉ ra rằng setaṭṭikā là một loại bệnh.
So pana rogo pāṇakadosena sambhavati.
That disease arises from the defect of insects.
Bệnh đó phát sinh do lỗi của côn trùng.
Eko kira pāṇako nāḷamajjhagataṃ gaṇṭhiṃ vijjhati, yena viddhattā nikkhantampi sālisīsaṃ khīraṃ gahetuṃ na sakkoti.
It is said that a certain insect pierces the knot within the stalk, and because it is pierced, even the rice ears that emerge cannot hold milk (sap).
Có một loại côn trùng đục vào cái nút nằm giữa thân cây, do bị đục nên ngay cả khi bông lúa đã trổ ra, nó cũng không thể chứa sữa.
Tenāha ‘‘pacchinnakhīra’’ntiādi.
Therefore, he says, " pacchinnakhīra" and so on.
Vì vậy, ông ấy nói "pacchinnakhīra" (mất sữa), v.v.
Vuttasassanti vapitasassaṃ.
Vuttasassa means "sown grain."
Vuttasassa có nghĩa là lúa đã gieo.
Tatthāti verañjāyaṃ.
Tatthā means "in Verañjā."
Tatthā có nghĩa là ở Verañja.
Salākāmattaṃ vuttaṃ etthāti salākāvuttā, purimapade uttarapadalopenāyaṃ niddeso.
Only sticks were sown there, thus salākāvuttā; this designation is made by the elision of the latter word in the former compound.
Ở đây, chỉ có những cành cây được gieo, nên gọi là salākāvuttā (gieo cành). Sự diễn giải này là do sự lược bỏ hậu tố trong từ trước.
Tenāha ‘‘salākā eva sampajjatī’’ti.
Therefore, he says, " salākā eva sampajjatī" (it became mere sticks).
Vì vậy, ông ấy nói "salākā eva sampajjatī" (chỉ thành cành cây).
Yaṃ tattha vuttaṃ vāpitaṃ, taṃ salākāmattameva ahosi, phalaṃ na jāyatīti attho.
What was sown or planted there became mere sticks; fruit did not arise, is the meaning.
Có nghĩa là, những gì được gieo ở đó chỉ là cành cây, không có quả.
Sampajjatīti ca iminā ‘‘salākāvuttā’’ti etthāyaṃ vuttasaddo nipphattiatthoti dasseti.
And by this word sampajjatī, he shows that the word vutta in "salākāvuttā" here means "to come to fruition."
Và với từ sampajjatī (thành), ông ấy chỉ ra rằng từ vutta ở đây trong salākāvuttā có nghĩa là hoàn thành.
Salākāyāti veḷuvilīvatālapaṇṇādīhi katasalākāya.
Salākāyā means "with sticks made from bamboo splints, palm leaves, etc."
Salākāyā có nghĩa là bằng những que được làm từ tre, mây, lá cọ, v.v.
Dhaññavikkayakānaṃ santikanti dhaññaṃ vikkiṇantīti dhaññavikkayakā, tesaṃ samīpanti attho.
Dhaññavikkayakānaṃ santika means "near those who sell grain," that is, "grain merchants."
Dhaññavikkayakānaṃ santika có nghĩa là những người bán ngũ cốc, tức là gần những người bán ngũ cốc.
Kayakesūti dhaññagaṇhanakesu.
Kayakesū means "among those who purchase grain."
Kayakesū có nghĩa là những người mua ngũ cốc.
Kiṇitvāti gahetvā.
Kiṇitvā means "having taken."
Kiṇitvā có nghĩa là sau khi lấy.
Dhaññakaraṇaṭṭhāneti koṭṭhāgārassa samīpaṭṭhāne, dhaññaminanaṭṭhāneti vuttaṃ hoti.
Dhaññakaraṇaṭṭhāne means "near the granary," that is, "at the place where grain is measured."
Dhaññakaraṇaṭṭhāne có nghĩa là gần kho thóc, tức là nơi đong đếm ngũ cốc.
Vaṇṇajjhakkhanti kahāpaṇaparikkhakaṃ.
Vaṇṇajjhakkha means "a coin examiner."
Vaṇṇajjhakkha có nghĩa là người kiểm tra tiền xu.
Nasukarā uñchena paggahena yāpetunti paggayhatīti paggaho, patto.
Nasukarā uñchena paggahena yāpetu (it is not easy to sustain oneself by gleaning with a bowl); paggaho means "that which is taken or held," that is, "a bowl."
Nasukarā uñchena paggahena yāpetuṃ có nghĩa là paggaho là sự nắm giữ, tức là bát khất thực.
Tena paggahena pattenāti attho, pattaṃ gahetvā bhikkhācariyāya yāpetuṃ na sakkāti vuttaṃ hoti.
Therefore, paggahena means "with that bowl"; it means "it is not possible to sustain oneself by going for alms, holding a bowl."
Có nghĩa là, không thể duy trì cuộc sống bằng cách khất thực với bát nắm giữ, tức là không thể duy trì cuộc sống bằng cách đi khất thực với bát.
Tenevāha ‘‘paggahena yo uñcho’’tiādi.
Therefore, he says, " paggahena yo uñcho" and so on.
Chính vì vậy, ông ấy nói "paggahena yo uñcho" (sự khất thực bằng bát), v.v.
Nasukarāti sukarabhāvo ettha natthīti nasukarā.
Nasukarā means "there is no ease here," hence nasukarā.
Nasukarā có nghĩa là ở đây không có sự dễ dàng, nên gọi là nasukarā (không dễ dàng).
Piṇḍāya caritvāti piṇḍāya caraṇahetu.
Piṇḍāya caritvā means "due to having gone for alms."
Piṇḍāya caritvā có nghĩa là vì lý do đi khất thực.
Hetuatthepi hi tvāsaddameke icchanti.
Indeed, some consider the word tvā to also signify a cause.
Thật vậy, một số người cũng muốn từ tvā ở nghĩa nguyên nhân.
Uttarāpathato āgatā, uttarāpatho vā nivāso etesanti uttarāpathakāti vattabbe niruttinayena ‘‘uttarāhakā’’ti vuttaṃ.
They came from Uttarāpatha, or Uttarāpatha is their dwelling place; thus, where it should be "uttarāpathakā," by the rule of etymology (nirutti-naya), it is said "uttarāhakā."
Đến từ Uttarāpatha, hoặc Uttarāpatha là nơi cư trú của những người này, nên đáng lẽ phải nói là uttarāpathakā, nhưng theo quy tắc ngữ pháp đã nói là "uttarāhakā".
Tenāha ‘‘uttarāpathavāsikā’’tiādi.
Therefore, he says, " uttarāpathavāsikā" (residents of Uttarāpatha) and so on.
Vì vậy, ông ấy nói "uttarāpathavāsikā" (cư dân của Uttarāpatha), v.v.
‘‘Uttarāpathakā’’icceva vā pāḷipāṭho veditabbo.
Or, "uttarāpathakā" itself should be understood as the Pali reading.
Hoặc, bản đọc Pali nên được hiểu là uttarāpathakā.
Keci pana ‘‘uttaraṃ visiṭṭhaṃ bhaṇḍaṃ āharantīti uttarāhakā, uttaraṃ vā adhikaṃ agghaṃ nentīti uttarāhakā’’tiādinā aññena pakārena atthaṃ vaṇṇayanti.
However, some explain the meaning in another way, saying, "They bring superior goods, hence uttarāhakā; or they bring a higher price, hence uttarāhakā."
Tuy nhiên, một số người diễn giải ý nghĩa theo cách khác, nói rằng "uttaraṃ visiṭṭhaṃ bhaṇḍaṃ āharantīti uttarāhakā" (họ mang đến những hàng hóa đặc biệt, nên gọi là uttarāhakā), hoặc "uttaraṃ vā adhikaṃ agghaṃ nentīti uttarāhakā" (họ mang đến giá cao hơn, nên gọi là uttarāhakā), v.v.
Assānaṃ uṭṭhānaṭṭhāneti assānaṃ ākaraṭṭhāne.
Assānaṃ uṭṭhānaṭṭhāne means "at the birthplace of horses."
Assānaṃ uṭṭhānaṭṭhāne có nghĩa là nơi xuất xứ của ngựa.
Verañjanti verañjāyaṃ.
Verañja means "in Verañjā."
Verañja có nghĩa là ở Verañja.
Bhummatthe hetaṃ upayogavacanaṃ.
Indeed, this is a locative case word used in the sense of "in."
Thật vậy, đây là một từ chỉ công dụng ở nghĩa định xứ.
Mandiranti assasālaṃ.
Mandira means "horse stable."
Mandira có nghĩa là chuồng ngựa.
Assamaṇḍalikāyoti paññāyiṃsūti parimaṇḍalākārena katattā assamaṇḍalikāyoti pākaṭā ahesuṃ.
Assamaṇḍalikāyoti paññāyiṃsū means "they were known as horse enclosures because they were made in a circular shape."
Assamaṇḍalikāyoti paññāyiṃsū có nghĩa là chúng trở nên nổi tiếng là assamaṇḍalikā (chuồng ngựa tròn) vì được xây dựng theo hình tròn.
Evaṃ katānañca assasālānaṃ bahuttā bahuvacananiddeso kato.
And because there were many such stables, the plural form is used.
Và vì có nhiều chuồng ngựa được xây dựng như vậy, nên đã sử dụng số nhiều.
Dasannaṃ dasannaṃ assānaṃ vasanokāso ekekā assamaṇḍalikātipi vadanti.
Some also say that the dwelling place for ten horses each is one horse enclosure.
Họ cũng nói rằng nơi ở của mười con ngựa là một assamaṇḍalikā (chuồng ngựa tròn).
Addhānakkhamā na hontīti dīghakālaṃ pavattetuṃ khamā na honti, na cirakālappavattinoti vuttaṃ hoti.
Addhānakkhamā na hontī means that they are not capable of continuing for a long time, they do not last for a long period.
Addhānakkhamā na hontī có nghĩa là không có khả năng duy trì trong thời gian dài, không phải là thứ tồn tại lâu dài.
Gaṅgāya dakkhiṇā disā appatirūpadeso, uttarā disā patirūpadesoti adhippāyenāha ‘‘na hi te’’tiādi.
With the intention that the southern direction of the Gaṅgā is an unsuitable region, and the northern direction is a suitable region, it is said, “na hi te” and so forth.
Với ý định rằng phía nam sông Hằng là vùng đất không thích hợp, còn phía bắc là vùng đất thích hợp, nên đã nói “na hi te” và tiếp theo.
Gaṅgāya dakkhiṇatīrajātā dakkhiṇāpathamanussā.
Those born on the southern bank of the Gaṅgā are dakkhiṇāpathamanussā (people of the Southern region).
Những người sinh ra ở bờ phía nam sông Hằng là dakkhiṇāpathamanussā (những người từ phương nam).
‘‘Amhākaṃ buddho’’ti evaṃ buddhaṃ mamāyantīti buddhamāmakā.
Those who cherish the Buddha, saying, “Our Buddha,” are buddhamāmakā.
Những người xem Đức Phật là “Đức Phật của chúng ta” như vậy được gọi là buddhamāmakā (những người quy y Phật).
Evaṃ sesesupi.
And so too for the rest.
Tương tự với các trường hợp còn lại.
Paṭiyādetunti sampādetuṃ.
Paṭiyādetuṃ means to prepare.
Paṭiyādetu có nghĩa là chuẩn bị, hoàn thành.
Niccabhattasaṅkhepenāti niccabhattākārena.
Niccabhattasaṅkhepenā means in the manner of regular almsfood.
Niccabhattasaṅkhepenā có nghĩa là theo cách cúng dường bữa ăn thường xuyên.
Pubbaṇhasamayanti idaṃ bhummatthe upayogavacananti āha ‘‘pubbaṇhasamayeti attho’’ti.
Pubbaṇhasamayaṃ – this word is used in the sense of the locative case, so it is said: “pubbaṇhasamaye is the meaning.”
Pubbaṇhasamaya là một từ chỉ công dụng ở nghĩa sở thuộc, nên đã nói “pubbaṇhasamayeti atthoti” (có nghĩa là vào buổi sáng).
Accantasaṃyoge vā idaṃ upayogavacananti dassetuṃ yathā accantasaṃyogattho sambhavati, tathā atthaṃ dassento āha ‘‘pubbaṇhe vā samaya’’ntiādi.
Or, to show that this word is used in the sense of constant association, it explains the meaning in such a way that the sense of constant association is possible, saying, “or in the forenoon” and so forth.
Để chỉ ra rằng đây là một từ chỉ công dụng ở nghĩa liên tục tuyệt đối, và để cho thấy nghĩa liên tục tuyệt đối có thể xảy ra như thế nào, đã nói “pubbaṇhe vā samaya” và tiếp theo.
Evanti evaṃ pacchā vuttanayena atthe vuccamāne.
Evaṃ means, when the meaning is explained in the manner stated later.
Eva có nghĩa là khi nghĩa được nói theo cách đã nêu ở sau.
Nanu ca vihāre nisīdantāpi antaravāsakaṃ nivāsetvāva nisīdanti, tasmā ‘‘nivāsetvā’’ti idaṃ kasmā vuttanti āha ‘‘vihāranivāsanaparivattanavasenā’’tiādi.
“But surely, even when sitting in the monastery, they sit having already worn the inner robe. So why is ‘having worn’ stated?” To this, it is said, “in terms of changing the wearing of robes in the monastery” and so forth.
Chẳng phải các Tỳ-khưu khi ngồi trong tinh xá cũng mặc y nội sao? Vậy tại sao lại nói “nivāsetvā” (đã mặc)? Để trả lời câu hỏi đó, đã nói “vihāranivāsanaparivattanavasenā” và tiếp theo.
Vihāranivāsanaparivattanañca vihāre nisinnakāle nivatthampi puna gāmappavesanasamaye cāletvā ito cito ca saṇṭhapetvā sakkaccaṃ nivāsanamevāti veditabbaṃ.
The changing of robes in the monastery, even if worn while sitting in the monastery, should be understood as carefully wearing it again, adjusting it here and there when entering the village.
Sự thay đổi y nội trong tinh xá cần được hiểu là việc mặc y một cách cẩn trọng sau khi đã chỉnh sửa y đang mặc khi ngồi trong tinh xá, bằng cách di chuyển y từ chỗ này sang chỗ khác vào lúc vào làng.
Tenevāha ‘‘na hi te tato pubbe anivatthā ahesu’’nti.
That is why it is said, “Indeed, they were not unworn before that.”
Chính vì thế mà đã nói “na hi te tato pubbe anivatthā ahesu” (chúng không phải là chưa mặc trước đó).
Pattacīvaramādāyāti pattañca cīvarañca gahetvā.
Pattacīvaramādāya means taking the bowl and robes.
Pattacīvaramādāyā có nghĩa là cầm lấy bát và y.
Gahaṇañcettha na kevalaṃ hattheneva, atha kho yena kenaci ākārena dhāraṇamevāti dassento yathāsambhavamatthayojanaṃ karoti ‘‘pattaṃ hatthehī’’tiādinā.
And here, taking does not mean merely by hand, but holding it in any possible way, as shown by the explanation “the bowl with the hands” and so forth.
Việc cầm ở đây không chỉ bằng tay, mà còn là việc mang theo bằng bất kỳ cách nào có thể, nên đã giải thích nghĩa theo khả năng có thể, bắt đầu bằng “pattaṃ hatthehī” (bát bằng tay) và tiếp theo.
Gatagataṭṭhāneti assamaṇḍalikāsu sampattasampattaṭṭhāne.
Gatagataṭṭhāne means at every place they arrived, within the horse-stalls.
Gatagataṭṭhāne có nghĩa là ở bất cứ nơi nào đã đến trong các chuồng ngựa.
Udukkhale koṭṭetvā koṭṭetvā paribhuñjantīti ettha kasmā pana te bhikkhū sayameva evaṃ katvā paribhuñjanti, kimevaṃ laddhaṃ kappiyakārakehi yāguṃ vā bhattaṃ vā pacāpetvā sayaṃ vā pacitvā paribhuñjituṃ na vaṭṭatīti āha ‘‘therānaṃ koci kappiyakārako natthī’’tiādi.
Udukkhale koṭṭetvā koṭṭetvā paribhuñjantīti – Here, why do those bhikkhus themselves eat after doing so? Is it not permissible for them to have gruel or food cooked by stewards, or to cook it themselves and eat it? To this question, it is said, “The elders have no stewards” and so forth.
Về câu Udukkhale koṭṭetvā koṭṭetvā paribhuñjantī (giã đi giã lại trong cối rồi ăn), tại sao các Tỳ-khưu đó lại tự mình làm như vậy rồi ăn? Chẳng lẽ không được phép nhờ người làm việc hợp pháp nấu cháo hoặc cơm rồi ăn, hay tự mình nấu rồi ăn sao? Để trả lời câu hỏi đó, đã nói “therānaṃ koci kappiyakārako natthī” (không có người làm việc hợp pháp nào cho các Trưởng lão) và tiếp theo.
Kappiyākappiyabhāvaṃ anapekkhitvā bhikkhūnaṃ evaṃ kātuṃ sāruppaṃ na hotīti vatvā puna akappiyabhāvampi dassento āha ‘‘na ca vaṭṭatī’’ti.
Having said that it is not proper for bhikkhus to act in this manner without considering what is allowable and what is not, it then further shows the unallowable nature, saying, “nor is it permissible.”
Sau khi nói rằng việc các Tỳ-khưu làm như vậy là không thích hợp, bất kể là hợp pháp hay không hợp pháp, lại nói “na ca vaṭṭatī” (và cũng không được phép) để chỉ ra rằng đó là điều không hợp pháp.
Bhājanādipariharaṇavasena bahubhaṇḍikatāya abhāvato vuttaṃ ‘‘sallahukavuttitā’’ti.
Sallahukavuttitā is said due to the absence of much baggage, in terms of carrying utensils and so forth.
Sallahukavuttitā (lối sống giản dị) được nói đến vì không có nhiều đồ đạc do việc mang theo bát đĩa và các vật dụng khác.
Sakaṃ sakaṃ paṭivīsanti attano attano koṭṭhāsaṃ.
Sakaṃ sakaṃ paṭivīsaṃ means their own respective share.
Sakaṃ sakaṃ paṭivīsa có nghĩa là phần của mỗi người.
Appossukkāti samaṇadhammato aññattha nirussāhā.
Appossukkā means those who are without zeal for anything other than the ascetic's duty.
Appossukkā có nghĩa là không có nhiệt huyết đối với những việc khác ngoài pháp Sa-môn.
Tadupiyanti tadanurūpaṃ.
Tadupiyaṃ means suitable for that (barley groats).
Tadupiya có nghĩa là phù hợp với điều đó.
Pisatīti cuṇṇeti.
Pisatī means to grind.
Pisatī có nghĩa là nghiền nát.
Puññañāṇavisesehi kattabbakammassa manāpatā hotīti āha ‘‘puññavatā’’tiādi.
That an action to be done by those endowed with special merit and wisdom is pleasing, is why it is said, “by those with merit” and so forth.
Đã nói “puññavatā” (người có công đức) và tiếp theo, vì công việc cần được thực hiện bởi những người có công đức và trí tuệ đặc biệt là điều đáng hài lòng.
Nanti naṃ patthapulakaṃ.
Naṃ means that portion of barley groats.
Na có nghĩa là cái bột lúa mạch đó.
‘‘Na tato paṭṭhāyā’’ti vacanato tato pubbe bhagavato piṇḍāya caraṇampi dassitanti veditabbaṃ.
It should be understood that, by the saying “not from that time onwards,” the Buddha’s going for alms before that time is also indicated.
Cần hiểu rằng từ câu “Na tato paṭṭhāyā” (không từ đó trở đi) cũng chỉ ra rằng Đức Thế Tôn đã đi khất thực trước đó.
Laddhāti labhitvā.
Laddhā means having obtained.
Laddhā có nghĩa là đã nhận được.
‘‘Laddho’’ti vā pāṭho, upaṭṭhākaṭṭhānaṃ neva laddhoti attho.
Or the reading is “laddho,” meaning that the position of attendant was not obtained.
Hoặc cũng có bản đọc là “laddho”, nghĩa là không nhận được vị trí thị giả.
Kadā pana thero upaṭṭhākaṭṭhānaṃ laddhoti?
When, then, did the elder obtain the position of attendant?
Vậy khi nào Trưởng lão mới nhận được vị trí thị giả?
Vuccate (dī. ni. aṭṭha. 2.11; a. ni. aṭṭha. 1.1.219-223) – ekadā kira bhagavā nāgasamālattherena saddhiṃ addhānamaggappaṭipanno dvedhāpathaṃ patto.
It is said: Once, indeed, the Blessed One, traveling with the Elder Nāgasamāla on a journey, came to a fork in the road.
Được kể rằng (Dī. Ni. Aṭṭha. 2.11; A. Ni. Aṭṭha. 1.1.219-223) – Một lần nọ, Đức Thế Tôn cùng với Trưởng lão Nāgasamāla đang đi trên đường thì đến một ngã ba.
Thero maggā ukkamma ‘‘bhagavā ahaṃ iminā maggena gacchāmī’’ti āha.
The elder deviated from the path and said, “Venerable Sir, I will go by this road.”
Trưởng lão rời khỏi con đường và nói: “Bạch Đức Thế Tôn, con sẽ đi con đường này.”
Atha naṃ bhagavā ‘‘ehi bhikkhu, iminā gacchāmā’’ti āha.
Then the Blessed One said to him, “Come, bhikkhu, let us go by this road.”
Khi đó, Đức Thế Tôn nói với ông: “Này Tỳ-khưu, hãy đến đây, chúng ta hãy đi con đường này.”
So ‘‘handa bhagavā tumhākaṃ pattacīvaraṃ gaṇhatha, ahaṃ iminā gacchāmī’’ti vatvā pattacīvaraṃ chamāyaṃ ṭhapetuṃ āraddho.
He, saying, “Please, Blessed One, take your bowl and robes; I will go by this road,” began to place the bowl and robes on the ground.
Ông ấy nói: “Bạch Đức Thế Tôn, xin Ngài hãy cầm lấy bát và y của con, con sẽ đi con đường này,” rồi bắt đầu đặt bát và y xuống đất.
Atha bhagavā ‘‘āhara bhikkhū’’ti vatvā pattacīvaraṃ gahetvā gato.
Then the Blessed One, saying, “Bring them, bhikkhu,” took the bowl and robes and went.
Khi đó, Đức Thế Tôn nói: “Này Tỳ-khưu, hãy mang đến đây,” rồi cầm lấy bát và y đi.
Tassapi bhikkhuno itarena maggena gacchato corā pattacīvarañceva hariṃsu, sīsañca bhindiṃsu.
And as that bhikkhu was going by the other road, robbers stole his bowl and robes and also wounded his head.
Khi Tỳ-khưu đó đi con đường khác, những tên cướp đã cướp lấy bát và y của ông, và đập vỡ đầu ông.
So ‘‘bhagavā dāni me paṭisaraṇaṃ, na añño’’ti cintetvā lohitena gaḷantena bhagavato santikaṃ āgami.
He, thinking, “Now the Blessed One is my refuge, no one else,” came to the Blessed One, with blood streaming.
Ông ấy nghĩ: “Bây giờ Đức Thế Tôn là nơi nương tựa của ta, không ai khác,” rồi với máu chảy ròng, ông đến gặp Đức Thế Tôn.
‘‘Kimidaṃ bhikkhū’’ti ca vutte taṃ pavattiṃ ārocesi.
When asked, “What is this, bhikkhu?”, he related that incident.
Khi được hỏi: “Này Tỳ-khưu, chuyện gì vậy?” ông đã kể lại sự việc đó.
Atha naṃ bhagavā ‘‘mā cintayi bhikkhu, etaṃ kāraṇaṃyeva te nivārayimhā’’ti vatvā samassāsesi.
Then the Blessed One, saying, “Do not worry, bhikkhu, it was for this very reason that we prevented you,” consoled him.
Khi đó, Đức Thế Tôn nói với ông: “Này Tỳ-khưu, đừng lo lắng, chúng ta đã ngăn cản con vì chính lý do này,” rồi an ủi ông.
Ekadā pana bhagavā meghiyattherena saddhiṃ pācīnavaṃsamigadāye jantugāmaṃ agamāsi.
Once, however, the Blessed One, accompanied by the Elder Meghiya, went to the village of Jantu in Pācīnavaṃsamigadāya.
Một lần nọ, Đức Thế Tôn cùng với Trưởng lão Meghiya đã đến làng Jantu trong khu rừng nai Pācīnavamsa.
Tatrāpi meghiyo jantugāme piṇḍāya caritvā nadītīre pāsādikaṃ ambavanaṃ disvā ‘‘bhagavā tumhākaṃ pattacīvaraṃ gaṇhatha, ahaṃ etasmiṃ ambavane samaṇadhammaṃ karomī’’ti vatvā bhagavatā tikkhattuṃ nivāriyamānopi gantvā akusalavitakkehi anvāsatto paccāgantvā taṃ pavattiṃ ārocesi.
There too, Meghiya, having gone for alms in Jantugāma, saw a beautiful mango grove on the riverbank, and said, “Venerable Sir, please take your bowl and robes; I will perform the ascetic’s practice in this mango grove.” Even though the Blessed One prevented him three times, he went, and being overcome by unwholesome thoughts, he returned and related the incident.
Tại đó, Trưởng lão Meghiya sau khi khất thực ở làng Jantu, thấy một khu vườn xoài đẹp đẽ bên bờ sông, liền nói: “Bạch Đức Thế Tôn, xin Ngài hãy cầm lấy bát và y của con, con sẽ thực hành pháp Sa-môn trong khu vườn xoài này.” Mặc dù Đức Thế Tôn đã ngăn cản ba lần, ông vẫn đi, rồi bị những tư duy bất thiện quấy nhiễu, ông quay trở lại và kể lại sự việc đó.
Tampi bhagavā ‘‘idameva te kāraṇaṃ sallakkhayitvā nivārayimhā’’ti vatvā anupubbena sāvatthiṃ agamāsi.
The Blessed One, saying to him, “It was precisely by discerning this reason that we prevented you,” gradually proceeded to Sāvatthī.
Đức Thế Tôn cũng nói với ông: “Chúng ta đã nhận ra chính lý do này mà ngăn cản con,” rồi tuần tự đến Sāvatthī.
Tattha gandhakuṭipariveṇe paññattavarabuddhāsane nisinno bhikkhusaṅghaparivuto bhikkhū āmantesi – ‘‘bhikkhave, idānimhi mahallako, ekacce bhikkhū ‘iminā maggena gacchāmā’ti vutte aññena gacchanti, ekacce mayhaṃ pattacīvaraṃ bhūmiyaṃ nikkhipanti, mayhaṃ nibaddhupaṭṭhākaṃ bhikkhuṃ jānāthā’’ti.
There, seated on the excellent Buddha-seat prepared in the Gandhakuṭi-pariveṇa, surrounded by the assembly of bhikkhus, he addressed the bhikkhus: “Bhikkhus, I am now old. Some bhikkhus, when told ‘Let us go by this path,’ go by another; some place my bowl and robes on the ground. You should appoint a permanent attendant bhikkhu for me.”
Tại đó, Ngài ngồi trên tòa Phật bảo cao quý đã được sắp đặt trong khu vực Gandhakuti, được bao quanh bởi Tăng đoàn, và gọi các Tỳ-khưu: “Này các Tỳ-khưu, bây giờ Như Lai đã già, một số Tỳ-khưu khi được bảo ‘chúng ta hãy đi con đường này’ thì lại đi con đường khác, một số lại đặt bát và y của Như Lai xuống đất. Các con hãy biết một Tỳ-khưu thị giả thường xuyên của Như Lai.”
Bhikkhūnaṃ dhammasaṃvego udapādi.
A sense of spiritual urgency arose among the bhikkhus.
Sự xúc động về Pháp đã khởi lên trong các Tỳ-khưu.
Athāyasmā sāriputto uṭṭhāya bhagavantaṃ vanditvā ‘‘ahaṃ, bhante, tumheyeva patthayamāno satasahassakappādhikaṃ asaṅkhyeyyaṃ pāramiyo pūresiṃ, nanu mādiso mahāpañño upaṭṭhāko nāma vaṭṭati, ahaṃ upaṭṭhahissāmī’’ti āha.
Then, the Venerable Sāriputta rose, bowed to the Blessed One, and said, “Venerable Sir, desiring you alone, I fulfilled perfections for an incalculable period exceeding a hundred thousand aeons. Is it not fitting that an attendant like me, possessed of great wisdom, should attend to you? I will attend.”
Khi đó, Tôn giả Sāriputta đứng dậy, đảnh lễ Đức Thế Tôn và nói: “Bạch Đức Thế Tôn, con đã hoàn thành các Ba-la-mật trong một A-tăng-kỳ và một trăm ngàn đại kiếp, chỉ vì mong muốn được phụng sự Ngài. Chẳng lẽ một thị giả có đại trí tuệ như con lại không thích hợp sao? Con sẽ phụng sự Ngài.”
Taṃ bhagavā ‘‘alaṃ, sāriputta, yassaṃ disāyaṃ tvaṃ viharasi, asuññāyeva sā disā, tava ovādo buddhānaṃ ovādasadiso, na me tayā upaṭṭhākakiccaṃ atthī’’ti paṭikkhipi.
The Blessed One rejected him, saying, “Enough, Sāriputta, the direction in which you dwell is not empty. Your advice is like the advice of the Buddhas. I have no need for your service as an attendant.”
Đức Thế Tôn đã từ chối ông, nói: “Thôi Sāriputta, phương hướng nào con an trú thì phương hướng đó không trống vắng. Lời khuyên của con giống như lời khuyên của các Đức Phật. Như Lai không cần con làm công việc thị giả.”
Etenevupāyena mahāmoggallānaṃ ādiṃ katvā asītimahāsāvakā uṭṭhahiṃsu.
By the same method, the eighty great disciples, beginning with Mahāmoggallāna, rose up.
Bằng cách tương tự, tám mươi vị đại đệ tử, bắt đầu từ Ngài Mahāmoggallāna, đã đứng dậy.
Sabbe bhagavā paṭikkhipi.
The Blessed One rejected all of them.
Đức Thế Tôn đã từ chối tất cả.
Ānandatthero pana tuṇhīyeva nisīdi.
However, the Elder Ānanda remained silent.
Tuy nhiên, Trưởng lão Ānanda vẫn ngồi yên lặng.
Atha naṃ bhikkhū āhaṃsu ‘‘āvuso, bhikkhusaṅgho upaṭṭhākaṭṭhānaṃ yācati, tvampi yācāhī’’ti.
Then the bhikkhus said to him, “Friend Ānanda, the assembly of bhikkhus is asking for the position of attendant; you too should ask.”
Khi đó, các Tỳ-khưu nói với ông: “Này Hiền giả, Tăng đoàn đang cầu xin vị trí thị giả, Hiền giả cũng hãy cầu xin đi.”
Yācitvā laddhaṭṭhānaṃ nāma āvuso kīdisaṃ hoti, kiṃ maṃ satthā na passati, sace rocessati, ‘‘ānando maṃ upaṭṭhātū’’ti vakkhatīti.
He said, “Friends, what kind of position is one that is asked for and then obtained? Does the Teacher not see me? If he approves, he will say, ‘Let Ānanda attend to me.’ ”
Ông ấy nói: “Này Hiền giả, một vị trí đã cầu xin mà có được thì có ý nghĩa gì? Chẳng lẽ Đức Đạo Sư không thấy ta sao? Nếu Ngài hài lòng, Ngài sẽ nói: ‘Ānanda hãy làm thị giả cho ta’.”
Atha bhagavā ‘‘na, bhikkhave, ānando aññena ussāhetabbo, sayameva jānitvā maṃ upaṭṭhahissatī’’ti āha.
Then the Blessed One said, “Bhikkhus, Ānanda need not be encouraged by anyone else; he will know by himself and attend to me.”
Khi đó, Đức Thế Tôn nói: “Này các Tỳ-khưu, Ānanda không cần ai khác thúc đẩy, tự mình sẽ biết mà làm thị giả cho Như Lai.”
Tato bhikkhū ‘‘uṭṭhehi āvuso ānanda, uṭṭhehi, āvuso ānanda, dasabalaṃ upaṭṭhākaṭṭhānaṃ yācāhī’’ti āhaṃsu.
Thereupon the bhikkhus said, “Rise, friend Ānanda! Rise, friend Ānanda! Ask the Dasabala for the position of attendant!”
Sau đó, các Tỳ-khưu nói: “Hãy đứng dậy, Hiền giả Ānanda, hãy đứng dậy, Hiền giả Ānanda, hãy cầu xin vị trí thị giả của Đức Thập Lực.”
Thero uṭṭhahitvā cattāro paṭikkhepe ca catasso ca āyācanāti aṭṭha vare yāci.
The Elder rose and requested eight boons: four rejections and four requests.
Trưởng lão đứng dậy và cầu xin tám điều ân huệ: bốn điều từ chối và bốn điều thỉnh cầu.
Cattāro paṭikkhepā nāma ‘‘sace me, bhante bhagavā, attanā laddhaṃ paṇītaṃ cīvaraṃ na dassati, piṇḍapātaṃ na dassati, ekagandhakuṭiyaṃ vasituṃ na dassati, nimantanaṃ gahetvā na gamissati, evāhaṃ bhagavantaṃ upaṭṭhahissāmī’’ti vatvā ‘‘kaṃ panettha, ānanda, ādīnavaṃ addasā’’ti vutte āha ‘‘sacāhaṃ, bhante, imāni vatthūni labhissāmi, bhavissanti vattāro ‘ānando dasabalena laddhaṃ paṇītaṃ cīvaraṃ paribhuñjati, piṇḍapātaṃ paribhuñjati, ekagandhakuṭiyaṃ vasati, ekanimantanaṃ gacchati, etaṃ lābhaṃ labhanto tathāgataṃ upaṭṭhāti, ko evaṃ upaṭṭhahato bhāro’’’ti.
The four refusals are: "If, venerable sir, the Blessed One does not give me the exquisite robe he has received, if he does not give me almsfood, if he does not allow me to dwell in a private Perfumed Hut, if he does not go after accepting an invitation, then I will attend upon the Blessed One." When it was said, "What danger did you see in this, Ananda?" he said, "Venerable sir, if I receive these things, there will be those who say, 'Ananda enjoys the exquisite robe received by the Dasabala, enjoys almsfood, dwells in a private Perfumed Hut, and goes to a single invitation. What burden is it to attend upon the Tathāgata receiving such gains?'"
Bốn điều từ chối là: Sau khi nói: “Bạch Thế Tôn, nếu Thế Tôn không ban cho con y phục thượng hạng do Thế Tôn tự mình thọ nhận, không ban cho con thực phẩm khất thực, không cho con ở trong một hương thất, và không đi nhận lời mời mà con đã nhận, thì con sẽ hầu hạ Thế Tôn như vậy.” Khi được hỏi: “Này Ānanda, ông đã thấy mối nguy hại nào trong điều đó?” Vị ấy thưa: “Bạch Thế Tôn, nếu con thọ nhận những vật này, sẽ có người nói: ‘Ānanda thọ dụng y phục thượng hạng do Đấng Thập Lực thọ nhận, thọ dụng thực phẩm khất thực, ở trong một hương thất, đi nhận một lời mời. Khi thọ nhận lợi lộc này, ông ấy hầu hạ Như Lai. Ai hầu hạ như vậy thì có gì khó khăn đâu?’.
Ime cattāro paṭikkhepe yāci.
He requested these four refusals.
Vị ấy đã cầu xin bốn điều từ chối này.
Catasso āyācanā nāma ‘‘sace, bhante bhagavā, mayā gahitaṃ nimantanaṃ gamissati, sacāhaṃ tiroraṭṭhā tirojanapadā bhagavantaṃ daṭṭhuṃ āgataparisaṃ āgatakkhaṇe eva bhagavantaṃ dassetuṃ lacchāmi, yadā me kaṅkhā uppajjati, tasmiṃyeva khaṇe bhagavantaṃ upasaṅkamituṃ lacchāmi, tathā yaṃ bhagavā mayhaṃ parammukhaṃ dhammaṃ deseti, taṃ āgantvā mayhaṃ kathessati, evāhaṃ bhagavantaṃ upaṭṭhahissāmī’’ti vatvā ‘‘kaṃ panettha, ānanda, ānisaṃsaṃ passasī’’ti vutte āha ‘‘idha, bhante, saddhā kulaputtā bhagavato okāsaṃ alabhantā maṃ evaṃ vadanti ‘sveva, bhante ānanda, bhagavatā saddhiṃ amhākaṃ ghare bhikkhaṃ gaṇheyyāthā’ti.
The four requests are: "If, venerable sir, the Blessed One goes to an invitation accepted by me, if I, when an assembly arrives from distant lands and provinces to see the Blessed One, can show the Blessed One to them immediately upon their arrival, if, when doubt arises in me, I can approach the Blessed One at that very moment, and if, whatever Dhamma the Blessed One teaches in my absence, he will come and tell me that, then I will attend upon the Blessed One." When it was said, "What advantage do you see in this, Ananda?" he said, "Venerable sir, here devout young men of good family, not finding an opportunity with the Blessed One, say to me, 'Venerable Ananda, may you and the Blessed One indeed accept almsfood at our house tomorrow.'
Bốn điều thỉnh cầu là: Sau khi nói: “Bạch Thế Tôn, nếu Thế Tôn đi nhận lời mời do con đã nhận, nếu con có thể cho hội chúng từ các vương quốc và lãnh thổ khác đến yết kiến Thế Tôn ngay khi họ vừa đến, nếu con có thể đến gặp Thế Tôn ngay khi con có nghi ngờ, và nếu Thế Tôn sẽ đến nói lại với con những pháp mà Thế Tôn đã thuyết giảng khi con vắng mặt, thì con sẽ hầu hạ Thế Tôn như vậy.” Khi được hỏi: “Này Ānanda, ông thấy lợi ích nào trong điều đó?” Vị ấy thưa: “Bạch Thế Tôn, ở đây, các thiện nam tín nữ không có cơ hội gặp Thế Tôn thường nói với con: ‘Bạch Tôn giả Ānanda, ngày mai xin ngài cùng với Thế Tôn thọ thực tại nhà chúng con.’.
Sace bhagavā tattha na gamissati, icchitakkhaṇeyeva parisaṃ dassetuṃ kaṅkhañca vinodetuṃ okāsaṃ na lacchāmi, bhavissanti vattāro ‘kiṃ ānando dasabalaṃ upaṭṭhāti, ettakampissa anuggahaṃ bhagavā na karotī’ti.
If the Blessed One does not go there, if I do not get the opportunity to show the assembly and dispel their doubts at the desired moment, there will be those who say, 'Why does Ananda attend upon the Dasabala? The Blessed One does not even show him such a favour.'
Nếu Thế Tôn không đến đó, con sẽ không có cơ hội để cho hội chúng yết kiến vào lúc họ mong muốn, cũng như không thể giải tỏa nghi ngờ của họ. Sẽ có người nói: ‘Ānanda hầu hạ Đấng Thập Lực làm gì, Thế Tôn còn không ban cho ông ấy sự giúp đỡ nhỏ nhoi như vậy sao?’.
Bhagavato ca parammukhā maṃ pucchissanti ‘ayaṃ, āvuso ānanda, gāthā idaṃ suttaṃ idaṃ jātakaṃ kattha desita’nti.
And people will ask me in the Blessed One's absence, 'Friend Ananda, where was this verse, this sutta, this Jātaka taught?'
Và khi Thế Tôn vắng mặt, họ sẽ hỏi con: ‘Này Hiền giả Ānanda, bài kệ này, bài kinh này, câu chuyện Jātaka này được thuyết ở đâu?’.
Sacāhaṃ taṃ na sampāyissāmi, bhavissanti vattāro ‘ettakampi, āvuso, na jānāsi, kasmā tvaṃ chāyā viya bhagavantaṃ na vijahanto dīgharattaṃ ciraṃ vicarī’ti.
If I cannot provide that, there will be those who say, 'Friend, you don't even know this much. Why did you wander for a long, long time, never leaving the Blessed One like a shadow?'
Nếu con không đáp ứng được điều đó, sẽ có người nói: ‘Này Hiền giả, ông còn không biết điều nhỏ nhặt như vậy sao? Tại sao ông lại đi theo Thế Tôn lâu ngày như bóng với hình mà không rời bỏ?’.
Tenāhaṃ parammukhā desitassapi dhammassa puna kathanaṃ icchāmī’’ti.
Therefore, I desire to be told again even the Dhamma taught in my absence."
Vì vậy, con mong muốn được nghe lại những pháp mà Thế Tôn đã thuyết giảng khi con vắng mặt.”.
Imā catasso āyācanā yāci.
He requested these four requests.
Vị ấy đã cầu xin bốn điều thỉnh cầu này.
Bhagavāpissa adāsi.
The Blessed One granted them to him.
Thế Tôn cũng đã ban cho vị ấy.
Evaṃ ime aṭṭha vare gahetvā nibaddhupaṭṭhāko ahosi.
Thus, having received these eight boons, he became a constant attendant.
Như vậy, sau khi thọ nhận tám điều ân huệ này, vị ấy đã trở thành người thị giả thường trực.
Tasseva ṭhānantarassa atthāya kappasatasahassaṃ pūritānaṃ pāramīnaṃ phalaṃ pāpuṇi, pāpuṇitvā ca upaṭṭhākānaṃ aggo hutvā bhagavantaṃ upaṭṭhahi.
He attained the fruit of perfections accumulated for one hundred thousand aeons for the sake of that very attendance, and having attained it, he became foremost among attendants and attended upon the Blessed One.
Để đạt được vị trí thị giả đó, vị ấy đã thành tựu quả vị của các pāramī đã được viên mãn trong một trăm ngàn đại kiếp, và sau khi thành tựu, vị ấy đã hầu hạ Thế Tôn, trở thành người thị giả tối thượng.
Thero hi upaṭṭhākaṭṭhānaṃ laddhakālato paṭṭhāya bhagavantaṃ duvidhena udakena tividhena dantakaṭṭhena pādaparikammena piṭṭhiparikammena gandhakuṭipariveṇasammajjanenāti evamādīhi kiccehi upaṭṭhahanto ‘‘imāya nāma velāya satthu idaṃ nāma laddhuṃ vaṭṭati, idaṃ nāma kātuṃ vaṭṭatī’’ti cintetvā taṃ taṃ nipphādento mahatiṃ daṇḍadīpikaṃ gahetvā ekarattiṃ gandhakuṭipariveṇaṃ nava vāre anupariyāyati.
Indeed, from the time he received the position of attendant, the Elder, while attending upon the Blessed One with two kinds of water, three kinds of tooth-sticks, foot massage, back massage, sweeping the Perfumed Hut and its precincts, and so on, would think, "At this time, it is proper for the Teacher to receive this thing, it is proper to do this action," and bringing about these various things, he would take a large staff-lamp and circumambulate the Perfumed Hut and its precincts nine times during the night.
Quả thật, từ khi đạt được vị trí thị giả, Trưởng lão đã hầu hạ Thế Tôn bằng hai loại nước, ba loại tăm xỉa răng, xoa bóp chân, xoa bóp lưng, quét dọn hương thất và các khu vực xung quanh, v.v. Vị ấy nghĩ: “Vào giờ này, Bậc Đạo Sư nên thọ nhận điều này, nên làm điều này,” rồi thực hiện từng việc đó. Vị ấy cầm một cây đèn lớn đi vòng quanh hương thất và các khu vực xung quanh chín lần trong một đêm.
Evañhissa ahosi ‘‘sace me thinamiddhaṃ okkameyya, bhagavati pakkosante paṭivacanaṃ dātuṃ nāhaṃ sakkuṇeyya’’nti.
It was thus for him: "If sloth and torpor were to overcome me, I would not be able to reply when the Blessed One called."
Vị ấy đã nghĩ như vậy: “Nếu sự hôn trầm, thụy miên ập đến với ta, ta sẽ không thể đáp lời khi Thế Tôn gọi.”.
Tasmā sabbarattiṃ daṇḍadīpikaṃ hatthena na muñcati, evametassa nibaddhupaṭṭhākaṭṭhānassa aladdhabhāvaṃ sandhāya vuttaṃ ‘‘no ca kho upaṭṭhākaṭṭhānaṃ laddhā’’ti.
Therefore, he did not release the staff-lamp from his hand all night. It is with reference to his not having attained this state of constant attendance that it is said, " but did not attain the state of constant attendant."
Vì vậy, vị ấy không bao giờ buông cây đèn khỏi tay suốt đêm. Điều này được nói đến khi đề cập đến việc vị ấy đã không đạt được vị trí thị giả thường trực: “nhưng không phải là đã đạt được vị trí thị giả thường trực”.
Nibaddhupaṭṭhāko nāma natthīti niyatupaṭṭhāko nāma natthi.
There is no such thing as a constant attendant means there is no fixed attendant.
“Không có người thị giả thường trực” có nghĩa là không có người thị giả cố định.
Aniyatupaṭṭhākā pana bhagavato paṭhamabodhiyaṃ bahū ahesuṃ, te dassento āha ‘‘kadāci nāgasamālatthero’’tiādi.
However, there were many non-constant attendants of the Blessed One during his first enlightenment. Showing them, it is said, " sometimes the Elder Nāgasamāla," and so on.
Để chỉ ra rằng có nhiều người thị giả không cố định của Thế Tôn vào thời kỳ giác ngộ đầu tiên, vị ấy nói: “Đôi khi là Trưởng lão Nāgasamāla” v.v.
Ñāti ca so pasatthatamaguṇayogato seṭṭho cāti ñātiseṭṭho.
He was a relative and was excellent due to his association with highly praised qualities, hence ñātiseṭṭho (foremost relative).
Vị ấy là bà con và là người tối thượng vì có phẩm hạnh cao quý nhất, nên gọi là “bà con tối thượng”.
Evarūpesu ṭhānesu ayameva patirūpoti āpadāsu āmisassa abhisaṅkharitvā dānaṃ nāma ñātakeneva kātuṃ yuttataranti adhippāyo.
In such circumstances, this one is suitable means that in times of distress, it is more fitting for a relative to prepare and give alms; this is the intention.
“Trong những trường hợp như vậy, chỉ có người này là thích hợp” có nghĩa là, khi gặp hoạn nạn, việc chuẩn bị và cúng dường vật thực chỉ thích hợp do người thân làm.
Pariyuṭṭhitacittoti pariyonaddhacitto, abhibhūtacittoti attho.
Pariyuṭṭhitacitto means one whose mind is enveloped, whose mind is overpowered.
“Tâm bị bao vây” có nghĩa là tâm bị che lấp, tâm bị áp đảo.
Āvaṭṭitapariyosāne āgamiṃsūti mārena āvaṭṭetvā gate pacchā āgamiṃsu.
They came at the end of the manipulation means they came afterwards, when Māra had manipulated and departed.
“Đến sau khi bị xoay chuyển” có nghĩa là họ đã đến sau khi bị Māra xoay chuyển và bỏ đi.
Avisahatāyāti asakkuṇeyyatāya.
Avisahatāyā means due to incapability.
“Do không thể” có nghĩa là do không có khả năng.
Abhihaṭabhikkhāyāti pacitvā abhihariyamānabhikkhāya.
Abhihaṭabhikkhāyā means almsfood brought forth after being cooked.
“Do thực phẩm khất thực được mang đến” có nghĩa là do thực phẩm khất thực được nấu chín và mang đến.
Nibaddhadānassāti ‘‘ettakaṃ kālaṃ bhagavato dassāmā’’ti niccabhattavasena paricchinditvā ṭhapitadānassa.
Nibaddhadānassā means an offering set aside with a fixed period, like "we will give to the Blessed One for this long" as a regular meal.
“Do sự cúng dường thường xuyên” có nghĩa là do sự cúng dường đã được ấn định theo kiểu cơm thường xuyên, rằng: “Chúng tôi sẽ cúng dường Thế Tôn trong khoảng thời gian này.”.
Appitavatthassāti ‘‘idaṃ buddhassa catupaccayaparibhogattha’’nti vihāraṃ netvā dinnavatthuno.
Appitavatthassā means an article offered by taking it to the monastery with the intention, "this is for the enjoyment of the four requisites by the Buddha."
“Do vật đã được dâng” có nghĩa là do vật đã được mang đến tu viện và dâng cúng với ý nghĩ: “Cái này là để Đức Phật thọ dụng tứ vật dụng.”.
Na visahatīti na sakkoti.
Na visahatī means is not able.
“Không thể” có nghĩa là không có khả năng.
Abhihaṭabhikkhāsaṅkhepenāti abhihaṭabhikkhānīhārena.
Abhihaṭabhikkhāsaṅkhepenā means by way of the semblance of almsfood brought forth.
“Do sự thu hẹp thực phẩm khất thực được mang đến” có nghĩa là do sự thiếu hụt thực phẩm khất thực được mang đến.
Byāmappabhāyāti samantato byāmamattāya pabhāya.
Byāmappabhāyā means by the radiance measuring one fathom all around.
“Do ánh sáng một sải tay” có nghĩa là do ánh sáng tỏa ra một sải tay xung quanh.
Ettha ca anubyañjanānaṃ byāmappabhāya ca nippabhākaraṇaṃ antarāyoti daṭṭhabbaṃ.
Here, it should be understood that making the minor characteristics and the one-fathom radiance appear dim is an obstruction.
Ở đây, cần hiểu rằng việc làm cho các tiểu tướng và ánh sáng một sải tay không còn rực rỡ là một chướng ngại.
Tenevāha ‘‘candimasūriyadevabrahmānampi hī’’tiādi.
Therefore, it is said, " even of the sun, moon, devas, and Brahmās," and so on.
Vì vậy, vị ấy nói: “ngay cả mặt trăng, mặt trời, chư thiên và Phạm thiên” v.v.
Anubyañjanānaṃ byāmappabhāya ekābaddhattā vuttaṃ ‘‘anubyañjanabyāmappabhāppadesaṃ patvā’’ti.
Because the minor characteristics and the one-fathom radiance are intertwined, it is said, " reaching the area of the minor characteristics and the one-fathom radiance."
Vì các tiểu tướng và ánh sáng một sải tay gắn liền với nhau, nên được nói là: “đến chỗ ánh sáng một sải tay của các tiểu tướng”.
Sabbaññutaññāṇassa antarāyo nāma ñeyyadhammesu āvaraṇaṃ.
Sabbaññutaññāṇassa antarāyo means an obstruction to the omniscient knowledge, a covering over the knowable phenomena.
“Chướng ngại đối với Tuệ Toàn Tri” có nghĩa là sự che chướng đối với các pháp cần được biết.
Assosi kho bhagavā udukkhalasaddanti kiṃ sayameva uppannaṃ udukkhalasaddaṃ assosīti ceti āha ‘‘patthapatthapulakaṃ koṭṭentāna’’ntiādi.
The Blessed One heard the sound of the mortar, so if one asks, "Did he hear the sound of the mortar that arose by itself?", it is said, " of those pounding rice husks," and so on.
“Thế Tôn đã nghe tiếng chày giã cối” – Nếu có ai hỏi: “Có phải Thế Tôn đã nghe tiếng chày giã cối tự phát sinh không?”, thì vị ấy nói: “của những người giã trấu và hạt gạo” v.v.
Atthasañhitanti payojanasādhakaṃ.
Atthasañhitaṃ means serving a purpose.
“Có lợi ích” có nghĩa là có thể mang lại mục đích.
Anatthasañhiteti anatthanissite vacane.
Anatthasañhite refers to words associated with what is not beneficial.
“Không có lợi ích” có nghĩa là lời nói không dựa trên lợi ích.
Ghātāpekkhaṃ bhummavacanaṃ.
This is a locative case (bhummavacana) expressing the sense of destruction.
Đây là từ ở thể sở thuộc (bhummavacana) mang ý nghĩa tiêu diệt (ghātāpekkhaṃ).
Yasmiñca yena ghāto nipphādīyati, tasseva tena ghāto kato nāma hotīti āha ‘‘maggeneva tādisassa vacanassa ghāto samucchedoti vuttaṃ hotī’’ti.
And indeed, when destruction is brought about in something and by something, then destruction is said to have been made of that very thing by that very thing, and so it is said, " it means that such a statement is destroyed, cut off, by the path itself."
Và vì sự tiêu diệt được thực hiện bởi con đường mà qua đó sự tiêu diệt được hoàn thành, nên vị ấy nói: “có nghĩa là sự tiêu diệt hoàn toàn của lời nói như vậy là do con đường”.
Sāmiatthe vā bhummavacananti maññamāno evamāhāti daṭṭhabbaṃ.
Or it should be understood that he spoke thus, considering it to be a locative case in the sense of possession (sāmī-attha).
Hoặc, có thể hiểu rằng vị ấy nói như vậy vì cho rằng đó là từ ở thể sở thuộc (bhummavacana) mang ý nghĩa sở hữu (sāmiatthe).
Vacanassa ca samugghāto tammūlakilesānaṃ samugghātenāti veditabbaṃ.
And the uprooting of speech should be known as the uprooting of the defilements that are its root.
Và cần biết rằng sự tiêu trừ lời nói là do sự tiêu trừ các phiền não gốc rễ của nó.
Natthi kiñci vattabbanti pubbe vuttanayattā na kiñci ettha apubbaṃ vattabbamatthīti dasseti.
“There is nothing to be said” shows that, because of having been stated previously, there is nothing new to be said here.
“Natthi kiñci vattabbaṃ” (không có gì để nói) chỉ ra rằng không có điều gì mới mẻ cần phải nói ở đây, vì đã được nói theo cách đã trình bày trước đó.
Tenāha ‘‘pubbe vuttameva hī’’tiādi.
Therefore, it says, “It is indeed what was said before,” and so on.
Do đó, nói “pubbe vuttameva hī” (quảng diễn điều đã nói trước đó) và tiếp tục.
Sādhu sādhūti idaṃ pasaṃsāyaṃ āmeḍitavacananti āha ‘‘āyasmantaṃ ānandaṃ sampahaṃsento’’ti.
“Excellent, excellent” is a word of reduplication for praise; thus, it is said, “exhilarating the Venerable Ānanda.”
“Sādhu sādhu” (lành thay, lành thay) là lời lặp lại để tán thán, do đó nói “āyasmantaṃ ānandaṃ sampahaṃsento” (làm cho Tôn giả Ānanda hoan hỷ).
Dvīsu ākāresūti dhammadesanasikkhāpadapaññattisaṅkhātesu dvīsu kāraṇesu.
“In two reasons” refers to the two reasons, namely, the teaching of the Dhamma and the promulgation of the training rule.
“Dvīsu ākāresu” (trong hai thái độ) là trong hai nguyên nhân được gọi là chế định giới điều thuyết pháp.
Ekaṃ gahetvāti dhammaṃ vā desessāmāti evaṃ vuttakāraṇaṃ gahetvā.
“Having taken one” means having taken the reason expressed as “I will teach the Dhamma.”
“Ekaṃ gahetvā” (nắm giữ một điều) là nắm giữ nguyên nhân đã được nói như vậy, rằng “chúng ta sẽ thuyết pháp”.
Evaṃdubbhikkheti evaṃ dukkhena labhitabbā bhikkhā etthāti evaṃdubbhikkhe kāle, dese vā.
“In such a famine” refers to a time or a region where alms food is hard to obtain, that is, in such a famine-stricken time or region.
“Evaṃdubbhikkhe” (trong nạn đói như vậy) là trong thời kỳ hoặc xứ sở mà việc khất thực khó khăn như vậy.
Dullabhapiṇḍeti etasseva atthadīpanaṃ.
“Alms food being hard to obtain” is an elucidation of the meaning of this very term.
“Dullabhapiṇḍe” (khó kiếm thức ăn) là sự làm rõ ý nghĩa của từ đó.
Bhājanādipariharaṇavasena bahubhaṇḍikatāya abhāvato vuttaṃ ‘‘imāya sallahukavuttitāyā’’ti.
“By such light living” is stated due to the absence of being burdened with many possessions, such as carrying bowls.
Do không có nhiều vật dụng do phải mang bát đĩa và các vật dụng khác, nên nói “imāya sallahukavuttitāyā” (với lối sống thanh đạm này).
Ettakameva alaṃ yāpetunti uttari patthanābhāvato pana ‘‘iminā ca sallekhenā’’ti vuttaṃ.
“And by such austerity” is stated due to the absence of further longing, as this much is sufficient to sustain life.
Vì không có sự mong muốn thêm nữa, nên nói “iminā ca sallekhenā” (và với sự khắc kỷ này), rằng chỉ cần chừng đó là đủ để sống qua ngày.
Dubbhikkhaṃ vijitanti ettha hi bhikkhānaṃ abhāvo dubbhikkhaṃ ‘‘nimmakkhika’’ntiādīsu viya.
In the phrase “the famine was overcome,” “famine” refers to the absence of bhikkhus, as in* “without flies.”
Trong câu “dubbhikkhaṃ vijita” (nạn đói đã được chinh phục) ở đây, “dubbhikkhaṃ” (nạn đói) có nghĩa là sự thiếu vắng Tỳ-khưu, giống như trong các từ “nimmakkhika” (không có ruồi) và tương tự.
Bhikkhābhāvoyeva hi taṃnimittacittavighātānaṃ abhāvato bhikkhūhi vijito vase vattito.
It is indeed the absence of alms food that was overcome and controlled by the bhikkhus, due to the absence of mental distress caused by that lack.
Thật vậy, sự thiếu vắng thức ăn đã được các Tỳ-khưu chinh phục, được làm cho nằm dưới sự kiểm soát của họ, do không có sự phiền não trong tâm do nguyên nhân đó.
Lobho vijitoti āmisahetu ratticchedavassacchedasamuṭṭhāpako loluppādopi tesaṃ nāhosīti āmisalolatāsaṅkhāto lobho vijito.
“Greed was overcome” means that craving for gain, which causes the breaking of the night’s retreat and the breaking of the Rains residence, did not arise for them; thus, greed, in the sense of attachment to gain, was overcome.
“Lobho vijito” (tham ái đã được chinh phục) có nghĩa là sự tham ái được gọi là sự thèm muốn vật thực đã được chinh phục, vì sự ham muốn vật thực gây ra sự cắt đêm (ratticcheda) và cắt an cư (vassaccheda) cũng không xảy ra đối với họ.
Icchācāro vijitoti ‘‘āmisahetu aññamaññassa uttarimanussadhammappakāsanavasena guṇavaṇijjaṃ katvā jīvikaṃ kappessāmā’’ti evaṃ pavattaicchācārassa abhāvato yathāvutto icchācāro vijito.
“Improper conduct was overcome” refers to the overcoming of improper conduct, such as “for the sake of gain, we will earn our livelihood by trading in qualities, proclaiming superhuman states to one another,” because such improper conduct did not arise.
“Icchācāro vijito” (hành vi tùy tiện đã được chinh phục) có nghĩa là hành vi tùy tiện đã nói trên đã được chinh phục, vì không có hành vi tùy tiện phát sinh như “chúng ta sẽ sống bằng cách buôn bán phẩm chất, bằng cách tuyên bố pháp thượng nhân của nhau vì vật thực”.
Cittuppādamattassapi anuppannabhāvaṃ sandhāya ‘‘cintā vā’’ti vuttaṃ.
“Or concern” is stated with reference to the non-arising of even a mere thought.
“Cintā vā” (hay sự lo lắng) được nói đến để chỉ trạng thái ngay cả một ý nghĩ cũng không phát sinh.
Punappunānusocanavasena pana cittapīḷāpi nāhosīti dassanatthaṃ ‘‘vighāto vā’’ti vuttaṃ.
“Or distress” is stated to show that there was no mental anguish either, due to repeated sorrowing.
“Vighāto vā” (hay sự phiền não) được nói đến để chỉ rằng ngay cả sự phiền não trong tâm do lo âu lặp đi lặp lại cũng không xảy ra.
Ratticchedo vāti sattāhakaraṇīyavasena gantvā bahi aruṇuṭṭhāpanavasena ratticchedo vā na kato sattāhakiccavasenapi katthaci agatattā.
“Or breaking of the night’s retreat” means that no breaking of the night’s retreat was made by going outside for a seven-day commitment and letting the dawn break, because they did not go anywhere even for a seven-day commitment.
“Ratticchedo vā” (hay sự cắt đêm) có nghĩa là không có sự cắt đêm bằng cách đi ra ngoài và để bình minh ló dạng, vì không đi đến bất cứ nơi nào vì công việc bảy ngày.
Sattāhakiccavasena vippavāsañhi sandhāya ratticchedoti aṭṭhakathāvohāro, tatoyeva ca vassūpanāyikakkhandhakavaṇṇanāyaṃ (mahāva. aṭṭha. 199) ‘‘ayaṃ panettha pāḷimuttakaratticchedavinicchayo’’ti vatvā ‘‘dhammassavanatthāya animantitena gantuṃ na vaṭṭatī’’tiādinā sattāhakaraṇīyameva vibhattaṃ.
The term ‘breaking of the night’s retreat’ in the commentaries refers to dwelling away* for a seven-day commitment. And it is in the Commentary on the Khandhaka on Entering the Rains Residence that, after stating “This is the Vinaya decision on breaking of the night’s retreat outside the Pāli,” the seven-day commitment is explained by “it is not allowable to go without an invitation to hear the Dhamma,” and so on.
Thật vậy, thuật ngữ “ratticcheda” (cắt đêm) trong các bộ chú giải là để chỉ sự vắng mặt qua đêm vì công việc bảy ngày, và chính từ đó, trong Vassūpanāyikakkhandhakavaṇṇanā (Chú giải về phẩm An cư mùa mưa), sau khi nói “Đây là sự phân định về ratticcheda không có trong Pāḷi”, đã phân loại công việc bảy ngày bằng cách nói “không nên đi để nghe pháp nếu không được mời” và tương tự.
Mahāaṭṭhakathāyampi vuttaṃ ‘‘sattāhakiccena gantvā ekabhikkhunāpi ratticchedo vā na kato’’ti.
It is also stated in the Mahāaṭṭhakathā: “Not even one bhikkhu broke the night’s retreat or the Rains residence by going for a seven-day commitment.”
Trong Mahāaṭṭhakathā (Đại Chú giải) cũng nói: “Ngay cả một Tỳ-khưu cũng không cắt đêm hay cắt an cư vì công việc bảy ngày”.
Evañca katvā ratticchedo nāma sattāhakaraṇīyavasena hoti, na aññathāti ratticchedalakkhaṇañca kathitanti daṭṭhabbaṃ.
Having established this, it should be understood that the characteristic of breaking the night’s retreat is by way of a seven-day commitment, and not otherwise; thus, the definition of breaking the night’s retreat is also stated.
Và như vậy, ratticcheda chỉ xảy ra vì công việc bảy ngày, không phải vì lý do khác, và đặc điểm của ratticcheda cũng đã được nói đến, nên cần phải hiểu như vậy.
Ettha ca paccayavekallasaṅkhāte vassacchedakāraṇe sati ratticchedassapi vuttattā yattha vassacchedakāraṇaṃ labbhati, tattha sattāhakiccena gantumpi vaṭṭatīti siddhanti cūḷagaṇṭhipade majjhimagaṇṭhipade ca vuttaṃ, taṃ suvuttaṃ vassūpanāyikakkhandhake vassacchedādhikāre –
And here, since the breaking of the night’s retreat is also mentioned when there is a reason for breaking the Rains residence (namely, the lack of requisites), it is established that it is allowable to go for a seven-day commitment where there is a reason for breaking the Rains residence, as stated in the Cūḷagaṇṭhipada and Majjhimagaṇṭhipada, and this is well-said in the section on breaking the Rains residence in the Vassūpanāyika-khandhaka—
Và ở đây, vì ratticcheda cũng được nói đến khi có nguyên nhân cắt an cư (vassaccheda) được gọi là sự thiếu thốn vật chất, nên điều này được chứng minh là được phép đi làm công việc bảy ngày khi có nguyên nhân cắt an cư, như đã nói trong Cūḷagaṇṭhipada và Majjhimagaṇṭhipada, điều đó đã được nói rất đúng trong phần về cắt an cư của Vassūpanāyikakkhandhaka:
Ettha ‘‘sace gāmo avidūragato hoti, tattha piṇḍāya caritvā vihārameva āgantvā vasitabbaṃ.
—this is corroborated by the commentary’s statement: “If the village is not far, one should go there for alms, return to the monastery, and reside. If it is far, one should let dawn break for a seven-day period. If that is not possible, one should reside in a suitable place there.”
Điều này cũng phù hợp với lời chú giải: “Nếu ngôi làng không quá xa, thì nên đi khất thực ở đó và trở về trú xứ để ở.
Sace dūragato, sattāhavārena aruṇo uṭṭhāpetabbo.
If it is far away, the dawn should be made to rise by means of the seven-day rule.
Nếu xa, thì nên để bình minh ló dạng sau bảy ngày.
Na sakkā ce hoti, tattheva sabhāgaṭṭhāne vasitabba’’nti (mahāva. aṭṭha. 201) iminā aṭṭhakathāvacanenapi saṃsandanato.
If this is not possible, one should stay right there in a suitable place," because it is consistent also with this statement from the commentary.
Nếu không thể, thì nên ở tại một nơi thích hợp ở đó” (Mahāva. aṭṭha. 201).
Tathā hi gāme vuṭṭhite bhikkhāya abhāvato vassacchedepi anāpattiṃ vadantena bhagavatā ‘‘anujānāmi, bhikkhave, yena gāmo tena gantu’’nti (mahāva. 201) vuttattā bhikkhāya abhāvo vassacchedakāraṇaṃ.
Indeed, when a village is pillaged, due to the lack of alms food, the Blessed One, in declaring non-offence even in the case of breaking the Rains residence, stated: “I allow, bhikkhus, to go to that village.” Thus, the lack of alms food is a reason for breaking the Rains residence.
Thật vậy, vì Đức Thế Tôn đã nói “Này các Tỳ-khưu, Ta cho phép các ông đi đến ngôi làng đó” (Mahāva. 201) khi nói về việc không phạm lỗi ngay cả khi cắt an cư do thiếu thức ăn khi làng bị cướp phá, nên sự thiếu vắng thức ăn là nguyên nhân của việc cắt an cư.
Tattha ‘‘sace dūragato, sattāhavārena aruṇo uṭṭhāpetabbo’’ti (mahāva. aṭṭha. 201) idaṃ aṭṭhakathāvacanaṃ vassacchedakāraṇe sati sattāhakiccena gantumpi vaṭṭatīti imamatthaṃ sādheti.
The commentary’s statement, “If it is far, one should let dawn break for a seven-day period,” in that context, proves that it is allowable to go for a seven-day commitment even when there is a reason for breaking the Rains residence.
Ở đó, lời chú giải “Nếu xa, thì nên để bình minh ló dạng sau bảy ngày” (Mahāva. aṭṭha. 201) chứng minh rằng khi có nguyên nhân cắt an cư, thì cũng được phép đi làm công việc bảy ngày.
Taṃ pana sayaṃ sammūḷhassa paresaṃ mohuppādanamattaṃ.
—that statement, however, is merely to confuse others, coming from one who is himself confused.
Điều đó chỉ là sự gây hoang mang cho người khác của một người tự mình đã hoang mang.
Na hi vinayadharānaṃ anicchāya kāraṇaṃ dissati aṭṭhakathāya virujjhanato yuttiabhāvato ca.
Indeed, no reason is apparent for the disagreement of the Vinaya-holders, as it contradicts the commentaries and lacks justification.
Thật vậy, không thấy có lý do gì cho sự không chấp nhận của các bậc trì luật, vì nó mâu thuẫn với chú giải và thiếu tính hợp lý.
Yañhi kāraṇaṃ vassacchedepi anāpattiṃ sādheti, tasmiṃ sati vinā vassacchedaṃ sattāhakiccena gantuṃ na vaṭṭatīti kā nāma yutti.
For what justification is there to say that when a reason exists that justifies non-offence even in the case of breaking the Rains residence, it is not allowable to go for a seven-day commitment without breaking the Rains residence?
Thật vậy, khi có nguyên nhân biện minh cho việc không phạm lỗi ngay cả khi cắt an cư, thì có lý do gì để nói rằng không được phép đi làm công việc bảy ngày mà không cắt an cư?
‘‘Pacchimikāya tattha vassaṃ upagacchāmā’’ti idaṃ tesaṃ bhikkhūnaṃ anurūpaparivitakkanapaadīpanaṃ, na pana visesatthaparidīpanaṃ.
“We will enter the Rains residence there in the later period”—this is a clarification of their appropriate reflection, not a clarification of a special meaning.
Lời nói “chúng ta sẽ an cư mùa mưa ở đó vào mùa sau” là để chỉ sự suy tư phù hợp của các Tỳ-khưu đó, chứ không phải để làm rõ một ý nghĩa đặc biệt.
Tathā hi dubbhikkhatāya vassacchedakaraṇasabbhāvato purimikāya tāva vassacchedepi anāpatti.
Indeed, due to the existence of a reason for breaking the Rains residence (due to famine), there is no offence for breaking the Rains residence during the early period.
Thật vậy, do có nguyên nhân cắt an cư vì nạn đói, nên không phạm lỗi ngay cả khi cắt an cư vào mùa trước.
Pacchimikāyaṃ anupagantukāmatāya gamanepi natthi doso pacchimikāya vassūpanāyikadivasassa asampattabhāvato.
Even if one goes with the intention of not entering the Rains residence in the later period, there is no fault, because the day for entering the Rains residence in the later period has not yet arrived.
Cũng không có lỗi khi đi vào mùa sau do không muốn an cư vào mùa sau, vì ngày an cư mùa mưa của mùa sau chưa đến.
Kiṃ idanti garahaṇavasena vuttaṃ.
“What is this?” is said by way of reproach.
“Kiṃ idaṃ” (điều gì đây?) được nói ra với ý nghĩa khiển trách.
Sālitaṇḍulehi sampāditaṃ maṃsena upasittaṃ odanaṃ sālimaṃsodanaṃ.
Rice prepared with Sāli grains and mixed with meat is Sālimaṃsodana (rice with Sāli grains and meat).
Cơm được làm từ gạo lúa sāli, trộn với thịt, được gọi là sālimaṃsodanaṃ (cơm thịt lúa sāli).
Atimaññissatīti avaññātakaraṇavasena atikkamitvā maññissati, lāmakaṃ nihīnaṃ katvā maññissatīti vuttaṃ hoti.
“Will despise” means will think of it as inferior by way of disrespect; it means will consider it poor and lowly.
“Atimaññissati” (sẽ coi thường) có nghĩa là sẽ coi thường, sẽ vượt qua bằng cách làm cho nó trở nên thấp kém, hạ tiện.
Tenāha ‘‘oññātaṃ avaññātaṃ karissatī’’ti.
Therefore, he said, "he will treat it as something known contemptuously, with disdain."
Vì vậy,* đã nói: ‘‘sẽ làm cho bị khinh miệt, bị coi thường’’.
Heṭṭhā katvā nihīnaṃ katvā ñātaṃ oññātaṃ.
Something known by making it lower, by making it inferior, is oññātaṃ.
Khi hạ thấp, làm cho thấp kém rồi được biết đến, đó là oññātaṃ (bị khinh miệt).
Avaññātanti tasseva vevacanaṃ.
Avaññātaṃ is a synonym for that very word.
Avaññātaṃ là từ đồng nghĩa của từ đó.
Svāyanti so ayaṃ janapado.
Svāyaṃ means this very country.
Svāyaṃ có nghĩa là xứ sở này.
Imāya paṭipattiyāti verañjāyaṃ pūritāya sudukkarāya paṭipattiyā.
By this practice means by the very difficult practice fulfilled in Verañjā.
Imāya paṭipattiyā có nghĩa là với sự thực hành vô cùng khó khăn đã được hoàn thành ở Verāñjā.
Tumhe nissāyāti tumhākaṃ imaṃ appicchapaṭipadaṃ nissāya.
Depending on you means: depending on this, your practice of having few wishes.
Tumhe nissāya có nghĩa là nương tựa vào sự thực hành ít dục vọng này của quý vị.
Sabrahmacārīsaṅkhātāti chabbaggiyādayo vuttā.
Designated as fellow-monks: the group-of-six monks and others are spoken of.
Sabrahmacārīsaṅkhātā là chỉ cho nhóm sáu Tỳ-kheo (Chabbaggiyā) và những người khác.
Tumhākaṃ antare nisīditvāti tumhākaṃ majjhe nisīditvā, tumhehi saddhiṃ nisīditvāti vuttaṃ hoti.
Having sat in your midst means: having sat in the middle of you; it means having sat together with you.
Tumhākaṃ antare nisīditvā có nghĩa là ngồi giữa quý vị, tức là ngồi cùng với quý vị.
Omānanti atimānaṃ.
Omāna means: conceit.
Omānaṃ có nghĩa là atimānaṃ (kiêu mạn quá mức).
Atimānoyeva hettha nihīnatāya ‘‘omāna’’nti vutto, na pana hīḷetvā maññanaṃ.
Herein, it is only conceit due to inferiority that is called "omāna," not the thinking that belittles.
Ở đây, kiêu mạn quá mức được gọi là ‘‘omānaṃ’’ vì sự thấp kém, chứ không phải là sự coi thường.
Tumhehi, ānanda, sappurisehi vijitaṃ sālimaṃsodanaṃ pacchimā janatā atimaññissatīti evamettha pāḷiṃ yojetvā atthaṃ vaṇṇayanti.
They explain the meaning by connecting the Pali text here in this way: "O Ānanda, the future generation will look down on the sālimaṃsodana conquered by you, the good men."
Ở đây, họ giải thích ý nghĩa bằng cách sắp xếp câu Pāḷi như sau: “Hỡi Ānanda, những người cuối cùng sẽ coi thường món cơm với thịt lúa sāli mà quý vị, những bậc thiện nhân, đã chiến thắng.”
Idaṃ vuttaṃ hoti – yaṃ laddhaṃ, teneva tussitvā sālimaṃsodanapatthanāya chinnattā ca tumhehi vijitaṃ abhibhūtaṃ sālimaṃsodanaṃ pacchimā janatā tattha patthanaṃ chindituṃ asamatthatāya atimaññissatīti.
This is what is meant: The sālimaṃsodana which was conquered and overcome by you—because you were content with whatever was received and had cut off the desire for sālimaṃsodana—the future generation, due to their inability to cut off that desire, will hold it in high esteem.
Ý nghĩa của câu này là: “Vì quý vị đã hài lòng với những gì đã nhận được và đã từ bỏ sự mong cầu cơm với thịt lúa sāli, nên những người cuối cùng sẽ coi thường món cơm với thịt lúa sāli mà quý vị đã chiến thắng, vì họ không thể từ bỏ sự mong cầu đó.”
17. Āyasmāti vā devānaṃpiyāti vā bhadrabhavanti vā piyasamudācāro esoti āha ‘‘āyasmāti piyavacanameta’’nti.
17. "Venerable sir," "beloved of the devas," or "good sir"—this is a term of endearment. Therefore, he said: "Venerable sir" is a term of endearment.
Vì ‘‘Āyasmā’’ (Đại đức), ‘‘devānaṃpiya’’ (được chư thiên yêu mến) hay ‘‘bhadrabhava’’ (ngài đáng kính) là những cách xưng hô thân mật, nên* nói: ‘‘Āyasmā là lời thân ái’’.
Viññujātikā hi paraṃ piyena samudācarantā ‘‘bhava’’nti vā ‘‘devānaṃpiyā’’ti vā ‘‘āyasmā’’ti vā samudācaranti, tasmā sammukhā sambodhanavasena āvusoti, tirokkhaṃ āyasmāti ayampi samudācāro.
Indeed, those of a wise nature, when addressing another with affection, address them as "good sir," "beloved of the devas," or "venerable sir." Therefore, this is also the mode of address: "friend" when addressing someone present, and "venerable sir" when referring to someone absent.
Quả thật, những người có trí khi xưng hô với người khác một cách thân ái, họ xưng hô là ‘‘bhava’’ (ngài), ‘‘devānaṃpiyā’’ (được chư thiên yêu mến) hoặc ‘‘Āyasmā’’ (Đại đức). Vì vậy, cách xưng hô trực tiếp là ‘‘āvuso’’ (này hiền giả), còn cách xưng hô gián tiếp là ‘‘Āyasmā’’ (Đại đức) cũng là một cách xưng hô thân ái.
Tayidaṃ piyavacanaṃ garugāravasappatissavasena vuccatīti āha ‘‘garugāravasappatissādhivacanameta’’nti.
This term of endearment is spoken with esteem, reverence, and deference. Therefore, he said: This is a term of esteem, reverence, and deference.
Vì lời thân ái này được nói với thái độ tôn kính và kính trọng, nên* nói: ‘‘Đó là một từ biểu thị sự tôn kính và kính trọng’’.
Guṇamahattatāya mahāmoggallāno, na cūḷamoggallānassa atthitāyāti āha ‘‘mahā ca so guṇamahantatāyā’’ti.
He is Mahāmoggallāna due to the greatness of his qualities, not because there was a Cūḷamoggallāna. Therefore, he said: He is great due to the greatness of his qualities.
Vì Đại Mục-kiền-liên vĩ đại do có nhiều đức hạnh, chứ không phải do có Tiểu Mục-kiền-liên, nên* nói: ‘‘Ngài vĩ đại do có nhiều đức hạnh’’.
Pappaṭakojanti pathavīsandhārakaṃ udakaṃ āhacca ṭhite mahāpathaviyā heṭṭhimatale samuṭṭhitaṃ udakoghena ajjhotthaṭe bhūmippadese sañjātakaddamapaṭalasadisaṃ atimadhurapathavīmaṇḍaṃ.
Pappaṭakoja means: the exceedingly sweet earth-essence that arises on the lowest level of the great earth, which stands touching the water that supports the earth, similar to a layer of mud formed in a land-area inundated by a flood of water.
Pappaṭakojaṃ là lớp đất mặt rất ngọt, giống như lớp bùn được hình thành trên vùng đất bị dòng nước lũ bao phủ, phát sinh ở tầng dưới cùng của đại địa, nơi nước giữ đất đã chạm đến và đứng yên.
Na me taṃ assa patirūpanti taṃ anāpucchā karaṇaṃ na me anucchavikaṃ bhaveyyāti attho.
That would not be proper for me means: that act of not asking would not be suitable for me.
Na me taṃ assa patirūpaṃ có nghĩa là việc làm mà không hỏi ý kiến đó không phù hợp với tôi.
Anāpucchā karontena ca yathā bhagavā icchiticchitaṃ kiñci anāpucchā karoti, evamahampīti bhagavatā samānaṃ katvā attānaṃ mānena kataṃ viya bhavissatīti āha ‘‘yugaggāho viya bhagavatā saddhiṃ kato bhaveyyā’’ti.
And by acting without asking, it would be as if I acted out of pride, making myself equal to the Blessed One, thinking, "Just as the Blessed One does whatever he wishes without asking, so too will I." Therefore, he said: It would be as if I had engaged in putting myself on a par with the Blessed One.
Vì khi làm mà không hỏi ý kiến, thì sẽ giống như việc tự cho mình ngang hàng với Đức Phật, rằng: “Như Đức Phật làm bất cứ điều gì Ngài muốn mà không cần hỏi ý kiến, thì tôi cũng vậy”, điều này được thực hiện với sự kiêu mạn, nên* nói: ‘‘Sẽ giống như đã đặt mình ngang hàng với Đức Phật’’.
Parena hi saddhiṃ attānaṃ yugaṃ yugaḷaṃ samānaṃ katvā gāho, tassa mama vā ko visesoti gahaṇaṃ yugaggāho.
The act of making oneself equal—a yoke, a pair—with another is a yugaggāha; the grasping of "what is the difference between him and me?" is a yugaggāha.
Yugaggāho là việc tự cho mình ngang hàng, tương đương với người khác, tức là chấp nhận rằng: “Người đó và tôi có gì khác nhau?”
Idaṃ paripuṇṇasampannaṃ nāma.
This is called complete-endowment.
Đây được gọi là hoàn toàn đầy đủ (paripuṇṇasampannaṃ).
Paripuṇṇampi hi samantato pannaṃ pattanti sampannanti vuccati.
For what is complete (paripuṇṇa) is also said to be endowed (sampanna) because it has come to be (pannaṃ), has been attained (pattaṃ), on all sides.
Quả thật, cái gì đã hoàn toàn đạt được từ mọi phía cũng được gọi là sampannaṃ (đầy đủ).
‘‘Iminā pātimokkhasaṃvarena upeto hoti samupeto upagato samupagato sampanno samannāgato’’ti (vibha. 511) idaṃ samaṅgīsampannaṃ nāma.
“He is endowed (upeto), possessed (samupeto), has come to be (upagato), attained (samupagato), perfected (sampanno), furnished (samannāgato) with this restraint of the Pātimokkha” – this is called possessed-endowment.
‘‘Vị ấy được trang bị, được trang bị đầy đủ, được đạt đến, được đạt đến đầy đủ, được đầy đủ, được sở hữu với giới luật Pātimokkha này’’ – đây được gọi là đầy đủ hài hòa (samaṅgīsampannaṃ).
Samaṅgīpi hi sammadeva panno gato upagatoti sampannoti vuccati.
For what one is possessed of (samaṅgī) is also said to be endowed (sampanno) because it has rightly come to be (panno), been attained (gato, upagato).
Quả thật, cái gì đã đạt được, đã đi đến, đã đến một cách hài hòa cũng được gọi là sampannaṃ (đầy đủ).
‘‘Tatrassa rukkho sampannaphalo ca upapannaphalo cā’’ti (ma. ni. 2.48) idaṃ madhurasampannaṃ nāma.
“Therein the tree would have endowed fruit and would have abundant fruit” – this is called sweet-endowment.
‘‘Ở đó, cây có quả ngọt ngào và có nhiều quả’’ – đây được gọi là đầy đủ ngọt ngào (madhurasampannaṃ).
Tattha madhurasampannaṃ idhādhippetanti veditabbaṃ.
Therein, it should be understood that sweet-endowment is intended here.
Trong đó, cần hiểu rằng ở đây ý muốn nói đến sự đầy đủ ngọt ngào.
Upapannaphaloti bahuphalo.
Abundant fruit means: much fruit.
Upapannaphalo có nghĩa là có nhiều quả.
Assāti pathaviyā heṭṭhimatalassa.
Its means: of the earth's lowest level.
Assā có nghĩa là của tầng dưới cùng của mặt đất.
Opammanidassanatthanti upamāya nidassanatthaṃ.
For the purpose of showing a comparison means: for showing by way of comparison.
Opammanidassanatthaṃ có nghĩa là để minh họa bằng ví dụ.
Anīḷakanti niddosaṃ.
Faultless means: without defect.
Anīḷakaṃ có nghĩa là không có lỗi.
Niddosatā cettha makkhikādirahitatāyāti āha ‘‘nimmakkhika’’ntiādi.
And here, faultlessness is due to the absence of flies and so on. Therefore, he said: Free from flies, and so on.
Và ở đây, sự không có lỗi là do không có ruồi, v.v., nên* nói: ‘‘nimmakkhikaṃ’’ (không có ruồi) v.v.
Natthi ettha makkhikāti nimmakkhikaṃ.
There are no flies in it, thus it is free from flies.
Không có ruồi ở đây, nên gọi là nimmakkhikaṃ (không ruồi).
Makkhikāsaddena cettha makkhikaṇḍakampi sāmaññato gahitanti vadanti.
And they say that by the word "fly," fly-eggs are also generally included.
Họ nói rằng ở đây, từ makkhikā (ruồi) cũng được hiểu chung là bao gồm cả trứng ruồi (makkhikaṇḍakaṃ).
Teneva tīsupi gaṇṭhipadesu vuttaṃ ‘‘nimmakkhikanti imassevatthaṃ pakāsetuṃ nimmakkhikaṇḍakanti vuttaṃ, makkhikāhi tāsaṃ aṇḍakehi ca virahitanti attho’’ti.
For that very reason, it is said in all three texts: "To clarify the meaning of 'free from flies,' 'free from fly-eggs' is said; the meaning is: devoid of flies and their eggs."
Vì vậy, trong ba vị trí nút thắt cũng đã nói: ‘‘Nimmakkhikaṇḍakaṃ được nói để làm rõ ý nghĩa của từ nimmakkhikaṃ, có nghĩa là không có ruồi và trứng của chúng’’.
Ayaṃ panettha amhākaṃ khanti ‘‘makkhikānaṃ aṇḍāni makkhikaṇḍāni, natthi ettha makkhikaṇḍānīti nimmakkhikaṇḍanti.
Herein, this is our opinion: "The eggs of flies are fly-eggs; there are no fly-eggs in it, thus it is free from fly-eggs."
Đây là quan điểm của chúng tôi về vấn đề này: ‘‘Trứng của ruồi là makkhikaṇḍāni (trứng ruồi). Không có trứng ruồi ở đây, nên gọi là nimmakkhikaṇḍaṃ (không trứng ruồi).’’
Iminā makkhikānaṃ aṇḍehi rahitatā vuttā, ‘nimmakkhika’nti iminā pana makkhikānaṃyeva abhāvo vutto’’ti.
By this, the absence of flies' eggs is stated; but by 'free from flies,' the absence of the flies themselves is stated.
Với điều này, sự không có trứng ruồi được nói đến, còn với ‘‘nimmakkhikaṃ’’, sự không có ruồi được nói đến.
Etaṃ kira madhūti khuddakamakkhikāhi katamadhu.
This honey, it seems, means: honey made by small bees.
Etaṃ kira madhu có nghĩa là mật ong do những con ong nhỏ làm ra.
Sabbamadhūhīti mahāmakkhikabhamaramakkhikādikatehi.
Than all honeys means: than those made by large bees, bumblebees, and so on.
Sabbamadhūhi có nghĩa là hơn tất cả các loại mật ong do ong lớn, ong vò vẽ, v.v., làm ra.
Agganti uttamaṃ.
Highest means: supreme.
Aggaṃ có nghĩa là tối thượng.
Seṭṭhanti pasatthatamaṃ.
Best means: most excellent.
Seṭṭhaṃ có nghĩa là đáng ca ngợi nhất.
Surasanti sobhanarasaṃ.
Delicious means: of excellent taste.
Surasaṃ có nghĩa là có hương vị tốt.
Ojavantanti accantamojasampannaṃ.
Nutritious means: possessed of extreme nutritional essence.
Ojavantaṃ có nghĩa là vô cùng bổ dưỡng.
Āyācanavacanametanti iminā sampaṭicchanasampahaṃsanādiatthaṃ nivatteti.
This is a statement of request: by this, he negates the meaning of acceptance, praise, and so on.
Với điều này,* bác bỏ ý nghĩa của sự chấp thuận, sự hoan hỷ, v.v., khi nói: ‘‘Đây là lời cầu xin’’.
Ekaṃ hatthanti ekaṃ pāṇitalaṃ.
One hand means: one palm.
Ekaṃ hatthaṃ có nghĩa là một lòng bàn tay.
‘‘Abhinimminissāmī’’ti vuttamatthaṃ pakāsetuṃ ‘‘pathavīsadisaṃ karissāmī’’ti vuttaṃ.
To clarify the meaning of what was said by "I will create", it was said: "I will make it like the earth."
Để làm rõ ý nghĩa của câu ‘‘Abhinimminissāmī’’ (Tôi sẽ tạo ra),* đã nói: ‘‘pathavīsadisaṃ karissāmī’’ (Tôi sẽ làm cho nó giống như đất).
Ayaṃ nu kho pathavī, udāhu na ayanti iminā nimmitapathaviyā pakatipathaviyā ca sandissamānattā ‘‘esā nu kho amhākaṃ pathavī, udāhu aññā’’ti uppajjamānakukkuccaṃ dasseti.
Is this the earth, or is it not? By this, he shows the doubt that would arise, "Is this our earth, or is it another?", because the created earth and the natural earth would look alike.
Với câu ‘‘Ayaṃ nu kho pathavī, udāhu na ayaṃ’’ (Đây có phải là đất không, hay không phải là đất này?),* chỉ ra sự nghi ngờ phát sinh khi đất được tạo ra và đất tự nhiên cùng xuất hiện, khiến họ tự hỏi: ‘‘Đây có phải là đất của chúng ta, hay là một loại đất khác?’’
Nibaddhavipulāgamo gāmo nigamo, pavattitamahāāyo mahāgāmoti vuttaṃ hoti.
A village with constant, abundant coming and going is a market town; it means a large village with great and continuous revenue.
Một ngôi làng có sự phát triển rộng lớn liên tục được gọi là nigamo (thị trấn); tức là một ngôi làng lớn có nhiều thu nhập được tạo ra.
Na vā esa vipallāsoti pubbapakkhaṃ nidasseti.
Or is this no delusion? indicates the first position.
Na vā esa vipallāso (Hay sự sai lệch đó không có?) là để chỉ ra mặt trước của vấn đề.
Kasmā panesa vipallāso na hotīti āha ‘‘acinteyyo hi iddhimato iddhivisayo’’ti.
But why would this not be a delusion? He said: For the domain of psychic power of one with psychic power is inconceivable.
Vì sao sự sai lệch này không xảy ra?* nói: ‘‘Phạm vi thần thông của bậc có thần thông là không thể nghĩ bàn’’.
Iddhibaleneva tesaṃ sattānaṃ tādiso vipallāso na bhavissatīti adhippāyo.
The intention is that, through the power of psychic ability itself, such a delusion would not occur for those beings.
Ý nghĩa là: do năng lực thần thông, sự sai lệch như vậy sẽ không xảy ra đối với những chúng sinh đó.
Idāni aññathā vipallāsappaṭilābhaṃ dassento āha ‘‘evaṃ panā’’tiādi.
Now, showing the acquisition of delusion in another way, he said: However, in this way, and so on.
Bây giờ, để chỉ ra sự nhận thức sai lệch theo cách khác,* nói: ‘‘evaṃ panā’’ (và như vậy) v.v.
Garahantāti sammukhā garahantā.
Reproaching means: reproaching in their presence.
Garahantā có nghĩa là quở trách trực tiếp.
Upavadantāti parammukhā akkosantā.
Speaking against means: reviling in their absence.
Upavadantā có nghĩa là chửi rủa sau lưng.
Nanu ca uttarakuruṃ piṇḍāya gamanaṃ paṭisedhetvā vipallāsampi sattā paṭilabheyyunti kāraṇaṃ na vuttaṃ, tasmā kimettha kāraṇanti āha ‘‘tattha kiñcāpī’’tiādi.
But was not the reason given for why, after prohibiting going to Uttarakuru for alms, beings might still acquire a delusion? Therefore, what is the reason here? He said: Therein, although, and so on.
Chẳng phải đã không nói lý do vì sao việc đi khất thực đến Uttarakuru bị cấm và chúng sinh có thể nhận được sự sai lệch sao? Vì vậy, lý do ở đây là gì?* nói: ‘‘Tattha kiñcāpī’’ (Mặc dù ở đó) v.v.
Yadipi na vuttaṃ, tathāpi ‘‘vipallāsampi sattā paṭilabheyyu’’nti pubbe adhikatattā teneva kāraṇena piṇḍāya uttarakurugamanampi bhagavatā paṭisiddhanti viññāyati, tasmā tadeva kāraṇaṃ idhāpi gahetabbanti dassento āha ‘‘pubbe vuttanayeneva gahetabba’’nti.
Although it was not stated, nevertheless, because it was mentioned before that "beings might acquire a delusion," it is understood that for that same reason, going to Uttarakuru for alms was also prohibited by the Blessed One. Therefore, showing that the same reason should be taken here as well, he said: It should be understood in the same way as stated before.
Mặc dù không được nói rõ, nhưng vì trước đó đã đề cập rằng ‘‘chúng sinh có thể nhận được sự sai lệch’’, nên người ta hiểu rằng chính vì lý do đó mà Đức Phật đã cấm việc đi khất thực đến Uttarakuru. Vì vậy, để chỉ ra rằng chính lý do đó cũng cần được chấp nhận ở đây,* nói: ‘‘Nên được chấp nhận theo cách đã nói trước đó’’.
Vipallāsampi sattā paṭilabheyyunti idaṃ idha avuttampi ānetvā sambandhitabbanti adhippāyo.
The intention is that this phrase, "beings might acquire a delusion", though not stated here, should be brought in and connected.
Ý muốn nói rằng, câu " Vipallāsampi sattā paṭilabheyyu" (ngay cả chúng sinh cũng có thể bị sai lệch) này, dù không được nói đến ở đây, cũng nên được đưa vào và liên kết. Đó là ý nghĩa.
Atthopi cassa vuttasadisameva veditabboti.
And its meaning should be understood as similar to what was said.
Và ý nghĩa của nó cũng nên được hiểu tương tự như những gì đã được nói.
‘‘Evaṃ pana vipallāsaṃ paṭilabheyyu’’ntiādinā pacchā vuttameva atthavikappaṃ sandhāya vadati.
He speaks with reference to the alternative meaning stated later by "However, in this way they would acquire a delusion," and so on.
Nó đề cập đến một ý nghĩa khác đã được nói đến sau này, bắt đầu bằng câu "Như vậy, họ có thể bị sai lệch."
Yaṃ pana tattha vuttaṃ ‘‘te guṇe nibbattetvā dubbhikkhakāle pathaviṃ parivattetvā pappaṭakojaṃ paribhuñjiṃsū’’ti, taṃ apanetvā te guṇe nibbattetvā dubbhikkhakāle uttarakuruṃ gantvā piṇḍāya caritvā paribhuñjiṃsūti evamettha yojanā kātabbā.
As for the statement made there, “Having produced those qualities, in a time of famine, they transformed the earth and consumed the essence of the soil,” having set that aside, the construction here should be made thus: “Having produced those qualities, in a time of famine, they went to Uttarakuru, wandered for alms, and consumed.”
Tuy nhiên, câu đã được nói ở đó là "họ đã tạo ra những phẩm chất đó, rồi trong thời kỳ đói kém, họ đã đảo lộn đất đai và ăn chất bọt từ đất," thì nên loại bỏ câu đó và thay vào đó, nên giải thích ở đây rằng "họ đã tạo ra những phẩm chất đó, rồi trong thời kỳ đói kém, họ đã đi đến Uttarakuru, khất thực và thọ dụng."
Ekena padavītihārenāti ettha padassa vītiharaṇaṃ nikkhipanaṃ padavītihāro, padanikkhepo, tasmā ekena padanikkhepenāti vuttaṃ hoti.
Here, in the phrase by one step, the carrying forward or placing of the foot is padavītihāro, the placing of the foot. Therefore, it means by one placing of the foot.
Trong cụm từ " Ekena padavītihārenā" (bằng một bước chân), padavītihāro có nghĩa là nikkhipanaṃ (đặt xuống) một bước chân, tức là padanikkhepo (bước chân). Do đó, có nghĩa là "bằng một bước chân."
Ekena padavītihārena atikkamitabbaṭṭhānañca samagamanena dvinnaṃ padānaṃ antare muṭṭhiratanamattaṃ, tasmā.
By one step to be crossed and by walking in unison, the space between two feet is the measure of a fist-span, therefore.
Và nơi cần vượt qua bằng một bước chân là khoảng cách bằng một nắm ngọc giữa hai bước chân khi đi đều, do đó.
Mātikāmattaṃ adhiṭṭhahitvāti muṭṭhiratanappamāṇaṃ mātikāmattaṃ adhiṭṭhāyāti attho.
Having determined the measure of a small channel means having determined the measure of a small channel, which is the size of a fist-span.
" Mātikāmattaṃ adhiṭṭhahitvā" có nghĩa là "sau khi xác định một rãnh nhỏ có kích thước bằng một nắm ngọc."
‘‘Ko nu kho, bhante, hetu, ko paccayo, yena pubbe appatarāni ceva sikkhāpadāni ahesuṃ, bahutarā ca bhikkhū aññāya saṇṭhahiṃsu.
“What, venerable sir, is the reason, what is the cause, why formerly there were fewer training rules, yet more bhikkhus were established in final knowledge?
"Bạch Thế Tôn, nguyên nhân nào, duyên cớ nào mà trước đây các giới luật ít hơn, và các Tỷ-kheo thành tựu chánh trí nhiều hơn?
Ko pana, bhante, hetu, ko paccayo, yena etarahi bahutarāni ceva sikkhāpadāni honti, appatarā ca bhikkhū aññāya saṇṭhahantīti.
What, venerable sir, is the reason, what is the cause, why now there are more training rules, yet fewer bhikkhus are established in final knowledge?
Bạch Thế Tôn, nguyên nhân nào, duyên cớ nào mà bây giờ các giới luật nhiều hơn, và các Tỷ-kheo thành tựu chánh trí ít hơn?"
Evametaṃ, bhaddāli, hoti, sattesu hāyamānesu saddhamme antaradhāyamāne bahutarāni ceva sikkhāpadāni honti, appatarā ca bhikkhū aññāya saṇṭhahantīti.
It is just so, Bhaddāli. When beings are degenerating and the true Dhamma is disappearing, there are more training rules, and fewer bhikkhus are established in final knowledge.
"Này Bhaddāli, đúng là như vậy. Khi chúng sinh suy đồi, khi Chánh Pháp biến mất, các giới luật sẽ nhiều hơn, và các Tỷ-kheo thành tựu chánh trí sẽ ít hơn."
Na tāva, bhaddāli, satthā sāvakānaṃ sikkhāpadaṃ paññapeti, yāva na idhekacce āsavaṭṭhānīyā dhammā saṅghe pātubhavantī’’ti –
The Teacher does not, Bhaddāli, lay down a training rule for the disciples so long as certain states liable to the corruptions do not appear in the Saṅgha”—
"Này Bhaddāli, Như Lai chưa chế định giới luật cho các đệ tử cho đến khi một số pháp là nguyên nhân của các lậu hoặc xuất hiện trong Tăng đoàn."
Imasmiṃ bhaddālisutte (ma. ni. 2.145) viya ekaccesu paññattesupi tato paraṃ paññapetabbāni sandhāya ‘‘na tāva, sāriputta, satthā sāvakānaṃ sikkhāpadaṃ paññapetī’’ti vuttaṃ.
In this Bhaddālisutta, just as some have been laid down, yet with reference to those to be laid down thereafter, it was said, “The Teacher does not, Sāriputta, lay down a training rule for the disciples.”
Trong kinh Bhaddāli (Ma. Ni. 2.145) này, cũng tương tự như vậy, dù một số giới luật đã được chế định, nhưng sau đó, đề cập đến những giới luật cần được chế định, Ngài đã nói: "Này Sāriputta, Như Lai chưa chế định giới luật cho các đệ tử."
Idheva ca aṭṭhakathāyaṃ ‘‘sāmampi pacanaṃ samaṇasāruppaṃ na hoti, na ca vaṭṭatī’’ti vacanaṃ ‘‘ratticchedo vā vassacchedo vā na kato’’ti vacanañca pubbe paññattasikkhāpadānaṃ sabbhāve pamāṇanti daṭṭhabbaṃ.
And right here in the commentary, the statement, “Cooking for oneself is not befitting a recluse, nor is it allowable,” and the statement, “The time of night or the time of the rains-retreat was not broken,” should be seen as proof for the existence of training rules laid down before.
Và ở đây, trong Chú giải, câu "ngay cả việc tự nấu ăn cũng không phù hợp với Sa-môn, và không được phép" và câu "chưa có quy định về việc cắt đêm hay cắt mùa mưa" nên được xem là bằng chứng về sự tồn tại của các giới luật đã được chế định trước đó.
Sesasikkhāpadānañceva pātimokkhuddesassa ca therassa āyācanena paññattattā ‘‘mūlato pabhuti nidānaṃ dassetu’’nti āha.
Because the remaining training rules and the recitation of the Pātimokkha were laid down through the Elder’s request, he said, “to show the reason from the beginning.”
Vì các giới luật còn lại và việc tụng đọc Pātimokkha đã được chế định theo lời thỉnh cầu của vị Trưởng lão, nên Ngài nói " mūlato pabhuti nidānaṃ dassetu" (hãy trình bày nhân duyên từ khởi thủy).
Rahogatassāti raho janavivittaṃ ṭhānaṃ upagatassa.
Of one gone to a secluded place means of one who has approached a place secluded from people.
" Rahogatassā" có nghĩa là "đã đến một nơi vắng vẻ, không có người."
Tena gaṇasaṅgaṇikābhāvena therassa kāyavivekamāha.
By this, through the absence of association with a group, he indicates the Elder’s physical seclusion.
Bằng cách đó, Ngài nói về sự độc cư thân của vị Trưởng lão, do không có sự tụ tập của đoàn thể.
Paṭisallīnassāti nānārammaṇacārato cittassa nivattiyā paṭi sammadeva nilīnassa tattha avisaṭacittassa.
Of one in solitude means of one whose mind, having turned away from ranging in various objects, is well and truly settled, of one whose mind is not scattered there.
" Paṭisallīnassā" có nghĩa là "tâm đã hoàn toàn rút lui khỏi việc rong ruổi theo các đối tượng khác nhau, tâm an trú ở đó mà không bị phân tán."
Tena cittasaṅgaṇikābhāvenassa pubbabhāgiyaṃ cittavivekamāha.
By this, through the absence of mental association, he indicates his preliminary mental seclusion.
Bằng cách đó, Ngài nói về sự độc cư tâm sơ khởi của vị ấy, do không có sự tụ tập của tâm.
Ciranti kālāpekkhaṃ accantasaṃyoge upayogavacanaṃ.
Ciraṁ is an expression of usage in the sense of absolute connection with respect to time.
" Cira" là một từ chỉ sự sử dụng trong trường hợp liên kết tuyệt đối, liên quan đến thời gian.
Cirāti cirakālayuttā ṭhiti abhedena vuttā.
Cirā is said undifferentiatedly for a state endowed with a long time.
" Cirā" được nói đến một cách không phân biệt, chỉ sự an trú kéo dài trong một thời gian dài.
Kasmā panettha bhagavā vipassīādīnaṃ sattannaṃyeva buddhānaṃ brahmacariyassa ciraṭṭhitikāciraṭṭhitikabhāvaṃ kathesi, na buddhavaṃsadesanāyaṃ viya pañcavīsatiyā buddhānaṃ, tato vā pana bhiyyoti?
Why did the Blessed One here speak only of the long-lasting and not-long-lasting nature of the brahmacariya of the seven Buddhas, namely Vipassī and others, and not of the twenty-five Buddhas as in the Buddhavaṃsa discourse, or even more than that?
Tại sao ở đây Đức Thế Tôn chỉ nói về sự trường tồn và không trường tồn của Phạm hạnh của bảy vị Phật như Vipassī v.v., mà không nói về hai mươi lăm vị Phật hay nhiều hơn nữa như trong kinh Phật Sử (Buddhavaṃsa)?
Yesaṃ sammāsambuddhānaṃ paṭivedhasāsanaṃ ekaṃsato nicchayena ajjāpi dharati, na antarahitaṃ, te eva kittento vipassīādīnaṃyeva bhagavantānaṃ brahmacariyassa ciraṭṭhitikāciraṭṭhitikabhāvaṃ idha kathesi.
Desiring to proclaim only those Perfectly Enlightened Buddhas whose teaching of penetration definitely exists even today and has not disappeared, he spoke here only of the long-lasting and not-long-lasting nature of the brahmacariya of the Blessed Ones, Vipassī and others.
Chỉ khi ca ngợi những vị Chánh Đẳng Giác mà giáo pháp chứng ngộ của các Ngài vẫn còn tồn tại một cách chắc chắn và không bị biến mất cho đến ngày nay, Ngài mới nói về sự trường tồn và không trường tồn của Phạm hạnh của các vị Thế Tôn như Vipassī v.v. ở đây.
Tesaṃyeva hi sāvakā tadā ceva etarahi ca suddhāvāsabhūmiyaṃ ṭhitā, na aññesaṃ parinibbutattā.
For their disciples alone existed then and exist now in the Pure Abodes, not those of others, because they have attained final Nibbāna.
Vì các đệ tử của các Ngài vẫn còn an trú ở cõi Tịnh Cư (Suddhāvāsa) vào thời đó và cả bây giờ, chứ không phải của các vị Phật khác đã nhập Niết-bàn.
Siddhatthatissaphussānaṃ kira buddhānaṃ sāvakā suddhāvāsesu uppannā uppattisamanantarameva imasmiṃ sāsane upakādayo viya arahattaṃ adhigantvā na cirasseva parinibbāyiṃsu, na tattha tattha sāvakā yāvatāyukaṃ aṭṭhaṃsūti vadanti.
It is said that the disciples of the Buddhas Siddhattha, Tissa, and Phussa, having been born in the Pure Abodes, attained arahatship immediately after birth in this dispensation, like Upaka and others, and attained final Nibbāna not long after; their disciples did not remain for their full lifespan in those various places.
Người ta nói rằng các đệ tử của các vị Phật Siddhattha, Tissa, và Phussa đã tái sinh ở cõi Tịnh Cư, và ngay sau khi tái sinh, họ đã chứng đắc A-la-hán trong giáo pháp này, giống như Upaka và những người khác, rồi không lâu sau đó đã nhập Niết-bàn. Các đệ tử ở những nơi đó đã không sống hết tuổi thọ của mình.
Apubbācarimaniyamo pana aparāparaṃ saṃsaraṇakasattāvāsavasena ekissā lokadhātuyā icchitoti na tenetaṃ virujjhatīti daṭṭhabbaṃ.
Moreover, the rule of no-earlier-and-no-later is intended for one world-system by way of the dwelling of beings who wander on through successive existences, so it should be seen that this does not conflict with that.
Tuy nhiên, quy định về "không trước không sau" (apubbācarimaniyamo) được mong muốn trong một thế giới theo cách chúng sinh luân hồi từ đời này sang đời khác, nên điều này không mâu thuẫn với quy định đó. Điều này nên được hiểu.
19. Asādhāraṇo hetu, sādhāraṇo paccayoti evamādivibhāgena idha payojanaṃ natthi, vipassīādīnaṃ pana brahmacariyassa aciraṭṭhitikatāya ciraṭṭhitikatāya ca kāraṇapucchāparattā codanāyāti āha ‘‘hetu paccayoti ubhayametaṃ kāraṇādhivacana’’nti.
19. There is no purpose here in a division such as, “an uncommon cause is a hetu, a common one is a paccaya”; because the question is concerned with asking the reason for the brahmacariya of Vipassī and the others being not-long-lasting and long-lasting, he says, “hetu and paccaya—both of these are synonyms for cause.”
19. Ở đây không có mục đích để phân biệt theo cách "nguyên nhân là bất thường, duyên cớ là thông thường" v.v., mà là vì câu hỏi về nguyên nhân cho sự không trường tồn và trường tồn của Phạm hạnh của các vị Phật như Vipassī v.v. là một sự chất vấn. Do đó, Ngài nói " hetu paccayoti ubhayametaṃ kāraṇādhivacana" (cả hetu và paccaya đều là từ chỉ nguyên nhân).
Hinoti tena phalanti hetūti karaṇasādhanoyaṃ hetusaddoti āha ‘‘tena tassa phala’’ntiādi.
Because the result proceeds from it, it is a hetu; this word hetu has the instrumental derivation. Therefore he says, “By that, its result,” and so on.
Từ hetu này là một danh từ chỉ công cụ (karaṇasādhana), vì "kết quả được tạo ra bởi nó," do đó là hetu. Do đó, Ngài nói " tena tassa phala" (bởi nó, quả của nó) v.v.
Kattusādhanopi hetusaddo no na yujjati hinoti phalassa hetubhāvaṃ upagacchatīti hetūti.
The word hetu with the agent derivation is also not unsuitable, as in: it proceeds towards the state of being a cause for the result, therefore it is a hetu.
Và từ hetu là một danh từ chỉ chủ thể (kattusādhana) cũng không phải là không phù hợp, vì "nó đạt đến trạng thái là nguyên nhân của kết quả," do đó là hetu.
Taṃ paṭicca eti pavattatīti taṃ kāraṇaṃ paṭicca tassa phalaṃ eti pavattati nibbattatīti attho.
Dependent on that, it arises and proceeds; the meaning is that dependent on that cause, its result arises, proceeds, and is produced.
"Taṃ paṭicca eti pavattati" có nghĩa là "kết quả của nguyên nhân đó phát sinh, tiếp diễn, và được tạo ra do dựa vào nguyên nhân đó."
Kilāsuno ahesunti appossukkā ahesuṃ, nirussāhā ahesunti attho.
Were weary means they were unenthusiastic, they were without effort.
" Kilāsuno ahesu" có nghĩa là "họ không có nhiệt huyết, họ không có tinh tấn."
Sā pana nirussāhatā na ālasiyavasenāti āha ‘‘na ālasiyakilāsuno’’ti, ālasiyavasena kilāsuno nāhesunti attho.
But that lack of effort was not due to laziness, so he says, “not weary with laziness,” meaning they were not weary through laziness.
Tuy nhiên, sự thiếu tinh tấn đó không phải do lười biếng. Do đó, Ngài nói " na ālasiyakilāsuno" (không phải là sự mệt mỏi do lười biếng), có nghĩa là "họ không mệt mỏi do lười biếng."
Tattha kāraṇamāha ‘‘na hī’’tiādi.
He states the reason for that, saying “For not,” and so on.
Ngài nói về nguyên nhân ở đó, bắt đầu bằng " na hī" (không phải vậy).
Ālasiyaṃ vāti iminā thinamiddhavasappavattānaṃ akusalānaṃ abhāvamāha.
By “laziness,” he indicates the absence of unwholesome states that arise under the influence of sloth and torpor.
Bằng từ " ālasiyaṃ vā" (hay sự lười biếng), Ngài nói về sự không tồn tại của các pháp bất thiện phát sinh do sự hôn trầm và thụy miên.
Osannavīriyatā vāti iminā pana ‘‘ālasiyābhāvepi antamaso annabhāranesādānampi sakkaccaṃyeva dhammaṃ desetī’’ti vacanato yassa kassacipi dhammadesanāya nirussāhatā natthīti dīpeti sabbesaṃ samakeneva ussāhena dhammadesanāya pavattanato.
And by “languid energy,” he shows that even in the absence of laziness, there is no lack of effort in teaching the Dhamma to anyone at all—as stated in the saying, “he teaches the Dhamma earnestly, even if it is just carrying a load of food”—because the teaching of the Dhamma proceeded for all with equal effort.
Hoặc là sự suy giảm tinh tấn – với cụm từ này, ý muốn nói rằng, “ngay cả khi không có sự lười biếng, vị ấy vẫn nhiệt thành giảng Dhamma cho bất cứ ai, thậm chí cho cả những người gánh thức ăn,” bởi vì việc giảng Dhamma được thực hiện với cùng một sự nhiệt thành đối với tất cả, nên điều này cho thấy không có sự thiếu nhiệt tình trong việc giảng Dhamma cho bất cứ ai.
Tenāha ‘‘buddhā hī’’tiādi.
Therefore, it is said, " buddhā hī," etc.
Do đó,* nói “chư Phật quả thật…” v.v.
Osannavīriyāti ohīnavīriyā, appossukkāti attho.
Osannavīriyā means with diminished effort; the meaning is with little exertion.
Osannavīriyā nghĩa là những người có tinh tấn suy giảm, tức là những người không có nhiệt tâm.
Ussannavīriyāti adhikavīriyā, mahussāhāti attho.
Ussannavīriyā means with abundant effort; the meaning is with great exertion.
Ussannavīriyā nghĩa là những người có tinh tấn vượt trội, tức là những người có nhiệt tâm lớn.
Vegenāti javena.
Vegenā means with speed.
Vegenā nghĩa là nhanh chóng.
Dhamme garu etesanti dhammagaruno.
The Dhamma is revered by them, thus they are dhammagaruno.
Những ai xem Pháp là trọng yếu thì được gọi là dhammagaruno (tôn trọng Pháp).
Dhamme gāravametesanti dhammagāravā.
There is respect for the Dhamma in them, thus they are dhammagāravā.
Những ai có sự kính trọng Pháp thì được gọi là dhammagāravā (kính trọng Pháp).
Vipassissa bhagavato kāle asīti vassasahassāni āyuppamāṇaṃ sikhissa sattati vassasahassāni, vessabhussa saṭṭhivassasahassāni āyuppamāṇanti āha ‘‘tesaṃ kira kāle dīghāyukā sattā’’ti.
In the time of the Blessed One Vipassī, the lifespan was eighty thousand years; for Sikhī, seventy thousand years; for Vessabhū, the lifespan was sixty thousand years. Thus, it is said: "In their time, indeed, beings were long-lived."
Trong thời của Đức Thế Tôn Vipassī, thọ mạng là tám mươi ngàn năm; trong thời của Sikhī, thọ mạng là bảy mươi ngàn năm; trong thời của Vessabhū, thọ mạng là sáu mươi ngàn năm. Do đó,* nói “vào thời của các vị ấy, chúng sanh có thọ mạng dài”.
Abhisamentīti paṭivijjhanti.
Abhisamenti means they thoroughly understand.
Abhisamentī nghĩa là thấu triệt.
Niddosatāyāti vītikkamadosassa abhāvato.
Niddosatāya means due to the absence of the fault of transgression.
Niddosatāyā nghĩa là do không có lỗi vi phạm.
‘‘Imasmiṃ vītikkame ayaṃ nāma āpattī’’ti evaṃ āpattivasena apaññapetvā ‘‘pāṇātipātaṃ pahāya pāṇātipātā paṭivirato hotī’’tiādinā (dī. ni. 1.8, 194) dhammadesanāvasena ovādasikkhāpadānaṃyeva paññattattā vuttaṃ ‘‘sattāpattikkhandhavasena āṇāsikkhāpadaṃ apaññatta’’nti.
Because the training rules of admonition were laid down only by way of Dhamma teaching, beginning with "having abandoned the destruction of life, one is abstinent from the destruction of life," without laying them down by way of offenses, such as, "In this transgression, there is such-and-such an offense," it is said: "A training rule as a command was not laid down by way of the seven groups of offenses."
Vì không chế định giới luật theo hình thức tội lỗi, ví dụ: “Trong sự vi phạm này, có tội này,” mà chỉ chế định các giới luật khuyên răn theo hình thức thuyết pháp, ví dụ: “Từ bỏ sát sanh, vị ấy tránh xa sát sanh” v.v., nên đã nói “giới luật theo hình thức mệnh lệnh với bảy nhóm tội lỗi đã không được chế định”.
Channaṃ channaṃ vassānaṃ accayenāti pāṭhaseso daṭṭhabbo.
The remainder of the text "after the passing of every six years" should be seen.
Phần còn lại của đoạn văn cần được hiểu là “sau mỗi sáu năm”.
Atha vā channaṃ channaṃ vassānaṃ osānadivasaṃ apekkhitvā ‘‘sakiṃ saki’’nti vuttattā tadapekkhamidaṃ sāmivacanaṃ.
Or, because it is said "once, once" with reference to the final day of every six years, this is a genitive case referring to that.
Hoặc, vì đã nói “mỗi lần” khi đề cập đến ngày cuối cùng của mỗi sáu năm, nên đây là cách dùng từ sở hữu để chỉ sự đề cập đó.
Sakalajambudīpe sabbopi bhikkhusaṅgho ekasmiṃyeva ṭhāne uposathaṃ akāsīti sambandho.
The connection is that the entire Saṅgha of bhikkhus in all of Jambudīpa performed the uposatha in one single place.
Tất cả Tăng đoàn trên toàn cõi Jambudīpa đã làm lễ Uposatha tại cùng một địa điểm – đó là sự liên kết.
Katamaṃ taṃ ṭhānanti āha ‘‘bandhumatiyā rājadhāniyā’’tiādi.
To answer the question, "What was that place?" he said, "In the royal city of Bandhumatī," etc.
Địa điểm đó là gì?* nói “tại kinh đô Bandhumatī” v.v.
Isipatanaṃ tena samayena khemaṃ nāma uyyānaṃ hoti, migānaṃ pana abhayavāsatthāya dinnattā migadāyoti vuccati.
At that time, Isipatana was a park named Khema, but because it was given for the safe dwelling of deer, it is called Migadāya.
Vào thời đó, Isipatana là một khu vườn tên là Khema, nhưng vì được ban tặng để các loài thú sống không sợ hãi, nên nó được gọi là Migadāya.
Taṃ sandhāya vuttaṃ ‘‘kheme migadāye’’ti.
Referring to that, it is said: "in Khema, at Migadāya."
Liên quan đến điều đó, đã nói “tại Migadāya Khema”.
Abbokiṇṇāni dasapi vīsatipi bhikkhusahassāni vasantīti visabhāgapuggalehi asaṃsaṭṭhāni dasapi vīsatipi bhikkhūnaṃ sahassāni vasanti.
Ten or even twenty thousand bhikkhus reside unmixed means ten or even twenty thousand bhikkhus reside unmingled with dissimilar persons.
Hai mươi ngàn, thậm chí mười ngàn Tỳ-khưu sống không bị gián đoạn nghĩa là mười ngàn hoặc hai mươi ngàn Tỳ-khưu sống không bị trộn lẫn với những người không cùng chủng loại.
Dīghanikāyaṭṭhakathāyaṃ pana ‘‘te sabbepi dvādasasahassabhikkhugaṇhanakā mahāvihārā abhayagiricetiyapabbatacittalapabbatavihārasadisā ca ahesu’’nti vuttaṃ.
However, in the Dīghanikāyaṭṭhakathā it is said: "All those were like the Mahāvihāra, Abhayagiri, Cetiyapabbata, and Cittalapabbata monasteries, which could hold twelve thousand bhikkhus."
Tuy nhiên, trong Chú giải Dīghanikāya, đã nói rằng “tất cả mười hai ngàn Tỳ-khưu sống trong các đại tinh xá giống như Abhayagiri, Cetiyapabbata, và Cittalapabbata Vihāra.”
Uposathārocikāti uposathārocanakā.
Uposathārocikā means announcers of the uposatha.
Uposathārocikā nghĩa là những người báo tin Uposatha.
Tā kira devatā ekamhi vasse nikkhante tattha tattha gantvā ārocenti ‘‘nikkhantaṃ kho, mārisā, ekaṃ vassaṃ, pañca dāni vassāni sesāni, pañcannaṃ vassānaṃ accayena bandhumatī rājadhānī upasaṅkamitabbā pātimokkhuddesāyā’’ti.
Indeed, when one year had passed, those devatās would go here and there and announce: "Venerable sirs, one year has passed. Five years now remain. After the passing of five years, the royal city of Bandhumatī should be approached for the recitation of the Pātimokkha."
Những vị thiên nhân đó, sau khi một năm đã trôi qua, đã đi khắp nơi để thông báo: “Thưa chư vị, một năm đã trôi qua, còn lại năm năm nữa, sau năm năm, cần đến kinh đô Bandhumatī để tụng đọc Pātimokkha.”
Tathā dvīsu vassesu nikkhantesu ‘‘nikkhantāni kho, mārisā, dve vassāni, cattāri vassāni sesāni, catunnaṃ vassānaṃ accayena bandhumatī rājadhānī upasaṅkamitabbā pātimokkhuddesāyā’’ti ārocenti.
Similarly, when two years had passed, they announced: "Venerable sirs, two years have passed. Four years remain. After the passing of four years, the royal city of Bandhumatī should be approached for the recitation of the Pātimokkha."
Tương tự, khi hai năm đã trôi qua, họ thông báo: “Thưa chư vị, hai năm đã trôi qua, còn lại bốn năm nữa, sau bốn năm, cần đến kinh đô Bandhumatī để tụng đọc Pātimokkha.”
Imināva nayena tīsu catūsu pañcasu vassesu atikkantesu ārocenti.
By this same method, they announced when three, four, and five years had passed.
Theo cách này, khi ba, bốn, năm năm đã trôi qua, họ cũng thông báo.
Tena vuttaṃ ‘‘mārisā ekaṃ vassaṃ atikkanta’’ntiādi.
Therefore, it is said: "Venerable sirs, one year has passed," etc.
Do đó, đã nói “Thưa chư vị, một năm đã trôi qua” v.v.
Sānubhāvāti iddhānubhāvena sānubhāvā.
Sānubhāvā means endowed with power through the might of supernormal ability.
Sānubhāvā nghĩa là những người có uy lực thông qua thần thông.
Te kira bhikkhūti ye devatānubhāvena gacchanti, te sandhāya vadati.
"Those bhikkhus, it seems"—this is said with reference to those who go by the power of the devatās.
Những Tỳ-khưu đó – điều này nói về những vị đi bằng thần thông của các vị thiên nhân.
Pācīnasamuddanteti pācīnasamuddassa samīpadese.
Pācīnasamuddante means in the region near the eastern ocean.
Pācīnasamuddante nghĩa là ở vùng gần biển phía đông.
Gamiyavattanti gamikehi kātabbaṃ senāsanapaṭijagganādivattaṃ.
Gamiyavatta means the duties, such as looking after the lodging, to be done by traveling bhikkhus.
Gamiyavatta nghĩa là bổn phận của những người du hành, như việc sắp xếp chỗ ở.
Uposathagganti uposathakaraṇaṭṭhānaṃ.
Uposathagga means the place for performing the uposatha.
Uposathagga nghĩa là nơi thực hiện Uposatha.
Gatāva hontīti devatānubhāvena gatā eva honti.
Have already gone means they have already gone by the power of the devatās.
Gatāva hontī nghĩa là họ đã đến bằng thần thông của các vị thiên nhân.
Teti attano attano ānubhāvena devatānubhāvena ca gatā sabbepi.
Te means all those who have gone by their own power and by the power of the devatās.
Te nghĩa là tất cả những vị đã đến bằng thần thông của riêng mình và thần thông của các vị thiên nhân.
Khantī paramantiādīsu (dī. ni. aṭṭha. 2.90; dha. pa. aṭṭha. 2.185) parūpavādaṃ parāpakāraṃ sītuṇhādibhedañca guṇoparodhaṃ khamati sahati adhivāsetīti khanti.
In such passages as "Khantī paramaṃ," khanti is that which forbears, endures, and tolerates the violation of virtue, which is of different kinds such as the criticism of others, harm from others, and cold and heat.
Trong các đoạn như Khantī paramaṃ v.v., khanti (nhẫn nại) là sự chịu đựng, nhẫn chịu, chấp nhận những lời phỉ báng, sự hãm hại từ người khác, và những phiền toái như nóng lạnh, cũng như sự suy giảm phẩm hạnh.
Sā pana sīlādīnaṃ paṭipakkhadhamme savisesaṃ tapati santapati vidhamatīti paramaṃ uttamaṃ tapo.
Because it especially burns, scorches, and dispels the states that are contrary to virtue and so on, it is the paramaṃ (supreme) tapo (ascetic practice).
Sự nhẫn nại đó là tapo (khổ hạnh) tối thượng, vì nó đặc biệt thiêu đốt, làm tiêu tan, và loại bỏ các pháp đối nghịch với giới hạnh v.v.
Titikkhanaṃ khamanaṃ titikkhā.
Titikkhā is forbearance, endurance.
Sự chịu đựng, nhẫn chịu là titikkhā.
Khantiyāyevetaṃ vevacanaṃ.
This is a synonym for khanti itself.
Đây là từ đồng nghĩa với khanti.
Akkharacintakā hi khamāyaṃ titikkhāsaddaṃ vaṇṇenti, tasmā evamettha attho daṭṭhabbo ‘‘titikkhāsaṅkhātā adhivāsanakhanti nāma uttamaṃ tapo’’ti.
For grammarians explain the word titikkhā in the sense of khamā (forbearance); therefore, the meaning should be understood here thus: "The supreme ascetic practice is called forbearance as endurance."
Các nhà ngữ pháp giải thích từ titikkhā trong nghĩa nhẫn nại, do đó, ý nghĩa ở đây nên được hiểu là “sự nhẫn nại chấp nhận, tức là titikkhā, là khổ hạnh tối thượng”.
Nibbānaṃ paramaṃ vadanti buddhāti bhavena bhavantaraṃ vināti bhavanikantibhāvena saṃsibbati, sataṇhasseva vā āyatiṃ punabbhavabhāvato phalena saddhiṃ kammaṃ vināti saṃsibbatīti vānanti saṅkhyaṃ gatāya taṇhāya nikkhantaṃ nibbānaṃ tattha tassā sabbaso abhāvato.
"The Buddhas say Nibbāna is supreme": Because of the state of delighting in existence, it sews one existence to another; or, because for one with craving, there is a cause for future rebirth, it stitches kamma together with its result; thus, Nibbāna is that which has departed from craving, which is known as vāna, because of its complete absence there.
Chư Phật nói Nibbāna là tối thượng – Nibbāna là sự thoát ly khỏi ái dục (vāṇa), là sự kết nối từ kiếp này sang kiếp khác do sự ham muốn tồn tại, hoặc là sự kết nối nghiệp với quả báo do sự tái sanh trong tương lai của người có ái dục. Nibbāna là sự thoát ly khỏi ái dục vì ái dục hoàn toàn không còn ở đó.
Taṃ nibbānaṃ pana santapaṇītanipuṇasivakhemādinā sabbākārena paramanti vadanti buddhā.
The Buddhas say that Nibbāna is supreme in all aspects, being peaceful, sublime, subtle, blissful, secure, and so on.
Chư Phật nói Nibbāna đó là tối thượng về mọi mặt, như sự an tịnh, vi diệu, tinh tế, an lành, và vô sự.
Na hi pabbajito parūpaghātīti yo adhivāsanakhantirahitattā paraṃ upaghāteti bādhati vihiṃsati, so pabbajito nāma na hoti pabbājetabbadhammassa apabbājanato.
Na hi pabbajito parūpaghātī: One who, being devoid of enduring patience, harms, afflicts, or hurts another is not called a pabbajita (one who has gone forth), because he has not banished the state that ought to be banished.
Vì người xuất gia không làm hại người khác – người nào do không có sự nhẫn nại chịu đựng mà làm hại, gây tổn thương, hoặc gây đau khổ cho người khác, thì người đó không phải là người xuất gia, vì người đó đã không từ bỏ pháp đáng từ bỏ.
Catutthapādo pana tatiyapādasseva vevacanaṃ anatthantarattā.
The fourth line, however, is a synonym of the third line, as there is no difference in meaning.
Chân thứ tư là từ đồng nghĩa với chân thứ ba, vì không có sự khác biệt về ý nghĩa.
‘‘Na hi pabbajito’’ti etassa hi ‘‘na samaṇo hotī’’ti vevacanaṃ.
"Na samaṇo hoti" is a synonym for "na hi pabbajito."
“Na samaṇo hoti” là từ đồng nghĩa với “Na hi pabbajito”.
‘‘Parūpaghātī’’ti etassa ‘‘paraṃ viheṭhayanto’’ti vevacanaṃ.
"Paraṃ viheṭhayanto" is a synonym for "parūpaghātī."
“Paraṃ viheṭhayanto” là từ đồng nghĩa với “parūpaghātī”.
Atha vā parūpaghātīti sīlūpaghātī.
Alternatively, parūpaghātī means one who destroys virtue.
Hoặc, parūpaghātī là người hủy hoại giới hạnh (sīlūpaghātī).
Sīlañhi uttamaṭṭhena ‘‘para’’nti vuccati parasaddassa seṭṭhavācakattā ‘‘puggalaparoparaññū’’tiādīsu viya.
Virtue is called "para" in the sense of being supreme, because the word "para" has the meaning of "excellent," as in "one who knows superior and inferior persons," and so on.
Giới hạnh được gọi là “para” (tối thượng) theo nghĩa tối thượng, giống như trong các trường hợp như “puggalaparoparaññū” (người hiểu biết về các loại người cao thấp) v.v., vì từ “para” có nghĩa là tối thượng.
Yo ca samaṇo paraṃ yaṃ kañci sattaṃ viheṭhayanto parūpaghātī hoti attano sīlavināsako, so pabbajito nāma na hotīti attho.
The meaning is that a samaṇa who harms any other being and is a parūpaghātī, a destroyer of his own virtue, is not called a pabbajita.
Và ý nghĩa là, Tỳ-khưu nào làm hại bất cứ chúng sanh nào, trở thành người hủy hoại người khác, hủy hoại giới hạnh của chính mình, thì người đó không phải là người xuất gia.
Atha vā yo adhivāsanakhantiyā abhāvā parūpaghātī hoti, paraṃ antamaso ḍaṃsamakasampi jīvitā voropeti, so na hi pabbajito.
Alternatively, one who, due to a lack of enduring patience, is a parūpaghātī, who deprives another being—even down to a gadfly or a mosquito—of life, is not a pabbajita.
Hoặc, người nào do không có sự nhẫn nại chịu đựng mà làm hại người khác, thậm chí giết chết một con ruồi, muỗi, thì người đó không phải là người xuất gia.
Kiṃ kāraṇā?
What is the reason?
Vì lý do gì?
Pāpamalassa apabbājitattā anīhaṭattā.
Because the defilement of evil has not been banished, not been expelled.
Vì người đó chưa từ bỏ, chưa loại bỏ ô uế của ác nghiệp.
‘‘Pabbājayamattano malaṃ, tasmā pabbajitoti vuccatī’’ti (dha. pa. 388) idañhi pabbajitalakkhaṇaṃ.
For this is the characteristic of a pabbajita: "Because he has caused his own defilements to be banished, he is therefore called a pabbajita."
Bởi vì đặc điểm của người xuất gia là “người nào loại bỏ ô uế của chính mình, người đó được gọi là pabbajita (người xuất gia)”.
Yopi naheva kho upaghāteti na māreti, apica daṇḍādīhi viheṭheti, sopi paraṃ viheṭhayanto samaṇo na hoti.
And one who does not actually harm or kill, but harasses with sticks and so on, he too, while harassing another, is not a samaṇa.
Và người nào không giết hại, không làm hại, mà chỉ làm phiền người khác bằng gậy gộc v.v., thì người đó cũng không phải là Sa-môn.
Kiṃkāraṇā?
What is the reason?
Vì lý do gì?
Vihesāya asamitattā.
Because he has not been calmed with regard to harassment.
Vì sự làm phiền chưa được dập tắt.
Samitattā samaṇoti vuccatīti idañhi samaṇalakkhaṇaṃ.
For this is the characteristic of a samaṇa: he is called a samaṇa because he is calmed.
Bởi vì đặc điểm của Sa-môn là “người nào dập tắt được sự làm phiền, người đó được gọi là Sa-môn”.
‘‘Samitattā hi pāpānaṃ, samaṇoti pavuccatī’’ti (dha. pa. 265) hi vuttaṃ.
For it is said: "Because of the calming of evils, he is called a 'samaṇa'."
Quả thật, đã nói rằng “do dập tắt được các ác nghiệp, người đó được gọi là Sa-môn”.
Apica bhagavā bhikkhūnaṃ pātimokkhaṃ uddisanto pātimokkhakathāya ca sīlappadhānattā sīlassa ca visesato doso paṭipakkhoti tassa niggaṇhanavidhiṃ dassetuṃ ādito ‘‘khantī paramaṃ tapo’’ti āha.
Furthermore, the Blessed One, while reciting the Pātimokkha to the bhikkhus, said at the outset "Khantī paramaṃ tapo" to show the method for restraining anger, since virtue is predominant in the Pātimokkha discourse, and anger is especially its opponent.
Hơn nữa, khi Đức Thế Tôn tụng đọc Pātimokkha cho các Tỳ-khưu, vì câu chuyện Pātimokkha lấy giới hạnh làm chính, và đặc biệt là lỗi lầm là đối nghịch với giới hạnh, nên để chỉ ra phương pháp chế ngự lỗi lầm đó, Ngài đã bắt đầu bằng câu “Khantī paramaṃ tapo” (Nhẫn nại là khổ hạnh tối thượng).
Tena aniṭṭhassa paṭihananūpāyo vutto, titikkhāggahaṇena pana iṭṭhassa, tadubhayenapi uppannaṃ aratiṃ uppannaṃ ratiṃ abhibhuyya viharatīti ayamattho dassito.
By that, the means of dispelling the undesirable is stated; by the inclusion of titikkhā, the means of dispelling the desirable is stated. By both of these, this meaning is shown: he dwells overcoming arisen discontent and arisen delight.
Với câu đó, phương tiện để đẩy lùi những gì không mong muốn đã được nói đến; còn với việc nắm giữ sự nhẫn nại (titikkhā), phương tiện để đẩy lùi những gì mong muốn đã được nói đến. Và với cả hai điều này, ý nghĩa được chỉ ra là vị ấy an trú bằng cách chế ngự sự bất mãn (arati) và sự mãn nguyện (rati) đã khởi lên.
Taṇhāvānassa vūpasamanato nibbānaṃ paramaṃ vadanti buddhā.
Because it is the calming of craving, which is vāna, the Buddhas say Nibbāna is supreme.
Các vị Phật nói rằng Nibbāna là tối thượng vì sự lắng dịu của ái dục (taṇhā-vāna).
Tattha khantiggahaṇena payogavipattiyā abhāvo dassito, titikkhāggahaṇena āsayavipattiyā abhāvo.
Therein, by the inclusion of khanti, the absence of wrong application is shown; by the inclusion of titikkhā, the absence of wrong intention is shown.
Trong đó, với việc nắm giữ sự kham nhẫn (khanti), sự không có sự thất bại trong thực hành (payogavipatti) đã được chỉ ra; với việc nắm giữ sự nhẫn nại (titikkhā), sự không có sự thất bại trong ý định (āsayavipatti) đã được chỉ ra.
Tathā khantiggahaṇena parāparādhasahatā, titikkhāggahaṇena paresu anaparajjhanā dassitā.
Likewise, by the term ‘khantī,’ endurance of others’ offenses is shown; by the term ‘titikkhā,’ not offending others is shown.
Tương tự, với việc nắm giữ sự kham nhẫn (khanti), sự chịu đựng lỗi lầm của người khác đã được chỉ ra; với việc nắm giữ sự nhẫn nại (titikkhā), sự không phạm lỗi với người khác đã được chỉ ra.
Evaṃ kāraṇamukhena anvayato pātimokkhaṃ dassetvā idāni byatirekato taṃ dassetuṃ ‘‘na hī’’tiādi vuttaṃ.
Having thus shown the Pātimokkha by the positive method by way of its cause, now, to show it by the negative method, ‘ na hī’ and so on was said.
Như vậy, sau khi chỉ ra Pātimokkha theo phương pháp nhân quả (kāraṇamukhena) và theo cách thuận (anvayato), bây giờ để chỉ ra nó theo cách nghịch (byatirekato), câu “Na hī” (Không phải vậy) v.v. đã được nói đến.
Tena yathā sattānaṃ jīvitā voropanaṃ paraṃ pāṇileḍḍudaṇḍādīhi viheṭhanañca ‘‘parūpaghāto paraṃ viheṭhana’’nti vuccati, evaṃ tesaṃ sāpateyyāvaharaṇaṃ parāmasanaṃ visaṃvādanaṃ aññamaññabhedanaṃ pharusavacanena mammaghaṭṭanaṃ niratthakavippalāpo parasantakābhijjhānaṃ ucchedacintanaṃ micchābhinivesanañca upaghāto paraviheṭhanañca hotīti yassa kassaci akusalassa kammapathassa kammassa ca karaṇena pabbajito samaṇo ca na hotīti dasseti.
By this, it is shown that just as depriving beings of life and harming others with the hand, clods, sticks, etc., is called ‘harming others, harming another,’ so too, stealing their property, molesting*, deceiving, causing division among them, striking at their vital spots with harsh speech, useless chatter, coveting others’ possessions, thinking of annihilation, and wrong adherence are also harming and harming another. Therefore, by doing any unwholesome course of action or kamma, one is not a renunciant or an ascetic.
Với câu đó, điều được chỉ ra là: cũng như việc tước đoạt mạng sống của chúng sinh, và việc làm hại người khác bằng gậy, đá, v.v. được gọi là “làm hại người khác, gây đau khổ cho người khác”, thì tương tự, việc chiếm đoạt tài sản của họ, việc xâm phạm, việc lừa dối, việc chia rẽ lẫn nhau, việc chạm vào chỗ nhạy cảm bằng lời nói thô tục, việc nói chuyện vô ích, việc tham lam tài sản của người khác, việc suy nghĩ hủy diệt, và việc chấp thủ sai lầm cũng là sự làm hại và gây đau khổ cho người khác. Do đó, một người xuất gia và một Sa-môn không thể là người thực hiện bất kỳ ác nghiệp đạo hay ác nghiệp nào.
Dutiyagāthāya sabbapāpassāti sabbākusalassa sabbassapi dvādasākusalassa sabbacittuppādasaṅgahitassa sāvajjadhammassa.
In the second verse, sabbapāpassa refers to all that is unwholesome, all the twelve unwholesome types of consciousness, all blameworthy states included within all arisings of consciousness.
Trong kệ thứ hai, sabbapāpassā (của tất cả các điều ác) có nghĩa là của tất cả các điều bất thiện, của tất cả mười hai điều bất thiện, của tất cả các pháp có tội được bao gồm trong các tâm sinh khởi.
Akaraṇanti anuppādanaṃ.
Akaraṇaṁ means not producing it.
Akaraṇaṃ (không làm) có nghĩa là không làm cho phát sinh.
Karaṇañhi nāma tassa attano santāne uppādananti tappaṭikkhepato akaraṇaṃ anuppādanaṃ.
For 'doing' means producing it in one's own continuity; by rejecting that, 'not doing' becomes 'not producing'.
Vì việc làm phát sinh điều đó trong dòng tâm thức của mình được gọi là ‘làm’, nên ‘không làm’ là không làm cho phát sinh, bằng cách từ bỏ điều đó.
Kusalassāti catubhūmikakusalassa.
Kusalassa refers to wholesome states of the four planes.
Kusalassā (của điều thiện) có nghĩa là của điều thiện thuộc bốn cõi.
‘‘Kusalassā’’ti hi idaṃ ‘‘etaṃ buddhāna sāsana’’nti vakkhamānattā ariyamaggadhamme tesañca sambhārabhūte tebhūmikakusale dhamme bodheti.
Indeed, the phrase ‘kusalassa,’ because it will be stated ‘this is the teaching of the Buddhas,’ indicates the Dhammas of the noble path and also the wholesome Dhammas of the three planes that are the supporting conditions for them.
Vì câu “Kusalassā” này được nói đến trong ngữ cảnh “etaṃ buddhāna sāsanaṃ” (đây là giáo huấn của các đức Phật), nên nó chỉ ra các pháp Thánh đạo và các pháp thiện thuộc ba cõi là những yếu tố cần thiết cho chúng.
Upasampadāti upasampādanaṃ.
Upasampadā means accomplishment.
Upasampadā (thành tựu) có nghĩa là sự thành tựu.
Taṃ pana atthato tassa kusalassa samadhigamo paṭilābho.
In terms of meaning, that is the attainment and acquisition of that wholesome state.
Tuy nhiên, về mặt ý nghĩa, đó là sự đạt được, sự thâu hoạch điều thiện đó.
Sacittapariyodapananti attano cittassa jotanaṃ cittassa pabhassarabhāvakaraṇaṃ sabbaso parisodhanaṃ.
Sacittapariyodapanaṁ means the brightening of one's own mind, making the mind radiant, the complete purification.
Sacittapariyodapanaṃ (làm trong sạch tâm mình) có nghĩa là làm cho tâm mình sáng chói, làm cho tâm trở nên rực rỡ, hoàn toàn thanh tịnh.
Taṃ pana arahattena hoti.
That, however, is accomplished through Arahatship.
Tuy nhiên, điều đó đạt được bằng quả A-la-hán.
Ettha ca yasmā aggamaggasamaṅgino cittaṃ sabbaso pariyodapīyati nāma, aggaphalakkhaṇe pana pariyodapitaṃ hoti puna pariyodapetabbatāya abhāvato, tasmā pariniṭṭhitapariyodapanataṃ sandhāya vuttaṃ ‘‘taṃ pana arahattena hotī’’ti.
Herein, because the mind of one endowed with the highest path is called ‘completely purified,’ whereas at the moment of the highest fruit it has been purified and there is nothing further to be purified, it was said with reference to the state of completed purification, “That, however, is accomplished through Arahatship.”
Ở đây, vì tâm của người thành tựu Thánh đạo tối thượng được gọi là hoàn toàn thanh tịnh, nhưng tại thời điểm quả tối thượng, nó đã được thanh tịnh và không còn gì để thanh tịnh nữa, nên câu “taṃ pana arahattena hotī” (điều đó đạt được bằng quả A-la-hán) được nói đến để chỉ sự thanh tịnh hoàn hảo.
Iti sīlasaṃvarena sabbapāpaṃ pahāya lokiyalokuttarāhi samathavipassanāhi kusalaṃ sampādetvā arahattaphalena cittaṃ pariyodapetabbanti etaṃ buddhānaṃ sāsanaṃ ovādo anusiṭṭhi.
Thus, having abandoned all evil through restraint in sīla, having accomplished the wholesome through mundane and supramundane serenity and insight, one purifies the mind through the fruit of Arahatship—this is the teaching, the exhortation, the instruction of the Buddhas.
Như vậy, sau khi từ bỏ mọi điều ác bằng sự phòng hộ giới, thành tựu điều thiện bằng samatha và vipassanā thuộc thế gian và siêu thế, và làm cho tâm thanh tịnh bằng quả A-la-hán—đây là giáo huấn, lời khuyên, lời chỉ dạy của các đức Phật.
Tatiyagāthāya anupavādoti vācāya kassaci anupavadanaṃ.
In the third verse, anupavādo means not speaking ill of anyone by speech.
Trong kệ thứ ba, anupavādo (không chỉ trích) có nghĩa là không chỉ trích bất cứ ai bằng lời nói.
Anupaghātoti kāyena manasā ca kassaci upaghātākaraṇaṃ manasāpi paresaṃ anatthacintanādivasena upaghātakaraṇassa vajjetabbattā.
Anupaghāto means not harming anyone by body or by mind, because harming by mind, by way of thinking ill of others and so forth, is also to be avoided.
Anupaghāto (không làm hại) có nghĩa là không làm hại bất cứ ai bằng thân và ý, vì việc làm hại người khác bằng ý, như suy nghĩ điều bất lợi cho họ, v.v., cần phải tránh.
Pātimokkheti yaṃ taṃ paatimokkhaṃ atipamokkhaṃ uttamaṃ sīlaṃ, pāti vā sugatibhayehi mokkheti duggatibhayehi, yo vā naṃ pāti, taṃ mokkhetīti pātimokkhanti vuccati, tasmiṃ pātimokkhe ca.
Pātimokkhe: That which is called the Pātimokkha is the most excellent, supreme sīla. Or, it protects (pāti) from the dangers of good destinations and liberates (mokkheti) from the dangers of bad destinations. Or, one who protects (pāti) it, it liberates (mokkheti) them, thus it is called Pātimokkha. In that Pātimokkha, and—
Pātimokkhe (trong Pātimokkha) có nghĩa là trong Pātimokkha đó, tức là giới tối thượng, hay giới giải thoát khỏi các nỗi sợ tái sinh thiện lành và giải thoát khỏi các nỗi sợ tái sinh ác lành, hoặc giải thoát người giữ giới khỏi các nỗi sợ đó, nên được gọi là Pātimokkha; và trong Pātimokkha đó.
Saṃvaroti sattannaṃ āpattikkhandhānaṃ avītikkamalakkhaṇo saṃvaro.
Saṁvaro means the restraint characterized by not transgressing the seven classes of offenses.
Saṃvaro (sự phòng hộ) có nghĩa là sự phòng hộ có đặc tính không vi phạm bảy nhóm tội (āpattikkhandha).
Mattaññutāti bhojane mattaññutā paṭiggahaṇaparibhogavasena pamāṇaññutā.
Mattaññutā means knowing the measure in food, knowing the proper amount with respect to receiving and using.
Mattaññutā (biết đủ) có nghĩa là biết đủ trong việc ăn uống, tức là biết chừng mực trong việc thọ nhận và sử dụng.
Pantañca sayanāsananti janasaṅghaṭṭavirahitaṃ nijjanasambādhaṃ vivittaṃ senāsanañca.
Pantañca sayanāsanaṁ means a dwelling that is secluded, free from the jostling of people, uncrowded by people, and remote.
Pantañca sayanāsanaṃ (chỗ nằm ngồi thanh vắng) có nghĩa là chỗ nằm ngồi vắng vẻ, không có sự tụ tập của người, không bị chen chúc bởi người.
Ettha dvīhiyeva paccayehi catupaccayasantoso dīpitoti veditabbo paccayasantosasāmaññena itaradvayassapi lakkhaṇahāranayena jotitabhāvato.
Here, contentment with the four requisites is indicated by just two of them; it should be understood that due to the general nature of contentment with requisites, the other two are also illuminated by the method of characteristic application.
Ở đây, cần hiểu rằng sự biết đủ về bốn vật dụng (catupaccayasantosa) đã được chỉ ra chỉ bằng hai vật dụng, vì hai vật dụng còn lại cũng được làm sáng tỏ theo phương pháp suy luận từ đặc tính chung của sự biết đủ về vật dụng.
Adhicitte ca āyogoti vipassanāpādakaṃ aṭṭhasamāpatticittaṃ adhicittaṃ, tatopi ca maggaphalacittameva adhicittaṃ, tasmiṃ yathāvutte adhicitte āyogo ca, anuyogoti attho.
Adhicitte ca āyogo: The mind of the eight attainments, which is the foundation for insight, is adhicitta. And even beyond that, the mind of the path and fruit itself is adhicitta. In that aforementioned adhicitta, there is also āyogo, application—that is the meaning.
Adhicitte ca āyogo (và sự chuyên tâm vào tâm tối thượng) có nghĩa là tâm của tám thiền định (aṭṭhasamāpatti) là adhicitta (tâm tối thượng) làm nền tảng cho thiền quán (vipassanā); và hơn thế nữa, chính tâm Đạo và tâm Quả là adhicitta. Và sự chuyên tâm vào adhicitta đã được nói đến như vậy, tức là sự tinh tấn (anuyoga).
Etaṃ buddhāna sāsananti etaṃ parassa anupavadanaṃ anupaghātanaṃ pātimokkhe saṃvaro paṭiggahaṇaparibhogesu mattaññutā vivittasenāsanasevanaṃ adhicittānuyogo ca buddhānaṃ sāsanaṃ ovādo anusiṭṭhi.
Etaṁ buddhāna sāsanaṁ: This—not speaking ill of another, not harming another, restraint in the Pātimokkha, knowing the measure in receiving and using, frequenting a secluded dwelling, and application to the higher mind—is the teaching, the exhortation, the instruction of the Buddhas.
Etaṃ buddhāna sāsanaṃ (đây là giáo huấn của các đức Phật) có nghĩa là: không chỉ trích người khác, không làm hại người khác, sự phòng hộ trong Pātimokkha, sự biết đủ trong việc thọ nhận và sử dụng, việc sống nơi chỗ nằm ngồi thanh vắng, và sự chuyên tâm vào tâm tối thượng—đây là giáo huấn, lời khuyên, lời chỉ dạy của các đức Phật.
Imā pana sabbabuddhānaṃ pātimokkhuddesagāthā hontīti veditabbā.
It should be known that these are the Pātimokkha recitation verses of all Buddhas.
Cần phải biết rằng những bài kệ này là các bài kệ Pātimokkha-uddesa của tất cả các đức Phật.
Tenāha ‘‘eteneva upāyenā’’tiādi.
Therefore, it says ‘eteneva upāyenā’ and so forth.
Do đó, Ngài đã nói “eteneva upāyenā” (bằng phương pháp này) v.v.
Yāva sāsanapariyantāti dharamānakabuddhānaṃ anusāsanapariyantaṃ sandhāya vuttaṃ, yāva buddhā dharanti, tāva uddisitabbataṃ āgacchantīti vuttaṃ hoti.
Yāva sāsanapariyantā is said with reference to the end of the instruction of the living Buddhas; it means that as long as the Buddhas are present, these verses are to be recited.
Yāva sāsanapariyantā (cho đến khi giáo pháp kết thúc) được nói đến để chỉ sự kết thúc của giáo huấn của các đức Phật đang hiện hữu. Điều đó có nghĩa là chừng nào các đức Phật còn hiện hữu, chừng đó chúng vẫn được tụng đọc.
Ovādapātimokkhañhi buddhāyeva uddisanti, na sāvakā.
Indeed, only Buddhas recite the Ovāda-pātimokkha, not the disciples.
Vì chỉ có các đức Phật mới tụng đọc Ovāda-Pātimokkha, chứ không phải các vị Thanh văn.
Paṭhamabodhiyaṃyeva uddesamāgacchantīti sambandho.
The connection is that they are to be recited only in the first period of awakening.
Sự liên kết là: chúng được tụng đọc ngay trong thời kỳ giác ngộ đầu tiên.
Paṭhamabodhi cettha vīsativassaparicchinnāti mahāgaṇṭhipade vuttaṃ.
And here, the first period of awakening is defined as twenty years, as stated in the Mahāgaṇṭhipada.
Và ở đây, thời kỳ giác ngộ đầu tiên được giới hạn trong hai mươi năm, như đã nói trong Mahāgaṇṭhipada.
Tañca heṭṭhā aṭṭhakathāyameva ‘‘bhagavato hi paṭhamabodhiyaṃ vīsativassantare nibaddhupaṭṭhāko nāma natthī’’ti kathitattā ‘‘paṭhamabodhi nāma vīsativassānī’’ti gahetvā vuttaṃ.
And this was stated based on the statement made below in the commentary itself, “For the Blessed One, within the twenty years of the first period of awakening, there was no one who was a fixed attendant,” thereby taking ‘the first period of awakening’ to mean twenty years.
Và điều đó được nói đến bằng cách hiểu rằng “thời kỳ giác ngộ đầu tiên là hai mươi năm”, vì chính trong Chú giải bên dưới đã nói rằng “trong hai mươi năm đầu của thời kỳ giác ngộ đầu tiên của Đức Thế Tôn không có người thị giả cố định”.
Ācariyadhammapālattherena pana ‘‘pañcacattālīsāya vassesu ādito pannarasa vassāni paṭhamabodhī’’ti vuttaṃ.
However, by the Elder Ācariyadhammapāla it was said, “Of the forty-five years, the first fifteen years from the beginning are the first period of awakening.”
Tuy nhiên, Đại Trưởng lão Dhammapāla đã nói rằng “trong bốn mươi lăm năm, mười lăm năm đầu là thời kỳ giác ngộ đầu tiên”.
Evañca sati majjhe pannarasa vassāni majjhimabodhi, ante pannarasa vassāni pacchimabodhīti tiṇṇaṃ bodhīnaṃ samappamāṇatā siyāti tampi yuttaṃ.
This being so, the middle fifteen years would be the middle period of awakening, and the final fifteen years would be the last period of awakening; thus, the three periods of awakening would be of equal duration, so that is also reasonable.
Và nếu vậy, mười lăm năm giữa là thời kỳ giác ngộ trung gian, và mười lăm năm cuối là thời kỳ giác ngộ cuối cùng, thì ba thời kỳ giác ngộ này sẽ có cùng thời lượng, điều đó cũng hợp lý.
Pannarasattikena hi pañcacattālīsa vassāni pūrenti.
Indeed, three sets of fifteen years complete forty-five years.
Vì ba lần mười lăm năm là bốn mươi lăm năm.
Aṭṭhakathāyaṃ pana pannarasavassappamāṇāya paṭhamabodhiyā vīsativassesuyeva antogadhattā ‘‘paṭhamabodhiyaṃ vīsativassantare’’ti vuttanti evampi sakkā viññātuṃ.
In the commentary, however, since the first period of awakening, which has a duration of fifteen years, is included within the twenty years, it can also be understood that this is why it was said, “within the twenty years of the first period of awakening.”
Tuy nhiên, trong Chú giải, vì thời kỳ giác ngộ đầu tiên có thời lượng mười lăm năm đã được bao gồm trong hai mươi năm, nên đã nói “trong hai mươi năm của thời kỳ giác ngộ đầu tiên”. Như vậy cũng có thể hiểu được.
Nanu ca kānici sikkhāpadāni paññapetvāpi na tāva āṇāpātimokkhaṃ anuññātaṃ pacchā therassa āyācanena anuññātattā, tasmā kathametaṃ vuttaṃ ‘‘sikkhāpadapaññattikālato pana pabhuti āṇāpātimokkhameva uddisīyatī’’ti, yadipi kānici sikkhāpadāni paññapetvāva āṇāpātimokkhaṃ na anuññātaṃ, tathāpi apaññatte sikkhāpade āṇāpātimokkhaṃ natthi, kintu paññatteyevāti imamatthaṃ dassetuṃ ‘‘sikkhāpadapaññattikālato pana pabhutī’’ti vuttaṃ.
But surely, even after laying down some training rules, the Āṇā-pātimokkha was not yet permitted, as it was permitted later at the request of the elder. Therefore, how can it be said, “But from the time of the laying down of the training rules, only the Āṇā-pātimokkha was recited”? Although the Āṇā-pātimokkha was not permitted just by laying down some training rules, nevertheless, when no training rule has been laid down, there is no Āṇā-pātimokkha; it exists only when they have been laid down. To show this meaning, it was said, ‘But from the time of the laying down of the training rules…’
Chẳng phải, dù đã chế định một số giới luật, Pātimokkha theo lệnh (āṇāpātimokkha) vẫn chưa được cho phép, vì sau đó nó mới được cho phép theo lời thỉnh cầu của Trưởng lão, vậy thì làm sao có thể nói “kể từ thời điểm chế định giới luật, chỉ có Āṇāpātimokkha được tụng đọc”? Dù Āṇāpātimokkha chưa được cho phép ngay cả sau khi một số giới luật đã được chế định, nhưng không có Āṇāpātimokkha khi giới luật chưa được chế định, mà chỉ khi giới luật đã được chế định. Để chỉ ra ý nghĩa này, câu “sikkhāpadapaññattikālato pana pabhutī” (kể từ thời điểm chế định giới luật) đã được nói đến.
Pubbārāmeti sāvatthiyā pācīnadisābhāge katattā evaṃladdhavohāre mahāvihāre.
Pubbārāme: in the great monastery that received this name because it was built in the eastern part of Sāvatthī.
Pubbārāme (trong tu viện Đông) có nghĩa là trong đại tu viện được gọi như vậy vì nó được xây dựng ở phía đông của Sāvatthī.
Migāramātupāsādeti migāraseṭṭhino mātuṭṭhāniyattā migāramātāti saṅkhyaṃ gatāya visākhāmahāupāsikāya kārite pāsāde.
Migāramātupāsāde: in the storied building constructed by the great laywoman Visākhā, who was given the designation Migāramātā because she stood in the position of mother to the wealthy merchant Migāra.
Migāramātupāsāde (trong cung điện của mẹ Migāra) có nghĩa là trong cung điện được xây dựng bởi Đại Ưu-bà-tắc Visākhā, người được gọi là Migāramātā (mẹ của Migāra) vì bà ở vị trí mẹ của trưởng giả Migāra.
Aṭṭhānanti hetupaṭikkhepo.
Aṭṭhānaṁ is a rejection of the cause (hetu).
Aṭṭhānaṃ (không có lý do) là sự phủ nhận nguyên nhân (hetu).
Anavakāsoti paccayapaṭikkhepo.
Anavakāso is a rejection of the condition (paccaya).
Anavakāso (không có cơ hội) là sự phủ nhận điều kiện (paccaya).
Ubhayenapi kāraṇameva paṭikkhipati.
By both, the reason itself is rejected.
Cả hai đều phủ nhận nguyên nhân.
Yanti yena kāraṇena.
Yaṁ means for which reason.
Yaṃ (điều mà) có nghĩa là bằng nguyên nhân nào.
Tesanti bhikkhūnaṃ.
Tesaṁ means of those bhikkhus.
Tesaṃ (của các vị đó) có nghĩa là của các Tỳ-khưu.
Sammukhasāvakānaṃ santike pabbajitāti sabbantimānaṃ subhaddasadisānaṃ sammukhasāvakānaṃ santike pabbajite sandhāya vadati.
Sammukhasāvakānaṁ santike pabbajitā is said with reference to those who went forth in the presence of the very last disciples who were like Subhadda.
Cụm từ sammukhasāvakānaṃ santike pabbajitā (xuất gia trước các đệ tử trực tiếp) được nói đến để chỉ những người đã xuất gia trước các đệ tử trực tiếp cuối cùng, giống như Tôn giả Subhadda.
Khattiyakulādivaseneva vividhā kulāti sambandho.
The connection is: from various families, by way of the khattiya family, and so on.
Sự liên hệ là họ đến từ nhiều gia tộc khác nhau, như gia tộc Sát-đế-lợi (khattiyakula) v.v..
Uccanīcauḷāruḷārabhogādikulavasena vāti uccanīcakulavasena uḷāruḷārabhogādikulavasena vāti yojetabbaṃ.
Uccanīcauḷāruḷārabhogādikulavasena vā: This should be construed as: by way of high and low families, or by way of families with grand and even grander wealth, and so on.
Cụm từ uccanīcauḷāruḷārabhogādikulavasena vā (hoặc do gia tộc cao thấp, hoặc do gia tộc có tài sản dồi dào và xuất chúng, v.v.) nên được phối hợp như sau: do gia tộc cao thấp, hoặc do gia tộc có tài sản dồi dào và xuất chúng, v.v..
Tattha khattiyabrāhmaṇavasena vā khattiyabrāhmaṇagahapatikānaṃ vasena vā uccakulatā veditabbā, sesānaṃ vasena nīcakulatā.
Therein, high birth should be understood by way of khattiyas and brāhmaṇas, or by way of khattiyas, brāhmaṇas, and householders; low birth by way of the remaining ones.
Trong đó, gia tộc cao quý (uccakulatā) nên được hiểu là do gia tộc Sát-đế-lợi (khattiya) và Bà-la-môn (brāhmaṇa), hoặc do gia tộc Sát-đế-lợi, Bà-la-môn và gia chủ (gahapati); còn gia tộc thấp kém (nīcakulatā) là do các gia tộc còn lại.
Uḷāruḷārabhogādikulavasena vāti uḷārataratamaupabhogavantādikulavasena.
Or by way of families with increasingly great wealth, etc. means by way of families possessing exceedingly great enjoyments, etc.
Cụm từ uḷāruḷārabhogādikulavasena vā (hoặc do gia tộc có tài sản dồi dào và xuất chúng, v.v.) có nghĩa là do gia tộc có tài sản thù thắng và tối thượng, v.v..
Uḷārātisayajotanatthañhi puna uḷāraggahaṇaṃ ‘‘dukkhadukkha’’ntiādīsu viya.
For the word uḷāra is repeated to indicate an exceptional degree of greatness, like in such cases as “dukkha, dukkha.”
Quả thật, việc lặp lại từ uḷāra (dồi dào) là để nhấn mạnh sự dồi dào tột bậc, giống như trong các trường hợp như “dukkhadukkha” (khổ khổ) v.v..
Ādi-saddena uḷārānuḷārānaṃ gahaṇaṃ veditabbaṃ.
By the word etc., the inclusion of great and not-great should be understood.
Với từ v.v. (ādi), nên hiểu là bao gồm cả những tài sản dồi dào và không dồi dào.
Brahmacariyaṃ rakkhantīti vuttamevatthaṃ pakāsetvā dassento āha ‘‘ciraṃ pariyattidhammaṃ pariharantī’’ti.
To clarify and show the very meaning stated in the phrase protecting the holy life, he said, “they maintain the Dhamma of the scriptures for a long time.”
Giải thích ý nghĩa đã được nói đến trong cụm từ brahmacariyaṃ rakkhantī (họ gìn giữ Phạm hạnh), rồi trình bày: “ciraṃ pariyattidhammaṃ pariharantī” (họ gìn giữ Pháp học lâu dài).
Apaññattepi sikkhāpade yadi samānajātiādikā siyuṃ, attano attano kulānugataganthaṃ viya na nāseyyuṃ.
Even though a training rule has not been laid down, if they were of similar birth and so on, they would not destroy it, just as they would not destroy the texts handed down in their own families.
Ngay cả khi giới luật chưa được chế định, nếu họ cùng chủng tộc, v.v., thì họ sẽ không làm hư hoại Pháp học như thể đó là bộ kinh được truyền thừa trong gia tộc của mình.
Yasmā pana sikkhāpadampi apaññattaṃ, ime ca bhikkhū na samānajātiādikā, tasmā vināsesunti imamatthaṃ dassetuṃ ‘‘yasmā ekanāmā…pe… tasmā aññamaññaṃ viheṭhentā’’tiādi vuttaṃ.
To show this meaning—"Because a training rule has not been laid down, and these bhikkhus are not of similar birth and so on, therefore they will destroy it"—the passage beginning with “because they have the same name… therefore, harassing one another” was stated.
Nhưng vì giới luật chưa được chế định, và những vị Tỳ-khưu này không cùng chủng tộc, v.v., nên để chỉ ra rằng họ sẽ làm hư hoại Pháp học, đã nói “yasmā ekanāmā…pe… tasmā aññamaññaṃ viheṭhentā” (vì họ có tên khác nhau… v.v… nên họ quấy nhiễu lẫn nhau).
Yadi evaṃ kasmā ciraṭṭhitikavārepi ‘‘nānānāmā’’tiādi vuttanti?
If this is so, why was the passage beginning with “having different names” also stated in the section on long-lastingness?
Nếu vậy, tại sao trong phần về sự tồn tại lâu dài (ciraṭṭhitikavāra) cũng nói “nānānāmā” (có tên khác nhau) v.v. vậy?
Satipi tesaṃ nānājaccādibhāve sikkhāpadapaññattiyā eva sāsanassa cirappavattīti dassanatthaṃ vuttaṃ.
It was stated to show that even though they have different births and so on, the Dispensation endures for a long time only through the laying down of training rules.
Điều đó được nói ra để chỉ rằng, ngay cả khi họ có chủng tộc khác nhau, v.v., thì sự tồn tại lâu dài của giáo pháp chỉ là do sự chế định giới luật.
Sikkhāpadapaññattivaseneva sāsanassa cirappavatti.
The Dispensation endures for a long time only by the power of laying down training rules.
Sự tồn tại lâu dài của giáo pháp là do sự chế định giới luật.
Yasmā buddhā attano parinibbānato uddhampi vinetabbasattasambhave sati sikkhāpadaṃ paññapenti, asati na paññapenti, tasmāti veditabbo.
This should be understood as follows: Because Buddhas lay down a training rule if there is a possibility of beings to be disciplined even after their final Nibbāna, and do not lay one down if there is no such possibility.
Nên hiểu rằng, chư Phật chế định giới luật khi có những chúng sanh cần được giáo hóa sau khi Ngài nhập Niết-bàn, nếu không có thì Ngài không chế định.
Yathā kāyavacīdvārasaṅkhātaṃ viññattiṃ samuṭṭhāpetvā pavattamānampi cittaṃ tassāyeva viññattiyā vasena pavattanato ‘‘kāyavacīdvārehi pavatta’’nti vuccati, evaṃsampadamidaṃ daṭṭhabbaṃ.
Just as the mind, although arising by generating a bodily or verbal intimation, is said to “arise through the doors of body and speech” because it proceeds by way of that very intimation, so should this example be seen as complete in this way.
Cũng như tâm thức khởi lên và vận hành thông qua sự biểu hiện (viññatti) được gọi là cửa thân và cửa khẩu, nhưng vì nó vận hành theo chính sự biểu hiện đó, nên được gọi là “vận hành qua cửa thân và cửa khẩu”. Điều này cũng nên được hiểu tương tự.
Yathā tanti ettha tanti nipātamattaṃ.
Here in Yathā ta, ta is just a particle.
Trong cụm từ yathā taṃ, từ taṃ chỉ là một tiểu từ.
Vaggasaṅgahapaṇṇāsasaṅgahādīhīti sīlakkhandhavaggamahāvaggādivaggasaṅgahavasena mūlapaṇṇāsamaajhamapaṇṇāsādipaṇṇāsasaṅgahavasena.
Through the collections of divisions, collections of fifties, etc. means by way of the collections of divisions such as the Sīlakkhandhavagga and Mahāvagga, and by way of the collections of fifties such as the Mūlapaṇṇāsa and Majjhimapaṇṇāsa.
Cụm từ vaggasaṅgahapaṇṇāsasaṅgahādīhi (bằng cách tập hợp các phẩm, tập hợp các bộ năm mươi, v.v.) có nghĩa là bằng cách tập hợp các phẩm như phẩm Giới uẩn (Sīlakkhandhavagga), phẩm Đại (Mahāvagga), v.v., và bằng cách tập hợp các bộ năm mươi như bộ năm mươi đầu (Mūlapaṇṇāsa), bộ năm mươi giữa (Majjhimapaṇṇāsa), v.v..
Ādi-saddena saṃyuttādisaṅgaho veditabbo.
By the word etc., the collections of the Saṃyutta Nikāya and so on should be understood.
Với từ v.v. (ādi), nên hiểu là bao gồm cả việc tập hợp các bộ Tương ưng (Saṃyutta), v.v..
Evaṃ vitakketha, mā evaṃ vitakkayitthāti ettha evanti yathānusiṭṭhāya anusāsaniyā vidhivasena paṭisedhanavasena ca pavattitākāraparāmasanaṃ, sā ca sammāvitakkānaṃ micchāvitakkānañca pavattiākāradassanavasena pavattati atthaānisaṃsassa ādīnavassa ca vibhāvanatthaṃ.
Herein, in the phrase “Think thus, do not think thus,” thus refers to the mode of proceeding by way of permission and by way of prohibition in accordance with the given instruction; and that instruction proceeds by way of showing the mode of occurrence of right thoughts and wrong thoughts, in order to explain the benefit and the danger.
Trong cụm từ evaṃ vitakketha, mā evaṃ vitakkayitthā (hãy suy tư như vậy, đừng suy tư như vậy), từ evaṃ (như vậy) là để chỉ sự quán chiếu về cách thức vận hành theo quy định và theo sự ngăn cấm của lời giáo huấn đã được dạy, và lời giáo huấn đó được vận hành bằng cách chỉ ra cách thức vận hành của chánh tư duy và tà tư duy để làm rõ lợi ích và sự nguy hiểm.
Tenāha ‘‘nekkhammavitakkādayo tayo vitakke vitakkethā’’tiādi.
Therefore, he said, “You should think the three thoughts, such as the thought of renunciation,” etc.
Vì vậy, Ngài nói “nekkhammavitakkādayo tayo vitakke vitakkethā” (hãy suy tư ba loại tư duy như tư duy ly dục, v.v.).
Ettha ādi-saddena abyāpādavitakkaavihiṃsāvitakkānaṃ gahaṇaṃ veditabbaṃ.
Here, by the word etc., the inclusion of the thought of non-ill-will and the thought of non-harming should be understood.
Ở đây, với từ v.v. (ādi), nên hiểu là bao gồm tư duy không sân (abyāpādavitakka) và tư duy không hại (avihiṃsāvitakka).
Tattha nekkhammaṃ vuccati lobhato nikkhantattā alobho, nīvaraṇehi nikkhantattā paṭhamajjhānaṃ, sabbākusalehi nikkhantattā sabbo kusalo dhammo, sabbasaṅkhatehi nikkhantattā nibbānaṃ, upanissayato sampayogato ārammaṇakaraṇato ca nekkhammena paṭisaṃyutto vitakko nekkhammavitakko, sammāsaṅkappo.
Therein, nekkhamma is said to be non-greed because it has departed from greed; the first jhāna because it has departed from the hindrances; all wholesome dhammas because they have departed from all unwholesome states; and Nibbāna because it has departed from all conditioned things. The thought associated with nekkhamma—by way of prerequisite condition, by way of association, and by way of taking as object—is the thought of renunciation, which is right intention.
Trong đó, ly dục (nekkhammavitakka) được gọi là vô tham (alobha) vì thoát khỏi tham ái; là sơ thiền vì thoát khỏi các triền cái (nīvaraṇa); là tất cả các pháp thiện vì thoát khỏi tất cả các pháp bất thiện; là Niết-bàn vì thoát khỏi tất cả các pháp hữu vi (saṅkhata). Tư duy liên hệ với ly dục (nekkhammavitakka) do duyên y chỉ, do tương ưng, và do làm đối tượng là tư duy ly dục (nekkhammavitakka), tức là chánh tư duy (sammāsaṅkappa).
So asubhajjhānassa pubbabhāge kāmāvacaro hoti, asubhajjhāne rūpāvacaro, taṃ jhānaṃ pādakaṃ katvā uppannamaggaphalakāle lokuttaro.
It is of the sensual sphere in the preliminary stage of the meditation on foulness; of the fine-material sphere in the meditation on foulness; and supramundane during the time of the path and fruition that arise having made that jhāna a basis.
Tư duy ly dục này thuộc cõi dục (kāmāvacara) ở giai đoạn trước thiền bất tịnh (asubhajjhāna), thuộc cõi sắc (rūpāvacara) trong thiền bất tịnh, và là siêu thế (lokuttara) khi quả và đạo khởi lên sau khi lấy thiền đó làm nền tảng.
Byāpādassa paṭipakkho abyāpādo, kañcipi na byāpādenti etenāti vā abyāpādo, mettā.
The opposite of ill-will is non-ill-will; or, because one does not bear ill-will towards anyone by means of it, it is non-ill-will, which is loving-kindness.
Đối nghịch với sân hận (byāpāda) là vô sân (abyāpāda), hoặc vô sân là từ bi (mettā) vì không làm hại bất cứ ai bằng nó.
Yathāvuttena abyāpādena paṭisaṃyutto vitakko abyāpādavitakko.
The thought associated with non-ill-will, as explained, is the thought of non-ill-will.
Tư duy liên hệ với vô sân đã nói trên là tư duy vô sân (abyāpādavitakka).
So mettājhānassa pubbabhāge kāmāvacaro hoti, mettābhāvanāvasena adhigate paṭhamajjhāne rūpāvacaro, taṃ jhānaṃ pādakaṃ katvā uppannamaggaphalakāle lokuttaro.
It is of the sensual sphere in the preliminary stage of the meditation on loving-kindness; of the fine-material sphere in the first jhāna attained through the development of loving-kindness; and supramundane during the time of the path and fruition that arise having made that jhāna a basis.
Tư duy vô sân này thuộc cõi dục ở giai đoạn trước thiền từ (mettājjhāna), thuộc cõi sắc khi đạt được sơ thiền nhờ tu tập từ bi, và là siêu thế khi quả và đạo khởi lên sau khi lấy thiền đó làm nền tảng.
Vihiṃsāya paṭipakkhā, na vihiṃsanti vā etāya satteti avihiṃsā, karuṇā.
The opposite of harming, or because one does not harm beings by means of it, is non-harming, which is compassion.
Đối nghịch với sự làm hại (vihiṃsā) là không làm hại (avihiṃsā), hoặc không làm hại là bi (karuṇā) vì không làm hại chúng sanh bằng nó.
Tāya paṭisaṃyutto vitakko avihiṃsāvitakko.
The thought associated with it is the thought of non-harming.
Tư duy liên hệ với bi đó là tư duy không hại (avihiṃsāvitakka).
So karuṇājhānassa pubbabhāge kāmāvacaro, karuṇābhāvanāvasena adhigate paṭhamajjhāne rūpāvacaro, taṃ jhānaṃ pādakaṃ katvā uppannamaggaphalakāle lokuttaro.
It is of the sensual sphere in the preliminary stage of the meditation on compassion; of the fine-material sphere in the first jhāna attained through the development of compassion; and supramundane during the time of the path and fruition that arise having made that jhāna a basis.
Tư duy không hại này thuộc cõi dục ở giai đoạn trước thiền bi (karuṇājjhāna), thuộc cõi sắc khi đạt được sơ thiền nhờ tu tập bi, và là siêu thế khi quả và đạo khởi lên sau khi lấy thiền đó làm nền tảng.
Nanu ca alobhādosāmohānaṃ aññamaññāvirahato nesaṃ vasena uppajjanakānaṃ imesaṃ nekkhammavitakkādīnaṃ aññamaññaṃ asaṅkarato vavatthānaṃ na hotīti?
Is it not the case that because non-greed, non-hatred, and non-delusion are inseparable from one another, there is no distinct classification, unmixed with one another, for these thoughts of renunciation and so on, which arise through them?
Há chẳng phải vì vô tham, vô sân, vô si không tách rời nhau, nên các tư duy ly dục, v.v., khởi lên từ chúng cũng không thể phân biệt rạch ròi với nhau sao?
No na hoti.
It is not that there is none.
Không, không phải vậy.
Yadā hi alobho padhāno hoti niyamitapariṇatasamudācārādivasena, tadā itare dve tadanvāyikā bhavanti.
For when non-greed is predominant—by way of determined, inclined, and habitual practice, etc.—then the other two follow it.
Khi vô tham là chính yếu, do sự định hướng, sự chín muồi, sự thực hành liên tục, v.v., thì hai pháp kia (vô sân, vô si) trở thành tùy thuộc.
Tathā hi yadā alobhappadhāno nekkhammagaruko cittuppādo hoti, tadā laddhāvasaro nekkhammavitakko patiṭṭhahati.
Indeed, when a state of mind arises that is predominated by non-greed and gives weight to renunciation, then the thought of renunciation, having found its opportunity, becomes established.
Thật vậy, khi tâm sở hữu vô tham là chính yếu và sự khởi tâm chú trọng đến ly dục, thì tư duy ly dục có cơ hội và được thiết lập.
Taṃsampayuttassa pana adosalakkhaṇassa abyāpādassa vasena yo tasseva abyāpādavitakkabhāvo sambhaveyya, sati ca abyāpādavitakkabhāve kassacipi aviheṭhanajātikatāya avihiṃsāvitakkabhāvo ca sambhaveyya.
Moreover, the state of being a thought of non-ill-will could arise by way of the non-hatred which has the characteristic of non-ill-will and is associated with it; and if the state of being a thought of non-ill-will exists, the state of being a thought of non-harming could also arise, due to its nature of not oppressing anyone at all.
Tuy nhiên, do đặc tính vô sân của tâm tương ưng với nó, có thể có trạng thái tư duy vô sân của chính nó, và khi có trạng thái tư duy vô sân, cũng có thể có trạng thái tư duy vô hại do bản chất không làm hại bất cứ ai.
Te itare dve tasseva nekkhammavitakkassa anugāmino sarūpato adissanato tasmiṃ sati honti, asati na hontīti anumāneyyā bhavanti.
Those other two follow that very thought of renunciation; they are to be inferred as existing when it exists and not existing when it is absent, since they are not seen in their own form.
Hai pháp kia (tư duy vô sân và tư duy vô hại) là tùy thuộc vào tư duy ly dục đó, chúng hiện hữu khi tư duy ly dục có mặt và không hiện hữu khi tư duy ly dục không có mặt, do đó chúng được suy luận là có mặt chứ không hiển lộ rõ ràng.
Evameva yadā mettāpadhāno cittuppādo hoti, tadā itare dve tadanvāyikā bhavanti.
In the very same way, when a state of mind arises that is predominated by loving-kindness, then the other two follow it.
Tương tự như vậy, khi sự khởi tâm chú trọng đến từ bi là chính yếu, thì hai pháp kia trở thành tùy thuộc.
Yadā karuṇāpadhāno cittuppādo hoti, tadā itare dve tadanvāyikā bhavanti.
When a state of mind arises that is predominated by compassion, then the other two follow it.
Khi sự khởi tâm chú trọng đến bi là chính yếu, thì hai pháp kia trở thành tùy thuộc.
Kāmavitakkādayoti ettha ādi-saddena byāpādavitakkavihiṃsāvitakkānaṃ gahaṇaṃ veditabbaṃ.
In thoughts of sensuality, etc., by the word etc., the inclusion of the thought of ill-will and the thought of harming should be understood.
Trong cụm từ kāmavitakkādayo (các tư duy dục, v.v.), với từ v.v. (ādi), nên hiểu là bao gồm tư duy sân hận (byāpādavitakka) và tư duy làm hại (vihiṃsāvitakka).
Tattha kāmapaṭisaṃyutto vitakko kāmavitakko.
Therein, a thought associated with sensuality is the thought of sensuality.
Trong đó, tư duy liên hệ với dục là tư duy dục (kāmavitakka).
Ettha hi dve kāmā vatthukāmo ca kilesakāmo ca.
Here there are two kinds of sensuality: sensuality as object and sensuality as defilement.
Ở đây có hai loại dục: dục cảnh (vatthukāma) và dục phiền não (kilesakāma).
Tattha vatthukāmapakkhe ārammaṇavasena kāmehi paṭisaṃyutto vitakko kāmavitakko, kilesakāmapakkhe pana sampayogavasena kāmena paṭisaṃyuttoti yojetabbaṃ.
Therein, on the side of sensuality as object, a thought associated with sensual objects by way of object is a thought of sensuality; whereas on the side of sensuality as defilement, it should be connected as a thought associated with sensuality by way of association.
Trong đó, đối với dục cảnh, tư duy liên hệ với dục theo phương diện đối tượng là tư duy dục; còn đối với dục phiền não, nên phối hợp là tư duy liên hệ với dục theo phương diện tương ưng.
Byāpādapaṭisaṃyutto vitakko byāpādavitakko.
A thought associated with ill-will is the thought of ill-will.
Tư duy liên hệ với sân hận là tư duy sân hận (byāpādavitakka).
Vihiṃsāpaṭisaṃyutto vitakko vihiṃsāvitakko.
A thought associated with harming is the thought of harming.
Tư duy liên hệ với sự làm hại là tư duy làm hại (vihiṃsāvitakka).
Tesu dve sattesupi saṅkhāresupi uppajjanti.
Among them, two arise in relation to both beings and formations.
Trong số đó, hai loại (tư duy dục và tư duy sân hận) khởi lên đối với cả chúng sanh và các pháp hữu vi.
Kāmavitakko hi piye manāpe satte vā saṅkhāre vā vitakkentassa uppajjati, byāpādavitakko appiye amanāpe satte vā saṅkhāre vā kujjhitvā olokanakālato paṭṭhāya yāva vināsanā uppajjati, vihiṃsāvitakko saṅkhāresu nuppajjati.
For the thought of sensuality arises for one thinking about dear and agreeable beings or formations; the thought of ill-will arises with anger from the moment of seeing up to their destruction, in relation to disagreeable and unagreeable beings or formations; the thought of harming does not arise in relation to formations.
Tư duy dục khởi lên khi một người suy tư về chúng sanh hoặc các pháp hữu vi đáng yêu, dễ chịu. Tư duy sân hận khởi lên từ lúc nhìn chúng sanh hoặc các pháp hữu vi không đáng yêu, không dễ chịu với sự tức giận cho đến khi chúng bị hủy diệt. Tư duy làm hại không khởi lên đối với các pháp hữu vi.
Saṅkhāro hi dukkhāpetabbo nāma natthi, ‘‘ime sattā haññantu vā ucchijjantu vā vinassantu vā mā vā ahesu’’nti cintanakāle pana sattesu uppajjati.
For there is no such thing as a formation that can be afflicted with suffering; but it arises in relation to beings at the time of thinking, “May these beings be struck down or cut off or destroyed or cease to be.”
Thật vậy, không có pháp hữu vi nào có thể bị làm cho đau khổ. Nhưng khi tâm nghĩ: “Mong cho những chúng sanh này bị giết, bị diệt vong, bị hủy hoại, hoặc không tồn tại”, thì tư duy này khởi lên đối với chúng sanh.
Atha kasmā vuttaṃ ‘‘saṅkhāro dukkhāpetabbo nāma natthī’’ti, nanu ye dukkhāpetabbāti icchitā sattasaññitā, tepi atthato saṅkhārā evāti?
Then why was it said, “There is no such thing as a formation that can be afflicted with suffering”? Are not those which are intended to be afflicted with suffering, being designated as beings, also formations in reality?
Vậy tại sao lại nói: “Không có pháp hữu vi nào có thể bị làm cho đau khổ”? Há chẳng phải những gì được mong muốn làm cho đau khổ, được gọi là chúng sanh, thì về bản chất cũng chỉ là các pháp hữu vi sao?
Saccametaṃ, te pana indriyabaddhā saviññāṇakatāya dukkhaṃ paṭisaṃvedenti, tasmā te vihiṃsāvitakkassa visayā icchitā sattasaññitā.
That is true. But since they are bound to sense faculties and possess consciousness, they feel suffering; therefore, they are intended as the objects of the thought of harming and are designated as beings.
Điều đó là đúng. Nhưng những chúng sinh bị ràng buộc bởi các căn (indriya) ấy, vì có thức (saviññāṇakatā), nên cảm nhận khổ (dukkha). Do đó, những đối tượng của tà tư duy làm hại (vihiṃsāvitakka) được mong muốn ấy được gọi là chúng sinh (sattasaññitā).
Ye pana na dukkhaṃ paṭisaṃvedenti vuttalakkhaṇāyogato, te sandhāya ‘‘vihiṃsāvitakko saṅkhāresu nuppajjatī’’ti vuttaṃ.
Referring to those which do not feel suffering because they lack the aforementioned characteristic, it was said, “The thought of harming does not arise in relation to formations.”
Còn những ai không cảm nhận khổ (dukkha) do không có các đặc tính đã nêu, thì lời nói ‘‘tà tư duy làm hại (vihiṃsāvitakka) không khởi lên trong các hành (saṅkhāra)’’ là để ám chỉ đến họ.
Anupādāya āsavehi cittāni vimucciṃsūti ettha āsavehīti katthuatthe karaṇaniddeso, cittānīti paccattabahuvacanaṃ, vimucciṃsūti kammasādhanaṃ, tasmā āsavehi kattubhūtehi anupādāya ārammaṇavasena aggahetvā cittāni vimuccitānīti evamettha attho gahetabboti āha ‘‘tesañhi cittānī’’tiādi.
In the phrase “Anupādāya āsavehi cittāni vimucciṃsū” (without clinging, their minds were liberated from the corruptions), the word “āsavehi” is an instrumental case in the sense of the agent; “cittāni” is a nominative plural; “vimucciṃsū” is a passive construction. Therefore, the meaning here should be understood as: “The minds were liberated by the āsavas acting as agents, without being grasped as objects.” Thus, he says “tesañhi cittānī,” etc.
Trong câu Anupādāya āsavehi cittāni vimucciṃsū (tâm của họ được giải thoát khỏi các lậu hoặc mà không chấp thủ), ở đây, từ āsavehi là một chỉ định cách (karaṇaniddesa) theo nghĩa chủ cách (kattu-attha), cittāni là số nhiều của chủ cách (paccatta-bahuvacana), và vimucciṃsū là bị động (kamma-sādhana). Do đó, nghĩa ở đây phải được hiểu là: các tâm (citta) đã được giải thoát bởi các lậu hoặc (āsava) với tư cách là chủ thể, mà không chấp thủ theo nghĩa đối tượng (ārammaṇa). Vì vậy, lời này đã được nói: ‘‘tesañhi cittānī’’ (tâm của họ) và tiếp theo.
Yehi āsavehīti etthāpi kattuatthe eva karaṇaniddeso.
Also in the phrase “Yehi āsavehī” (by which corruptions), the instrumental case is in the sense of the agent.
Ở đây, trong câu Yehi āsavehī (bởi những lậu hoặc nào), cũng là một chỉ định cách (karaṇaniddesa) theo nghĩa chủ cách (kattu-attha).
Vimucciṃsūti kammasādhanaṃ.
“Vimucciṃsū” is a passive construction.
Vimucciṃsū là bị động (kamma-sādhana).
Na te tāni gahetvā vimucciṃsūti te āsavā tāni cittāni ārammaṇavasena na gahetvā vimucciṃsu vimocesuṃ.
“Na te tāni gahetvā vimucciṃsū” means: Those āsavas, without grasping those minds as objects, were released, they released them.
Na te tāni gahetvā vimucciṃsū có nghĩa là: những lậu hoặc (āsava) ấy không chấp thủ những tâm (citta) ấy theo nghĩa đối tượng (ārammaṇa), mà giải thoát chúng.
Ettha hi cittānīti upayogabahuvacanaṃ, vimucciṃsūti kattusādhanaṃ.
Herein, “cittāni” is a plural of application, and “vimucciṃsū” is an active construction.
Ở đây, cittānī là số nhiều của đối cách (upayoga-bahuvacana), và vimucciṃsū là chủ động (kattu-sādhana).
Anuppādanirodhena nirujjhamānāti āyatiṃ anuppattisaṅkhātena nirodhena nirujjhamānā āsavā.
“Anuppādanirodhena nirujjhamānā” means: the āsavas ceasing through the cessation known as non-arising in the future.
Anuppādanirodhena nirujjhamānā có nghĩa là: các lậu hoặc (āsava) đang diệt đi bằng sự đoạn diệt (nirodha) được gọi là không tái sinh (anuppatti) trong tương lai.
Aggahetvā vimucciṃsūti ārammaṇakaraṇavasena aggahetvā cittāni vimocesuṃ.
“Aggahetvā vimucciṃsū” means: without grasping them by way of making them an object, they liberated the minds.
Aggahetvā vimucciṃsū có nghĩa là: các tâm (citta) đã được giải thoát mà không chấp thủ theo nghĩa đối tượng (ārammaṇa) và công cụ (karaṇa).
Vikasitacittā ahesunti sātisayañāṇarasmisamphassena samphullacittā ahesuṃ.
“Vikasitacittā ahesuṃ” means: their minds blossomed through contact with the rays of exceptional knowledge.
Vikasitacittā ahesuṃ có nghĩa là: tâm của họ đã nở rộ (samphulla-citta) do tiếp xúc với ánh sáng trí tuệ (ñāṇa-rasmi) siêu việt (sātisaya).
Purimavacanāpekkhanti ‘‘aññatarasmiṃ bhiṃsanake vanasaṇḍe’’ti vuttavacanāpekkhaṃ.
“Purimavacanāpekkhaṃ” means: it is in reference to the previous statement, namely, "in a certain terrifying forest grove."
Purimavacanāpekkhaṃ có nghĩa là: ám chỉ đến lời đã nói ‘‘trong một khu rừng đáng sợ (bhiṃsanaka vanasaṇḍa)’’.
Tenāha ‘‘yaṃ vuttaṃ aññatarasmiṃ bhiṃsanake vanasaṇḍeti, tatrā’’ti.
Therefore, he said, “That which was said, ‘in a certain terrifying forest grove,’—there.”
Do đó, lời này đã được nói: ‘‘yaṃ vuttaṃ aññatarasmiṃ bhiṃsanake vanasaṇḍeti, tatrā’’ (điều đã nói ‘trong một khu rừng đáng sợ nào đó’, ở đó).
Katanti bhāvasādhanavāci idaṃ padanti āha ‘‘bhiṃsanakatasmiṃ hoti, bhiṃsanakakiriyāyā’’ti.
This word “kata” is a term formed in the sense of a state (bhāva). Therefore, he said, “it means ‘in the state of being terrifying,’ ‘of the action of terrifying’.”
Kataṃ là một từ chỉ trạng thái (bhāva-sādhana). Do đó, lời này đã được nói: ‘‘bhiṃsanakatasmiṃ hoti, bhiṃsanakakiriyāyā’’ (nó ở trong trạng thái đáng sợ, trong hành động đáng sợ).
Bhiṃsanassa karaṇaṃ kiriyā bhiṃsanakataṃ, tasmiṃ bhiṃsanakatasmiṃ.
The act or action of terrifying is bhiṃsanakataṃ. In that, is “bhiṃsanakatasmiṃ”.
Hành động tạo ra sự đáng sợ (bhiṃsanā) là bhiṃsanakataṃ. Ở đó, trong bhiṃsanakatasmiṃ (trong trạng thái đáng sợ).
Purisayugavasenāti purisakālavasena, purisānaṃ āyuppamāṇavasenāti vuttaṃ hoti.
“Purisayugavasena” means: by way of a human time-period, that is to say, by way of the measure of human lifespans.
Purisayugavasenā có nghĩa là: theo thời gian của con người, tức là theo tuổi thọ của con người.
‘‘Sabbapacchimako subhaddasadiso’’ti tīsupi gaṇṭhipadesu vuttaṃ.
"The very last one is like Subhadda"—this is stated in all three gaṇṭhipada texts.
‘‘Người cuối cùng giống như Subhadda’’ đã được nói trong cả ba chỗ khó (gaṇṭhipada).
Tasmiṃ kāle vijjamānānaṃ dvinnaṃ purisānaṃ āyuparicchedaṃ sakalameva gahetvā ‘‘satasahassaṃ…pe… aṭṭhāsī’’ti vuttaṃ.
Taking the entire lifespan-limit of the two persons existing at that time, it was said “one hundred thousand... lasted for eighty.”
Vào thời điểm đó, tuổi thọ của hai người đang sống đã được tính toàn bộ và nói là ‘‘một trăm ngàn…pe… tám mươi’’.
Dveyeva purisayugānīti ettha purisānaṃ yugappavattikālo purisayugaṃ.
Here, in “dveyeva purisayugāni” (only two human generations), the period of a pair of humans' occurrence is purisayugaṃ.
Trong câu Dveyeva purisayugānī (chỉ có hai cặp người), purisayugaṃ là thời gian mà các cặp người xuất hiện.
Abhilāpamattameva cetaṃ, atthato pana purisova purisayugaṃ.
And this is merely a term of expression; in terms of meaning, however, a person is a purisayugaṃ.
Điều này chỉ là một cách diễn đạt, nhưng về mặt ý nghĩa, chính con người là purisayugaṃ.
Dharamāne bhagavati ekaṃ purisayugaṃ, parinibbute ekanti katvā ‘‘dveyeva purisayugānī’’ti vuttaṃ.
It was said “dveyeva purisayugāni” counting one human generation while the Blessed One was alive, and one after he had attained Parinibbāna.
Khi Đức Phật còn tại thế là một cặp người (purisayugaṃ), khi Ngài nhập Niết-bàn là một cặp người, nên đã nói ‘‘chỉ có hai cặp người (purisayugānī)’’.
Parinibbute pana bhagavati ekameva purisayugaṃ asītiyeva vassasahassāni brahmacariyaṃ aṭṭhāsīti veditabbaṃ.
However, it should be understood that after the Blessed One's Parinibbāna, it was only one human generation, and the holy life lasted for just eighty thousand years.
Tuy nhiên, cần phải hiểu rằng khi Đức Phật đã nhập Niết-bàn, chỉ có một cặp người, và đời sống Phạm hạnh (brahmacariya) tồn tại trong tám mươi ngàn năm.
21. Ko anusandhīti pubbāparakathānaṃ kiṃ anusandhānaṃ, ko sambandhoti attho.
21. “Ko anusandhī” means: What is the connection of the preceding and subsequent accounts? What is the relation?
21. Ko anusandhī có nghĩa là: sự liên kết (anusandhāna) hay mối quan hệ (sambandha) giữa các câu chuyện trước và sau là gì.
Sikkhāpadapaññattiyācanāpekkhanti yācīyatīti yācanā, sikkhāpadapaññattiyeva yācanā sikkhāpadapaññattiyācanā, taṃ apekkhatīti sikkhāpadapaññattiyācanāpekkhaṃ bhummavacanaṃ, yāciyamānasikkhāpadapaññattiapekkhaṃ bhummavacananti vuttaṃ hoti.
“Sikkhāpadapaññattiyācanāpekkhaṃ”: "It is requested" (yācīyati), thus it is a request (yācanā); the laying down of a training rule itself is the request (yācanā), a sikkhāpadapaññattiyācanā. It refers to that, hence it is a locative expression (bhummavacanaṃ) which is relative to the request for the laying down of a training rule. It is said to be a locative expression relative to the requested laying down of a training rule.
Sikkhāpadapaññattiyācanāpekkhaṃ có nghĩa là: yācanā là điều được thỉnh cầu (yācīyati), sikkhāpada-paññatti (sự chế định giới học) chính là yācanā (sự thỉnh cầu), điều đó mong đợi (apekkhāti) sự thỉnh cầu chế định giới học là sikkhāpada-paññatti-yācanāpekkhaṃ, đó là một từ chỉ địa điểm (bhummavacana). Điều đó có nghĩa là một từ chỉ địa điểm mong đợi sự thỉnh cầu chế định giới học.
Yācanavisiṭṭhā sikkhāpadapaññattiyeva hi ‘‘tatthā’’ti iminā parāmaṭṭhā, teneva vakkhati ‘‘tattha tassā sikkhāpadapaññattiyā’’ti.
Indeed, it is the laying down of a training rule qualified by the request that is referred to by "therein"; for that very reason, he will say "therein, of that laying down of a training rule".
Thật vậy, chính sự chế định giới học (sikkhāpada-paññatti) được đặc trưng bởi sự thỉnh cầu đã được đề cập (parāmaṭṭhā) bởi từ ‘‘tatthā’’ (ở đó), và vì lý do đó, sẽ nói ‘‘tattha tassā sikkhāpadapaññattiyā’’ (ở đó, của sự chế định giới học đó).
Yaṃ vuttanti ‘‘sikkhāpadaṃ paññapeyyā’’ti iminā yaṃ sikkhāpadapaññapanaṃ vuttaṃ, yācitanti attho.
“Yaṃ vuttaṃ” means: the laying down of a training rule which was stated by “one should lay down a training rule,” meaning, what was requested.
Yaṃ vuttaṃ có nghĩa là: điều đã được nói bằng câu ‘‘sikkhāpadaṃ paññapeyyā’’ (nên chế định giới học), có nghĩa là đã được thỉnh cầu.
Tattha tassā sikkhāpadapaññattiyāti tassaṃ yāciyamānasikkhāpadapaññattiyanti attho.
“Tattha tassā sikkhāpadapaññattiyā” means: therein, regarding that requested laying down of a training rule.
Tattha tassā sikkhāpadapaññattiyā có nghĩa là: trong sự chế định giới học đang được thỉnh cầu đó.
Akālanti sikkhāpadapaññattiyā akālaṃ.
“Akālaṃ” means: not the right time for laying down a training rule.
Akālaṃ có nghĩa là: thời điểm không thích hợp để chế định giới học.
Āsavaṭṭhānīyāti ettha adhikaraṇe anīyasaddoti āha ‘‘āsavā tiṭṭhanti etesū’’tiādi.
Here in “āsavaṭṭhānīyā,” because the suffix -anīya is in the sense of the locative, he says “āsavā tiṭṭhanti etesū” (corruptions stand in these), etc.
Trong câu Āsavaṭṭhānīyā, từ anīya là một hậu tố chỉ địa điểm (adhikaraṇa). Do đó, lời này đã được nói: ‘‘āsavā tiṭṭhanti etesū’’ (các lậu hoặc (āsava) tồn tại trong những điều này) và tiếp theo.
Ke pana te āsavā, ke ca dhammā tadadhikaraṇabhūtāti āha ‘‘yesu diṭṭhadhammikasamparāyikā’’tiādi.
But what are those corruptions, and what are the dhammas that are their basis? He says, “Yesu diṭṭhadhammikasamparāyikā” (In which things seen in this life and in the next life), etc.
Những lậu hoặc (āsava) ấy là gì, và những pháp (dhamma) nào là nền tảng (adhikaraṇa) của chúng? Lời này đã được nói: ‘‘yesu diṭṭhadhammikasamparāyikā’’ (trong đó có những điều thuộc hiện tại và tương lai) và tiếp theo.
Diṭṭhadhammikā parūpavādādayo, samparāyikā āpāyikā apāyadukkhavisesā.
“Diṭṭhadhammikā” are censure by others and so on; “samparāyikā” are the particular sufferings of the states of woe, which occur in those states.
Diṭṭhadhammikā là những lời chỉ trích từ người khác (parūpavāda) và những điều tương tự; samparāyikā là những loại khổ đau đặc biệt ở các cảnh giới thấp (apāya) phát sinh trong các cảnh giới thấp (apāyika).
Te āsavanti tena tena paccayavasena pavattantīti āsavā.
Because they flow on (āsavanti) through various conditions, they are “āsavā” (corruptions).
Những điều ấy phát sinh (pavattanti) theo các duyên (paccaya) khác nhau, nên được gọi là āsavā (lậu hoặc).
Nesanti parūpavādādiāsavānaṃ.
“Nesaṃ” means: of those corruptions such as censure by others.
Nesaṃ là của các lậu hoặc (āsava) như lời chỉ trích từ người khác (parūpavāda) và những điều tương tự.
Teti vītikkamadhammā.
“Te” means: the transgressive dhammas.
Te là các pháp (dhamma) vi phạm.
Asati āsavaṭṭhānīye dhamme sikkhāpadapaññattiyaṃ ko doso, yenevaṃ vuttanti āha ‘‘yadi hi paññapeyyā’’tiādi, vītikkamadosaṃ adisvā yadi paññapeyyāti adhippāyo.
What is the fault in laying down a training rule when there is no dhamma that is a basis for corruption, such that it was said in this way? He says, “yadi hi paññapeyyā” (for if one were to lay it down), etc. The intention is: if one were to lay it down without seeing the fault of transgression.
Nếu không có pháp (dhamma) là nền tảng của lậu hoặc (āsavaṭṭhānīya), thì việc chế định giới học (sikkhāpada-paññatti) có lỗi gì mà lại nói như vậy? Lời này đã được nói: ‘‘yadi hi paññapeyyā’’ (nếu chế định) và tiếp theo. Ý nghĩa là: nếu chế định mà không thấy lỗi vi phạm.
Parammukhā akkosanaṃ parūpavādo, parehi vacanesu dosāropanaṃ parūpārambho, sammukhā garahanaṃ garahadoso.
Abuse behind one's back is “parūpavādo”; attributing faults in the speech of others is “parūpārambho”; criticizing face-to-face is “garahadoso”.
Sự mắng nhiếc sau lưng là parūpavādo (lời chỉ trích từ người khác); sự đổ lỗi cho người khác trong lời nói là parūpārambho (sự trách móc từ người khác); sự quở trách trực tiếp là garahadoso (lỗi quở trách).
Kathañhi nāma paliveṭhessatīti sambandho, kathaṃ-saddayoge anāgatappayogo daṭṭhabbo.
The connection is: “How indeed could it beset him?” In conjunction with the word kathaṃ, the future tense should be noted.
Làm sao mà nó lại quấn lấy được? Đây là mối liên hệ. Cần phải hiểu rằng khi sử dụng từ kathaṃ (làm sao), thì động từ ở thì tương lai (anāgata-ppayoga) được sử dụng.
Anvāyikoti anuvattako.
“Anvāyiko” means: a follower.
Anvāyiko có nghĩa là: người theo sau.
Bhogakkhandhanti bhogarāsiṃ.
“Bhogakkhandhaṃ” means: a mass of wealth.
Bhogakkhandhaṃ có nghĩa là: khối tài sản (bhoga-rāsi).
‘‘Amhākamete’’ti ñāyantīti ñātī, pitāmahapituputtādivasena parivaṭṭanaṭṭhena parivaṭṭo, ñātīyeva parivaṭṭo ñātiparivaṭṭo.
They are known (ñāyanti) as "ours", hence they are relatives (ñātī). Due to the sense of revolving through grandfather, father, son, and so on, it is a circle (parivaṭṭo). The relatives themselves are the circle, “ñātiparivaṭṭo”.
Họ được biết là ‘‘những người này là của chúng ta’’, nên họ là ñātī (thân quyến). Do sự luân chuyển theo ông nội, cha, con, v.v., nên đó là parivaṭṭo (sự luân chuyển). Chính thân quyến là ñātiparivaṭṭo (sự luân chuyển của thân quyến).
Ghāsacchādanaparamatāya santuṭṭhāti ghāsacchādane paramatāya uttamatāya santuṭṭhā, ghāsacchādanapariyesane sallekhavasena paramatāya ukkaṭṭhabhāve saṇṭhitāti attho.
“Ghāsacchādanaparamatāya santuṭṭhā” means: contented with the supreme state regarding simple food and clothing. The meaning is: established in the highest state, excellence, through austerity in the search for simple food and clothing.
Ghāsacchādanaparamatāya santuṭṭhā có nghĩa là: hài lòng với sự tối thượng của thức ăn và y phục, tức là hài lòng với sự tối thượng trong việc tìm kiếm thức ăn và y phục theo cách làm sạch phiền não (sallekha).
Ghāsacchādanameva vā paramaṃ paramā koṭi etesaṃ na tato paraṃ kiñci asāmisajātaṃ pariyesanti paccāsīsanti cāti ghāsacchādanaparamā, tesaṃ bhāvo ghāsacchādanaparamatā, tassaṃ ghāsacchādanaparamatāya santuṭṭhā.
Or, for them, simple food and clothing is the ultimate (paramaṃ), the final limit (paramā koṭi); beyond that they do not seek or hope for anything that is not worldly. Hence, they are ghāsacchādanaparamā. Their state is ghāsacchādanaparamatā. In that “ghāsacchādanaparamatāya santuṭṭhā” (contented with having simple food and clothing as the highest).
Hoặc, thức ăn và y phục là tối thượng, là điểm cao nhất của họ, họ không tìm kiếm hay mong muốn bất cứ điều gì khác không phải là vật chất sau đó. Do đó, họ là ghāsacchādanaparamā (những người xem thức ăn và y phục là tối thượng). Trạng thái của họ là ghāsacchādanaparamatā (sự tối thượng của thức ăn và y phục). Trong trạng thái đó, họ là ghāsacchādanaparamatāya santuṭṭhā (hài lòng với sự tối thượng của thức ăn và y phục).
Tesu nāma koti yathāvuttaguṇavisiṭṭhesu tesu bhikkhūsu ko nāma.
“Tesu nāma ko” means: who indeed among those monks endowed with the aforementioned qualities.
Tesu nāma ko có nghĩa là: trong những Tỳ-kheo có những đức tính như đã nói, ai là người?
Lokāmisabhūtanti lokapariyāpannaṃ hutvā kilesehi āmasitabbattā lokāmisabhūtaṃ.
“Lokāmisabhūtaṃ” means: being included in the world, it is called worldly gain (lokāmisa) because it is to be tainted by defilements.
Lokāmisabhūtaṃ có nghĩa là: vì nó nằm trong thế gian và bị các phiền não (kilesa) chạm đến, nên nó là lokāmisa-bhūtaṃ (vật chất thế gian).
Pabbajjāsaṅkhepenevāti ‘‘pāṇātipātā veramaṇī’’tiādinā pabbajjāmukheneva.
“Pabbajjāsaṅkhepeneva” means: simply through the gateway of ordination, with such phrases as "abstinence from killing living beings".
Pabbajjāsaṅkhepenevā có nghĩa là: chỉ bằng cách xuất gia (pabbajjā-mukha) như ‘‘pāṇātipātā veramaṇī’’ (tránh sát sinh) và những điều tương tự.
Etanti methunādīnaṃ akaraṇaṃ.
“Etaṃ” means: the not doing of sexual intercourse and so on.
Etaṃ có nghĩa là: việc không làm những điều như tà dâm (methuna) và những điều tương tự.
Thāmanti sikkhāpadānaṃ paññāpanakiriyāya sāmatthiyaṃ.
“Thāmaṃ” means: the capability for the act of laying down the training rules.
Thāmaṃ có nghĩa là: năng lực (sāmatthiya) để chế định các giới học (sikkhāpada).
Balanti yāthāvato sabbadhammānaṃ paṭivedhasamatthaṃ ñāṇabalaṃ.
“Balaṃ” means: the power of knowledge, which is capable of penetrating all dhammas as they really are.
Balaṃ có nghĩa là: sức mạnh trí tuệ (ñāṇa-bala) có khả năng thấu hiểu (paṭivedha) tất cả các pháp (dhamma) một cách chân thật (yāthāvato).
Kuppeyyāti kuppaṃ bhaveyya.
“Kuppeyyā” means: it would become unstable.
Kuppeyyā có nghĩa là: sẽ bị lung lay (kuppaṃ bhaveyya).
Etassevatthassa pākaṭakaraṇaṃ na yathāṭhāne tiṭṭheyyāti, paññattiṭṭhāne na tiṭṭheyyāti attho.
The clarification of this very meaning is “na yathāṭhāne tiṭṭheyyā” (it would not stand in its proper place). The meaning is: it would not stand in the place of the regulation.
Việc làm rõ ý nghĩa này là nó không nên đứng đúng chỗ, nghĩa là nó không nên đứng ở vị trí đã được chế định.
Akusaloti tikicchituṃ yuttakālassa aparijānanato akusalo acheko.
“Akusalo” means: unskilled, inept, from not knowing the proper time for treatment.
Akusalo (bất thiện) là do không biết thời điểm thích hợp để chữa trị, là người không khéo léo.
Avuddhi anayo, byasanaṃ dukkhaṃ.
Non-growth is “anayo” (misfortune); “byasanaṃ” is suffering.
Sự không tăng trưởng là anayo (sự bất lợi), byasanaṃ (sự phá hoại) là khổ.
Paṭikaccevāti gaṇḍuppādanato paṭhamameva.
“Paṭikacceva” means: right at the very beginning, before the boil has formed.
Paṭikaccevā (trước khi) là ngay trước khi vết thương sưng mủ.
Sañchaviṃ katvāti sobhanacchaviṃ katvā.
“Sañchaviṃ katvā” means: making the skin appear good.
Sañchaviṃ katvā (làm cho có da thịt) là làm cho có da thịt đẹp.
Bālavejjoti apaṇḍitavejjo.
A foolish physician means: an unwise physician.
Bālavejjo (lang băm) là người thầy thuốc không có trí tuệ.
Lohitakkhayañca maṃ pāpetīti vibhattivipariṇāmaṃ katvā yojetabbaṃ.
It should be connected by changing the case ending thus: 'and it causes me to reach the exhaustion of blood.'
Lohitakkhayañca maṃ pāpetī (khiến ta mất máu) phải được kết nối bằng cách thay đổi cách chia.
Lābhaggamahattanti cīvarādilabhitabbapaccayo lābho, tassa aggaṃ mahattaṃ paṇītatā bahubhāvo vā.
The greatness of the highest gain means: the requisite to be received, such as robes, is gain; its excellence, greatness, is its sublimity or its abundance.
Lābhaggamahattaṃ (sự vĩ đại của các lợi lộc cao nhất) là lợi lộc (lābha) là các vật dụng như y phục, v.v., cần được thọ nhận; sự cao tột (aggaṃ mahattaṃ) của nó là sự thù thắng (paṇītatā) hoặc sự phong phú (bahubhāvo).
Bahussutassa bhāvo bāhusaccaṃ.
The state of one who is learned is great learning.
Trạng thái của người đa văn là bāhusaccaṃ (đa văn).
Ayoniso ummujjamānāti anupāyena abhinivisamānā, viparītato jānamānāti attho.
Emerging unwisely means: applying the mind in an improper way; the meaning is, knowing in a contrary way.
Ayoniso ummujjamānā (những người nổi lên một cách không khéo léo) là những người suy xét một cách không đúng đắn, nghĩa là những người hiểu biết một cách sai lệch.
Rasena rasaṃ saṃsanditvāti sabhāvena sabhāvaṃ saṃsanditvā, anuññātapaccattharaṇādīsu sukhasamphassasāmaññato upādinnaphassarasepi anavajjasaññitāya anupādinnaphassarasena upādinnaphassarasaṃ saṃsanditvā, samānabhāvaṃ upanetvāti attho.
Having compared one flavor with another means: having compared one nature with another nature; because of the commonality of pleasant contact in what is allowed, such as bed-coverings, having a perception of faultlessness even in the flavor of contact with what is animate, having compared the flavor of contact with what is animate with the flavor of contact with what is inanimate, the meaning is, having brought it to a state of similarity.
Rasena rasaṃ saṃsanditvā (so sánh cái vị với cái vị) là so sánh tự tánh với tự tánh, tức là, do sự đồng nhất của xúc lạc trong các vật trải giường được cho phép, v.v., và do sự không đáng chê trách trong xúc vị do sự chấp thủ, nên so sánh xúc vị không chấp thủ với xúc vị chấp thủ, làm cho chúng trở nên tương đồng.
Uddhammaṃ ubbinayaṃ satthusāsanaṃ dīpentīti ‘‘tathāhaṃ bhagavatā dhammaṃ desitaṃ ājānāmī’’tiādinā (pāci. 418) satthusāsanaṃ uddhammaṃ ubbinayaṃ katvā dīpenti.
They explain the Teacher's Sāsana as being against the Dhamma and against the Vinaya means: by saying "Thus do I understand the Dhamma taught by the Blessed One," and so on, they explain the Teacher's Sāsana, making it against the Dhamma and against the Vinaya.
Uddhammaṃ ubbinayaṃ satthusāsanaṃ dīpentī (làm cho giáo pháp của Bậc Đạo Sư trở thành phi pháp, phi luật) là làm cho giáo pháp của Bậc Đạo Sư trở thành phi pháp, phi luật, bằng cách nói "Ta hiểu pháp được Đức Thế Tôn thuyết như vậy" và những điều tương tự.
Sabbaparittaguṇoti sabbehi nihīnaguṇo, appaguṇo vā.
The quality of utmost inferiority means: of inferior quality to all others, or of little quality.
Sabbaparittaguṇo (phẩm chất thấp kém nhất) là phẩm chất thấp kém hơn tất cả, hoặc phẩm chất ít ỏi.
So sotāpannoti ānandattheraṃ sandhāya vadati.
He is a stream-enterer: he says this with reference to the Elder Ānanda.
So sotāpanno (người nhập lưu đó) là nói về Trưởng lão Ānanda.
Sotaṃ āpannoti maggasotaṃ āpanno.
Having entered the stream means: having entered the stream of the path.
Sotaṃ āpanno (người đã nhập vào dòng) là người đã nhập vào dòng Đạo (magga).
Paṭipakkhadhammānaṃ anavasesato savanato pellanato soto ariyamaggoti āha ‘‘sototi ca maggassetaṃ adhivacana’’nti.
Because it completely flows against and crushes opposing states, the noble path is the stream; thus, he said: "And 'stream' is a designation for the path."
Vì Đạo Thánh (ariyamagga) là dòng (sota) do nó loại bỏ (savana) và đè bẹp (pellana) các pháp đối nghịch một cách không còn sót lại, nên nói: "Dòng (sota) là một tên gọi khác của Đạo (magga)".
Sotāpannoti tena samannāgatassa puggalassāti iminā maggasamaṅgī sotāpannoti vatvā tamevatthaṃ udāharaṇena sādhetvā idāni idhādhippetapuggalaṃ niddhāretvā dassento āha ‘‘idha panā’’tiādi.
Of the person endowed with that, a stream-enterer: by this, having said that one endowed with the path is a stream-enterer, and having established that same meaning with an example, he now, determining and showing the person intended here, says: "But here," and so on.
Sotāpannoti tena samannāgatassa puggalassā (người nhập lưu là người có được điều đó), sau khi nói rằng người nhập lưu là người có được Đạo (magga), và chứng minh ý nghĩa đó bằng ví dụ, bây giờ để xác định người được đề cập ở đây, vị ấy nói: "idha panā" (nhưng ở đây) và những điều tương tự.
Idha āpannasaddo ‘‘phalasacchikiriyāya paṭipanno’’tiādīsu (saṃ. ni. 5.488) viya vattamānakālikoti āha ‘‘maggena phalassa nāmaṃ dinna’’nti.
Here, the word āpanna is in the present tense, as in "practicing for the realization of the fruit," and so on; thus, he said: "the name has been given to the fruit by the path."
Ở đây, từ āpanna (đã nhập) là thuộc thì hiện tại, như trong "phalasacchikiriyāya paṭipanno" (đã thực hành để chứng ngộ quả), nên nói: "Đạo được đặt tên là quả".
Maggena hi attanā sadisassa aṭṭhaṅgikassa vā sattaṅgikassa vā phalassa sototi nāmaṃ dinnaṃ, atītakālikatte pana sarasatova nāmalābho siyā.
For by the path, the name "stream" has been given to the fruit that is similar to itself, whether eightfold or sevenfold; but if it were in the past tense, the name would be obtained from its own function.
Thật vậy, Đạo được đặt tên là dòng (sota) cho quả tương tự với nó, hoặc quả có tám chi, hoặc quả có bảy chi; nhưng nếu là thì quá khứ, thì tên gọi sẽ tự nhiên mà có.
Maggakkhaṇe hi maggasotaṃ āpajjati nāma, phalakkhaṇe āpanno.
For, at the moment of the path, one is said to be entering the stream of the path; at the moment of the fruit, one has entered.
Trong khoảnh khắc của Đạo, nó được gọi là nhập vào dòng Đạo, trong khoảnh khắc của quả, nó là đã nhập.
Virūpaṃ sadukkhaṃ saupāyāsaṃ nipātetīti vinipāto, apāyadukkhe khipanako.
It causes one to fall in a perverted, painful, and distressing way, thus it is a downfall; it is that which throws one into the suffering of the lower realms.
Làm cho rơi vào trạng thái xấu xí, đau khổ, phiền não là vinipāto (sự đọa lạc), kẻ ném vào khổ cảnh.
Dhammoti sabhāvo.
State means nature.
Dhammo (pháp) là tự tánh.
Tenāha ‘‘na attānaṃ apāyesu vinipātanasabhāvo’’ti.
Therefore, he said: "it is not of a nature to cause oneself to fall into the lower realms."
Vì vậy, nói: "Không có tự tánh đọa lạc vào các khổ cảnh".
Atha vā dhammoti apāyesu khipanako sakkāyadiṭṭhiādiko akusaladhammo.
Or else, state means an unwholesome state, such as identity-view, which throws one into the lower realms.
Hoặc dhammo (pháp) là pháp bất thiện như tà kiến về thân (sakkāyadiṭṭhi), v.v., kẻ ném vào các khổ cảnh.
Yassa pana so akusaladhammo natthi sabbaso pahīnattā, so yasmā apāyesu attānaṃ vinipātanasabhāvo na hoti, tasmā vuttaṃ ‘‘na attānaṃ apāyesu vinipātanasabhāvoti vuttaṃ hotī’’ti.
But for whom that unwholesome state does not exist because it has been completely abandoned, since he is not of a nature to cause himself to fall into the lower realms, it is therefore said: "it is said to be not of a nature to cause oneself to fall into the lower realms."
Nhưng đối với người mà pháp bất thiện đó không còn nữa do đã được đoạn trừ hoàn toàn, người đó không có tự tánh đọa lạc vào các khổ cảnh, vì vậy đã nói: "Được nói là không có tự tánh đọa lạc vào các khổ cảnh".
Kasmāti avinipātanadhammatāya kāraṇaṃ pucchati.
Why? He asks for the reason for its quality of not leading to downfall.
Kasmā (tại sao) là hỏi về nguyên nhân của trạng thái không đọa lạc.
Apāyaṃ gamentīti apāyagamanīyā.
They lead to the lower realms, thus they are leading to the lower realms.
Những gì dẫn đến khổ cảnh là apāyagamanīyā (những gì dẫn đến khổ cảnh).
Vinipātanasabhāvoti uppajjanasabhāvo.
Of a nature to cause falling means: of a nature to arise.
Vinipātanasabhāvo (có tự tánh đọa lạc) là có tự tánh phát sinh.
Sammattaniyāmena maggenāti sammā bhavaniyāmakena paṭiladdhamaggena.
By the path which is the certainty of rightness means: by the path that has been attained, which is the determinant of the right state.
Sammattaniyāmena maggenā (bằng Đạo được xác định đúng đắn) là bằng Đạo đã đạt được, được xác định đúng đắn.
Niyatoti vā heṭṭhimantato sattamabhavato upari anuppajjanadhammatāya niyato.
Or certain means: certain by nature not to arise above the seventh existence at the lower limit.
Hoặc niyato (đã được xác định) là đã được xác định do không phát sinh trở lại trên bảy kiếp từ kiếp thấp nhất.
Sambodhīti uparimaggattayasaṅkhātā sambodhi.
Enlightenment means: the enlightenment designated as the three higher paths.
Sambodhī (sự giác ngộ hoàn toàn) là sự giác ngộ hoàn toàn được gọi là ba Đạo trên.
Sambujjhatīti hi sambodhi, ariyamaggo.
For one rightly awakens, thus it is enlightenment; the noble path.
Thật vậy, sự giác ngộ hoàn toàn (sambujjhati) là Đạo Thánh (ariyamagga).
So ca idha paṭhamamaggassa adhigatattā avasiṭṭho eva adhigantabbabhāvena icchitabboti.
And here, since the first path has been attained, only what remains is to be desired as that which is to be attained.
Và ở đây, do Đạo thứ nhất đã được thành tựu, nên phần còn lại cần phải được thành tựu và mong muốn.
Tenāha ‘‘uparimaggattayaṃ avassaṃ sampāpako’’ti.
Therefore, he said: "one who will certainly attain the three higher paths."
Vì vậy, nói: "Người chắc chắn sẽ đạt được ba Đạo trên".
Uparimaggattayaṃ avassaṃ sampāpuṇātīti sampāpako, sotāpanno.
One who will certainly attain the three higher paths is one who will attain; a stream-enterer.
Người chắc chắn sẽ đạt được ba Đạo trên là sampāpako (người đạt được), tức là người nhập lưu (sotāpanno).
22. Anudhammatāti lokuttaradhammānugato dhammo.
22. Conformity with the Dhamma means: the Dhamma that follows the supramundane Dhamma.
22. Anudhammatā (sự phù hợp với Pháp) là pháp phù hợp với các pháp siêu thế.
Anapaloketvāti padassa vivaraṇaṃ ‘‘anāpucchitvā’’ti.
The explanation of the word without informing is "without asking."
Anapaloketvā (không hỏi ý kiến) là giải thích của từ "anāpucchitvā" (không hỏi).
Janapadacārikaṃ pakkamantīti ettha iti-saddo gamyamānatāya na vutto, evaṃ aññatthāpi īdisesu ṭhānesu.
In the phrase they set out on a tour of the countryside, the word iti is not stated, as it is understood; so too in other such places.
Trong câu "Janapadacārikaṃ pakkamantī" (đi du hành trong các quận), từ "iti" không được nói ra vì nó được hiểu ngầm, và tương tự ở những chỗ khác như vậy.
Tattha janapadacārikanti janapadesu caraṇaṃ, caraṇaṃ vā cāro, so eva cārikā, janapadesu cārikā janapadacārikā.
Therein, a tour of the countryside means: journeying in the countrysides; or, journeying is a tour, and that itself is a tour (cārikā); a tour in the countrysides is a tour of the countryside.
Ở đó, janapadacārikaṃ (sự du hành trong các quận) là sự đi lại trong các quận; hoặc sự đi lại là cāro, chính sự đi lại đó là cārikā; sự du hành trong các quận là janapadacārikā.
Taṃ pakkamanti, janapadagamanaṃ gacchantīti attho.
They set out on that; the meaning is, they go on a journey to the countryside.
Họ đi du hành đó, nghĩa là họ đi du hành trong các quận.
Pakkamantiyevāti avadhāraṇena no na pakkamantīti dasseti.
They certainly do set out shows by the emphasis that it is not that they do not set out.
Pakkamantiyevā (chắc chắn đi) cho thấy rằng không phải là không đi bằng cách nhấn mạnh.
‘‘Janapadacārikaṃ pakkamantī’’ti ettha ṭhatvā bhagavato cārikāpakkamanavidhiṃ dassento āha ‘‘janapadacārikaṃ carantā cā’’tiādi.
Standing in the phrase "they set out on a tour of the countryside," and showing the Blessed One's method of setting out on a tour, he says: "And while wandering on a tour of the countryside," and so on.
Đứng ở chỗ "Janapadacārikaṃ pakkamantī" (đi du hành trong các quận), để trình bày cách Đức Thế Tôn đi du hành, vị ấy nói: "Janapadacārikaṃ carantā cā" (khi đi du hành trong các quận) và những điều tương tự.
Cārikā ca nāmesā (dī. ni. aṭṭha. 1.254; ma. ni. aṭṭha. 1.254) duvidhā turitacārikā ceva aturitacārikā ca.
And this tour is of two kinds: the swift tour and the unhurried tour.
Và sự du hành này (cārikā) có hai loại: du hành nhanh (turitacārikā) và du hành không nhanh (aturitacārikā).
Tattha dūrepi bodhaneyyapuggalaṃ disvā tassa bodhanatthāya sahasā gamanaṃ turitacārikā nāma, sā mahākassapattherapaccuggamanādīsu daṭṭhabbā.
Therein, seeing a person to be enlightened even at a distance, and going quickly for the purpose of enlightening him, is called a swift tour; it should be seen in the cases of going to meet the Elder Mahākassapa and others.
Trong đó, việc đi nhanh chóng để giác ngộ một người đáng được giác ngộ khi thấy người đó ở xa là turitacārikā (du hành nhanh), điều này có thể thấy trong việc đón Trưởng lão Mahākassapa, v.v.
Bhagavā hi mahākassapattheraṃ paccuggacchanto muhuttena tigāvutamagamāsi, āḷavakassatthāya tiṃsayojanaṃ, tathā aṅgulimālassa, pukkusātissa pana pañcacattālīsayojanaṃ, mahākappinassa vīsayojanasataṃ, dhaniyassatthāya sattayojanasatāni agamāsi, dhammasenāpatino saddhivihārikassa vanavāsītissasāmaṇerassa tigāvutādhikaṃ vīsayojanasataṃ agamāsi, ayaṃ turitacārikā.
Indeed, the Blessed One, going to meet the Elder Mahākassapa, traveled three gāvutas in a moment; for the sake of Āḷavaka, he traveled thirty yojanas; similarly for Aṅgulimāla; but for Pukkusāti, forty-five yojanas; for Mahākappina, one hundred and twenty yojanas; for the sake of Dhaniya, he traveled seven hundred yojanas; for the sake of the novice Vanavāsītissa, the co-resident of the General of the Dhamma, he traveled one hundred and twenty yojanas plus three gāvutas; this is the swift tour.
Thật vậy, Đức Thế Tôn khi đi đón Trưởng lão Mahākassapa đã đi ba gāvuta trong chốc lát; vì Āḷavaka, Ngài đã đi ba mươi yojana; tương tự vì Aṅgulimāla; nhưng vì Pukkusāti, Ngài đã đi bốn mươi lăm yojana; vì Mahākappina, Ngài đã đi một trăm hai mươi yojana; vì Dhaniya, Ngài đã đi bảy trăm yojana; vì Tissa Sāmaṇera, đệ tử của Pháp Tướng (Dhammasenāpati), Ngài đã đi một trăm hai mươi yojana cộng thêm ba gāvuta; đây là turitacārikā.
Yaṃ pana gāmanigamanagarapaṭipāṭiyā devasikaṃ yojanaaḍḍhayojanavasena piṇḍapātacariyādīhi lokaṃ anuggaṇhantassa gamanaṃ, ayaṃ aturitacārikā nāma.
But the journeying in sequence through villages, market-towns, and cities, showing compassion to the world daily by means of the alms-round and so on, traveling a yojana or a yojana and a half, this is called the unhurried tour.
Còn sự đi lại của vị Thế Tôn, hằng ngày theo thứ tự làng, thị trấn, thành phố, mỗi ngày một dojana hoặc nửa dojana, với các hạnh khất thực và các hạnh khác, để độ hóa chúng sinh, đó gọi là aturitacārikā (du hành không vội vã).
Imaṃ pana cārikaṃ caranto bhagavā mahāmaṇḍalaṃ majjhimamaṇḍalaṃ antimamaṇḍalanti imesaṃ tiṇṇaṃ maṇḍalānaṃ aññatarasmiṃ carati.
And while undertaking this tour, the Blessed One wanders in one of these three regions: the great region, the middle region, and the outer region.
Đức Thế Tôn khi thực hiện chuyến du hành này, Ngài du hành trong một trong ba vòng tròn này: đại vòng tròn (mahāmaṇḍala), trung vòng tròn (majjhimamaṇḍala) và tiểu vòng tròn (antimamaṇḍala).
Tattha ‘‘janapadacārika’’nti vuttattā aturitacārikāva idhādhippetā.
Therein, since "a tour of the countryside" is mentioned, it is the unhurried tour that is intended here.
Trong đó, vì đã nói “du hành trong xứ” (janapadacārikā), nên ở đây chỉ đề cập đến aturitacārikā.
Tameva vibhajitvā dassento āha ‘‘mahāmaṇḍalaṃ majjhimamaṇḍala’’ntiādi.
Dividing and showing that very thing, he said, "The great sphere, the middle sphere," and so on.
Để phân tích và trình bày điều đó, đã nói “đại vòng tròn, trung vòng tròn” và vân vân.
Tattha antimamaṇḍalanti khuddakamaṇḍalaṃ, itaresaṃ vā maṇḍalānaṃ antogadhattā antimamaṇḍalaṃ, abbhantarimamaṇḍalanti vuttaṃ hoti.
Therein, "the final sphere" means the small sphere. Or, because it is included within the other spheres, it is the final sphere; this means it is called the innermost sphere.
Trong đó, tiểu vòng tròn (antimamaṇḍala) là vòng tròn nhỏ, hoặc vì nó nằm trong các vòng tròn khác nên gọi là tiểu vòng tròn, tức là vòng tròn bên trong.
Imesaṃ pana maṇḍalānaṃ kiṃ pamāṇanti āha ‘‘tattha mahāmaṇḍalaṃ navayojanasatika’’ntiādi.
Regarding the measure of these spheres, he said, "Therein, the great sphere is nine hundred yojanas," and so on.
Về kích thước của các vòng tròn này, đã nói “trong đó, đại vòng tròn có chín trăm dojana” và vân vân.
Navayojanasatikampi ṭhānaṃ majjhimadesapariyāpannameva, tato paraṃ nādhippetaṃ turitacārikāvasena agamanato.
A place of nine hundred yojanas is also included in the middle country; beyond that is not intended, because of not going by way of a swift tour.
Ngay cả một nơi có chín trăm dojana cũng thuộc về vùng trung tâm (majjhimadesa), không có ý định đi xa hơn vì không du hành theo kiểu vội vã.
Yasmā nikkhantakālato paṭṭhāya gatagataṭṭhānassa catūsu passesu samantato yojanasataṃ ekakolāhalaṃ hoti, purimaṃ purimaṃ āgatā nimantetuṃ labhanti, itaresu dvīsu maṇḍalesu sakkāro mahāmaṇḍalaṃ osarati, tattha buddhā bhagavanto tesu tesu gāmanigamesu ekāhaṃ dvīhaṃ vasantā mahājanaṃ āmisapaṭiggahena anuggaṇhanti, dhammadānena ca vivaṭṭūpanissitaṃ kusalaṃ vaḍḍhenti, tasmā vuttaṃ ‘‘gāmanigamādīsu mahājanaṃ āmisapaṭiggahena anuggaṇhantā’’tiādi.
Because from the time of departure, in the four directions of every place gone to, there is a single great sound for a hundred yojanas all around, those who arrive first get to invite. In the other two spheres, the reverence flows into the great sphere. Therein, the Blessed Buddhas, dwelling for one or two days in those various villages and towns, support the great populace with the acceptance of material things, and with the gift of the Dhamma, they increase the wholesome states that have Nibbāna as their support. Therefore, it was said, "Supporting the great populace in villages, towns, etc., with the acceptance of material things," and so on.
Vì từ lúc xuất hành, ở bốn phía của mỗi nơi đã đến, trong phạm vi một trăm dojana xung quanh, đều có sự ồn ào (kolāhala) đồng loạt; những người đến trước có thể mời thỉnh; ở hai vòng tròn còn lại, sự cúng dường đổ về đại vòng tròn; ở đó, các Đức Phật Thế Tôn, khi lưu trú một hoặc hai ngày tại các làng và thị trấn đó, đã độ hóa đại chúng bằng cách thọ nhận vật thực, và bằng pháp thí, Ngài tăng trưởng thiện pháp dẫn đến sự giải thoát khỏi vòng luân hồi (vivaṭṭūpanissitaṃ kusalaṃ). Do đó, đã nói “độ hóa đại chúng tại các làng, thị trấn và vân vân, bằng cách thọ nhận vật thực” và vân vân.
Samathavipassanā taruṇā hontīti ettha taruṇā vipassanāti saṅkhāraparicchedane ñāṇaṃ kaṅkhāvitaraṇe ñāṇaṃ sammasane ñāṇaṃ maggāmagge ñāṇanti catunnaṃ ñāṇānaṃ adhivacanaṃ.
Here, "samatha and vipassanā are young" means that 'young vipassanā' is a designation for four kinds of knowledge: knowledge in the defining of formations, knowledge in overcoming doubt, knowledge in comprehension, and knowledge of path and not-path.
Trong câu “samatha và vipassanā còn non nớt”, vipassanā còn non nớt là tên gọi của bốn loại tuệ: tuệ phân biệt các hành (saṅkhāraparicchedane ñāṇaṃ), tuệ vượt qua nghi ngờ (kaṅkhāvitaraṇe ñāṇaṃ), tuệ quán sát (sammasane ñāṇaṃ), và tuệ về đạo và phi đạo (maggāmagge ñāṇaṃ).
Samathassa taruṇabhāvo pana upacārasamādhivasena veditabbo.
The youthfulness of samatha, however, should be understood by way of access concentration.
Còn trạng thái non nớt của samatha thì phải hiểu theo cách cận định (upacārasamādhi).
‘‘Sace pana antovasse bhikkhūnaṃ samathavipassanā taruṇā hontī’’ti idaṃ nidassanamattanti daṭṭhabbaṃ.
It should be seen that "But if, within the Rains, the samatha and vipassanā of the monks are young" is just an illustration.
Câu “Nếu samatha và vipassanā của các tỳ khưu còn non nớt trong mùa an cư” này chỉ là một ví dụ mà thôi.
Aññenapi majjhimamaṇḍale veneyyānaṃ ñāṇaparipākādikāraṇena majjhimamaṇḍale cārikaṃ caritukāmā cātumāsaṃ vasitvāva nikkhamanti.
For other reasons too, such as the maturing of the faculties of those to be trained in the middle sphere, desiring to tour in the middle sphere, they depart only after dwelling for four months.
Với lý do sự trưởng thành về trí tuệ của các chúng sinh cần được giáo hóa trong trung vòng tròn, các Đức Phật muốn du hành trong trung vòng tròn, nên sau khi an cư bốn tháng, các Ngài mới xuất hành.
Pavāraṇāsaṅgahaṃ datvāti anumatidānavasena datvā.
Having given the pavāraṇā acceptance means having given it by way of granting permission.
Sau khi ban bố sự tự tứ (pavāraṇāsaṅgahaṃ datvā) có nghĩa là sau khi ban bố sự cho phép.
Māgasirassa paṭhamadivaseti māgasiramāsassa paṭhamadivase.
On the first day of Māgasira means on the first day of the month of Māgasira.
Vào ngày đầu tiên của tháng Māgasira có nghĩa là vào ngày đầu tiên của tháng Māgasira.
Idañcetarahi pavattavohāravasena kattikamāsassa aparapakkhapāṭipadadivasaṃ sandhāya vuttaṃ.
And this is said in reference to the first day of the waning moon of the month of Kattika, according to the current usage.
Điều này được nói đến để chỉ ngày mùng một của nửa tháng sau của tháng Kattika theo cách gọi thông thường hiện nay.
Tesanti tesaṃ buddhānaṃ.
Of those means of those Buddhas.
Của các vị ấy là của các Đức Phật ấy.
Tehi vinetabbattā ‘‘tesaṃ vineyyasattā’’ti vuttaṃ.
Because they are to be disciplined by them, it is said "their beings to be disciplined."
Vì họ là những người cần được giáo hóa bởi các Ngài, nên đã nói “các chúng sinh cần được giáo hóa của các vị ấy”.
Vineyyasattāti ca cārikāya vinetabbasattā.
And beings to be disciplined means beings to be disciplined through the tour.
Và các chúng sinh cần được giáo hóa là các chúng sinh cần được giáo hóa qua chuyến du hành.
Māgasiramāsampi tattheva vasitvā phussamāsassa paṭhamadivaseti idampi nidassanamattanti daṭṭhabbaṃ.
Having dwelt there also for the month of Māgasira, on the first day of the month of Phussa—this too should be seen as just an illustration.
Câu “sau khi an cư tại đó suốt tháng Māgasira, vào ngày đầu tiên của tháng Phussa” này cũng chỉ là một ví dụ mà thôi.
Catumāsavutthānampi buddhānaṃ vineyyasattā aparipakkindriyā honti, tesaṃ indriyaparipākaṃ āgamayamānā aparampi ekamāsaṃ vā dviticatumāsaṃ vā tatthevavasitvā mahābhikkhusaṅghaparivārā nikkhamitvā purimanayeneva lokaṃ anuggaṇhantā sattahi vā chahi vā pañcahi vā catūhi vā māsehi cārikaṃ pariyosāpenti.
Even for Buddhas who have dwelt for four months, the beings to be disciplined may have immature faculties. Awaiting the maturing of their faculties, they may dwell there for another one, two, three, or four months. Surrounded by a great Sangha of monks, they depart and, in the same way as before, support the world, concluding their tour in seven, six, five, or four months.
Ngay cả sau khi an cư bốn tháng, các chúng sinh cần được giáo hóa của các Đức Phật vẫn còn những căn chưa trưởng thành. Vì vậy, để chờ đợi sự trưởng thành của các căn của họ, các Ngài lại an cư thêm một tháng, hoặc hai, ba, bốn tháng nữa tại đó, rồi xuất hành với đại chúng Tỳ khưu vây quanh, độ hóa chúng sinh theo cách đã nói trước đó, và kết thúc chuyến du hành trong bảy, sáu, năm hoặc bốn tháng.
Veneyyavasenevāti avadhāraṇena na cīvarādihetu carantīti dasseti.
Solely on account of those to be disciplined—by this emphasis, it is shown that they do not travel for the sake of robes and so on.
Chỉ vì chúng sinh cần được giáo hóa – từ ngữ nhấn mạnh này cho thấy rằng các Ngài không du hành vì y phục và các thứ khác.
Tathā hi imesu tīsu maṇḍalesu yattha katthaci cārikaṃ carantā na cīvarādihetu caranti, atha kho ye duggatabālajiṇṇabyādhikā, te ‘‘kadā tathāgataṃ āgantvā passissanti, mayi pana cārikaṃ carante mahājano tathāgatadassanaṃ labhissati, tattha keci cittāni pasādessanti, keci mālādīhi pūjessanti, keci kaṭacchubhikkhaṃ dassanti, keci micchādassanaṃ pahāya sammādiṭṭhikā bhavissanti, taṃ nesaṃ bhavissati dīgharattaṃ hitāya sukhāyā’’ti evaṃ lokānukampāya cārikaṃ caranti.
Indeed, when traveling on tour anywhere within these three spheres, they do not travel for the sake of robes and so on. Rather, thinking, "Those who are poor, foolish, old, or sick, when will they be able to come and see the Tathāgata? But when I am on tour, the great populace will get to see the Tathāgata. Among them, some will gladden their minds, some will offer worship with garlands and so on, some will give a spoonful of almsfood, some will abandon wrong view and become of right view. This will be for their welfare and happiness for a long time," they travel on tour out of compassion for the world.
Thật vậy, khi du hành ở bất kỳ vòng tròn nào trong ba vòng tròn này, các Ngài không du hành vì y phục và các thứ khác, mà là vì lòng từ bi đối với chúng sinh, như những người nghèo khổ, ngu si, già yếu, bệnh tật, họ nghĩ: “Khi nào họ sẽ đến và gặp Như Lai? Khi Như Lai du hành, đại chúng sẽ có cơ hội gặp Như Lai. Ở đó, một số sẽ phát khởi tâm hoan hỷ, một số sẽ cúng dường bằng vòng hoa và các thứ khác, một số sẽ dâng một muỗng cơm cúng dường, một số sẽ từ bỏ tà kiến và trở thành người có chánh kiến. Điều đó sẽ mang lại lợi ích và hạnh phúc lâu dài cho họ.” Các Ngài du hành vì lòng từ bi đối với thế gian như vậy.
Apica catūhi kāraṇehi buddhā bhagavanto cārikaṃ caranti jaṅghavihāravasena sarīraphāsukatthāya, aṭṭhuppattikālābhikaṅkhanatthāya, bhikkhūnaṃ sikkhāpadapaññāpanatthāya, tattha tattha paripākagatindriye bodhaneyyasatte bodhanatthāyāti.
Furthermore, for four reasons the Blessed Buddhas travel on tour: for the comfort of the body by way of walking, for the purpose of awaiting the time for a matter to arise, for the purpose of laying down training rules for the monks, and for the purpose of awakening beings to be awakened whose faculties have reached maturity in various places.
Hơn nữa, các Đức Phật Thế Tôn du hành vì bốn lý do: để thân thể được thoải mái bằng cách đi bộ, để mong đợi thời điểm thích hợp cho sự phát sinh (của các sự kiện), để chế định các giới luật cho các Tỳ khưu, và để giác ngộ các chúng sinh cần được giáo hóa đã đạt đến sự trưởng thành về căn tánh ở từng nơi.
Aparehipi catūhi kāraṇehi buddhā bhagavanto cārikaṃ caranti buddhaṃ saraṇaṃ gacchissantīti vā, dhammaṃ, saṅghaṃ saraṇaṃ gacchissantīti vā, mahatā dhammavassena catasso parisā santappessāmāti vā.
For four other reasons the Blessed Buddhas travel on tour: thinking, "They will go for refuge to the Buddha," or "They will go for refuge to the Dhamma, to the Sangha," or "We will satisfy the four assemblies with a great rain of the Dhamma."
Ngoài ra, các Đức Phật Thế Tôn du hành vì bốn lý do khác: hoặc để chúng sinh quy y Phật, hoặc quy y Pháp, quy y Tăng, hoặc để làm cho bốn chúng hội (Tỳ khưu, Tỳ khưu ni, Ưu bà tắc, Ưu bà di) được thỏa mãn với trận mưa Pháp lớn.
Aparehipi pañcahi kāraṇehi buddhā bhagavanto cārikaṃ caranti pāṇātipātā viramissantīti vā, adinnādānā, kāmesumicchācārā, musāvādā, surāmerayamajjapamādaṭṭhānā viramissantīti vā.
For five other reasons the Blessed Buddhas travel on tour: thinking, "They will abstain from killing living beings," or "They will abstain from taking what is not given, from sexual misconduct, from false speech, from states of heedlessness due to intoxicating fermented and distilled drinks."
Ngoài ra, các Đức Phật Thế Tôn du hành vì năm lý do khác: hoặc để chúng sinh từ bỏ sát sinh, hoặc từ bỏ trộm cắp, tà dâm, nói dối, và các nơi phóng dật do say rượu, bia.
Aparehipi aṭṭhahi kāraṇehi buddhā bhagavanto cārikaṃ caranti paṭhamaṃ jhānaṃ paṭilabhissantīti vā, dutiyaṃ…pe… nevasaññānāsaññāyatanasamāpattiṃ paṭilabhissantīti vā.
For eight other reasons the Blessed Buddhas travel on tour: thinking, "They will attain the first jhāna," or "They will attain the second... and so on... the attainment of the base of neither-perception-nor-non-perception."
Ngoài ra, các Đức Phật Thế Tôn du hành vì tám lý do khác: hoặc để chúng sinh đạt được thiền thứ nhất, hoặc thứ hai... cho đến đạt được thiền định phi tưởng phi phi tưởng xứ.
Aparehipi aṭṭhahi kāraṇehi buddhā bhagavanto cārikaṃ caranti sotāpattimaggaṃ adhigamissantīti vā, sotāpattiphalaṃ…pe… arahattaphalaṃ sacchikarissantīti vāti.
For eight other reasons the Blessed Buddhas travel on tour: thinking, "They will attain the path of stream-entry," or "They will realize the fruit of stream-entry... and so on... the fruit of arahantship."
Ngoài ra, các Đức Phật Thế Tôn du hành vì tám lý do khác: hoặc để chúng sinh đạt được đạo quả Dự lưu, hoặc quả Dự lưu... cho đến chứng đắc quả A-la-hán.
Pupphāni ocinantā viya carantīti iminā yathā mālākāro bahuṃ pupphagacchaṃ disvā tattha cirampi ṭhatvā pupphāni ocinitvā pupphasuññaṃ gacchaṃ disvā tattha papañcaṃ akatvā taṃ pahāya aññattha gantvā pupphāni ocinanto vicarati, evameva buddhāpi yattha gāmanigamādīsu vineyyasattā bahū honti, tattha cirampi vasantā te vinetvā vineyyasuññagāmādīsu papañcaṃ akatvā taṃ pahāya aññattha bahuvineyyakesu gāmādīsu vasantā vicarantīti dasseti.
They travel as if picking flowers—by this, it is shown that just as a garland-maker, upon seeing a large flower bush, stays there for a long time and picks the flowers, and then, seeing the bush empty of flowers, does not delay there but leaves it and goes elsewhere to pick flowers, in the same way, the Buddhas too, wherever in villages, towns, etc., there are many beings to be disciplined, stay there even for a long time to discipline them. In villages, etc., that are empty of beings to be disciplined, they do not delay, but leave and dwell and travel in other villages, etc., where there are many to be disciplined.
Với câu “du hành như người hái hoa”, điều này cho thấy rằng, giống như người làm vòng hoa, khi thấy một bụi hoa lớn, anh ta ở đó một thời gian dài để hái hoa, rồi khi thấy bụi cây không còn hoa, anh ta không chần chừ ở đó mà bỏ đi nơi khác để hái hoa. Cũng vậy, các Đức Phật, khi ở những làng, thị trấn có nhiều chúng sinh cần được giáo hóa, các Ngài ở đó một thời gian dài để giáo hóa họ. Rồi khi ở những làng không còn chúng sinh cần được giáo hóa, các Ngài không chần chừ ở đó mà bỏ đi nơi khác, đến những làng có nhiều chúng sinh cần được giáo hóa để lưu trú và du hành.
Tatoyeva ca atikhuddakepi antimamaṇḍale upanissayavantānaṃ bahubhāvato tāva bahumpi kālaṃ sattamāsapariyantaṃ cārikaṃ caranti.
For that very reason, even in the very small final sphere, due to the abundance of those with supporting conditions, they travel on tour for such a long time, up to seven months.
Chính vì vậy, ngay cả trong vòng tròn nhỏ nhất (antimamaṇḍala), do có nhiều chúng sinh có duyên lành (upanissaya), các Ngài đã du hành trong một thời gian dài, lên đến bảy tháng.
Santasabhāvattā kilesasamaṇahetutāya vā santaṃ nibbānaṃ, sukhakāraṇatāya ca sukhanti āha ‘‘santaṃ sukhaṃ nibbānamārammaṇaṃ katvā’’ti.
Because it has a peaceful nature or because it is a cause for the calming of defilements, Nibbāna is peace, and because it is a cause of happiness, it is happiness. Thus he said, "Having made the peaceful, happy Nibbāna the object."
Vì bản chất là sự an tịnh, và là nguyên nhân làm cho các phiền não được an tịnh, nên Niết Bàn được gọi là an tịnh (santaṃ); và vì là nguyên nhân của hạnh phúc, nên được gọi là hạnh phúc (sukhaṃ). Do đó, đã nói “lấy Niết Bàn an tịnh, hạnh phúc làm đối tượng”.
Dasasahassacakkavāḷeti jātikkhettabhūtāya dasasahassilokadhātuyā.
In the ten-thousand world-system means in the ten-thousand-fold world-system which is the birth-field.
Trong mười ngàn thế giới là trong mười ngàn cõi giới (lokadhātu) là trường sinh.
Idañca devabrahmānaṃ vasena vuttaṃ, manussā pana imasmiṃyeva cakkavāḷe bodhaneyyā honti.
And this is said with respect to devas and brahmās, for humans to be awakened are only in this world-system.
Điều này được nói đến theo khía cạnh của chư thiên và chư Phạm thiên, còn loài người thì chỉ có thể được giáo hóa trong thế giới này mà thôi.
Bodhaneyyasattasamavalokananti paṭhamaṃ mahākaruṇāya pharitvā pacchā sabbaññutaññāṇajālaṃ pattharitvā tassa anto paviṭṭhānaṃ bodhaneyyasattānaṃ samolokanaṃ.
The surveying of beings to be awakened means, first pervading with great compassion, and then casting the net of the knowledge of omniscience, it is the surveying of the beings to be awakened who have entered within it.
Quan sát các chúng sinh cần được giáo hóa là sau khi dùng đại bi tâm bao trùm khắp nơi, rồi trải rộng lưới toàn trí tuệ (sabbaññutaññāṇajālaṃ) và quan sát các chúng sinh cần được giáo hóa đã đi vào trong lưới đó.
Buddhā kira mahākaruṇāsamāpattiṃ samāpajjitvā tato vuṭṭhāya ‘‘ye sattā bhabbā paripākañāṇā ajjayeva mayā vinetabbā, te mayhaṃ ñāṇassa upaṭṭhahantū’’ti cittaṃ adhiṭṭhāya samannāharanti.
It is said that the Buddhas, having entered into the attainment of great compassion and having emerged from it, resolve and direct their minds, thinking: "May those beings who are capable, whose knowledge is mature, and who are to be disciplined by me this very day, appear to my knowledge."
Chư Phật, sau khi nhập Đại bi định (mahākaruṇāsamāpatti), rồi xuất định, với tâm nguyện rằng: “Những chúng sinh nào có khả năng giác ngộ, có trí tuệ chín muồi, đáng được Ta giáo hóa ngay hôm nay, xin hãy hiện ra trong sự hiểu biết của Ta,” các Ngài liền quán sát.
Tesaṃ saha samannāhārā eko vā dve vā bahū vā tadā vinayūpagā veneyyā sabbaññutaññāṇassa āpāthamāgacchanti, ayamettha buddhānubhāvo.
As soon as they direct their minds, one, two, or many beings to be disciplined who are fit for training at that time come into the range of the knowledge of omniscience. This, here, is the power of the Buddhas.
Cùng với sự quán sát đó của chư Phật, một, hai, hay nhiều chúng sinh đáng được giáo hóa (veneyya) vào lúc đó liền hiện ra trong tầm nhìn của Trí tuệ Toàn tri (sabbaññutaññāṇa), đây là Phật lực ở đây.
Evaṃ āpāthamāgatānaṃ pana nesaṃ upanissayaṃ pubbacariyaṃ pubbahetuṃ sampativattamānañca paṭipattiṃ olokenti.
Then, of those who have thus come into range, they survey their supporting conditions, past conduct, past causes, and present practice.
Sau đó, các Ngài quán sát căn duyên (upanissaya), hạnh nghiệp quá khứ (pubbacariya), nhân quá khứ (pubbahetu) và sự thực hành hiện tại (sampativattamāna paṭipatti) của những chúng sinh đã hiện ra như vậy.
Veneyyasattapariggaṇhanatthañhi samannāhāre kate paṭhamaṃ nesaṃ veneyyabhāveneva upaṭṭhānaṃ hoti.
Indeed, when a mental advertence is made for the purpose of discerning beings to be trained, their first appearance is simply in their capacity as beings to be trained.
Thật vậy, khi sự quán sát được thực hiện để thâu nhiếp các chúng sinh đáng được giáo hóa, trước tiên, sự hiện ra của họ chỉ là với tư cách là chúng sinh có thể được giáo hóa.
Atha ‘‘kiṃ nu kho bhavissatī’’ti saraṇagamanādivasena kañci nipphattiṃ vīmaṃsamānā pubbupanissayāni olokenti.
Then, while investigating to see what sort of attainment might come to be, by way of going for refuge and so on, they examine the past supporting conditions.
Sau đó, với ý nghĩ “điều gì sẽ xảy ra?”, các Ngài quán sát các căn duyên quá khứ (pubbupanissaya) để tìm hiểu về bất kỳ sự thành tựu nào, chẳng hạn như sự quy y Tam bảo (saraṇagamana).
Otiṇṇeti ārocite, parisamajjhaṃ vā otiṇṇe.
Having entered means when it was announced, or when he had entered the midst of the assembly.
Otiṇṇe (đã đi vào) nghĩa là đã được thông báo, hoặc đã đi vào giữa hội chúng.
Dvikkhattunti ekasmiṃ saṃvacchare dvikkhattuṃ.
Twice means twice in one year.
Dvikkhattuṃ (hai lần) nghĩa là hai lần trong một năm.
Buddhakāle kira ekekasmiṃ saṃvacchare dve vāre bhikkhū sannipatanti upakaṭṭhavassūpanāyikakāle ca pavāraṇākāle ca.
It is said that in the time of the Buddha, the monks would assemble twice in each year: at the time approaching the rains-residence and at the time of the Pavāraṇā ceremony.
Vào thời Đức Phật, các Tỳ-kheo thường tụ họp hai lần mỗi năm: vào thời điểm cận kề an cư mùa mưa và vào thời điểm Tự tứ (pavāraṇā).
Upakaṭṭhāya vassūpanāyikāya dasapi vīsampi tiṃsampi cattālīsampi paññāsampi bhikkhū vaggavaggā hutvā kammaṭṭhānatthāya āgacchanti.
When the rains-residence was approaching, monks in groups of ten, twenty, thirty, forty, or fifty would come for the purpose of receiving a meditation subject.
Khi thời gian an cư mùa mưa đến gần, mười, hai mươi, ba mươi, bốn mươi, năm mươi Tỳ-kheo đến từng nhóm để xin đề mục thiền định (kammaṭṭhāna).
Bhagavā tehi saddhiṃ sammoditvā ‘‘kasmā, bhikkhave, upakaṭṭhāya vassūpanāyikāya vicarathā’’ti pucchati.
The Blessed One, after exchanging friendly greetings with them, would ask, "Monks, why do you wander about when the rains-residence is approaching?"
Đức Thế Tôn chào hỏi các vị ấy và hỏi: “Này các Tỳ-kheo, tại sao các con lại du hành khi mùa an cư đã cận kề?”
Atha te ‘‘bhagavā kammaṭṭhānatthaṃ āgatamha, kammaṭṭhānaṃ no dethā’’ti yācanti.
Then they would request, "Blessed One, we have come for a meditation subject. Please give us a meditation subject."
Khi đó, các vị ấy thưa: “Bạch Đức Thế Tôn, chúng con đến để xin đề mục thiền định, xin Đức Thế Tôn ban cho chúng con đề mục thiền định.”
Satthā tesaṃ cariyavasena rāgacaritassa asubhakammaṭṭhānaṃ deti, dosacaritassa mettākammaṭṭhānaṃ, mohacaritassa ‘‘uddeso paripucchā kālena dhammassavanaṃ kālena dhammasākacchā idaṃ tuyhaṃ sappāya’’nti ācikkhati.
The Teacher would give them a meditation subject according to their temperament, giving the meditation subject of impurity to one with a lustful temperament, the meditation subject of loving-kindness to one with a hateful temperament, and for one with a deluded temperament, he would explain, "Recitation, inquiry, timely listening to the Dhamma, and timely discussion of the Dhamma—this is suitable for you."
Bậc Đạo Sư, tùy theo căn tánh của các vị ấy, ban đề mục bất tịnh (asubhakammaṭṭhāna) cho người có tánh tham (rāgacarita), đề mục từ bi (mettākammaṭṭhāna) cho người có tánh sân (dosacarita), và chỉ dạy cho người có tánh si (mohacarita): “Sự học hỏi (uddesa), sự vấn đáp (paripucchā), sự nghe pháp đúng lúc (kālena dhammassavanaṃ), sự thảo luận pháp đúng lúc (kālena dhammasākacchā) – những điều này là thích hợp cho con.”
Kiñcāpi hi mohacaritassa ānāpānassatikammaṭṭhānaṃ sappāyaṃ, kammaṭṭhānabhāvanāya pana bhājanabhūtaṃ kātuṃ sammohavigamāya paṭhamaṃ uddesaparipucchādhammassavanadhammasākacchāsu niyojeti.
Although the meditation subject of mindfulness of breathing is suitable for one with a deluded temperament, he would first engage them in recitation, inquiry, listening to the Dhamma, and discussing the Dhamma in order to remove delusion, so as to make them a vessel for the development of the meditation subject.
Mặc dù đề mục niệm hơi thở vào ra (ānāpānassatikammaṭṭhāna) là thích hợp cho người có tánh si, nhưng để giúp họ trở thành người có khả năng tu tập đề mục thiền định và để loại bỏ sự si mê, trước tiên, Ngài hướng dẫn họ vào việc học hỏi, vấn đáp, nghe pháp và thảo luận pháp.
Vitakkacaritassa ānāpānassatikammaṭṭhānaṃ deti.
To one with a discursive temperament, he gives the meditation subject of mindfulness of breathing.
Ngài ban đề mục niệm hơi thở vào ra cho người có tánh tầm (vitakkacarita).
Saddhācaritassa visesato purimā cha anussatiyo sappāyā, tāsaṃ pana anuyuñjane ayaṃ pubbabhāgapaṭipattīti dassetuṃ pasādanīyasuttantena buddhasubodhitaṃ dhammasudhammataṃ saṅghasuppaṭipattiñca pakāseti.
For one with a faithful temperament, the first six recollections are especially suitable, but to show that this is the preliminary practice for cultivating them, he would, by means of a sutta that inspires confidence, proclaim the Buddha's perfect enlightenment, the Dhamma's well-taught nature, and the Sangha's good practice.
Đối với người có tánh tín (saddhācarita), sáu pháp tùy niệm (anussati) đầu tiên đặc biệt thích hợp; để chỉ ra rằng việc thực hành những pháp này là sự thực hành sơ khởi, Ngài thuyết giảng về sự giác ngộ tối thượng của Đức Phật, sự thù thắng của Giáo pháp và sự thực hành đúng đắn của Tăng đoàn qua kinh Pasādanīya.
Ñāṇacaritassa pana maraṇassati upasamānussati catudhātuvavatthānaṃ āhārepaṭikūlasaññā visesato sappāyā, tesaṃ upakāradhammadassanatthaṃ aniccatādipaṭisaṃyutte gambhīre suttante katheti.
For one with an intelligent temperament, mindfulness of death, recollection of peace, analysis of the four elements, and perception of the repulsiveness of food are especially suitable, and to show them the teachings that are helpful for these, he would teach profound suttas connected with impermanence and so on.
Đối với người có tánh trí (ñāṇacarita), niệm chết (maraṇassati), tùy niệm tịch tịnh (upasamānussati), phân tích bốn đại (catudhātuvavatthānaṃ) và quán tưởng sự ghê tởm của thức ăn (āhārepaṭikūlasaññā) đặc biệt thích hợp; để chỉ ra những pháp hỗ trợ này, Ngài thuyết giảng những kinh sâu xa liên quan đến vô thường (aniccatā) và các pháp khác.
Te kammaṭṭhānaṃ gahetvā sace sappāyaṃ hoti, satthu santike eva vasanti.
After taking a meditation subject, if it is suitable, they stay right in the Teacher's presence.
Các vị ấy nhận đề mục thiền định, nếu thích hợp, thì ở lại với Đức Đạo Sư.
No ce hoti, sappāyaṃ senāsanaṃ pucchantā gacchanti.
If it is not, they ask for a suitable lodging and go there.
Nếu không, các vị ấy hỏi về chỗ ở thích hợp rồi ra đi.
Tepi tattha vasantā temāsikaṃ paṭipadaṃ gahetvā ghaṭentā vāyamantā sotāpannāpi honti sakadāgāminopi anāgāminopi arahantopi.
While staying there, they take up the three-month practice, and by striving and making an effort, they become stream-enterers, once-returners, non-returners, or arahants.
Khi ở đó, các vị ấy, sau khi chấp nhận sự thực hành trong ba tháng, tinh tấn và nỗ lực, trở thành những bậc Nhập lưu (Sotāpanna), Nhất lai (Sakadāgāmin), Bất hoàn (Anāgāmin) hoặc A-la-hán (Arahant).
Tato vutthavassā pavāretvā satthu santikaṃ gantvā ‘‘bhagavā ahaṃ tumhākaṃ santike kammaṭṭhānaṃ gahetvā sotāpattiphalaṃ patto…pe… ahaṃ aggaphalaṃ arahatta’’nti paṭiladdhaguṇaṃ ārocenti, upari anadhigatassa adhigamāya kammaṭṭhānañca yācanti.
Then, having completed the rains-residence, they perform the Pavāraṇā ceremony and go to the Teacher, where they report the qualities they have attained, saying, "Blessed One, having taken a meditation subject in your presence, I have attained the fruit of stream-entry... I have attained the highest fruit, Arahantship," and they also request a meditation subject for the attainment of higher states not yet realized.
Sau đó, khi đã mãn hạ an cư và Tự tứ, các vị ấy đến yết kiến Đức Đạo Sư và trình bày những thành quả đã đạt được: “Bạch Đức Thế Tôn, con đã nhận đề mục thiền định từ Ngài và đã chứng đắc quả Nhập lưu… v.v… con đã chứng đắc quả A-la-hán, quả tối thượng,” và xin thêm đề mục thiền định để đạt được những gì chưa đạt được.
Tena vuttaṃ ‘‘pure vassūpanāyikāya ca kammaṭṭhānaggahaṇatthaṃ…pe… upari kammaṭṭhānaggahaṇatthañcā’’ti.
Therefore, it was said: "for the purpose of receiving a meditation subject before the rains-residence... and for receiving a higher meditation subject."
Vì vậy đã nói “để nhận đề mục thiền định trước mùa an cư… v.v… và để nhận đề mục thiền định cao hơn.”
Āyāmāti ettha ā-saddo ‘‘āgacchā’’ti iminā samānatthoti āha ‘‘āyāmāti āgaccha yāmā’’ti, ehi gacchāmāti attho.
In the phrase Let us go, the prefix ā- has the same meaning as "come." Therefore, he said, "‘Let us go’ means ‘Come, let us go’," the meaning is "Come, we shall go."
Ở đây, từ āyāmā (chúng ta hãy đi) có từ ā (hãy đến) đồng nghĩa với “hãy đến,” nên đã nói “āyāmāti āgaccha yāmā” (hãy đến, chúng ta hãy đi), ý nghĩa là “hãy đến, chúng ta hãy đi.”
Ānandāti bhagavā santikāvacarattā theraṃ ālapati, na pana tadā satthu santike vasantānaṃ bhikkhūnaṃ abhāvato.
Ānanda: The Blessed One addressed the Elder in this way because he was a close attendant, not because there were no other monks dwelling in the Teacher's presence at that time.
Đức Thế Tôn gọi Trưởng lão Ānanda vì Trưởng lão là người thân cận, chứ không phải vì không có các Tỳ-kheo khác đang ở với Đức Đạo Sư vào lúc đó.
Pañcasataparimāṇo hi tadā bhagavato santike bhikkhusaṅgho.
Indeed, at that time, there was a Saṅgha of about five hundred monks in the presence of the Blessed One.
Thật vậy, vào lúc đó, có một Tăng đoàn gồm năm trăm Tỳ-kheo đang ở với Đức Thế Tôn.
Thero pana ‘‘gaṇhathāvuso pattacīvarāni, bhagavā asukaṭṭhānaṃ gantukāmo’’ti bhikkhūnaṃ āroceti.
The Elder, for his part, would inform the monks, saying, "Friends, take your bowls and robes; the Blessed One wishes to go to such-and-such a place."
Tuy nhiên, Trưởng lão đã thông báo cho các Tỳ-kheo: “Này các hiền giả, hãy lấy y bát của quý vị, Đức Thế Tôn muốn đi đến nơi kia.”
‘‘Atha kho bhagavā āyasmantaṃ ānandaṃ āmantesī’’ti vuttattā ‘‘bhagavato paccassosī’’ti idha bhagavatoti sāmivacanaṃ āmantanavacanameva sambandhīantaraṃ apekkhatīti iminā adhippāyena ‘‘bhagavato vacanaṃ paṭiassosī’’ti vuttaṃ.
Because it is said, "Then the Blessed One addressed the Venerable Ānanda," here in "responded to the Blessed One," the word to the Blessed One is in the genitive case, yet it looks for another connection, namely, the word of address. With this intention, it was said, "he responded to the Blessed One's words."
Vì đã nói “Rồi Đức Thế Tôn gọi Tôn giả Ānanda,” nên ở đây, từ bhagavato (của Đức Thế Tôn) trong “bhagavato paccassosī” (đã vâng lời Đức Thế Tôn) là cách sở hữu (sāmivacana) và chỉ đòi hỏi một mối quan hệ đặc biệt với lời mời gọi, với ý nghĩa này đã nói “bhagavato vacanaṃ paṭiassosī” (đã vâng lời Đức Thế Tôn).
Bhagavatoti pana idaṃ patissavasambandhena sampadānavacanaṃ yathā ‘‘devadattassa paṭissuṇotī’’ti.
Alternatively, this word to the Blessed One is in the dative case in connection with the response, just as in "he responds to Devadatta."
Tuy nhiên, từ bhagavato này là cách tặng cách (sampadānavacana) theo mối quan hệ vâng lời, như trong “devadattassa paṭissuṇotī” (vâng lời Devadatta).
Paccassosīti ettha paṭi-saddo abhimukhavacanoti āha ‘‘abhimukho hutvā suṇī’’ti.
In the word responded, the prefix paṭi- means "facing." Therefore, he said, "having faced him, he listened."
Ở đây, trong từ paccassosī (đã vâng lời), tiền tố paṭi có nghĩa là “đối diện,” nên đã nói “abhimukho hutvā suṇī” (đã lắng nghe trong tư thế đối diện).
Bhagavato mukhābhimukho hutvā adhivāsetvā suṇi, na udāsino hutvāti adhippāyo.
The intention is that he listened, having turned to face the Blessed One and having consented, not being indifferent.
Ý nghĩa là: đã lắng nghe và chấp thuận trong tư thế đối diện với Đức Thế Tôn, chứ không phải một cách thờ ơ.
Brāhmaṇa tayā nimantitā vassaṃvutthā amhāti pāḷiyaṃ sambandho veditabbo.
The connection in the Pāḷi should be understood as: "Brahmin, invited by you, we have spent the rains-residence."
Này Bà-la-môn, chúng tôi đã an cư mùa mưa theo lời mời của ông – đây là mối liên hệ cần được hiểu trong bản Pāḷi.
Dātabbo assāti dātabbo bhaveyya.
Should have been given means it should be given.
Dātabbo assā (nên được ban cho) nghĩa là nên có thể được ban cho.
No asantoti neva avijjamāno, kintu vijjamānoyevāti dīpeti.
It is not that it is non-existent indicates that it is not non-existent, but rather that it does exist.
No asanto (không phải không có) chỉ ra rằng không phải là không có, mà là có sẵn.
Vinā vā liṅgavipallāsenettha attho daṭṭhabboti āha ‘‘atha vā’’tiādi.
Alternatively, the meaning here should be understood without a change of grammatical gender; thus, he said, "Or else," and so on.
Hoặc ý nghĩa ở đây nên được hiểu mà không cần thay đổi giống, nên đã nói “atha vā” (hoặc) v.v…
Iminā sāmaññavacanato ettha napuṃsakaliṅganiddesoti dasseti.
By this, he shows that the use of the neuter gender here is due to it being a general statement.
Với điều này, Ngài chỉ ra rằng việc sử dụng giống trung ở đây là từ một cách nói chung.
No natthīti no amhākaṃ natthi.
It is not that for us there is none means for us, there is not none.
No natthī (không có của chúng tôi) nghĩa là chúng tôi không có.
Noti vā etassa vivaraṇaṃ natthīti.
Or, the word not is an explanation of is none.
Hoặc no là sự giải thích của natthī.
Kesaṃ adātukāmatā viyāti āha ‘‘yathā’’tiādi.
Like whose unwillingness to give? Thus he said, "Just as," and so on.
Giống như sự không muốn cho của ai? Để trả lời câu hỏi này, Ngài đã nói “yathā” (như) v.v…
Pahūtavittūpakaraṇānanti ettha vittīti tuṭṭhi, vittiyā upakaraṇaṃ vittūpakaraṇaṃ, tuṭṭhikāraṇanti attho.
In the phrase of those with abundant means of satisfaction, vitti means satisfaction; an instrument for satisfaction is vittūpakaraṇaṃ, meaning a cause of satisfaction.
Ở đây, trong pahūtavittūpakaraṇānaṃ (của những người có nhiều tài sản và vật dụng), vittī có nghĩa là sự thỏa mãn, vittūpakaraṇaṃ là phương tiện của sự thỏa mãn, ý nghĩa là nguyên nhân của sự thỏa mãn.
Pahūtaṃ dhanadhaññajātarūparajatanānāvidhālaṅkārasuvaṇṇabhājanādibhedaṃ vittūpakaraṇametesanti pahūtavittūpakaraṇā, tesaṃ pahūtavittūpakaraṇānaṃ maccharīnaṃ yathā adātukāmatā, evaṃ no adātukāmatāpi natthīti sambandho.
They for whom there are abundant means of satisfaction—in the form of much wealth, grain, gold, silver, various kinds of ornaments, golden vessels, and so on—are "those with abundant means of satisfaction." The connection is: just as there is unwillingness to give on the part of those misers who have abundant means of satisfaction, so too for us, there is no unwillingness to give.
Những người có nhiều tài sản và vật dụng (pahūtavittūpakaraṇā) là những người có nhiều tài sản và vật dụng như vàng bạc, tiền của, các loại trang sức, đồ dùng bằng vàng, v.v. Mối liên hệ là: giống như sự không muốn cho của những người keo kiệt có nhiều tài sản và vật dụng, sự không muốn cho của chúng tôi cũng không có.
Taṃ kutettha labbhāti ettha tanti taṃ kāraṇaṃ, taṃ kiccaṃ vā.
In the phrase From where could that be obtained here?, that means that reason, or that deed.
Ở đây, trong taṃ kutettha labbhā (làm sao có được điều đó ở đây?), taṃ (điều đó) là nguyên nhân đó, hoặc việc làm đó.
Etthāti gharāvāse.
Here means in the household life.
Etthā (ở đây) nghĩa là trong đời sống gia đình.
Dutiye pana atthavikappe tanti deyyadhammassa parāmasanaṃ.
In the second interpretation of the meaning, however, that refers to the donative items.
Trong trường hợp ý nghĩa thứ hai, taṃ (điều đó) ám chỉ vật cúng dường.
Etthāti imasmiṃ temāsabbhantareti attho.
Here means within this three-month period.
Etthā (ở đây) nghĩa là trong ba tháng này.
Yanti yena kāraṇena, kiriyāparāmasanaṃ vā.
That means for which reason, or it is a reference to the action.
Yaṃ (điều gì) là do nguyên nhân nào, hoặc ám chỉ hành động.
Dutiye pana atthavikappe yanti yaṃ deyyadhammanti attho.
In the second interpretation of the meaning, however, that means "which donative items."
Trong trường hợp ý nghĩa thứ hai, yaṃ (điều gì) có nghĩa là vật cúng dường nào.
Alaṃ gharāvāsapalibodhacintāyāti saññāpetvāti brāhmaṇa netaṃ gharāvāsapalibodhena kataṃ, atha kho mārāvaṭṭanenāti brāhmaṇaṃ saññāpetvā.
Having made him understand, ‘Enough with this worry about the hindrances of household life’: Having made the brahmin understand, "Brahmin, this was not done due to the hindrances of household life, but rather through the agency of Māra."
Alaṃ gharāvāsapalibodhacintāyāti saññāpetvāti có nghĩa là: Này bà-la-môn, việc không cúng dường này không phải do ngươi làm vì chướng ngại của đời sống gia đình, mà thật ra là do sự cản trở của Ma vương. Sau khi làm cho vị bà-la-môn hiểu rõ như vậy.
Taṅkhaṇānurūpāyāti yādisī tadā tassa ajjhāsayappavatti, tadanurūpāyāti attho.
Appropriate to that moment means appropriate to whatever his disposition was at that time.
Taṅkhaṇānurūpāyāti có nghĩa là: Tùy theo sự phát sinh khuynh hướng của vị ấy vào lúc đó, có nghĩa là phù hợp với điều đó.
Tassa tadā tādisassa vivaṭṭasannissitassa ñāṇaparipākassa abhāvato kevalaṃ abbhantarasannissito eva attho dassitoti āha ‘‘diṭṭhadhammikasamparāyikaṃ atthaṃ sandassetvā’’ti, paccakkhato vibhāvetvāti attho.
Because at that time the brahmin lacked such a ripeness of knowledge connected with release, only a benefit connected with the sublime was shown. Thus he said, "having pointed out a benefit visible in this life and in the future," which means having made it directly evident.
Bởi vì vào lúc đó, vị ấy không có trí tuệ chín muồi, nương tựa vào sự giải thoát như vậy, nên chỉ trình bày ý nghĩa nương tựa vào nội tâm mà thôi, do đó nói ‘‘diṭṭhadhammikasamparāyikaṃ atthaṃ sandassetvā’’ti, có nghĩa là sau khi làm cho sáng tỏ một cách trực tiếp.
Kusale dhammeti tebhūmake kusale dhamme.
In wholesome states means: in wholesome states of the three planes.
Kusale dhammeti là các pháp thiện trong ba cõi.
Tatthāti kusaladhamme yathāsamādapite.
Tatthā means: in the wholesome states that have been undertaken.
Tatthāti là trong các pháp thiện đã được khích lệ như vậy.
Nanti brāhmaṇaṃ.
Naṃ means: the brahmin.
Nanti là vị bà-la-môn.
Samuttejetvāti sammadeva uparūpari nivesetvā puññakiriyāya tikkhavisadabhāvaṃ āpādetvā.
Samuttejetvā means: having rightly established it again and again in his mind, having brought about a sharp and clear state for the meritorious action.
Samuttejetvāti là sau khi đặt tâm vào các tầng cao hơn một cách chân chánh, làm cho việc thiện trở nên sắc bén và trong sáng.
Taṃ pana atthato tassa ussāhajananaṃ hotīti āha ‘‘saussāhaṃ katvā’’ti.
However, that, in meaning, is the generation of his effort; therefore, he said, “having made him zealous.”
Điều đó, về mặt ý nghĩa, là sự khích lệ cho vị ấy, do đó nói ‘‘saussāhaṃ katvā’’ti.
Evaṃ puññakiriyāya saussāhato evarūpaguṇasamaṅgitā ca niyamato diṭṭhadhammikādiatthasampādananti evaṃ saussāhatāya aññehi ca tasmiṃ vijjamānaguṇehi sampahaṃsetvā sammadeva haṭṭhatuṭṭhabhāvaṃ āpādetvā.
Thus, from being zealous in meritorious action and being endowed with such qualities, the accomplishment of benefits visible in this life and so on is certain. Therefore, having gladdened him by that zeal and by other existing qualities therein, having brought about a state of complete joy and satisfaction.
Như vậy, do sự nỗ lực trong việc thiện, và do sự hội đủ các phẩm chất như vậy, chắc chắn sẽ thành tựu các lợi ích trong hiện tại và tương lai. Do đó, sau khi làm cho vị ấy hoan hỷ và vui mừng một cách chân chánh sampahaṃsetvā bằng sự nỗ lực như vậy và bằng các phẩm chất khác hiện có trong vị ấy.
Yadi bhagavā dhammaratanavassaṃ vassi, atha kasmā so visesaṃ nādhigacchi?
If the Blessed One rained down the rain of the jewel of the Dhamma, then why did he not attain a special state?
Nếu Đức Thế Tôn đã ban mưa Pháp bảo, vậy tại sao vị ấy không chứng đắc được sự đặc biệt?
Upanissayasampattiyā abhāvato.
Due to the absence of the perfection of supporting conditions.
Do không có sự đầy đủ về upanissaya (duyên hỗ trợ).
Yadi evaṃ kasmā bhagavā tassa tathā dhammaratanavassaṃ vassīti?
If so, why did the Blessed One rain down the rain of the jewel of the Dhamma for him in such a way?
Nếu vậy, tại sao Đức Thế Tôn lại ban mưa Pháp bảo cho vị ấy như thế?
Vuccate – yadipi tassa visesādhigamo natthi, āyatiṃ pana nibbānādhigamatthāya vāsanābhāgiyā ca sabbā purimapacchimadhammakathā ahosīti daṭṭhabbā.
It is said: although there was no attainment of a special state for him, it should be seen that the entire Dhamma discourse, from beginning to end, was for the purpose of attaining Nibbāna in the future and for the sake of the portion of conditioning.
Xin thưa rằng – Mặc dù vị ấy không chứng đắc được sự đặc biệt, nhưng cần phải hiểu rằng tất cả các bài pháp thoại trước và sau đều là để gieo duyên lành (vāsanābhāgiya) cho việc chứng đắc Niết-bàn trong tương lai.
Na hi bhagavato niratthakā dhammadesanā atthi.
Indeed, there is no pointless teaching of the Dhamma by the Blessed One.
Vì rằng Đức Thế Tôn không có bài thuyết pháp nào là vô ích.
Temāsikopi deyyadhammoti temāsaṃ dātabbopi deyyadhammo.
Temāsikopi deyyadhammo means: the gift to be given for three months.
Temāsikopi deyyadhammoti là vật phẩm cúng dường đáng được dâng cúng trong suốt ba tháng.
Yaṃ divasanti yasmiṃ divase.
Yaṃ divasaṃ means: on which day.
Yaṃ divasanti là vào ngày nào.
23. Buddhapariṇāyakanti buddho pariṇāyako etassāti buddhapariṇāyako, bhikkhusaṅgho.
23. Buddhapariṇāyakaṃ means: the Buddha is its leader, thus it is buddhapariṇāyako; this refers to the Saṅgha of bhikkhus.
23. Buddhapariṇāyakanti là Đức Phật là người lãnh đạo, đó là Tăng chúng tỳ-khưu.
Taṃ buddhapariṇāyakaṃ, buddhajeṭṭhakanti attho.
Buddhapariṇāyakaṃ means the Saṅgha with the Buddha as its elder.
Taṃ buddhapariṇāyakaṃ, có nghĩa là Tăng chúng có Đức Phật là bậc trưởng thượng.
Yāvadatthaṃ katvāti yāva attho, tāva bhojanena tadā katanti adhippāyo.
Yāvadatthaṃ katvā means: as much as was desired, so much was done with food at that time—this is the intention.
Yāvadatthaṃ katvāti có ý nghĩa là, vào lúc đó, đã làm cho đủ theo nhu cầu bằng vật thực.
Dātuṃ upanītabhikkhāya paṭikkhepo nāma hatthasaññāya mukhavikārena vacībhedena vā hotīti āha ‘‘hatthasaññāyā’’tiādi.
The refusal of alms offered for giving can be done by a hand gesture, by a facial expression, or by a verbal utterance; therefore, he said “by a hand gesture,” etc.
Việc từ chối vật thực được dâng cúng có thể được thực hiện bằng dấu hiệu tay, bằng cách thay đổi nét mặt, hoặc bằng lời nói, do đó nói ‘‘hatthasaññāyā’’ti v.v.
Onītapattapāṇinti ettha onīto pattato pāṇi etassāti onītapattapāṇīti bhinnādhikaraṇavisayoyaṃ saddo bāhiratthasamāsoti āha ‘‘pattato onītapāṇi’’ntiādi.
In the phrase onītapattapāṇiṃ, it is onītapattapāṇī because his hand (pāṇi) was withdrawn (onīto) from the bowl (pattato). This word is a bāhiratthasamāsa whose referent is different; therefore, he said “with hand withdrawn from the bowl,” etc.
Onītapattapāṇinti ở đây, onīto pattato pāṇi etassāti onītapattapāṇīti, từ này có đối tượng khác nhau, là một hợp từ có ý nghĩa bên ngoài, do đó nói ‘‘pattato onītapāṇi’’nti v.v.
‘‘Onittapattapāṇi’’ntipi pāṭho, tassattho onittaṃ nānābhūtaṃ vinābhūtaṃ āmisāpanayanena vā sucikataṃ pattaṃ pāṇito assāti onittapattapāṇi, taṃ onittapattapāṇiṃ, hatthe ca pattañca dhovitvā ekamante pattaṃ nikkhipitvā nisinnanti attho.
There is also the reading “onittapattapāṇiṃ.” Its meaning is: his bowl was onittaṃ, meaning separate, apart from his hand, or cleaned by the removal of food, thus onittapattapāṇi. Taṃ onittapattapāṇiṃ means: having washed his hands and bowl, and having placed the bowl aside, he was seated.
Cũng có bản đọc là ‘‘Onittapattapāṇi’nti, ý nghĩa của nó là onittaṃ, tức là đã tách rời, không còn dính, hoặc đã được làm sạch bằng cách loại bỏ vật thực khỏi tay, nên gọi là onittapattapāṇi, taṃ onittapattapāṇiṃ, có nghĩa là sau khi rửa tay và bát, đặt bát sang một bên rồi ngồi xuống.
Pattuṇṇapaṭṭapaṭe cāti pattuṇṇapaṭe ca paṭṭapaṭe ca.
Pattuṇṇapaṭṭapaṭe cāti means: and pattuṇṇa cloths and paṭṭa cloths.
Pattuṇṇapaṭṭapaṭe cāti là cả vải pattuṇṇa và vải paṭṭa.
Tattha pattuṇṇapadese bhavā pattuṇṇā, kosiyavisesātipi vadanti.
Therein, cloths originating from the pattuṇṇa country are pattuṇṇā. Some also say they are a special kind of silk cloth.
Trong đó, pattuṇṇā là loại vải có nguồn gốc từ xứ Pattuṇṇa, người ta cũng nói đó là một loại vải lụa đặc biệt.
Paṭṭāni pana cīnapaṭāni.
Paṭṭā, however, are cloths from China.
Còn paṭṭāni là vải từ Trung Hoa.
Āyogādīsu āyogoti paṭiāyogo, aṃsabaddhakaṃ pattatthavikādīsu.
In āyogādīsu, āyogo refers to a waist-band; aṃsabaddhakaṃ refers to what is used for bowl-bags and so on.
Trong āyogādīsu, āyogoti là tấm đai lưng, aṃsabaddhakaṃ là dây đeo vai trong các vật dụng như túi đựng bát v.v.
Bhesajjatelānanti bhesajjasampākena sādhitatelānaṃ.
Bhesajjatelānaṃ means: of oils prepared by being cooked with medicinal ingredients.
Bhesajjatelānanti là các loại dầu được bào chế cùng với dược liệu.
Tumbānīti cammamayatelabhājanāni.
Tumbāni means: oil containers made of leather.
Tumbānīti là các bình đựng dầu bằng da.
Ekamekassa bhikkhuno sahassagghanakaṃ telamadāsīti sambandho.
The connection is: he gave oil worth a thousand to each and every bhikkhu.
Cần hiểu rằng ông đã cúng dường dầu trị giá một ngàn cho mỗi vị tỳ-khưu.
Buddhānaṃ anabhiratiparitassitā nāma natthīti āha ‘‘yathājjhāsayaṃ yathārucitaṃ vāsaṃ vasitvā’’ti.
There is no such thing as dissatisfaction or longing for Buddhas; therefore, he said, “having lived a life according to his disposition, according to his liking.”
Đối với chư Phật, không có cái gọi là không hoan hỷ hay bồn chồn, do đó nói ‘‘yathājjhāsayaṃ yathārucitaṃ vāsaṃ vasitvā’’ti.
Abhirantaṃ abhiratīti hi atthato ekaṃ.
Indeed, ‘abhirantaṃ’ and ‘abhirati’ are one in meaning.
Vì abhirantaṃ và abhirati thực chất là một về mặt ý nghĩa.
Abhirantasaddo cāyaṃ abhirucipariyāyo, na assādapariyāyo.
And this word ‘abhiranta’ is a synonym for ‘liking,’ not a synonym for ‘enjoyment.’
Và từ abhiranta này là từ đồng nghĩa với abhiruci (sự ưa thích), không phải là từ đồng nghĩa với assāda (sự hưởng thụ).
Assādavasena ca katthaci vasantassa assādavatthuvigamanena siyā tassa tattha anabhirati, tayidaṃ khīṇāsavānaṃ natthi, pageva buddhānaṃ, tasmā abhirativasena katthaci vasitvā tadabhāvato aññattha gamanaṃ nāma buddhānaṃ natthi, vineyyavinayanatthaṃ pana katthaci vasitvā tasmiṃ siddhe vineyyavinayatthameva tato aññattha gacchanti, ayamettha yathāruci.
For one who dwells somewhere through enjoyment, dissatisfaction may arise with the departure of the object of enjoyment. This does not exist for those whose cankers are destroyed, let alone for Buddhas. Therefore, for Buddhas, there is no such thing as dwelling somewhere through delight and then going elsewhere due to its absence. Rather, they dwell somewhere for the purpose of training the trainable, and when that is accomplished, they go elsewhere for the very purpose of training the trainable. This here is ‘according to his liking’.
Đối với người sống ở một nơi nào đó vì sự hưởng thụ, khi đối tượng hưởng thụ mất đi, có thể có sự không hoan hỷ ở nơi đó, điều này không có ở các bậc đã đoạn tận lậu hoặc, huống chi là chư Phật. Do đó, đối với chư Phật, không có chuyện đi đến nơi khác vì không còn hoan hỷ sau khi đã sống ở một nơi nào đó vì sự hoan hỷ. Mà các Ngài sống ở một nơi nào đó để giáo hóa chúng sanh, và khi việc đó hoàn tất, các Ngài đi đến nơi khác cũng vì mục đích giáo hóa chúng sanh. Đây là ý nghĩa của yathāruci ở đây.
Soreyyādīni anupagammāti mahāmaṇḍalacārikāya vīthibhūtāni soreyyanagarādīni anupagantvā.
Soreyyādīni anupagammā means: without approaching the cities of Soreyya and others, which were on the route of the great regional tour.
Soreyyādīni anupagammāti là không đi đến các thành phố như Soreyya v.v., vốn là những con đường trong chuyến du hành lớn.
Payāgapatiṭṭhānanti gāmassapi adhivacanaṃ titthassapi.
Payāgapatiṭṭhānaṃ is a name for both a village and a landing place.
Payāgapatiṭṭhānanti là tên gọi của cả một ngôi làng và một bến nước.
Gaṅgaṃ nadinti gaṅgaṃ nāma nadiṃ.
Gaṅgaṃ nadiṃ means: the river named Gaṅgā.
Gaṅgaṃ nadinti là con sông tên là Gaṅgā.
Tadavasarīti ettha tanti karaṇatthe upayogavacananti āha ‘‘tena avasari tadavasarī’’ti.
In tadavasarī, taṃ is a term of scope in the instrumental sense; therefore, he said, “tena avasari, tadavasarī.”
Tadavasarīti ở đây, tanti là cách dùng từ trong ý nghĩa công cụ, do đó nói ‘‘tena avasari tadavasarī’’ti.
Samantapāsādikāyāti samantato sabbaso pasādaṃ janetīti samantapāsādikā, tassā samantapāsādikāya.
Samantapāsādikāya means: because it generates confidence all around, in every way, it is the Samantapāsādikā; of that Samantapāsādikā.
Samantapāsādikāyāti là Samantapāsādikā vì làm phát sinh sự trong sạch từ mọi phía, một cách toàn diện; của bộ Samantapāsādikā ấy.
Tatridaṃ samantapāsādikāya samantapāsādikattasminti ettha tatrāti purimavacanāpekkhaṃ, idanti vakkhamānakāraṇavacanāpekkhaṃ.
In tatridaṃ samantapāsādikāya samantapāsādikattasmiṃ, tatra refers to the preceding statement, and idaṃ refers to the reason about to be stated.
Tatridaṃ samantapāsādikāya samantapāsādikattasminti ở đây, tatrāti là chỉ đến câu nói trước, idanti là chỉ đến lý do sẽ được nói.
Tatrāyaṃ yojanā – yaṃ vuttaṃ ‘‘samantapāsādikāya vinayasaṃvaṇṇanāyā’’ti, tatra yā sā samantapāsādikāti saṃvaṇṇanā vuttā, tassā samantapāsādikāya saṃvaṇṇanāya samantapāsādikattasmiṃ samantapāsādikabhāve sabbaso pasādajanakatte idaṃ hoti.
Herein, this is the connection: with regard to what was said, “of the Samantapāsādikā, the commentary on the Vinaya,” therein, that which was called the commentary Samantapāsādikā, in that Samantapāsādikā commentary’s being the Samantapāsādikā, in its being productive of confidence in every way, this is the reason.
Cách kết hợp ở đây là: Điều đã được nói là "của bộ chú giải Luật tên là Samantapāsādikā", trong đó, bộ chú giải được gọi là Samantapāsādikā, trong tính chất Samantapāsādikā của bộ chú giải Samantapāsādikā ấy, tức là trong khả năng làm phát sinh sự trong sạch một cách toàn diện, có điều này.
Kiṃ hotīti āha ‘‘ācariyaparamparato’’tiādi.
What is the reason? He says, “from the succession of teachers,” etc.
Có điều gì, nên nói ‘‘ācariyaparamparato’’ti v.v.
Ācariyaparamparatoti ‘‘upāli dāsako’’tiādinā (pari. 3).
Ācariyaparamparato means: from the stated succession of teachers beginning with “Upāli, Dāsaka.”
Ācariyaparamparatoti là theo sự truyền thừa của các vị thầy đã được nói đến qua câu "Upāli, Dāsaka" v.v.
Vuttaācariyaparamparato.
From the stated lineage of teachers.
Từ sự truyền thừa của các vị thầy đã được nói đến.
Nidānavatthuppabhedadīpanatoti nidānappabhedadīpanato vatthuppabhedadīpanato ca.
Nidānavatthuppabhedadīpanato means: from the exposition of the different kinds of introductions and the different kinds of subject matters.
Nidānavatthuppabhedadīpanatoti là do sự trình bày về các loại nidāna (nhân duyên) và các loại vatthu (câu chuyện).
Tattha bāhiranidānaabbhantaranidānasikkhāpadanidānadassanavasena nidānappabhedadīpanaṃ veditabbaṃ, theravādappakāsanaṃ pana vatthuppabhedadīpanaṃ.
Therein, the exposition of the different kinds of introductions should be understood through showing the external introduction, the internal introduction, and the introduction to the training rules. The clarification of the Theravāda, however, is the exposition of the different kinds of subject matters.
Trong đó, sự trình bày về các loại nidāna cần được hiểu qua việc chỉ ra nidāna bên ngoài, nidāna bên trong và nidāna của học giới; còn việc làm sáng tỏ Theravāda là sự trình bày về các loại vatthu.
Parasamayavivajjanatoti ‘‘sakāya paṭiññāya mettiyaṃ bhikkhuniṃ nāsethā’’tiādīsu (pārā. 384) micchāpaṭipannānaṃ paresaṃ laddhinirākaraṇato, tatoyeva ca attano samayapatiṭṭhāpanena sakasamayavisuddhito.
Parasamayavivajjanato means: from the refutation of the views of others who have practiced wrongly, such as in the passage “destroy the bhikkhunī Mettiya by your own admission,” and therefore, by the establishment of one's own doctrine, from the purity of one's own doctrine.
Parasamayavivajjanatoti là do sự bác bỏ quan điểm của những người khác có tà kiến trong các câu như "Các ngươi hãy làm cho tỳ-khưu-ni Mettiya bị trục xuất theo lời thú nhận của cô ấy" v.v., và cũng do đó mà làm cho giáo pháp của mình được trong sạch bằng cách thiết lập quan điểm của chính mình.
Byañjanaparisodhanatoti pāṭhasodhanena byañjanaparisodhanaṃ veditabbaṃ, saddasatthānusārena vā nibbacanaṃ dassetvā padanipphattidassanaṃ byañjanaparisodhanaṃ.
Byañjanaparisodhanato means: the purification of the text should be understood through the correction of the readings. Or, the purification of the text is the showing of the derivation of words by presenting the etymology in accordance with grammar.
Byañjanaparisodhanatoti là việc thanh lọc văn tự cần được hiểu qua việc hiệu đính bản văn, hoặc việc thanh lọc văn tự là việc chỉ ra sự hình thành của từ ngữ bằng cách trình bày cách giải thích theo ngữ pháp.
Vibhaṅganayabhedadassanatoti ‘‘tisso itthiyo’’tiādipadabhājanassa anurūpavasena nayabhedadassanato.
Vibhaṅganayabhedadassanato means: from showing the different methods in accordance with the analysis of terms like “the three women.”
Vibhaṅganayabhedadassanatoti là do sự chỉ ra các phương pháp khác nhau một cách phù hợp với sự phân tích các từ như "tisso itthiyo" v.v.
Sampassatanti ñāṇacakkhunā sammā passantānaṃ, upaparikkhantānanti attho.
Sampassataṃ means: of those who see well with the eye of wisdom, that is, of those who examine.
Sampassataṃ có nghĩa là của những người thấy một cách đúng đắn, của những người xem xét kỹ lưỡng bằng tuệ nhãn.
Apāsādikanti appasādāvahaṃ.
Apāsādikaṃ means: that which brings about a lack of confidence.
Apāsādikaṃ là mang lại sự không trong sạch (không hoan hỷ).
Etthāti samantapāsādikāya.
Etthā means: in the Samantapāsādikā.
Ettha là trong (bộ) Samantapāsādikā.
Sampassataṃ viññūnanti sambandho.
The connection is: for the wise who see.
Cần được liên kết là "sampassataṃ viññūnaṃ" (của những bậc trí thấy rõ).
Tasmā ayaṃ saṃvaṇṇanā samantapāsādikātveva pavattāti yojetabbaṃ.
Therefore, it should be connected that this commentary proceeds precisely as the Samantapāsādikā.
Do đó, cần được hiểu rằng bản chú giải này diễn ra chỉ là (bộ) Samantapāsādikā.
Kassa kena desitassa saṃvaṇṇanāti āha ‘‘vinayassā’’tiādi.
As a commentary to what, taught by whom? He says, “of the Vinaya,” etc.
Để trả lời câu hỏi "bản chú giải này là của (bộ Pāli) nào, do ai thuyết giảng?", ngài đã nói ‘‘vinayassā’’ và các từ tiếp theo.